2WTRA

Full length arrestin2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
394
structure length
356
Chain Sequence
KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSDVAVELPFTLMHPKPKDDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords BETA-ARRESTIN-1
total genus 58
structure length 356
sequence length 394
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA01
4GEIA 3LH8A 1G4RA 1JSYA 4GEJA 5F0LB 2WTRB 4JQIA 3GD1C 1G4MA 1AYRA 4ZRGA 5F0PB 4LL1A 3LH9A 3UGUA 4R7XA 1CF1A 3P2DA 3UGXA 2R51A 2WTRA 3GC3A 4R7VA 4J2QA 5F0MB 3LHAA 2FAUA 1SUJA 4LL4A 4GFXA 5F0JB 1ZSHA 4P2AA
chains in the Genus database with same CATH superfamily
3QWNA 3TGXA 4AJVA 3PXLA 4OF7A 5JQIB 3SDDB 4XVJH 1L3WA 3W39A 3FQ4A 4BFIA 5IT2L 5MEQA 3QO1A 3KL3A 5EC1B 3HG4A 2QDWA 1G7IB 2RB8A 4LKCB 5HJGA 4A6YL 3TBSB 2YHGA 4WQOA 5KEZA 1FNLA 5CMAB 5E99L 4U33A 2GSMB 3EBIA 4FQJL 4CW1A 4Z78B 3CFDA 2BWQA 4L0ZA 4PTUA 1M4KA 5I8EB 3M17B 4H25B 1SVBA 5JW4Q 2BSDA 2JI1A 3NEEA 3RL1B 1CDHA 4PVLA 4QRUB 4Q6YA 3JWOC 2H26A 3B56A 4Z77B 4HIJA 4G6KH 4PRPB 1WCQA 5C07A 4KKAD 4AIXA 3CSBA 3PFQA 3QEHB 4BKTC 3DPBB 2Z91B 4IBUA 5MI0B 3E6HB 4GKOA 3D85D 4OJAA 1D9KD 2G2PA 4UI2A 1SYSB 3PWJB 3HTLX 1HIMH 1AIFA 4N85A 5D7JB 5DC4B 3HB3B 5MENE 1KIQB 2Z0UA 3QUZB 5D1ZA 4LOFA 4ZMLA 3S5LG 4ZMPA 4UTAL 4N25A 1D6EA 2BFVH 2Q6WA 4CBPA 5JHLL 1JGEB 2ZUSA 3QC5X 4I18C 2YC1B 3ARDB 2E7DA 1CI3M 1QHQA 3U6RB 1YNTF 1P5UA 4OZGF 4Q7DA 4M6MH 4CJ1A 3BIBX 3M1OA 3EH2A 3WTSA 2EVGA 1A3LH 5FYJD 3DIDA 2V7HB 4TV3A 5EU3B 3ATDA 2D4FA 3VI4A 1YG9A 3SBQA 3FT1A 3QSKB 3SKMA 5HJDA 4PCYA 3RIFK 3BAXA 4XO9A 1ITCA 2QQLL 1D6EB 3U0TB 4Z3JA 2J5LB 4K07A 3TO2A 3D39B 4LKXB 5EEVA 1RD6A 2J8UA 4JFFE 3HCVA 1AS8A 3PWJA 4W9ZA 3ABLB 5LLIC 1LP9E 1WCBB 3CUPB 2G3NA 1AQKH 2FQDA 5K9QG 3E6HA 2JB6A 5DDHA 1FYTD 2PO6B 1S7QA 2EXYC 2C7FA 3B2VL 3FT4A 2A2QT 3GSUB 3OV6A 3QIUB 3QISA 2XWJA 4LRIA 5FS5A 3V8CA 4PJ9A 1G94A 2ZUUA 3CFEA 4F33B 5HBBA 4WWKB 5EUKB 4FFYH 5DJ8B 1JUFA 4FA6A 5EBWB 1IM9B 1RH8A 4U3XA 2UZXA 3UBHA 1MHPH 3NPSC 4D9QE 5I1HH 4OIIL 3S3CB 3FUFA 1E28B 2E6PA 3QUZC 4AEHL 1MW2A 2CIKB 2JCCE 4CMHC 4G42B 2IH1A 3OKKA 4U6YA 4A7GF 5CILL 1K9TA 2BNUA 4Y4HD 2J56A 1KMGA 4PGDB 3D7PA 5F8RC 4F58H 2NY2B 2EO1A 3BUPA 1MFNA 1ZA3A 4WI0B 4DKEH 3PQYA 4OCMC 3VD1A 1SUHA 2R2HA 3VWJC 3BPLB 5B1JA 1U93B 4D9QD 4N8VA 4IU3B 4FGMA 3S3SA 1UKQA 3DPDA 1H6EA 4PS3A 2F7PA 1I3GL 1VACB 2NCMA 1DBAL 3BSGA 1LYQA 4HC1L 5ALBL 5DRNA 2G0KA 1LWRA 3LS4H 2V9TA 2XA8H 2EE9A 3ILQD 3GUTA 2XVBA 3WKML 1RU9L 4M61A 3G08A 1OP4A 3EGSB 3ZPDA 5FGBC 4WO4D 3GMLB 2YMXH 3SKOB 3Q7JA 2X87A 1Z5HA 5D71L 1MVYA 4LBAA 4ZFGL 1HINL 1JUFB 1OAQL 35C8L 4K7PH 1U3HC 4OKVB 3FCBA 4X50A 2ESVE 2BC4A 4BRVA 1KBWA 4B6ZA 5LG1A 5JA8B 4RRPM 1EUTA 2HJKA 1V3LA 3EADA 4M6ML 4E5XA 5EZOH 2F74A 1OTUC 4K5OA 1GMIA 3PWLA 3S36L 3O9WA 2G0LA 4QOKD 4FS0A 1ODAA 1KPUB 2B8OT 3I74A 3MJ9A 2ARWA 4AGPA 3SE3A 2NYYC 5LBSA 2IH3B 2Y2TA 3CK0L 5JHMA 1S78C 2V8LA 3HC0B 3CIAA 3PP3H 5DJCA 3L5WA 3WE6A 5BS0E 3ABZA 3MRRA 5B39A 3HN8A 4F7PA 3NZSA 5DVMA 4AT6A 3OJVC 2ZSWB 2XKUA 1BZEA 2CHNA 4FXGC 4XHQA 5IIEB 4XWOD 1MRFH 5J6GA 2ZUXA 4TRPH 1FNAA 3FFCD 1SLUA 2JCCB 1F1GA 1CQYA 5DUBB 2VN4A 4U6VH 3QIBC 4WW1A 2CLRA 3DO7B 1XH3A 2YWZA 4YAQB 1FPTL 1OO2A 3JVGA 1J8HE 1Q90A 1ZJAA 3SE4A 1ZK5A 4PVMA 2EE0A 3JUZA 1NQBA 4L4VB 1KGWA 1Z3RA 4NKMB 3ZE0E 4L8CB 3VFUA 2DLIA 3PRZA 7FABH 3WKMH 4LARL 4CADA 4PWKA 3PAZA 5IG7A 2DL9A 4HMEA 1R34A 3S35H 2KQMA 2IAMB 5AWNH 1AZCA 5EEXA 3VGDA 1XGPB 1TEYA 4TLKA 2WGNB 4YBLB 5C0AB 5HYJA 4E9RA 3BW9A 2QTVA 2OTUA 1CI5A 3F01A 1DP0A 1WC7A 4JRLA 3N0AA 1T5WB 1PDKA 3L1FA 4FA8A 4YSSA 1F8TL 2I07B 3T0EA 4UYQA 2CJ3A 1LK2A 2HT3C 2AXFA 3K72B 5HJ3B 3DSFH 4OCWH 4BELD 1NEZG 5HYSB 1XVSA 4HUUB 3H9HA 1X3DA 2D9QB 3O6ML 1AGEB 4N2IA 3SE8H 2GAZB 2WBJD 2XI9A 1AXTH 4N0FB 1JF6A 2LFEA 2PW2B 4GW4B 5DI8A 5ANMB 4RDBA 3KJ6L 1OWRM 4OCSH 2GJ6A 1OV8A 4EDXB 2HZHA 4JY6A 3F7PC 2HJLB 4JFHE 3TJEH 3OKDA 5EPMB 3FO0H 1OF2A 1FLRL 4M5TA 4EI6B 3VXSE 2D03L 3CXFA 3GFUA 4BRJA 5JW4R 3EJZC 3TO2B 2BHUA 3QHZH 4NO5A 4O5LH 2XY1A 2VLMD 3T2PA 4ANWA 3A67L 2XZZA 3N6YA 4K3JL 4H1LA 5DUMH 3QZWG 5C6TH 4XH2A 1FPTH 1AXIB 2OYPA 4U1LB 5DJ6A 2IBBA 1WK0A 1J1PL 3F2LA 3Q3GB 4MMXB 2LVCA 4R4ND 4JR9L 1KCSH 3CH1B 1ASQA 5IB4B 2YN5A 4F9PA 1AKJB 1F3DJ 1H9VA 1MN4A 1OCCB 3SY0A 1NCHA 1IC5H 1R5WB 1YN7B 4BFOA 1YUHA 5HPMB 2AP2A 3L3KB 2FL5A 4OGZA 4HUKB 5E03A 2YAEA 1GW6A 1SHXA 5KG9A 1AIFB 1OXYA 4PJGE 3H55A 4W9JC 3DJRA 3H9SB 3VXTA 2Y7QA 2VXSH 4NBZB 5CJXC 3Q6FB 3ZDYF 2A74C 1ZVNA 3AVEA 2NSQA 5E8OA 3ROOA 1OTSC 2PR4H 3TBYB 2V8MA 3NFNB 4GKNB 1N3NA 1KTLA 1YNKH 2Y06L 4U4IA 1IAII 5HI5C 3DSFL 1UTDA 2JXMA 3EO0A 4QHLB 5E2UH 5DO2D 1WVZA 5I8OL 1NL0H 1U91A 1JPTL 2DYPD 4AH2B 1DCEA 3E6FB 4FJYA 2HJFA 4MRBA 4PJEA 3N41B 4UQAA 3QDGD 1I1YA 1U8HA 3CDFA 2ATPA 5I6PA 4U4BA 2EIKB 2DD8H 5FF6A 3PIQA 4LVEA 1BW8A 4C47A 1CC3A 1XB3A 3DO3A 3MXVH 2UXTA 3FQWA 5DJ6B 3BDYH 1QLRB 3GUTB 1MFAH 1HHGB 1MCPL 3TIEB 2VM9A 1T03L 1KCBA 1TZIA 4OLZH 1BEXA 3OF6D 1FH5H 4MCNA 4ODHH 5JORB 1S7WB 1UXSB 1E3XA 4HV8A 4YIQA 3MV8D 3AREC 5ABAA 3HE6C 4FLOA 3LIZA 1F3DH 1NEZA 4M1GH 5C07D 3BP7A 3GC3A 3OF6A 4JRWA 