2WTRA

Full length arrestin2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
394
structure length
356
Chain Sequence
KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSDVAVELPFTLMHPKPKDDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN-1
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 58
structure length 356
sequence length 394
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA01
3GC3A 5F0LB 4J2QA 4GEIA 3UGUA 1SUJA 1CF1A 2WTRA 1AYRA 2R51A 1G4RA 5F0PB 4JQIA 1G4MA 3LHAA 5F0JB 4P2AA 4ZRGA 1ZSHA 4R7XA 3UGXA 4R7VA 3P2DA 2WTRB 4LL4A 4LL1A 1JSYA 3GD1C 5F0MB 3LH8A 4GEJA 3LH9A 4GFXA 2FAUA
chains in the Genus database with same CATH superfamily
4QOKA 4LU5L 4U3XA 1PTZA 5B38B 1TTFA 1J1XH 5ANHA 3UROR 2VMDA 2VO5A 1BXVA 3E3QE 4P2CG 4R7DA 5ENWB 3CZFB 2G3NA 4X7FC 2ENQA 3HBZA 5IB4A 4J8QA 3WLBA 2ZKHH 4PJ6A 2ITEA 2XX0A 3UZQA 5MP6H 2JLPA 4WWKC 1XVSA 5I1EH 2WXPA 4N9GA 2C1PA 4Z7VE 4P3WA 1UC6A 4F33A 4R7VA 2Y2WA 2YD1A 4ZSOE 3GMQA 1Z5LA 3TTSA 3OAUL 3SGDI 2PCPB 4OZGF 4P5KA 2PTTB 3NH7L 2R56L 4OCSL 4QHPA 3KPLB 4Q0XL 1JNHB 5EH1A 4XE5B 5JA9A 4JRXB 2GBUA 2CMRL 3HMWH 5DRWB 1BOGB 1E9QB 5JPNB 4E2OA 2RH0A 4L18A 2H3KA 1PIFA 1GZPB 2WBJD 4R83A 2D9CA 1A6WH 2X4NA 1RZPA 4Y5XA 3NCYP 4FNQA 1C1EH 5E2TL 3MA9L 4CC0A 2AV1A 3ZR5A 3TV3H 5F9JB 2ZNWA 1IEBB 3TC9A 4LB8A 1N18A 4M6OL 2ZPKL 1IKFL 5JHDB 1KEGH 2Q8AL 3VW3L 1GYWA 3K80A 2Q76A 4UT7H 2Z4TA 2Y1ZA 5BRZA 3I9IA 5EUOA 3U9PL 2FYVA 4XP4L 1W6WA 4MD4A 3SGEH 4X4YB 4YSUA 3VXOB 4KUCF 5I6LA 3ULVC 1TPXB 1O75A 1UH2A 1MREH 1QEXA 4BQ8A 4POZD 3ASWA 3MJ7B 5EPMA 2Q6WA 1HNYA 4XVSH 1E8WA 1NGXA 1CGYA 4HIJB 1FZKA 1DQDH 2RFXA 1AP2A 2YLKA 3M1OA 4H0LC 4M1GL 3BPLC 2IO5A 3S36L 5F72S 3PAUA 2HLFC 5FFGA 1NLDH 4HJIA 1JI2A 4NT6B 1GSMA 2HN7A 1KBWA 1F18A 1RURH 3WJJA 4OI7A 2ICWJ 4LDEB 2BY3A 4QRAA 4YAQA 5T5FA 1GOGA 1YY9C 1I8IA 4YLBA 1AZCA 1O5DT 1U4FA 1NANI 3X14B 2EYRB 3GS0A 4TVPD 4OGXH 2YQGA 4E5XA 1MLCA 4PRID 4FZEH 4GXUN 4AMKL 4DGYL 2EQDA 1WIOA 3UP1A 5DK2B 2LABA 2Z0UA 4JANB 4JCWA 4ZQKA 3DROA 1J8HE 4Q6IC 5E99H 3KPMA 3UXFA 3QXDA 1INEL 3TCXA 4JRFA 2ODHA 4K7PY 3CPUA 3L4ZA 4WK4B 1TVDA 5GRZA 2M26A 5LG6A 3KBPA 5I73B 3ZE0B 4ZX3A 3CPLA 3OLEA 1FF5A 2HT2D 2W9DL 2WGXA 1FSKC 1UXMA 4Z6AT 1A6AA 5CN1A 4N2LA 1BQKA 1HT6A 4NZJA 1JV5A 1L9RA 2DQGL 4X4XA 3GSWA 3QQDA 4O4YH 4YHNB 3AJ7A 3PV6B 1XH1A 1G6RB 5EZIH 2V5TA 3VCLA 1VGKA 2CJUH 3NTCL 2WUBL 4NJAL 2FX8L 3LS5L 4OLEA 5C08E 4ZW7A 1MCOH 2DBLL 5FO7B 1FG2A 4MZIA 2C7FA 3NPZB 4KC3B 1CDCA 1MEXH 1U95A 5I9QC 1UZ6E 3N6YA 1RXLA 2E7DA 4KXCA 5B39B 3LIZA 2WC7A 3KLLA 2EC9U 2ICEC 4FGMA 5E03A 1N0LA 3ILPA 3WJLA 4AM0A 2GQHA 3II2A 4DGWC 4M93C 4Y16D 1DQML 4M8VA 5BO0D 5AVSB 4JRYA 3NCXA 3GB7B 4U1MA 4CN1A 5IVNA 4X5LA 5TE4H 2NX5A 2UWEB 1IC0A 3KPNA 2Z91A 1B4JH 1VFMA 2BW4A 2IH1A 2H2PD 2Y6SD 5EU5A 4FQCH 4Y9BA 5AYUH 1KIUA 2R1XA 2FJHB 2AI0H 4XBEH 4ANXA 4E5XG 5D71L 1BVLB 2NUPB 3NDYE 4PS7A 2V3EA 4LKCB 5IFHL 4IOSD 4WO4D 4JFXB 3T65A 4Y19E 3V10A 3CLFL 5HI5D 4X6CE 4EIBA 43C9B 2VDRB 3T6XA 4YPJA 3CLWA 1PZSA 3T0DA 4AEEA 2HVJA 1ZTXL 2RB8A 3FCSA 3GPSA 4AJWA 1RK0B 4PRBA 3IE4A 5F9OH 5T3ZE 5D1XE 4K71B 4B50A 1CK0L 1UWYA 2E7HA 1R3KA 4WENB 1XSKA 1MJ8H 2IQ9H 2PCFA 4GT7A 1ZANH 4BWWA 3CFDB 3T6QC 3LB6D 1YC8A 5C0RL 1UM5L 4FA6A 3KE0A 2IQAB 3O9WA 1AXIB 3RGVB 3NIFF 3RFRA 2VLRD 4WWID 4PJ5E 3TT1L 4U05A 3U82B 1XF3A 3UZVB 4JZJB 2PLTA 4R4ND 3NA9H 1UZGA 4HLZG 2BJML 3EOBB 2DWEA 1KY7A 3QNYA 4DKAA 5JHBA 2BC4A 1P4BH 2H8PA 3STLB 3N2JA 4YDIL 4G6FD 4LFHG 5IHZB 4ZMZA 5K9JL 2XWDA 2C7UB 3RG1C 4DQAA 3V2AR 1S3RA 5MHSD 2JB5H 4U4BA 2AEPL 1XO8A 1W8EA 4Q2ZB 1EH9A 4O2FB 4FQXD 5ITBH 4AKOA 1TJHH 2XVBA 2C9VA 1BVNT 2HB0A 2P47B 2B77A 2JKNA 3WNMA 3T3PB 3TZVD 3A47A 3FOMB 1SXCA 4IMLA 5IUSA 3MRFA 4DUWA 5B21A 3ZPDA 1OCOB 2ESVB 1FGVH 2VR4A 3L5WA 4H1LB 1DVSA 3RIAK 4M6MH 4ZNCD 3MJ8B 4FADA 3WTSA 2V8MA 3Q3GB 4RVBA 3W81A 