4WI6A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation n434a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHAHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi6A01
3TA3A 4WUUD 4NN7B 1MRDH 1L9NA 2DYPB 1CDUA 3GHEL 3QDJD 1QYGL 4NO3A 3FFCA 4FFWC 5DFWH 2NXYB 4NQVA 4HPOL 4YHZH 1F3DJ 4L8CA 1KTLA 3UTSB 1IRAY 3UTTB 1AXSA 3EKCA 1A1NA 2WP3O 4MD5A 1LVEA 4PRPA 2X09A 4D3CL 5A40E 2BK8A 1GL4B 3ARFC 3TEUA 3PDDA 3U46B 3VXUA 4K55A 2IBGA 2H8PB 3R8BB 1BVLA 4MJIE 4EOWH 3KLSA 1P2CB 1FGNL 2L4OA 4XP1H 1DEEB 4ZMAT 5TE6H 5C0DB 4YDLB 2C3XA 1NCCL 4P4KA 2ZP0T 2VZ3A 3QUXC 1TJHL 2C4FT 3G08B 2EYRA 1OHQA 1S7RA 5CZVL 3PWNA 4MS8D 4Y16D 2F8XC 1KLUA 3GO1L 4ISVB 3WEXB 1T0PB 5F70A 1CTNA 5IFJB 3F7YB 1TZGH 1UZ8A 1EH9A 4JKLA 4QTIH 4OD1H 5GZOC 4OIAA 2OI9B 1AO7B 5D7KD 2GIYA 4LK4A 3MMEB 5F9JB 1NGQH 1EHLH 1CGYA 4NT6A 2O26U 4PYHA 2RR3A 2Y6SC 4LBEB 5TDNA 3IAQA 3TESA 2E7LA 1YDPA 1I4FB 4HIJA 5HDQL 1IZJA 2V9TA 4JFEE 3UROR 3CNKA 3FN0H 4XPBH 2V2WA 1VDGA 3LSOB 1B0RB 1ES0B 4HEPG 1JTOA 2XWBB 1CFQA 1KEMH 3T0EA 2VXQL 3MFFB 3TNMB 1XGTB 3NFSH 2NY6B 2AJVL 2W9LA 4MSWB 1RJLB 4Z77A 4HXBH 1FORL 3LMJH 4HGMA 4WHCA 3CZJA 2VQ1B 5DD5L 4RGMC 5C0CB 2Y9RT 5F1KC 3KXFA 4B7IA 3IU3B 5IOPA 3D3VA 4YPJA 4U0QB 5FYKU 2XTJC 5EBLA 2ED7A 3VFGH 4FXKA 1IM9B 3F7VA 3MUGA 2JKXA 1QHPA 2OJEA 1UM4L 3HZMB 4GXVH 3W11D 1A7QL 1K5NB 4F58H 4PGEA 1CICB 4Y4KB 3TNNB 4HQQL 2I24N 3T65B 1F8TH 1FP5A 4WI2A 4F33A 4OUOA 2AXHA 3K80A 5JUEL 4R97B 5IJVB 4KI5D 4EKXA 5EBMA 3DXAD 3ULVH 3LZFL 1J5OL 5M94B 4TTDD 5DJ2B 3KPRB 3MGTB 1V8HA 3F12B 4U1LA 2VABA 3CMOL 4MA8H 3QIWB 3S96B 2CSPA 4YIQB 4PTTA 3SDDD 3ZDXF 1WZMA 3D2UB 2HWZH 5FV1L 5GS2D 5JIPA 2H9GB 2WV3A 1C5DB 4TUKL 1RZKC 3KHQA 1S9VA 3I2CL 4RISL 1MRCL 3T1WA 3UC0H 5DJCB 2UVEA 4PLKC 3BKCL 4MAYA 1KB5L 4P2RB 4DW2H 2DWEB 5JNYB 5ALCL 2WLYA 5JHDB 3SKMA 5ID0B 1BQHA 4ZUSB 2CKNA 4RAUB 3HC0A 3T2QA 5CBAA 4JY5L 3IYLW 4WHTB 1K8IA 4ZUUA 1PX3A 2PKDA 3FB5A 1UEYA 2HFFA 1S9XB 5L0QB 1NGYB 1W0WA 3U4BH 3F65A 2O61B 5B22A 3OXRB 1KTDB 2DQDL 2PF6A 2D0GA 2R39A 4OM0H 5J6HB 32C2B 1F4YH 1IC5H 4GG8A 1IAKA 2HLFC 2XKUA 4YGVB 4M1CC 4C57C 4XXCA 4MXWL 3MROA 4LARL 4ZFGH 4QKXB 3O9WB 1OGAD 4JFZL 1EO5A 4KY1H 4DN3H 3AB0B 4LCYB 1CDHA 4EN3D 4YHLL 1IILE 1CXIA 3JV4B 5HYJA 3I3BA 5D8JL 3BN9D 2DIBA 4PJBA 3L3GA 4L1HA 2NW2A 1FNGA 1L7IL 3M8OL 4UV7H 3O3DB 1G7LA 4X4MA 3D85B 3ZKXC 5CLWA 2R56H 1ZWIA 2GSGB 1BD2D 5E8PA 3QUYC 2K3TA 1DFBH 5LCVL 2DMCA 1BFOA 1NSNH 5IEKA 1NCBL 1MWAA 3RPKA 3HE7D 3CIQA 3CVHL 4Y5XB 1TZIA 3QO1B 3CDGB 3RIAF 4FS0A 4AIZB 3K3QA 4PLOB 1K4DA 4GSDL 3IKCB 4BQ6A 2NY4C 4GRMA 4GOSA 1BLNB 5T5FH 1X5GA 5TPWL 4KHTL 3CMGA 4JFHE 4HUUB 1HSAB 3BP6B 3OWEA 1FLTX 1JPFA 4H88L 1QSFD 4G5ZL 5C09B 3RU8H 1QBAA 3LN9A 3MLXL 3TPKA 1HKLL 4WJ5A 2WINA 2EH7L 1ND0A 1KEGL 3ZTNL 4FFWD 4KC3B 1MCDA 1NC4D 4ZD3L 3PP3K 3HMXL 2VR4A 2GTZA 4F2MB 5T1MA 2P5EE 3H7LA 5K9QG 4XH2B 5K9KA 3RVTC 4KAQL 4Y4HB 3O6LL 1M6OB 3U6RA 4RX4A 3QEUA 3EO9H 3ARFD 4BZ1H 1IAOA 2Z8VC 3JBG7 2ADJB 4FMFA 2BNUB 4F8TA 1MCPL 1BAFL 1H3UA 1ETZB 2Z92A 2DMKA 3DNKA 3U7WH 4ODBD 1A2YB 4HFWA 4JFYA 4X5XA 4F7MA 3KLDA 4DOHB 3QQ3B 1UCBH 3UTZB 3QUKB 5F3BA 1CFVL 2SEBA 1NLDH 3QUXD 4TSCH 3T1FB 5GRZA 5SWZA 1GXEA 5C0BE 2D7MA 3WIIL 4ZNEE 1YYML 5INDA 3K4AA 2IH3A 3HMWL 3C5ZB 5HYQA 3S5LA 1KT2B 4X7EC 3DYOA 3VG9B 4WU7A 1OCWH 2OTWA 5GRJL 3GRWH 3A67L 3QFDA 4Q6YA 1DL7H 1FGVL 3EUUA 2BY2A 4KZDH 1ZGLM 3MV9D 4RGNC 5AYQA 3D39D 3HR5A 4NCC2 1VB9A 1JV5A 2Y6SD 5D2NB 1FL3A 4NDMA 4OF0A 5HGGS 3CLEL 1X5AA 3C8DA 3E6HB 5DF0A 2QHRH 3QPQC 1Q0XH 3MLSH 3TV3H 3KPMB 1U8JA 1F13A 3PP4L 4M03A 3RUGE 1AE6L 4F7PB 2BSED 3VFNA 1MJ7L 3FO2B 5ANMA 2W38A 3BH8B 5F7EH 5GIRB 4PJEA 1FN4A 5FV2A 3OAZH 2VLJE 1OB1A 5KW9L 4R7DB 5EUOF 1K3IA 2ARJQ 3AU1B 1FYTD 1IM3A 2ZJSL 5J12C 3LKNA 2D7TL 4MNQA 4RZCB 3IAGC 4KMTH 4UILL 1WAAF 3JWOL 2HTLC 2DQGL 1NDGB 3VMOA 4CMMB 4GRWB 2XTJD 5KVGH 5ESAA 4P48A 5C9KA 3OXSB 2EYSB 3NCBB 4TUJB 1EFXA 4QT5A 2FHFA 4HIIB 3QQ4A 1ZT1A 2DI9A 5I1EH 3PGDB 5F9OL 1FH5L 3U0TA 4LASL 3ARGB 4LKCA 1FV1B 5FUOL 3O6FC 3HI1B 4X5WA 4HZLA 1AJ7L 2YPVL 5J11B 3QA3B 2B7DT 4I48A 4P5TC 4WTZG 1CR9L 1JPTH 3SJVB 2QLVB 1QSVA 1T1WB 3P0YL 2NLJA 3NABL 4MQ7A 4UT7L 3WHE1 4WUKH 1UXSB 4FXLA 4YO0A 5FXCH 4K7FA 1JGDB 1RD6A 3ARDD 4HWBL 1BWMA 3X11A 4DZBB 4ESKA 1QRKA 5AUMA 4XP9L 3DGGB 3BWUC 1DANT 5IIEB 3FQRA 1M7IB 5D7IF 1PZ5A 1CGVA 4G6FD 3BEVB 3DUUB 2A83A 5CP7A 4YPGA 5E8EA 5I1HL 1SMOA 5D72L 3QDGA 3SE4A 1HYSD 3MBXH 2X42A 3PQYE 4G9FD 2DLHA 1CDJA 1G9NL 1B0WA 3PV6A 4WRLA 3U79A 4L8BA 3GIVA 1GVIA 5C08B 3IDGB 5BVJA 3VDBA 3VD9A 4HJ0C 4JFPB 1PX4A 1YEKH 4QHLB 2VDPL 4V2CB 1YA5A 1RJZB 1U8MA 2W07A 1MLCA 3RZWA 2HLFD 1JBJA 3T2NH 2BSSA 1OP5K 4PJGB 4M1CD 3SPVA 1LWRA 4ONFL 3PWVA 3T0WA 5A2IH 5GGSA 4NQCA 1LP9F 1H5BB 1SJHA 4ZFFA 4HBCH 1VFBB 5D2LF 3WJJA 2XT1B 5KVMC 1NC2A 2NW3A 1JHTA 3E2HB 1QG3A 2IG2H 4Z5RA 2FR4A 3C6SB 3P4NB 3SQOL 4LRIC 1BVZA 2XN9A 1NUDA 3NVQA 4H25B 3QUYD 1G9MH 1OT2A 2D31B 2IBZX 2OSLB 2ZUYA 3EYFA 3ZL4H 1CG9B 3BDYH 2QR0B 4QHKJ 4RAHA 1TQCB 3RGVA 5I8KH 3P9LB 2WUCL 5A3IC 3JSSA 2EDLA 5C0NC 3RBSA 5E2UL 1VPOL 5EC1A 2JCCE 4YXLL 5FGCE 1KSRA 2K7PA 