2AJYH 4WNQB 3JT2A 1JGVL 4MQTB 2JJWA 2C4FT 5IJCC 1NLDH 1B6UA 4JHBA 5F71A 3COOA 3QQDB 1GZHC 1KLUB 3TIDA 2WYTA 3ZO0A 1AOZA 4YZWA 1SFDA 1KWGA 2OV0A 2C9VA 2I85A 5IUSA 4OCRH 3JTTB 1ED3B 1YPZA 3HE6A 4R9HA 3RDTD 1XD1A 1V7ML 3FONA 3HRZA 3PP4L 3SCMA 4KJYA 4X4ME 5EHFA 2VLRB 3HS9A 4PMFA 3TA3B 3V0JA 1GYVA 3C2AH 4R4NC 4YXKH 4KNSA 4RMVA 3HZVB 1I1CA 2B20A 2LHAA 3DA0A 4QXGL 1ZK9A 4UTCA 2QPFA 3L95B 4HK0B 1LQSR 3UO8B 4MD4B 5LXVA 5AAMC 1UACH 2B3RA 4N2GA 4S1DD 1H5BC 2YD7A 4P3WA 3D12B 4FFYA 5JA9A 4LPWA 5JIPA 5BRQA 5FECA 1L0QA 3BSZA 5KVDH 3MSPA 3BH8B 4WJG3 3MLVL 4N8VB 1NSNH 3DVNB 3K6DA 3QQ9D 2OQJB 2AEWA 1RPQA 1BYPA 4Q97A 1Q1JL 1O0VA 2YAQA 4IKNA 3U0TA 1BHGA 3IAQA 3RVVC 2QVIA 2DPKA 5L7XH 3P9WB 3ZSSA 2DWEA 1CBVL 1CZ8L 3HHSB 2J88H 4IIZA 1ECZA 3HC4H 4DPCX 2C3HA 1N68A 5DO2C 5I1DB 1PYWA 2XETA 4A2DA 5I1JH 4K73A 3BQUB 4HMCA 1CWVA 3OZLA 1AHKA 3L17A 1XBDA 3DV6A 3W38A 2OL3A 2VLJD 3CXDL 3KLSA 2AJZA 3APDA 1BSIA 3BLBA 2EDKA 2XXMB 5T1KA 5EBWA 1IBDA 4LEXH 3B6SB 1OTTC 2BERA 5I76A 1H6FA 2HFFB 1CO1A 4ZQKA 2FWLB 3QQNA 3MLTA 5DZNA 4Y5XA 4G43B 1AHWC 2BW4A 4NZRH 2ORBH 1TQCB 5LGHL 2CALA 2A7BA 3ETSA 5FECB 3ARED 2O4EA 4M9PA 3QNZB 3ATEA 4OZ4A 2PN5A 3DK2A 4QRTA 4U6YB 3ZLQC 3BAEH 3VH8A 1B0GA 2AQRA 4UUJA 4B9FA 1CT8B 3NT0A 3FTGA 1AG0A 3NACH 4W9GC 3L5XL 3NOIA 3SGEH 4CGUB 4YHYC 3REVA 4F2EA 4JRXA 1JPTH 3AREA 2ZOOA 3GBML 2EXWC 3JV0A 4W9IC 4L1TA 1DBJL 4U3HA 2OL3B 3V4VB 2HVKA 3F58H 1T2QL 3FQ2A 3LZPA 5IEHA 4ENZA 4NAMA 2AQTA 1CFTB 3GQFA 2ITFA 4NQDB 4OD1L 4WI8A 4WWNA 4JPWH 5H2BB 2QHRL 4PN6A 1T04A 2CLVA 2AEQL 3FQXA 1HIML 5ADOL 1TQCC 1T6BX 2A9AA 3DUUA 3CFBB 4KI1A 2PLTA 2PNDA 3B7UX 2CGZA 3IF1B 1ONQA 1RZGB 1RMFH 2G4GA 4KRMB 2R4SL 3ULUE 1HSAA 4BUHA 3DTUB 4FNTA 2VDPH 3VYNA 3PDOB 1NC4A 4K94C 2OLDA 2A9DA 3MZGB 1JAEA 4XE5B 4CILA 1LP9A 3O6FB 2YEQA 1N64L 5ANME 4MJJA 5HDRA 1HEZB 1KC5H 2VW7A 1FFNA 3VCLB 1YJDC 1S7XB 3CSYA 3KR3H 2IDFA 1LEGA 4Y4FB 3U2SA 2A6DA 5I8CB 5I5MA 3W37A 4G6AC 1JERA 4U1JA 3D69B 4KUCF 4BWUA 3Q13A 3LV3A 3RX8A 2XPGB 3PLYA 4X6FB 1KIQA 3V4PB 4D9RE 4UT6A 3GSNL 1FFPA 3UOAB 4MJIE 4QXGH 5G55A 5LAXB 1GIGH 1Z9SB 3BT2H 4FTVD 3ZYJA 4OLXH 3BWAB 4L5FH 4FZEL 2CIIB 3WHE1 4X5WA 1H15A 2E27L 4NKDA 5L6YH 4MJ5B 3T4YA 4MMZC 1T66D 3LKNB 2O26U 4KKLC 3QCUL 1QBML 4HEPG 4WW2A 4XPBL 4X5QA 3VNZA 4UNIA 2XIBA 2GK0A 3D2UA 4S1SH 2N56A 3TZVC 3AM8C 3L3HB 4ONGH 1TKWB 4P46D 4CBZA 1F11A 2UWEF 2VERN 3EG9A 2DMGA 3KD4A 5KVGH 4N0CD 1IE4A 4NC1C 3B5HA 3SY0B 1AKJA 1OOWA 1NCTA 4P4KB 4N2BA 1FIEA 2C4FU 3VSQA 3KYOB 4HX1A 2OPCA 1IGFH 4X4YA 4OCNC 2EXWD 3QP3A 1NGPH 3MV9E 2KPNA 4JFPB 4RWYH 1TTUA 1YNLH 2ZTBA 4KKPA 5DR5L 3SBWC 2DV6A 4JFOB 3HAEH 4ELMA 4JCLA 3HC2A 3GBMH 2BSTB 2BNRA 2COVD 2IBGA 3MHZA 5DK0A 3ALXA 4C56D 2WWMC 4I3GA 1DN0B 3ZU8A 2X1XR 4W93A 1KTLB 5FYLE 4PM1A 5FGSA 4NQCB 1EGJH 3TBYA 1U3HD 5T1JA 3SYOA 1CN4A 1YO4A 1WWWX 4P46B 2PYFA 1OAUL 1LE5A 4KGLA 1TU2B 4X4ZA 5D2NC 2PW2A 3QC6X 4GW4A 3MRCA 2BNRB 4IRJA 3QARA 4MRCA 5ID0B 3P9LA 5G4OA 5G2NA 4R7DB 3KPOB 4TTGA 3WTWA 1A66A 1A6WL 5LKNA 3D85B 2EINB 2GFBB 1CTNA 4J3OD 1ORSB 1KBGL 2NY4C 5B38G 3TIEA 1OPGH 3VXPB 1AXSA 4GO8A 3SDYH 4G7QB 4LOUC 5BCAA 2HFGL 1R46A 2R0WH 1LO5B 5I1KL 3GMMB 2B1AH 1L9QA 5JHDE 5D7IB 1VACA 2RFXB 5KVGL 3MLXL 1JL8A 1CU4L 1ESOA 1NEZB 4ZS6C 5HYSG 3QUZA 1DE4B 5TQ2H 5I66A 5SX4H 4XNMA 1TOXA 3H3PL 1Z9PA 4RX4A 2AVFA 4CVWA 2ZOKB 2MIZA 1HXMB 4FZEH 4KJQC 4WTXA 4LLWA 1KXTB 1TVDA 4IYKA 3SDAC 3X1EA 3AXLA 4P8QA 4UNUA 4YH6A 1LO3L 1JWSB 2XFGB 4I0PA 4NFBA 4HXAH 3SYCA 5ISZB 1H3UA 2Z34A 2FJFB 4EIBA 1MFUA 3NJNA 4HKXA 4M7KL 4PJEB 2ARJQ 3CZUB 2A0LC 5BV7C 2DLFH 3OAWA 3E8UH 3CBKB 1VEPA 4YFDB 1N8ZB 2YBRB 3L5WB 3Q8CA 3C5SB 3TONA 1MELA 4PJ9B 4BV1A 2P7TA 1NAKH 4IJ3C 1AMXA 4PY8J 4KK9D 4MQ7A 4NM4L 5F9OH 2CPCA 1RZKC 2GTQA 1XCTB 3QUYC 2FSEA 4LEOB 4ONHA 1CG9B 4YQXL 2XBTA 1GGTA 3PWPB 5GGSB 3BUTA 1UM5L 2XACC 4UQDA 2BIHA 4AYEC 2HKFL 4W9HC 3KPTA 5DJZB 1S7WA 5E99H 1UXWA 4K23L 4D8PB 1K2DA 1KPRB 3FQXB 5C7XH 3MRJA 3BSZL 1XXDC 5E1AA 5EO0A 1R0AL 4O51B 5F70A 4EJ1C 2UZIL 2IAAC 5CGTA 2E47A 3ABGA 2MOQA 1FJ1A 3K8MA 2PTUA 5DMGD 1RVFL 1ZLDA 3IKKA 1LD9A 4JE4B 4PJBB 1YEFL 1NA8A 1QW8A 2QVKA 4OZIA 2NY4D 2MCPL 1F4AA 1PEWA 2E4TA 2C3WA 4Y9CA 4J4PD 5BRPA 1P9MA 2P5EA 2IXQB 3C60C 2OR7A 1U8OA 3DX7B 3LNEA 4N0YL 3S34H 2XPYA 3SKJH 4LL4A 3WG7B 2GCYA 1OAKH 3MLWL 4PJ8B 3F83A 3C2SA 3PJSB 3WHE0 43CAA 4DTGH 4XBPB 2ZWYA 1CXHA 2PPEA 3RIAK 5F0LB 2DI7A 5F7AA 1YYLL 2C1PB 1B0GB 3PAYA 3IMSA 3CVHL 4HF5H 2RHEA 3B37A 4LRIC 3QEQB 4ANKA 2QKIC 2XV0A 1IM3A 1M57B 2C4XA 1Y6MR 2O61A 4PCSA 4P57A 1L9TA 4FG6D 3L81A 3D0LB 4R0LA 3PJSA 43CAB 2X9WA 1MHPL 2BP8B 2A6JA 2V17L 1PY0A 2ROYA 3BISA 4YR6A 3ZTJG 2FT8A 2P47B 3ZDZE 1KCSL 4O02B 2DYPB 2APWA 2EH7H 1QNZH 3B8YA 2YPVL 1FP5A 4TNEA 5CJBA 2K7PA 1TVHA 2AHIA 3OWEA 3CLEL 3QUXC 4C56B 1E4KA 4AYFB 2FT7A 4AOFA 1SXBA 4DUVA 4Y1SA 4RMQA 1CPUA 1S5HA 3V95A 1FGVH 1L4IA 2GY5A 4QWWD 1KTRL 1D6VL 1JWMA 3LEYH 1NJ9A 4AIZB 1VGEH 4TVPH 1MFEH 1A7NL 3WE6B 1D7DA 5TQ2L 1DDTA 4DP1X 2IGFH 1RLWA 2X4PA 3V0WL 3HBZA 4Z7UA 4RNRA 4AJYV 5DUJA 3H4FA 4NNYB 4RIRB 4IRSD 4JDZA 1OGTA 4G3YL 1HT6A 3LS4L 2QSVA 5K69A 5KBNC 1GKOA 4DQOH 2CLRB 