4WI6A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation n434a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHAHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
total genus 39
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A01
5E94A 4JFZH 3JTSB 3V5KB 4WO4A 3M17B 4JHAL 4JG1L 3OAYH 1DBBL 2J6EL 4KK5D 5D7IF 4NOBA 2VDNL 5EIVA 3ZE2E 4G6KL 2WUBL 5JPNB 3DXAE 4QRUA 3VGFA 2BNUA 3IJYB 2B4CH 4MNQD 4WI9A 4M48H 4NWTH 2IFFH 4JRYB 5DMKA 1G9MH 5DC4B 1DQDH 3Q1SH 1M7DB 3RWGB 4X6DA 3QUXB 4UU9A 3V4VL 1MREL 5JIIA 5GISH 4EOWL 4GRLC 1YJDL 4HT1L 1SYSB 1KIQB 5EIIB 1MI5B 4KRMB 1T1WB 1R3JB 1MCBA 4WEUD 5KSUB 1MJUH 3TO4D 5EBLB 1BFOB 1JPGA 4URTB 2P49B 3QDGA 3QH3B 2VJXA 2AS5M 4L3AA 1MIEL 3HI6L 3BH9B 4WI3A 4AL8H 3O8XD 1KB5H 4XPBH 1XR9A 4OFYA 1EHXA 3I3BA 5T5NG 5HYQB 3G6AB 2D31B 3W0WB 5L2JB 3ARSA 5DZLA 2V7NB 5IW6B 2AV1A 1FAIL 3BD3A 1NKOA 5IJKA 1SJHB 4LCIL 2B5IC 1FE8L 3KLSA 5MEND 3VGDA 4X9GA 4POZD 2XKUA 1IKFH 1I85A 1MHPH 5IR1B 1GHFL 4DCQA 4Y5XC 1Z9MA 3MRFA 4RFNB 4EZMA 1J1XL 1B4RA 1EMTL 1QTYT 1Q8MA 3RA7L 1HYSD 3OZ9H 1IKNC 4V1DE 3EHBC 4JPKH 1CZ8L 1NUDA 1X5ZA 4L8SB 3BZDA 4I48B 4LHUB 1FC1A 1U91A 1XZ0B 4IDJL 4NSKA 2VXSH 5HI4D 1OAKH 4Z0XB 2WBJB 2X1OA 1BF8A 4HPYL 4LAJH 1J9CT 1ZV5A 4EN3C 4FG6C 4GXUM 5DHYA 3TJEL 3SO3C 2AEPL 2VH5H 4LF3A 3DIFB 2Q6WB 5BVJB 3RUGA 1M4KA 2FGWH 3QIWA 1OLLA 2EC9U 1M71B 1X5AA 2HLFC 1ZLWK 4APQD 5AG8A 1ETZA 5IT2H 1QFWL 5EN2A 4PJ8D 1FH5H 5ILTH 5CSZA 4OV6F 4Q9RH 1SQ2N 4ODUB 1IM3B 4NUGL 4CU6A 25C8L 1AO7D 3RX7A 5EBMB 1KYOK 4YBHA 5DRWA 5ACMA 3QUMH 3IJSB 5FYJH 4AEFA 1URLA 3MRCA 4S0SD 4DQOL 4YH6A 4XP5H 1W72A 2H9GA 4OQTL 1VENA 4QEGA 5EUKA 3FO0L 4LSPL 2A83B 4H1LH 3MODL 1J0HA 4LPWA 2VDLH 4QHUA 3GSUA 1AFVH 3LRSB 5CIPB 2ZZUT 4PJ5A 1P4BH 3UJIH 3UPRB 4I2XB 2CR3A 3FHAA 4U0RC 4Y2OA 3BSZL 1E6OH 4KI5F 3BEVB 5CUSL 3IAPA 2PYED 4J4PC 3VI4E 3TM6A 2I07B 1OSZB 3CX5J 3ULUD 1EO8L 4NKOB 4F7EA 1JZ2A 1QR4A 1JGUL 1BZ9B 2WANA 4RX4D 4RAVB 3CZFA 3DXAA 4G6AD 1KPUB 4HKZB 3STLB 3OAZK 2R0LH 4L4JA 5CEXB 1NCUA 1IT9H 5ID1A 2JIXA 5DO2D 4N0FB 4MNQB 4YXKL 5DQ9B 5C0BD 1Q9KA 3ARGC 1U8MA 4F7CA 4QKXB 5ADOL 3MNZA 3PIQA 4XNXH 1CICC 1T0MA 4MD0B 5D72H 1QACA 4KQ3L 4NKDB 4UINH 5KG9A 3B9DA 2WV3A 3FFDB 3KJ4C 4TVSa 3O6LL 4NYLB 3BKCH 2Y5EA 2EXYD 3VFPB 3WNNA 1UGNA 4Z5RA 3SDCC 3TO4B 1QSFD 1RIHH 2MNUA 3EFDL 4LVOB 5AZEL 3TBWB 3PL6D 5C9JA 3BQUC 5J7CC 5DFVD 3UEZA 3QSKB 5L2KA 1LO3H 5GS3A 2E6JA 5I9QB 2A77L 5H94A 5GGVH 1B4JL 3BPNC 4FQHA 1ZANH 4N5UA 5E56A 2BVEA 3IDMB 2IBZY 4OM0H 1BF2A 1S7UA 3QHZH 4ODHL 1OSPL 1A9BB 5D1QA 2VNCA 1FFOB 2XNAA 3ZHKA 4NQEE 3W82A 4WUUB 3GJEB 5KOVC 5FDWA 2DTSA 2A6DB 4MXVF 3BISA 2YS4A 4TUKH 1TLKA 3V0WL 2P4AB 1UWXK 1K6QL 5D7LB 4JHWH 2P44B 5BS0B 1NMBH 3U9PH 3QISA 1YPZE 5HDOA 3B9AA 1BBDH 1PD6A 4Z76A 4YK4B 2B0SH 5CSGA 5FOBA 4BZ1H 4OIIL 5EUOB 1A1OB 5BVPH 3OXRB 3UTPD 2OR7A 4ZNCD 1I1YA 2AEIT 4H0GA 1P7KA 1HHJA 1I7RA 3X13B 1BMGA 1XGQA 3VA2C 2R9HD 1FYTA 1QYGL 2B4CC 5GS1B 4MNGE 3ULVL 1A6TB 5HDLA 1KOAA 1G9MC 1RU9H 4NO2B 3V9FA 2AJSL 1LP9B 2HFFA 1QFHA 3L3GB 3QZWB 1E4KA 5BV7B 3QXAB 2VL5B 2ICES 3DMMB 3EZJB 5E2TH 4LDOB 2FWOB 3PV7A 4QRTB 1PW3A 1MCEA 3ROOA 4PIRF 4APQB 4UQ3A 4JKPL 4UT6L 5D1ZC 4F33B 5TF1H 3MJ8A 5I19L 5DDHB 1S78C 3I9GH 4EEEA 3JV6B 1DN2A 3S35H 1A2YA 1FFNA 4PRHE 5K9KB 1ZHLA 1UM5H 2DJSA 3WL9A 3W5NA 4M7LH 1H5BB 3KPRA 2DDQH 5JOPD 1A6VL 4C59B 4JFXA 4XVTH 3WFCH 1HILB 1BFSA 1JZ3A 5IHUH 3MRDA 4ELMB 4R0LA 5ITFB 4GRLD 3BEWB 5EBWB 5J6GA 4U1KA 3SGKC 3MFFB 5C9KA 5KAQG 3BPOB 2GCYA 4LPUA 3VD3A 4I3SH 1ORSA 1JGVL 3RGVC 1LO0L 3NIGE 4LEOB 1R0AH 4OCRH 3MRNB 1NFDB 2EDEA 3OWEA 4FQJL 5E24E 5F7WC 3QCVH 1Q9OA 2FHBA 3SKOB 4BH7A 4YHOH 1P7HL 5IMOB 3LQZA 1OW0A 1RZ7L 1U58B 2G60L 2XQBL 3GSNH 3KJ6L 1T04B 2XRAH 4EUPG 1EUTA 1NJ9A 5JORA 3DX6B 4L9DA 3DURA 1C08A 1XAUA 1OF2B 4WCYL 5AYUH 3VFSB 1CDBA 3MLRH 4LMQE 4LLUA 2ORBH 2EDBA 4YXLH 3F5WB 5D7IE 3QO0B 2CLZA 1NEZA 4NRZA 1MCDA 1HCFX 2Q76B 5GJTL 3IFPB 3VFNB 5DK2A 3WS3B 4HIJB 3ZKXB 4HG4J 3BMWA 1AGEB 2DWEB 4X4ME 3LCYA 1NMAH 4Z0BH 3EHBD 1F4XH 5C0RL 1LP9F 2QR0A 3L1OL 4NJ9L 3PL6B 4PV8B 3EDKA 3UC0H 4XVJL 1IZKA 5DUBB 4JY6B 4H8WL 4OIBA 4U49A 4IJ3B 4UIMB 4KKBD 4F80A 3N1PC 5CEZD 3O6ML 5EB9A 3LSOB 1JZ4A 3U2SB 2P5EE 1QRKA 2C7UB 2J1KA 3QDAA 1NGPH 1DQMH 1JI1A 2C4FT 3DTXA 2VAJA 3QNXA 3DHMA 4Y16C 4XNYH 4FG6D 3BKYH 2X70A 3WXVH 3DV4B 1F11B 4C56E 1MCPL 1G9EA 3T1FA 3LDBB 2F74B 3LY6A 4K3JL 3IFOA 5CZVL 3HCVB 2XXCB 1KXTB 5GHWH 1WWBX 1KUMA 2HLFD 4X4YA 4X0KB 3VFRB 1I3RA 2ZCLL 5HYJA 2CSPA 1ZHBB 1SY6L 4JY5L 2M2DA 4Y5YA 2R4RH 1ZK9A 4N0CC 3OGCA 3MRGB 2FBJL 4OCLC 5B3JF 4JJ5A 2ZUWA 2QQKH 3O0RH 1SEQH 4HFUH 1A3LH 4YHLH 2R8SL 2W60A 5HDBE 4UBDD 3ZKNC 2ZG2A 3PWJB 3AGVA 4M6OH 4NIKB 1B6DA 3ULUF 4PY7B 4UDUB 1F6AB 4Q97A 1TZGL 3E6FA 4ZS7L 3UAJD 1R5IB 2QQLL 1HZHL 3MRJB 2JCCB 4QRUB 1CQYA 3S88H 5FYKD 5DMKB 1HH6B 1KEGL 4MXWL 5KVDL 4X6DB 3HG1D 3PV6B 1F4HA 4UU9B 5E9DB 1KNOA 1YC8A 1DBJL 4U7MA 1JNNH 3PWUA 5T1LA 4NZRL 4Z95L 3RDTA 5E2VH 2EXWC 4KMTH 1AIFB 4JRYE 2OL3H 1XGRA 5FM8A 4XBGB 4ZXBC 3KPSA 1CICD 4K07A 4BUGA 3FRPG 1FL6A 2MKWA 1PZUB 4Q7DA 3S34H 4PTUA 3LD8B 3IRZA 4LCCA 1NBVH 4ONOA 