4WI6A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation n434a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHAHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A01
4ODXB 5D4QA 3U7YH 2F54A 3AC0A 1YECL 3WJLA 3DX6B 5A2IH 2WWKT 4R96B 1E6OH 4CN6A 4OFYA 1OAUL 2P44B 1DP0A 5KVDL 5K9OA 3LZFL 5DO2C 4MNHA 3UTQB 4Y0GA 4GO6B 4IJ3B 4Z7WB 5CEXB 2AJUH 3WIHA 4QTIH 3LD8C 4MAYB 4LRNL 3VD5A 3FRPA 3NN8A 2LAAA 2VRAA 4FQQA 1MCCA 3QZWG 1DSFL 4K3EL 3T3PF 1EEZA 2ZPKH 1C7TA 5SWZB 5FK9B 1MWAL 1X5JA 3MO1B 4HPYH 4LLMB 4OZIA 3WD5H 2NY0C 3GSRA 3NPSC 3FN3A 4G6KH 3U4BL 3V6FB 3RTQA 1RUMH 2P24A 5LWYL 4MNQA 3VG9B 3SDYL 2Q87A 4PJXE 1F11A 3ZL4H 1SJXA 3GUTA 1CGWA 3PABA 2C3WA 5INCB 3BN9C 2H26B 4Z8FL 3GIZH 4Q9BA 4LLDA 3NFPA 4X6CF 1MCJA 1ED3B 5F7MC 2X4NB 1KLGA 4MS8C 2WBWB 3BKJH 1ZGLM 4JKMA 3ARGB 3MLUH 1WICA 3KHQA 3T09A 5SWQB 5BZWB 2K1MA 3QH3B 1Z0MA 4U3HA 4F7TA 1K8IA 3MRBB 3UPAA 2IPTH 3LN4A 3SGEI 1WQVT 4MLIA 4HUVA 3EO0A 1MY7A 4JM2B 3KJ4C 4ZPVA 4LLYB 5I18H 4MAUL 2XIDA 4Y19B 3FL7A 2X2YA 1NC4D 5C0CB 1ZEAH 2EE9A 3ARRA 4XC1H 1NEUA 2W0LA 2IC2A 1MFEH 1SJEB 3RA7L 4QGTA 4YO0B 3MMEB 4YHPA 4ACPA 4KK9C 1LNUB 2FJGA 4IEFB 3ZKNC 1J0KA 2F8OA 3Q3GA 1WCBA 4AEEA 5EU6A 2LVCA 3MJ9H 4XMPH 3BP7A 5FCSH 5KVDH 4GKZA 3VGAC 5TGBA 3KLHC 3BP4B 2M8XA 1FSKB 4NRZB 5GIRB 5H94B 3ARTA 1WVZA 4Z6AT 1FNSL 3MJ8B 1AR2A 2O5ZH 3AAZB 5EBLB 1MJUL 2EH8H 5J1AB 3L3DB 1PBYA 1IAII 1PJ9A 1NBYA 3QQ4B 4TUKL 4KTEH 5DXWA 2BSSA 2EE6A 4NWUH 4GKSA 1G9NC 1EFXB 4ZFFA 3OBAA 5T5NG 5J1TC 3IKCB 1QVOA 3CVIL 3WN5B 1RZ8A 5CD3A 1OAXL 4PJ9A 5EZOH 3CIQA 2BVUA 5DQ9A 3RWIA 2LU3A 1Y6MR 3CFJB 2X4SB 3T2QA 4L3AA 1MLBB 5BCAA 5BQ7B 5EO9B 1UENA 1EXUA 2GI7A 2XV6B 4HIJB 1T03L 3EW3B 1F58L 2EH7L 5F44A 4ENEC 2HFEB 1RUKL 3VI4E 3SKJL 4JLRA 4U1GB 5HVFB 5IWLA 1I4FB 2AW2A 4HKJA 5SX4H 3QCTL 3GMLB 1UC6A 5MENE 3TV3H 4PJGA 2IANA 2PYEA 2X05A 5FDWB 3IDYC 2BVOA 3RI5K 1OAYL 3WUWA 1DANT 4GBXC 4OV5A 1Z9OA 5KVEL 1X44A 4PBVC 2B4CL 1QSFB 4PG9B 1INDH 1KELL 3RZWA 3TO4C 4Y19D 2P5WD 4QTHB 3PGDB 4HK3J 4XC1L 1HXMA 2H2SC 3QFJA 4Z18A 1ZLSH 1FVDB 1BECA 1WBYA 2AGJH 1KULA 4LLUB 4PJDF 4WTZA 1NCBL 3HUJB 5E9DD 1GGIL 3V5KB 2H32A 1WUNT 1ZT4A 2VITB 4PBXA 4PUBL 4HD9A 3QUXB 2D4FA 2QLVB 2DQDL 4JB9H 1P4BL 4NYLB 3C08L 1GOFA 1KPVA 3OXSB 4WWKC 5HI3C 1EVUA 5ALBL 3IU3B 1P6AB 5HY9B 5JW3L 3DURA 1JV5B 1MJJA 4PTTA 5D1ZC 1KFAH 5T1LD 1UA6L 2NZIA 5BJTB 4KKBD 4MXQC 2OR9L 4MJ4A 3HZYB 3OAZH 4PJIF 1A6WL 2BSED 5D6CA 1Z6JT 2DQTL 3VFRB 3ZYZA 3HMXA 4PJ5D 4TRPH 4PR5A 5B4MC 4XB7A 1NBYB 4OLYH 3DX9B 4QYOB 2NY7H 4L1HA 4RBPH 3MLPA 5DD6A 5D2LF 4PRHE 2R0KL 1AH1A 2VSDA 3WXVL 1FG9C 5ESQB 3K4ZA 5I1LA 3ULSB 4FQXA 3UCRA 4UV7H 1ZT7A 5I1JH 4GKZB 1TCRA 3WFDH 3DXAA 5IMOB 1A6AB 3WJJA 5C07E 4XGZB 4WEBH 3P9WB 4X98B 4CMMB 2YPVH 3TT3L 2JJTA 4KZDL 1PYWA 4Z7QE 4U6TA 4JFYB 5FO7B 5FUOH 1OCWL 3FAWA 1MCSA 2W60B 1QFHA 1QO3B 2DI9A 4OGAD 4L4TB 3PV7A 3BT2H 4P4KA 4I0PB 5IVZA 1TQCC 3VWJB 2D2OA 1EFXD 4YFLF 4JE4B 1X3DA 3C2SA 3S36H 4ZG1A 4JM2A 5EIIB 3TP4A 3VWKA 3VWJA 3EUUA 2QBWA 1S8DA 1RJZA 1QLEH 1F90L 3M17B 4RGOL 3VFWB 5L2JA 1CFNA 1S9WA 4ETQA 5GRZA 1QRNE 5CD3B 2BP3A 2CK0H 3EYQC 4XPHL 4LLVB 5HHME 1CD0A 3MGTB 4HW6A 4NM4H 3PGFL 5IV2A 3ARPA 3EDEA 3OG6B 4HX1B 1NAMB 2NYYC 2NXYC 2J6EL 1TETL 3SKMA 5J1SC 4M6AA 1S5HB 3T0EA 3HMWL 1NSNH 2OSLA 4LLDB 3QIWC 5HGHA 4YGVB 1MCBA 4LCWA 3DNKA 4ODTL 4JM2C 2VJXA 5DA0B 5LXGL 5H2BB 3U79A 3MJGX 3O3EA 2HVKB 5D5MB 1I1FA 3X14B 3ZSTA 2ID5A 4FZEL 1Q9WB 4XPFL 4U1SB 1RJYA 5JR1L 4PG2A 3V7AE 1HOCA 3K1DA 2PO6A 5SX5H 4MXWH 3UTSD 3CX5J 5DWUH 1DBKH 4ZAKB 4DOHB 2FX9H 3X11B 4OT1L 3RKPA 5EZLB 3RIFF 2P8LB 4PJAE 4FQQB 1B90A 3T77A 3OXSA 5E2JA 4IRJD 2YZ8A 4OCSH 3NBNA 3KXFE 2B20A 1C08A 1BJMA 3BAEL 4YDLC 5I6XC 1XGUB 1URLA 1UWGH 1OW0C 3DXAB 2QEJA 4I9WD 1IQDA 3MRLB 1B3JA 4H8WC 1GHFL 3OKLA 4PREA 5CD5C 2JIXD 4PRBB 2CKBL 2FGWH 5CUSL 1AI1L 4BFEA 1G7PB 5HYSA 1JNNL 4YEEA 3TH2T 2VLLA 4CMHB 5GRXG 1QSFE 3ZKSD 1B88A 2FBOJ 1K8DA 1I3VA 1G7MA 3X3GH 4DVBB 4LP5A 1KF9B 2DJSA 5BVJB 1J8HA 1L0XA 4G6AD 3VXRB 4HBQA 2Q8BH 3RGVB 3U0TB 5E99L 3V4VL 4WENB 4N0FB 1BZ9B 4CUCA 1T2QH 2I07A 2UUDK 4OFPA 4IDLA 4KI5F 1P4LA 5CLWA 5F93C 3RNKA 3L6FB 4IHOA 1YEGH 4GLRI 2J6EH 3DROA 3DVNA 4HJ0C 5DQ9B 4DUVA 3MRGB 1S7UA 2XQBH 3AB0C 2X4TB 2DQJL 5BV7B 5ITFB 5L2KA 3WFEH 5D5ME 4LPXA 1BX2B 3CPLA 3GKWH 4GW4A 1OLZA 1RZGB 1MCIA 5A43C 4OFIA 1F90H 2YD9A 3KPPA 3ZTJG 3T0WA 4M62L 1QSEA 4G8GB 4LPCA 3P77A 5GHWL 3WFBL 1CBVH 4OV5B 2W65B 2I9LB 1E27A 3OR7A 3QCVL 1KN4L 1NGWB 3TLRA 3LCYA 2C1OA 1IGCH 2Z4QB 3T0EB 5DQJB 3GRWA 2GTZA 3NCYP 4TVPH 3KXFB 5EU6B 4U6VH 5DJXA 1ZLWK 3WDIA 2OQJB 3L3OA 4Y5XA 5GSVB 4QT5B 3ROOB 3ULUD 2AABH 3REVA 5D2NA 1OAKH 4R9HA 3F7VA 3PWNA 3O2WL 5TPWH 1P9MC 2D7MA 2A9MH 1R24A 2VXSL 2CLZB 3BGFB 2DQGL 1FORL 1YPZF 5DYOB 2IPTL 4FQIL 1J8KA 4A6YH 4LCCB 3CK0L 4DEPC 2QSVA 5HYIA 1DUZB 1MVUB 4KV5E 4QHLA 4LVHC 4I0PA 5IVZB 1D5MA 4L4TA 1YEIH 5I1AB 4FHBD 1J9CT 1NAKH 3ALWA 1C16B 3E6HA 4NZUL 4UZGA 3ME0A 3D3VE 3BZEA 4JO3H 1EGJL 4Y16C 1CT8B 1R3KA 5BV7L 4BUHA 5IR1B 3MRMA 1WWAX 3OAZK 1CFBA 4NZRH 3BKCL 3QXUA 5C09D 3UYPA 3FN0H 4WNQB 2XZAL 4H5SA 2OJZH 4PRPD 