4PG9A 4KTYA 5GRYA 2GJ6D 1JZ3A 5FYLD 2NY4D 2QADC 1KN4H 1KPUB 1FZOA 3CPLA 3HE6B 5IMOA 1YC7A 3ZLQC 1TJGH 3MUY1 1MEXH 3MJGX 5E8DH 1KGCE 3NTCL 2L7JA 4HGWB 3RJQB 4FABH 2AVGA 1UWGL 4OZHA 3UTQB 4PJ7E 5B39G 5MEOA 4RWYL 1NBVH 2CDFA 1H3PL 5EOTB 2UY7A 3K2UH 1N5YL 1ZEAH 2AJ3A 4PRAA 5D7JD 2J3SA 4GLRH 4GMTH 3RVTD 3VFTA 1U6AH 3C6LA 4O2FA 5I71C 3SCMB 4HPYL 3IDYB 3B9KB 3N0PB 1KPRB 4JRYE 4RGOL 2B4CC 3TO4A 1TFHA 1IGCH 3B2VH 3UTPD 3BYTA 3KWWB 4R8WL 4U1KA 5EH1A 1A14L 4G6MH 3GSRA 3MRLB 2J4WH 5T3ZE 1NBYA 4APQA 4UT6H 4BA8A 3PWLB 2M2DA 4DKEL 2IANB 1VADA 4S10A 2AV7B 1UJ3B 1S5HA 4JJ5A 4ZO7A 3KLAB 1EEZB 3LQAL 2L7UA 4RGND 4HC1H 3F8UB 4DCQA 3QIBB 5L2KA 3V4UH 1U3JA 4XMLL 5HGDB 4LFHD 4BFIB 3V6OE 4OF5A 3IU4H 2JIXA 1VEPA 4XBPB 2Q86B 5HSFA 2EH8L 2UV3A 4EVNA 1T83C 3MRQA 3I6GA 1LO4L 1BWWA 3TBYA 5IVXE 3VXOB 1DQQA 1DTUA 3BP4A 4DGYL 5E4EC 3HAEG 1PQZB 2YPKB 5DTFA 4YXKH 1JYXA 4WGVB 2G5BB 4P3CH 1TVHA 2W9EL 3GSNL 1E4WH 4OCLC 3VRJA 1XGPA 4OZGB 4XP6H 1EV2E 5DC4B 3VI3F 4J3UA 1MAMH 5HY9B 3SE8H 1E6JH 3G5VA 3VXRB 5I76A 2YMXH 2HTLD 5DQJB 1Z6JT 1N64L 3HN3A 1Y6MR 1S9YB 5F1NB 2DQEH 4B41A 1WBYA 1L0YA 3LAFA 1YECL 4NNXB 1JZ2A 2EC9U 2DQFB 3WXWL 3BRFA 3ZE0E 2D0HA 3NACH 1S9KC 1QFUL 5CWSA 2ITCA 3GI9L 2IPUG 4FQ1L 5DJAA 4R96A 4G80A 3CFKA 2EXYC 3VXTB 1CI5A 1NEUA 2FYYB 5SX4H 1YJDL 4RIRA 3MNWA 5CGYC 4LCWD 1FFNA 3TBWB 3O6FD 3HLAB 1J18A 2VLKB 2IADB 5H37H 2PXYC 4U6VL 3LV3A 5L8JB 1BQLL 2PCPA 4P5TD 1B2WH 4PLJC 5HHOA 1A1MA 1MCKA 1X5YA 1U95B 2B20A 2G9HB 4TOYH 3QEGL 4NSKB 5FYJH 5JO5B 5DVLA 1M05B 3GB7B 1ZHBB 1HHKA 1YMHB 2UWEB 1QACA 4HC1A 4XVSH 5IB1A 5IGXL 3IXAB 3UZQA 3OAUH 1HHGA 4MA7L 3FQWB 2IPTH 4FQXD 4AJ0A 1U36A 5F8QC 4EUPA 2Y5TA 4DKFH 2C1PB 5EZOL 4WIQA 5CLTA 1RHHA 4WO4A 4DUXA 4JQIH 2ZPKL 1R0AL 4NUJB 2GUOA 3CSYA 4QRUB 3PDOB 2Q8BL 5GSRA 2VH5L 4ZAKB 3CFCH 1G7PA 1HILB 3VGHA 5T1KD 2VXSH 1MHEB 2OK0H 3SY0A 1WF5A 2DLFH 5DMKB 4MJ4A 5EB9A 3Q6GH 4CAGA 3KYKH 3LHPL 3NPSB 1T7XA 3DV4A 4OCSH 1JGLH 3IETA 4UTAL 1N4XL 1MCHA 4XCEA 1S9WB 1QO3A 5HHPB 5LKNA 4MD4B 4D0BA 3KPSE 1YQVH 2O5ZL 4V1DD 1R5IA 4X6DE 4O4YL 2NY5L 1P4BL 4HXAL 4AH2B 5MHSD 1MQ8A 4HF5H 4X83A 3GEWB 4Y2DC 1OP3H 2R0ZL 2EDRA 4JKPH 3P0VL 1KV3A 2Y07L 3P9MA 5I18L 1A22B 2NY3B 4NQTA 4FTVB 1IC7L 2E7LC 3N1QC 4CVWA 4GW1A 3O2DL 3O11A 2QKIA 5CUSH 2WIMA 3FQNB 4JAMA 1FDLH 2XA3A 4S1QL 3WFZA 4YR6B 3CLFH 1DQDH 5B38G 1QFHA 4KMLB 1IQDB 2DQJL 4S1DC 5D1XC 5BV7H 3T0EC 1SQ2N 3UTSE 5ALBH 3AC0A 1DBAH 4YHIA 3UTTE 1KNOB 2FX9H 4LEXL 4LSPL 1IBGH 4UZGA 4PV9A 3JXAA 5A3ID 1A5FL 3FCTA 3OPZH 1T22A 3QSKB 4AEHL 5IQ7L 5C0ND 4QRRA 4ELKA 4XVTH 4NZRH 3QZWA 5HDBE 2P7TA 3CFEA 1CDGA 5HHVH 3TT1H 5EZJB 2QADD 4OZ4A 1A6TA 5F97E 3O3EB 1YEDA 1NBQA 4D9QD 1MIEL 3V5HB 2Q3AA 4GMSL 5I8OH 1NLBL 4NQDB 1BZ9B 5DD3L 5GGVY 5KANG 4EI6B 4OB5H 4MMXC 2FEEI 1BEYL 1AO7E 2EDQA 2XACC 2YD7A 1QYGH 5EU7E 4WI7A 4J1UA 3DECA 1NCUA 4HPOH 1WCBB 4GQ9L 2WWMC 3LRSB 4PJ5D 1HXYA 1Z9MA 1P7QA 5T3XH 1CYGA 1CT8A 1WEJL 2RB8A 3WHXB 2Q87A 4OGYL 3QP3A 1LD9A 1INDL 5I1KL 1XH3B 3QDAA 3WBDA 4QXGL 4WWKC 2AABH 1CL7I 1FGNH 3BT2L 4NKMB 1T7WA 4Z7QF 2AXGA 3HNSL 1U41A 4XMKL 3AROA 4UU9A 1TJHH 1JGVL 1AGFB 1EBPA 2D4DA 5CZVH 4LPCA 1T5WB 5C0CE 1MCIA 3GO1H 3HRPA 5I17A 2X7LB 1IEBA 3QDMA 4GAYB 3MBED 5F3HB 3VRIB 3X13A 1AKJD 1C16A 4MNHA 3SKJL 4MJID 3PGCB 3PL6B 3WYRA 2EDKA 4PJ9C 1FAIL 2F54A 4QTHA 3FOLB 4P2OC 2CO7B 1A0QH 5HDQH 3KVQA 5JPNA 3UBXI 1UACL 2EE2A 4G8GA 1KB9J 4XMPH 1A6AA 3MV7A 3QAZB 3ET9F 2D9CA 3GMLA 3CSPA 3WL9B 4R0LC 1A4JA 3RL2B 4QRQA 3TJEL 1KF9B 3QEHB 1VCAA 4Y5VC 4NNYB 3MRRA 4KTEL 5FYKE 3KPRE 1FORH 3G6JF 5D1ZB 4YBHA 2OQJB 3SOBH 3CCHA 3FJTA 1QFPA 2ZG1A 4YC2B 3D0VB 1DUYA 1UH4A 2Z93A 2ZSWA 4EXKA 4X9FA 1RIHL 5HVHB 2GY5A 1WT5A 2YSSA 1KJ3L 4JFDD 4RBPH 4UI2A 3VXPA 1K8DB 2C7UB 4L4VA 3U9UA 1JTTA 2EXYD 5HGHA 3H9SA 5DFVC 5ERWA 1AHWA 1UM4H 1RZ8B 4ODXB 4P2RE 5GRVL 5CGYD 5C86A 5JHDE 2W60B 3VFVA 3QXVA 1MUJA 2PXYD 4HQQH 3DV6B 1HINL 4MX7B 3W9DB 2OL3H 3FTGB 4PLJD 1LE9A 3HUJA 4PRHB 1W72L 5GJTL 1D7FA 4LLMA 3TA3D 2HLAA 5E5MB 5C0RL 2HJKA 2DTSA 1PG7W 5I66A 3I02A 2AJSL 3QI9C 1HZHH 3FFCD 3NCMA 3IFOA 2OTUA 2VERN 1HH9A 1QVOB 3MNZA 1KLGA 5HJ3A 3JWDC 2BNQD 2BY0A 1BFTA 2R29H 1ZA3B 1BZ7B 4OI9A 3F5WA 3BQUB 3EGSB 4I0PA 1JFQL 4EQ3A 1BOGA 5CIPB 3I2CH 4PRPD 5I8EB 1MRCH 5CZXC 2N4IA 2VDLL 3OKMA 4NC0B 4PREB 5J06A 4C4KT 1X5FA 2EEDA 1Q94B 3L3HB 4FMKA 4KKNA 1ZGLA 1PYWB 4Z7WF 1IC4L 4D2NA 2LU3A 1UVQB 3SE9L 2EE9A 3RTQB 4K8RL 1QSEB 3FB8B 1U91A 3QWOA 1G1CA 2EZ0C 2F53A 3NIDF 3TN0C 3MLRL 3K4ZA 4JQXC 4P9HC 5D7SL 4M62H 2CKBB 4KDTA 1MSPA 5GHWL 3P9WB 3RZCC 2YD4A 1NGXA 2P8LA 1MCQA 5DEFB 3IFPB 2VL4A 5E8NA 1D5BA 4CL7A 1DSFH 2XNAB 1LDSA 4OZIA 4X7SL 2PTVA 3AMKA 5C09E 3HZKA 1J8HB 4N5UA 5D8JH 4IRJA 3STZA 2MWCA 2WMPA 4XNMA 5LGJB 1JZ6A 4UIKH 1HOCB 4ACPA 2BVQB 3QISA 4S1DD 3VI4F 3A6CH 2Z8RA 3MGOA 1DE4B 1L6XA 2ZCHL 3JTSA 3R06A 5DJDA 3T0ED 2QQLL 1CFNA 1D5ZA 4MQXC 5F1OB 5IB4A 4HJJH 4IEFB 1G7MB 1S7UA 3FB7A 5DUBA 5FKPB 4JO4L 4OZHF 5CEZL 3DIFB 3P4MB 5EO1B 3CVHH 4LLQA 4ONOA 5EWIL 5F7LB 5JORB 5GGUB 3KXFD 1G1YA 1QLEL 2JELL 1MREL 3BPNB 3D3VD 3QT2A 5DUPL 5GGRY 4XPGH 4ZQKB 2EDWA 4DOHE 5EOCH 