1MLCB 1CDYA 3S5LA 4L9LC 1QRNA 4JHAH 1BP3B 4GRWH 1DBBH 2R15A 4J3VA 3DYOA 1WWWX 5FDYA 3FB7B 1CD9B 3BQUD 5GRUH 1IAIM 1RK1B 4XPTL 3B5HA 4MQTB 2YPLD 2WUBH 1EUUA 5CWSA 5I75C 1RJZA 2Q20A 5GGVY 3PGFL 1EGJA 4XC1L 3WLBA 2A6KA 1F4YL 1CFQA 3W0WE 4DCQB 2ITCB 1IBGL 2PTVA 5H35A 4OCMC 1QQDA 4L4VD 5KZCD 4KI5E 4PS4H 4OD3L 3H9SB 1FZKA 3OL2A 3VH8A 3O3BA 4CN1A 1BX2B 5IW1A 3OTTA 1FL3A 1P2CA 2ZCHL 1UCTA 3MRPA 1CYGA 4OLEA 1Q94B 3F6IA 1QUNA 4RMSA 5AEAA 3PWVB 3Q3GB 4P4RA 4RMVA 2G75A 2MCG1 4LLMA 3BPLC 3JWDL 3RY4A 4J12A 4HC1H 3DX7A 1MIEH 2X4SA 1K9TA 3T0XA 1MJ8H 3DECA 1S3KL 1A7PL 4U6YB 2RQ8A 1HH9A 4RWYL 3B6SB 4JVWA 1MSPA 2EE3A 1G7QA 5DHVB 1Z0MA 2WLZA 2JCCF 1JNJA 3QG6B 1FC2D 4ZFOA 4LCIH 2Y7QB 4OD1H 4C54A 1S7RA 2I60L 3X12B 2HTKC 1C8PA 1RZFH 5D5MF 5IB2B 2NY3C 2YXMA 1YEHH 3UTTE 1R24A 1LO5B 1GHFH 1I1RA 4MX7A 3REWA 1E4JA 3SO3B 1WITA 5EOCJ 4TUOA 4XT1C 4QXUH 5DVOA 2Z0BA 5A2IH 1YN6A 5D1ZD 4HLZH 5J12C 5IK3A 1HQRA 5D7KD 3FTGB 4P5TA 3OXSB 2OSLB 3DRTB 1HSBB 2BCKA 2BJML 5DUPL 4O2FB 4MXVE 4NKIH 5MERB 4PJXA 2X7LB 3EYQC 1SJVA 3HMWL 4J8RA 1IAMA 3S7GA 4NN6C 1J05B 2VISA 4WU5A 2PO6B 4UV4L 1EFXA 3VRLE 4LFHD 4LPVA 2UUDK 5EOQL 3WFBL 1JF1B 4F7EB 1S8DB 3GJFA 3T2OA 2F58L 1UJ3B 1QFWH 3HNTL 1B0RA 3SOBL 4I2XE 5D93C 1CFTA 3QUZB 5MEQA 3RGVD 3ZE1E 3KYKL 4NUGH 25C8H 3WIHH 1SHMA 5ETUA 2ZG3A 3TV3L 3MRHB 4D2NA 4F7CB 1QLRA 3MNZB 2GTWB 3HG1B 1MFCL 1QG3A 2VR4A 4YHKL 2GJ6D 1KN4L 2OI9B 4OQTH 1KCVL 4HIXH 3TPKA 4LSPH 5C0EA 4Z5RB 4MNQE 2XZZA 1KTLB 2FEDC 1WZMA 3QG7H 4HZLB 3TNMA 5L2KB 4XCNA 1F97A 2Q7YA 1YEEL 4R3SA 5E5MB 2G9HB 3BSZH 3HPLA 5TE7H 4NKQB 1ZS8B 1UXSA 4V2BA 3RTQC 1XF3A 4RRPG 1CGXA 3TA3B 4WDIB 1AI1L 2YWZA 4N9GA 5DJYA 3RU8L 1H3PH 3HFMH 1J86A 1ZTXL 3T08A 4X6CB 3BQUB 1LWRA 3UYRL 4P2OA 5FDWB 1A7RL 2BHYA 1F90L 3SE4C 3QFDB 2YPLB 2JLLA 4U1JB 1CDUA 1ZA6A 3AS1A 3BJ91 2VAAA 5FYJD 4LLWB 4MZ3A 3JUZA 1JJUA 3VXSA 1ZHKB 4KQ3H 4M3JA 5KZCB 4F9LC 2P48B 4Y16D 1MRCH 2DQHH 3OAYK 3PHOA 4K94H 4G9DA 1QLFB 4X4XB 5FK9B 1DQLH 1VFMA 2CDEB 4CMMA 3BIAX 4RAHA 4UQ2B 3EFDH 3MA7B 4HIEA 1I1YB 3QRGL 2QQQA 5BS0E 3O6FA 4X80H 5DJ2A 1G6RL 1B4JH 3BT2L 5C07B 2IPKB 1FDLL 4PYGA 4N0CD 4LDLB 5L0QB 4C83A 4WEBL 2HFFB 3BPCA 3SE3C 5EUOE 1N3NB 3BZFB 5EIQA 5BZWA 3NCFB 1OSPH 1CG9B 1AHWC 3PG2A 2C3HA 5CP7A 1IGIH 1U8OA 3HC4L 4MWFA 3MV9B 3ZKND 3RVXD 1G7PA 2CR6A 1RI8A 3MJ8B 3CJJA 3OAUH 1LP9E 5FCUL 2X4NB 1ZXQA 4OLZL 5GGSA 2DI8A 3DX9B 2DN7A 2A6IB 2YD6A 1LEGA 1A2YB 5DZNA 2XZCH 2Z8RA 5FKPA 3UBXI 2Y72A 2Z31B 5T3XL 3V95A 3HMXL 2Q86B 2FR4A 3UTOA 1OGAA 3MRIB 3AREC 5FA4B 1JI2A 2DQIH 1SJEA 4JFXB 3KPOB 4BELD 1GGBL 4YQXL 4L3EA 3GKWH 4JO1L 1SYVA 1FVCB 1AO7E 4OZ4A 2MSPA 4BFIB 5H2BB 4F57L 5HHMD 1YEKH 3EFFA 4U1KB 1QYGH 4LSUL 2EXWD 3ULVH 2GT9A 3BIKA 1CU4L 4PJ9A 3BGMA 3C6LD 2AJSH 4K55A 2IEPA 2GSGB 1DANU 4ZXBD 5F9WC 2J7LA 1DVFC 4XMKL 2BNQA 2FJHA 4ELME 3RWEA 5B3JE 5GRVL 3VXRA 1OD7A 5JR1H 5GIRB 4JKPH 4UT6H 4M9OA 2B1HH 1MFDL 3GSRB 1J1OL 4Q9QL 1KYOJ 3R06B 3O9WC 1NL0L 1SMOA 3P0YL 3DRQA 3MYJA 4LL9A 2BRQA 2ZUXA 2OXGA 1XMWA 2MHAB 4NPYB 2C3VB 2XWTB 1H3UA 2BDNH 2GJ6B 1QEWA 1NGZA 4A6YL 3KWWA 4BQ8A 5B39B 1IQDA 3R0MA 4LHUG 5IQ9A 3B2UD 4LSQL 4RDQG 5DUML 3SPVA 1H0DB 5GSRB 3T4AA 3EGSA 1T6WA 4FFVC 1EZVX 1JGVH 4PLKC 3ZDXE 2OK0H 3BH8A 4ZSOB 1T6VN 2FYYB 4EI5C 3U36B 1QSFE 1EEYB 2ITDB 4I18B 1A6UL 2ZP0T 5KJRH 2XQBH 2W9DL 3KJ6H 3GM8A 4ODXA 4AENB 1U9KA 1XCTA 3B83A 3HZMB 3O8XA 1KJ2L 4ETQB 4LKXB 4N9OB 3QFJB 4P4KB 3VFMB 1EXUA 3FONB 2ZOLA 3MJ9L 4X5XB 5IV2A 5MI0C 3NCJH 2HTKD 4JB9H 5JUEH 1TZIA 2NY3D 3OKDA 3LV3A 5FA3B 1J88A 4WU7A 2E9JA 5ANMA 3AFLA 5F9OL 5D9SB 5MENA 1MAKA 4MXQC 1I8LA 5IEKA 5GJTH 3PDGA 2R0WH 4JJ5B 5SX4I 3CMGA 3HKFA 3PWPA 2XQYK 1TETL 4IRSC 3OPZL 4HQQH 15C8L 1T03L 3BN3B 4BSWB 2VABA 3L1OH 2DLFL 4LCUA 4H8WH 4OTXL 4S1QH 4G80B 3O6MH 4PLOB 2ZUUA 3R0NA 1MPAL 2H26A 4C4KO 3EYQD 1IC5H 3QJHB 5EU7C 3MXWL 3UTPE 5T5FL 4TSAH 1V3MA 2K7PA 1AQKL 2JELL 5C2UB 2Q3AA 1MCPH 3Q48A 4RNRA 4JCMA 4P5KB 2O61A 3MUZ1 4I0KA 4K3JH 1EBAA 2AJZA 3Q6FA 5CZVH 1KNOB 3FT4B 1UCBL 2GJJA 2L4OA 4TQEL 2ZCLH 4XPAL 1JPTL 3NIFF 3GBNL 2JCCE 1TQCB 3O2DA 3RDTB 1SY6H 1KCSH 2XTJB 4JY5H 4PR5B 1VFBB 2ZWLT 2HLAB 3LKNA 1P1ZB 2FBJH 4PJ8A 5FGBA 4XBPB 3FRUB 3KPSB 4I8DA 5SWZB 4YHYC 3UZEA 2Q7NA 5E9DE 1YMMD 1ZLSL 4P5MB 4K7FA 4G8FA 3UBXA 2IMNA 4RGMC 2A1WH 3T09A 1KULA 4YBLB 3ZTJG 2E7BA 43C9A 4PBVC 4RIRA 2YR3A 3RY6C 3C6LB 3HI1B 2FEDD 3QEQB 1ZT7B 3N85H 4KK6C 4KTDL 4ZXBB 3IFNL 1TZGH 2YRPA 2Z8WC 4HBCL 2VE6B 4GUPB 4K94C 4NM4L 3VFOB 1I9JL 1OTUC 5CWSB 2H41A 3RTQD 3ULSA 4P57A 5L8JB 2BY0A 1LDPH 1FP5A 1PJ9A 1CE6B 4E41D 1KEGH 4MXWH 1A4JA 1QQDB 4Q2ZA 2E7CA 2PYEA 3GHBL 3CSYA 4R96B 3QUKA 1A4KA 4JZNA 1HHGB 1AR2A 4Z95H 1CFVL 3VMNA 1K5NB 4ZO9A 4YDVA 4OZIB 3UJTH 3KYOB 1J0YA 4LVNC 1MVUA 2AK4B 4UTBL 3SDXB 4I13B 2IGFL 1YUHA 3BP6A 3H9SE 1TVHB 5FO7B 2VDML 2R1WB 2R0KH 2AJYL 1R5WB 2FSEB 1I7TA 5C0BA 3NACH 1AGCA 2IPTH 2BSSA 4XPGL 3KHOA 2HJFA 1QO3A 1AD0A 4NQCD 3CDFA 3BPLB 4L8DA 3MTRA 4PRAA 3QZWG 2GUOA 5TFSL 1ERNA 3LQAH 4DUVA 4FTVD 4XC1H 5E08L 1YY8A 1F4YH 2HT4C 2VLLB 2E7MA 2E3VA 3WIIL 4OD3H 4RMWA 2YD1A 3QT2A 3GEWB 4PJHF 2ZCHH 4CVZA 3ULVC 4L3CA 