1EHLH 5E8PB 1I85A 3H9ZA 4LK4A 1NOAA 1HL5A 3RGVB 2AJ3A 4HS3A 2NY6D 3QPXL 3QULA 4XP5H 1S8DB 3P4NB 1LWJA 2IQ9L 4TNVF 2VLME 3D51A 3FQTB 1JDCA 4ETQA 3KPSD 1MCKA 2HT4C 4UUJB 3VFSB 4TUUA 1HXKA 2B7DT 3D3VA 3KLKA 5B8CA 5IW1A 4J2XA 1AGCA 1W0WA 3CFUA 1FNEA 3S37H 1JGUH 4A2MA 1G4MA 2KI6A 2EACA 3E80A 4Z7UF 1BJMA 1C08B 2WP3O 5I19L 43C9A 2ADIB 3PABA 1AY1L 3WNMA 2A73A 1YJDH 2BX5A 5KYNA 2XT1B 1WUNT 1IVTA 2EVFA 3HZKA 3GRWH 2CUHA 4Y5YB 1U8PA 4FXLA 4PJXB 3N44B 3BGMA 2AABH 4FNLH 4KK8C 1B4LA 5T33L 1MHCA 4LARH 2VXUH 5C0AD 3MRMB 4FL4B 1JPSH 5FYJU 1B0IA 1KYOK 5F88A 4M3JA 2FBJH 4PJAB 4QRPA 3M6DA 1U36A 4TVPL 2AQPA 3EZJB 4NO0D 5C2BH 2BNQE 1QBAA 5D1QB 1VADB 5EA0L 1U4FA 4N0RA 3B7YA 2IGFL 3MCKA 4GG8B 3V0WH 4FJ6A 5GISH 3TV8A 3R19A 3MUJA 2R23A 1MFEL 3ECWA 2A99A 2FQEA 4JRYD 1MY5A 3DURB 4MJ6B 2RALA 2XX1A 4EPSA 4F2ME 2JSFA 1JZ5A 2YC1A 4KHTH 2AMUA 4KTGA 1PQZA 3D2UD 2R69H 2X1WL 2Y1YA 5IGXL 3O8XC 5ITFA 3BVTA 4UILL 3DV4B 5KBMA 3E8VA 1B0RB 3MLVH 2OJZL 1LE5B 1T5XA 3F12B 4KU1A 1M2VB 4MXQC 2VLKB 1E9QB 3MRDA 5KVDL 3W9EB 5I2IA 3DJZA 4JN2A 3BD5A 3EBAA 1XF5A 4LSSH 4XAWL 1YNTA 2H8PB 5BVPL 4DOHE 5CLYA 3KLDA 4QHNA 3SPGA 4F7KA 2RBLA 1QAWA 1ZHBA 3R8BB 1KF9B 4HHAB 4IRSC 5L8LB 4LVOC 1ZHKA 5FM5O 1BD2A 4AVJA 4XVTH 1IBHA 5C0FA 5B4MC 4DPRA 3DUSA 2YPVA 2AKRA 3MV9A 2PP9A 1DZBA 4G8IB 4DVRH 5ADPL 4WJ5B 2A3TA 4UMSA 1CE6B 4M8RA 2GEEA 4AL8H 1QTYT 2P5PA 4FL4C 2X41A 4ZUUA 1QEXA 2W91A 2BWIA 4WAFA 3KL5A 4QOKA 1AQ8A 1JHTA 4IGBD 4DESA 4LLAA 5AB9A 4MCZB 4ZPVB 3WAJA 4FQQA 1CICA 4HV8B 4JQIH 5GZOD 5K33A 1KBPA 1M2VA 5C2BL 4N5ED 1D3CA 4PGJA 1J05B 2GUOA 1U3JA 1SUJA 2WZ5A 4CKVX 4LSUL 1QSEE 4XNZB 4APXA 1G5AA 4HS6B 1OD9A 2CHXA 3A0OA 3CPLB 5F1NB 3VWJD 5LBSL 5A1AA 3JV4B 3Q5OA 5F7NC 1SXZA 2K6YA 2BNUB 3BQUD 4M5YH 3U46A 3BAEL 3SJVA 2BP3A 4IIQC 5MENA 4NWTH 5E4IA 4P2QE 4I7ZC 4ODUB 2ISDA 1TF4A 4M5SA 3ESNA 2OTPA 3F58L 1OP3H 4P2OC 1A6VL 2VLJE 5EC2A 1DBJH 4GXUM 3BZEB 2DOCA 4XBMA 4ONFL 1SHWA 4KUCD 3RVXD 5C0BD 5J6HA 2VJ0A 3OPZH 2UXVA 4JHVA 2ADJA 4UZGA 4CDGC 4YSUA 4M6NL 1RIHH 1QYGH 2WQUA 5MP6H 2AJSH 3THML 3QHZL 1KCUH 4P5TB 4UT7H 5BUPA 3C5JA 3EDJA 4JFFB 3BZDA 2YK1L 1GZQA 4BH7B 1AGDA 4DZBA 1KJ2B 1YEEH 1WCBA 2XTJC 3O4LB 5CAYB 2QR0B 5F0PB 2CPUA 2YD6A 5HDBF 5KVEH 2HX8A 1CYWA 2W94A 2YLHA 2BOCA 4Y2LA 4PRNA 5EU6D 5AVTB 2Z4QA 1Z32X 2QQKH 2VL5B 1CE1H 4KXDA 1CGSL 4OZIB 2F18A 4Q58C 1HOCB 1IRAY 5F93C 5TGBA 2IXQA 5J8OA 4PJGF 3FB8B 3MREB 3O4OC 1FRGH 5B4MD 4P9HL 3MFGB 3E9UA 1FBIH 2IIJA 4F7PB 1U92A 1NCJA 3CN0A 1HSAB 1OCZB 3GJFA 5C0RL 4OLXL 2NY0D 3OM3B 3TTYA 3H9SE 2B1HH 4GBXA 4L37B 4WF7A 3VFPA 2X53A 3ZQ9A 1BQRA 1BZ7B 2WNGA 2H5UA 4QYOA 3VTAA 5CEXA 1GGYA 4HZLB 3KPNB 1U8IA 2FX8L 1SDDA 2A9BA 4LRNH 3T0VA 3IDIA 4HFWB 4OJYA 1GZQB 1BAWA 1Y6KR 3LPWA 1KIUB 2OXHA 4BH7A 3QJSB 1N26A 1C08A 1N8ZA 1N70A 2FSEB 1RIHL 3B9AA 3VXQA 4ELKB 3K74B 2HAZA 3IE4A 4YHZH 4LAJH 2NZ9D 4PJGA 3MFFA 3NIGB 5TTRA 1RZIA 2J25A 3PP4H 2X6VA 3II3A 1TEGA 3QG6B 3LRHA 4PLJD 3EJUA 1NCIA 3F7RA 3SKOA 2YPLA 2ADFL 2WJ7A 4MZ2A 1QPPA 5DR5H 2AZUA 1UXMA 1EJOL 2F54B 3OKOB 3PF2A 4MCYB 3S96A 4AL8L 3RUGE 2EUVA 2F1AA 3MCKB 4GG8A 1A1MB 1EEUA 1FZMA 2ADGA 1HTYA 2A83A 4X80L 5MERA 5CD3A 1NAMA 3NJJA 4J3XA 5ACMA 3CSPA 4X6CB 3RBSA 3DUUB 4KKRA 4ODSH 1AJ7L 1QFWH 3T6ZA 4LASL 4KQ3H 1XF1A 3BEWA 1U58A 2ZNWA 5F8QC 3RNQB 2R9HC 1J8HA 2HPOA 4ZQTA 2WLIA 3L6FA 2CO4A 5DEGA 3GPEA 4UIKH 4DGWC 1KSRA 2A83B 1FE8H 1VEOA 4NBXB 4YHIB 5A6IA 2XWEA 4TSBL 1J7VR 2V9QA 2PCXA 2YUWA 3PWPD 4LCCA 1NBYB 4Z7QE 1H9DA 5IW1B 1M42A 3GBDA 4LHQB 2QQNH 2OBGA 3U2SB 4QRSB 3WTYA 4KJWD 4WWPA 4U6XB 4NNXB 1IC0A 4IDJH 3OKOA 1J5OL 3F7VB 5FKPA 5GGQH 2DI9A 3PY9A 2Q76A 2FWOA 5C0FB 4QMEA 4YVUA 2UZYB 1I9JH 5AUMB 3S8GB 2Q7NA 2A4EA 4GRMA 4XN4A 4TQ8A 1U8PB 3FMGH 4GLRH 1SZNA 3JTSA 1MWAL 4NRYB 4Y5VC 4QJ5B 5BOJA 4P2AA 5EDSA 2R59A 2EDYA 2LQRA 3QZMA 1XSKA 4NXSA 2X88A 4LQFH 3WKQA 4LBEB 1NEPA 2WQSA 1HL4A 4BSWB 1AZZC 5T3XE 5D1XB 4BFBD 2OJ1A 4BXVA 4YBQC 2UZYA 2J71A 2V9UA 4Y0GA 1EJOH 2B16A 1UWXH 1UQSA 5BZWB 2R4SH 4XNDA 1FNSL 1V3MA 2WN3A 4M8VA 1AP2A 2C9QA 4JKPL 3ML8A 3K2UL 2FIKA 5C0GA 4YHYB 1BVNP 5K9JH 1PKQE 4LCCB 2FAUA 2DMBA 3WN6A 4AQZA 3H7LA 4YHIA 3UTTA 4JJ5B 1KJMA 1U8JA 1XSJA 4O9HL 1JZ7A 3QIBA 3E8UL 3FSVA 4JPKH 5E8PA 4HU8A 3ZIMA 2ATPB 1PZUB 4EMZA 1H8OA 2IH8A 4QCIA 5E9AA 5IEKA 1W91A 4HVBA 2X4SB 4N9GB 5I73B 5L8KB 4AGMA 4TUKH 3UPAA 3WEOA 3MYJB 4UOZA 2Q6WB 4AYBA 3ZDZF 4ADIA 1TKWA 5JNYB 2E9BA 1I4FB 2DJ4A 4O58L 3LZFL 3OKDB 4NENB 2DN7A 2EEAA 5ID1B 4M7LT 2UX6A 2R1YB 4GMSL 1XBRA 3MJ8A 4J3OG 2KH2B 5A2AA 3PV6A 2OXGB 2Z7ZA 2R0LL 5EO9B 4DZ8A 4HGMA 3PNWA 2NY1D 4TPRH 5I6XC 4GS7B 4G7SB 5FDWA 1A64A 4HD9A 2PYEE 1G6RL 1N59A 4IBYA 1B6DA 2FATH 3X14A 2Z6FA 2X4UB 1PNCA 2Y25A 1OLLA 2BXYA 1FLTX 2ROXA 1R24A 3AQXA 4GUOA 4DKFH 3QJFB 1SOSA 4MZ3A 3S34L 1M9WA 3EFOB 4JL1A 4ODTH 1SF5A 2IOIA 4XBGB 5DD1L 5FV2A 1TR7A 4U7MA 2Y5QA 1FC2D 1J48A 4K3EL 4IOSA 1KLUA 4IRJB 4WI9A 3MA9H 4Z76A 3APMA 2FGWL 5LB1A 1VZIA 4FLHA 4KDWA 3UPRA 2V0AA 3IN0A 1E5AA 1X7TA 2W80C 3CSTA 3ILPB 4JQIA 4ZO7A 4MD5B 3JV4A 1FH2A 3GMQA 4UF7C 1JGIA 1UKSA 1CVRA 3MCLH 2VQ1B 2WIIA 3WCYA 4P2OD 3TCLA 1XF2A 2ZSVA 1FA4A 4ISVB 2DKSA 