2LU3A 4RZCA 4DH2A 5CFAA 5IJVA 5DJ2A 3OX8A 4LLMB 2V4LA 1J8SA 4F7MB 1UHVA 3TONA 3EZJB 1UVQA 1GYVA 2VABA 3GI8H 1WFOA 4F7CB 1LNUB 5D2NC 3ARDA 2VLJE 3ZHKA 4GSXA 1I7RB 3PQYB 1OCRB 3OGCB 5CR1A 1F4YL 3IFLL 5EIIG 1OP4A 2BS9A 3NPSB 1KG0B 1M71A 4JN1L 2OTWA 4BHUI 4JDTH 5A2CA 1QPXA 2YC1B 2VZSA 1LD9A 4K3DH 4Q9RL 1HILA 4C59B 5I1CL 2GTZA 5J12C 3ZT5A 1M2VB 4IRSA 3COOA 3F8UB 3BKYH 4LCVA 5KZCD 4FFWC 3TBSA 1JTOA 3QQ4A 3NJGA 5F96H 3MNZA 3PGFH 1NL0H 3JWNC 2XKUA 2YXVA 5IMKB 5EF2A 4HX1A 4OLVL 1HL5A 4JHBA 4NOBA 1EZVY 4DGIL 5IWLC 5DSCA 1E7UA 3RWHA 4IBZA 3ZDZF 5C7XH 4B9CA 1MHCA 1XH0A 4MA3A 5HHMD 1OAZL 3IT8D 4Z7NF 5IBLD 2NZ9D 2YSSB 3BW9B 2GSIB 1I8AA 3V0AC 3RWJA 3U4EB 1GGCH 3NACH 4OFYA 5HDOA 2JI3A 1C9SA 4GQRA 2NNRA 4N6QA 1D2OA 3KPOB 3F3HA 3B9DA 3OKMA 3KDMB 5L9DL 3KPSB 4TSAH 2APXA 1GGIH 3IFOB 1RHHA 4CW1B 3N40F 1C5DA 4P2QB 1LO2H 1I3RA 3LCYA 3FT2A 3HG4A 4W93A 1HXYA 2R9HC 1F1AA 4ZMVA 1A3LH 2WSPA 4YMPA 3QFJD 5BJTA 5EZOH 4ZTOL 5GZND 3AWGA 5KVDL 3MPCA 5TQ2H 3R8QA 2IALB 3LNGA 2JCCF 3BP7A 3F65A 1E27B 2WSKA 2AJUL 3LNIA 4GSUA 4RGOL 3QJVB 4E36A 1AZBA 1PZBA 3PL6B 4NZTH 4YQXL 1JJUA 1GMEA 3VX1A 2QADC 1TZHB 2E6QA 5IQLA 4PJDB 2YUXA 4MWFA 1W0VB 2CNYA 3LRSB 2WAHA 1HDMA 1MCPL 2NY4D 1YYMH 1UA3A 2PCPA 4I0CC 1RP9A 2HSIA 1KWGA 5D5MA 3HMXL 2GSMB 2PTTA 1MG3C 1YN7A 2TSBA 4TVSa 3EOAA 5E2WL 4LVHC 4D0DA 4K5NA 1A22B 4NRXB 5DZNA 5DRWA 3RVXC 3EXLA 2EUZA 1G7PA 1M53A 1FVCB 4KAQL 2VXSH 1E9QA 1NIFA 1YAIA 3EYQC 1R75A 2FATH 2WYHA 2OP4L 3BH9B 3CBRA 4ETQA 1NDGA 4QJ5B 3DMMC 1P5UB 3VB9A 1YYCA 2E6JA 3B5GA 4I2XE 1A64A 3MACH 3ZN6A 3CFMA 1A7BA 4OGAD 2K4AA 4BRJA 5JHDA 3L2MA 3IGAB 4LEOA 3S2CA 1U8OA 1FO0L 2EDTA 4PH8A 5F1OB 1FNSH 4MQSB 3BVTA 4UM9D 4QY8A 1UM6L 5AW0B 1RKRA 1C12B 2A1WH 3PJNA 3A23A 4FYQA 4IM8A 4ODUB 1OZTG 1PLGL 2IADA 1HHIA 2RQ8A 3BZFB 4XP9H 4FXLA 3GMNA 3P2BA 4QRPB 2W8CA 5JOEA 3EJJX 3QCVL 4UZGA 1CFMA 4DK3A 1MHPH 3MLZL 4G9FA 1V27A 3CX5J 4BBWA 1A2YA 4HCGA 2X42A 2BSSB 4G8FA 2GCYB 5B38G 1QEWB 1ZS8B 1LEIA 4NT6A 2BVQB 2APBA 4DNLA 5IIEB 3SDXE 4IEFA 3QPKA 5C0FA 5JR1L 5E1GA 1IC4H 4F58L 4XOEA 5KSBA 4NO2B 3PLYA 4LT7A 1T0MA 5CSBA 3EUUA 1S7XA 1GIGL 3RBGA 5DK0B 1DZ0A 1FPTH 3ATBA 2EYRA 4QRBA 3O6KL 3U2IA 3SPIA 2JJSA 3FUJA 3K46A 3WY2A 4U6VH 1Y0LA 1HHJA 1M3JA 5E8OB 2X6UA 2RQEA 1J05A 3BZ5A 3U36A 4LKXB 4K15A 1OTSC 3OKYA 4JANA 1FHNA 1OXYA 2XZQL 1G1YA 2NQCA 5K93A 4XZUB 3WO4C 3SKJL 1ZLVH 4HJJH 3QT2A 1N64H 4N86A 3LKOB 1EAJA 4XMKH 5KOVC 5IMMB 4QHLA 3T0EE 1DQVA 3ERXA 1XSOA 3RFZC 1ND0A 6TAAA 2YAMA 1C8PA 1IMHC 3U1PA 3S35H 3K4AA 5HGDB 1MDAA 3ZKMD 5EOTB 2OMTA 4HMEA 2FQGA 3S37L 4KRNA 5IFJA 5T1DH 3X3FL 3PV6A 5DHVH 1AI1L 1NBZA 3V7AE 3K6IA 1OT4A 3VRJB 1S46A 3U30B 2B3IA 1Q38A 3EYSH 1BFVH 1QNIA 3OB0H 4PCTA 5GJTL 4ZODA 3SCMC 3CWGA 3O3EB 4M61A 3MBEA 3MLUL 4PJBA 4W9JC 2Q1EA 2NQ3A 5ALBH 5I75B 1JYXA 3DTXB 1OVZA 3KM2A 2DV6A 4I87A 1EDQA 1A1MA 2PP9A 5TE7L 3BAXA 3TL5A 4Y4KB 3HTLX 1A7OL 2AEOA 2E6PA 3KNBB 3NSCA 3QIUB 4Y2DB 5KAQG 5PCYA 1V5JA 2JELL 3JTSB 3X1GA 4LDCA 3HCVB 3LJ3A 3QWRA 5DT1L 3SE4C 3KPRB 3V9CA 1RZQA 1CL7H 1HL4A 3APCA 3EJYD 1F13A 2FEEL 5FW7A 1I1FB 4KV5F 1LO5B 1N19A 2JF1A 4ZXBA 4JFDA 1TVBB 4YDJB 3RWFB 1BM3H 1GHFL 3PWPD 1OAKL 4JS7A 4NYLA 3AZUA 3JV0A 2P7TB 3NCFB 3OKOA 1N9PA 4NCDA 1ED3B 1J0HA 4U4IA 3R7QA 3TYGL 1Q9KA 4WF7A 2AQ1A 3HBQA 4RGMB 3G5ZB 3K74B 4NO0B 5D7HA 1MF2L 3RI5F 4ATTA 4OBRA 1JFQL 1G0XA 4X5QA 1AGEA 3FCUB 3WAJA 2NY6D 2DI9A 4GUQA 4LCYB 3CVDA 2YKLL 4P23D 3VRIB 5C0BA 4PRPE 4RFOL 1D5ZB 3LVEA 4XPBL 4O58H 1OAUL 1DBBH 3VI4E 1NAKH 5AZ2H 5AW8B 1X5AA 3MA7A 4KGJA 2K9UA 5J11C 2ODIA 4YSDA 3QCTL 1A65A 1WC7B 1RULL 3DECA 3LY6A 4CSZA 4EQ2A 5KANI 2NY2C 4Q9BA 1FFPB 4BSVA 3BH8A 1YEHH 2WLNA 3VWJA 3GRGA 1UD4A 3CD4A 4KI5E 3QXVA 3E6HB 2IQAA 4ZUUB 1J88A 1OTTD 3B8YA 4JREB 3VXRD 4AQ1A 5DMKA 3WENA 4TTDC 1NWPA 3RHWF 3HR5B 4QXWA 4XX1E 1S7TA 2W88A 3VSUA 3RAJL 5E23A 3O3DB 