3WO4C 2DYPA 3NPSC 2AJVL 4NHCL 3QAZB 1UWEH 1T83C 1RURH 3G08A 2FECL 3O4OC 2VQ1A 4JLRA 4YWGH 4QXTA 5FF6B 3C8HA 5IEHA 1XF1A 2KBGA 2F15A 2FHCA 4Q9CA 5SX5K 4ZODA 3WNPA 8FABB 4X9FA 3ARED 3PHQA 3RWHA 4WU5B 1EFXB 4WY7H 3IS0X 1I9IL 4PB9L 2PETA 5F88B 2ADIB 5FB8B 3WLWC 3OQ3B 5GGQL 5JW5B 3C60B 2I60H 1CFTB 3Q5TA 2XWBA 2O5ZH 4NN6B 1U8NA 5A2JH 2UWEF 1DVFD 4PGJA 2XACC 2X4PA 3BYTA 3WDIA 4OLYL 3ECBB 4FNLH 3HZVB 5CZXC 4JFPA 5SWQA 3SE8H 4OZIF 1UACH 3EO1A 3IVKB 4K3DL 3T2NH 1T80A 2ATPA 5D93B 4HCRA 4YC2B 4WVRA 1YECL 3U79A 4N8VB 2CXGA 5CS7A 2AP2A 3O9WD 5D5MA 2EYRB 3QWOB 1FVEA 2DMKA 3Q6GL 2BNRA 3FKUS 4MDIA 3HG1E 4KK9D 5JQHC 1I7ZB 2CRZA 4C58B 4R6UA 5I8EA 1IC1A 1TJIH 4P2QD 1CFSA 2DOCA 4NN5C 1LK3L 3WFBH 3MV7B 2FB4L 3P3YA 1LE9A 3V4PL 5IGXL 5EC2B 1ZLUH 1NBZA 2EYSB 2VDKH 4R7DA 5C7XH 1MAJA 4D0DB 1KACB 4XNUH 1AKJB 4PLKD 1NQBA 4NCC1 3QJFB 3MLTB 3V6OC 2ZUQB 3HE7C 1LD9B 1I1CA 4Z7UF 1EHNA 2EIBA 2WSKA 2YN5A 3ZDYF 3EO9L 1ZGLB 1BEYH 4NKMB 2PYFB 2H32A 1BFVL 4YHKH 4H8WC 3MZGB 1KN4H 1M05A 4YDIL 2YPLE 3GMPA 5F7DB 4CMMB 1HNFA 2RBLA 2QJDA 3U7WH 3HS0A 3MACH 1IC4H 4IRJD 1XH3B 5EA0L 1I1AC 4NQVB 4F2MB 2VUYA 1RUAH 1CI5A 5J9PA 5HPOA 5AAMA 4G6MH 4M1CC 1T0NB 5CD3A 3FT2A 1JK8A 3LN4B 1HWGB 1XGTA 1ZEAH 4CJ0A 2P5WB 1FQ9C 4JZOB 3RP1A 1BZ7A 3E3QC 3FCTA 4IRSD 4Y5XA 1MCNA 3O11B 3MRMB 3IFLH 1ZTXH 4X99A 3BXNB 3GSWB 5AYQA 4YGAB 3DX8B 5E8OB 2AXFA 1MY5A 2H8PB 5C07E 1IKNA 1G7PB 3LQMA 3VXQA 1N59A 3I3DA 1F58H 1RPQA 5HGGS 2OMNA 3E2HC 1QFUH 4JHZA 1NPUA 2M26A 1JV5A 3MV11 4UILH 4P46D 1C5DB 3MV9E 2G2RA 4KTEH 3RQ3A 1A9EB 5DEGB 3GBML 3IB4A 1ZT1A 3HZKA 4EN3A 1IEAA 3C9NA 1K3ZA 1L4IA 4DGIL 3ALWA 4IBLT 2RFXA 1C5CL 4OZ4B 2Z91A 3QRGH 4KUCD 3S98A 5FM5M 3ARXA 1FG2B 1RUKH 4NQDB 5C70A 1G6RH 3BT2H 3RWJB 3NZHH 3L5WB 3JWNC 1U8HA 3AREB 3CXDL 1E28B 2CQVA 4RFOL 2VDQL 3M8OL 5D7KE 4MHHG 1UXWB 1GOFA 1XF4A 1WUNT 4ZTPH 2VXUL 3CH8A 3HC4H 2C5DC 5JHDB 4EXPX 3H6JA 5I66B 3QNYA 3MA9H 3HUJB 1MRFH 5SWSD 5TDPB 5GZNC 3O45A 4HS8L 4KK6D 3SDYL 5FUOL 3DPBA 3L3IA 4LARL 1A6AB 3HRZA 1OTUD 4IMLB 5F1NB 2X4RB 3HMXH 1XIWD 1RAMA 2NTFA 3U9UA 4RBPH 3WNLA 3IF1B 3S4SA 1TVBB 3SN6N 3U46B 5JLZB 1GGBH 2H2PC 4UNTA 3VXUB 4JO1H 4J4PA 2PCPA 4PV9B 4GSDL 4Q58C 3LQAC 2DQFA 4OLVH 1T4KA 1AR1D 3WFDL 1EAPA 4ONFL 3JXAA 3DETC 3EGSB 5HGHB 3PNWA 4X5LA 1AXIB 3NIFE 2GJ6E 2YOCA 4XMKH 4JO4H 1BLNB 3B8YA 5I8OL 4HKBA 1D9KA 3ARGA 4OSUH 5E8DL 1CICA 4IEFB 4NC0B 4AMKL 3T4YB 1MFDH 3Q0HA 4WJ5B 3CDGB 3RVWC 1J1OH 3T0EC 4Q9QH 4X8JA 4ZSOE 5A2FA 3SDCA 4NO5A 3P0YH 1P6FA 4QHNA 3OG4B 5C0FB 4XWGL 4X7DC 5F70A 2CO6B 32C2A 4HWBA 3LV3B 2HT4D 1FORL 1B0GB 4KVNL 4LPXA 3DSFH 1P69B 4GG6A 1IFHL 4A6YH 2AAVA 5F9JA 1B2WH 3QFJE 3PWPB 3EYUH 4IRJB 4LSQH 3ULVD 3V5HA 3GSQB 4L4VA 2VABB 4GRWF 3RWCB 3U48A 3LKRA 5BXFB 1PG7W 2LU4A 3IYLW 4X7TB 4P0DA 1I8MB 5DWUL 4S0TD 5A16B 1VADA 4WWKB 2DQJL 5ELIA 3GUTB 1IAIL 1HDMA 1D5BA 3G6JB 4IRSB 3LKPB 4LK4A 1A6UH 4KKLD 3LHPH 1D5IH 4MD4B 5FO9A 4UNVA 3DWTA 4XXDA 1RJCA 3MQIA 5F7MC 1S9YA 1KJ2H 3HAEA 4NUJA 3WLWD 3FO9A 2P24A 3FQUB 4M8VA 1MHHA 4ZO7A 3WSQL 3T0DA 1OWRM 3NPZB 4P46B 4PGEB 2NTSP 4RISL 1BPVA 3SY0B 4WHDA 1G1CA 1JUFA 3GMNB 3P77A 4DKEH 2DM3A 5CZXD 1L9NA 2ZCKH 4PGBB 3HZYB 1TETH 4GAJH 3OPZH 5D1XC 3TCXA 4LCWD 4NNXA 2DLFH 3JBG7 4OTXH 5C0JA 1SBBA 2XTJE 3A6CL 4PJHE 4DN3L 3L3HB 2RCSL 3OKOA 4M6NL 4BYHA 3SQBA 1IAOA 3CUPB 5D1ZA 4CAGA 2OZ4H 4YFLF 4XGZA 1R3KB 5SWZE 4I3GA 3MROB 1DQJB 5J6HA 5DD3H 2YMXL 2GSIB 3QBTB 1MUJA 4M7KL 4GAYA 3QA3B 5HHME 4PGZA 4OM1L 4DKFH 2VTFA 1CLOH 5DJ8B 3OX8B 3CGTA 1ZT4A 5SWSB 5IP4A 3SO5A 3A6OA 4KC3B 4ZAKB 4TQEH 4LLYB 3G5YB 4FOMA 1J5OL 3EJZD 1JPTH 5D7SL 2W0FA 5DJ6B 3MZTA 3T3PF 4H0HB 1HQ4B 3HE7D 3SGKA 1XIWB 4N1HB 3P4MB 4ZYKA 5B8CC 3WE6A 2AEWA 4Y19D 2D9CA 3OKKA 5DJ0B 1GGTA 4POYA 3RGVA 4R8WL 1H15A 5F6IC 4PTTB 4HV8B 3MRQA 5IMLA 1ES0A 4U2YA 3VD5A 5CHNA 3ROLB 3G5VA 5CBAB 3Q2CA 4OZIE 1JYNA 1UEMA 1AD0B 3NCYS 1I1AD 1WK0A 1X3DA 2AK4E 3SDXE 3KLHC 4M8QB 5DS8B 2EEBA 3IFNH 1JZ7A 4PRAB 4C55A 3CAFA 4M1CD 4MJ6A 2DM2A 4ONHA 1NGXB 4CNIB 2Y5TA 3F7YB 3KDMB 4YGVB 1FAKT 3TT1L 1NC4A 1G9NH 5DJDA 5BCAA 3VDBA 3GNML 1PDKA 4Z18A 4FQXD 4Y89A 3QUYD 1ZKAA 3RIAK 3SKNB 2IANA 4UNUA 1ZHNB 2H6PB 1CFVH 2EICA 1HINL 4XNQA 1VKXB 2FH8A 1MCWM 2BY1A 3G08B 2IGFH 3JVGC 4JLRB 4ZPTB 3QUMA 5F7KC 4XVSH 3K3QA 4KUCF 4ZOAA 4M7ZC 4X6FB 4CBPA 1NAKH 2AJYH 2JK5B 3I6KA 3QCTL 4RSVA 4QT5B 3I2CH 3S36X 3VXMD 1NMCC 3CVHL 3WO4B 4XPGH 1LHZA 4O2EB 3T77B 1GGCL 3L3KA 2FHFA 3D1MC 3NABL 5C6TH 3QEHA 5DA0B 1CBVH 4LAQL 4ELKB 4NQSB 4JKWA 4H1LA 1RUQL 2NY5L 3LS4H 2ICEB 3MRKB 2DQEH 4O58L 5TFSH 1RMFH 3MLWL 3JWOL 1U3HC 4YHZL 5DQJB 3KS0H 4N0RA 5IIEA 1G7LB 1DFBL 1TITA 5HI5C 4Y2DC 1UZ6E 1V8HA 4DUWA 1BD2D 3SGJC 1UH2A 4N8PA 1DBKH 3P9LA 2Y23A 1IGFL 2V9TA 5A2LH 4BZ2H 2BY3A 2Z93B 4X6EB 5KSVB 5GZND 4E0RA 2O26U 3DVIA 3BAEL 3G9AB 1NEZG 5EBGA 2MCPL 1XGUA 1FVEB 3ZHLA 2AQ1A 3H42L 1MCHA 5B39G 1A8JH 2XFXA 3L6FA 2H2PD 1TNMA 4HEPG 2AGJH 1KIRA 5GRJL 1RULH 2IALA 3CFBB 3L7EB 1JHKL 5GGQH 5K59F 2PNDA 1I8IB 1DLHB 3MJ6A 5K9QG 2Q8AL 3KPNA 2EDLA 1X6NA 3DETD 4X7SH 1OGTB 1IJ9A 5I1JH 2O5XL 4OBRA 3F6LA 4PJ7F 4GG8B 1F4AA 2NR6C 3T65A 3CVIL 3K46A 