4UDTB 3NIFE 1BBJA 5HPOA 3QXWA 4NZTH 2ZOLB 3HA0A 2C9AA 1P4LB 4XAKE 5FA3A 1OAUL 3ILPA 4F7EA 2EO9A 4LPTA 2CIKB 2W9DL 1EVTC 3ES6B 3ZTNH 5KSUB 3GUTA 3BPLC 3MREB 2ICWI 2R0WH 4ZD3H 4OUUB 1M7DA 1PKQB 5D2NE 2WWMD 1DBKL 4NC1E 2HVJB 2EKSB 1K3ZA 5I6XB 5EUKA 3ZKNC 4J8RB 5IV2B 4AEIL 4Q9CA 3DSFL 1T04A 5J56B 1BAFH 4JANB 4WWKD 4XX1G 5EZLB 1T20A 2DQHH 4FZEL 1A3LL 4KROB 3Q6FB 2X4QB 1I1RA 1K2DB 4NQEA 1WWAX 4U0RB 1SYVA 4GFTB 4GRLA 1CK0L 4G43B 5JW5B 2HMIC 4X6CF 4GRWE 5GRJH 2X40A 5IW1A 4WU5B 3SKOA 1F11A 2ZG3A 4IM8A 4WEBL 4X8XA 3N50A 1MCBA 2AP2A 1PLGH 4LMQI 3EO1A 3JUZA 1D5XB 4GW5A 3CLEH 3CVHA 2JJVA 1X5IA 2R4SL 4WNQA 4GLRI 4NKDA 1JNLH 4M93C 3GBNL 5C0AA 1FG2A 2HYMA 3QQ9C 4U2YA 4XNZC 5HVGB 1AE6H 2BVYA 5BO1L 3A6OA 1MJ7H 4I2XB 2H26B 3PIQB 3FONA 4D0DA 4WI8A 1E0OB 1F6AB 1W0VA 3ALXA 3SJVE 3MOAL 4HS6B 3CDCA 1GGTA 3G04B 1DCLA 2W65B 3CGTA 2BHYA 2D7TH 3FAXA 4J2XA 4NRYA 4PRNA 1S78D 5IVZB 3OKEB 4TVSa 1MNUL 3IB4A 3V6OC 5GRUH 4JE4B 2VB5A 3ULVD 1EXUA 5DJXB 3V2AR 5I75B 3IKKA 3MLWL 5DFVD 1T89C 2PTTA 5E99H 4P4RB 1FH5H 1BM3L 2VAAA 5B38B 1I8KB 3MA7A 3KYNA 2R2HB 2H2SC 1N59A 5FUOH 1PG7L 4MCYA 4UINL 5SWSB 1U3YA 4CN6A 3PXHA 3FOMB 1AJ7H 1BFVH 4JM2F 3KHOA 2YPVH 2DQCH 5C08E 3QR2A 4CVXB 1T0NB 3W0WA 1RK0A 1CR9H 3DRQB 4PJ8C 4LHUD 3HCVA 3QCVL 2JB6A 5MEPB 1MHCA 1VFMA 3NABH 5D70L 5E94B 1F97A 2CRZA 3QI9D 4UT7H 4ELMB 3V95A 5I1GL 1KB9K 5D9SA 2C1OB 2PO6A 3I6LE 3WJLC 4PJGE 5DRXA 3BW9B 5DJ8B 5FDYA 3MACL 2W1NA 1EAJA 4OLZH 5DQDH 4QRPB 1DVFC 3HNTL 4XP9H 4MZ3A 5L8KB 3FRPA 3OJDB 8FABB 3GM8A 3FB6B 4X6FB 4HUKB 2Q7YB 1QFOA 5HVFB 1Z0NA 4WUUB 5E2VL 5I1DA 2AK4B 5TDPA 2DKMA 3AXLA 3QDJB 3W2DL 1IFHH 1J9CT 2EZ0D 3TZVB 5IHZB 1G9NH 2FWOA 3PGFH 2R4RH 3TN0D 5SX4I 4DFIA 4PJCB 3V7MA 5HVWA 1ZLUK 1OW0C 4KVNH 4APQC 1Q9OA 3L3DB 2PYEA 5EU6A 1FFPA 2FX7L 1Q9KB 4KKAD 3DI3B 4MZ2A 3RVUD 3P4OB 3TBVA 2V7NA 4G3YL 4W6XB 4K3JL 3NA9L 4PB0L 4G8EA 5SWQA 1AP2A 4DVBB 3HZYA 5D7LB 5K9JL 1HN1A 2P8PA 3MLUL 4NP4L 4JZOA 3UJJH 3ROLB 1P7KA 3UO1L 1BPVA 3EDFA 4PB9H 5DT1H 4PJFA 1YN7B 3GMOA 4ZFZA 4HG4J 4HX1A 3U9PH 1JGEB 2CUHA 2AJUL 5GS1C 4RA0C 3D6GA 3WFCL 3TT3L 4NBYB 5GGQL 1I7UB 4U31A 4K94C 2G60L 1CD0A 4BSVA 4JN1L 4F7CB 4MNQD 1QPXA 5C0BA 4NQSA 5FOBA 3NAAL 4N0FB 4NGHL 1H0DB 4NN6B 4UV4L 3MLTB 4HWBA 2X9WA 3OTTA 1DUZA 4OGXH 1FZJB 2NX5B 3A0OA 1EFXD 5F1IA 3ZKQD 4YE4L 4MVBD 2NXYC 1HCVA 4P9HH 3LD8B 1O5DT 4OI8A 2IGFL 3DUSB 5IBTH 1MAJA 1GZQA 3K46A 3NTCH 4MJ2A 2IANE 1RZJC 5DZLA 4CU7A 2ZKHL 4J4PC 3CXHK 2VLRB 4OIBA 4I4WA 1NGPH 2CRYA 2ICCA 5C70A 1KJMA 4Y89A 1N5YH 3U30B 5FO8B 3QXDA 2X4TB 3AS2A 2R2EB 1EEYB 1YPZA 5H2BA 4JPWL 4Y2OA 1A7RL 3ZKND 4OFKA 1EJOL 4LLWB 15C8L 4RFEB 4HV8B 4YDLC 5C3TA 4G9DA 3HPJA 2YD6A 3NMEA 4LLUB 4RGOH 3PWPA 3VE0B 4U3HA 2YA1A 3OGOE 4NKOA 4WW1A 3RWHA 2FBJL 2NY2C 2AV1A 3CFBB 5JLZA 3MRIA 3FRUA 2LTQC 4RMRA 3RWDB 4G7VL 4PLNC 5E1AA 4A6YL 4OZGE 1INQB 1QEWB 2BNRA 3L95B 3DXAB 4M7LL 5EU7C 3TH3T 4D8PB 4YHNB 1ACYL 1OVZA 3VXRE 4WO4C 1N6QL 2HMID 4WI5A 4DKEH 4I9WD 1R3LA 3MNVA 2FX8L 3V52L 1HHHB 4JRYD 4DKDC 2C4FU 3DARA 1FE8L 4OF6A 2WUBL 3NN8A 4XMLH 4I3SL 1A9BB 4IMLB 4LFHG 4LAJH 1E6OL 3KS0J 4JHAL 4OKVB 4WHDA 2FL5A 2VL5A 5ESQB 2V2TA 1I8IA 3VGEA 4PJXB 3QFJB 1F58L 1F4XL 1LK3H 3QQ9D 1V3MA 4YHML 2ICES 2NY7H 1WZLA 3B3IA 1LO4H 2VLKE 4FFZH 4X7FC 4GKSB 2R69H 2NPLX 4DGYH 3T0AA 3T0DA 2EECA 2WQRA 4PJIA 1EMTL 3S88L 1AH1A 1G7IA 2W9EH 1HQ4B 2Y25A 5HPMB 1A9EA 1ZHKB 4XPTL 1WWBX 4DZ8A 4M6AA 2UWEE 5KVEH 2P47B 4EDXB 4OZFG 1A3QA 5T1LA 3QXAB 3HUJF 2XN9D 1YECH 1CICC 4NOBA 3AFLA 2BDNL 4Y4KC 3RGVD 1HE7A 1UYWL 1QFUH 3BP7B 1OGAB 3U0WL 3WUZA 1CLZL 4FQ1H 4KJQC 3M1BB 2YUWA 5IQ9A 4R97C 5ADPL 3SGDH 3PNWB 3RVXC 5CMAA 2H2SD 5DC9B 5C0GA 1K6QH 4PRDB 1HEZA 3LKSB 4MAUH 5IW6A 3DX7A 4ODWB 1EX0A 2VJXA 4DN4L 5JOFA 3MRJB 3T8XA 2BMKB 2NNAA 2VLMD 3QIWC 3PABA 4PJ8D 5I74C 3HE7B 5KSVB 2IAMA 5IBLC 1T80A 3H9YA 5T3ZH 4PJHF 2X4PA 3Q5TA 1A6ZA 5E5RB 5EC2B 3JV0A 1LDPH 4Y0GA 1LEGB 4RMUA 5I1JL 2VZ1A 1DVFD 3NZHH 3ULUE 4X4ZA 5DJ0A 4WFHD 1ZANL 4JDZA 3C6LD 5C07A 2VSDA 4FTVE 4IHOA 3AM8A 1QSFB 5DD6A 4ZUWB 1HIML 1QBLL 4O9HL 1AD9B 2XFXB 1FC2D 2AQ2A 3QUMH 4U6TA 2ZPKH 3L5IA 1R0AH 2H1PL 2Z91A 2IQ9L 5L0QC 4PJDB 4JO1L 1NC4B 2GFBB 4JVUA 2CLZB 2NY0C 2MMXA 4X7TB 1CLOH 3GSNA 4JPIB 3NFPA 4Y19B 4APQD 4WV1A 3RX7A 1NUFA 5DHVB 2AGJH 3LHPH 4Z9KB 1N7MH 1N4XH 3UMTA 4XCCL 2CDEA 4MQSB 3VFUA 3ARFB 3VGGA 2HN7B 3M07A 3SDCA 3VWJC 1UKTA 4L3CA 4TSBL 1OAZL 2EDOA 3MV8D 3M17B 2O5ZH 4Z7UB 1J1XL 1MQKL 3OB0H 1P4BH 4P57B 5FFLA 5T33L 1U8KA 1WSST 4JVPA 3O8XA 5IEHA 5FDWB 8CGTA 3ZYZA 1FPTH 3QUXB 5DDHB 5E00B 1I9IH 1AGBB 3AY4A 3P0VH 2Y07H 4NQDE 2DQUL 4M9PA 5C6TL 5I18H 5E03A 1IC7H 2YBRA 3KG5A 1OF2A 3X12B 2GCYB 2CK0L 1XF5B 2JJTC 5H94A 5HYSB 1NUGA 1JWUA 4IRSB 2HRPL 1ITCA 1C08A 4M00A 4UUJB 4Y5XC 1D5MA 5B3JF 1SJEB 3ARBB 2XRAL 4TSAL 2D7OA 4Z78B 3TGXA 5EU5A 4PYGA 4S1SL 3EOBB 1PFCA 2P43B 5K9OB 1UGNA 3OKDB 3U0PB 1OQXA 4BH7A 5AD0A 4EXPX 2Z0BA 1OGTB 2GY7B 1NCAL 5C9JA 1RU9L 1YC8A 1ZOXA 1KLFA 1VESA 3KYOB 1E4XH 2YRPA 5E2TH 3TO2A 1JF1A 2NXYD 1U0QA 4A2MA 3KDMB 2DBLH 4J7RA 1NLBH 1FYTB 4PGBA 3QUMA 4J4PD 3UTTD 9CGTA 4WEUD 1JRHH 3HTLX 4NPYA 