1M7DB 3EOBA 5CEZL 32C2B 3FO9A 5JUEH 2I07B 2JIXB 2EIMB 1G1KA 3GSVB 1EGJH 5HJBA 2C7UA 3TWYA 3MRBB 2H3NA 4NHUB 1YUHA 2AK4D 4HKZA 1ZMYA 4ONHB 3MV7D 4P4RB 1IARB 3X11A 2FO1A 4GAJL 3RDTA 4PM1A 2A6IA 1D7DA 1R5VB 4XP5H 3I2CH 2F6AA 5AOJA 1MCQA 3F6JA 4NC1E 1A9EA 1U8NA 3OL2A 4KJPD 3C5JB 2FECI 1J7VR 1G9ML 4AEIL 2GVYA 1ZSDB 4I13B 1KZQA 5AL0A 5JIIA 4G42B 4JM0A 5FCUH 1WZMA 2JV6A 4ADJA 1IAIH 4R96A 3Q3GA 5DEJA 3CXHJ 3L3OC 3TA3B 4YHYB 3KYOA 5F7FA 3ZT6A 2DKUA 4KMTL 1OPGL 1VAHA 5E94B 2QGBA 3L4CA 4RETB 1ES0B 3ARVA 1AZNA 4L4VA 3HG1B 1HL9A 9CGTA 3BUYB 1UT2A 4N90D 4E9QA 4ABWA 4HSAC 1I7RA 1NGPH 3GIVA 4MAZA 3WHXB 3QQNA 3Q43A 1EHLH 1LGVA 1OM9A 1T22B 4XXWC 3GIZH 2XRAH 3ARSA 5ISZA 5E9NA 1X7QB 4U1IA 7PAZA 2ZYIA 2PXYB 5AW6B 5JO5A 4EDWH 1W8NA 1M2VA 2WCGA 4KFZC 2IC2A 3VQ1C 1QBLH 2VLLB 3IRPX 1QA9A 1U4EA 2X4QB 5ABAA 3WTYA 1ONQB 3ROOB 2DM2A 1I9RL 4N2OA 1UWXK 4XVJL 3D69B 4EQ3A 4DEUA 5TPWH 3QFGA 3CU7A 3U0TB 3SOBH 3U0WH 3C5ZA 2OKMA 2Y2YA 5F7WC 1DE4B 2MQ3A 4FG4A 2VDLL 1K8IA 3GZPA 1KSRA 2X28A 2NR6C 3N06B 3N85H 3H0TA 3ZTCC 2DQDH 1NMAL 1MCEA 2VZTA 1RZJL 4U1SB 5D4QA 3BW9A 3ECBB 2OXGA 4X9IA 4UNUA 3OTTA 4B3EA 1CE1H 2FJGB 2E76C 4KK5C 4PV8B 3V8OA 2VISB 4YBLC 3K71A 4MNQB 4IGBD 1ZHLB 5KUKA 1ZTMA 3LZFH 3VGEA 2O6FA 4ZFQA 1E5BA 2VDNL 2QMJA 1LP9F 3UBFA 1JZGA 1BQHB 3R1GH 4MYWB 1FL3A 3MBXL 3G7TA 4JKPH 4Z0BH 3D33A 4ZTPL 4PREB 1RIHL 2VN3A 2CLRA 1TZIA 5LGHH 4M6NH 1L7IL 5FPIA 1ZTXE 5LBSL 5J5EA 1W9XA 2XWJA 1Y07A 1ORSA 2EXYC 3TFKC 3Q2CA 3UABA 4PUBL 5D7JD 5DGQA 5IQMA 1CYXA 3IF1A 4ZPTB 1A6PA 4RFNC 4TUKH 4OZFB 2WXGA 3EADA 3ZZSA 1CXFA 4HH9A 4YL4A 3ZVVA 2HFFB 3UJTL 5DHVA 4NRYB 3HLKA 3NFSH 3WS3A 2AJSH 5E95B 2GTWA 3AM8C 4XNUH 4NKMA 2Y7SA 1WK0A 1WO2A 5CJQH 2ZYHA 2YGOA 1FVCA 4JFEE 1VACB 4UV7H 3BSHA 3M7OA 4QLWA 2WXLA 1ZV9A 2IEPA 2EXTA 3MLRH 1U21A 5I66B 3B43A 3FYEB 3HNVH 2XWRA 3GBLA 5F7BA 3AMLA 4LXFA 3N1QC 5D1QC 1PKQB 4L1HA 2V9UA 3PWNA 4F15B 1HJCA 4FQJH 4LP4A 1TLMA 4D3CL 4YPGA 4MDJB 4PJXE 2QTVA 1HINH 3AROA 2J71A 4M5YH 2G30A 5LWYH 4OJEH 2BVOB 3IFPB 4KNTA 3WNOA 3DHMA 3WAKA 1J86A 1DUZB 3FQ1A 2GY5A 4OIAA 3ARGD 3SQOH 4J39A 2AEIT 3HNTH 2WBWB 4MQXD 5L8JB 4G8GE 2QQKH 1QASA 3HE7B 5FFOA 1KPVB 1EDHA 1QR4A 1WA1X 1WCBB 5I18L 3JV5A 3RZCC 3JWOL 4DVBB 5J1AB 3IE9A 3IU4H 3QJXA 4V1DD 4PRNB 1P1ZB 5ID0B 1TZGL 2GCYA 2A6DA 1ZAGA 5E8DL 1QEWA 4QHUB 2BSTA 2PW2B 4OAWB 2XXMB 2IOOA 1E4KA 2CIKB 4LNVA 4XN1A 5CGMA 3OKLA 1HE7A 1N6QL 1XGPA 3B3BA 4NHCH 4KO7A 4FZ8L 5DUMH 2VC2L 2QLYA 4OCMC 5JHLL 5DD5L 4LF3B 5FC9A 1FGNL 4ZJ9A 1V3KA 5C0DB 5KYWB 1VA9A 5C2BH 3P0YL 4R97C 3SDXF 1O9ZA 2ZXCA 2V6HA 3CVHH 4KQ3H 4X9HA 4LKXA 1D5MB 5D1ZB 2DM7A 2G3MA 3MUHL 4MDIB 4EN3A 3CZKA 1LE5A 1LMIA 3E80A 4K9EC 4H8WL 1IT9L 4L8CB 3GZQA 1EGJA 4DZBB 4YGVA 1ET8A 2ORBL 2WP3T 1R3LB 5LDSA 1C08A 3X2QB 5J13C 3IS1X 2YXWA 2PN5A 5C09D 4P06A 2CRIA 2BNQE 3FT9A 5DZJA 5CFHA 1LDSA 4LCCB 1FNAA 2WUCL 4OCWH 2J2ZB 3NG5A 3FXIC 1NMBH 2IDQA 1AIZA 1N10A 4X9YA 2IAMC 3H9SB 1XGYL 3TNMA 5C8JB 3EO0B 2XSKA 2O93L 3R4RA 2CZNA 3N41F 4P4KC 3MZTA 3QXTA 4ABQA 3L9RA 3U1SH 4TUUA 1HIMH 3O3EA 1NIBA 3FHQA 5KVDE 4M62H 25C8H 2F5BH 4KI5C 1NGZA 1QFHA 3CVIL 1BYNA 4Y4KA 3SOTA 4OV5A 3MQIA 2NTFA 4Y2DA 3ZTNH 5IVXF 5E5UB 5EORH 2OBGA 1D9KA 3FU5A 3NJMA 4HK0A 4GRLB 5TQ0L 3HCVA 4I1RA 5EA0H 3KPRA 1NGWB 3IKKA 3FO0L 4OZHA 1YJDC 5H35A 2A74C 2MTAA 3R8BB 4WI0A 1O5PA 3AUWB 3U7AA 3NIGB 5ECJE 5DJCB 1A6VH 2P7TA 2WKOF 4N0YL 4EI5D 3BP6B 3WKNA 4BFKA 4EI0A 2H5UA 3C2SA 1QZ1A 3CIQA 3HKZA 1X5IA 3FRPA 1UXSB 3NRPA 4R90H 4NUQA 3WSQH 5IJCC 4NC1C 3E2HC 5CZVH 4FI6A 1X6LA 4JM2B 4OLZL 4QD2E 4HDIB 3V7MA 3ETBJ 2Z31B 4X6DE 3EDDA 3T4AA 2VLKA 3KVDD 1WRFA 3GK8L 3V4LA 3GNML 8FABA 2BMKB 2N4IA 4PY8J 1KUMA 1UQSB 1D5ZA 1VERA 3QUXC 2AEQH 4QT5A 2MOQA 4R2GC 3RX7A 3DJRA 3QEGH 1IE5A 4FXGC 1OB1B 2VR7A 3GO1H 4YHIA 4NXSA 4QLRA 5F7NC 5IMOA 1U36A 5GPRA 4ZFOL 4HFUL 4LDOB 3IJYB 4AUJA 