3G6AB 4L37A 1PG7L 3T1WA 1FFQA 4PRIA 5DD0H 2CO6A 3DX7A 3UX9B 3EO9L 3P3UA 5PCYA 2KKQA 4YLBA 1X5KA 3GMMA 2DQHH 4LCWA 5IB2A 1F6LL 1B90A 3CFIC 1Q0XL 5CJOL 4AGNA 1ES0B 2WBJB 1BXAA 3O2WL 4IGBA 4V1DB 2J3SA 4NP9A 4XNUH 2BSCA 4S1RL 3K6NA 3CVIL 2WUCH 3VNYA 3E3QC 4FQHA 1E90A 2E27H 7FABL 5HD8C 3QDME 3D5OF 1OTUD 4A04A 1ZHKB 5E4EC 4HPYH 4TUOA 3LVTA 5SWSA 2GQHA 1ET8A 4XTRD 2QR0A 4YDJA 4Z8FL 1MJJB 2NX5D 3BVUA 2DQIH 3U4BH 4UIMB 3ZVVA 5D1ZB 2WMPA 2NYKA 5DD5H 4AGOA 2IANB 2H6OA 4XOEA 2J44A 3CVBA 5EU6E 3BLPX 3F7QA 1VGKB 3T0EE 4B9PA 1BPVA 4GO9A 2ILLA 1NFDE 4C55A 4ZQKB 1A1OB 4L3AA 1M71A 4WUKH 4XODA 2NQDA 1JZ3A 4HD5A 5SWSB 4PRPE 2B4CL 1DUYB 1NFAA 5D2LA 4NT6A 5D6CB 2EEDA 1IJ9A 2ITCB 5CSZB 2P3YA 4PLKD 1IQDA 1UZGA 1H3VA 2VDMH 4J6RH 3C6LA 4XGZA 4ETYA 1T20A 4BSVA 1RUML 4JCWA 4MHHI 1CD9B 1QUNB 3H9YA 1HCVA 1LD9B 4N0UA 4D0DB 5MENB 5H35B 5IB2B 3HPLA 5T8IA 5HDQH 3MV7D 4NN7B 3RWFB 4U05A 2X1QA 4ZW7A 3K8LA 1EBAA 3MOBH 3DOIA 4J8QA 2XZCH 4DP4X 3OHXC 3ZY7A 1S9VB 1K8IA 1Q0XH 2KLSA 3TEZA 4NQSB 4OIIH 3M1CA 4PTTA 1OGPA 2ED6A 3CVIH 4KI5D 5I19H 1KJVA 1Q8MA 3BJ91 1FDLL 1G1KA 4DQAA 2J8HA 2WC7A 2Z31B 4FXGB 5BW7C 5DC0A 1UUSA 3OLIA 2P42B 1F42A 3TJHD 4I3SL 3QO0A 3ZQWA 5KBPA 2VLKD 5AYTA 2FQGA 3SCMD 3SGKA 1TJHH 1N0XL 4XPTL 4KV5F 3WFDH 5KS9F 1SYVB 2E9IA 3ASNB 5DRZA 1KTKE 1JBJA 1A22B 2JJSC 4PJCF 3VFGL 6TAAA 4MMYA 3IMWA 4MNQB 4POUB 3WUZA 1MREH 1TLMA 3EGXA 1RK1B 5L2KB 4JFQA 3FH8A 3DX4A 4DK6A 3L45A 1JNHB 4LHUG 1NCWH 3WD5H 5HD8D 5A3ID 4GRLD 1K8DB 1B3JA 1TZOA 2QVTA 2W9LA 3SE8L 1Q9KA 2VDML 2VUYA 4J6RL 3UG5A 2CKBB 3ZTJH 5JOPE 5CWSB 4OUOA 3EHBB 5FXCH 5AW6B 4TNWK 1QLEB 3MRBA 3N1PC 4KHXH 4LU5L 3TBVB 3JV5A 4LCVA 4H5SB 2BVPA 4MQXC 2LTQB 3FHEA 4RIRA 3SGEI 4P5SA 4F8PA 4S0TD 3MYJA 4Z7WE 3NJHA 1FLRH 4JO1H 1XGTB 3H6AA 2ZAGA 3RWHA 1TJMA 4AW7A 3PGFL 5L2KD 3JYBA 4OKVA 2X05A 1R3HB 1NM9A 1TVBB 3ZDYB 2WSDA 3CX5K 3QORB 4MSWA 1UZ6E 3S5ZA 1QHOA 1KENH 4YHOL 1W8OA 3RWCB 3VX0A 3MR9B 4BWWA 2FHFA 4EKJA 4EXPX 4KROC 3EYVA 2HN7A 4WU7A 1BIHA 4LZKA 4DKDC 2E7HA 5BQ7A 1CGWA 3FSOA 4HCIA 4NP4H 5ESAB 4XMTA 1DFXA 3PPEA 4BA0A 5JQHC 1ZLUK 5EIIB 1JXDA 4JMNA 1XFPA 4OD2B 3CGTA 1MQKH 3T0XA 4U0RB 3APFA 2VABA 3Q2VA 4WK4B 4HSQA 3ZTCC 2VRQA 5F7YC 2W0FA 5C0IB 3TC9A 2OMBA 3OG6B 4I4WA 3HZKB 4JUTA 5B1CA 1M53A 1WF5A 2EDFA 4X4MA 1A0QH 4H20L 5KUKA 1Z0MA 4M5YL 1ANUA 2R4RH 3GSRB 4MJIA 3HG1B 4ZNEE 4EN3D 4Y16D 3VE0B 1W0WB 2XQBH 2DWSA 4JAMA 2QPUA 4G6JH 5K39B 4CNIB 4Q0XH 1G9NH 5DUBA 2FB4L 5HVWA 3ORJA 1OGAB 3WLWD 2XTSA 4QRRD 1CIUA 3EOTH 4XP9H 4Z7OB 3OC8A 2BJMH 2VQUA 3K6SB 2VDQH 5T3XD 2GJZB 1OZTG 1I75A 2HUEA 5CEZE 4RH4A 3O0RH 3AMLA 3AT8A 4Z3HA 4DO6A 4JKNA 1A3ZA 1ZSHA 2C9UA 4XX5A 5A6LA 4ZPTA 1GRWA 1T03H 3BRGC 4P3DA 4Z95L 4NDMA 3CDZB 3D39A 4LKXA 5AOJA 4HPHA 3C8DA 2FECL 4PFEA 2NX5A 1SEBB 3RX5A 5CCKH 2DLTA 3BAWA 2VZTA 4NO2B 5GSVB 5DD6A 2K4AA 5B22A 2D73A 3RTLA 4NUJA 3AGWA 4AE1A 4X9HA 4FG4A 2UXFA 4XO8A 2AJYL 3PAVA 2Q8AL 4AQ1A 4PYHA 5A6MA 1ZT1A 1KYAA 4HPOL 4HIJB 4JM4H 4OVVA 5DLLA 4Z77A 1D7FA 1MAJA 4MAYB 1R5VB 3QYNA 4Z3EA 5GS1A 2FBJL 4G7VH 5KAQG 2FD6L 4LCIL 2AKRB 3MV9B 4G8IA 2Z7YA 2OZNA 3DTXB 3TT1H 4CNIA 3OZ9L 5C07E 4GRWH 4JG0L 4X7DC 1U8HB 4YDLB 1MREL 2ZAHA 1JWSA 3IDJB 4E42B 2VJ8A 4EI5C 3V4UH 3IGAA 4LLWB 2B1HL 3WBDA 3WS6A 1ZHBB 2UV3A 3UG4A 3FO9A 5BRZE 3ZL4L 1HNGA 4OBRA 1IAKB 2XKNA 3AT9A 1X5JA 1PKQB 1WAPA 3CCHA 4U2ZA 2F5AH 1SY6H 1J1OH 4NCDA 1QRNB 4IU3A 1SEQH 2MTAA 3MOAH 5IROC 4P2RE 3P02A 2R2HB 5I74C 5J12C 3MRPB 3GXDA 2FX8H 2FGZA 3VFUB 3RY5A 4YZFF 1ICTA 2YFNA 2XWXA 1NCBH 3L4UA 5B1BB 2EZ0C 2YA2A 2C5DC 3BPNB 3PGFH 3LXUX 1NFIA 1ZOXA 2BIIA 4CMHB 4HUXA 2HCZX 5D93B 1OM9A 4A67A 4F20A 4DH2A 1VFUA 1YCSA 3MRJB 2W8CA 1AXTL 1DN2A 4WTWA 4UT9L 5FWRA 3OKNB 2D4DA 1ED3A 1YPZB 3QI9C 2H0FA 2ZX9A 3DJTA 4LGPB 3EH1A 3OSVA 3SQOL 2XWJB 4DFHA 1IMHC 2OSLA 3KM1A 2PYEB 4E9TA 3P40A 1C7SA 2FO4A 3EDDA 3JUYA 5D96C 3N04A 3KWWB 3EJJX 5ACLA 1IBBA 3BFOA 1X5HA 2FHCA 4UM8B 4LL1A 3HC0A 1WIPA 4BQ9A 3OHXB 2N7BA 4NN6B 3VFVA 3WN5B 2BNQA 4M48H 1JG9A 1M7IA 5DJDB 2DRUA 1IVLA 2NW3B 3GXTA 3OB0K 4J27A 4MB1A 5IVOA 2XN2A 1CTMA 2IDSA 2OAAA 4XMKH 4LL9A 1WGVA 5E08L 3T1FA 1W6WA 4RGNC 5AVYB 2NNFA 3IRCA 1PLBA 2VRKA 1N5AA 3R8QA 1U2CA 2J55A 1J18A 2EDRA 5D2NB 4EI0A 2CXKA 4J3OF 3Q8BA 2V2TA 4AC4A 1L7TH 2VB5A 4CKQA 1QLFA 4W68A 4L9LB 2YFOA 1GGIL 1UH2A 4HKXB 2WXIA 2Q8AH 2X28A 3ZQXA 2AS5M 2ZP8A 1J10A 4S1SL 1NPNA 2NT1A 5E8NB 5D5MA 3H1ZA 3EHBC 3IJYA 5E5MB 4LCWB 3T6XA 5L4MA 3II1A 1HK6A 5I8KL 4FDWA 3WMPA 1OAXL 1VZGA 1DVFB 1NUGA 1FZOB 5IV2B 3DX6B 4NPYB 5I30H 3NG5A 4RCAA 4A2GA 3KWUA 4LQFL 4MDIA 3RG1C 5HYEA 4FQPA 5DS1A 1YY8A 4X0KB 4N86A 2DW5A 4KK5D 5D6DC 2JK5A 1T4WA 2A9MH 1S7TA 1MNUH 3FQNB 3PGCA 1AS6A 3ROOB 5IFAH 4YO0A 1GXEA 2H2SD 2VISA 1E42A 3FUEA 4NIYE 1DVFA 5E1GA 3TXAA 2BNRE 2R0KH 3QJVB 3U30C 1IQWL 5J6SA 3BX7C 1JCKA 4LLYA 1A6TA 4OD3H 1NKRA 2E9JA 1IAIL 3VDBA 1L9OA 4DERA 4JQIL 4R5VA 3QORC 3TA3C 5JOPD 4R8WL 3BH4A 5JHLA 3DSNA 1WSST 1I9EA 1WFTA 3MA7B 2CCLA 1SXNA 2I9LA 4KKBD 2D3JA 2ZCHL 2OJEB 3IJEA 3TO4C 1A7PH 1H19A 1A7OH 1JV2B 3AU0A 4HFWA 2VDNH 4NRXA 1Q9WA 1HAWA 2DQDL 3VG0L 4U1NB 2P24B 5DJXB 3IRZA 2LLNA 3CD4A 