1NMBL 3WUWB 4X4ME 5L2KD 3T2OA 2XY1A 4H20L 4KI5E 2QSCL 4DGYH 2BNRA 4IDJH 3V0WL 1LDPL 5E5MA 3LRSB 4WHYH 2Q8AH 1JNJA 5FM5M 2DIAA 1RK0A 5FO8A 2CKBB 4X6DF 4QRQA 1I7RA 4V1DA 5D8JH 1BQSA 5IFHH 4Z8FH 1I3UA 2ADGA 3DV6B 5B38A 4NN5C 4Z7OF 4YDJA 2BXZA 2FEEI 1S7RB 2C26A 4KTEL 3W11D 1KXVC 1CTOA 1AGDB 4DKDC 4HZAA 5SWZE 3PWJB 4KTDL 1PZ5B 2PR4L 3BQUB 2J4WL 5C2UB 1AKJB 3BIKB 3VXQA 5DEGA 1K2DA 4KVNH 1XCQB 2GJ6A 3NN8B 2R4SL 3UTQA 4XC3L 4Z7WA 5E2WL 2VDLL 1RUKH 5D1QC 2BNUA 1HDMA 3P4OA 3UYRH 3W9EA 3QEQD 3MCG1 4NJ9H 3MRIB 4H0IA 5I19L 3D3VD 4OCRH 4C56A 3KJ6H 4GG8A 2B1HH 3UXFA 2VXSH 1A7RL 1P7QA 1EH9A 5E7BA 1ZA6A 3TH3T 1F11B 5FOBB 4QRUB 5D2NE 5GHWH 1MLCA 4YR6B 3H9ZA 4MNQB 3Q3GB 4P59L 3MLZH 4O00A 1WTGT 3LKOA 5C0JA 5F1NB 1L6XA 1SMAA 2DQUL 2Z92B 5FUCC 5AYUL 2EDBA 2VXUL 1G7LB 3MYZA 4P46B 3WNLA 4ETYA 5KAQG 5DGRA 2AI0L 4PUBH 3KPTA 2J8UA 1QFWH 3DURB 5SWSB 3R06A 5JA9A 1JZ5A 4ZPTA 4XPBL 3EJZD 1CFTA 1BQHB 4NWUL 1NCTA 1CU4L 4WW1B 3L5XH 5DJ2A 4N8VG 4HKBB 1IC5L 3SGDH 4H1LH 2O26U 3F7QA 3T3ME 4QY8B 1LGVA 3QUYC 1AGDA 3F58H 3BDBA 1T66D 3IXTB 4YFDB 1RVFL 5CBEB 3I9GH 2OTWB 3E3QC 5DSCA 2QSQA 3SCMA 5ISZB 1D7FA 1IAOA 3A67H 2DM7A 3QHZH 3BKYH 4YDJB 5L8LB 2FBJH 3BGFC 2PF6A 2VSCA 3AY4C 4ZS7L 1CICA 2VLKB 5FYKE 4UTBH 1GIGH 4M48H 4DVRH 4JJHA 3MSPA 2ILLA 2XZAH 4F7MB 1CGSH 4XP6L 2ZUXA 3BP5A 4K8RL 1CQKA 1LO2L 1R5IA 4I3RH 4M61A 3G04A 3VXRE 4P49A 5FGSA 3ZE2F 3THML 5DJAA 4QXUL 1MF2H 2X4SA 1GYAA 4X6CB 3LRGA 4E41B 4KJYA 4R97B 2VYRE 4X5XB 4OLEA 3QH3A 1G1CA 2Z35A 4WUKH 1SEBA 4KVCL 3QXDB 4JZJA 2BY2A 5CEZE 3WNMA 2C4FU 2ZUWA 4J4PC 1WWBX 3EO0B 1RUML 1C1EL 2VDRH 4O2CA 4YK4C 4B50A 4YBQD 3G5ZB 3PHQA 1JGUL 1ZLUH 1KPRB 2XQYK 1HXYA 3B83A 1MCPH 5CZVL 2WINB 1EO8L 1AJ7L 3O8XC 3S88L 4DK6A 2EIDA 1XIWB 4JRXE 2J8OA 3HC4H 4RGMC 3S3JA 4LBEB 4TNVF 3NIDE 3S35L 1MNUL 3TYGL 4KRPB 4J1UA 5IUSA 3UX9B 5FYLL 3AUVA 1MFAL 2Y06L 1MCKA 1IAOB 3LS5H 4U4BA 1LE9A 1X5XA 2IFFH 4AK1A 4Z7UB 4U0QB 4Q0XL 5J06A 2YBRA 4F37K 4JFQB 2UZXB 1M71B 3NZHL 4PGBA 3QIBD 4LKCB 1KBGL 4Y19E 2MKLC 4J3VA 4S1RH 5CJ8A 1AE6H 1YY9D 5F6HJ 3BJ91 4I0KA 4MJIB 3QUXA 3P11L 1PSKL 5E7FA 1BIIA 1F2QA 3LN4B 2LABA 5BRZB 4UT9L 2FZ3A 3E3QE 5HVGB 2YEZB 3MNWA 4E41A 2VDKH 1D5ZA 4TULH 5JTWA 4A6YA 1EERB 3LKSB 4DFIA 3O8XD 5KVGL 1UM6L 3MPCA 2CR3A 3B5HA 3NABH 4B41A 2VXTL 5DFWH 5K9KA 1P7HL 1CN4A 5LGJB 4OZFH 1MCEA 2XKUA 4PJEF 1G0XA 2PR4H 1KCSL 4LEOA 4PGCA 5TH2A 3GUTB 5ITBL 1K8DB 3WS3A 4YQXL 1JGLH 3F58L 1IC7L 2APXA 2WANA 1ZA6B 5FOBA 4OZFG 3EDDA 1MCQA 4MNQE 1YEJL 4NZJA 3KYAA 1OTUC 3GSNH 5EU3A 1SMOA 3D0VA 3PJSB 1WZKA 3TJHD 1YNTB 1BOYA 1KFAL 2HT4C 1BBJB 1PZ5A 1D9KC 1NCUA 1W8NA 3EYOB 4PJDB 3TVMA 4OTXH 2CMRH 1R5WB 1C08B 5IESH 1K85A 5DYOA 3RI5F 2B0SH 3ARDC 4P2QD 3ZDZF 3K0WA 4BH8B 1DEEA 2X89A 1ZANH 3E8UH 1LVEA 1JRHI 4Z7UA 4QXGL 5JOEA 3S9DB 1A4KA 4U7KA 3ILPA 3QIWD 3WLBA 4U1NA 5LBSH 1FG2A 3AREB 5IVXB 4IRSC 4U1KA 2Y5EA 5IHUL 5IFJA 3PDOA 3DX7A 2WBJD 2ADFL 3GSQA 3OPZH 1N8ZB 5IEHB 5L8KB 5ILTH 2IQ9L 2R0ZL 5MEOB 1FFNB 3QEQB 3SGKA 2GW5A 1F02I 4J6RL 1X7QB 1FYTD 2GJZB 4DCQB 1KJ2B 4LOUD 4JZNA 1QLRB 3BP6A 2VAJA 4Y4KB 2AQ1A 3TGXA 1XZ0A 3QT2A 4D3CL 4O9HL 3O2DH 4G3YH 2V9QA 2XXCB 3BQUD 2WMPA 5LGHH 4HH9A 5FXCH 3TA3B 4HIIA 4MD4A 4HHAB 5CEYA 1K8IB 4K71C 25C8L 2VXVH 43CAA 1QSVA 4L4VE 4QHUA 1YZZA 1KN2L 4FQJL 1YEFH 5KTEL 4GRLC 3SKUD 5CFHA 4P3CH 2GKIA 1Z2KA 1F45A 3QPQD 4XVJH 5KANI 4Q6IA 2FATL 3O3DB 4PJEE 4UNVA 4NP4L 4MJ6A 4DN4H 1Q0XL 2VDMH 3OKDB 3SDDC 4P4KB 4WCYH 4QXTA 3W5NA 4HLJA 2VLJE 3HE7D 3E2HB 4KGLA 4G7VH 5TFSH 1Z9LA 4GRLD 1CDCA 1DQLL 4RGMB 4DN3L 2P5WA 5JQHC 4OQTL 2JJVA 2YSSA 3ZDZE 1S9XB 1RD6A 3O4LB 3WFDL 3OR7B 1B4JL 5FYJL 1CD8A 3BKCH 4OCMC 3TIEA 2AXJA 5C07B 3H9SB 4X99B 3GBNH 3CDYA 5GJTL 4Y4HA 4P9HC 3RX8A 3JWOH 4OGYL 4X5WB 2ITDB 4KZEL 1XGRB 4YHNB 4NO2A 2C1PA 5L8JB 1D5IL 1BGXH 1SBSH 1U3HB 4NO3B 2GJ6E 2FD6H 3AMLA 4L9LB 4XXCC 1JZ4A 3IJYB 4KC3B 4D94A 1YNLL 3QEUB 1ZHLB 4UIKH 3CCHA 5DUBB 4FXGB 4GG6F 4ZUUA 3OF6A 1RZGA 4JPVL 3U9PH 1VADA 1KJ2L 2BVYA 1A4JB 4ZPTB 1XCQA 1XFPA 2HKFH 4HEPG 3QNZB 2D7PA 2JJWA 1J12A 1ZS8B 1II4E 2HN7B 1G7JA 5F9JB 1OTSC 4L4VD 4N0FA 1U3HD 1NMAH 4QRSB 3NIGE 2R4SH 1CDJA 3L6FA 2Z8SA 3MACH 2OYPA 4KK8C 1J0IA 4YUEL 1H0DB 1KJVB 3MLSL 3FO2A 2NY2B 4XHJC 3EGSA 3WKNA 1MI5D 1XGQA 3VRLF 3GHEL 2B0SL 3L7EB 2JF1A 3C5SA 4LSUL 3JUZA 4PRBA 4GRMA 1JJUA 2C3VB 2F54E 3HB3D 3PGDA 5K9KB 3N9GL 4NZRL 5FHAH 5D1XB 3RIFK 4NGHL 3CXDH 1N26A 2CRMA 4JPKH 5TQ2L 3R1GL 5HYSB 3FQNB 4JFOB 4JPWH 4OF0A 3BPLB 4I3RL 1N4XH 4MD0A 1YN6B 2VIRB 3MBED 1FL5A 4JHZA 1MWAH 3SDXF 5IGXL 3D0LA 4PGJA 2NXYB 4WUUD 3FQXB 4E5XA 2R1XB 4M48L 5GGVH 5A16A 5D71L 2QR0B 2Y6SD 2R2EA 1E4XH 4NO0A 2SEBB 5TQ0H 2IG2L 5J7CC 3BQUA 4MJIE 5EIIA 2CLRB 1EIBA 1FP5A 4G6MH 5LGHL 3CFJA 4M7JH 4JCMA 4AEHL 4X7FC 5IB2A 2FGZA 1BGXL 1U41A 4UQ3B 1WISA 5CJQL 2E7HA 4NDMB 2YA0A 3F6IA 5F6IC 4XP5H 4WO4B 1MPAH 2VUOA 1M4KA 1FYTB 3UPRB 1MY5A 1G6RB 4WTZG 4PJAF 3UO1H 4XWGH 3NGBC 1L9NA 4YHIA 4K71B 4Y7MA 3B9KB 5EOTA 1SVZA 2X42A 1IEAA 2R4RL 1ZGLB 5JOPE 3HNVL 4WNQA 1DBMH 2OL3H 3FOMB 4LIQH 5GRJH 2F58H 3EYSH 1E27B 1JCKA 2VC2L 4ZSOB 2PO6D 4L29B 3RUGA 5IV2B 