1RIUH 1HOCB 4G5ZL 4C4KO 2XN1A 2LW3A 1XF5B 1T1WA 3OC5A 1H0DB 2GK2A 3D1MC 4G80A 4P05A 1SY6H 1VZGA 1N4XL 2J7LA 2W0FA 2XWZA 1A6ZB 3IJEA 3QHZH 5AKSA 1BJMA 1KGCD 5JIHA 3MROB 4QTFA 4M5SA 3KYKL 2R29L 3CFCL 4YGAB 2EDFA 2HYMA 4J3BA 4BA8A 4P07A 5GS1A 1I31A 32C2A 4MYPA 3M07A 4H8VA 4Y7OC 5DRNA 1AHWA 1OIOA 4HXBH 4K8RL 1JK9A 1GOFA 3MRBA 4J3OF 5FYKU 1MVUA 1X4XA 5ESAB 4U7MA 3RKPA 3TT3H 1TCRB 4HHAA 3VXME 4XMWA 4DAGH 5D7IB 4XBGB 3WHE0 4NSKB 4PJEB 1R5VA 4AG4H 2NNAA 5CP7B 3S9DB 4M7LL 4I4WB 3IDGB 3GINA 5F7HA 3CFJB 4Y1AB 2VLMD 3BUQA 3SPJA 3ULUE 3EJZC 2OW6A 2ZCHL 2P5WE 3GQFA 3DBSA 3APNA 3FRPG 1FH5L 4RQQA 4TKWA 1FLRH 1HQRB 3HC0B 1OLZA 1QBBA 2YPVH 2BNUA 3SGDH 1S5IL 3CHSA 1VF5C 3FO2A 4D0BA 1K5NA 5E94A 2ZKWA 3FB6B 3B2VH 2EVIA 5C9JB 3OR6A 1L9OA 1QTPA 3BGMB 2WBKA 3MFFA 3I9GH 3FB7B 5ICUA 1E67A 2EVHA 5FUZH 4F20A 2VQTA 3WBDA 4KUCD 3N91A 4K07A 4UM8B 4A2GA 3ZDWA 2DMHA 3RJOA 4FQPA 1TU2B 2GIYA 1X7QA 3EYFB 1LK3L 1CURA 2PXYA 3BSZL 3IXAB 2C9RA 3LRHA 2E86A 4ONGH 2BNRE 3FU7A 3IXTB 2AXWA 2NYYD 5DS1A 1H5BA 2NT1A 1MVYA 4FJYA 5D72L 1RIVL 4JFOB 5FW6A 5DURD 2C4FU 5F8RC 3G5WA 2DJ4A 5C0EB 3S37X 1E28A 3CZNA 4XPTL 2D0HA 4N0RA 3UBXA 3LDBB 4HOMA 4IBVA 4F5CA 4CKVX 2HT4D 3ES6B 3Q1SL 3GXDA 2WBJB 4WUUD 4X2UA 2HRPH 4QDGA 1BV8A 1LO0H 3Q2LA 1J1PH 4N85A 1IBGH 3U7WH 4OZGA 1AYRA 3QH3A 4BD4A 3WN5B 3DRQA 5EOQL 3ARXA 1VESA 2JCWA 3K8LA 4NPKA 1XF2A 1KENL 3HHSB 2IAAC 3N1FC 2CO7B 4OJFH 4PV8A 4AIEA 1T1YA 3CHPA 3MRKA 4U6XB 1BQLL 4LPWA 3MLWL 3CVHA 3WNIA 5FOBA 5D4JA 1AFVL 3O6LH 2P46B 3QNXA 4ZD3L 5HTSA 2PYED 1SRDA 4OF8A 3X12B 4XO8A 2X53A 5BS0E 4PGCA 1SYSA 3VGFA 3ARQA 1H3XA 4OIIH 3RPKA 1X44A 1NANH 4X6EB 1A7QH 4PCKA 2J8OA 3WI9A 3GMPA 2KI6A 3PXHA 2EDQA 4LIQH 3WE6B 1KIQB 2A4ZA 2B7DT 2X1QA 5H94B 4J3UA 1DEEB 2IBZX 4D9LH 1JN6A 5TF1L 4LCWA 5IG7B 1I7TB 4XAWL 5I6KA 3AS0A 1KTDB 3T2QA 1JZ6A 1B88A 4UAHA 5G4OA 2M8XA 3L7EA 4NJ9H 5IB3B 4OF5A 4XRCA 2GUOB 3ULVD 3SKOB 1HXMA 3DO7B 3P30L 2R69H 4IK7A 4X4ZA 3W5MA 5T1KD 1MPAH 5CEZE 2XI9A 3MCLH 3HBGA 2FWOA 5CSZA 4N2IA 1TQTA 3H7BB 4PGBB 4PRIB 5IFAH 2Q3AA 1YEEL 1QUNA 4G7SB 2JI1A 2HLFD 3JTBA 3CC5B 4Z76B 2AHIA 3MRMA 1A7NL 3R06A 4K5MA 3UBXG 4FQ2H 4H4NA 1PKQA 2Y3NA 4A04A 4M43L 2UUDH 2XQYG 5CEYA 4RIRB 5H8DA 3ARBA 3T2NL 4EE2A 4WWOA 5HHVH 3HI6H 4RGNE 3KWWA 1YY9D 2HKHL 3JV6B 5CGBA 3GXNA 3V52L 1IEHA 4JVWA 2Y07L 4HH8A 1IO4C 2H1PH 5J1TC 3MMEB 4JKLA 4XCCH 3ZY7A 2VDPL 4E68A 2CR0A 4BH7B 2YARA 3KXFD 2FGWH 2OTPA 4HUVA 4PJXF 2G75A 5ALCH 4OCXL 1EMTL 3B9KC 3MRRA 4LNRA 3DPBB 1CR9H 1PFOA 2P3YA 2XTJD 2IV8A 2YQBA 3AXIA 4ZBJA 2A3TA 5TDNB 5IHUH 4AIOA 2WXNA 2Q0ZX 4RRPM 4XP1H 4XMPH 1RU9L 5FO9B 2R0LL 2XV6B 5LNGA 2ZYSA 1S7RB 4FLSA 3T1WA 5KSUA 3C87A 2NY7H 1LK2B 2D73A 4C4BA 4A7SA 1TR7A 3SEPA 2ERJC 1MI5E 1UYWH 5T1MB 1OV8A 5C0GA 1SOQA 3U2SB 4EKXA 4MB5A 4WU7A 1CXHA 2EUVA 1SY6A 4ZW8A 2IDUA 2J8UB 1JGUH 3TBYB 1S7SA 1XR9A 1D5MA 2FHFA 3PHSA 3V6OE 2L4OA 1KELL 4HEME 3TN0C 2O4EA 3ABKB 1FNFA 4L8CA 3CMGA 3RDJA 4KMQA 3UADA 5D7LA 2KYIA 1DQQA 3CV5A 3H2WA 3BQUA 5CU9A 2Q5BA 4W1TA 5E2UH 2A7BA 2DD8L 4XWOC 1BFOB 1LVEA 5LXGL 5J56B 1LJMA 3LH2H 2DKMA 5HYJA 2DJMA 2JSFA 2FUTA 1KB5H 4FTVA 4QXTB 1T03H 3CZGA 4GJTB 3MKGA 4WNQB 1KMGA 3ZTEA 3B8SA 2DTSA 1E9PA 4HGKC 3AREC 3G9AB 3UTOA 3DSNB 4MNHB 3MODH 3QUML 4M29A 5CILL 1U92A 4PN6A 3TO4D 1O9VA 3M1BB 4FI7A 5KS9E 2YN5A 1QPPA 4E41E 4Y1TA 1X9RA 3ZLQC 1AG6A 3OHXB 2B20A 5D96B 3AY4A 4IRJC 3IDXL 4X80H 5AVWB 1SJHB 3US1A 3N50A 3QYCA 4TNVF 4UMSA 2WQRA 2YPVA 3CIAA 3P3TA 1MQKH 1EEQA 1JHKH 5IKCA 1QFWL 2VLRB 1CU4H 4X5XA 5DMIH 1MUJB 1RZFH 4DTGH 3W38A 3US0A 4JBSA 4DFIA 2XYBA 4UT6L 1CC3A 5SWQB 4PR5A 3JVFC 1DANU 1Q8MA 1Y18A 2FL5A 3HAEH 5L2JA 3ZKXB 3Q6FB 2ZXWB 4G6FB 1URLA 3V4VH 1IZKA 2EKSA 2ZAHA 5J6SA 3OM3B 5FYJU 1XF4B 5BW7C 4OJYA 3V6FB 3L3KA 2WJ7A 5EU6E 5IROC 1BGXH 1DP0A 4FQXB 5TDOB 1SN5A 2V3DA 5DEFB 2D31A 3VX0A 3TZVB 1WWAX 2A6KB 