4UT9H 2JKWA 4WFFD 4X5XA 4Y2NA 3WFZA 5IKCB 4R26L 4Y4FC 2GABA 4LSTL 1W72B 3GXIA 4U6HA 2YD3A 4HS8H 3TU6A 4KX9A 4P5KA 5IVNA 4N0CC 2E8YA 1KTCA 5GS1C 1MFBL 3IGKA 1SN5A 1A8JH 5IEKB 1NCUA 2C3XA 5D1ZD 5F1OB 1BXUA 1MI5E 4RGND 3ZTDC 3FRUA 1TETL 3MRIA 4MQSB 2Z1PA 2YPLE 2BNRD 1CFNB 3V0EA 4C56A 5IMKA 2WLNA 2WINA 1R3KB 2V3DA 3EFDL 4Y2DB 4F91B 3QJZA 3HUJF 5D4IA 2UYLA 4NS0A 5F88B 1DO5A 1T89C 5FGRA 3K6FA 1JK9A 4RNRB 4RWHA 3NIGE 1U3NA 3OKYA 1CJYA 1I82A 1DJZA 2J21A 4I4WB 3HG1A 3T08A 3GSRA 3ZE0B 2Q2EB 4MLSA 1ECYA 2NY5H 1JYVA 2ZF8A 2FX7L 2ZWKA 3CHQA 3EDEA 4GO6B 2PPCA 1AGEA 4HEME 3LN9A 3FF7A 3DIFA 4F9PC 2L7JA 3FOLA 5E08H 2QKIB 2F08A 4X5LA 3KPMA 4OZHF 4M3KB 5EBGA 5H8DA 2FWOB 1PIFA 2YQ3A 3FUNA 3K81A 1R19A 2ZAIA 3PL6C 3VG9C 1TTRA 3EYQD 1ERNA 3N2JA 5F7BA 3RPKA 1IBGH 3PXHA 1AFVL 1E8XA 4ZXBB 1UT9A 1H8LA 3VDCA 4I2XE 1E7VA 4H8WH 5IHLB 4NQEB 4YHKL 5DRWA 1F3RB 3DROA 3ZHDA 4UZSA 3ARDD 2FUTA 4OGYH 2B1AL 4C8XA 1XIWB 2NXZB 1DEEA 3OAUH 4NO2A 3HMXL 1WWCA 2J72A 4NZRL 5FYLH 1IGJB 2QVFB 1QO3A 4OU3A 4JVUA 1T1ZA 4M4RB 5GGTA 2HMID 3W81A 3OJDA 4WGWB 3B9KD 2VR5A 4Y5YA 3FMGL 4RFOH 3QIWB 1G6VK 5C08E 4OAWB 4BZ1A 1WD9A 1MJ7L 4K7FB 2EAEA 1B9KA 3GKWH 3CDYA 1MAML 3H4HA 3QRGL 5GRZA 3RWGB 2CKBL 4QNPF 4YLQT 1T0MB 2JJUA 4JKWA 1JHTB 3EFDH 4Y8DC 4YDKL 3UZQB 1WAAA 1EAPB 3RI5K 3HG5A 2BZ7A 4RGMC 2X1OA 4ZUTA 4XPBH 3FQUA 1QWHA 1FNSH 3FOMB 3K72A 1WWAX 2FEJA 3UTTE 2J6WA 4WSJA 4B9CA 1UCBH 5DQ9B 2E7LA 2IOOA 1HESA 1WS7A 3F6JA 4RSYA 3QXWA 3QEUB 1A7BA 4G6KL 2BVTA 4CSSA 3ATFA 1AS7A 1X5ZA 5KOVC 1RULL 3ARGC 2DQGL 3SDDD 3VRJB 3EZ8A 4XVJL 4QHNB 3LNIA 4BM7A 4AUYA 5C9KA 1BZQK 3RZCC 2X10A 2Y6TE 3GMPA 3NCYP 3H2QA 1A65A 3WEXA 5JZ7D 1U93A 4P0DA 4NWUL 4A6YH 1BMWA 4J8RB 2NR6A 2DYRB 3R7RA 1J5OH 1TZIB 4FULA 4EOWL 3UTQA 4M5ZH 4ZTPH 2IFFL 1T1XA 2X9YA 3JWDH 5C7XL 2B08A 3V8OA 3VXUE 1E2VA 4JDTL 1JK8A 3L2LA 4O2FB 2HPTA 1UD8A 4JY4B 1AQHA 3S4SB 1Z7JA 3G08B 4LLUA 3AXLB 1JYNA 5CIPA 1RHHA 2R69A 1HKLH 2KZWA 4NQUA 5DZOA 2V2XB 4HUNB 4Y1AA 3QNXA 1BPLB 2IO5A 4ZT1A 1I9IH 2ODHA 5BRZA 2G3MA 5DMIH 4UYPA 2QV2A 4HJUA 1HQRB 5D72L 4OCXL 1GYWA 4K3EH 4FNRA 1N9PA 4APXB 2LW3A 1T6VN 2NY0C 2G3ZA 2JJSA 1REIA 3O9WC 2R2EA 4ACPA 4A63A 4ZG1A 1CFVL 2AGJL 3CVDA 1TQSA 3O2DH 1PKQA 1XSOA 2KC0A 3TM6A 2FLBT 3LN4A 3MX0B 3TJEL 4JQVA 4AV4A 3IMBA 3QEQD 1BJ8A 3GJEA 3VW3H 1SXCA 3S37L 5IHWA 5JXAH 3D3VE 5I1CL 4UQBA 1WISA 4GBXB 2ZKHL 5BOZG 1OY3B 5C8JB 3TBBA 1JGUL 2X9ZA 4V1DD 3ZE2B 5IMMB 1TCRB 3UYRH 5A43C 3OKMA 2PXYB 1IB5A 4X8JA 5C0ND 1FGNL 3GIZL 4J3VA 2CKBH 1W16A 4LCYB 2W81C 1RZIB 2FYYB 1VENA 2KYIA 3P2TA 5CLWA 2MHAB 3RPBA 4WO0A 1CLYH 5A2IH 5FUCC 5C9JB 3GXUB 1AD0B 1PCSA 1EQWA 1NPUA 2VXUL 3OB0H 2Q3AA 1OOAA 4KV5E 3VWJA 4HJEA 1GSKA 5AVZB 1XGZA 2DICA 4OLVL 4KMQA 4HOZA 2GIMA 5MI0C 3H85A 1DN0A 2PYEA 4JRXD 3T8XA 3LKQB 4MX7A 5F96H 4KRPB 4U7KA 2FIRT 4PRHB 4U1HB 2BS8A 2CGYA 4M03A 2A77L 2P8LB 4YE4L 4KOCA 5L2JB 4PJIB 5EOCH 4OZFG 2J57A 2AANA 3VVWA 3KPSA 4H8WC 3NZ8B 4U1JB 1AR1D 3MO1B 1A4JB 1LK3H 2X09A 5TE4L 4WWID 3OZKA 4J3OH 5JW5A 4MB4A 4Y9GA 1BYOA 5D2NA 1HS6A 4HU2A 2IGLA 4P5TC 5IMMA 3TVMD 2FWSA 3WJLA 1FO0L 4QEGA 4CMMA 3D4GA 4ZUSB 4XVTL 1PG7X 2LGNA 3KCPB 4ZDHB 1KY6A 1BYNA 1ZDSA 5EOCJ 1O5PA 2OXHB 5D1ZC 4LSQH 4HK3J 4G2AA 3G6JB 4HXBH 1FGNH 3U0PB 5DVNA 3VD5A 4OQTH 4XCEA 3MNDA 1UB5B 3GMOA 1KLGB 4G1MB 1ZT7A 5I5RA 1C9SA 3O9WD 5I66B 5CILH 4S1RH 3GIZH 2L4OA 3HN5A 5JHDD 1V7NH 2YOAA 3VMOA 5L0QC 2Q3XA 1FZOA 5IV2A 3MBEC 3L5JA 2PABA 1FSKB 3C09B 5E2TL 3FQ1A 4GFXA 5JHAA 1BFVL 1I9RL 1NIDA 3KVQA 4IW4C 3MRIB 4Y2DA 3LRLA 5GS0C 2C7UA 4DKAA 1MHEA 1JPST 5JDSB 3NPSB 1ZHLB 2CD0A 4TSAL 3SO5A 3ARUA 4QRFA 3IB4A 2GKIA 3U1QA 5IY5B 4DOHB 1R5IA 5DMYA 4OGAC 4WW2C 4RBPH 4JUSA 3CK0H 1I8KB 1I9IL 3L48A 4HBQA 5LBSH 3T3PE 4L8SC 1AP2B 4JPVL 1LHZA 5D72H 4JBSA 3HS0A 5AOKA 4P46A 5F7EL 3MN8A 5IMLB 1JTOA 2C9SA 4CVXB 3MRQB 3NSCA 3QXUA 3ZGIA 5T1LA 4WENB 1DJIA 5KAQF 3UJIL 1XGYH 5F7KC 3U0PA 4FNQA 3OMZA 3BPOB 1PTZA 3IJSB 3LRMA 3JVFC 3FC8A 3O45B 3U36A 5J9PB 2Z9TA 1HAUA 1Q9WB 5BOPA 3GBLA 1A9BA 2WXJA 3HPJB 4PJ5A 1XR8A 1B4RA 3WLBA 5ITBH 1JFQL 3F7VA 3OAYH 1A4KA 2LLGA 5JO5B 2F53A 1SXAA 4HKBB 1R3LB 1RZ7L 1HHKB 5AL0A 1F4WL 2XV2A 4G83A 5CMAA 1INEH 3GXNA 3QUKA 5T3XL 4QGYA 4IS6B 3ZTNH 2OXGA 1N59B 1ADQL 4A2FA 4K4KA 4A68A 3R18A 4DNLA 4EN2A 3OD3A 1IGYB 2I25N 3QR2A 3RFRA 3MLSH 5ESQB 5L4JA 1QQDB 4JFEB 5EOTA 3BUQA 4MS8D 4N0UE 5KWYC 3SPCA 2I24N 3DC0A 4M48L 4PD4J 1JTTA 2P5WE 2RD0A 4NZ8A 5IFHL 1G7QB 3QZWB 4D9LL 2EKSA 3NJMA 1KN2L 4CA4A 5CHNA 3O6LH 3VA6A 3QDMD 4N2OA 1SLVA 2E6QA 4W81A 5HDWA 2FJHB 1HQ4B 4K5LA 1N2RB 4D7PA 5GZOA 4OQTL 2I7OA 3X13B 3LQAH 4GH7B 2QMKA 2WXPA 3IDMA 1OSPH 1QLRA 5BPPA 1F2XK 5DRXB 1E5CA 2WLMA 3V6BR 4XN5A 4R96A 4Q9RH 3IDUA 1O7VA 3CQQA 4MFHA 4HSAC 2A6DB 3ARGD 3IJ9A 4G6JL 3HKFA 4RETB 4WDIA 4QTHA 5E6ZA 5HHOA 4AZUA 1KCVL 5JO5A 3SCMB 1ZEAH 3ECUA 5LQBH 2NZIA 3TLRA 1KB5L 3MRCB 3BKJL 1P7QD 2GFBA 3NA4A 4EUPB 4YHNB 5CZKA 1XGQB 4N8UA 2K3TA 4JO1L 1FL5B 5D1QD 1GMEA 2YXWA 4E41B 4N22A 4C4UA 5IB5A 3KLHD 1KCUL 4UT7L 4F37F 4P2QB 5D7SL 2D0GA 1KXVC 2C9AA 5GGSA 3QAQA 4AG4L 1MCIA 2NY0B 2F8IA 1IIIA 2F8OA 1KG0B 1KFGA 3KL0A 2GI7A 2Q0ZX 