5JQ6L 2WBKA 4XAKD 1KJMA 2A74A 4GAGL 4OLYH 1F4WL 1DDHB 1VGKB 4GW5B 4JRXA 1P5UA 3C5ZC 4WHYG 1N4XL 3VE0A 3FO2A 1D6EB 2FJGA 1M7IB 1M05B 3BDXA 3RVWD 1U93B 2BVUA 1YECH 1KGCD 3MCG1 4L9LA 3ULVF 4Y19B 2UWEA 4YNYB 3RIAF 4JFFB 1BQLH 1LK2B 2DWDA 3W5MA 3GIVB 3LEXA 3ARFB 4FABH 1F3JA 2W65B 3FOLB 4ENEC 4HJJL 4J6RH 2HRPL 3D48R 1EEZB 1KG0B 3SCMC 1Z3GL 3OR6A 3SEPA 2C4XA 4HUWB 4Z7VB 2FB4H 2X4QA 3QEUA 2DQDH 3FCTB 4HGKC 4OZFB 4BM7A 2X2YA 3V4PH 1KENL 3ARPA 3WN5B 1UYWL 4X99B 3UJJL 1J7VR 1I8KA 4AIXA 3EJYC 3BRDA 3GO1H 4XPHH 1QBAA 1P9MC 2DICA 2XN9D 5LGKA 3VFUB 2R4SH 3CLFL 3JV0A 5F9AC 3D25A 2P5WE 5H8DA 5K9OB 5L6YL 3MCKB 4PYHA 2PR4L 3SQOH 1MAML 4WUKH 3TJHC 4EUPH 4HWEL 2BRRL 4NQCE 4FQXB 1FIGL 1HN1A 1XCQB 3QUYB 1IGYA 4I0PA 1BFVH 4FQQB 4U3HA 3H9YA 4AEHH 3G04B 3F7VB 5IFHL 4ZOEA 1J10A 3RVVC 1NLDH 1OAUL 2F53D 3MUGB 4PJFA 1MOEA 4W4OC 1IEAB 1YDPA 4UDTA 4XP9L 3L5XL 2ADGB 4RZCA 1NBYA 3RNQA 3FQTA 2QADB 2KPNA 2HVJA 4Z7UA 1F02I 4KXZI 2Y07H 4LP5A 2YZ8A 2VLJD 5EDXA 1YNTA 2NLJA 3LKOA 2A6JB 5T3ZL 3BW9B 1T2QH 1PGRB 5D1XD 2QQNH 1N2RB 2W0PA 1T5WA 1T89C 2FIKB 3VFTA 2AXGA 3P2TA 1NGYB 4NQDE 3LKSA 5IB1B 4K71C 2V9RA 4S1RL 3BUTA 4JQVA 3QQ3B 2GK0A 2JKXA 4M5YL 1A3RL 3BDYL 5JHDE 1R5VA 1VEPA 3GBMH 4JQXC 3S4SB 2VDPH 4BH8A 3GSNA 2VKWA 3W81A 2R2BA 4NQTA 2EZ0D 3F58L 1C5CH 3VRIA 4GW4B 4QY8A 1G9NC 4YHIB 3CFEB 4Z7VF 5DD1L 3OF6D 1YNKL 3GMRA 4MJIB 4RCAA 4YHPB 3CXDH 3ZE0F 5BJTB 3M8OH 4KPHH 4PREB 5DZOA 3GSOA 5E99L 1FNGB 1D9KB 4ORGA 1CDJA 4HK0B 4HWZB 4MAUL 4YFLI 2EDKA 4HMEA 5JO5A 3SHSA 1RZIB 1YMMA 7FABL 4LSRL 4OCXL 1BAFL 4QHMB 4BKLA 1U6AH 1U95A 2IBGA 3KLHD 5FUOH 3GZKA 3Q5OA 4LARH 3FO1B 5HGBB 3H8NA 4JFYA 5K9JH 4HS6A 1DCLA 2P8PB 1UT9A 4JFEB 3L95A 4KZEL 3DJ9A 3D3VD 1JWSA 5JW4Q 3AXLA 4ZPVA 3DI2B 2OTPA 1WBXA 3RTQA 1A7OH 1M6OA 3DLQR 3NGBB 4E41A 5E6IC 5GQBA 1N6VA 1AY1H 4JGMA 1FLTX 4YDJA 3WFDH 3VRJA 5F7EL 1DL7H 5IMMA 4YLQT 2KH2B 4HLJA 3PWLA 1RY7B 5T1DH 1A6WL 2HFEB 2OR8A 1CDGA 1WCBA 2ATKB 2PTTA 4WNQA 5I8OH 5FO8B 3U7YL 4U1SB 5IB3B 1S5HB 1QFPA 1QFWI 4MD5B 5IF0A 4K23L 1G84A 4K9EL 2FJFA 5I16A 1DE4B 1TQBC 1TCRA 1S9YB 3BO8A 5HPMA 4PGCB 3HAEB 2XN9B 3D0LA 4EDWH 5T3XD 4OAWB 2VLKA 3VFWA 3MUY1 5GSVA 2IQAA 3G6JE 1U3HD 4FZEH 4XWGH 4DK3A 4I4WB 4ZUTB 3FJTA 2C1OA 4GQ9H 3B9KC 5KANG 4KHXH 4JQIL 3S36H 5HI5D 1H3TA 4Y2DD 3B9EA 1LEIA 2ENYA 4FTVA 4QTHA 1ZLUK 1IFHH 1JUFB 4Y4FA 3P77B 5HHPA 3OV6A 3SE3A 3GDBA 1AGBA 2R29H 2R69L 5E7FA 4KTYA 1AHWA 3GRWA 5D8JL 4FXKA 3FHQA 4Z8FH 3S8WA 1UQSB 5IG7B 4AH2A 1U8KA 1JN6B 3W2DL 4NBXB 1CD1B 5DMYA 5E00B 5CJOH 2DQJH 4U6XB 3VJ6A 2GKIA 2ZSVB 3BN9C 2NNAB 5AD0A 3W39B 2V17L 4KMQA 4ODSH 3VGHA 3BHBB 1BQUA 4CADB 1RHFA 1YEDB 5T1MB 2AEQL 1A1NA 3IDUA 2CDFB 5DJXA 2CRMA 3QQ4A 4B7LA 4P59L 1T20A 1C16B 5CINH 3WSQH 3SGEH 4G8IB 2VYRE 3KPPA 3DSNA 5E2UL 4FQCH 2NR6D 3NTCL 1FLRL 3NFSL 2E7LC 2XA3A 3QP3A 3MV8A 1MWAH 3ME0A 1CCZA 1KCRL 2Y06L 3P4NA 3OKKB 1J8HB 1BQHB 5EPMA 5SWSE 1WTGT 3C5ZD 1DVFA 3HLAB 3H7BB 3L3JB 3MMEB 4G7YH 1TJHL 4LRNL 2D0HA 3QPXL 3VA6A 3A6CH 4UI2A 4MAYB 4DN3H 3H2WA 4Y1AD 5I1DB 3WUZA 5IMKA 4QGTA 3P73B 5M7QA 1AGFB 1WC7B 1PKOA 4HC1A 4PLNC 5L9DL 4MYWB 2BVQB 3U0WL 5ACZB 4ENED 3CPLB 1Y0LA 4M7KH 5ISZB 4AQ1B 3N9GH 1NC4B 4OM1H 4UOW1 5KSBF 4CVXA 3SCMD 9CGTA 2APVA 5D2LA 4P2QA 3U6RA 5HHXL 3K2MC 3NA9L 1TJGH 2IANB 3EJYD 5I73C 2Y6SC 5K59E 1P7QD 5T1KD 3V7AG 5EC1B 5BQ7A 3QXUA 3D3VB 4QXGH 1YYML 3VW3L 2HN7A 1RUPL 3FOMA 3TJHD 2YC1A 3CMOL 4O5LL 4R8WH 4LNRB 4G8GD 4XAWL 2OCFD 3OG6B 4N5EC 4EI5A 5JW4N 1KJ3L 2ESVA 2EIDA 3QNZA 4DZ8A 1KELL 3T2QA 2CKBL 4ZUSA 1A7NL 3ET9F 2I9TA 1L9MA 3SDDD 4NFBA 4P3DA 2DI7A 2AW2A 3T0BA 3ULVE 3HC0A 2WINA 3B2VL 4L8BB 5FKAA 5F7HA 5IIEB 4NN7C 4MA8L 1N0XL 1VCAA 4CVUA 4IOSD 1BM3L 1HINH 4TPRL 2APFA 1HXYA 2R2EA 2VLRD 3P9MA 5MEPB 4GKZA 1N5AA 3WDJA 5IM7A 1G0DA 4E0RB 5LKNA 2N7BA 5DEFA 3D39A 3WIHA 4OFDA 1PX3A 3WUWB 4Y2DB 2NZIA 5GRVK 3CFDB 3JV4B 3LEYH 1E4WL 3EYOB 4OFVA 4HPOL 1ZWIA 4ODVL 2WUCH 3CVHH 5I1EL 3L6FB 2CUMA 1JYVA 1L7IL 5IKCA 1PZ5A 5M94B 4YR6B 4G7VH 4O2CB 1DQQB 1CQKA 4NRXA 1MCLA 3L3OB 1OP9A 1RUQH 4DEPB 2NY5H 3K8LA 1HWHB 2Y25A 4ALAH 5I1HL 4OT1L 4OCYL 3KPNB 3JWOH 3MLWH 4JN2B 5FUCE 4M93C 3OHXA 2P7TB 4GRMA 4F7TB 4LCWE 2BOCB 5IVXA 5J8OA 1UZ8A 3E6HA 3VWJB 5EU3A 4Z7NF 1SBSL 3IDYC 1PKQB 4N0UE 1VFUA 2CJUH 3GSXA 1S9WB 4HMDA 3OKMA 1IGFH 5CEYB 4L4TB 1EX0A 4OGAC 5FV1L 4BSVA 3TPUB 5FIEA 5C09D 2UVFA 3NBNA 2C1PA 1EVTC 5E4EC 5ICYB 3RY6A 5EU5A 5HHOD 3O2WH 1NAMB 4FFYL 5IROC 1JMZA 3S97C 1HK6A 3EAKA 4D9RD 3V6BR 5JNYA 4RAUA 2P8LA 4OD2B 3HA0A 5FGSA 3RL1A 2X6MA 3STZA 3V6OE 4Y1AB 3QEUB 5GRJH 1ADQA 5E6ID 2AXJA 2ZUYA 3K8KA 4Y19E 2YEZB 3D69A 1MJ7H 4JFFE 4OZGA 3LS5L 2GK2A 2O5XH 3D25B 2MWCA 2D03H 1KJ2B 5JQ6H 2EE6A 3MGTA 1KLUA 4Z7VE 4GAGH 1JPFA 2I26N 1MCJA 3BWAA 1UB6A 3UZVB 1N4XH 4I0PB 5DC9B 3BP7B 3QQ9C 2NX5D 3FT3A 3N50A 3UYPA 1M1SA 3FQNA 5A3IC 3KR3H 3GMMA 2P8MB 1KTDB 1XEDA 1BZQK 1P7QB 1WLHA 4Y4KB 3S96B 1QPPA 5HYSA 2YPVH 3ILPA 4PJ7A 2RAMA 1CLZL 1W0YT 1W72L 3E3QE 1DJSA 4DW2L 4G8EB 4KUZH 1WT5C 5LGHL 3B9KD 1X4ZA 1I3GL 4G8GB 4NDMB 2PXYB 3CNKA 4H25B 5DJAB 3X11B 4BQ6A 1Z3GH 4LQFH 3PGDB 3UX9B 5EO0B 2NLJB 2HJKA 