1ZT7B 4MXWL 5JPNC 2E74C 4IJTA 4M56A 3F12B 3NCYS 2W07B 2YUVA 1QYGH 1IC5L 1F02I 2J6EH 2IANA 3QG7H 4KKBC 3ULUC 1OAQL 1QFPA 4NQDD 5CZKA 4AQZA 3KWXA 3CSTA 4A39A 4OTXL 3VFOB 5H2BB 3MXWL 1UACH 4BUHA 1Z9PA 1KIRB 1B2YA 2ITFA 1KTLA 1J18A 4XNXH 4BSJA 2F8XC 4N87A 1T66D 4YDLB 5GZOA 1HZHL 2DYPD 5DJ6A 2A0LC 4K23H 4Z7UF 3MROA 2H7WA 2DI7A 3O3AA 4HIXL 1TNNA 4XMVA 3GDCA 3RTQD 4AQ8A 3F7YA 5KZCB 1MY5A 1R5IA 3PDGA 3F64A 2W91A 3DGGB 3F58H 4Q74A 1FNLA 4M48H 4HPOH 2DLIA 1AQDA 1NCDL 3ZDYB 2BIMA 1BP3B 1BBJA 5ESAA 1XGTA 3IDIA 4DKFL 4KZDL 4BZ2L 4HISA 4LP5A 2FT8A 3C09C 3HOGA 1MCFA 5DD0H 3T1FB 1MW3A 1Q9LB 2NY5C 3FPYA 1KGXA 3BI9X 3X3GL 4BINA 2QFRA 2VQ1A 4JQVC 1X5FA 2KPWA 4ZS6C 2XWTB 4GUOA 4ZNEE 2D2CC 4EBQH 3ZHFA 4YHPB 3P0GB 3MRDB 1KLGA 4K3EH 4LRNL 4ODBD 3V9FA 1K6QL 4BH8B 2NUTB 5CZRA 1Q9WB 1CGUA 4FFWD 4BDVB 1NGQH 1I53A 4FEMA 3NCWA 4Z78A 1CXIA 2GYSA 2YEZB 3PGDB 1KTBA 2FYYA 3CFTA 4FNPA 3CX2A 3F7VA 2ILLA 2I60L 5F3HA 5ERWB 3KWUA 4O2EA 1DO6A 3QFJB 3FUDA 4IIZA 5AB9A 1DQTA 2ZP0T 3P77A 5DJ8B 3L4YA 1A4AA 3D48R 2ARJQ 3HI5L 2G4GA 2NLJA 2KERA 1E8ZA 4P59H 3IRCA 2UX6A 3W39A 2FAUA 3K6NA 3KR3L 3TIDA 5KTEH 1KCUH 2AJXH 4PPTA 4Y2OA 4TNFA 1U93B 4G9DA 3ARFD 2NY4B 4U1HA 4P9ML 2J88L 2N1TE 4HWEL 1Q94A 3KWTA 2FHCA 1U8JA 2JCCA 2R9HD 3NFPB 2HG5A 4RDBA 4YWGL 5KBLA 3QJZA 3CDZB 3HUJE 3ZXAC 1QRNA 3QORA 3LKSA 1HH6B 4HPHA 2EO9A 3ES6A 3DUUA 4KK9C 4J3VA 5T3XL 3T04D 1TLKA 3HHRB 4PRHE 1NLBH 3PV7A 2BIIA 4O02H 2QADD 2Z8WC 2AQ2A 2EDDA 3HPJB 5I6XC 3MVSA 1CE6B 4OCRH 2C3XA 2CO7A 1ROCA 4XB3A 5ESVA 4OT1H 4BFRA 4UM9B 1NICA 1T1XB 1AE6L 2R4SH 2Y06H 1SFHA 4JB9L 2DY2A 4W9ZA 3LD8B 4A6YL 4TMPA 2WTPA 3BKCH 4RGNC 1LL1A 2B39A 2CLVA 4PIBA 3C2AH 4FXKA 5I8KL 3BAEL 5TK2A 1BZ7B 5E0FA 3Q5OA 5CKAA 1MCHA 4PJ7F 1LDPH 4ZW5A 1IQWH 3QXAB 5D2LF 3CHQA 3DMMD 1VCAA 3EFDL 2JKRM 4X6EA 5F88A 1EA9C 4N8CL 3AT0A 3WE6A 3GUTB 2IVFC 5DEGA 4GG8B 1I1YB 1R4XA 1F86A 1P7BA 2GW5A 1RUAL 4FE9A 4IU2A 5GRWA 3UTQA 4NUJA 4NO5B 5DUBB 2ISDA 1J8HD 1KB5A 2GJ6E 3FC8A 1YECL 4FCHA 2C9AA 3DVIA 2FBRA 1KTDA 1BEYH 3NJNA 1T21A 3T6VA 3OVUB 5E00B 3LHPH 5F6IB 3SKOA 3DO7A 1LE9B 3FQTB 4N0UA 2X05A 4JHVA 4OLYH 4QTHB 4YHLH 4KXAA 3RGVC 3W2DH 5T5FL 1MJJB 3LRGA 3C75A 2LT9A 3K6SA 5AKTA 5HYFA 3H7LA 4MNGE 4FA8A 5CAYB 4JZJC 4JL2A 4ODVL 4KUZL 5AD0B 2VDQL 4ZOBA 1YY8B 1DJIA 3LV3B 5K9OA 2OSLA 3HZYA 5C08D 1ANUA 3HAEA 5KVGE 2I25N 1KTKE 2J12B 4NFCA 4LPCA 4LLQB 3V4VA 4ALAC 2QQNH 2XG4B 2A9MH 3FH8A 3OKNB 1JSYA 1Z3GH 3VXSE 4POYA 1IJNA 2FB4H 4DP6X 3CCHA 1RZJC 4HUNB 5J9PA 5ES4B 3Q8EA 4OLWL 2IGFH 3MV8E 1M1SA 2FHBA 2DQHH 3CSYB 5TGBB 4B41A 1LLAA 3MKKA 3PNWB 4GNKB 1NC4D 3V0FA 4JG1H 2B9BA 3CDGB 2QKIB 1BMZA 3KG5A 1OTSD 3WIFA 1BX2A 5KYYB 5EOCH 1J8KA 1P6FA 1XIWD 2J6EA 3AG1B 4PI0A 2XZAH 3REWA 3NZUA 1FYTE 1TQCB 3GMOA 3QRGL 1UWEL 4FP8L 1G94A 5IW6A 5DHMC 1VB9A 3PGCA 1NIDA 3B83A 1LK2A 3DVFA 4UT9H 3UCQA 5AB0A 3FDWA 4Y19D 5KBPA 2FK9A 1B0WA 1CXLA 3U0PB 3UJJL 1KYOK 4ELKA 3LIZL 4QGYA 2O6EA 4LCUB 3P3YA 2K6WA 5BV7L 3I84A 3LXUX 1YEGH 4JO5A 2FT7A 3PWPB 4ZUVB 4BQ9A 2B1HH 5T3ZD 5D1XD 5DC0A 2EDKA 3SCMD 5FR3A 2VR6A 4C83B 3R19A 4TLKA 3QUGA 4MMXB 1G7LB 3V0VA 1GZHC 3WFHB 5B8CC 2MPAL 2OR7A 4PJ5D 6PCYA 2NY6B 8CGTA 5FA3A 1INQA 2DTMH 5GGRY 4L3EE 1U8MB 1Z5HA 5AKRA 4KXBA 4P23B 3L5JA 4QHMB 2EC8A 2X09A 1IFRA 3ME0A 4JFFA 1KBBA 3DJTA 2O5NA 4NQVB 4WNQA 1FFOB 4K7PL 1U8HB 1CPUA 1NBCA 5MERA 2G9KA 3UFIA 3L8QA 3H42H 3M1BA 3UIYA 2QPSA 3X17A 1SN2A 4IJ3B 1IEAB 3M45A 2APTA 1YEDB 5DZVA 1SJEB 1A8JH 1EX0A 1SJHA 4UQBA 2XNAB 2CJSA 5TE6L 2FBJL 3VXRB 2BFGA 4RMTA 4WFGE 3X1NA 3PHOB 4RFEB 5JQIB 5ILTH 4NN7C 3ULSB 4JY5H 1TETH 3GSXA 5FDWA 4FDWA 4LMQE 2FD6H 3A5VA 5DJDB 5KS9F 4E9YA 1IGML 2VRQA 2QELA 4HSQA 1Q1JH 1HESA 2J8HA 5EN3A 1J1XL 4C56A 3L9YA 5IQ7H 3QI9D 3NSYA 2X9ZA 4UOQA 5DCCA 2AK4B 2ZKHL 3ECVA 3MV7B 4YHMH 2VMJA 5MP6L 5I1EL 2NY2D 1CIDA 2WLLB 2PW1A 3CDFA 1ODUA 2IG2H 