4HJ0D 2F19L 4XP4H 4NRZA 2AJXH 5KSAA 4DQOL 3HUJF 4MA1C 3QJHA 3LKRA 2Y9RT 1RUQH 4NQCB 3C6SB 3S36L 1FZJA 2R23A 3CFKB 4LSUH 3D85B 1NFDB 4K2UL 5DEFB 3UTSB 1G9NL 4U33A 1QO3A 1FN4A 3QUYD 4PTTB 4PGDB 4ONHA 6FABH 1OSPL 4XMPL 1IBGL 3RWHA 1S9WB 4ETQB 5D72H 1YNLH 4ONHB 2BXYA 1WF5A 3MRGA 1QBMH 4I5BB 3QEHB 1SBSL 2Z93B 2AVGA 3QI9A 5DMIH 1K5NA 4Y4FA 2EYRA 1IAIH 4B0MM 3FO9A 3BDXA 3VXMB 4TNVK 4OLZL 3PF2A 1A6VL 4IIQC 4TSAL 1MELA 4OB5H 2XT1B 1U8MA 3LB6C 3B6SB 3I9GL 2BSRB 2ZUVA 2IH3B 1A6AA 1C5CL 4OUUB 3BDYH 1I8IA 1RUAH 3IDJB 3ZE1E 2IMMA 5E8PA 4U6VL 1FLRL 2HH0L 1ZV5A 3MLYL 2APTA 4PJIB 2KQMA 4H8WH 4NQVA 4DGIL 1VPOL 5CJ5A 2QHRL 5D7LB 4H25A 5KANG 5J11B 4LQFL 5IQ7H 3FB5B 1MREH 2E27L 4OZIE 3BZFA 3SCMC 4OZ4A 4M6NH 3ECBA 5IHLB 4L9DA 4NZUH 1HEZA 4BELD 4HIJA 1QZ1A 1YNKH 4FXKA 5CGTA 2LU4A 4S1RL 1S8DB 1F4XH 5KVEH 3VWKB 3MV9A 1IARB 2P8LA 4XP4L 1LDSA 4LU5H 3VJ6B 4JDZB 2VKXA 1HILB 4Y8AA 3ZHDA 2BSTA 2GSIB 4BSJA 2E9BA 2L4OA 5I74C 1LILA 4MNGE 4XBEH 2A38A 5JHDE 2RJMA 4OGXL 2DQIH 3VD3A 4NYLA 4HPYL 1VGKB 4XCCH 3P4LA 5LKNA 4GMSH 1M1SA 5DJCB 2CGRH 3E2HC 1C5BL 5DA4A 5D93C 4JFEA 3LKNA 4M93C 4MDIB 4JFEE 4UTAL 3HE6A 2JJSA 2VLLB 1PKQE 5IBTH 4MD5A 3UPCA 2ADFH 4X9HA 4X5WA 1NC2A 5H37H 3ZHLA 3C2AL 4UAOC 1U8KA 1HINH 2ARJA 3GMMA 4LLQB 1A1OA 3GMRA 2E7BA 1Y18A 2HTLC 5HGAA 2BJMH 1LK2B 3IDMB 4BQ8A 5MHSD 4P57B 3VXUB 3QG6B 3WFZA 5CSGA 2OK0L 3SKOA 3MLRL 1WLHA 1BLNA 3QFDB 4LLVA 4N0CC 1U92A 1WAAF 3S6CA 3LQMA 1P84K 4K23L 3QQ3A 4CVXB 5F9JA 3P2TA 5HDQH 3OHXB 5CCKL 3RX5A 1KLUA 3NCFB 1AXIB 2EKSA 4JANA 3RZCD 1U8JA 4G9DB 3KJ6L 2C7UB 3BYYA 2L7UA 3WIHH 1U2CA 2J7LA 1P6FA 3B4NA 8CGTA 5I0DA 4NP4H 4LASH 2LU7A 5T3XH 4K7PH 3OJMB 3O3EB 2E9IA 2EXWC 3QI9D 1TZIA 5IIEB 3VXMD 3FFCA 4KZDH 3H42L 4D8PB 4HJJL 3VFTB 4OCSL 4G7YH 5GGSY 5C07A 1E0OB 1JI1A 5DURD 5D1ZD 5E1AB 2BSRA 5C08B 1V3MA 4N90E 4PFEA 4K94H 1U8MB 1ZSDB 3ROLA 1CYGA 2YMXL 3MFFB 4LSVH 3RFZC 5FUCE 2GHWB 1F4YL 1NC4A 5GJTH 4JRWA 3DROB 3DVNB 4KJQC 3UDWA 3PL6A 2H1PL 4UDUA 1N5YL 3RL2A 5C0EA 3SE3C 4KDWA 4XAWH 1E4WL 4PYHA 3W0WD 3BGAA 1BD2B 2VB5A 3MRBA 4C54A 4NQSA 5HDOA 2IFGA 2YN3A 4NCC1 4PGDA 5KG9A 3QSKB 5IMKB 1MFBL 3FQTB 43C9A 3VI3F 5DD1L 3LV3B 3BXNB 1KV3A 1Q94B 1VEMA 2PW2B 1K9TA 3EJYC 1RMFH 3MLVH 4G6KL 2DI7A 3GMMB 4LLQA 1U95A 3Q6FA 3RBSA 2D0FA 4FZEH 3T1FB 1OGAA 3BMWA 4ODXA 1QSED 1MFAH 2C1OB 1SJHB 4R26H 2H26A 1BVLA 5IMLB 1NGWA 5J6HB 4ENED 4DKEH 2QTEA 4X6EA 1TNMA 5GRUH 4ELME 3Q1SL 3MRLA 5D7KE 3TBTA 5EDXA 4BQ6A 1D9KA 3HE6B 1BWWA 4J7RA 3G6DL 3ZE0F 4MVBD 4I8DA 3I6KA 4R7NA 1NCWL 3J7HA 2X4RB 4KRNA 4WV1B 4P2YA 1QYGL 2G5BA 5I73C 3OAUL 2W0FA 5FEBA 5ITFA 1FNLA 2Y25A 3O2VL 3VFPA 3GB7B 2Z31B 2KBGA 4XNUH 5T5NF 3MRJB 4Y1AE 1VFOA 1V5JA 3MO1A 2DYPB 1MHHA 1OSZB 3C60C 3TH4T 4MA7L 5F9WC 4QRRA 5D1QB 1UA6H 2BOCB 1ZHKA 2R1XA 3IDXL 2RB8A 3NH7L 4UBDD 4UT7L 2GSGA 2J8HA 1CG9A 3RDTB 3ZKND 4YHYC 3L3JB 5E8PB 4DWHA 2G60L 5AZ2L 1I8IB 1K3ZA 3N1PC 5HHOB 1JF1A 3RVUD 3EAKA 2FLBT 3JV4B 4NRYA 3SGJC 2WIIB 1AE6L 1XGTA 2BVOB 4YDKH 1LE9B 4R6UA 2PYEB 5KVFH 3PE9A 3MJ9L 4PGCB 4HFUH 3BEWB 3BHBA 1IKNC 1U8NA 3VWKD 4F58H 5DD3H 3PNWB 5HGGS 4Y4FB 3VFWA 1AHWA 5DHYA 1AY1H 1S3KL 2OCFD 1IZKA 2VLJA 3MLWL 3QUYB 4D3CH 2NX5A 2V5SA 5HHMB 1CK0H 3NFSH 5C0BA 4GAYB 1KJ2A 2XFXA 1F8TH 2KH2B 1MFDH 4N9OB 3WN5A 2HFTA 3D25A 2CJUH 4A2MA 3WSQL 5I1EL 4ZAKA 5BRZA 3SO3C 1FGVH 4CVWA 5BO1H 1KTLA 2EE2A 3L5WB 3P73B 5C6PB 3TFKD 1M7DB 4FQ2H 4PLJD 4Z95H 2HYMA 5EIVA 1Q9KA 1JGUH 4E0RB 2Z0BA 4IM8A 1YY8A 3SO5A 4ZQKA 3B9AA 5EZOL 4F15B 3HAEG 1IBGH 4KROB 5LAXB 4JPIB 4BQCA 2FJFA 4CAGA 3QCTH 4WW2C 2DLFH 2FHCA 4GG6E 3TN0B 1F6AB 4L8SA 4ONGH 3DX9A 3HMXH 1JF6A 4KROD 4F7MA 3HZKA 4QRRD 4YHIB 4LDLB 4MJID 3JWOC 5K9QG 1RZJC 5C09A 1S9XA 2JELH 1ACYL 5EU3B 5D2LB 1KUMA 1UZ8B 2YXMA 2GT9B 5GRVK 4Y2DC 2ZCKL 4P48A 3SE4C 2BHYA 4HKZA 4PY8J 5D9SA 5T3ZH 4OLWH 1D3CA 4AM0B 1HYRC 1RK1A 1RUPH 4ZUWA 5B4MD 3G6DH 1JTPA 4OZHF 4G7YL 5BS0D 3VWJC 3AY4A 2JB5L 4Z9KB 1F4XL 5CAYB 6CGTA 5ICXB 1NGPL 1HHGB 4PRIB 1H15B 2GY5A 2AEWA 5KVGH 1N6VA 3S35H 4YEFA 2DQHL 2OI9C 4H26A 2BVQA 5ENWA 3BGMB 3MOQA 4YXHL 4CKVX 4X4MA 1NQBA 4NKOA 2WBJC 2CK0L 2DWEB 4CVUA 4JREC 4IRSD 1P4IL 2PETA 2Z92A 3EOAB 3J8F7 4GKNB 4HWEL 2DLTA 4HUWB 2HJLA 1HSBA 3DETD 1I8MA 3O8XA 3QDJE 4HFWB 4KJPD 5GS1C 2NY4C 4R0LC 2MHAB 3WUWG 3I02B 3L5IA 5I1HH 1UXWB 4L3EA 4PGBB 4LLWA 1K4CA 2A1WH 4HS8H 3IF1A 4JN1L 1P84J 3GSXA 3UROR 4J4PA 1MJ7L 2C3HA 4ONGL 5CZVH 3UYRL 1EEYB 5BJTA 1A6ZB 2F53B 4F80A 3TNMA 1C5DB 3W9EB 4BZ1L 1A7NL 4UU9A 1A64A 4OV6F 4PJ7A 4JHWH 4Z5RB 4Q97A 3TYGH 4G6ML 3LSOA 1IEBA 3TZVC 4G6FD 4JAMA 1R5WA 4KAQH 3WO4C 1UVQB 3MRPA 1BJ1J 1FNHA 4G8GE 3VXQB 2H32B 3DV4B 4AZ8A 4F3FB 5F6HI 1IGJA 1ONQA 1A8JH 2DLEA 4NN7B 2ESVA 2Q86B 4UIMB 3DI3B 1XGYL 4O58L 5IROA 1QHPA 1WBZA 3RU8L 4DZBA 3H9SA 3ZKXC 1A14L 3FB6A 2A83A 1FH5H 3WS3B 5GSRA 5IK3A 4HUKB 5GGRB 3VFNA 3FZUD 1DDHA 4KJYB 3WL9A 3FN0L 4PLJC 1M05A 4NM8L 1N5AB 3QUMA 4YAQB 2FJHB 5DMYA 2GK2A 5BMFH 2VZ3A 3ULVC 3LQZA 3SE9L 5A3IC 3QHZL 5IVNA 4OAWB 4XPGL 1KB9J 1U6AH 1T0MA 1HN1A 2FX9L 1WV7T 1BAFL 2FEEL 4X5LA 3EZJB 5I1AA 1JF5A 3AM8A 4JQVA 4HIXH 4ORGA 5ITBH 1RY7B 