3NFPA 3MLUH 4RQQA 3C2AH 1VACB 2NW2A 2X1QA 3RWDA 4R26L 3SDDB 5DTFA 4U6TA 3UTZA 1Z9LA 4FXGB 2MFNA 4YX2L 1OVZA 1HOCB 3VXME 3V0VA 2PR4H 1ZVSB 1NDGA 3BN9D 1T83A 2CIKA 3X3FL 4LLDB 1E27B 2W07A 5CBEB 5DSCA 3WHE1 5IFHH 1JGDB 1IGJA 1XF5B 4HS3A 3IDNA 2N4IA 3QDJA 4JG0H 4TNVF 1Z9OA 1FGNL 4OZHF 2VLRB 3P4LA 4XP9H 4DN4L 5HXMA 2R2BB 4R2GB 1BBJB 4M00A 3MYZA 4QY8B 5DF0A 3I6LE 5INDA 4QRRD 2FX7H 5T5NF 4YBQC 2RR3A 1X7QB 3NFNB 1QLEH 3BZ4B 5CIPH 4TSCL 5T3ZH 5I8CB 4OUOA 3HE6A 2WIIB 4HIHA 4L1HA 1MF2H 1GGIH 1QPXA 4XP4L 1FJ1A 2J88H 4F15C 4QRSA 1JTOA 4LCWA 5EORL 3EDDA 2VC2L 1YN7B 4FXLA 4AT6B 5J1SC 3DVNB 3LAFA 1DSFL 2IAMC 4QYOB 5DRNB 4M5YH 1A3RH 4K3EH 1EK3A 2O5YH 5CILH 3BDYH 3QIBC 2WQRA 4S2SA 4HK3J 1KXQE 1U92A 1ITCA 4X8XA 3SKMB 4M4RA 4HH9A 3QO1B 2DL9A 1WBYA 2W91A 3IDJA 2X4TA 1HHHA 5J11C 1X4YA 1JNLH 3FN9A 5IOPA 2XYCA 4XAKE 4OCWL 4U1NA 2Y6SD 3VGGA 2GAZB 1C7SA 4DK6A 3ABZA 3HPJA 4KFZC 5IMMB 1OAXL 5AZ2H 4IIQB 5L88L 3ZTJH 3D87B 3TT3L 4P2RA 3L3DA 1VFAA 1TNNA 3HE7A 1KGCE 2D4FA 5E99H 3ARBA 4H5SB 3TFKD 4JE4B 4N5ED 4JFQA 2NY0D 1Y18A 4PG2A 2DQCH 1P4LA 2HJLA 35C8L 3RPIB 1BAFH 5I16B 1GC1L 3KNBB 2EH7H 2C9AA 2VLKB 3VFWB 3CU7A 5F97E 2HFGL 2VR5A 4HGWB 4N90D 1ED3A 3WNMA 1FNAA 4WTXA 2YPKB 4BZYA 4LASH 5DRZB 3GMLB 5JHLL 1I1FB 2NY5C 4Q6IB 2XN9E 1K2DA 5KSBE 3TBVA 2YD7A 2R1XA 3JWOC 1ND0A 4R7NB 1VESA 1GZQB 1HHKB 4WFGD 3GSVB 5F7EH 2DIBA 3TN0A 4M7JH 3IGAB 4J1UA 4MQSB 3MBEB 5C71A 1JFQL 3MOBL 1FZJB 5E4IA 3MRRA 1CFNA 2V2XB 4HKJB 4N0YL 4UT7H 5GRZA 4XXCC 1V7NL 3O41B 3L7FA 3WEXB 4KZDH 2CXKA 2G5RA 1JIBA 3TBSA 1LQSR 5I15L 1A3QA 2G5BB 4ZFFB 1BGXH 3G5ZB 3TIDA 1SM3H 1KEML 5BV7H 1CK0L 3NCCB 3VXMA 2DLGA 4YXHL 2E27L 1RJYA 5DA4A 3LPGA 2ZNWA 5E8PA 2UY6A 3EYSL 1C12A 3PXHA 3AM8C 3MNVA 1RHHA 1HEZA 2CGRH 5IB4B 3TVMD 3MLPA 1QR1A 2HFTA 4HUXB 2IH1B 5C0IA 5JXEA 3MUJA 2BC4B 4F7MB 5ACLA 4KY1L 5A1AA 4FQIL 5D8JH 4OGAD 4NOFA 5ESVA 4NQED 1BD2A 1CL7L 3QXWA 4AEIH 3C6SA 1LO4H 4ZFGL 5KVGH 4EBQL 3MREA 4KJYA 4X98B 3VU2A 1J8HE 2IBZX 3ILQC 1LO2L 2V17H 4OZFG 4RFNC 3TBYB 2Z8SA 1CVSC 5IHZB 4PJBB 4JDZB 4RA0C 5B38A 3QCUL 1JHTA 1B9ZA 1EJOL 4MVBC 1C5BL 4O51A 5D2LB 1OL0A 2XA8H 3MLZH 4EUPB 4L8SC 4PJEF 3EOTL 4P59H 4R97B 3VXNA 4TUJA 1WV7T 2W0LA 4EI6B 2MOVA 1AQDB 5ISZE 2WBJC 2JJTC 1FLRH 1YEFL 1F3DH 4M61A 2ARJB 4M1GL 2WP3T 1HHIA 2OLDA 3QULA 3QR2A 2Y06H 1K8DA 2M1KA 5D7JB 3OSKA 4XNMB 2NY2B 4MCZA 5ID0A 1MFEL 1B6UA 1GGUA 3QQ9D 4Z7NE 5KW9L 1DN0B 1I4FB 3LZFL 4MCYA 3TCLB 2R39A 4MB5A 5I76B 4JDVA 2GTZA 5F7LB 3QNZB 3VFVA 3G9VA 3D3VE 2P42B 4QTIL 1S7SB 1T3FA 3TYGH 4EVNB 3T0EA 4X5WA 1QSED 5IFAH 1KC5L 2BOBA 2R1YB 4PRHD 5HHQB 1GIGL 1W2KT 1XGYL 2NY0B 3D6GA 4WWID 1A1MB 2X4OB 3A0OA 1IGTA 2CLRA 2DS4A 4U1MA 1MELA 3PP3H 5AWNL 4I3RH 4DTGL 3PF2A 2EDRA 3PWNB 1U3JA 3V4UL 3ZKMD 3NVQA 3STBA 1MH5A 1QNZL 4OF3A 4EXKA 3M45A 1YYMH 3VW3H 1RUPH 3D39B 2CRIA 4XMLL 3S4SG 1JRHH 3ZTNL 3IU4L 3R1GL 1NFIB 5T3XE 4WV1A 3QDMD 1CXKA 1KCUL 5KAQF 2OJEA 1G7JB 1ZOXA 2FL5B 2OJZL 3I6GA 1KJ3H 4HIIB 4OKVA 3IXTA 1KELH 1QZ1A 5EO1B 3M1BA 3WFEH 1A7NH 4HWUA 4WW1B 2F53A 2V7HB 1RZGB 4S1SH 5GGUB 4NBZB 4YBQD 4L29A 1MNUH 5I2IB 2EIZA 4O02L 2Z4QB 3UCRA 4LSSL 1OP5H 4ISVA 4NJAL 3RBSA 1KT2B 1N8ZA 4YHNB 3MCLL 5C3TA 4J3OC 1EGJL 2VLJA 3LEVL 3MLSH 5TH2B 4B53A 3TO4C 4U1IA 3E0GA 1BM3H 5D1XA 1IE5A 4GW1A 1RVFL 5ENWA 4A2MA 3TVMB 4ZNEA 2YBRA 4YPGB 5I9QC 1CFBA 2IAMD 1RV6X 1PKQE 2FO4A 1S5IH 3R8BB 2BP3A 3CIQA 4ZD3H 2VXVL 3FQWB 1T1ZA 5F1IA 3QIBD 4CJ1A 2JB5L 3C8DA 5I1EH 4NCDA 1DUZA 2ADJA 2FEEL 2Z35A 5GGRA 5DQDH 1RIVL 1Y6KR 2F8VA 2UZXB 4WGVB 3WFHA 5IB5A 1IM9D 4HDIA 4C56D 1WVZA 5E4EB 1TZHA 3IT8D 5DRXB 4OT1H 3BVNA 1R3HA 5JIPA 3NIDE 3D0VA 1BVKA 3UO1L 1UWGL 3OJDB 2YD5A 5ESQB 3MLVL 1R3LB 2W59A 4ZFOL 5EU6B 4YAQB 1E6JH 3U4EA 5B8CA 4Y1AE 5EOCL 2J8UB 3BUYB 5CMAB 3OF6A 4YK4C 4Z7WF 1I7UB 3HAEG 5J1AA 3DUUA 5DK0A 2J8HA 3P0VL 1U8IA 2XPGB 4H88H 2OMBA 5C0GA 1RZ8A 4NQXB 1H3VA 4EJ1C 3V7MA 5I1AA 5E2WL 4N8CH 2VDRL 4F3FB 2HT2C 3GGWA 5GS1C 3TYFB 3WIFB 3DO7A 5IJVB 2YSSB 5JW3L 2BMKA 1EJ6A 2XTLA 4FFYH 5BV7C 5FECA 3DMMC 3H0TB 2DIJA 3PGCA 2BVPB 3QXTA 3NH7L 5BMFL 1JPSH 5L8LB 3ARDA 4JANB 3H3PH 4XH2A 3BKJH 5I71B 5KVFL 4PRBA 4PRPA 3LS5H 1AGDB 3T8XA 5DHVH 4G8GE 1QSEB 1G6RA 3ARQA 4R4NC 2HG5A 1OD9A 4KDVA 1U3ZA 1FPTL 3WJJC 5KS9A 3OJVC 3PXJA 1H5BC 2BFVL 3U30B 3JVGA 5LGJA 5IBTL 2XZAL 3QXDA 4MJ4A 4YO0B 4ONGH 1T5XB 4XCEB 3QDJB 4Q0XH 4PG9B 1DBML 5KN5A 3VGAB 1MI5D 2QHRH 4JFDD 3MV01 5FAAA 3BPOC 3CSGA 3LPFA 3PQYB 5C0AA 1FL5B 1W72H 4WTZA 5LGHH 1GL4B 5JW4M 1BQHG 3GIZL 5DD0H 4NZUL 4R4FL 4QRPD 3QDMB 3IDXL 1N5YL 1U3HA 4K7PL 5C1MB 4LKCA 2VLRE 1LEKB 3RAJH 1LE5A 5F1KC 3C8KA 3MOQA 4G6FB 4PP2A 5EOTB 3SGJA 3THML 4PJCB 1YPZF 4PRIA 5DO2C 4YX2H 4MA3B 1INQA 3H3BC 3ILQD 3X3FH 5ERWA 1IGML 5HVHB 4LGPB 5BRZB 2HYMA 2V2WA 5E8NA 2EXYC 4KRPB 4HK3N 2QSCL 1TTGA 5CJQH 1FGNH 1UM4L 3V6FA 3FFCD 5EFIA 1A14L 1INEL 3KYMB 2ICWB 4DN4H 2X4TB 4WFHE 3TESA 2EKSB 2YD3A 4LHUD 4XBEH 4IJ3C 2IAMB 1IEHA 3LKQA 4JFHE 3QI9B 1WJ3A 3TNNA 2B1AH 3P30L 4TSCH 3OKLB 4Z78A 5F3HB 1PSKL 1W0VA 4EDXA 3LDBC 1IAKA 4OZHA 4UAOC 2K9UA 1RUML 4UZGA 4XP4H 2YUVA 4XCCL 3RZCA 5HHOE 2A73A 3EO0B 