4N2BA 4PJFF 2R0KH 2VLJD 3W82A 3QO1A 3UBGA 2V2XB 3L3JB 2DZEA 4TTDD 3SGJA 3MHZA 3SE3A 1MFUA 3MV9E 2I26N 3WMSA 1BW8A 3O4LE 3O4OB 4V33A 3RKDC 1AGCA 5DVNA 2DMBA 3HMWL 1P5UC 4PBXA 2ZF9A 2JNZA 1E6OH 4XMTA 1NBYA 2DLEA 3LQAH 5EEWA 1A6WL 4CSSA 1KEMH 2FEJA 4O02A 3WKMH 1C1EL 1FCCA 3L3GB 3SDAC 3TV3L 3ZZLA 5GGRA 3RE0A 3O41A 1KEGL 3TO2A 4UT7L 1UGNA 2OA9A 1RUPH 1BYPA 3DETC 2XKNA 2R1WA 5IT2H 2J73A 3DXAA 3VNZA 4BE6A 1HEZB 5C07A 3KL0A 4GW1A 4HIIA 4F7TB 3MX0B 2ZNXA 2AJZA 1MREL 3NSJA 2JFCA 5IVOA 4V2BA 4Z7WF 2W38A 3UG4A 4XVSL 2V37A 4PJHB 5IR1A 1DQDL 4JLRB 3UPRB 1ZVSA 2ZOLB 5IHBA 3IU3A 1S5HB 2DB8A 1KC5H 4OGYH 3W5NA 1NLDL 4F3FB 3Q5YA 3DRTB 1BXAA 3QUYB 1HI6B 1QNZH 4MRBA 1RURL 1CDBA 2HFGH 3F00A 2MMXA 4L4JA 1DHKA 1I3GH 4Z0XB 1RPQA 4XO3A 5LLIC 2UUDK 1Q9WA 1BQ5A 3JVGC 3IJ7A 4U1JA 3AADB 5J1SC 3T6ZA 4OGXL 4IGBB 1IM3D 2Y6TE 4S1DC 5DZOA 4FZEL 4I48A 5I1AA 4W6YB 5CXPA 2IWEA 3TPUB 5SWZA 5ERWA 4MS8C 4JNXA 2C9PA 5C6TH 3DI3B 4QRUA 3BWAA 3BLBA 3U6XA 5E99L 4U6HB 4AJ0A 3KGSA 4ZPVB 4F8PA 4PY7B 3EJPA 4OM1H 1RJYA 1D6VH 3WV0A 2WIMA 1MVFA 1S8DB 4FLOA 2E9JA 3BEVA 1J9QA 1OKEA 1SYVB 2YQ3A 5D7JB 3N42B 4P57A 2SEBB 1LP9A 2Y7QA 2ZQKA 3KLSA 1SM3H 4P46C 3SJVA 5EF1A 4GIPD 3U30C 4B9PA 2YUZA 2X6BA 3QO0A 2X6MA 3QR2A 4O4YL 4F92B 5EZIL 3MJWA 3EBGA 5E4EB 5JW4M 1MFCH 2CJUL 4J3OH 1CGSH 5J6HB 1MCOL 1PZDA 2ZP8A 2ICWB 5F1NB 1A02N 4GRMB 4PJ8C 1G84A 4FTDA 2ATPB 2WLHA 4U6TA 3TBVB 3TFKD 2DWDA 1MEXL 3TIEA 2P26A 2BIQA 4UT9A 4X98B 3CH1A 4R8WH 3C8DA 5EU4A 1XZ0B 1CFBA 5D9SA 3HE6A 2FIRT 3VVVA 4F80A 1OM3H 2BIHA 2W59A 2X4TB 3FTXA 4P2RE 3B7YA 3BGFB 2XVLA 2CDGB 2DL2A 4RGMC 4HJTA 5EBMA 5AW5B 2FDBP 3LN4B 5TE4L 3WL9A 1B4JL 2PWGA 5AKVA 4DN3H 3SDCC 3DX7A 4FQCL 3O2VH 5AYUL 1H8LA 2NNFA 1LWJA 1TO4A 3ARGB 4W9IC 2Q7NA 4XBEL 2AI0L 1UENA 4G1EB 3QA3A 3ZMEA 3C60A 2UZXA 4HJEA 4NI6A 4V1DB 1UJ3C 4AVHA 4MMZB 3L7FA 1H6TA 1AKJD 4HIHB 4UB0H 3H54A 3WN6A 2P45B 5CWSB 2HLEB 3TEYA 3T0ED 4J8RB 1IAMA 1ZRUA 3A6CH 1T6BX 1Y1DA 4PJGF 5F9OL 1F2XK 3HRPA 2JMRA 1MRFH 1EZLA 3M17A 3OAYK 5HJGA 5MEPA 1ZT1B 1MJ8L 2IQ9L 2OMUA 5L4JA 1ZANL 3BDBA 4M8RA 1PQZA 2Y7MA 4MAYC 3W3BA 1RJLB 1TQVA 1MHEB 5ELIA 1BM7A 5KUMA 5AD0A 1YMMA 2OX5B 3FF8A 1K2DB 1YY8A 2BSEA 3LV3A 4HMCA 4Y0GA 1DBMH 1L9MA 2VN7A 5IB2B 1NBVH 2WXIA 3NA9L 1B3IA 4JPSA 2NY0C 2JQMA 4LLQA 3NJLA 3RA7H 1FFRA 2RALA 1P2CA 1P4BL 1W72B 2WO2B 3FNKA 3IJ8A 3OG6B 5F1KC 5I74B 5BCAA 1T3FB 5BRPA 1JV2B 1XR8A 2JJTA 1XFPA 5C09B 2JB5L 3CZUB 2XVGA 4LBAA 1QSFE 5ITBL 5C0IB 1TJHL 1LHZA 3QIWA 4X5WA 3EFOA 1NDMA 1DDHA 3C6LA 5D55A 3MV11 3QSKB 4GB9A 4IHOB 5SX4I 2X2IA 3BC9A 2EKJA 1WBZB 4Q58C 1TENA 1KIPA 2Y0SA 4DGUA 1DVFC 1FGVL 4PG2C 1M7UA 3VXTA 3HBPA 4YHYC 2JXMA 1BZ9B 3KYNB 3F83A 4N9OB 1JDAA 4QOKE 4XCYA 5TDPA 1JS4A 3AQDA 3MJ6A 4TTGA 4HUWB 4UIKH 4OZIB 4M6ML 4APQD 1YC7A 3TV8A 2KLRA 2XQBH 1I8LC 4MDRA 5KSAA 1WD8A 1B6DA 3MRCA 4DP5X 3BVUA 1JGLH 5FGRA 3FOLB 3GI8L 3G6JB 2W0KA 3U0PA 4WI7A 3VGAC 3BO8B 5GS0C 4PRPD 2IAMD 3HC2A 5CO1A 4X8CA 3OXSA 3RVVD 2WNWA 2X2JA 4P4KD 2LTQC 4GPVA 4MBRA 1QWUA 2B08A 4JDTL 1YEFH 5D6DA 2EE0A 3CQFA 3FT3B 1JGDB 4K3DL 4L3CB 4EI5B 2MWCA 3HI1B 1E40A 5IVXA 3HC3H 2HA1A 4HIQA 1XH3B 4KI5D 3BKYL 5T3XE 2XA8H 3RY6C 4WW2B 4O9HH 1WEJH 2MQCA 4J28A 5ID1A 2EDBA 5F96L 3PGFL 5CJ8A 1NL0L 2EDEA 1UB5A 1PX4A 2V7HB 5BO1H 4IBLT 3GC3A 5C7XL 4K5OA 5L7XH 5BRZE 3ZTDC 5EUOE 1SFDA 3ETTA 4ABVA 1O7SA 2A2QT 3UPAA 1HSAB 3WDHA 3FSOA 4WNJA 5GQBA 1GGCL 3NACL 4OSUH 1KJVA 2WXKA 3BPNC 4L9DA 3MRGB 4LK4A 5FYKH 3WXVH 3HZMB 4TSAL 4U1LA 5AAMC 1X4ZA 3RHWK 1I85C 5EUKA 1GGIL 1PY0A 2OM5A 4RFEA 2K70A 4U1GB 1LO2L 2KPNA 4GW4B 5CLZA 4ODHH 3BXNB 1A3LL 3TJEH 5EZOL 1XCQA 5DMGD 5KVFH 2JVUA 2MTPA 3LKPA 2VAJA 1RZ8B 2VSCA 2AXFB 5TQ2L 1ET7A 1SN0A 3HRZA 4UUJA 5E08H 3FT0A 2V7NB 2AV7B 1IBYA 5HGAA 3SBRA 4HS6A 3U4BH 2WLLA 4HAFA 4NZTL 2F74B 2BSBA 2EIZB 2WNGA 4UQ3A 5HGHA 4ZMLA 3R7RA 4S2SB 4XGZB 