5D72L 3O11B 5I2IA 4Z77A 4MJIA 4XPTH 4XRCA 1CVSC 1HKLL 1SYSA 3A6BH 4YHLL 2O61A 4RSVA 2R1WB 1N6QH 3WHE1 4S1SH 2PCPB 3QO0A 4GUPA 5F3BB 1ED3A 3FQRB 5HVHC 1NAKL 5EO1A 2DDQH 3SHSA 5DRNB 1T89A 2VWEE 1YC7A 4ZFZA 2XN9D 2WBJB 3TCXA 5JUEL 5JDSA 3IETA 3I2CH 5I8EA 5F96L 5JW4M 4NGHH 4PRNA 1AKJD 4RMRA 2AEPL 4UB0L 2BNRB 1J8HE 3OJVC 5FFLA 1WT5C 4BQ9A 1AIFA 2QKIA 4QOKD 2OXHA 2BMKB 1D5XA 4IRSB 4U1HA 4JEGB 4NN5B 3KGRA 1FVEA 1XIWA 2HJFB 3O45B 1U92B 1U8IA 4F9PA 3Q5YA 3E8UL 3T8XB 1F5WA 5LVEA 4G8EB 4HC1A 4MZ2A 3NCBB 3RUGE 2AJYL 4NO5A 3QDMA 5HHQB 4QO1A 2LV4A 2FECL 1YMMB 1OAZL 3P4MA 1T22A 5BXFB 1DL7H 4HUNB 5DZNA 3QZWA 1AO7B 1HH9A 1HZHH 5L0QB 4WTWA 2DBJA 1KCUH 4RMWA 1OOAA 3BFOA 3GSNL 2P5ED 3UO1L 2CPCA 1MFBH 4XMKH 1KCRL 2H32H 3WNOA 5CSZA 2W07A 3QB7C 3CFEB 4WHTA 3TBSB 3O2DL 5B21A 2WWMD 1U6AL 1JUFB 1QRNB 3BDYL 4OTXL 3KPRB 2AKRA 4MWFA 5GGTL 3RGHA 1A1NA 4LFHG 2K3TA 3L3IB 1WWWX 1TITA 3ES6B 3RGVA 5INCA 2R1YA 1XCTA 5DJ0B 3SDCC 3O4OC 3BN3B 3DPBA 3DSNA 1XGTB 3EJYD 1J10A 2EE3A 2OZ4A 4P5MA 5CHNB 4ZAKC 2W92A 1CF8L 3IFLH 3QUKB 3VXUE 3IVKA 2BOBA 5T1MB 3U6RB 2YUWA 4P46C 5IGXH 2OX5A 3SJVB 3EJZC 5IF0A 4O2EA 4BH7B 3W81A 3FB5A 1SY6H 4H25B 4X6BA 2VXTH 5E1AA 5C08A 4ZS6D 3LHPL 5IQ9A 4QRPD 1EAJA 1DVFB 3ALPA 5FYJH 1INQB 1ITCA 2AXFB 4RRPG 4D0CB 2AJ3A 1QPPA 1FYHB 5DJ6A 1Q38A 2AJZA 5CJXA 5E8DH 3QG7L 4HCRA 3O2DA 3CH8A 4B53A 3LRHA 1C5CH 5C08D 3FOLB 2VLMD 4PRIE 4LHUA 5F70A 3RJQB 5IR1A 4CW1A 4PJAB 1S7TA 4OD3H 1MI5A 3O6FB 1ZVSB 3HKFA 4NNPL 4MYWB 3T1FA 3DOSA 3V0AC 2VH5L 3HR5A 4G5ZL 4YDVB 3QDGA 5DF0A 3HZVA 4PJEA 5ALCL 5F8RC 4NQDA 3BYTA 4QEGA 5TDOA 5BVJA 3ISWA 4JANB 2BNQE 4MA8H 2X7LB 4LK4A 2HT2D 5I1IH 4XPTL 5IMMA 2DQFB 4UOW0 1UB5B 3ARXA 3DLQR 4GH7B 4WEMB 3DVGA 3I2CL 3BKML 2YD7A 2HP4A 3VFUB 1R24B 4NQDD 5E99H 2EKJA 5HI5C 3AXLB 3QA3B 4P2RD 4XPFH 4BKLB 3PHOA 3HFML 2DQEL 5CS7A 4RNRA 1NBVL 5E6YA 3BRGC 1YEHL 3DHMA 4NKDA 1Y18B 1CGTA 3D48R 1F3JA 5I18L 2BY3A 1UYWL 4OD2A 2PTUA 4LCCA 2OMBA 5F88B 5FF6B 5AUMA 2VR9A 3SY0A 5HD8D 4LFHD 3HLAB 3MLZL 2Y36H 4P3WA 4U1JA 4FQ2L 5DHVA 3UBXG 2JCCA 1RJZB 1BVKB 3DSFL 3MBEB 4NFCA 3FN9A 3GBML 4LAQH 4XVTH 2R4RH 5TQ2H 1T21B 4ALAL 2VDRL 1SY6L 2UVEA 1S7WA 5KVMC 1T0NA 1MJUH 1BQHG 4LNRA 2XN9B 4OIIL 3VXPA 3H3PL 4KUCD 4XI5D 2NY5H 2LTQC 2Z9TA 2LE9A 2EC9U 1X5HA 4FQJH 2VQUA 5I1DB 4Y16D 1ES0A 4RA3A 2ENYA 1UH4A 1VFAB 1MHPL 3P77B 3IAQA 1UZ6E 2A6KB 5I8CA 4UQ2B 5K93A 1Q72H 2G2RB 1WZ1L 5DHYB 4WFHD 4NQCE 4GXVL 5ESQA 4NO0B 5GGTH 5HYFA 2WWKO 2QR0A 3FRUA 1YEKH 3QNYB 3BPNC 3P30H 4E41D 2DIBA 3RA7H 3ESVF 3QG6A 1IQWL 4MXWL 1I75A 4PY7A 3AROA 5ANMB 1C16A 1J88A 1FRGL 1CFTB 1RZJL 3BAEH 3QHFH 5EU4B 1U8PB 1ZTXH 1G7IA 5JQ6H 5E94A 4O5LL 4DZ8A 3C09B 1X6NA 2X4QA 4POZC 5T3XL 1FL6A 4LPVA 3MROA 5MEPB 3MRDB 5HXMA 3QYCA 3G6JB 1MHHB 4NT6A 3UJIL 3DTXB 5IT2H 1KIPB 4PP1C 3SGDI 4K2UH 4NPYB 3WLWD 1RVFH 2YMXH 1NCWH 1CI5A 1F3DJ 1YEFL 4RRPA 4IRJA 2DQDH 3HNTH 1IFHL 2DD8L 2W38A 3VGAB 2AS5M 1KG0A 3O4OB 1JPGA 4RQQA 1QG3A 1IGCL 1X5IA 2GAZA 4L4VB 2OS7A 3CX5K 4P5KB 3I6KB 3FQUB 3IGAA 5JO5A 5EUKB 1I1FB 4PJHE 3RUGB 4ZUSA 4NN6C 1CCZA 3I3BA 1OL0A 2W0PA 3S3PA 1YQVL 4P4KC 3BKMH 2HFEA 1TVBA 3HI1A 2H9GA 5DD1H 4GBXA 4GKOA 2B8OT 1AIFB 4JM4L 2VQ1A 4RGNB 2F19H 5HHNA 3BPOC 3CMOH 1UYWH 3QFJD 4DKEL 1RZIB 1D5BA 1BMGA 4TOYL 2VR5A 1GZPA 4WUUA 4EVNA 1GVIA 5C9JB 1KNOB 1LEKA 3W39A 1R0AH 4PPTA 1CDUA 1VEOA 3U9UA 3NA9L 5JW4R 1NCAL 4FQHB 3VCLB 1QOKA 4P2QE 3OKEB 1UCBL 3S3SA 3U9UB 4JPKL 1C1EH 2YXFA 3ES6A 3H3BC 2CDGA 3ARZA 4NRXB 1NANI 4KFZC 1DQML 5TQ0L 2AJSH 5KOVC 4P59H 5HGHB 4XZUA 1NGZA 1QYGH 4N5ED 1MRFL 1LEGB 4PJ7F 1M7XA 4FTVA 2VL5B 3CSBA 1FZMA 4LNVA 3CU1A 5C0AD 3FJTA 3K3QA 3KR3L 1CE6A 5FV1L 2NY1C 1FFOA 1AXTL 5F1KC 4NM8H 4I3SL 1EHLL 3NFNA 3ULUL 2Z91B 3ARYA 4NKDB 3KPNA 1NFIB 1I1AB 2XTLA 2EDFA 1K5NB 2DQTH 3VFTA 4ZOEA 4I1NB 4FQIH 1A5FH 2DIJA 5BZDB 2D31B 2VISA 5HI4C 1PW3A 2R29H 5L9DL 5EPMB 2IADA 3B3IB 3EIFA 4MCZB 1FZOB 2A74A 3G9AB 1C7SA 3MV9E 2EYSA 3X11A 2P7TB 3U46A 1AGBA 3TZVD 1HSAA 4S0TD 3UTTA 4CVZA 3GMOA 2OR8A 3UTTE 2FYYA 4EDXB 4HXAH 3FFDA 3HB3C 1YNKL 5DD3L 2FYYB 4EDXA 3LEXA 2JCCF 5HHNB 3ARFD 1FNGB 4XNMA 4JY6A 1KCUL 2NY2D 2IF7A 3MRFA 4M7KL 5DVNA 2EDQA 3V0WH 3ARDB 3VD4A 4ODSH 5HDQL 1T7YA 3BH9B 1NBZA 1UACL 3DYMA 2ATKA 1FBIL 4P57A 2DMCA 4WFGD 5F97E 3LKPA 3MRRB 4LEXH 1U3HA 2VABB 1QBML 3VMNA 3F6LA 4Y4HC 1X5GA 1H8NA 2ESVE 4FQPA 3RY4A 1OTTD 1JPSL 3BVNB 4K3DH 4WUUE 1DVFD 1YN6A 3IF1B 1IT9H 3QDAA 3U2SA 1UJ3C 3BZ4B 4WI8A 4UILH 4FQCH 5J12B 1IC5H 1H8SA 4LP4A 5I1KH 1Q72L 4HUVB 1YJDL 4Z7UF 5DD5H 4OZGE 3B9KC 5LGJA 3ZT5A 4BK4A 1FL6B 2UZIL 3RWCB 4ZXBD 1S7TB 2CIKA 4UV7L 3FO2B 3N1MC 1J0HA 4NNPH 2YD8A 3KAAA 3VFOA 5GRVL 4LLAA 1IAIM 4KRPD 5EA0L 1QFUL 4LRNH 5F7LB 5DJYB 1J05B 5ICYB 2X70A 2ZWLT 3DO3A 3AB0B 4BFIA 1NCAH 1EFXA 3PABB 4ZFFB 5I30H 2EDDA 5GJSL 5B3NA 1T5WB 3FRUB 3QNYA 3K8LA 4J8RB 4XNQB 3UJTL 2FO4A 5D7IB 1AO7D 1NH6A 1REIA 1WIUA 4GT7A 4YBLC 3SGKC 3L3DA 2HWZL 1X5YA 2GAZB 4L4VA 4TN9A 3BH9A 1K4DB 2APVA 5EC1B 5E6IB 4Y89A 4KPHL 3GSXB 3TCLB 1SEQH 1C5BH 2NY6C 4F2MA 4G3YL 1FVEB 1UGNA 3VH8B 3FO1A 5MENB 4K94L 5C0FA 1ZS8A 5FYLD 1OAQL 2ZJSH 