4LVOC 1AR2A 1AIFA 2XTJB 1QQDA 5DUMH 1B4RA 1AGDB 4H20L 1LK2A 3S9DB 1RV6X 1LEKB 4TPRL 4GQ9H 4TYUA 1C5BL 1AI1H 1VGEH 2F74A 3RNQA 4DAGL 3TIDA 1INEL 4M5ZL 3P11H 2YN5A 1UC6A 1IC1A 5FECA 1C12B 1RJYB 1KIUA 1WEJH 4KK5C 1YMMB 3NGBC 4HG4K 5KAQG 5KSAA 3V4VL 1K85A 3DMMC 4TVPE 3ZT6A 2NR6C 3SKNB 3C5ZC 4XCNB 5I1KH 2MQ0A 2NY2D 2BVTA 4PPTA 1AY1L 4LIQE 3BJ91 1RZIA 4F8QA 2XWTB 3HNSH 4X4XA 4X0KA 3O3BA 3O2DA 4WO4D 3RNKB 3VXQA 4Z7NE 1JL8A 2HJFB 2DTML 3CZFB 1ZLVK 5D2NC 4QYOA 4NC1C 3DBXA 3V0VB 4KHXH 4RFNB 3ARDB 4XP4L 2R0KH 3H42L 2A77L 4ZOEA 3WNNA 4YHOH 3SKJH 1YN6A 5MERA 3BH9A 3FO0L 1JPGB 4G6FB 3OZ9L 1YUHA 4WFEE 1FAIH 1SJXA 5EU4B 1IKNA 4E41B 4A2LA 2FJFB 5KSBB 5DMGC 4IOFC 4XZUB 4LLVA 4G9FB 3OR7B 4EZMA 5E5UB 5C0CD 5CEXA 1HHJA 4PRHE 3PHQA 4HKJB 5J6GA 3PG2A 5BJTA 4L9DA 4Z7VA 2E27H 2HG5B 2BC4A 3BGMA 3IFLL 4R4BB 3STBA 3BAEH 4YHKH 4GUPB 4AY0A 4ODHH 3WSQL 1XGQA 4HH9A 3IDIA 3GSXA 2B8OT 4TQEL 5I30L 5CP3H 4LHQB 4HLJA 3ARGC 1KJ3H 4Y4KD 2FZ3A 2FGWH 1X5JA 1KCLA 4KJQD 5C7XH 3QNXA 4X5LA 3FO1A 3W82A 2VRAA 4JZJB 3BD3A 2FB4L 5J11C 3RVXD 2J6EH 5CGMA 2VDNL 4RMWA 5IROC 3QG7H 4MDJA 5FGRA 1IZKA 3TCLB 3IJSA 5GGTL 3OQ3B 3KPRD 2X9YA 1ZLWH 5I0ZA 1TDQA 3ZE2F 1LO0L 4X6DA 1GIGH 1QSEE 1FNAA 4NIKB 5CEYA 3QIWD 4P99A 3O3UN 1FL6A 3GMRA 1VFAB 2OP4L 5IBLD 2HP4A 2RCSH 1YNLH 3ZT7A 3MSPA 3OX8B 3U7YL 2A6DA 4UQ3A 1JWSB 4FRWA 4TRPL 3DYPA 5TF1L 5ESVA 4CRPA 4KZEL 2AKRB 3O6MH 1GC1H 4KRMB 3R4DA 2AJSH 4XNXL 1E27B 2AJXL 1FSKB 1GOFA 2GJ6B 2HJLB 4IDLA 2NY4B 3IDJA 1T1ZB 1UCTA 2Y72A 5BZDA 4EIGB 5TGBA 2NTFB 2CUIA 2HT3C 2M1KA 2MPAL 1NKRA 1P7QD 3A6BH 1J8HE 1IL1A 2YC1B 1MCCA 4JO2H 4W6YB 3I9GL 3QCTH 1FBIH 2VDLH 1GGIH 4QRTA 3U83A 1ZMYA 3D1MC 1ACZA 4KJWC 2MHAA 5ACMA 3U46A 4UAOB 2NY0D 1DBJH 1DANU 3IJHB 4RMTA 3INUL 4KUCF 2G2RB 1CGSL 5D7JB 1WISA 3GSOA 5TQ2L 4Y1AA 2R1WA 5IB2B 2HFEB 5IF0A 3NCYP 3CK0L 2VZSA 2HVKB 3KGRA 1IGYB 1DLHB 3GSWA 4GRLC 1NKOA 3VWJD 4RDQG 1Q9WA 1CTOA 3O2WL 5D7SH 4WW2B 1SEQH 3OBAA 5BW7A 3U1SL 1H5BC 4OCRH 5FYKH 5IM7A 4S0TD 2J12B 1AO7A 4GAJH 3E8UL 4KGJA 2VXUL 3IVKA 5F9JA 3ARXA 3GMMB 1NFDB 2MKWA 3E2HC 3QIUA 3PWJB 1PZUB 4P3DB 5TQ0L 1CFTB 3D85D 4X7SH 2PW1A 2OJZL 2BVOB 2F54D 1FZMA 1LO5A 3EFDL 3GM0A 4LBEA 1OTUC 1YEHH 3D87B 4C56D 1HQRB 4G8GD 1MRFH 4JN2B 2VUYA 3FT2A 3OJMB 4MB5A 2XQBH 3OR6B 4U1MA 2K9UA 1P6FA 1PKQE 2I9TA 4RGNB 1WBXB 1ES0A 1ZGLP 2F5AL 2QQLH 1W72A 4CVZA 1CZ8L 1V05A 3DX8A 3V6ZA 3C8KB 5KVFH 4MSWA 5EFIB 1I7ZB 5CJQL 2BCKA 5DMIH 2ESVA 3RWGA 4R26L 3RWEB 1XGRA 4OLUL 3MXVH 1H9VA 2VQ1A 1P4IH 4M1DL 4P9MH 1IGMH 3RUGF 4PY8J 3IXTA 1QLEH 1MJJB 3C9NB 1IAIM 4POZC 2XV6B 1J0YA 4NFBA 2X4NB 1YEJH 4OSUL 1IM9A 4MDIA 1RK1A 4MWFA 3WLBB 1OAUH 3LDBB 5DRWA 4G7YL 1Z3GH 3D69A 3HZMA 4KVCH 4OFIA 3RDTC 3SCMC 1WLHA 4OZFB 3B9KC 4Y4FC 4QXTA 4FP8L 5JR1H 5IP4A 1ZVSB 2ENSA 3TPUB 4F57L 1F90H 2YKLH 3SQBA 5IJVA 1G84A 1KCVH 4YJZL 4KK5D 1JP5A 3B4NA 4YDIL 2XY2A 3DMMD 4NO5B 5DJ2A 2NR6D 2CMRH 3C5ZD 3QULB 1PAMA 3SDXA 3T3PE 3TCXA 1CXLA 4LCWB 4OQ1A 5L7XH 4YUEH 3O6FB 4I2XE 2BY3A 1TZHA 4FZEH 5C8JB 1UJ3C 2G75A 4OCXL 3RWCB 5DI8B 4P5TB 3D2UA 3VXSA 2D4FA 2EDHA 4YK4B 5FCSH 1OP9A 3S34L 2R2BB 1CXEA 4F37F 4P59H 3BP5B 1I7RA 3UYOD 1UKSA 5JNYA 1BQHG 5EU3A 3LEYL 4E42A 1BJ1H 1FFOB 1UEMA 3LN5B 4NWTH 7FABH 2CIIB 4ZUSA 2DWDA 1UZ6E 4FQXB 2F53D 4WEBH 4YBQC 2OR9H 2YN3A 4DQOL 1A1OA 1KTKE 2R4SH 1DDHA 5AZEL 5EN2A 3JWOC 1CIDA 2BFVH 4WDIA 5DMGD 3GBNH 1BHGA 2H3NA 3ZHLA 3HI6H 5SWSE 1H15B 4Z0XB 5T1KB 2I9LA 5FUZL 2YUVA 2R23B 3D25B 4QGYA 4TUOB 2YD8A 4NUGH 4G42B 5HHQB 5LWYL 2E6QA 3MOAH 4M4PA 3C60A 4HIXL 4PV8A 4CDGC 3KPPB 1UB6B 1J11A 4ELME 1XF2B 1NQBA 4V1DB 3OKOB 3QNZB 3MR9B 4NO2B 5IJKC 4QRPE 1Y0LA 2FD6L 3DHMA 1UQSB 1PSKL 2GSGA 4LOUC 4NCDA 5KN5A 3MLWH 1R3KA 3EYOA 4M61A 3CFDB 4WVRA 4WUUE 1KG0B 2AK4E 4HDIA 1G6RB 3SJVD 3H0TB 4KPHL 4I0KA 5IFAL 3QDJE 1BM3H 3LB6C 3VFWA 1YEEL 3PF2A 3QWRD 3Q3GB 2VITA 3MFGB 4DVRL 1JTPA 2CLRB 3GIZL 4M6NH 2EIZB 4UINH 4PJCE 5MENA 5T5NG 1Z0MA 2X4SB 4CADB 3MXWH 1BX2A 3OKLA 1D6EB 2ADGA 4XWOC 3NZ8B 2BHZA 3MO1A 1HSAA 3BP6A 4LHUG 2EYTA 5DA4A 2F5BH 3SGJA 5C09A 1EAPB 2JCCF 1OAQH 2LV4A 5KS9A 1MRDL 4HCRH 3TBTB 2QADB 1A7PH 5D7LE 4HK0A 5A2JH 1K9TA 3WN5B 4HKXB 3OAZK 2HT3D 1EEUA 4PG2C 3HNTH 4YHZL 2ZUTA 3R8QA 4YGAB 4Y4HA 2IF7A 2MCPL 5EUOB 1JVKA 2GK2A 5FF6B 1G0XA 4KJWD 5E2VH 3NPSC 2Y5EA 2EIDA 3C5SA 2VAJA 5D7KE 4PJ7F 3VD3A 3WFHB 4P2CG 3C5JA 3TYGH 4PJAB 3W2DH 4WHYH 3HC4H 3SGDI 1EUUA 4EOWL 1X3DA 4N9GB 4XP1L 3QQ3A 4NQED 4JY6A 4P23A 3UTZA 3CFJB 5TE6L 3ZO0A 4N0YH 3DROA 4PJ5B 4GRLD 5DJZB 5EIIA 3ULUC 2FX7H 2NY3C 3JV6B 4G3YH 5B8CA 5I1AB 5E2JA 5SV4A 4O58L 3IDXH 4Z76B 3T0XA 4QTIL 2NX5E 4OD1L 5A2KH 3RWJB 3RKPA 1HNFA 1X9QA 2FDBP 1NGQL 3GMPB 1EHLL 3Q1SH 4M43H 4KTDH 1MHHA 3PWUB 5CD5C 3EOAB 1A7BA 3E6HA 2VLRE 5C0AD 4JFFD 4XHJD 4KJYB 2QJDA 4N8VG 3T4AA 3MBEB 3GSVB 1XCTB 4NFCA 1LMKA 3FN0L 3ZYOA 4XPBL 4N0UB 1AKJB 1OTTC 1IGJB 3WFCH 4JFOB 4ZDHB 2H6PB 1QA9A 1NJ9B 1KEML 3MRHB 3P73A 3VGAC 3RKDD 1GGCL 5J7CC 1DEDA 5LAXA 1Q9LA 5AG8A 2X4RB 3NFSL 4R7DA 5D7IB 1MJUH 4HXBL 4J3OC 4HCRA 1EDQA 3LMJL 2EC9T 4YHPB 2VIRB 3C08H 3TVMC 1SBSL 3L3KA 2GTWA 3ARYA 4BUHA 1VSCA 