3QW9A 3FO2A 4XP6L 3J7HA 1PG7W 5E8EA 5IVZA 5D1XC 2NY2C 3IU3A 3O6FD 3I84A 5ICXA 3RHWK 5IWLC 2IGTA 4TQEL 2V2XA 4WI7A 2OR9H 5EEYA 3CC5B 3I6LD 2IWFA 2Z0BA 4XC3L 4WDIB 2Z8SA 1DDHA 3RGVA 4NIKB 3AWGA 4WK2B 1CQKA 2YKLH 1I7UB 4G7VL 4GI6A 5DQJA 1BG1A 1EERB 3IMVA 1AJ7H 4I0PB 5EDXA 2H0EA 3HAEA 4TSCL 1IQDB 2YD4A 4ZZFA 5C1MB 1SY6A 1RZ7H 5D7IE 1KN2H 4GJTB 4IOFC 2VL5A 5LCVA 3TCLB 2D31A 1U30A 1ZA3B 2XSKA 4FYSA 2NMSA 1NGYB 3S9DB 5C0JB 2QGDA 5J5EA 5JIIA 2DM4A 4LSRL 4DZBB 3VO0A 2X7LA 1M3JA 4LFHD 3ZYZA 2ITDB 4LNVA 3VGFA 4B41A 2DI8A 4JFFA 4ZDHA 3MI6A 5T3ZE 5DVKA 4CAGA 3TEWA 1I1AB 5CCJA 2ZQKA 1XZ0B 4YBHA 3C5SA 5E2JA 4XT1C 5ICYB 4J1UA 4J3TA 4UQEA 1P84J 4OCYH 3MRHB 4PRIE 1VAHA 3QAZB 1YUHB 1NBZA 3N06B 4O02A 2XU9A 3DI2B 1PD1A 4L9LA 2RA1A 1U33A 2Y06H 1DANU 3OL2A 2DQTL 2GBTA 4J3BA 1OF0A 1K4DB 3MACL 1OT1A 4ICWA 4PP2A 2Q5BA 4HCFA 4OZGA 3WY3A 3SB3A 2VOTA 3RDTA 1MFMA 3BGFC 4Z5RB 1JTPA 3FTVA 2XRAH 4PBDA 3HB3D 3I3DA 1DQIA 1YAZA 2HRHA 4L4TE 3L9RA 4HS6A 4KQ4H 4NJ9L 4B9IA 3LKQA 1NLDL 4U1GC 4OBSA 4GI9A 2CSPA 1HE7A 3BDYL 1PZ5B 3P0GB 5HTSA 2Y36H 4Z7UB 2A74B 1XTMA 4YEFA 4BGDA 1DQTA 1I8KA 1GS6X 2R9HD 4NQDD 4ODSL 4LLQA 4PJ8A 5BV7L 4OF8A 2F5BL 2YSTA 5FYKU 3U4KA 4WLCA 3V10A 1HH6A 1RJLA 1DVUA 3BKCH 3EJSA 1N19A 3L3DB 4FRWA 3WJJC 1FH5L 3MUUA 3ULSA 4LSUH 3L9RB 4Y2OB 2DB8A 1TJIH 1YN6A 3EBGA 5DI8B 5GRWA 3WIAA 2V9RA 3POHA 5SX5K 5TJWK 3B34A 5KSUB 5E00B 1L3NA 1QFHA 4IQHA 3ZUCA 1QVOA 4GP5B 2BM3A 1J5DA 3FU0A 1M9SA 1ILSA 3ISWA 5DWPA 4JGMA 1RJLB 2P9RA 4IDJL 5EZPA 3OKMB 3MV8E 1BQHG 4NRZB 1JZ6A 4I48B 5IWLA 3DIFB 3RVWC 2JF1A 5C8JA 1UB5A 1Y1DA 4OGYL 3UDWA 1QYGL 2PO6C 4JFXA 3FT0A 4WEBL 5GZNA 9PCYA 1ZKAA 2JJVA 3GMOB 1YEGH 4XNQB 3ZKNC 7PAZA 2QPEB 3UIYA 4DAGH 4WKZA 2B59B 1MAMH 4G9FA 2EDLA 1GGUA 2CHZA 1E5UI 2DQTH 4H0LC 4YDKH 5J1AA 3HFML 1RZKH 1ZGLB 4HIXL 3P11H 1AIZA 1WD8A 3BP6A 3MUGA 4EEEA 5GIRA 2CK0H 4IRSA 1MSPA 3X11B 1NDGA 2YD2A 3EOYG 2BFVL 1GC1H 4BGLA 3IAGC 1DJSA 2CDEA 4G8FB 4XMPL 4HUCA 2EYTA 5L88H 1OAXH 1CS6A 1ETB1 4M4PA 5DD0L 4JFDB 3LKRA 4XRCB 1FBIL 4PJIA 1NBVL 2WBXA 2J6EA 1ZY9A 2OQJA 2MSPA 4NI3A 3ZRSA 4Z7QB 1PBYA 2Z31C 2J88L 4KXBA 4TLUA 2VXQA 1W72L 1PEZA 4OFYD 1E67A 3FAXA 4KXZI 2EADA 3T0AA 4EI5B 3VD0A 1T7YA 4TQIA 4I3RH 4KH2A 1VFMA 2RCSL 2JVUA 1BOGA 1TQTA 3KPLA 3C6SA 2DQIL 5LN4A 3U4BL 3ULUC 4YLCA 3AZUA 2DM2A 2K45A 1KEMH 5FYJH 3DDGA 4XPAL 4ZUUB 2XWZA 1CYGA 2FZ3B 3QCVL 2CO3A 3KEHA 4GBXD 4LCUB 1RUQH 4OH2A 4WJ5A 5I1AB 3O8XA 3U4AA 4ZD3H 4JFDD 4P2CG 4JDEA 3NACL 4R83A 4MAYA 5AYUH 1FE8L 4HWZA 2DMKA 3SOBH 1I3UA 2KERA 2VUKA 4KMTH 4F8NA 3BCFA 1KTJA 4ES8A 5BO1H 3J2PA 4K0OA 1CXFA 4XO4A 1XGPA 4RA3A 4N0YH 3D52A 1WT5C 2BCKB 3JQOB 3S7GA 4HH8A 2ZYHA 3HMWL 3KPQB 1T80A 1S4IA 4JDZB 3BUYB 3VFPB 4LLMB 1R17A 3ETTA 1AC0A 5CJQL 4U3SA 5INDB 2WVVA 5E1IA 4FABH 4Y1AB 1H15B 4NKDB 3V6OE 4PR5A 1EAQA 3IMRA 4M7LL 4OVUA 3BKCL 4MCMA 3PWPE 2JLPA 2CU9A 3N1FC 3PFUA 3T3PF 5LGYA 3PIQB 3VRIA 4OJEH 1T2JA 3QQ3B 2HWZL 4MNGB 3FQWB 3JTBA 3S88H 3BWUC 2VAAB 1J8SA 1PZ3A 2NW2B 1VJSA 2WNXA 1MHHB 3GSQB 4NQXB 5CEYA 1LEKA 3LKSA 5AW7B 3GDBA 2QSCL 3IDXL 3K6OA 5DMGC 2XZAL 4TYUA 4N1CA 2NY2D 3O6FC 3FPYA 4KQ3L 3HUJA 5BXFB 4PBXA 4GQZA 2XN9E 1NC4B 1JGLH 3FT9A 4GYBA 4CC0A 2K8MA 3S8WA 4BCZA 1TETH 5JIHA 5DEFB 5E6UB 3D6GA 4MBOA 3QCVH 3FNKA 1DQJB 2A1WL 3AG2B 3B2MA 4K55A 3KWWA 4ABUA 3QIWD 5C70A 3L3KA 1D9KB 1U3HA 1T3FA 3DGDA 2JIXD 5IJKC 2HTKD 4JQXC 2AQSA 2NNAB 2QQNL 1P7QA 4U31A 2FL5B 4AMWA 3T6VA 3QA3A 3P3TA 4IRJD 4IOFD 3HMWH 1DDHB 1ZMYA 5GS3A 4FTDA 2EIZA 3AGVA 4PY8I 1SQ2N 3MBWB 5EC1A 1U8NB 1TYJA 3GLAA 3LCYA 5FM8A 3IM1A 4LDEB 5DJYA 3KM2A 3VGAB 4L48A 4DEWA 3F65A 1ND0B 2NNAA 2XC8A 3REVB 4XXDA 2AJVH 3A4AA 2J8UB 2DBLH 3VFMA 3TEYA 2YD0A 4FI7A 2HKHH 1N12A 2VLKE 2Z93B 5EFIB 4HXBL 1WHPA 4NQCE 3ZYIA 3RX7A 4MDRA 3D48R 1G7PA 4O58H 2I9TB 1GJWA 3DHMA 4A66A 4FJZA 2L7EA 4HZAA 5EG6C 1FL5A 5EB9A 1S9XB 4P5TA 3LQAC 5DK2A 4ZUSA 3VQ1C 3ARVA 4O2EA 3HB3C 3ULVH 3V5KA 1ZPUA 2E46A 1N0XH 2F54A 3QUGA 3UAJA 3WKPA 1LO0H 2JQMA 4LVNB 4TKWA 2TSAA 5IK3A 4JPKL 3Q5YA 2A9CA 3LYRA 2ENSA 4L4TD 1V54B 4N3TA 4JFZH 5EU6A 2FATL 2YJQA 1XR9A 4PP1D 3UAEA 4I18B 5ERWA 3RDJA 4J39A 4JRYB 3ZHLA 2EDOA 4ICXA 3IU4H 2ERJB 4NLAA 4TULH 1QRKA 4YDZA 3LN4B 3EYUL 1EHLL 2IWGA 5JUEL 1U58B 1T1WA 3C8KA 4YX2H 1ZD6A 3QZBA 1LO3H 4EAEA 5AOIA 3EGDB 4ZFZB 2FH6A 2YGNA 3DVIA 2ODIA 4XCNB 1P7KA 5DJAB 1CFVH 1Q0EA 1KJ2H 5CP3A 5A7EA 3DBSA 5LG6A 3DMMC 2W07A 1JXFA 3O2VH 2HRPH 4MS8C 4ZUWB 5H4ZA 1RUPL 2NY3B 2WXRA 3O3BA 3P69A 5G4NA 3HNTH 3O3AB 1HDMB 1QSFB 2D3LA 3QDHA 4JW3A 3V79C 1RK1A 5L2KA 1AD9A 2EECA 1K2DB 3NAAH 5IR1A 4P5KB 3A6CL 1Q72L 3HE7D 2FO8A 3RTQC 5I26A 4B97A 4JKLA 3OR7A 5HI3C 2F1BA 5E1AB 5EO0B 2WP3T 3MFFB 4Q2ZB 1ADQH 4KGJA 3NIFB 1KCWA 5ACZA 4EOWH 1BFOB 1S9YB 1ASOA 2PWGA 3QI9B 1ZRUA 2Q20A 4CU8A 3TT1L 4PSPA 4HHWA 4HIIB 2IH3A 3JWNE 5IQNA 3BVNB 1BEYL 1WV7T 2XN9A 4F8OA 1OE2A 3SYAA 5IW6A 3ELAT 3RNKB 1VFAA 1RZFH 4OUUB 4XP1L 4GINA 3MXWH 5T5FA 5DGQA 4CMMB 3IFLL 5ACZB 1SY6L 2UY7A 1WFIA 3RFZA 2AITA 1S7SB 3BH9B 1KB5B 3ZL4H 5FO9A 1PAZA 5JXED 2HKFH 1OSYA 3LKRB 4XRCA 4ZFGH 3MLWH 4ADJA 1J1OL 1ROCA 1P1ZA 4A7SA 1BQLH 1E5BA 1GL4B 2XDHA 