4PJDB 3UMTA 1ACYL 2VC2H 4D9RE 2R0ZH 2OYPA 4IHOB 1DSFH 1YQVL 1QD0A 1S7TB 1U3YA 2VDOH 4DZBA 1RIUH 2WWKO 4XZUB 4U1LA 5CCKL 4AEEA 2SEBA 4LEXL 4MNHA 1SVZA 2D3VA 3G6DH 2FX9H 5B22A 2NXYB 3TZVB 5HHNA 1U8JB 5EO9B 5C6PB 2BK8A 3NIGF 1CLCA 3TBVB 4WO4C 3MGAA 1ND0B 2HH0H 3WUWG 3O3AB 3F12B 1FO0A 4P23B 3CVHB 1JGLL 1GPOL 4EIGB 1PY4A 2DBLL 3BZEB 3K4DA 5C8JB 5EG6C 5T3ZD 1L0XA 5L88H 4DGVL 4XRCB 1P9MA 3TT3H 3HC3L 1L7TH 4ZUVA 5LWYH 3B3IA 3C5JA 5T1KA 1CFNB 1KJVB 3C5SA 1WBZA 2RHEA 3ZL4L 3TO2A 1MLBB 2IC2A 2V2TA 2B7DT 4XP6H 2EC8A 4O9HH 35C8H 43CAA 1O7SA 1E4XH 4PGDA 1K8IB 4ODTL 1TENA 4DVRH 4IM8A 1XGPB 2OZ4A 1KPRA 5AUMA 4W4OA 1N6QL 2IH3B 3OKEB 2HFGH 4MQ7A 1BFTA 1T1YA 4GMSL 4PLJC 1FRGH 4PD4K 3BP5A 2YD2A 2JB6A 3P11L 5DI8B 3VMPA 1C7TA 4A2LA 1OT1A 2CIIB 3LD8C 5IQ7H 5JHLH 2CLVB 5DFTA 3O6KL 3KPQA 1NKRA 4JFDB 1MHCB 1C1EL 2GHWB 4GFTB 4PFEA 5E1HB 4GMTH 1J0ZA 3KAAA 1G7HA 2VQTA 4PJIB 1T89A 2N56A 4Q74A 4KDTA 1Q1JL 3MBXL 3REVB 3LMJH 3BE1L 2L0DA 3U4BL 4QRPB 4UV7L 3UDWC 4N0YH 1V7NH 4PUBH 3IETB 1NLBH 4UUJA 4HKXA 3IKKA 5I15H 3GMOB 3RWFA 4JFOA 4WUUD 3L9RA 3LN5A 1KEMH 4QRRE 1OAQL 3IDIA 3IS1X 1CK0H 2GFBB 2NYYC 2YK1L 4TRPH 4JQXA 4ZUUB 1TPXB 5C6WH 4JPIB 1ZAGA 3ES6B 3CK0H 4LLVB 2R56L 5D7LD 4D0CA 4Y5VA 1YEGH 3FQXB 4PY8I 5E1AB 4TUJB 3ARUA 4NZDA 4QRQB 5BS0D 4PJBE 4HUVB 5I1KL 4U1HB 5HDBF 2UYLA 5EZIH 1NSNL 5LCVH 3KGRA 3FFCB 2CK0H 4ZQKB 4ZMAT 5TPWH 1PQZA 2UZIL 1IEBB 4FQIH 3UROR 3NN8B 1J1PL 4DAGH 4KKBC 1MCWW 2CUIA 1CL7H 5D71H 4Z6AT 4F58L 4ZFGH 3K2UH 4G6JL 2FLBT 2HT2D 1BVLA 1XR8A 4EBQH 5JOFB 5C09A 1AXSB 3V5DB 2XICA 2UVEA 4BQ9A 1LO2H 4ZUWA 3IAQA 4MDJB 4WFEE 3DMMD 2EE9A 2FZ3A 3EIFA 1P84K 3I02A 3D2UB 3RL2A 4RFEA 1EJOH 1C5BH 4OUUB 3ZKSD 1V3JA 3KXFB 4HF5H 4W4NA 4GKNA 1GRWA 1UA6L 4JR9H 3BWUC 3G5XB 5E6IA 2AERT 4R4ND 4NO3A 4FFWC 4WHYH 3IJHB 1MCRA 4HXBL 2PW2B 4M1GH 1CR9L 5C0CB 1FVDA 1S9XA 5HJ3B 4JM4L 2GQHA 1D5ZB 4ODWA 4XCFL 5EZLA 2Z8VC 1KLGB 3O2DL 1P53A 2PO6C 5INCA 4UBDC 1JP5A 3KS0J 1A6PA 2J4WL 2OJEB 3LZFH 3HR5B 4R9HA 5E5RB 4Z7WE 3V8CA 5LBSL 4PJEA 4N90E 2VIRA 1T21A 2GW5A 3ZO0A 1UJ3C 2NX5A 4OLWH 3D85A 2ADFL 4YDKH 3TBTB 3MFGB 4OI8A 4QTIH 3UAJC 3QUZC 1YNLL 3UTSB 3ZT7A 4IS6A 5F89A 2YUWA 1ZA3A 1CWVA 4XP1L 2PKDA 5F3BA 3MLYL 1B0WA 1CT8B 3JSSA 1Q9WB 2CDGB 1GIGH 4WW2B 4CU8A 5BOPA 5IFJA 2ARWA 4WFGE 3B9KA 1W0WA 4BSJA 5KTEL 2DL2A 1CGTA 2WAHA 2OI9C 5DJCB 4JN1H 1HSAA 4H26B 3MGOA 4FP8L 1B3JA 3ZKQD 1K4DB 1WZ1L 1U36A 4D9LH 4E5XA 4LLQA 1QNZH 1OP3H 4PJAB 1HKFA 3BFOA 5MEOB 5DVNA 3SDAA 1U8LB 1JWUA 3ULUL 4M43H 4QOKD 2FO4B 1CGVA 1J0IA 1Q9LA 3ZTNH 4RDQF 5J13C 3TA3C 3R1GH 1F42A 2EDDA 5HY9A 5JA8B 2EEAA 3MJ7A 5TE4H 2ADJB 5EU4B 5KVEH 1MCOL 2F54D 4YIQA 5TDNB 3I85A 3TH3T 4JO2H 4LBEB 5DMGC 5FV2A 1RJLA 3HHRB 3FQRB 4U1GC 1ONQA 5DD6A 1BVKB 3M07A 1MJJA 1FN4B 4LSSH 4HUUA 4QRRA 2NW3B 2VSDA 5HGAA 3CCHB 1FZOA 4L8CA 2V5MA 1BIIA 5TGBB 3GHEH 1WSST 2Q1EA 3MRBA 1TVDA 3ARVA 5DJZA 3BKML 3W9EB 1QBML 4LCYA 5LQBH 2Q8BL 2OTWA 4G9FD 3FN0L 3VRLF 1A6ZA 2BVTA 1DEEB 4V1DA 2H3NA 5L0QC 5ICZB 2J8UE 2AABL 4QHLB 2I9LB 2PTUA 5F6HI 1Y6MR 2HKFH 2DJUA 3DYMA 3PDOA 1S7WA 3VXOA 1S9KC 1EO7A 8CGTA 3CC5B 2ZPKH 1Q72H 3X17A 4B7IA 1RIVH 2V5TA 1OARL 2X41A 3ZE1F 3TLRA 3SJVB 5HHVL 4WO4D 2LE9A 1SEBA 4OB5L 1T7XA 2ZSWB 2BSTB 3X14A 2FX8H 2NCMA 1RK0A 1FGVL 3UO1H 4JY4A 3IU3A 4GBXB 3QDHA 3IDGA 4JM2A 2Z31C 1BOGB 3KPMA 2VSCA 2NY1B 3CLEH 4TOYL 4G43A 5EOCH 2VZSA 3VXPA 3I75A 3P0VH 4MJ5B 3RNKB 5E9DD 3SGEI 3HI5L 1MFAL 4KJWC 4E42B 4NO0A 1QSEE 2AV7A 4LU5H 5JXAL 2FD6L 2VDRH 1CD8A 2FO1A 4Y4HB 3JTTB 3D9AH 3WHXA 1K4CB 5IHLB 2AJ3A 3ALPA 4HCRL 4PLJD 4DVBA 4RMUA 3AU1A 2XIDA 4B41A 3IXAA 2DI9A 3NH7H 5BMFH 1NCNA 1F8TH 1WQVT 2VXQH 4OV5B 5HSFA 3VFGH 3OKNB 3EDEA 3PQYE 3GI8H 4KVCL 5B21A 5ICXB 5C08B 3WBDA 4X6BA 1RSFA 1G7IB 1N0LA 4X9BA 4IOIA 3OB8A 2AQ3A 3O4LB 2HTLC 3QDME 4KKAD 4NP4L 3GJFH 4LMQI 4PJGB 5E8EB 5D2NB 4U6HA 3CDYA 3MO1A 5ABDE 5KBNC 1IC7L 3EYVB 5IBTH 2XZAH 3K4AA 2OM5A 3H9SD 4X7EC 5IWLA 1ORQA 4PJCE 3DROA 4XX1G 1KPVA 1DBMH 2NYYD 1PBYA 1PLGH 4JO3L 2AVGA 2OR9L 2HT3D 1U8PB 2ICWI 5EUOF 1NC2A 1QFWM 1S7XB 3VCLA 3QIUB 4NRYB 1T22A 3GMQA 4QOKB 2P43B 5BRZE 3GIZH 3FMGH 1A0QL 2DF3A 2CPCA 2IADA 1IGCH 1YQ2A 4I77L 3PP3K 1RFDH 4OLXH 4I18C 4WI8A 5MP6H 4HLZG 4P9HH 3PABA 1NDMB 1PX4A 5I1IH 2F54B 2JJSA 4X9HA 4JAMB 1G7MA 3QIWD 4P4KC 4LPCA 1JCKA 3DGCR 3CU1A 1IQWL 1OCWH 4NQEA 3PJSB 3WKML 3MR9A 3C87A 3WNKA 5F96L 2VWEE 1DUYB 4LRIC 2LAGB 2OTUB 4UAOB 3A67H 3WS6A 3UYOD 4NGHH 5IVZB 3GB7B 2QSCH 4U6VH 4MNHB 5F7YC 1UB5A 1JNHA 5IROA 4XI5C 1S7VA 4PJDE 4AM0B 5CEZL 4PRNA 3U0TB 1FNEA 4AYFA 2CO7B 4G9FB 3TP4A 1YPZA 1NCWL 5I1LA 4NHUB 4CRPA 2BSRA 5L8KB 1LMKA 3SKJL 1OP5K 4ELMF 4FFWD 1VPOL 3CFCH 5KSAB 2CKBB 2PO6D 1NFDF 3CXHJ 4MNGA 3RVXC 4CW1A 2JF1A 5E94B 4QCIA 1RUMH 1KIPA 4WO4B 2OQJA 1CXFA 1CGUA 4PJGF 4S11A 1K85A 43CAB 2E9WA 2F8OA 2F9BT 3H9ZA 1OQOA 4ODBD 1T0PB 3MRLA 3QUZD 1JYWA 1TQCC 3RDTC 5F6HJ 4L5FL 3VGEA 3K1KC 2XTJC 5DR5L 2JIXD 2BNUB 3HNSL 4HGMA 2APXA 1KBGL 5CCKH 4F7PA 1WT5A 2JB6B 4LVHB 4M1DH 4G42A 4O4YH 4LCCC 1OTTC 4PRHA 2P46B 4M62L 4YBLC 2IG2H 3ZDXF 1O7VA 4DFHA 2DTMH 3C6LC 1FFPA 1JPGB 2KZ1B 1JGLH 3QDGB 