4MJ5B 5IVXF 2P45B 4POZD 2FH8A 2FSEB 5GRXG 2QQQA 4KI5E 1T2QH 4LSDA 3DXAE 3U82B 3E1F1 2XZAL 4TUJA 4YE4H 1U8IB 1QLRA 4Z8FH 3VFGL 4HFUH 2Q3ZA 4DGIL 4LVEA 4FQQB 3RDTD 3SCMD 3PGDA 2ZKHH 1SEBA 3EO0B 2ICEA 4GXVL 4Y4FD 4GJTB 3GSQB 43C9A 1S7TB 4I5BB 1U93A 1KJ2L 4JFDB 4YFLI 3MC0A 4JRWA 5EBGA 3ZE0F 3W0WD 4JM4L 4YFLF 3OHXB 1BZQK 3RPIB 4JY4A 3QWQB 4PJXE 3QFJE 3RY6A 1KCKA 2WQ8A 3MLZL 1NCWL 3LQAC 1G7HB 3B2UC 4FQLL 2R9HC 1K4CA 5TJWK 3VDAA 3FFDA 4MA8L 1T66C 4Z95H 5CFHA 4G7VH 4A6YH 2HWZL 3KPOA 1KFAL 3SO5A 5IIEA 1ACYH 3TA3B 2VQUA 3BEVA 1HWGB 3DUUA 3PL6C 1RIVH 1RIUL 3UC0L 4HW6A 3NCJH 3TBSA 4C55A 3FFCB 4F9LA 3G5YB 1J05B 4DW2L 3L9RA 2BNQB 3PUCA 4L8CB 4YBQD 3GHBH 1KTLB 1SVZA 5C0JB 1JRHI 1OGAE 1R3HA 3NCEB 4GXUN 2DLEA 2PYED 4I3SH 4MNGA 4MD5B 1E6OH 5C08A 3IDGA 4PRPB 5JIKA 1GAFL 1E4KC 1U8NB 3LY6A 1KC5L 3ILQD 4I18A 3P0GB 1F5WA 3U4BL 1LQSR 2WP3T 3VXRD 2R1XB 5M7QA 3IJYA 5D1ZC 1ZK9A 2FO1A 1IC5L 4YC2C 5BRZD 5TDOA 5ICYA 2EYRB 1EMTH 1MCFA 2FEEL 4NO0A 3PWNB 4XT1C 1TTUA 2X1QA 1KLUB 2Z8WC 3VA2C 4XPTH 1UZ8B 4KY1L 4DN3L 1LEIB 1WV7T 4NC2B 2I27N 4O5LL 2DKUA 4D9RD 1RUQH 1UWXH 4X6DF 2YD1A 1I3GH 5KZCD 1HDMA 7CGTA 4NT6B 2X89A 4UV7L 3W5MA 1JNHA 5TDNB 2D31A 2R56L 1YDPB 1UYWH 1QSFE 2J88L 3MRKB 4XCYA 2A6KA 2V2XA 1MCWM 1DFBL 1NSNL 2R8SH 2J8UA 1JHKH 2V2WB 1KENL 5I15L 3LB6D 5IESL 5T1DL 3OV6A 4R3SA 4PJDE 1CFQB 4LCUA 3H9ZA 3T0EB 1U3HA 3JVGC 1A6PA 4LEOB 4RNRA 4Y19E 4A6YA 5KOMC 1P1ZA 5C0IA 4N1CA 4U1JA 4Z77B 1CD1B 3WV0A 5CJXA 3HFMH 5F71A 3HE6A 5T5FL 1VENA 4OCMC 3LOWA 3BQUC 1EZVX 4JG1H 2X41A 3KXFB 4XX1E 4Z7UE 3RU8L 5IOPB 5J0BA 1RZGA 4Z18A 3D3VB 4L8SA 3VWKC 4MQTB 4H0IA 3IFNH 3S3PA 1XT5A 5DC0A 5I1JH 1GHFH 1XF4A 1MAKA 4FXKB 5F72S 2X1WL 1MI5A 2PNDA 1U9KA 5IBUG 3RTQC 1HIMH 4O9HH 3ZHKA 4RFOL 3PWPD 4NBXB 4PGEB 5ISZD 4KH2A 2IQ9H 1C1EL 4X4YA 1HH6A 3D9AH 4F33B 3O4LA 1I1YA 2BHUA 3U7WL 4KUZH 3MZGB 4CU8A 2BNRD 5EBMB 1UCBL 2HH0L 5CCKH 1NLDL 3MLYH 1MFNA 4TSCL 1NDMB 2IQAB 2NY3D 2CUMA 3LPGA 4ZPTA 1CS6A 3WFEL 2VN7A 4U1LB 4HH8A 4TSBH 2IANA 3QUZA 4K2UL 1JI2A 1MQKH 3KLAA 1EEZA 4PTTB 1OCWL 1XIWA 3QRFM 3GRWL 2UVFA 1DL7L 3QIBA 1CGWA 4ORZC 3KPNA 1FYTE 3QG6B 3QHTC 5D6CA 5CD5D 3H6JA 2CK0H 2WK2A 4XBPA 3K1KC 1G7JB 1SBBA 3SKMB 2XTJE 1BQHB 2QHRL 3RJDA 3MLSL 3RVWC 3TV3L 1OTTD 2E6JA 2CQVA 1JZ7A 3AAZB 3HC0B 4OF3A 4U49A 3BPNC 4ZUUB 5HDLA 4TSAH 4F9PA 2YPKA 3N1FC 2Q6WA 3FB5B 4ZG1A 2X1OA 2HFFB 5F7EL 4S1SH 4HWUA 1W0WB 1NH6A 3L5WA 1QHOA 4OZGA 5I9QB 1EZVY 1YMME 1RPQA 4XWGL 5CJBA 3TVMD 1I7TA 4ENEC 5T1LD 5EIQA 1F45A 1NCAH 4GG8B 5E7FA 1RU9H 1JK8B 4OFYD 5TE7H 3VGBA 2EEAA 5F96H 4NFDA 5DHYA 1CDIA 2NZ9C 5FHAH 3MROB 4O2EA 3CX5K 2C3WA 2KUTA 5HYJB 1T1XA 3ULUH 3P77A 4P2QD 3SDXF 4PJBB 2P24A 3LEVL 2D2OA 3VXTA 5C6WH 5I1EL 2NW2B 2JTDA 4MA3A 3QEQD 5DEZA 2FYYA 4OF7A 1G7LB 1IAIH 3NIGE 3TBWA 1ZWIB 1XF3A 2ZZUT 4H20H 1JF5A 4OI7A 3GDBA 5E8PB 3EJZC 1BFOB 3NFNA 4TPRH 4O02L 5IEKB 1MWAB 2IAMD 1INEH 3MCG1 1OAXH 4DK3A 1JPTL 1TZIB 4E41E 2BSRA 4LKXB 5KSBE 5JO5A 3UPRB 1VACA 1HHIA 2R9HD 1K4DB 4G9FE 4MB3A 1YMHA 1AY1H 1H3VA 4GRMB 4U3CA 3IXAA 5A2FA 5KOVC 3IRPX 4EUPG 2BRQA 4GXUM 1JPFB 3L5JA 1UM5H 4EI5A 1FHGA 5DFTA 2Z35B 3PL6D 2DTMH 4WJ5B 3VFOB 5E6IA 5L9DH 1ND0B 3QI9B 3VMNA 4HT1L 4NUJA 1N0LA 3LPFA 2GTZB 5T1MB 3T04D 4XP4H 4LLYB 2A77H 1MHEA 2DDQL 3MBXL 5K9KB 3FMGH 1BQSA 4UNTA 4GT7A 4GKZA 3U6RB 3FO0H 1F2QA 1IAOB 3LS5L 2WWKO 4HWEH 4YDVB 2Z92B 1YEKL 1S7XA 4HFWB 3T2PA 4X5XB 2JLLA 1C8PA 4QHMB 4F7MB 4FFYL 3FZUC 5F3BB 3ZKMC 2SEBB 4FQHB 3SBWA 3P2TA 2QBWA 5AWNH 3T2NL 4UB0H 1FIEA 5INDB 2IH3B 5F21B 3IRZA 5DJYA 2EXWC 3I6KA 5I75C 3B83A 4WU7B 3FQNA 2OTWB 3QFDB 4HBCL 4X8JB 2GJ6E 5ACLA 3EJYD 5FYLE 5DLMH 4MD0A 3QO0B 2PETA 3HR5B 2IG2L 3GZKA 1JV5B 3IDNA 1BREA 4YZFE 5FK9A 1FL3B 1UT9A 4PR5A 1KNOA 4PGCA 2ARWA 2X70A 3MRCA 4HGKC 4WENB 5I8KL 5KS9F 1U8JB 4KQ4H 4N8VB 4K7PY 3W39A 1H8NA 3VFNB 1Q72H 1Q8MA 3O45A 5IR1A 5GGTH 4QHNA 5ANMB 3OKNA 4WFGD 5LGHH 1LO0H 3NOIA 4K3DL 4PJEB 4TVPH 1FN4B 3D0LB 1OB1B 1KN4L 4PUBH 4UQ2B 3K81A 3MGAA 4BH8A 3JUYA 3LKNB 4MNQB 4WWID 3U7YH 2P42B 1TJGL 1MEXL 4TRPH 3TWCH 5E8DL 4KKBC 3VWKD 3UTPE 4KZEH 4G6KH 3MJ6A 3WS6A 1NFDE 1NBVL 4K8RC 3EZ8A 3NIFF 1EFXB 3K2UL 2XZZA 4NKQB 2C5DC 3AS0A 3SE3A 2MPAH 4CN1A 4GMTL 1XAUA 2CRMA 3K8KA 1OAKH 1URLA 1ZT1B 1IGFH 4KXZI 1QSED 3LRSA 2IPKB 5FGBA 3TZVC 3HG1A 3QXUA 2F19H 4LVHC 3I9GH 3U0TB 3WHXA 2XXMB 4LKCB 1N2RA 4KI1A 4E9LA 4RGNE 4L3ED 1DQLL 3BXNA 4LPXA 4X5WB 4NRZA 1JN6A 1IGCL 1J86A 1VGKA 1CGSH 5IK3A 2AI0H 1T21A 4I48B 4YQXH 1UB5A 4K3EH 4NKMA 4G6ML 3MRGB 4Q6IC 3CK0H 4WTZA 3LS4H 1NAML 2NLJB 1MHPH 2J4WL 3OAYH 4MQ7B 5DRZA 1X6NA 1T5WA 4OGAC 4UT6L 1J8HD 4YO0B 2X7LA 1S3KH 5F3HA 2V5YA 5AUMB 2PW2A 4YLQT 1R5WA 1L7TL 4HC1L 4CJ1A 3V4UL 1PZ5B 3PGCA 5DR5H 2OJZH 3CVIL 2A83B 5CP7B 4IIQA 1GOGA 4N0CC 5I1IH 3QDGB 3FOLA 1X4XA 2MSPA 5CIPH 3VW3H 4KDWA 4NZUH 5GGTA 4GRWF 1CWVA 3W81A 5DYOA 3TJHD 3QPXH 2F5AH 1X44A 4L8BB 3GIVB 5KVDL 4U1HA 3WL9A 1TJIH 2C3GA 4YXKL 4LCCC 4P3CL 3C60C 2B2XH 2RBLA 3WNMA 4NNYA 3UPCA 2GQHA 4BSWB 1D9KA 4XP6L 4R26H 4ENED 4XNZB 3FL7A 3HI5H 4LCWE 1U8MB 1MAML 1MLCB 2F58H 4P46A 5JMOC 2BSSB 2CKBH 2BVUA 4DKAA 