1TZHA 3TC9A 3UAJD 1RURH 2BDNL 4LIQE 5F3HB 5C0BD 1J8HD 4WU5B 3KPRA 3AREA 4Y5YA 2NX5E 5E8NA 3ZLQC 4JKWA 2VZ1A 5DD0L 4LL9A 3CNKA 3NAAL 3D87B 5D7SL 2VO5A 5EOQL 3C08H 5DFVC 5I1CH 1CL7L 2NY2C 5LXGH 2JLLA 4ZS7H 1CZ8H 5EO1B 3IDUA 4F58L 5F3BA 2YD1A 5D1XD 3V4UH 3MLSH 3OG4B 1UKSA 1LWRA 2BVPA 1A3LL 2CLVB 2OL3L 5E4IA 3QJHB 1BD2D 1FE8L 4W4OC 43CAB 5FM5O 5KSAB 3CU7A 3WS6C 1FL5B 4O2EB 4KY1L 3RY6C 2YPLD 1HNGA 5GISH 4GG6A 3L3HA 4AEFA 3A6CL 2FL5A 1U91B 3JV6A 4KROC 3IFPA 3LQZB 5EU5A 4JFDE 3QPXL 3OKDA 3TPKA 1CIDA 4JO3L 4MB4A 1T89C 4ZPVB 3FCTA 4HGMA 2WBKA 1VFAA 1NC2D 2DS4A 3KPQA 2WUCL 1DTUA 2FD6L 3JWDC 1JZ7A 4MXVE 4JR9L 1IM3A 3F5WB 4XNYL 5FCUL 5FGCB 1G9ML 1S7QB 2ARWA 5FKPB 2CXGA 8FABA 4GAJL 5HYJA 4PLNC 2PTVA 3NZ8B 2UYLA 1EA9C 1CWVA 4HH9B 3TFKC 2ICWA 4N5EC 1RZ7L 1CR9H 5DJ6B 2O61B 3D69B 2EDEA 4YDIH 5EBWA 3V7MA 4OSUL 5EOCH 1P69B 3MRKA 2R39A 1IAKB 3V5HB 2NY5L 1TDQA 1I3RA 4RDQF 4Z7VF 1W72L 4A6YL 3LS4H 5IW1A 12E8L 3ULVE 4PY8I 3D18B 3VGHA 2XZCH 4Q7DA 1UEYA 2IH1B 1PEWA 3N9GH 4PJXF 1HK6A 4YHZL 5DMGD 1JWUA 1VGEH 4DGVL 4BZ2H 2VE6A 3NTCL 5M7QA 1YC8A 2FX7H 5C0CD 4WHCA 5DT1L 5D6DA 5M94B 4P46A 2OL3A 2WLYA 1A6ZA 2F53A 3EBAA 4TVPD 3S4SG 4W6YB 1MJ8H 2OL3B 4P4KD 1MREL 2WP3T 5SWSD 1ZA3B 5HJ3A 1OD7A 4GRWH 3WXWH 3GZKA 3WIIH 1Q0XH 2BJML 1L7IH 2DQHH 3IXAB 1EO5A 1B6DA 5FM4A 1UACH 4LMQE 2XY2A 2BX5A 4YIQA 5CP3H 1G6VK 4HEME 3WFBH 3ARSA 2YWYA 1P7QD 1CGYA 4NQEB 1Z3GH 3OKNA 1OGAE 4MNQD 4JG1H 3GSWB 2WIIA 2Q8AL 2EDTA 2A0LC 2DWEA 5C6TL 4F3FA 3O3BB 4G80A 4CW1B 3QRFM 5C3LD 3CFEA 4WHTB 4HPOL 1PZUB 1AGCA 1DBKL 3D3VB 5EZJA 5C0AE 2L7JA 1W72B 4JN1H 2N4IA 2YA2A 2EZ0D 1CLYL 4L9LA 3C5ZD 3OWEA 4KVNL 4S2SB 3QFJE 1LO3H 4IJ3C 5TPWL 4IMLA 5IB1B 1IAIL 1B2WL 4HMCA 1DUYA 4POZD 4BSVB 5KSAC 5J9PB 3VDAA 2ZCHL 1RK1B 4ZUWB 3NIGF 1DEDA 1WC7A 2GFBA 4M1GH 5CZXD 4NO5B 3HN3A 3MLUL 4G8EA 1J5OL 2BOBB 1GC1L 3JWDH 3IJSB 4Y88A 4TVPE 2NW2B 4HBCH 4DQOH 3RTQC 5C6WH 4YNYA 3IJHA 5HGBA 1CLZL 3P9MA 4NQXA 4QNPF 1E6OL 1JNNH 2VTFA 2ZG1A 5FYJU 1Q9OB 5C08E 3MRRA 5K9QI 5GISL 5EZIH 3BD5A 2EEAA 1CXLA 5CEXA 3GJEB 5IB5B 1H3VA 5IB4B 4RFNC 2OJZL 4H88L 4ZTOL 1F6AA 4L8SB 5ENWB 2DQUH 3ZMRA 1DSFH 1FH5L 5DQDH 2YPVL 3STZB 5F9AC 5CSZB 4P3DA 2D9QB 3HG1E 5F96H 3FB7B 1ORQA 3OKKA 4PRIA 3STZA 3STLB 3GI9H 3NCJH 3SE4A 5EIQA 5E6IC 2NW3A 2FIKA 4Z77B 1BOGA 1UWEH 1S78C 3EYOA 1R3LB 3IYLW 3K46A 2Y72A 1M7IB 1VACB 4IOFC 3WDJA 3VW3H 1EEYA 5C6TH 5JIIA 1JHKL 1OWRM 1A0QL 2V5TA 3X13B 2MNUA 3TIDA 5INDB 2X4UA 2HJKA 1FFRA 1K4DA 4KKCD 5FHBL 3TIDB 1JWSA 5HD8C 3OMZA 4NKQB 2H6PA 3CMGA 5C0EB 2IAMC 5MERA 1OAZH 4WVRA 4AEHH 5HPOA 2OXGA 5DRXA 5E2UL 1ZLVK 3RVTC 4BSVA 4QRPB 4GRWB 4ZYKB 2H2PC 3NMEA 3MNVA 3KNBA 4G8FA 4OGZA 3DUUA 2HLFD 3GIVB 5B8CB 5JPMB 4DN4L 2Q86A 4N0UB 1ONQB 5EH1A 3EFFA 1KACB 1CICB 4MSWB 4ERSH 1B4JH 2YUVA 3UTPD 2IQAA 4OCLC 4P5TB 5HGDA 3RY5A 4L5FH 4ZOAA 3L5JA 1LO0L 3V8OA 1GC1H 1QLEL 5FAAA 2AXGA 2DOCA 3RDTD 1INDL 1KELH 3BW9A 4TTGA 3GHEH 2D0HA 1A6UH 1T3FA 2ZP0T 3FKUS 4POUB 1A3RL 3K2UH 4B5EA 5IKCB 3PWLB 4MZ3A 4Y5YB 5ACMA 3KPRD 1DZBA 5F7EH 4RISL 5J6GA 4TNWF 3MRJA 5D1QD 4P2QA 4U1LA 3H42H 4YHLH 2AXHA 4QNPE 1AD9A 3M8OL 5KS9B 5CKGA 3T0BA 1PEZA 1IKFL 2A6DA 1J0ZA 2IGFL 2XG5A 2V7HB 2AV1A 4LHQB 1N5AA 3QUMB 4YAQA 2ZPKL 4LCUA 1TJIH 2FX8H 1PX4A 3N50A 1J8HB 3LRSA 1K4CB 3L3KB 4WWKB 2HKFL 5CGYC 3T4YA 4OZFB 3JVGA 4XMKL 3I02A 2XZZA 2EIEA 3HNSL 5B39G 4NKOB 3RL1A 4XNQA 1QFPA 2XTJC 4HWZA 5BMFL 4CU8A 1GC1C 4IS6B 4UIMA 4J3SA 3C8KB 3B9DA 2GEEA 2HLAA 1X4ZA 1AO7E 1OGAB 3SDCD 4LARL 3VXOB 3OKNB 3MUGB 3R0MA 3SEPA 3QP3A 1AGEB 4KMLB 4MXVF 3V6OA 2YRLA 2XKSA 1HSAB 1WWCA 5CINL 3GGWA 4AT6B 4OZHA 1ETZB 3Q48A 1KCKA 2UY7A 5AWNL 1TQCB 3EYFA 1MVFA 4PJXA 4ZTPL 4XCYA 1C5DA 4LRIC 4XBGB 2D31A 1QNZL 2VISB 5D2LA 3LH2L 1GL4B 1QFWI 4NC2B 4OD1L 2QKIB 1UXWA 4L3EB 4L9LC 4ODWA 4HZLA 4M6OL 5DQJA 1ZLSL 1CBVL 1OLLA 2F8VA 3LB6D 5FIEA 4JRXB 3DO7A 3FTGA 3U36B 4L4TD 5FHBH 3OR6A 2ZG3A 1JPSH 4K3DL 4OQTA 1PG7X 1KEML 2D03H 1AFVL 1FL3A 3UZEA 1HIMH 2KZ1B 4HS6A 5I9QC 3WNNA 2XOTA 3ABZA 1C12B 3TBWA 3HNTL 5GZNC 4APQD 2WUCH 3RRQA 5C09E 1WBXB 4ZNEE 1V7NH 5GZOD 1D6EB 4FQHA 5ETUA 2J4WH 1G7HB 2ADIA 3LEVH 3BZEB 1EHAA 1H3PH 1ZK9A 1CD1B 3O4LE 1FIGL 4HUXB 4FA8A 1BPVA 3HTLX 1EK3A 3LQAL 1NCDH 4FFYL 4EUPB 2DWDB 4IOIA 1CICC 5F9DC 1A3LH 4CVXA 1GZQB 2RIKA 2R56L 4ZUTA 2A77L 2FL5B 4WV1A 5FO7A 4M6NL 1U91A 4PJBF 5DMJB 2FBJL 2VXVL 2D4DA 2IAMA 3ELAT 2HJKB 5EN2B 1WFUA 3LKOB 3OV6A 5HHMD 1X5FA 3FQUA 4G6FB 4FG6D 4OJFH 1FDLL 3QUYA 4AG4L 4LCIL 4DTGL 1W72A 2WM0A 3KPMA 1R3IL 3DBXA 5E00B 4GMTH 3MLWH 3LKPB 4JR9H 5HYEA 3U30C 5DWUL 1N0XL 2Y4SA 2VLRB 1FNEA 1KIUA 5FUZL 5IW6A 4X0KA 4HT1L 1FGNL 4XBEL 2PYED 2QQKL 3VXTA 1U58A 1XH3A 3N0PB 3ARGC 1ZHKB 3U4BH 3O2WH 4XVSH 4P3DB 4Y1AB 2ERJB 2Z8WC 3REVB 4NCC2 1IGYB 2P8PA 1YY8B 1UQSB 3P3YA 4XCEB 1JPTL 2MFNA 3AS2A 3QDGE 5SWSE 4L3CA 3TN0C 1EEQA 2CDGB 4U0RC 5TE4L 5KJRH 5EG6C 1FYTA 1H5BA 4NQSB 1VENA 1Q9OA 4WO4A 4LVHB 4M3KB 2DMKA 1Z5LA 3QIUC 3HAEB 3IDNB 2V7NB 1KB9K 4UMGA 3S96A 1EGJH 3C6LA 1NCNA 4M00A 1LO4H 1GSMA 1T1YA 2G60H 5AZ2H 4U2YA 4LARH 2DLGA 2GUOB 4R7DB 4X6FB 3V8CA 2XN9E 3GKZA 4W4OA 