4X4KA 3CFEA 1JG9A 3HPLB 3PWUA 4U0QB 1YYML 1XB3A 4ZTEA 4W4OC 1X5YA 1WS8A 4QAWA 3QULA 4YH6A 2M2DA 4HPYH 1V05A 1BZOA 3P4OB 3WIAA 1MCNA 2HMID 4L8BA 3SBWC 3T8XA 2SODB 4N3TA 5DJYB 1ORQA 4YDNA 2VXSL 1MFDH 2AZAA 4UINH 2FATL 2HKFH 1I1AA 3MGOB 5LCVH 5IW3A 2FBOJ 3K5SA 1NOAA 4PJ9A 3L3GA 2EE9A 3DX6A 5DZPA 3GF8A 3MACL 3N0AA 1AHMA 4HMDA 2HWZH 3EZ8A 4A7GF 1FFQA 2OCFD 1FNSL 5CEXA 4N2EA 3RL1B 1XGQB 4QPEA 2HVKB 2W80C 2P80A 4Y89A 3RWDB 3D87B 3IMBA 1DN0B 2AKRA 2BOLA 1N8ZB 5T1LD 1TIUA 1R24A 3EJZD 2A1WL 2ZCKH 1HC1A 4LAJH 3PYCA 4GAGH 5E7FA 1QLRA 4FD0A 3HE7C 4LHQB 4QWWD 4XP9L 2VITB 2D0FA 4HCIA 5DUPH 4PJHA 2ZAIA 3NFNA 5DURB 4S0HA 5DHYB 5KVMC 2OMVB 4QRRA 3WIHH 2BHUA 1S5HA 3VI3F 1MHPL 1E90A 2EYTA 4M7LT 4O5LH 1J9TA 3QUYA 5CNHA 5F70A 2MNWA 4R3SA 3LNEA 4WUUB 4WEBH 4R5TA 2I7SA 2E8ZA 5B1CA 3UZEC 4YDZA 2QKSA 1KWKA 5E6YA 5MEOB 2GI0A 4IKJA 1T20B 1IC4L 3HS8A 1BREA 1FQ9C 4JCLA 1L3WA 4ZZFA 1SEQH 1V7MH 4JRYE 3P0VH 5EBLB 1F6FB 4JPIA 1T04A 2NX5E 5EU3B 5DYOA 5BZDA 1FPTL 3RPIB 5D1ZC 2F5AH 2UY6A 5EN2B 2NCEA 2E0PA 4U6VL 1TSHA 4XHJD 5IV2B 4Q14A 3SYOA 1PSKH 2O5YH 2X4SB 4OKVA 4DKDC 2PYEB 5BXFB 4GLRH 4K55A 4JFED 2ATKB 3K2IA 4HJJL 4YN3A 3S3JA 1KJ2H 1N64L 3AABA 4E9RA 3MLPA 1SJMA 2NDGA 4XMKL 5HYSB 2YRBA 4O00A 2CGYA 3FCGA 3CMOH 4LCCC 1TJGH 2A73A 4QYOA 2SEBA 1K4CB 2O5XH 1MHHA 2BXYA 4PLJC 4BKLA 4FF9A 3S35L 4BFOA 1BOYA 1MCJA 4TOYH 1WS7A 5K1JA 5JTWA 1KXTB 3QJFB 4GBXD 2PO6C 3VFNB 1JPSH 3P9MB 4PWKA 3FFDA 5T1DL 1SXSA 1ZA6A 1HQ4B 4NQXB 2WMPB 2X4OA 4L05A 1K5WA 1DN2A 2XWBA 1EANA 3EYSL 1BFVL 5EWIH 3NJFA 5LVEA 5T1KB 4JPQA 4HAKA 4WHYG 4DK6A 1B4RA 3W0WB 4IS6B 4FOMA 4FS0A 4QHKJ 5CUSH 3BPLB 5ALBL 2P8PB 1B2WH 4G8GD 4KKAC 1KACB 4GRLC 3DX9A 5IW1A 4M7JH 2Y72A 2B9AA 4FHBD 1G7MB 1UD5A 3WS6A 5DQJB 1J0YA 1AD0A 1H6FA 3MJ9H 1OWWA 1NFDF 2HTKC 4PSPA 4XCEB 1CL7L 2X4TA 1OAYH 4PFEA 3FK3A 5EBWA 4XTRD 2PCYA 1BM3L 4DEWA 2YGNA 1VKXB 1JCKA 2CKBB 2XETA 3T0BA 4PWGA 4YX2H 2ADIB 4N5EC 3P4NA 4LASH 2YD8A 3D3VE 5GGUA 3KXFB 4TVUA 1U8CA 3QRFM 1U91B 3GSRA 4TQPA 3EYVB 4Q6IB 2XTJB 5E6IC 2C3VB 4AV4A 3DV4B 4V1DA 3MR9A 1ITBB 2BSRA 4TUOB 4J2XA 1T0NB 4FXTA 4O58L 5JXEA 1DQLH 2YEQA 4G7QB 1CF8H 2OAAA 1DBBL 5HJ3A 1FSKB 4EI6A 1NAKL 1JWUB 5AZ2L 1R5WB 3GM8A 4M4PA 2BNQD 4UTAH 2YBRB 3BFOA 4LBEB 2P8MB 4L9LA 1QFUH 3T0VA 1YEHL 2JWYA 4I89A 2I32A 2YA2A 4B0MB 2EVJA 1RJLA 2B59B 3B9KD 2OMZB 2Y4SA 3NN8B 4FI8A 5E8EB 1R34A 2XTSA 5JOFB 5JNYB 1TT6A 2WVVA 3BAKA 2GBTA 4WTWA 3CSBA 4UDTB 5SWSA 3LTVA 5FGCE 1G5GA 5I9QB 5JUEL 1ETZB 3ZX1A 1GKEA 3KCPA 5CINH 1GZQA 1CWVA 4KHTH 1EGJL 4Y5XC 2M83A 5I28A 3WNKA 4QRTA 2ICEB 2BS71 1WHPA 5DA0B 4PP2A 2H32H 4KTDH 4BSWA 2W1NA 3ZYZA 1PD1A 5BMFH 4OCYH 4WGKA 3I2CL 3O6FA 4XP5L 4EVNA 4M93B 4F57H 1NIEA 1S7QB 2ZX9A 3GGWB 3G6AB 4F2MB 3ARZA 4OZ4A 4DKEH 3II1A 2Z4QA 4NN5B 4WSKA 3TO4B 3BAWA 3CFUA 1UTDA 3U6XS 4EXKA 3TN0D 3UEQA 3GTNA 4JZNB 3TFBA 5F3BB 1NCNA 4JMXA 5FCUL 3FB5B 5FYJH 1E50A 2PABA 5LCVA 4H25A 5I0YA 1IAIL 1J5IA 3SQBB 1FE8H 1AAJA 1AGDB 2VM9A 4ODXB 4RMWA 3FSVA 4PJIF 4X8XA 5IEHA 2QZQA 1VGEH 1HHGB 1RZKC 4JFYA 3G5VB 1XB6A 3FOLA 3G6JA 1U42A 1L5GB 3T8VA 2V17H 5DRZA 1A4JA 1FZJA 1N8OE 4ZUSA 3PPSA 2WQVA 1QSEB 3BHBA 3TF4A 1NGPL 2N0KA 3WJJC 1EHLL 2Z35B 5D5ME 4XNBA 1AD9B 1QKZH 2WLIB 3GIZL 1D7BA 2XRAL 4OF3A 3FT3A 2GFBA 1JGDA 1DJYA 3LH9A 4IRJD 1QTYT 4JFQB 4XVOA 1NA8A 4X42A 3IJHB 1IVTA 4Z3FA 2CKBH 4EDWL 3MBWB 1BG9A 4Y5YA 1PFCA 1QBLL 1NDTA 2F54A 1OCWH 1NM4A 1YNTB 2EICA 4KHXH 3HNSH 3WIHA 3AAZB 5K59E 5G4MA 4NO3B 2H3XC 3QHTC 1YPZF 2XJLA 3BMVA 5A2IH 3DURA 3IMSA 5TPWL 1P7KA 3VMNA 1JZDC 5FKAB 4A2LA 3U0WL 3SOBL 4NQDB 3ZDZB 3V79C 1MXDA 5HYIA 4XN9A 3WEBA 4R7NB 3N85L 1FN4B 2DQDL 2V5SA 5HHOA 2ADJB 3GMLA 5IROD 2GAZA 4B97A 1Q4NX 4HT1H 5FWQA 4G8EA 4JFPB 5E5LA 1CE1L 3NSFA 3VXMD 2H0EA 1PD6A 4XMZA 2R8SH 3K4DA 5MEQB 3WTVA 1L6XA 4HLEA 1VFOA 3MRGA 3NJJA 4DZ8A 2XFGB 1RD6A 1A1NA 2IPKB 