3SEPA 3SPVB 3G5XA 1PVHA 2UZXB 3PWVB 2AEPL 2DQEL 4NQCB 3ISWA 5DMYA 3UZEA 3HPLA 1K8DA 1SJHB 4ZFFB 4OSUH 4HIEB 2ZNWA 1NC2B 2NW3B 1JHTB 4H26A 4G7YH 4Z5RB 2FR4B 2Q76A 3OF6A 2W60A 3W11C 1BIIA 2XN9B 4FP8H 3EYFB 1OD7A 3EJZD 1CD8A 1F6LL 3W9DA 3RGVB 3FTGA 4PRHA 5IHBA 3O6KH 2VR9A 1B2WL 3WO4B 5FA4A 1SJVA 1CE6A 1QLFA 3SGJC 5EC1B 4TOYL 3THMH 1MCOL 4PG9B 1A6UH 1FQ9C 4LGPB 1FZOB 4CBPA 3CPLB 2RAMA 1EPFA 1U8OA 3OAUL 4OCXH 5IMOB 2XOTA 5IUSA 1EUTA 3HAEH 4PJ8B 2IPTL 3EGSA 1OPGL 4DKFL 3S34H 5CIPA 1QBML 4OZHB 3DURB 5F7DB 4V1DE 1YNTB 2CO6B 5MEOB 3WNOA 4H8WH 2CDFB 5MHSE 5B39A 4PRAB 4PJGF 1PYWA 5SX5H 1DVFB 4AEEA 3VFTB 3CFCL 4AL8L 3C6LB 2VXSL 1OP5H 2OK0L 2DLFL 2BXYA 3OSKA 1JUFB 3Q6GL 2XA8H 3TO4B 5AZEH 4LSQH 2WBWB 5L2JA 2ATPA 4M9OA 4QXUL 4U1KB 4HKZB 4XP5H 1YQVL 3FZUD 3ZKMD 3DTXA 4LSUH 5DEFA 4EEEA 2BVEA 1TITA 1NBYB 3DVGB 4HF5L 4APQB 3LQZB 3TIEA 2J8UF 3WMSA 4JKPL 5BOZG 5IKCA 5F8RC 2EXWD 1DP0A 1VADB 2DJ4A 2FHBA 2A6JA 1I8MA 2KQNA 3MV8B 1F4WH 5CUSL 1FDLL 4HHAA 2P46B 4NM8H 1RHFA 4DCQB 2BVQA 3CLFL 4PP2A 4QXWA 3O0RH 1N5AA 1EERB 5TH2A 3V7AG 5E6YA 5BV7L 2DJSA 2FD6H 3GSUB 1PSKH 4XXDA 2JIXB 5IWLC 1ADQL 3ETBF 5ALBL 2O93L 1DBAL 5EUOE 5FKPA 4XBEH 1MIML 5JIIA 1IBGL 4EVNB 2VDQH 3KR3H 3MRQB 5EO1A 3I6GB 4KPHH 5GS1B 5CHNA 1LP9A 4PJAE 3ELAT 1YEEH 3TBYB 2ZOKA 3KLHC 4XVTL 4NZRL 2DD8H 5HHVL 4Q58C 3TT1L 2JJSA 1N0XH 4KKCC 1TVHB 3HAEA 2Y1VA 3TLRA 1ORQA 3VRJB 4PJ5E 1XGPB 4K9EC 3CXDH 5I8OL 2DKSA 2OS7A 4L9LA 3G5VB 1H8OA 5CKAA 4KKBD 1W8NA 5E0QA 2AK4D 4K8RD 2VQTA 3VD7A 2IEPA 1PKQA 3UX9B 2ZSVB 4KGLA 4P5MA 1MLBA 2HVJA 5DJAB 2RFXB 3TZVD 4R96B 3O41B 3CFKB 4JQVC 2MCPH 4L4TA 3JTTA 1TMCB 2AXFA 1RZFH 1SM3L 5T3XL 4RIRB 3MNWB 1KCSL 4D0CA 3QRGL 2K1MA 1FFNB 2ERJC 1B3JA 3VA6A 4N0UE 1FLRH 4TNWF 5J3HC 4C83A 4B53A 4JANA 3LV3B 4HEME 5I19L 2PCPB 3VXSD 2AABL 4PGZA 1A1MB 1HI6A 3F7PC 3KYMA 5D7LD 4HS8H 1K2DA 5D7IE 4OGAD 4X99A 1OARL 1S8DA 3RAJH 1KTRL 4HSQA 5IB1B 4O58H 2NY2B 2XKNA 3BSZL 1I1AC 4IRSC 2LTQB 4WU5A 3SDAC 4EUPB 1T7YA 2E9WA 5CEZD 4OZGF 3RIFF 3ARBC 3FO9A 1QFWM 4YNYA 4N0CD 4WO4B 2B0SH 3RL1A 4AM0A 2GUOB 3CSYB 1MFEH 3VFMA 1A0QL 3WFDH 1G7PB 2Z9TA 2VOTA 4XMPL 3SY0B 3S36H 4JFDE 4I2XA 4XB8A 5JW4R 3DV4B 4XTRD 1UH2A 3DX6A 2NX5D 3C60D 5DJ6B 2VZTA 4GO6B 3JZ7A 1GGCH 1PEZA 5E2WL 3DHJA 4XCEB 1P9MA 4KV5E 4D0BB 3N9GH 5FYJU 4M7ZC 2B4CL 1SBSH 3UAJC 3SOBL 2ZCLH 2VLRD 2D0FA 2HT4C 2I25N 3B43A 3V5KA 2N56A 3P9MB 2VTFA 2XZAH 4GW1B 3O11B 2QKIB 5HI3C 1R5VA 3QXTA 3K1DA 4JAMB 4B0MM 4DGIH 1R24A 4NQUA 3WUWG 1BVKA 4P4RA 2UWEF 2DMBA 3FFCE 2YPLA 3MJ7A 1I8KA 2BNQE 5D5MA 1U3HC 1ZTXH 5C0EA 3REVA 3MJ8A 5MEND 4YHIB 1KJ2H 2VDKL 1MVUB 2GJZB 4PV9B 3LPWA 3DVIA 4PRPE 4JM4H 3FCTB 2OL3L 1T22B 1T0NA 1I85C 2W0FA 4QRRB 2FECL 4ELKB 5CINL 3QZWB 2P7TB 3CFEB 1A7OH 3MLZH 4LDEB 2P5WA 1NCWH 4L8SC 5K9QI 4FQLH 4EJ1C 1YEDB 4CDHA 1HZHL 4KK6C 4HIHB 5DJ8A 3MCLH 4RFNC 3FRPG 3EYVA 5I74B 2R29L 3ARDC 2H41A 1I8LA 3OJDA 4OCYH 2PR4L 3H2WA 5GJSH 43CAA 1KFAH 3FB6A 3VG0H 1J0KA 2Z31A 1RIUH 2J1KA 3MCKA 3QFJD 2P1YA 1MCNA 1J87A 3T3ME 1YY8A 5C0FB 4HKBA 3ULUF 4P23D 1HYSC 2W59A 3UDWC 1HXYB 2R1YA 1P7QB 3RRQA 1IAII 1CT8B 4F3FA 3L3DA 3GJFH 4OAWA 1GAFH 4U4BA 5JXEA 1DN2A 3VU2A 3B9DA 1LD9B 2I07A 5FIEA 3ZMRA 1KC5H 4M62L 2NY0B 3T0EE 1TPXB 1XIWC 4OD3H 3VGDA 5I8CB 1WC7A 4QOKA 4UU9B 3NCYS 1FNSL 2W0LA 4NZJA 1DSFL 2OBGA 4Q2ZA 3WD5H 3ROLA 3VWJB 5BS0D 4JGMA 5I17B 4Y16A 3TF7C 1IEBB 3KXFE 4OCNC 3RQ3A 3QDMB 1ZAGA 1YN7A 3D3VE 1PY4A 4OLWH 2JJUA 4O5LH 3RP1A 5I73B 4JZJC 3X13B 2GITA 1C16B 1PJ9A 2ILLA 4MNHB 4UIKL 1KJ2A 5CBEA 2RGSA 1FAKT 3TYFA 25C8H 3A6CL 4UIMA 3OB8A 4BK4A 5CJ8A 2F54B 4HJJL 2J88H 5GS2H 3PJSA 5DZOA 4LCIH 3VI3E 5JPNB 1V5JA 4C56B 5JPMB 1KENH 4G8GB 5F7NC 1A6AB 5I15H 5IESH 1CL7H 5T1DH 3KLHD 4HMEA 1MFBL 4JFQA 4YWGL 4M7LT 3GMLB 4KKCD 3W9EA 2I5YH 1CQYA 3GI8H 4XPGL 5F88A 5EOCL 3G6AA 1FO0L 1FSKC 4ETYA 1FVDA 2VZOA 2FLRT 3MRRB 3QYCA 4J6RH 4NZTL 3DLQR 5DSCA 3CCHB 1BF2A 5ILTH 2Z93B 3HNVL 1SYSB 1QKZH 2APFA 3VXPB 2R0WL 4JLRA 2FJHB 5GS0C 2BVPA 4MXVE 4UAOC 4H5SA 4EDWL 2KZWA 5F6HI 1I9RL 2ITDA 3GJFA 5D7JC 5HGHB 5CZKA 5ERWB 1AHWB 2YWYA 4Y19D 2DLGA 4HV8A 3STLB 4RFOH 2F15A 3VFVB 5GGVH 4LVOB 2BJMH 4K71C 3VE0A 5J3HD 1C1EH 1KIPA 4WW2C 2CLVA 3UZVB 1LE9B 1NFKA 1UENA 2DQHL 3CFBA 4IMKA 3RWDA 2HH0H 4UNVA 4LLMB 1INQA 5JDSA 2HLAB 2IJ0C 2HJKB 3NGBB 3HR6A 3LEXA 3TH4T 2CDGA 4QCIB 3DMMB 1CXFA 5E6IC 1WVZA 3WFEH 2KPNA 1BECA 1NANH 3IFOB 2OTUB 1KLGB 2XICA 4K2UH 1WBZA 1I1AD 4IRSD 3SDAD 3MV01 4JZNB 4FQ2L 1I3VA 2ATKB 3F5WB 3SDDA 1J0IA 4I0PB 4K9EH 5HYJE 3ARBD 1BOGB 3S37H 1CBVL 1PLGL 1J0HA 4QGTA 4Z7NF 4PJBE 3OKMB 4JDVA 4NBZB 4PJXA 1AQKL 1ZGLB 4JRXA 2Y7QA 4Z6AT 1HYRC 1JNLL 3WIFA 3ULVE 1NPUA 3QWOB 1U91B 4GKSA 2F53B 3SBWC 1DQMH 4YFEA 2R0LH 2QEJA 2AERT 3LKOA 4DUVA 1QNZH 2A9ML 4N1EA 2NQCA 1I9JH 4LQFH 1ZHKA 5IB5B 4XWGH 1F2XK 1NGXB 2P8LB 3UAJD 4GBXA 2A1WL 3LDBC 4HUWA 4XGZB 3BUYA 1D5BB 2HT4D 2X89D 5GRUL 4OZIB 4JJHA 1XEDA 4LPWA 3HHRB 1RVFL 3UBXA 2X4OA 5HI3D 3HZKB 3STZB 4EN3A 3M1BA 3LEVH 2WM0A 1YEFH 4KFZC 5E99L 3MGOB 3R06B 5DJDB 1YMMD 1U3HD 3VFPA 1D5ZB 5DK2A 3G6JA 4FXGA 5IB4B 4HZAA 4ODWA 4RAVA 1S7UB 