1RJYB 3VFPB 2CMRL 3A0OA 3IB4A 3I85A 4OIAA 5TFSL 3KPNB 1WC7B 3T0AA 2Z91A 4OCRL 1JP5A 5E4EB 3UTZA 2KDGA 5D5MA 1T5WA 1ZSDA 4J8RA 4WCYL 4X8XA 5DMKB 3GSNB 1J86A 2FR4B 1G0DA 3T2PA 2BFVH 1YDPB 3ARBB 4PJHB 3LS5L 4LDOB 4XCCL 3T0VA 3RPIA 5D7LD 4J2XA 1XR8A 3VMOA 3CK0H 4NC1C 3T65A 4IHOB 3SDYH 3IS1X 3B2VH 4KZEH 1WZ1H 4YHML 3HAEH 1WITA 3K80A 4BFGA 1HHGA 1OTSD 2ZUUA 5IEKB 1BAFH 5MEPA 3VXPB 1B0RA 4NRXA 1FNGA 4XNMB 4BYHA 3U7WL 1I4FA 1DBJH 1KIPA 4JZJC 4LQ1A 4NQEA 2AI0H 5I1JL 4K7PL 1Q94A 1A21A 2HRPL 5GJSH 4H88H 4ZTOH 3INUH 2DYPA 3TBSA 4HS3A 2YPLE 5I73B 4Y1AA 5EU5B 1CU4H 5F6IB 2PN5A 1T5XA 2IG2H 1I9RL 4TSBL 4X4XB 2NY4B 4FN0A 4R0LB 3EYQD 4PY7B 1MCPL 1RFDH 5D71H 3ARUA 5IJVA 4Y5XB 5CILH 2CRIA 1R3HA 3VWJD 1TMCB 3O0RH 3U4AA 1NFIA 3JWDL 5IMOA 2RQ8A 5EUKA 3ZKMD 4TOYH 4NQVB 4OF8A 1NC4B 3NFNB 1KJ3H 1G9MC 1MIMH 2X5PA 1K6QH 3MACL 4K94C 4OZIF 2F5BL 2A6JB 1I1YA 1QA9B 1VFUA 3NCYS 4NUJA 5GGTA 1PD6A 3MNZB 4NQTA 1TZGH 3IDNA 3MRKB 1U3JA 1YUHA 1FZKA 1TQBB 2F5AL 5C70A 2PO6B 1X5ZA 4PR5B 2Z8RA 2NY5C 4ZFGL 5I9QB 4HJJH 3VFRA 5JXEA 4JO2L 2EEBA 5D6CB 2FO1A 1IGMH 3CXDL 1D9KD 3QI9B 5D93B 3V6OE 3WBDA 1E4XL 2WV3A 1UJ3B 3X14A 1OW0A 4Q9QH 1WJ3A 1JRHH 1T83C 4BH8A 3QULA 1OGAD 3QIUB 1D6VH 3ZKMC 5I74B 5C0BB 3KVQA 2ZOKA 3QWOA 3DRTB 5JORA 3I6GA 2AGJL 2Q7YA 5JR1H 3A67L 4DKAA 4LAQL 4XVTL 4KKBC 4MXQD 2XPGA 1NGXA 5D7KD 3ZHKA 1I1RA 1QPXA 1DBAL 4FP8L 3ZDXE 3MOBH 1U8KB 3D2UD 5DLML 5GGVY 3DO7B 4WWKD 5HI3D 5CWSB 4Z0BL 5IF0B 5GGQH 1CDHA 4BSWA 2OZ4L 5HGAB 1LP9A 4P23A 3KPSB 4FTVD 1BZQK 3E6FA 1KIQB 4R3SA 1RU9H 1QR4A 4C83A 1AD0B 3W0WB 2EDWA 3ARGD 2WAHA 4ERSL 5IWLC 1TJIL 2DTML 2FX8L 3HFMH 4MA1B 4M7LH 5KW9H 3I75A 3T0EC 2XA8H 4HKJB 3MUHL 3O6FA 4EEEA 1RULH 2CIIB 1OT1A 4NNXB 2AKRB 3HI6L 1I8LC 1TVDA 1SM3L 3QWRD 4PJ9C 2D7OA 1EPFA 4NJ9L 4G9DA 1IM9A 1BWMA 2DBLL 1A7QH 3BZ4A 3IDGA 3ILPB 4QRRE 3T3MF 3W82A 2HT4D 1ORSA 3S5LA 3REWA 1NJ9A 5JXEC 4KH2A 5C1MB 4S1SL 4XH2A 3HCVA 4WY7L 1CICD 3STBA 3S36X 2UWEE 3C60D 4ZUSB 4G7VL 2JKXA 4HDIB 1ERNA 3QCUH 2WIMA 3MV9D 4BH7A 2VIRA 2C4XA 3QBTB 4XNYH 3SJVA 4EKXA 3QDMB 2KPNA 1HEZB 3GNMH 4N8PA 2GUOA 4R7DA 3FONB 1A1OB 4R4NC 4X6BB 4YHKH 4XPGH 1R3HB 1J5OH 4EXKA 4OQTH 1ND0B 3HPLB 3CAFA 3L1OL 2DMBA 4M6ML 5HTSA 1QBLL 3CVHB 3MJ7A 1IFHH 2DD8H 4L8DB 2X4PA 5IM7B 5CJOL 3SPVB 4L3EE 3CLEH 5KTEH 3C2AH 1NEZG 1BHGA 2CUIA 2VZTA 1AGEA 3H9SD 2EYSB 4YHZH 25C8H 2YRPA 4UDTA 4XXCA 3ARFA 5IEKA 5JXED 3RIAF 3JWNC 1JUFA 4HUUA 3V4VH 3S88H 1JHTB 1BREA 5DJ8B 1LE5A 4LCYA 3MNWB 9CGTA 4KK9D 1XF2B 3EOYG 3O41A 1IL1A 3OKMA 3VA6A 1SEQL 1WIPA 5F21B 1IVLA 2FH6A 1LO2H 1A7NH 3TVMC 4NCDA 1F3JB 2ITDA 1GGBH 2W59A 3C09C 4YXKH 1A7OH 4Q9RL 4FFVD 5EO0B 4EN3B 5D9SB 1IC7H 5H37G 3H9SE 1IE5A 4LCIH 2IGFH 5BO1L 2R69L 3MRHB 1WFNA 1DDHB 4XAKE 3SDDA 2X4UB 2IALB 3R1GH 3S37L 4OLVH 4EQ3A 1NCBH 2HTKD 5I8EB 4MS8D 4JRXA 5HHXL 1J87A 1RZKL 4L8BA 5F1IB 1DL7L 3TEUA 5DRWA 4JVUA 1T0NB 3NIFF 3X3FL 3WLBB 3VFMA 2VDKL 2OK0H 3O3DA 4QRSA 2Z93A 3TN0A 1HH6A 4L8CB 1MI5B 1L7TL 3MV7E 1GOGA 3FT2B 2Y5TA 5I71B 2NR6C 1S9VA 4EQ2A 1HXYB 3QIWB 3QRGH 2UZYB 5CJQH 5JPNB 3G5YB 1T6VN 4L4JA 4DGVH 1J1PH 2UZIH 4KQ4L 2NY0D 3BP4A 3AGVA 5FYLH 1T1ZA 7FABL 4HZLB 2R8SL 3ILQD 4YC2B 4X9GA 1PY4A 4RQQB 2FLRT 1IGML 1S7XA 5ILTL 2ORBL 4XP5L 1JK8A 2VZUA 3VXSB 3NACL 2A9NL 4WHDA 4BZ1H 2QQNL 4K9EH 4XCYB 5INDA 2XQBL 2YRZA 5MEOA 1FO0B 2H8PA 1N6QL 5E08L 1S7SB 3DTXA 4EJ1C 5D1ZA 1F13A 2BCKA 1FBIH 3LDBB 4WU7A 2WK2A 1BQUA 1BFVL 4ZFOA 5EOTB 3L3KA 4WWKA 2HFFA 4KK5D 1NAML 4YDVA 1YEDB 1G7HA 2ADIB 4JFDB 5ADOH 1D6EA 2BSTB 2GSIA 5IROC 2HN7A 3MXWL 3SOBH 3FB7A 1NUFA 4NDMA 5KJRL 4AYFA 1HQ4A 4HWZB 1GGIH 1MCLA 1D5ZB 4G80B 2IJ0C 4ODHH 2O93L 3GSUA 3HE7B 1KCLA 5MI0B 4QY8A 2VDOL 3CXHJ 1FHGA 4MQXC 1P4BH 3TZVA 4OLVL 1X5AA 5BV7C 4H1LA 5HPMB 3FT3A 1KPUB 2W91A 4YQXH 2BC4A 5GS3A 4YHNA 1XF3B 4OZGF 2VN7A 4EI5C 3QDHA 4NN6B 5HDBE 3EFDH 4O4YH 3U4EB 2R0LH 4HBCL 3FQNA 4JFOA 1HNFA 3EOTL 1U8IB 4EI6B 4WJ5B 2NX5D 4N8CH 1MHCB 1KJ3L 1UT9A 3UEZA 5B8CA 2OJEB 7FABH 1GGBL 4G8FB 4MHHI 4Y4KD 5KSVB 4AG4H 3MCLH 1DQDL 2J8UE 3OZ9H 5E2VH 3MV7A 3I50L 4JM2F 4I48B 1K6QL 4X8JB 1OAUH 3LKSA 5KZCD 3TBTB 5EO9A 5F7EL 1QFWM 1I3RB 2QSCH 2ARJQ 3MROB 1H15A 4PRAB 4TYUA 1KC5L 2NR6D 4G6JL 1JBJA 4ZQKB 3TESA 4C56B 5B22A 4PRPA 4EOWL 3FFCE 3G5ZA 4GRLA 2V2XA 4PJBA 4ISVA 3N1GC 3W11C 2BVQB 2GK0A 3BWUC 3PV6B 4ODVH 4F15C 5T1KB 5EBGA 4UT6H 1V8HA 3KPMB 4NJAL 1BFVH 1XZ0B 2YKLH 3KYNB 4BQBA 4NM4L 4HLZG 4L29A 4XP9H 5HJ3B 1ADQH 4GAYA 3NAAH 3CZJA 1QFOA 2Q7NA 2BNQD 4QRPE 2BNQB 4JY5L 2IPUG 3L9RA 1AFVH 5T5FH 5IBLD 1EFQA 4PJGE 1MAML 1BF8A 3JTTB 4P2RB 3TVMD 5JOFB 1HINL 3BEWA 2OTUA 3RPKA 4NQDB 2CKBA 3KPOB 3SDDB 2ORBH 2FECI 3VRLE 2XN9A 5LAXA 2EYTA 1VESA 2CRYA 5GRUL 5DRNA 5I1IL 1UKTA 2HT3C 4MJ2A 5SX5K 3IXTA 5CBEA 1C12A 1J1XL 1QUNA 5J56B 3MRQA 1FQ9C 3ARWA 1WZMA 5TE4H 2JCCB 1HHKB 3MUJA 4M5YL 1U8HB 3O41B 1ZHBA 5I15L 3O6KL 1XF2A 3H0TB 1XR9B 4E0RA 2O5XH 4FMKA 3VGEA 5HHXH 1YEEH 5F88A 4W70A 5FKAA 4WUKL 1T7XA 2P8MA 5AZEH 4G9FA 5DJAB 3OHXA 1JGVH 1P7KB 3Q0HA 4OI7A 1MRCH 4G9FE 3G04B 5GGQL 1KOAA 1Q0YL 3DARA 2FJHA 4LVOB 2EZ0C 2CLZA 2VAAB 1ZLUK 2UWEF 1S5IL 