2VZ3A 4PBXA 5KOMC 3HRPA 5L2KD 1JF6A 1U2CA 3RWIA 1MWAA 4OF0A 2EYTA 2FATL 4KAQL 3TA3D 1MI5E 1XR9B 3ZL4H 4JFDE 3RFZC 3VWKA 4KXZH 4BJLA 4JG1H 1MQKL 2AV1B 3KPTA 2J6EH 4I5BA 4PJIE 5EULV 2VDNH 4GS7C 3BP4A 5ALCL 4G6KH 4QRPE 3W9DA 5DMGD 1HI6A 5BZDA 1N6QH 3KPLA 1X44A 4UB0L 2ENSA 4FS0A 3MRFB 2NQCA 3V4VH 1MREH 4HUNB 3RVUC 3FL7A 3B2UC 4EOWH 1YJDH 4HT1H 3SE9L 3GK8L 4D9QE 4HWBL 5D7IA 3NCBB 5E7BA 3H9HA 2R2HA 1E0OB 3DV6A 1U91B 3T04D 3CFKA 5ADPL 4MSWA 4NSKB 1Q1JH 3HI6H 1HXMA 2ARJQ 3BE1H 3U4BH 4X4MA 5C07D 5JDSA 3RRQA 1EEUA 4PB0L 3FFCE 5FGCB 5DHYB 3V52L 2Y36L 1FAIH 4LF3B 5JDJA 4XCYA 1YA5A 3ZT5A 3RUGB 1AP2A 3T0AA 3QIWB 3QIBA 3AMKA 3MV9D 2P5EA 4AIZA 1AD9A 1ETZB 1FE8H 2CMRL 3EYFA 4W6WB 5EN2B 3V6ZA 3QAZC 3VXTA 5CSZB 4BK5A 4HF5L 4X6DF 4C56A 3CFJA 1A7QL 4JFZL 1J1XH 5DRWB 1EMTH 3UTQA 2LVCA 5I1KH 4LHQB 2Z31D 4QF1A 3RA7H 3AAZA 3KPRD 1GZPA 3MRCB 1KFAL 2DBJA 4CL7A 3KXFE 1A7BA 1CZ8H 1W72B 2H9GB 5LAXA 3MJGX 2UZIH 5EUKB 4WHTA 4KJWD 2B4CL 4M48L 4NWTL 1D5XA 1G9ML 4IDJH 3H7LA 3C09B 3Q1SL 4D0BA 4QHUB 3GSUB 3C60C 1T21B 4HPYH 4PJ5B 5C0CE 2XG5A 5GISL 1T1XA 3KLAA 4ZDHA 1F5WA 3TJEH 5DYOA 1QVOA 1MJUL 4JREB 5EZJA 2AEPH 4JHBA 2EDTA 2AKRA 3P4OA 2XZQL 3B9VA 2XWJA 2I24N 5T3ZE 2X1WL 3CZFB 3DXAB 4YC2C 3UTSE 1UA6H 4AL8L 4AIOA 1IL1A 4XPBL 4Z9KB 3JTSA 3V5KA 5ID1B 2JIXB 3M17A 1J0KA 2HTLD 3AMLA 3PHSA 1UH4A 4JKLA 1Q9KB 1U8MB 2QLVB 3PIQB 3TF7C 1T0MB 4P9HC 4DQOH 4XCFH 5KG9B 4JRWA 5JPNA 1IKFL 3FO0H 3IJYA 4XXCA 2J4WH 1MHPL 4JRYA 2NY6C 3AROA 3MODH 3MJ7B 4P9ML 1M7DA 1F6FB 3RWGA 4PJAE 3QUXA 5C9JB 2ADFH 4P2OC 1GXEA 1YNLH 4KI1A 2DLIA 5H94B 1SYSA 1KIQA 5EIIA 1J11A 4JPKL 5CUSH 1MI5A 2ZUQC 4FQHB 3RUGF 1T1WA 1R3JA 5KSUA 4JKMA 5J13B 5EBLA 1BFOA 2GIYA 3MLYH 1EO8H 1S7UB 5DD6B 3AM8A 3ZYJA 2BHUA 3QH3A 5D1QB 3JUYA 2XNAB 1JGUH 1OAKL 3BH9A 5KTEH 5HGAB 1W8OA 3U7AA 5FHBL 4ZTOL 1JMXA 4CGTA 2DLHA 3ZYIA 5HYQA 2D31A 2FIRT 3QFJD 4P4KD 3W0WA 5L2JA 4YXKH 2V7NA 4U1GB 4PD4J 5IW6A 5ADOH 2VH5L 2FGWL 1A6ZB 1OLZA 4WUUE 1SJHA 5IT2L 4TSBL 3WKNA 3O6LH 4EIZC 4Z76B 4U05A 1FH5L 5FOBB 2J2ZA 4TVPL 5IR1A 2WMPA 3VG0L 1OT2A 5D7LE 3RX8A 4XI5D 3WFZA 2JE8A 5AZEH 3QUML 1MCOH 3FB8A 1P7KB 1HHJB 1I7RB 5FYJL 1XGQB 1GCFA 2A77H 2GI7A 1FYTB 4XP5L 4L8SA 4I48A 4LHUA 1XZ0A 3IU3B 4ODHH 4QNPF 5FM5O 1TCMA 4PPTA 3V0AC 4JM2B 4Z0XA 2WBJA 2JJTA 3QXVA 3SJVE 4WEMB 3ROOB 4UQ3B 4OGYL 4B0MM 2YKLL 3UTTA 1E6OL 4EKXA 5AAWA 3V0WH 5HD8C 4CDGC 1K6QH 2ZKHL 3ZMRA 3DIFA 4NO0B 2Q6WA 5BVJA 3AVEA 1Q0XL 1FFNB 1IARB 1WWAX 3FN0H 3RDTD 1M71A 2XTJD 2E8YA 1ZHLB 3WL9B 4HJGA 4PJ9C 3KPRB 2AABH 3KPSD 5SWZD 4HXAL 4M02A 4OIIH 2R0LL 1IM3A 1ZLVH 1FBIL 5EBMA 5GGSY 2MKLC 3MRDB 1OTTD 4R0LB 1OARH 4XNXL 3IJSA 2XKSA 5J6GB 3BGAA 5D72L 2GCYB 4HMCA 4HUMB 1ORSB 1P4IL 3QEQD 3BKCL 4X6CF 3ZDZE 2A83A 2H45A 1P84J 1RIHL 4MJ2A 1YJDC 3FZUC 1Q9OB 3LRSA 4BH7B 5CIPA 3LQZB 4TOYH 3MO1B 3UPRA 4I2XA 4ZO6A 5C08E 3BEVA 4Y7MA 5I19H 5JORB 1NJ9B 1ZANL 2ED9A 3DURB 3QB7C 1C08B 1NFDE 1OSZA 5J0BA 3O4LE 1GYAA 5JXAH 3QHZL 4NKOA 2EO1A 2X05A 2ERJC 4LLUB 5I0ZA 3K7UA 4PJGE 5D2NE 1EHAA 2CLZB 4KK9C 4MA1B 4RAVA 1NEZB 1A6VH 2AK4D 4HKZA 4NRZB 1KPUA 5K93A 1H8OA 3STLA 1PG7L 4XB7A 5CEXA 3GI9L 4N0FA 4MNQA 5DK2B 1F2QA 5DQ9A 4HH8A 3RVUD 5DMJB 4KJQC 4MD0A 1NMBL 2QR0B 1NAML 3RI5F 3FFDA 5DT1L 4NYLA 4QOKE 3GBLA 2B0SL 1LO0H 4BZ1L 3VFPA 4IDLA 1MCSA 4FQJH 4ZG1A 3B5GA 5JIKA 3TO4A 4NP4H 3TBWA 3DTXB 3QNXB 1RZ7H 2XT1B 2F54E 2G60H 2IWGA 1IC7H 5CP3H 2X70B 4P2YA 1I9EA 3T1FB 4U31A 1ZVHA 3BRFA 2Z9TA 3TGXA 3IDMA 3IFOB 2C4FU 4WCYH 4IRJC 1L0YA 1NCBL 4F9PC 3ZSTA 4X4YB 1A9BA 4JO3H 1I3RB 1FFOA 1KF9B 1R3IL 5E2TL 5MHSE 2L7JA 1HYRC 5HYJB 4WUUA 4P5TD 1JRHI 4D94A 4HSQA 4Y5YB 2A6DA 3OGCB 4WWKC 1A0QH 3RX5A 1JZ5A 5D7LA 3I9GL 5C3LD 2VITA 3S35L 1ULVA 5BS0A 5C0RH 4WIQA 4NJ9H 1EFXD 2W60B 3LH2L 4HJ0C 4G9FE 4XVJH 1AC0A 2D7QA 1UM5L 1OP3K 2DDQL 5EUOA 1A1OA 4XVTL 3C60D 4OZFH 3OXRA 3ESUF 4Z7QF 2EDOA 1IQWH 5IHUL 3E6FB 3X13A 3WKMH 2JTDA 3EDJA 3AY4A 4P46C 5D6DC 5GS1A 3UXFA 1A6TA 4NO2A 1LP9A 1R0AL 3L3GA 4XB8A 3QZWA 2D7TL 3QXAA 2VL5A 3DMMA 3QCVL 3PWUB 2FWOA 5T1LB 4RGNC 4YHOL 4QRTA 2D4DA 4APQA 4F33A 3BI9X 2XRAL 1XGRB 5DDHA 1VPOH 1HE7A 1X5HA 1KTRL 4X6DE 1FL6B 1T2JA 3JV6A 1AO7A 4PTUB 4LCCB 3NMEA 2R8SH 2HAZA 5D70L 3WJJA 2NY4B 4YXLL 3S5LB 3MV7D 3VWKB 1QRNB 4MHHI 2NY6D 4ZAKC 3QDGE 1HILA 3Q5YA 2A9NL 4NT6A 5ALBL 1VSCA 3EOAA 4P2OD 2UY7A 1JE6A 4ZS7H 4ELMA 5ITFA 2QQLH 1AKJD 1NMAL 1HZHH 3BEWA 4L5FH 5EBWA 1F4XL 1RJZB 5DR5H 3MFFA 1XIWC 3UC0L 3WLBB 2EIEA 2A6KB 2VL4A 1CFQB 1KBGH 5H35B 5KVDH 3VXSD 4X7CC 4LEOA 3MRNA 4YFEA 1FZKB 1BQSA 1DBJH 3VH8B 3O3BB 4J2XA 5IW1B 4GS7B 4M62H 1NGPL 1FL3B 1P2CB 3SKOA 3MRPB 4NZRH 1DQML 1II4E 4WI4A 5D7IB 1AR1C 1U58A 3CDCA 4NBYB 4XNYL 3WO3B 4YDLB 3BKYL 3WXVL 4RX4A 4P4RB 1K3IA 2G75B 3EBAA 1T04A 4LLMB 3DX6A 1WWCA 3DX7B 2X4SB 4KRLB 1OF2A 2C26A 3O6FD 2W38A 1B90A 1I3VA 2P5WD 2HRLA 1PG7X 4KAQH 1HH9B 3BOVA 3F5WA 3BGFB 3QO0A 4IMKC 1G7QB 2R4RL 2LV4A 5H37G 4GLRI 2Q76A 4ZOBA 3VFNA 3IFPA 3WS3A 4HIJA 1GH7A 4XPTH 5ALCH 4ZFOB 3I50L 4LSVL 1AGEA 2DWEA 1QSFA 1S7RB 1SEQL 4HFUL 4PV8A 3PL6A 3PGFH 1TFHA 5FGCE 5DUBA 1R24B 2AI0L 4JY6A 4KQ4L 3REWB 4MX7B 