3FB7B 5DUBB 1BD2A 3MRJA 5EULV 4O02H 2BMKA 1QRNA 1BFVL 2PYFA 4JR9H 2DQCL 2QQNH 4LLQB 3S98A 3HE7A 5KSVA 4OLXH 4BUGA 3PE9A 3EYUH 4YK4C 2EIEA 3AGVA 4Y8AA 3L1OL 5EC2A 4LP5A 3GRWA 4KK6D 1BBJB 3VFRB 3UYRH 1MVFA 2APWA 4OLZL 5DQDL 5F9DC 3MOBH 5AAWA 1KB5B 2JK5B 2I60H 4FQXC 4F7EB 1QSFA 4ZUWA 4ZTOL 1YEGH 2A0LC 3GUTB 1ZA6A 1BJ1J 4HT1H 2A73A 1M7DB 2UUDH 4FN0A 4E41D 3ME0A 4Y5YC 2WIIA 2GFBA 3L6FB 2DDQH 4IDJH 1IFHL 4JPIA 4U6YB 4ONGH 1IKFH 3PGFL 2R4RL 3O4OB 4KVNL 3LS5H 1U92B 1T04B 3ARFA 3QUZD 1WZKA 2WBJC 4RRPG 5ETUA 1T20B 2EC8A 5ANME 3MOQA 4OFPA 4Z7UA 3T08A 1XIWD 4FFYH 4PJEE 4HUVA 4B7LA 3L5XH 5FDWA 1FFQA 2OZ4L 4NQEB 1X6LA 3QUXA 5DDHA 1SYVB 2NXZB 4Z7WA 5E00A 4MNQE 4GRLB 3UJJL 1D6VH 3VXMD 3MUJA 3VGFA 4ERSH 4PB9L 3LVEA 5DT1L 5IW1B 3U9PL 4R2GB 3R1GH 3SKOB 1F11B 4L1DA 2XPGB 3S36X 1SJEA 3MV9A 3D39A 3EO1B 2AEQH 4GW5B 2YD2A 2OMBA 3CVHB 4TTGA 3MZTA 4NKDB 3EOBA 1RZKH 5C0AB 1FG2B 4JFFB 2X5PA 1GGBL 2AJZA 4P46C 1OGTA 4ZS7H 4ZXBC 3H9HA 5CSZA 5EZIL 3KYOA 4K3DH 4D0DB 1VKXA 2EICA 4OGXL 1TCMA 3B9AA 3WN5C 3KDMA 2RIKA 3C87A 3DUHA 3GK8H 1FYTA 4P9HL 4NRYB 4PRNB 3ARVA 5IBTL 4CMHB 3EDJA 4M6ML 4ODTL 4G8FA 5GS0D 1NGPL 3G6DL 1AGDA 3OKKA 3WIHH 4X9HA 4M1GL 1ZHNB 4PRIA 2PTTB 3MRBA 3WXVH 4M6OH 3QDGE 2DM7A 3WUWB 4I9WE 3RDTB 2VAAB 5DEGA 5J1TC 4KKLD 3MA7B 3KYNB 4WCYL 4Y4FB 4OKDA 3SKNA 1DQLH 4MCYB 1HXMA 3K2MC 1YYLH 4UDUA 3KJ6H 4UOJA 4LSRH 3W0WB 1RK0B 3K74B 1T4KA 4EI5D 4X80H 4ZFOL 3HCVB 4W4OC 2JB6B 1MHCB 1NAMH 3Q5YA 1JE6A 4PIRF 5GRVK 5CAYB 5E6ID 2ICWA 4HAGA 4JHZA 3S8WA 3ORJA 4NKIL 1ZLWK 3T3PF 1ZE3C 5D9SB 2PO6B 4YAQA 3L3JA 4M02A 4N68A 5ICXA 2X44D 3MBEC 4NQCE 1MFCH 1L7TH 5FYLH 1C5CH 4FNLH 4P5KA 3LKRB 3S3SA 3CVIH 1FVCA 5I1DB 1RUAH 5JW4N 3AXLB 3LKQA 3MJ9H 4UTBH 1LK3L 5KSBA 4HBQA 4HMDA 2XN9E 3PHOA 3V4PH 5JHLH 5LVEA 2NY7L 4YHYB 1R3IH 4G9FA 3OR7A 2FWOB 5F9AC 4QHUA 4FFZL 1UZ6F 4X6CA 2R69L 5KVDH 1Q9OB 2PYEB 5EU6B 4U6HB 1FFPB 3CC5A 1TVDA 2YZ1A 3TBVB 2HG5A 2V7NB 3V79C 3CDFA 3BIKA 3L3IA 5D5MF 4G8EB 3VI4E 5SWQB 1AP2B 5KVEL 1CF8L 1F4HA 1ZVHA 2P8PB 4ZOAA 5GGRA 5GRWA 2VLME 4JZOB 5BRZB 3DSNA 2OX5A 1I75A 1UJTA 2AEPH 4DEPB 1P7KB 4MCZA 4IJ3B 4PJFB 2H2PC 4OZHE 3GMOB 5HD8C 4ZFZB 1MPAH 4HX1B 1XR9B 1FVEA 3QJFA 4ELMF 1U2HA 2OCFD 5DK3A 4KRLB 2B39A 3VJ6B 5KZCB 4AIOA 4WFHE 1K6QL 3CAFA 2JJSC 5KANI 2CH8A 3SHSA 5E9DD 4MAUL 3QUYA 1NAMA 1RUPH 3O2VL 4LLDA 1A6WH 4NQSB 1NBZA 3AREC 5DD1L 5FOBB 2EDEA 3OGCB 3BZ4A 4L29B 1MCOH 3L5HA 5T3ZL 3OL2A 1DUZB 3TA3C 1T0MB 5FHBL 2V5RA 1B4JH 2VMFA 4W70A 1LDPL 3ZTJG 4I77H 3X3GL 5F1IB 4PJCF 5DS8B 1BBDL 1SMAA 3NZHL 1GZQB 3HG1D 1ZLUH 1OPGH 5E24E 4TNVK 3C2SA 2A0LD 1QBMH 3MV8E 1NGWA 2C3VB 4JM2A 4R6UA 1CGTA 2WLZA 3SKUD 5A16B 2YOCA 3L7FB 4JG0H 3QUML 3QXDB 5E8OA 2J2ZA 4OZFH 2ARJB 3MRNA 4OT1H 1F00I 1YPZB 4HS3B 3HB3C 4AL8H 1QSZA 4OTXH 3SN6N 1CLOL 4P4KC 4G9DB 3F58L 2AGJL 1DLHA 3PWPB 4WY7H 5ITBH 1N7ML 2WBJD 4WW1B 4NKOB 5JXAL 5ISZB 4BQBA 2YZ8A 4QXUH 3B6SB 2AV1B 1EJ6A 5JLZB 4J3XA 3FRUB 5DO2D 5E1AB 1UKQA 2BNRB 4GW4A 4JREB 3LKPA 3WFBH 1FPTL 4P3DA 2P8MB 4Y8DC 1JYWA 1I9IL 4HLZG 3S37X 3D18B 2BVOA 4JPVH 1AQDA 4DTGH 1R3LB 1Y18A 3MNVB 2V5SA 4AENA 3OR6A 2VSCA 2Y36H 2MQ3A 1WBXA 1JJUA 3NN8B 2D3VA 4LNVA 1J0ZA 1DN0B 1JGUH 2FL5B 2VL5B 5JOPE 1ADQH 1I8IB 2FIKA 3CH8A 3C8KA 1EO7A 1D9KD 1TVBA 1MIMH 2YR3A 5FCUH 3RWEA 4P46D 3B3IB 4GKNB 4R4FL 2CR6A 4D9LH 4ZXBD 4JB9L 4FHBD 3D48R 4MMZC 4HULB 4PJIB 3VGAB 3C9NA 1E4XL 1G7IB 5E2TL 5GSVA 2FJGA 1A9EB 4PS4L 5KTEH 4XBGA 1L6ZA 2DBLL 2OR7A 1CVSC 2MCG1 4DZ8B 2DJUA 3TVMB 4MJ6A 5T1LB 2ZUWA 4LHJB 1JRHL 4NM4H 5DUML 2ZUSA 4KI5F 1NAKH 1NL0H 1JPST 1ZVSA 1U3ZA 3TPUA 1XGUA 4P2QB 1AI1L 1VGEL 3CD4A 3P11L 1SM3H 1RURH 2WANA 1KCSH 1HEZB 3QRGH 3QEQB 3QULA 1G6RH 5IW6B 2OR8A 3O6FA 4U6XA 3BESR 3VRLE 5JOFB 5KG9A 2NNAB 5I19H 1T7VA 3MX0A 4QF1A 2IAMB 1NCDH 4PJXF 4PY7A 2X4PB 3QCUL 5JW4M 1OARH 5JA8B 4P2YA 2Z31C 3BP5A 3VDCA 1IEAA 4MAYC 1NFIA 1DBBL 1NMBL 4KHXL 2J8HA 3BSZH 1KN2L 5INCB 2VZUA 3DI2B 3I50H 4JDZB 2E7BA 5F7UA 4GG6A 5C07B 4IHOB 5FEBA 2R0KL 1ADQA 4YHOL 5DD6B 4S11A 1LE5A 1JWMA 1ODAA 1RAMA 5I9QC 4BYHA 3GSNB 3NFPB 3T4YB 4Z0XA 3P40A 4ZTPL 1VFOA 4WV1B 1D3CA 1A21A 5FYJE 5HHMD 5FB8A 4OLEA 4TUOA 3VFUB 5HHQA 4G42A 4QRRE 4XXCC 5E2WH 4WI9A 3SDCB 1OSPL 3ULSA 2X1XR 2E27L 4L3CB 1C7TA 3CH1A 3BAEL 4YHKL 3H3KA 2XZCH 1XF2A 2B4CH 3Q5OA 3BPOB 4ODHL 1CE1H 3DPBA 5IEHB 3MR9A 4KK9D 1S78C 4NO2A 3B9VA 5GS3A 4NOFA 2JB5H 4ZYKA 1NANI 5J1AB 2H2PD 5JIHA 5HD8D 3WDIA 1OF2B 2FGWL 5I2IB 3ULVC 3FN9A 5H94B 1JWUB 4N8PA 5C7XL 6FABH 1KG0A 1C08B 4QY8B 2WNGA 2J6EL 1D5MB 3QG7L 4M7KL 2A9NH 1FL5A 3EFFA 4M48L 4L8DA 4URTB 4W6WB 1EGJL 5CKGA 4DWHA 5EU5B 3FQTA 1XR8A 1GIGL 2VDKH 4AYFA 3ARED 1I3RA 2Q20A 2X4SA 5J13B 2MFNA 4PBWD 3SO3B 2X9XA 4BH7B 2RCSL 5AD0B 1YNLL 4FQJH 5CINH 1V7NH 5DVMA 3E6FB 4LPUA 4ZUVB 5C9JB 1AGCA 1O0VA 1U8LA 4PJDF 2NTSP 4OLYH 1TIUA 3O6ML 1GC1L 2VDML 2EE3A 1JF1B 2UYLA 3VXNA 1VFUA 1T3FA 2FO4A 4L4TD 1AGEA 2PR4H 1CIUA 3QDME 3GMNA 1CN4A 3EOTH 3A6BL 2H32H 1MFDH 2XY1A 4JO2L 4IS6A 4R90H 4Z7UF 3VWKB 3QCTL 1FBIL 1GGIL 1AIFB 1M4KA 1QQDB 2LE9A 3VXUD 3K8MA 3BZEA 3WFHA 1LK2B 4XNQA 3GJEA 4PJHA 1DBJL 3HB3D 