1QLRA 4BKLA 4RX4A 1A6VH 2JB5H 2NQCA 32C2A 4FRWA 1NL0L 2WZPD 3HNSH 3LOWA 4R4ND 5KSUA 1TFHA 3L3OB 4E42A 4H0GA 2QSTA 2ZSVB 2P45B 5L6YL 3KR3H 3MLXH 1S7SA 2R0WH 3LMJH 3VGGA 3P0VH 3PDOB 4RAVB 3VD7A 3SGJA 4LSRH 2ZCLH 2EC8A 5C2BL 3VXOA 4MAUH 1W0VB 3MV01 4GG8B 1G7JB 2DJ4A 1H8OA 2J12B 4YC2C 4PJCA 1QRND 3DV4A 2R56H 2YD4A 1BM3H 3BUYA 5C07D 1MCOL 2K7PA 3S5LG 2AK4A 5IHUH 4PJ9D 1TCMA 1UCBH 4N0UE 1RSFA 1JGEA 5AYUH 3HPJA 3O4LD 3RWJA 4YK4B 5FB8A 4PS4H 5IHZA 2F53E 1AXSA 2MCPL 4NQDE 5I66A 1M71A 1Z3GL 2C1PB 3IRPX 3IJHB 4RBPK 1ORSB 1CIUA 1E6JL 3BISA 5B39A 2A6DB 5KS9E 5DVOA 2VE6B 4MAYC 2XTJD 3L1OH 5DTFB 1F97A 1U3YA 5GGRY 4O5LH 5E9DB 5F71A 3MFFA 1AHWB 1I7RB 3PHSA 4LGPB 4KJWC 3ZSSA 2FH8A 1AGFA 1KN4H 4O02H 5HYSG 3CVHL 2P5WB 3PWVB 2R1YB 5E2TL 4MJ5A 2EIBA 5DJDB 1P5VA 3BWAA 3DX8A 3MODL 3FQRA 3MRIA 3ZZ1A 2HRPH 1LP9B 4AENB 1XT5A 1HQ4B 2X41A 4AQ1B 2VLKD 4HX1A 1T2QL 5TE6H 4NKIH 5BOZG 1MIEL 4MSWA 2CIKB 1DBBH 3GSWA 4KK6D 1U36A 1MRDL 3KLAA 2AABL 4RMUA 2XWBA 4UOW1 1ZLWH 2A2QT 4LIQL 5E03A 5GRJL 4XC3H 4OGXH 1DQTA 3WKML 3HNVH 3F12B 3R4DA 2V6HA 4ZO8A 2A6IB 3MLXL 4ISVB 5DRXB 2VZOA 1N6UA 4CL7A 5I8OL 1S7RA 3ILQC 3WIHL 1VEPA 2NNAA 4PJ5A 3V2AR 4OLYL 5K59E 3L3HB 1FSKC 4R26L 4GAFB 5HVHB 4X6CA 3CSGA 3A6CH 5CEZD 5DJXB 1NGPH 4XCNB 1U0QA 4NOFA 2X4RA 1JGVL 2Y36L 1ZTXL 3CFBB 4KI5D 1JZ2A 1O7VA 2YPKB 4NQCA 2NYYD 3O6ML 3QDMD 1J11A 1ZGLP 4RFOH 3V6ZA 1LDPH 2IAMD 1E6JH 2R69H 2VNCA 3FO1B 3SDXB 3TO2A 1U2HA 4HWBH 5LGKA 1P2CB 3CX2A 5HHOA 3VD9A 4JFEB 4F9LC 3D69A 1FORH 4HKBA 3P0VL 3GHBH 4LHJB 5E8NB 4TSAH 3B9KA 3H9YA 3OSKA 3LEYL 2A9ML 2O5YL 3IDIA 1NFKA 3LV3A 2I9TA 15C8H 4OBSA 3P30L 3VE0A 2P7TA 4RA0C 5EUOA 2C7UA 1FGVL 4MA3B 3CLFH 3NCCB 3HS0A 4PLOB 1I8LA 1FC1A 3OL2A 1NSNL 5I71C 4U0RB 5DC4B 4XXDB 2GFBB 2I07B 4FQLH 2R29L 3RBGA 2PKDA 3PNWA 3WFCL 1GGCH 4XNXH 4LCCC 1R5IB 1G6RL 4XMLH 3RZCB 1FFOB 3UJTH 1EAPA 4FMFA 3D0LB 4QWWD 4ODTH 1NC2B 4LCWD 3EZ8A 3GM0A 4M5ZH 1RJCA 1HHIA 3SE8H 4MCYB 3TO4B 2HWZH 4YR6A 1WEJL 5E1HB 3T65B 3QQNA 4NO0D 1XF4A 3CDGB 5JNYA 1CLCA 1NCDL 4FFYH 1TXKA 2P48B 3IDYB 1NDMA 2AEPH 3BEVA 4TTDC 5J4MA 2QADB 1LE5B 3BT2L 3AS0A 1KGCD 4HIHA 3NFSL 2P49B 5ACZA 3ULSA 1MWAA 3BVNA 5KSAD 1CFVH 5HI4D 1TZIB 4ESKA 5D1QA 3ZL4L 2AJSL 4YBLB 1Q8MA 1AP2B 2JJUA 1JGLL 5L0QC 5IBTL 1JN6B 1CFSB 1T1ZB 3QNXB 3GJFB 1U8QB 5ID0B 1MAKA 5I1GH 1BQHA 1QBBA 1NFDF 3QWOB 2X9XA 5SWZD 4O9HH 4U1MB 4WI6A 4YPGA 1T1YB 5ID1B 4YDIL 1T4KB 3HZYA 4LPTA 1YPZA 4XCFL 1OQOA 4XH2B 4UOJA 3RWGA 4TUJB 3V9FA 4DZ8B 4OZGB 1U8OA 4JFZL 4JCLA 4XTRC 1YPZB 3REWB 3NIFE 5GSVA 2YA1A 4L4TE 1PDKA 2EH8L 2YKLL 3NH7H 1KIRB 4WHYG 1W8OA 3PL6B 4ZXBB 1DLHA 1H3UA 2CDEB 3BE1L 3IT8D 2FGWL 4TPRH 5JHDD 1A6TA 3CCHB 5DUBA 4ELMF 5C0JB 4AIZA 5BS0A 3BMVA 4PB0H 4UAOB 4GBXD 4D9RD 3QG7H 2FATH 3TBYA 2MHAA 2BZDA 3FO0L 1I8KA 1JZ8A 1PAMA 4G5ZH 4HJGA 1FO0L 4UUJA 5TE7L 5DJZB 1A9EA 4OM1H 1SJVA 1CLZH 3QPXH 4JY5H 4FFWC 1KB5H 1CF8H 1JK8B 2CDFB 4PRPE 1AD0A 4LSSH 4CGTA 3SKMB 3T0ED 3FT4B 3HR6A 3OAUH 3E6HB 5TDPB 1GAFH 1MJ8L 1U95B 2CUHA 4AEIL 1A1MB 1DR9A 4Q2ZA 5E8EB 3Q2CA 5EUOE 2W9EL 4HK3N 4LPYA 4WI7A 3MLVL 4M7KH 3V6BR 2CQVA 2Z35B 4ODVL 2ITCA 2NTSP 4HGWA 5EWIL 5DEZA 3V52L 5I76A 3FMGH 3VFGH 3HI5H 3M17A 4GXUN 12E8H 3FT2A 4KXZI 1ZHNA 4QHMB 4MJ6B 2B7DT 5C0GB 1JHTA 1XAUA 3F65A 5DEFA 5DJ8A 2DRUA 3UTSA 2I27N 4HUUB 4LF3B 2OP4H 5MP6L 1KEGL 4HKXA 5J89A 1KLFA 3H6JA 1G9NH 1FCGA 1NKOA 1EJ6A 1U8LB 5A16B 3G9VA 1N5YH 3QIBA 3BKYL 4UIKL 3RAJH 1HZHL 2J5LC 2B5IB 3KLHD 1NCCH 4F57H 4K9EC 1PG7L 5B8CC 1OWWA 5E4EC 3RPIB 1JMZA 1I7UA 4RGNC 4JB9L 3I6GB 4EN3A 4AL8H 1Q0YH 3D2UA 4LVNB 4OCYL 4PREB 3V4PL 3MNZA 5EBMA 4DKFL 2XQYG 3BUTA 4JN2B 1NL0H 1EHNA 1OAKL 4EI5A 2FJFB 2DQFA 3GSOB 1ROWA 5D7JA 4UINL 4G9FD 4Z0XB 4M8QB 3LEXB 3GSQB 3RTQB 4FABH 5IFJB 1CFNB 4ZXBA 1VGKA 2CDEA 5H35B 3PIQA 1G6RA 5GS0H 1IGTB 1N3NA 3EYUH 4Z7NF 1FV1A 5F7NC 4L5FL 4YDLB 5C0CE 1H5BC 3ZDYE 2DF3A 3LAFA 1MUJA 4NKMB 4JKKA 2PW1A 4WFED 5T33H 5BVPH 2J1KA 1I9IL 3MREB 2RCSH 1ZWIB 4WGWB 3VFSB 5KSBA 3OXRB 4DFHA 1PG7W 3LPFA 1E4XI 5F1NA 5JO5B 3ROOA 5B38G 4IMKA 3TVMB 5CP7B 1WAAE 2R23B 4R90H 2SEBA 3GMRB 5I1KL 2EDHA 2HVKA 1IZJA 4XI5C 3VA2C 5IBUB 2RR3A 5JUEH 1G9MH 3VXRD 4BZYA 2FSEA 4R8WL 4JFFE 4GQ9L 3W0WA 4YXLL 1T7ZA 4HLZH 4LKXB 2FSEB 3CSPA 5DHXB 1L7TH 2Y06H 1A6PA 1JWMB 3MLTA 3QUZA 1NKRA 5IB2B 3MUZ1 4XVUC 3HE6D 1DQJA 1AQKL 1I8KB 3MLTB 3QUZB 1CLOL 1O5DT 1WZLA 4JRYA 4QOKB 2PW2A 4OGYH 1MI5E 3G6JA 1H0DA 1KJVA 4WV1C 2XWJA 1P1ZB 2FR4A 4QHNB 3BX7C 2FNBA 5F7YC 3C87A 4OCXL 5D70H 4QRRB 2X6MA 4D9LL 3GI9L 3NCJL 4EOWH 2LQRA 3V0VA 3FHQA 1LEIB 5JORB 1CZ8L 3RWDB 3IRZA 3HS0B 3BZDA 5FKAB 4I18A 1GAFL 4LLMA 3RGVC 3OAYK 4LVEA 1X5LA 4ZXBC 2V2TB 1H3GA 3BZFB 3H2WA 4LNRB 2L0DA 5FB8B 1FV1B 2H2PD 3W2DL 5D7LA 5IFHL 3IDIB 3OF6D 1A7PL 3CFKA 1WBYB 3G6JF 1OCWH 2YD3A 1QHOA 4X4ZA 3QFJB 2BRRL 1F4HA 4KQ3L 3THMH 1UADC 4M8QA 4Y4KA 5DS8A 4HUMB 4LDEB 5GRYA 1YUHB 3HC3H 1MFDL 5KAQF 2BDNH 2GCYA 3EFFB 1YEJH 1KG0B 2A1WL 4HS8L 2C5DC 4JHBA 2PTTB 1U58B 2FEDC 3O4LA 2F15A 5FF6A 2A6JA 1MH5A 4X0KB 3TWCL 3ZYJA 1EMTH 1BVZA 3TNNA 2EYRB 2Y07L 4Y4FD 4OLXH 5E5UB 3EGSB 1RFDL 2E7LC 2VDOH 