3FCTB 4MSWB 4Z8FH 2VRAA 1J8HB 2VAJA 2VSCA 3B1TA 1J8RA 4O2CB 1DTUA 4JZOA 5DD5L 3SDDA 4U2YA 3FRPB 3IBOA 3FTSA 1DQLH 3EAKA 5AW1B 1KJ2L 2CLZA 3ME0B 1OKEA 1YEFH 1G4RA 1NKOA 1G0DA 4U1MA 1C5BH 1YA5A 4XN9A 1QEWA 4NZTH 3L2NA 4K5NA 3P9MA 2V5SA 3B4NA 1YEEL 1ORQA 2VLRE 1LO5A 3S4SG 1ZTXL 5D2LE 3L3GB 3MNWA 4QRUA 5F7UA 1JE6A 1Q72H 3ARGB 3QFJA 3W3BA 1KCLA 4B0MM 4R4BA 1RP8A 3OKKB 1KB5A 1RY7B 5EIIG 2YPLB 1KELH 2OZ4L 3GTNA 4HKBA 3SSGA 2AXFB 5HJ3A 3SGDI 2HUHA 3PCYA 2ITCA 5AVUB 2F54E 5CUSL 3NABH 5GPRA 5M7QA 4G8GE 3T4AC 5HHNB 1ZT4B 5I1IH 3O2VL 4GLRI 3K2IA 3UXFA 4U1IB 3UJTH 4NN5B 3O45A 4KUZH 3U36B 4JFTA 1XH2A 1A2YA 1OIOA 3E0GA 4AE0A 4YC2C 3SDXF 3CX2A 3TFBA 5C0RH 4RDQF 2BS9A 4XXWA 1UT1A 8CGTA 5DTFA 1Y07A 5I6XB 1UZ8A 4AQAB 4FNLL 5T33H 5I9QC 5IHHA 4PWEA 5J11C 2VQ1A 3GS0A 3U9PH 2RH0A 4PTTB 5FYKH 5B8CB 2YZ1A 4L4VA 3LEYL 5F72S 3U0WL 2X4SA 1QZNA 4LPUA 3MGAA 4AKQA 5GGSY 5FM4A 3VUAA 4KKQA 2BP5M 1D6VH 3ABKB 4MMXA 3BWZA 5EZLB 5I0YA 5FFOA 1ES0A 2I69A 2WBJA 5HHXL 5E6IC 5IOPB 4KKZA 3S37X 3I6KB 2YS4A 3FT2B 4Z7WB 4B96A 5JXEC 2MKLC 2CH8A 2FT6A 4PG9A 1XAKA 3QUXB 5F6IB 5I1LA 1JNLL 2CDGB 3L3OB 2H1PL 4YN3A 1KT2A 2Z92B 3UTOA 1JZHA 3UTQB 1KPRA 4LVHC 2BVOA 1HU8A 4AKPA 4GIAA 1AZVA 4LPTA 1C1EH 2OW7A 2IG2L 2CBMA 2EKSB 3L3HA 5E70A 4L1BA 3X1BA 1ITBB 5LXGH 5TPWL 3GLDA 2WNKA 3P73B 4P59L 4AEEA 5IOKA 5LN8A 4NOBA 5DTFB 1CF8L 4LMQI 4K3HA 3QWQB 1GYUA 4XN2A 4ZSOE 4F7TB 5D7JA 4XMWA 1HJCA 3QDGE 1NCAH 3O4LA 3MLZH 4WZ9A 1DQLL 2YD5A 2Q87A 3DV4A 5HDLA 3RVWD 1DBBL 4YC2B 4L23A 2OMTB 2XNAA 3PGDA 4GRWB 2VDNL 2GCYB 4HLJA 2AFNA 5GQBA 4YPGA 3V6OC 2D7MA 1N6QH 1KIPA 1NGZB 5KYYB 2H6PB 2QV4A 5FOJA 1LO4L 3FQYA 3VACA 2H45A 1CD1A 2VM3A 5J11B 3L7FB 4TSBH 5T5FL 4XZUB 5E6RB 1MOEA 3QORA 2VKXA 1CFQB 3P0VH 4FA7B 4ECNA 5ABDE 7CGTA 1G84A 4QXUH 2BVYA 1J1XH 1HWHB 2WXFA 3MLSL 4UV4H 4W1TA 1J5HA 5C6WH 5FOBB 2E9GA 2FRGP 3D0VB 2D2CC 2FJSA 2ZYSA 4PJ8C 3TNMB 5DD6B 3QHFL 5LQBL 4E41D 4FXKC 1SLWA 4JHUA 4JVPA 4L1DA 4Q4EA 1MHCB 4KK5C 5LO7A 4WV1C 4B3VA 4NENA 3FO2B 1QSEA 1VF5C 1XGUA 1H3PH 3HCVB 1ZVHA 2D7PA 1CLOH 2R4RL 5K59E 2L7UA 2DQMA 2VMDA 3EYOA 2OMVA 3UTZB 3L9EA 3SJVE 5IJVB 5EF1A 3LZLA 4P05A 5IGXH 1KUMA 3FUMA 3TNMA 5AOMA 4JRXE 4XMUA 3MV01 5EOQH 4QXTB 4U49A 3QDMA 2VDPL 5IP4A 3L1OL 4WI4A 5EH1A 4YXHL 3LH2L 3TA3A 3V0VB 2VDQL 1IU1A 4ZFOB 1AQMA 3ZDWA 1KOAA 3MUHL 4XZ4A 2RACA 1QLFB 3LQMA 1TZHA 2NY3C 4OSUH 3UROR 3LNDA 1WWBX 4PWGA 1D9KA 1U3HB 1OCRB 1HEJC 3ZR5A 1IL1B 1GZPB 1H8SA 1ZVYA 2G9HA 3MMEA 4L3FA 3WTXA 2E59A 1BV8A 3WFEL 1IGIH 1NIEA 2P5WA 2ZOUA 5EU5A 2MOGA 1XF5B 1GCYA 4P4KD 4RAVB 1OHQA 4V2CB 1NIBA 2AI0L 4G80B 1KIUA 3IXAB 3GEWB 1MLBA 3LN5B 3QXAA 3FRPG 2DMCA 4DGYL 1P7HL 1F1AA 1OQOA 5T5FH 3E2HC 2ZE0A 4IOIA 4HCGA 3OAYK 3QEHA 1LMIA 1Z5YD 2WXOA 3IDGB 2NXYD 1L9PA 1MCBA 3UC2A 2E76C 3D8MA 4L8SB 5EN3A 1A25A 3M1BB 2D9CA 1QPXA 3BZ4A 1J8KA 4OF0A 3U0WH 2DDQH 4PCTA 1Z9NA 1JSYA 3AG4B 2IADB 4PRAA 4AVKA 1A6TB 3E1ZA 2IDUA 4RFOL 4ZD3L 3SE9L 1BBDH 1S7UB 4X98B 1XAUA 4L9DA 4PBVC 1AZRA 1HHJB 4GAYB 1MJ7H 2H9GB 3FO1B 5AKSA 4JM2D 4PS8A 1E2ZA 3QRGH 1FVDA 3L2MA 3DWTA 5BVJB 3MRMA 3DDFA 3SKNA 3WNKA 1KIRB 3AXHA 3BZ4B 5KVEL 4R97B 1UXWB 2F19H 3BP4A 3O6KH 4X9YA 2X2HA 3BE1L 4OGAD 2JTDA 4MX7B 2VITB 4KNUA 5BS0A 3GUFA 1VB9A 2HX7A 4ATWA 2AERT 3O81A 4XPHH 3L1OH 1MWOA 2Y72A 2WYHA 2E75C 3MJWA 3BAIA 4KK6C 4TQHA 1A1OA 3HOGA 5TD4A 2P46B 2JCWA 3D50A 1XIWD 4IMLA 4JKMA 1VSCA 4WKZB 5DVPA 4YJZL 5KJRH 5K1JA 2XPZA 5BS0D 2R2CA 5C09A 1PZAA 3H3BC 1K8DA 1MCRA 3FTZA 1USZA 1CLOL 2VSDA 1U8OB 3SE6A 1K4CB 2LU5A 4QF1A 3MYZA 2D3VA 4N90D 5GGUB 4I0KA 3DBXB 5G5DB 5C08B 2EIMB 2VW6A 5IHUL 5IBUB 2GITB 4KVNL 2G60L 2MKWA 2EDHA 2NY1C 1QBLL 2CXGA 4HALA 3RURA 3GS7A 4QXUL 2A4CA 3CFCH 1BGXL 2PPDA 1WICA 4KDTC 1B3IA 3LKOA 4H1LB 2FJGB 1FRGL 1IZKA 2UUDH 4OT1L 3P2DA 5E51A 5KVMC 4KRPC 4ODWA 3CFBA 5BV7H 3DI3B 3KMDA 4HLZG 2NX5B 3BFWA 2WWOA 1IFHH 1C7TA 5IZ7A 3SE9H 5JXEA 2HFEA 1KACB 2XVGA 3X3GL 2ADFH 1EFXA 3V6ZB 2NYZA 2XN1A 3EJYD 2F19L 4BA8A 3KW7A 3B9KA 1BFSA 1CGYA 1ZHLA 3IVKA 5HHNA 3VYOA 1F3JA 1IEAB 3LV3B 3P11L 3FPXA 4NCC1 2HT4D 1DVXA 2IPTL 4K7PY 3LRGA 1PZBA 3BVXA 3LDBC 5HPOA 1I9JL 1NBQA 2GSIB 4JAMB 3I6GB 4MD0A 2H6PA 2CHDA 5GJTH 4LGRB 1X7QB 4PEEA 5E6YA 5HGDA 5HDQL 5HY9B 5AVXB 5C97A 1BIIA 3TWCL 3SQBB 3VI4E 2ZPKH 1TENA 4XMXA 4ILDA 5DMKB 1UH4A 3VXQB 3EYFB 4PGCA 2ZCHH 5D5MF 4GMTH 2ZWSA 2ZUTA 1BP3B 4YGVB 3RWJA 3MRQA 2DQDH 3GBNH 1E9QA 1Y0LB 3MRDB 3V0FA 4PGEA 1JRHH 5I2IB 1V3KA 3RP1A 5C3IA 3IFPA 1U42A 4ONOA 3MV7E 3QXTA 2UVEA 2HFTA 4BQ6A 1E4JA 3RL1A 4YFLI 3ZDYE 3U6XA 1AGCB 4QI3A 5DSCA 2UZPA 1M1XA 2MNUA 3QEUA 4ZPTB 1BXVA 4N6RB 4ZX4A 2FO1A 4QHUB 4JFPA 1MLCA 4R90H 2YA1A 2V6HA 1O6VA 4LASH 4WWKD 4G1EB 3VFNB 1R0AH 4GEJA 3QIUD 2G2RA 2X2UA 1MWAH 1ZT1B 3C6LD 3S36H 4AT6B 1CXLA 2O6PA 4X9FA 4GSQA 2WZAA 4NNPH 5INCA 3VXSB 3CC5A 5AW2B 4PR5B 4RGOH 1CCZA 4PRNB 2FIKB 5I75B 1SJEB 2VXQL 3HLAA 3RKDC 3Q06A 2E7CA 3ESUF 4KMTL 3QZOA 3VXUB 1WFJA 4LPXA 2ARJA 5E0QA 3VXRB 1L0PA 1Y0LA 4RISL 2VMJA 3OC5A 1I8MB 2PKDA 4G8GD 3V5HB 4FFZH 3W0WD 5TF0A 3VU2A 5C0EA 2XKNB 4B9KC 3IGLA 1A2YB 1ET7A 3DOSB 4H7VA 3OR6B 4RFNB 4DW2H 1I3RB 2KUTA 4EF3A 