4FZ8L 1B90A 4P3WA 5D71H 2F54E 2F74B 3RNQB 3TIDB 1KXQE 4P4KD 2DL9A 5FECB 3EBAA 4PJ5A 4C56E 4G8GE 2BOBA 2MJWA 4XPHH 4KKAC 1SEQL 4L3EB 3RVUC 2Z4QA 4WFFD 4OCRL 5FYKL 3PHSA 4HUXB 1FFRA 5B3NA 4GAJL 4R7NA 4X4XB 1E28B 1ZXQA 4X0KB 1FNSH 5LXGH 3VXQB 1OSZA 4QYOB 4TULL 1V3KA 4Q7DA 3PWUA 5DK0A 1YEHL 3H3PH 2IMNA 2AQ1A 5C92A 3FT4A 1MRFL 4U33A 1KJVA 2XQBL 4NHCH 4N0UA 2AJYL 3WDJA 5MERB 1VEMA 3BH9B 2W0PA 4N8CH 2OL3A 1U58A 3GKZA 5JTWA 4JFOA 4MJIA 4ZDHA 4ORGA 4AT6A 4JHWL 3V9FA 1FZKA 2GSIB 5B21A 1KULA 5KVFL 1T83A 5DMIL 4CUCA 1B6UA 2QHLA 2CRIA 3MXVL 1MFBH 1UG9A 1P4IL 4LAQH 4JDTH 4P9ML 1IGML 5DGRA 4YWGH 1HHJB 3PHQB 5FGSA 1UXWA 5J6GB 1G6VK 1I9EA 4Z7VB 1FO0H 3BGMB 1WTGT 2YEZB 1N8ZA 2VKXA 1U8IA 2H32A 3GBMH 3RFZC 1YEJL 5JOEA 4MVBC 2YPLD 4H0HB 4HH9B 1GSMA 4NRXA 3IDIB 3HNVH 3F7RA 1Z3GL 4KVCL 4K3GA 3MTRA 1N6VA 2VZVA 3UYPA 4JFEA 3I75B 1S7TA 5DURB 3L3OA 5JR1L 1ZLSH 3QNXB 4EDWH 1I9RH 3OHXA 3RPIA 4P0DA 3RI5F 3LN4B 1F90L 2YKLL 4MDJB 2FCBA 1UWXK 1KCVL 1WZ1H 2X4UA 2P5WD 2PN5A 3IJSB 5GQBA 2E9BA 3EZJB 5ITFA 5IG7A 5F6IB 2CMRL 1FNEB 2EIBA 3NIGF 4XC3H 2F53E 1X4ZA 2PXYA 1AXIB 5CEYB 5L7XL 4YUEL 3VH8A 3DRTB 1S7WA 3GMRB 1Q0YH 3H7BB 2A6DB 4UQ3B 3BO8A 4JFXB 5ESVB 3S4SG 4M3JA 2Z31D 1JI1A 3C2AH 1PGRB 5KSBF 5EOQH 4MAYD 4OIIH 4P59L 3R0MA 4ZPVA 5AYUH 3IDJB 5HYSG 5BZDB 3G5YA 3B8SA 1J05A 3FQUB 5TGBB 4OZIE 3SE4C 4RQQA 2BNQA 4FQ2H 4QNPE 1TQBC 1BJ8A 1FJ1A 5E56A 4NWTL 7FABL 4OCWL 5C0JA 3QQNA 2YK1H 1IL1B 4OQTH 5JXED 4QRTB 1CBVH 2OR9L 3RIFK 3T77A 3QJHB 2MHAB 1A4KB 1AQKH 1U8NA 5CJ5A 1ITBB 4UOW0 5BCAA 4U1NA 2BFVL 4IOSD 5ENWB 3V7AE 3HZVB 2GK0A 3GSOB 4Y1AB 2R1XA 2R1WB 1EIBA 3HI6L 5IF0B 4QOKD 1FO0A 2DQTH 4LSTL 2K7QA 1HSBA 2EO1A 5BZWA 4JGJA 1R3JA 3GSWB 5F44A 3GMQA 2A9MH 1Q9WB 4NUGL 1F3RB 2DI8A 1FCGA 5HYJD 3QHZH 1G7QA 2C4XA 4YDJA 5IM7B 1LEIA 1GPOH 3IVKB 3WJJC 2A1WH 3K7UA 1QP1A 5B3JE 3MUZ1 4Y2DA 3QIUB 4WTXA 5ID1A 1MCEA 4K23L 2PW1B 1FZMB 4OV5A 2FRGP 4S2SA 1RVFH 1LO5B 2GAZA 1T1YA 5I1LA 5IMKA 3MA9L 3MRKA 3HC3H 3KS0H 3RGVC 2O5YL 1AR1D 2ZUQB 1S7VA 3FT2B 1P69B 4MHHG 4U1MB 3TM6A 3WO4C 3CUPA 2I9TB 5D1XA 1MFAL 1W72B 4CVZB 1Y6NR 4YZFF 1OD9A 4LEOA 3DX8B 4M6NL 3V6ZB 4ZS6D 2BCKB 1U42A 1RFDH 1CD1A 2ESVB 3RWGB 3MXWL 4ALAH 1XGRB 3U48A 2Y06L 3RBGA 3IXTB 1QFWI 2F5BL 4LF3A 1QD0A 3L1OH 1OAQL 4K7PL 2QQKH 3EOYG 4HCRL 3H3BC 4PBXA 2XI9A 4NQEE 1X5ZA 1A7PL 1V3LA 3HRZA 4QEGA 1TCRA 4OQTA 4MDIB 1RK1B 2VNCA 4MWFB 1EVUA 4U1SA 3IF1A 1EHAA 5DRWB 3L7EA 3C6LC 3D69B 4WW2F 2E8YA 4RX4D 4ZTOH 3T0VA 5L6YH 4QXTB 3TO4C 1S7SA 1NFDF 1KCUL 3K8LA 3G9AB 3TYGL 2YXFA 3HC4L 5IHUL 3MLVH 2ZCKH 2V17H 3U2SB 5SWZD 3BVNB 3MRPB 4LVHB 5HI4C 5C0AE 4JFFE 4N0YL 4ODUA 5ACZA 5LQBH 1NDMA 1MWAH 2VDOH 3IT8D 4IOIA 2IQAA 5E08L 5DGQA 3SDXB 3MYJA 5D96B 4GAGH 1H3TA 4I1NB 1TZHB 1L0XA 3FT3A 3MODH 4WWKA 3WNPA 1BOYA 2HFGH 2G75B 3IDXL 3VXSB 1IAMA 4Q6IB 2OZ4H 1Z5LB 1G9MC 3BMVA 3U7AA 3BPCB 1BQUA 3QG6A 3Q1SL 4XNUH 2EDFA 4M43L 3WKMH 4KTDL 3RHWF 2P5EA 4JRXD 1NMCB 1I7RB 5ELIA 1OAYH 4L4JA 1G7JA 5EU3B 1DZBA 3KPLA 4E42B 1PKOA 4Q0XH 5FO7B 2DWDB 4E5XA 3AAZA 3JWDH 3K4DA 3DYMA 5F89A 1LNUA 1A1OB 4B50A 4PJ9A 1DDHB 5BQ7A 5EO9A 5EN2B 3U4EB 4P2OA 3IS1X 4RWHA 4WDIB 2H3NB 4GBXD 1GGBH 3U36A 1MJUL 1FYHB 5TFSL 4I3GA 4ZNEA 2DIAA 3SGKA 4AMKL 2XZQH 2I9LB 3C08L 1JK8A 5EZIH 2Y23A 1ZT4A 3E0GA 4R0LA 3W0WE 3RIAK 2VISB 4LCCB 3C60B 1QTYT 4Y5VA 4PV8B 1T2QL 2B1AH 5GISH 3BGAA 4Z8FL 1ZS8B 4HFUL 1A8JH 4XAWH 4P49A 4BELD 4M6MH 4ODTH 2AXJA 3ZE2E 5DRNA 1JZ5A 1Y0LB 5SV3A 3G6DH 1W0YT 2BSTA 1ZV5A 5KN5B 3RUGA 4C54A 1QRND 1R3KB 3EYOB 4M61B 1T5XB 4M1GH 2GW5A 4HDIB 4YEFA 4JPKH 3VFWB 4LKXA 4WCYH 2VLJA 5F7KC 3UPRA 2VITB 4GG6F 1AD0A 5J1SC 4I3RH 3UEZA 3DVFA 2OZ4A 3B9EA 5MENB 4MLSA 3X14A 2PYEE 1BX2B 5EU6E 3UJIH 3OKLB 2ADGB 5I0DA 3MO1B 2AS5M 1NMAL 1ZT7B 2EYTB 4Z95L 1F4AA 1B0GB 4LHUA 4QLRA 1L0QA 2Z35A 4JM2C 3VFOA 3CDYA 5KS9B 4NKIH 3QI9A 5DQ9A 2ORBH 4HK0B 3QDGD 1RIVL 3S35H 2VKWA 3NCJL 5BRZE 3DVNA 5EPMA 4LLYA 4F7TA 1JF6A 3GHBL 4ZODA 4PJFE 1U8QB 4NQXA 2P44B 3ZHDA 1QR1A 2VWEE 2W0KA 3ECBA 4D9RE 3C5SB 1NGZA 5L88H 2DAVA 3C5JB 5D6DA 4YDVA 3B5GA 3V0WL 2O5XH 5H35A 4KMQA 4QHMA 4J3VA 1J88A 4JY6B 4P23B 1JYVA 2OYPA 3G5ZB 4X6BA 4FQHA 2CD0A 3ROOA 3DROB 4H1LG 3TN0A 2A74B 5EIIB 4JQXA 4NQCD 1I1FB 2FGZA 5GZOD 5B8CB 1IGTB 3VCLA 3RZCA 2HKHL 4HUMB 1NC2D 4OD2A 4X8JA 1RUQL 3WE6A 2JJWA 1CF8H 2IALB 3QO0A 1EEQA 1PDKA 5ICZA 3GNMH 1I3GL 1CLYL 2EDXA 2V7HA 3OAYK 4PTUB 4RA3A 1MHHB 3PQYA 1KXVC 5BS0B 2A38A 2GKIA 3T4AB 1WFOA 4ZUTA 3OG6B 2R8SL 1JHKL 4N8VA 1FG9C 5ECJE 1VA9A 2A6IA 1YPZE 1QA9B 3P73B 1J8KA 3I84A 4O2CA 4ZFOA 1MF2L 3D0LA 1IT9H 5LAXB 1Q9LB 5DD0L 4XPAH 5FO9B 3O2VH 3WDHA 4UQ2A 3F6IA 3PWPE 5DD1H 4QRSA 5D1QA 3HFML 5ISZE 2CJUH 4LRNH 3L3KB 2GTWB 4JGUA 2X2YA 4PJAF 1YEIH 4JG1L 5IVNA 5FHBH 1OWRM 4LNRA 3IFNL 2BNRE 1XZ0B 3X3GH 1QLRB 1BBDH 1F3JA 1LO3H 2B5IC 1GHFL 4PRID 4XCFH 4G6AC 1ORSA 5KAQF 2IPKA 1SEBB 3BKMH 1FIGL 2ICEB 4M7JL 1CXKA 5HGBA 4M3KB 3RWIA 2EDTA 3TO4D 4E0RA 4ZOBA 43C9B 5CD3B 1MCJA 1U93B 1S7QA 1DQTA 4NWUL 3D9AL 2JCCA 4J12A 4JY4B 1W8OA 3P30H 1A7NH 3HS0B 4KUZL 1TPXC 5HI4D 3MRGA 2XWJB 1YY9C 4I8DA 3MRDB 1LO2H 5CCKL