5EFIA 5IVOA 2ZOKB 5EN2A 4DGIH 3N85H 2WBJA 1U9KA 4Z7VA 3IU4H 5F7KC 3RWHB 3U7YL 1FLRH 2HH0H 4FG6C 1RUQL 4UT7H 4PV9B 4Y16B 5D2NB 2NPLX 3ARFC 3N1FC 3ZYOA 2E3VA 4HHAA 3CD4A 5J11C 1ZHNB 3H9HA 4QHMA 1LK2A 2VDML 3K1KC 1L0QA 1XGYH 3Q5TA 1RJLB 3CMOL 1X6LA 1E4JA 4U1SA 3D9AL 4WRLA 1TCRB 1FIEA 2Z4QA 3UDWC 5HVWA 1E4KA 4L3ED 1JVKA 2CD0A 5F7DB 4DCQA 1AR1C 3WXWL 4XWGL 3VFUA 1FVCA 4NO2B 1S9YA 1A9EB 2OTPA 3BJLA 3KPSD 4FTVB 1VKXB 1N0LA 2EDOA 5FA4B 1I1YB 1QA9A 4JDTL 3WJLC 3PG2A 3DX8B 1F8TL 1GCFA 4MNGB 2Q20A 3BP7B 1NBVH 4O51A 3OB0H 4HQQL 3DVFA 3O9WB 1I1AC 5IQ9B 5I75C 3UBXB 3UPRA 1GXEA 4JLRB 2KZWA 3ULUH 2V2TA 1I9JH 4ODUB 3V79C 2XZCL 5E5RB 4LHUB 4CN1A 1UCTA 4UTAH 4ODSL 2MCG1 2PXYB 4UQ3A 4UT6L 1F3RB 3VMPA 2FB4H 1INEL 1FG2B 3GSRB 5B39B 4HS3B 3C6LB 1YMHB 5I2IB 5T1LB 4HWEH 3BD3A 4U6HA 5GGUA 4OD3L 4NIKB 2I9TB 1I7ZA 1VADB 1OAXH 3ARED 3EDJA 4PJ7E 2AK4B 5HGDB 3OJ2C 2YK1H 4LSQH 4XGZA 3U6RA 2DTMH 3CZFB 3HG1B 4X80L 4K55A 3D39D 3IVKB 2J8UF 4CJ0A 4K7PX 3RVVC 1P2CA 4P99A 2HLAB 3MJ8A 4P23C 4TVSa 3L95A 4JGMA 4QTHA 4IS6A 5FHAL 3D5OF 3AFLA 1JTOA 3PWUB 4GXVH 4M5ZL 2NY6B 3SBWA 2FIRT 5DMGC 5IHBA 5K59F 3RUGF 1HHJA 1DBAH 5GPRA 4KQ3H 2MSPA 3C8DA 4MDJB 1N64H 1CE1L 4GKNA 5EULV 3GMQA 1KJ2H 1P53A 4LCUB 2AJUL 4ZUVB 1A6UL 4P5TD 1LO3L 2X10A 4NNYA 5EUOB 3HZMB 3AM8C 3VE0B 3ZYIA 3WNKA 4EUPA 1JV5A 1MJJB 5CUSH 1UM6H 2IAND 3GRWH 3D85A 5DMIL 4ALAH 3EDKA 2XWBB 3C6SA 4WI9A 4HV8B 3L7FA 5I0ZA 1XF3A 2HAZA 2JTDA 3UMTA 3TT1L 4HIEA 3GMNB 4PRHA 3UJIH 4QLRA 2VDNH 4EBQL 4EUPG 2X4OB 2XRAL 3EO1A 1I1CA 3EHBD 3TA3A 5CCKH 4K3JL 1YMHA 2E7MA 3I6LE 2X4NA 3KYOA 3EO9H 3MR9B 4I4WB 3PXHA 1FNEB 2DN7A 3R0NA 3ARBD 1FAIL 4P5MB 1GGCL 4XNXL 4XCNA 1S7QA 5FKPA 8FABB 4XNZC 4N9GB 4UT9H 5FO9A 1A02N 3P9LA 3V4UL 3QCUL 4XVJL 4M8VA 5D2LE 3AMKA 5HDLA 1JYWA 3C5ZB 4MNGA 1A1NB 2D7NA 1DN2A 5ERWA 1ZT1A 2VOTA 4PJ8A 4WDIA 4XHQA 5FK9A 4I2XE 1MLBA 5BQ7A 3VW3L 1LNUA 3QQ9D 5DFVD 5EORL 1QSFD 2J88H 1XGPB 5JIKA 3QCVH 1PYWB 1PFCA 2J3SA 3NABL 1JGEB 5J13C 4KKCC 4S1DD 1KTDB 5A2JH 3U83A 4JKPL 3D39E 3VRIB 4DZBB 2K7QA 2ZSWB 5GS0L 2ZKHL 3BO8B 2R9HC 4GW5A 1OVZA 4TSCH 3U7AA 2N1KA 2EDYA 2XI9A 3T1WA 1RZKH 4JG0L 3RHWF 4EDWH 5DI8A 1V7ML 2DQCH 3GO1L 3NCMA 4PJ8C 2GT9A 2XFXB 5DJZA 2X1PA 4X6CE 3KYKH 3I6LD 2BY1A 5ICZA 4CDHA 1RMFL 4K7FB 2GIYA 3MV7B 4M1CC 1XIWC 3TNNB 1A6TB 4OFYD 2V2WA 4K3JH 2OJEA 4XWOC 4WEUD 1EJOL 3NGBB 4GXUM 3M1BA 3WUZA 5DVMA 3G5VB 1JHLH 1R6VA 5C7XH 4YH6A 1KT2B 2ATPA 4JPIA 4RISH 3L3JA 4NBYB 4YO0A 1CTNA 1N59B 2H1PH 2BNRD 3OKOB 3ZO0A 5IB3B 4OCXH 1S9KC 3HPJB 3RU8H 1OARH 2HT2C 4J23A 4L1DA 4TQEL 2IH1A 2A6IA 2PYFB 3U0WH 2R0ZH 1ZHBB 1EDQA 2K9UA 4HXAL 4DUWA 1BBJA 2V2XB 4Q9QL 5AAMA 4OT1H 4WWID 3D0VB 4IRZL 4JFFA 3VI4F 3JVGC 1CFQB 2EIZA 3S98A 1LMKA 4M1CD 3WSQH 4MD0B 3ARGA 5FV2A 4RWHA 3BUYB 4S1QL 3PXJA 4IOFD 3DUSA 4JG1L 4I0CC 4YZFE 5ERWB 4LSRL 3GMPA 5F1OB 2YBRB 4KVCH 3QUXC 1M05B 3MOAH 4ZDHA 3M45A 3ULUF 1QQDB 3LVEA 4ZDHB 3D85D 1AGFB 1LP9F 4X6DB 3GK8L 3QUMH 2F5BH 4WU7B 2NY3D 5D1ZB 3MFGB 5I75B 3CSYA 2H8PB 4P46D 3BGMA 2GQHA 2P24B 3K74B 4H26B 2BERA 4TSCL 1CT8A 1R3KB 1IGFL 1BEYL 4JFXB 1MPAL 1XR9A 2B2XL 4QXWA 1Y0LB 1I85A 4U05A 3T0EE 5BRZE 3K81A 3DHJA 5DZLA 1X9QA 5K33A 1QTYT 2W1NA 1R3LA 4OF6A 5EC2B 3WMSA 1OM3L 2DQIL 2Q7YB 1OP5H 2E5EA 2P8MB 3RWJB 4Y2DD 3GSUB 4WI2A 2WWMC 3BE1H 4TPRL 3G5YA 3DUHA 3SDCB 1PKQB 4ONOA 5C71A 2DQJH 2ZCLL 1HI6A 4WIQA 5JLZB 5JW5B 3UJJH 1XF5A 2NLJA 3AAZA 4JHAL 3M1BB 3KPOA 3O45A 5DRZA 4D9QD 4HIXL 3VFMB 3BRDA 4YE4H 3JTSA 3ULVL 3KLDA 1KCVL 1UFUA 1KTLB 3P73A 4K07A 3CFBA 4QF1B 3TJEL 1B0GB 1JNHA 5ICZB 1FZOA 2A74B 3O81A 5EPMA 2FJGB 2W65A 4X6EB 2N7AA 5E6IA 5DK2A 5IMLA 1FIGH 4OI8A 2IWGA 1AJ7H 4OCNC 4UINH 3LEYH 4X7TB 1I7UB 2J6EA 3LEVL 1HHHB 2R1WA 4G42B 1X4YA 4XPAL 2IFFL 1E4KC 4KUZL 3BXNA 4EIZC 3CLEL 3B2UD 3F62A 4OKVA 4OI9A 3IU4L 5IMKA 3HHRB 3FHAA 1Q1JL 3HE7A 4E9LA 4AIXA 5SWQA 4U6HB 3ZDYF 4Z7VB 3WXVH 2HMID 4FQ1H 3RP1A 2GK0B 3QAZB 1CL7H 2NX5B 3TA3C 4LSPH 3CSYB 4GS7B 1FO0H 4P23D 2VDLH 2LVEA 5FUZH 5FOJA 5C0DA 5F9OL 3QFDA 5D1XC 4N9GA 5FO9B 1FFNA 3GI8L 4HT1H 2PTTA 3PGCA 4GSDL 4KDTA 4M02A 4WJ5A 1AXTH 1LO0H 4BJLA 2A73B 3O9WA 1A22B 2P5EE 4BFBD 4DOHE 5ADPL 4CNIA 1AY1L 4KPHH 5KBNC 4M6MH 1UM5L 5KSVA 2XZQL 2NY3C 1BBDH 4OQ1A 4QHKI 1A3RH 5FA4A 5C0FB 1RAMA 4HXBL 2G5BB 5AD0B 1T1XA 2BC4B 3MRMB 4A2LA 5EU6D 5CJOH 1CDBA 1QR1A 3FZUC 3X17A 4L8SC 1DEEB 2ICWI 4AH2B 35C8L 3WE6B 2ICEB 4OFKA 4NC1E 3X3FH 4HDIA 1RJLA 4XBPB 3WS6A 5T1KA 4JGUA 5IB3A 4XCFH 4MGXA 1UWGL 4PJFF 5J6HA 4XNUL 3P0YL 4B7LA 3PWJA 2O5ZL 1LK3H 4GLRH 4MB3A 4NKIL 2OZ4H 1DBML 3WV0A 3HA0A 4I18B 3F7VB 2JK5B 3P4NA 1TTUA 3VXUA 3VXSD 1JGDA 4JRXD 4NN7C 4PJ5E 4R7NB 1U8QA 1IGYA 1KBGH 2EXWD 2P8PB 4Q9RH 1SYVA 5D6DC 3QUZD 3ECBB 5I19H 5FO8B 3PWUA 2XRAH 5KSUB 1TJHL 6FABL 2NY0B 2JELL 2HFFB 2MKWA 2E8YA 1OB1A 1QQDA 4ZNCD 4ZD3L 4HIHB 3DYOA 3FCTB 3CLFL 2BCKB 1A9BB 5D7IF 4R3SB 2COQA 5B3JE 3K2UL 4HCRH 4MA8L 4LSPL 3KPSE 1XIWD 5IOPB 1MHEA 1VB9A 4HQQH 4MX7B 2BVEA 3CC5B 3WNPA 3LH2H 3FAXA 4LSDA 3DETC 4ZODA 2FWOA 1I7ZB 4KKLD 1IQDB 4HWBA 4LPWA 5DMKA 1AKJA 3BIKA 5KN5A 4GMSL 5DEGB 4KMTH 2W9LA 4WO4D 4XX1E