4N5UA 5SX4I 1MHHA 3GSQA 5CEYB 3TTSA 3UL4A 3QWRA 4BKLA 1WEJL 3DVFA 4FCHA 4ODTL 2CBOA 4RMUA 3GINA 4X6EB 1BREA 5AAWC 5CIPB 3KBFA 1KGXA 1LL1A 4DZ8B 4WFHE 3B5TA 1I1AA 1NFIB 2DJMA 3DK0A 4XVSH 4ZFOL 4U1KA 1CVSC 2ICWI 2ICCA 1YQ2A 1CLYL 3A6CH 5ICYA 4OJFH 2H8PA 2DWEB 2ESVA 5AB0A 1S7VA 3LD8B 3OVUB 2FECI 2FHBA 4XNMB 5C0DA 3KDMB 4S2SB 4XPTH 1D5IH 1XMEB 5HVHC 2CZNA 2SEBA 4NC2B 3Q9PA 1O7SA 3I9GL 2CGRH 1EGJL 4Y4HA 1GGCH 2CJSA 4PGDA 1ZCRA 2JCCF 4RMTA 4G9DB 3BPLC 4XNYH 1XV8A 5BNXD 5ETUB 2H3KA 1PL3A 4DKFL 2VXQH 5CGMA 3VD2A 1DJGA 3MRNB 2ZCKH 4QHMB 3SE3C 4RGOL 2GHZA 5J1TC 2ZIDA 5HGBA 4KRNA 3KPPA 3AMKA 3MMEB 4LHUD 3KJ6H 1ID5I 4X6CE 5CZXC 1A9EA 3VQLA 4G8GB 1KBGH 4YHKH 2M26A 4URKA 4NKQB 1R33A 4R7DA 3MNZB 4AXWA 2EC8A 4BDVA 1AO7A 3MZTA 2WLKA 1YY9C 2FDBP 5D7KD 4DP6X 3OKEB 4HKJB 3C6LC 3QS3A 3IS0X 4FFZL 3H9SD 1NDTA 3FZUC 1BX2A 1PU0A 1RFDH 1AQDA 4LPCA 3RL2B 1IGML 1YVLA 2VDKH 5FUOL 3TCTA 2QBWA 3K6SA 3MLXH 1NINA 2OMZA 3LB6C 1YLBB 4HZLA 1JXGA 4IHOA 3VMPA 3BYYA 1U95A 1L9MA 4UIMA 3NGBB 4DFIA 4NKOB 1GSMA 2EEFA 4PUBH 3S88L 4HETA 4P99A 1CFMA 4FFTA 3QFGA 4NWUH 4ACTA 5JR1H 2DWTA 4O02L 1YDPA 3UBGA 3MA9L 1S9KC 1XF4B 3O2DL 5EUOF 3SYQA 4ZMTA 1TT6A 2NNXA 3RWCA 3S0PA 3ARFA 2BY3A 2OMYA 4UQIM 5HGBB 3UJTL 3LMJH 1NCCH 3C6LB 3O3DB 4MXVE 1PZSA 2FBRA 4LP8A 4P49A 1R3IH 4XCNA 4L4JA 3A23A 4JCMA 3DHPA 4KJQD 1QI3A 1MVFA 4XNUL 4ISVA 2KDGA 2J5WA 4B9YA 1PD0A 2FTAA 3IXTA 1L9RA 2F0CA 3ILDA 3MLYL 2FLRT 3X12A 1DVTA 2OULB 2MCMA 3VH8G 5HI5D 1MXDA 2WLZA 4AL8C 5AW3B 2IQAB 3EXJA 4PJ9C 5DGRA 2J4WL 4G80A 4MQ7B 5KVGE 1IEBB 5DA4A 2YEZA 4D3CH 3V4PA 3PS6A 2YPLD 2AQNA 4HPYL 1W0VB 1MFAL 1MPAL 4WHYG 4LB8A 1Z5LB 1OP9A 5CO1A 4E0RA 1RUKH 2OX5A 4DKTA 4OF6A 3QAZC 3DXAD 3L5HA 1SYVA 5BMFH 4H8HA 5CZXD 5DHVB 5GSRA 3MKKA 3IJSA 3BAKA 3CFEB 3IDIB 3FL7A 3ZO9A 4QRRB 1EHAA 1KGYE 2G75A 3HNVL 5AL8A 4PH8A 5K5YA 2HFEB 5C09D 3IDNA 2F1EA 3DIVA 3CBJB 4KHXL 1ZE3C 3HS0B 3RBGA 2ATKB 3CDZA 4ZMAT 3QIWA 1OSZA 2OR9L 2AJXH 4LVHB 3IF1A 4Z0BL 3LZRA 4J5VA 1BWMA 3A21A 5CWSA 3HLAB 2HT2D 1OVZA 2ESVD 5GGRB 3NYKA 3EOBA 5AENA 2Y69B 5C0CA 1DBAH 1VFBB 3TYFA 2TAAA 3ULUH 3RWFA 3O41B 3LHPL 2MTPA 1IKOP 5F3HB 5EORL 1ZLVK 4X8XA 3ARDA 3LOWA 3NAAL 4L2LA 1HILA 5K9QI 3JV6A 1WAAF 4AMKL 4I0CC 1HH9B 5I75C 1S46A 3QK0A 4P07A 5B7FA 3FT3B 1HINH 1HZLA 5C2UB 15C8L 4HJ0D 4Y4KB 3RZCA 3FOLB 1NIFA 2XNAB 4AVIA 4CN1A 5I0XA 4PGEB 3HA0A 1FZJB 4R3SA 3ARGA 3H42H 4FQ1H 1Q1JH 1UC6A 1E8YA 2OSXA 4V33A 4JS7A 2XWRA 5I71C 3L3GA 4BFEA 4C83B 4ZYKB 4LESA 3K4DA 4OTXL 4IK7A 4YOKA 1BCIA 5BZXA 2IAMA 4JM2B 3G5YA 5BJTA 5ID1A 2BK8A 2YARA 1B4JL 4L18A 2F7IA 3D4ZA 3FCGA 4HIHA 4CJ0A 3M17A 4E5XB 5B3JE 4YHNA 4TUOB 4YSRA 1DJYA 4EUPA 4Q0XL 4M7JH 4B0MB 4JPSA 1KB3A 1E4HA 4H25A 1VPOH 5IQOA 3N85H 1BQLL 2R23B 2AJXL 4FLSA 4R96B 4K3GA 3KYOA 3PQYE 4M6OL 5TFSL 4GP4B 5F0JB 4GT7A 4Y4KD 4G7YH 2PF6A 1FFOA 3TNNA 1RJZB 1I1YB 2PCPA 2DQCH 2WXLA 4JANA 2Y7OA 4OB5L 3AW5A 3B9KB 5IVXE 1U91B 3BOVA 3ULUL 1DQML 1XCWA 1UKTA 3DETC 1YEWA 3BUYA 4I1PA 2JKXA 5AVWB 5CP7B 2JB5L 1V5JA 3IPBA 4U3SB 5INDA 3G04A 2BSEA 3GMQB 2NY6C 4JM2C 1D5MB 1L5GA 4F93B 3AM8A 5L2KE 1JWUB 2CR0A 2JE8A 4N2HA 4PJ7A 2ZUWA 1XTLA 4LRNL 4JM4L 1EVUA 1AVAA 2BJML 2DDQL 2YBRA 4J28A 4AM0Q 3V0HA 1W8NA 4L8BA 2FQFA 2VC2B 4F27A 2OTWB 1A0QL 3VI3E 1BG9A 5J13C 3IU3B 2O5YH 4EZJA 4JVWA 4PJHF 4LF3B 4JO8A 4AYDC 5CZVL 1DVFC 4K5MA 3KPRE 1QI5A 5I28A 4Y2DD 4Y9BA 4B60A 1C5BL 1DSWA 4B5ZA 4KK8D 2PO6A 5DMJB 3U9UA 5EU7E 4MWFA 4HJ0C 2JB6B 2CWRA 2Z35A 1IKFL 2X12A 2XWBA 3VD4A 4AQEA 4JZJC 2XN9D 4OFIA 1HCZA 1DVSA 5BRZD 2CK0L 4X6DE 1NGYA 1JWUA 2M8XA 3NJKA 5D4HA 3EYOB 4NHCH 1AI1L 4YSEA 3V4PL 5MEOA 5KYXA 3G04B 4EDXA 5E56A 4XNAA 4MJ5A 3FB6A 3NFSL 4NM8L 2VXSL 3T4YB 3O0LA 1T1WB 2F6AA 2PCFB 4NQEE 3X2QB 5MHSD 1A4AA 3SKNB 4APQC 4G8GA 1NUNB 4XCFH 4OB5H 2E8ZA 4X9BA 4POZC 5HGGS 2VMFA 1SBSH 4M8QA 2APSA 4ZUVA 2IH1B 2MFNA 4WRLA 4UIKL 4WU5B 1T20B 2W60A 2PUQT 4WEMB 4KO7A 4UNTA 4UOQA 1KLFB 3LB6D 2TSBA 4AY0A 3W0WE 4OFKA 1R3LA 1G87A 3SQOH 5DJAA 4F3FB 1AFVH 1WBYB 3H7BB 1GH7A 4P57B 3CFTA 3DX8B 2WV3A 3INOA 3V0IA 3Q0HA 1KG0A 3LQZB 2NRDA 1ZT7B 5FKAA 1OARL 1MLBB 2NLJA 4TS6A 2I7SA 5DK3A 3DETD 3CBRA 4HK3N 3CV5A 1A9VA 1T7XA 5ESQA 5GS0L 3CNKA 4WY7L 2CM6A 4PJHB 4YHPB 4LHUA 4HUWA 4WUUA 4N2MA 2WY3B 1BFOA 1S9YA 2CM5A 1JPFB 1OSPL 4I9XA 2VLLA 4OQTA 5I76B 4UCFA 3D25A 1RURH 5F3BA 4OI8A 5FHAH 2XTJD 4WUUD 5KVFE 4G70B 5DJ0B 2ZOTA 3FSAA 4MMYB 1IO4C 2O5ZL 3BJLA 3S5LB 3SDXB 1XF3A 3UO1L 1ACCA 2F8XC 3SHSA 5DRXA 2VJXA 1VFBA 3TYFB 1CF8H 4XMPH 4FG6C 3Q01A 3NIDE 4UQ2B 4PLNC 2D3NA 1J0IA 5ETUA 3OGCB 3U7YL 1FL6A 3GM0A 5F3BB 4JRXB 5F9JA 5GS2D 5CEXB 4WTQA 1C5CH 1LDSA 2BVUA 1ZE3H 6PAZA 1X9RA 4ZOAA 3TBVA 5T5NF 2WJ5A 1PS3A 1LILA 3KPSE 2AQQA 5J12B 1UACL 1G7LA 1YPZF 2PPFA 4NO0A 3VFWB 1ZXQA 2VDOH 1VA9A 2MNJB 2QSCH 4PRDA 4R90L 4X7EC 1G7JB 1KTDB 3QE5A 3FB5A 1Z5LA 4LO9A 5DHVA 5DEZA 5GSRB 1JDAA 3HR5B 4XHJD 4R8WH 3QDGA 1BZDA 1YEDB 2P8MB 4GY4A 1ROWA 4OIAA 4WU7B 1H3PL 3WN5C 1INQB 2DQFA 1RI8A 3T0WA 4NERA 4Y1AE 5CKAA 2HTLD 2HT2C 3KPRA 4PLJC 1D5XB 3L3JA 4ES9A 3BW9B 1A14L 2B2XL 2WLLB 1IC7H 5FHBH 3GNMH 6FABL 2XJLA 1TYRA 1J0ZA 4R26H 4A2LA 4AIEA