1IBGH 4UIMA 4D8PA 3LSOA 3L5JA 3RUGE 4FFZL 1V3KA 4TUOB 5E0QA 3U2SA 2C7UA 3SE9H 3GK8H 1YN6B 2X1XR 3OB0H 5IK3B 1CD0A 1HQRB 3DV4A 1F11A 4P5TB 5HD8D 2BCKB 3JWDH 3S88L 5ADPH 1BIHA 4KDWA 4WTZG 4PJXB 1GAFL 3HCVA 2EDXA 4NQDD 1S3KH 1A7PH 1CTOA 4X0KA 3VFRA 2YRLA 4PJ9D 4KMLB 3GRWL 4J8RB 4RWYH 4PB0H 4KKLC 2VISB 3DGGA 3EKCA 3VDCA 3V52H 4KV5F 2BNQD 5EZJB 4KMTL 3MRGA 3AS2A 3PUCA 1OHQA 5JHDD 3VXRD 3GJFB 2VERN 4PJ5E 2CMRH 4J3SA 1B0RB 3S34L 4NZTL 4U0QB 1JBJA 5MEQB 4YE4L 3F65A 3PWJA 1AC6A 4WTWA 1FIEA 1UADC 1A7QH 1BECA 3WDHA 3HAEH 4UOJA 5ETUB 3LVEA 4PY7A 4UDUA 1QLRB 1F6AA 3FZUD 4Q9BA 2E6QA 5FUCC 5GRUL 5TJWK 1GGYA 4JZJA 1KFAH 4KKNA 4QNPE 1QFOA 1R5IA 3MRJA 2JCCA 3SDXF 1TXKA 2NXZD 3VXUD 5F7NC 1EAJA 2BJMH 5DUPH 5C0EB 1HH6A 3FN3A 4PS4L 5DEZA 3PV6A 5E9DA 4GXVL 3TNMB 3HMWH 4XCNB 2Q7YB 4R3SB 2J12B 3HPLB 3WV0A 1UXSB 4UV4H 1XF3B 6FABL 5EOQH 4GH7B 3ZLQC 1AIFA 4XBGA 2NY6B 4N9GB 5DJYB 4KJQD 4GO6B 4HC1L 2XZQH 2F58H 1MJ8L 3HNTH 5L2KE 1MCIA 3SOBH 3EJZC 4P2OB 2X10A 4GRLA 1MLCA 3KYKH 1ZA6B 3AS3A 3P9WB 2VAAB 3TV3H 5DVMA 3V8OA 3FB7A 3VXSB 1D6VL 2DAVA 1RK1A 1MFCH 3ARFC 4X6CE 2D9QB 1ODAA 4OD1L 3PHOB 4G9DB 1TMCB 3RY5A 1RZFL 1KCVH 4PJXF 3UDWA 1YEHL 5GPRA 3PWPD 2ITCA 5F71A 1CTNA 4P9MH 5I1CL 2HKHL 4XNZB 4HIEB 3WN5C 3H9SA 3FB8B 4WRLA 2RJMA 1BX2A 1REIA 4QXUL 3O6FB 1YEEH 5DJ2B 1UC6A 1UZ6F 4ZS6D 4C83B 4WWKD 1Q94A 1BHGA 3BPCB 3PWVA 3Q3GA 5BZWB 1AI1H 4FQXC 3RU8H 3QUYC 1E4XI 4NKIL 5CP7B 3MLXL 1U8OB 4HJ0D 4Y0GA 4MWFB 3UYRH 5LXGL 4U6YA 5DK3A 1A7RH 1F90H 1FYTE 5FHBH 4ZTOH 3LPWA 3UTTB 3B6SA 3GFUA 5GGSB 5DHVA 1VGEL 5HYFA 1LEGB 2QADC 3QG6A 1GOGA 5FKPB 5F93C 2Y7QA 2FR4B 4HJGB 3X12A 1OGAB 1DZBA 4TSBH 5IB2A 4BQCA 2IPUG 4J7RA 4TVPH 1SJEB 1LO5A 3VG0H 3MUHL 4L3EB 3WIHL 1F45A 1SYVB 4MA7L 3VD7A 4RGND 3EFFB 1H3XA 1FDLH 2GT9B 3BIKB 2MTPA 3KPRE 4PJ9B 3BGMB 4WEBH 3FTGA 4HIXL 3OXSA 2OSLA 3DRTA 1HSBA 2K1MA 4O2FA 2BNQB 2FJHB 5TDOA 1PVHA 5MERA 2X7LA 3RWEB 3QG7L 3VXRB 2A2QT 4OGYH 1J05A 4PP1C 2YKLH 1IZJA 5TE7L 5FCUH 2PO6A 3MXVL 4ZAKD 2DIAA 4OLZH 1Q0YL 2ZKHH 4K2UL 1Q0XH 1JF1A 2P47B 3DRQB 3MYJB 1H3PL 1S8DA 2HWZL 5T3XH 3HFML 1RQ5A 1WIPA 3K1DA 1UJ3A 4Z7QE 5A40E 3QUZA 4HXAH 1QEWB 4YQXH 2NXZB 1NGZB 1FBIH 1CL7I 3KWWB 1IQDB 5GGTA 1D9KC 2YHGA 4G3YL 3MRHA 5IQ9B 2XXMB 4F57H 2ERJB 2GTWA 2OX5A 3SPVB 3HG1A 4LSUH 1MRCL 1CU4H 4LOUC 2DQHL 2ZOKA 1J18A 3T4AB 4K94L 1P4IH 1DQLL 2NY7L 5FM4A 4IOFC 3MNWA 3BH8B 5K9QI 1ADQL 1KTLA 4LP4A 4HZLA 4TULL 5E5MA 2G9HA 4X80L 3JWDC 4JPVL 1ZS8A 4ODXB 3O8XB 1XCTB 3ZYZA 1NH6A 3TA3A 4WDIA 1VEMA 3NGBC 1EXUB 1NL0H 3C2SA 2D0FA 2ZOLB 5IV2B 1WTLA 2DYPD 1IGIL 4X6CA 1TZIB 3BQUA 3OKDB 2VLME 4WU7B 1T7ZA 5ANMB 2OS7A 1X6LA 3QFDA 2YPLA 1PG7H 5MENB 5CD5C 4U1JA 3OAUL 3GI9H 5IEKB 4MZ2A 4LLWA 2VITB 5DUMH 1ZHKA 2XZCL 2LU7A 4MLIA 5HYJE 1NAMH 3ARWA 4LCUB 1XFPA 4X4XA 1QLFA 5DT1H 5HYIA 1DBAL 2DQIL 5FK9A 1YC7A 2CDEA 1JPST 2MMXA 2C3WA 2H26B 4UQ2A 3GKWL 3MA7A 1CXEA 3HUJF 3MX0A 1YEKL 2W9DH 5C07A 5DFWH 3F7PC 2IPKA 2YWYA 4RNRB 4XWOD 2O61B 1X5KA 5LJYH 2AJZB 3Q6FB 1N3NA 1MVFA 3BZFA 4KGJA 1NCBH 3MJ9H 1CG9A 1R3IH 3BYYA 5FGRA 1BOYA 4J3WA 3MV9A 1PY9A 5JR1L 5F9OH 3LKNB 4OFPA 2B1HL 4PJ8B 2X4NA 3QHTC 2BNRD 3DX9A 2A6IA 5HVGB 1AO7B 4K7FB 15C8H 1T2XA 1T03H 4G8FB 3UBXB 2Z31A 3LH2H 4RGNB 2Q86A 5DXWA 43C9B 3MRIA 4RIRB 5FA4A 2BDNL 5DVKA 3KPOA 1MPAH 3KPSE 4NT6B 1EV2E 3EOAB 5CGMA 3U4AA 1FVCA 3MXWH 1DANT 4BFIA 2A9ML 5H2BA 5T5FH 1KB5A 3ULSB 4P57B 1AQKH 2JELH 4NC1C 3EOYG 3KYNA 2M8XA 1QRNE 5DMIL 2GSGA 1A4JB 5F7FA 3QEQE 2OK0L 4Q2ZB 2PYEB 1P6AB 2EZ0C 2D7TH 3CSYB 4KV5E 5JMRA 1UCBH 3O3DA 3QUKB 4XPAH 1A4KB 2E7HA 4JZNB 3VMOA 4CU7A 3GBNH 4TYUA 4MAYC 4YDVB 5KJRL 5GIRA 2Y9RT 1WFNA 2MQCA 5SX5H 1MVUB 1YUHB 3BP6B 3GSRA 4JFFD 3R06A 1ZLSH 2FEEI 3ARFD 1I7TB 3NCJL 5C0BB 1ZSDA 5D70H 1AGCB 4JB9L 5JUEL 2BSSB 3J7HA 4XHQA 2LVEA 2APWA 2MHAA 2HJFB 4NPYA 1JF5A 2C3VA 2XWTA 1QO3B 3G6JF 1KV3A 2GJ6A 5GRYA 1Q38A 5I6XB 3LRHA 4KTDH 2A9NH 4L8DB 5I74C 5ALBH 5B39A 2R0WL 4HBCH 2GUOB 1QSFB 1Z9SA 4HQQL 4NM4H 1I9JH 3I3EA 2YZ1A 1H0DA 5GSRA 1YY8B 1ZLVK 1OY3B 2BVOA 4S1QL 4D8PB 4YEFA 5TQ2L 3GHBH 4ZSOA 3OGOE 3T1WA 2B20A 5F8RC 1IC5L 2FYYA 7CGTA 4CVZB 3U36A 4L3CB 1EEYA 2DYPB 2ITDA 1VFOA 1CXLA 4I18A 4TSAL 4EN3D 4YUEL 4BUHA 4TTGA 4AENA 4UTBH 4ETQA 3HZMA 2VQ1B 2QADD 4QXTB 5IEHB 4LKXA 4P4KA 2VDMH 3BDBA 3QFJA 3VFMA 3FONA 4C4KT 4X5XA 1NCTA 4WHCA 1D3CA 3PHQB 2E6PA 3RWHB 3DGGB 5FA3A 4BA8A 2QEJA 4Y16A 1KCSL 3MC0A 5D9SA 4LRIA 2QTEA 4PJXE 3I50H 4LSVH 1WZLA 5JW4R 4BSWA 2A1WL 5E08H 2XWBB 1U8NB 2AI0H 4KQ4H 2FBOJ 4V2CB 4G80A 4LDEB 2X4PB 3WIIH 3I6LD 4P49A 1FFQA 4FFZH 3N85L 4JFPB 5KANI 3QJHA 5SWQB 4JZJB 3EO1B 1F13A 4PP1D 1F6LL 3EDFA 2AJVH 4NHCH 2ATPB 3DI3B 4CUCA 4J4PD 1LDPL 4P5KA 4DEPC 5D5MB 1GAFH 2D7MA 2BNRB 3FT4A 4MDIB 3GRWH 1W8NA 4MJID 2DQGL 5I8EB 5F72S 3VWJC 4PJHA 2J5LC 2JJWA 4PR5A 1CFSB 1I9IH 4PB9H 1VFBA 2HLAA 1LNUA 1D9KD 1P1ZA 3UJTL 3ARGD 5E6ZA 1LE9B 2DRUA 4XBPA 4OF7A 3FRUA 5SWZA 1UVQA 4DWHA 4P5MA 1NBZB 2R0KL 2X9YA 4LOUD 4NZTH 4R7DB 4OGXL 2D2OA 3NACL 4YE4H 4GRLB 2IPTL 1GVIA 1T7YA 4IOFD 3SDCD 2C3GA 3MV7E 3C6LA 1BREA 3HI1A 2YRZA 3QEQA 1ZT7A 3WYRA 4JFED 4OCSL 4ZXBA 4B5EA