2P8LB 4D2NA 2ZXQA 3LZFL 2DYPB 3Q2VA 2HKAA 1M7XA 3QDAA 5C0AA 2BX5A 4G9FE 3ULUD 4AQAA 3LN5A 1D5BB 1L3NA 3R1GL 3DLQR 5CSGA 4JKPL 3KPPB 1ESOA 2P5WD 1PX8A 4Z0BL 2NZ1A 2EXWC 5A7BA 3RTQB 1KJ2A 1XXDC 3G04B 3PDOB 1FO0A 4M6NL 5LGHL 3IVKB 1RUQH 1JD9A 1JNNH 3U83A 5C97A 3J7HA 1ZOXA 3QEQB 2IH9A 4NPJA 3UTZB 3P2TA 3P4LA 1ZJBA 1TFHA 3H3PH 4OD1H 2V7NA 4N2DA 3SYAA 4D0CA 5KSBE 5D2NB 1ECZA 3U9UA 5ESQB 2W60B 3RU8H 4TUKL 4S2SA 1FORH 1OGAB 1A4KB 1UZ8B 4FYRA 3WJLC 2WLZA 1RP8A 2CHXA 2ZOWA 3DGCR 3JWDH 3NFSL 2ITCB 1BXXA 4HEPA 2AJSL 2F08A 5F89A 4ZOAA 5B7EA 4XNUL 3AGVA 2WXOA 3UO8B 4RMUA 4Z7VB 5J12B 3MRPA 5CJQL 3BZ4B 2XN9E 4WW1A 2BNRD 5FIEA 4ZSOB 5I15H 1KB9K 4Y4HD 2D4FA 4UV7L 5A16A 3MGOA 2QVMA 2DEYX 1U8PB 2FWSA 3MLRL 5T33H 2DPKA 2P1YA 2QSCH 4TRPH 5I1DB 1AMXA 2QJDA 2FO4A 1M2OA 1TTUA 3MJ9A 1A6TB 3PWLA 2A9AA 5LJYH 1KFGA 3HNVL 5FCSH 4G5AA 5A6IA 5DRXA 3LSOB 4Q4EA 5JDSA 4FQJL 4Z7OF 4ZS6D 3EKCA 2IBZY 1B0RB 3VFVA 2ZCLH 2ZUXA 1HINL 1MFEH 1DN0A 2K8MA 5HVFB 2HRLA 4M5YL 5LWYL 4JO3H 2ZSWB 5DS8B 4ES9A 4V11A 2VAAA 4MCZB 5JW5A 2CHZA 5K5YA 4PJBE 1IFHH 2QVIA 5B22A 4GRWB 2XQ0A 3ARFB 3OWRA 1JI1A 3SQOL 2ARJB 3HNTL 5T8IA 3L95A 5ACLA 2QQKL 1JK8B 3OKEA 4GI6A 5DHYA 4MLIA 5FHBH 1ZK9A 3SGKC 3UAJA 3R4DA 3EG9B 3IU4L 5I8EB 5BS0D 3DIVA 4EUPH 2Q7YB 4ZRGA 1XD0A 2EYSB 2CUIA 2UZPA 3B4NA 4O51B 1RSFA 4J12A 4FYTA 5KBNC 3GKWH 4I0PD 4WWKA 4JFDE 2QADB 4HUUA 1E5ZA 4FNTA 4UTAA 3RNQA 3T2LA 5I8CA 3IK2A 3HG2A 5EBLA 1P0SE 4NHCL 4Y16C 5EU7E 1VZHA 4MCMA 5DUML 4AC4A 1L7TH 3NIDF 4F8OA 1UKSA 3ARYA 3INUH 4GKNB 4PJCF 2AITA 3RWEB 4HEPG 2H2PC 3ZE2E 4LVHB 5C2BL 1U0QA 4XVTH 3CVHL 4KQ3L 5DJZB 3DVGB 4BQCA 4LL9A 3GM0A 3U6RB 5CEZD 5BXFA 2BP0B 4KK9D 1HX0A 4I77H 5C0BE 3DMMB 4WO4C 4FABH 5FOJA 5HHNB 3CBJB 1HHKB 4OKDA 3TH4T 3V0JA 4FL4C 3H3KA 4F8LA 1K4CA 2H32A 1E4XI 4N1HB 1J8HB 4PLKC 5IJKA 2RA1A 4QF1A 4Y2LA 1KXTA 2OL3H 5FM5O 3MCYA 2ALAA 1IQDA 2DQEH 4OCWL 3GI9H 5D2LA 1NMBL 2E75C 2DQIH 5D96C 3PS6A 1ZA3B 3PJSA 4FQLH 3LB6C 4RGND 4RCAA 5CKGA 3U1SL 3QUZA 1UB6B 1HIML 5T1KA 1KCVH 2X44D 3HLAA 4HS3A 4XNDA 4JJ5B 4M62L 3W0WA 1J48A 25C8L 4IRSC 2NXYD 1PNCA 2F5BL 4JRLA 3CVBA 4ZUTA 3JWNH 5CCJA 1YNLH 3ZTNL 1LYQA 1OEZW 5EORL 5DFWH 1A3QA 4Q52A 3UX9B 5EA0L 3WGVB 3VD2A 3FTZA 3OZLA 4XPGH 1P4LA 1CMOA 2ZX6A 3KW7A 3B6SB 3E38A 5K39B 3RIKA 3LXAA 4D8PB 1MI5D 1A6VL 2XXFA 3TZVC 2Y5TA 3BP5B 2Z6FA 2MFNA 2AANA 2ADIA 2R2EA 3FN0H 2Q87A 5ICZB 2ZXGA 4UQCA 3Q13A 3WSQL 1DQIA 4GRWH 1NC4B 1W0WB 3GXMA 3KBFA 4M7KH 4R90L 5BZWB 1UURA 3G5YB 3R18A 5CZVL 5JORA 1RHFA 5TD4A 1ZDQA 3LZNA 4L29A 3WO4B 3DV4A 5E6ZA 2FTAA 5DTFB 4EEEA 4L4VE 2OYKA 3IDYC 2VCOA 1PY9A 2VQ4A 2P9RA 2E7LC 1Q9OB 1T1ZA 2AEQL 3HZVB 2HVBA 3RFZB 3QEGL 1CICD 2O1AA 1JWUA 1QSZA 1NCBH 4YVUA 4WHDA 4NKDA 1MJUH 4YDLC 3WDIA 3GO1L 5ISZE 3KHQA 3VFWA 4Z7QE 2HH0H 4X6CB 4PMEA 3UTSA 3ESUF 1RIUL 3PABB 5IB1B 4UNTA 1AO7A 5G4NA 1SY6L 2YD9A 1T4KA 3QHZL 4FKEA 4QHNA 3RVUD 3SCMB 3MUY1 4E41D 4ZMWA 5GGSY 3K72B 4X5PA 4OQ1A 5JNYA 4RAUA 5CBEB 5G5DB 5A1AA 5F7UA 1RUMH 9PCYA 4HXBL 1BQRA 4PJ5B 5F7EH 4CC4C 4IKNA 5JHMA 1IC1A 3O8XA 1NFIA 3KL3A 3TT3L 4AEFA 1G4MA 2HLAA 3FB8B 4U6YA 5IBLC 4DAGL 1S3KH 3QE5A 3REVA 4AG4L 3GGWA 2GJZA 3N1GC 1IGYA 1JZIA 2ADYA 3STBA 3ZW3A 3ILDA 1NGYA 1GTNA 5EU6D 3NMEA 2F53A 5F44A 2DOCA 1T7WA 4M7ZB 4TNVK 5ACZB 3KH3A 4H5SB 5HDLA 3BEWB 3V4PH 1FLRL 2COQA 4PIRF 3TBCA 4MVBD 2YPVL 3VD3A 5E5MB 5E2JA 4X99A 5GZNC 3IETB 3OR7A 1YVLA 4P5TD 1KPUB 2RD0A 2QR0A 3B2VL 5HHPA 1R47A 5EEUA 1CD0A 1QSEA 2OMXB 3NT0A 3QI9B 4PW4A 3I9GL 4PGDB 1U8IA 5CJ5A 4APXB 5FUZL 3GJEB 5J11B 5I6MA 4JE4B 4B5EA 3E8UH 1A66A 2NY2B 2NY4C 4XWGH 5B3NA 3JBG7 2VLJB 2XACC 4ONGL 4BEIA 1KXVA 2JB6B 4NCC2 3BKJH 3BZEA 1BBDH 4KI1A 4N2KA 2JJSC 1RK1A 4RDQG 4MB4A 4ZX4A 3ZL2A 3VFMB 5GGSA 2F7IA 3MRJB 4EUPA 4PJFA 2BW5A 1AC6A 4KTGA 4ORGA 3VXNB 4OGAC 4ZAKD 3ZKNC 1F6AB 1RZGB 2HRPL 2ZOKB 5B3JE 2AP2A 1PLBA 1LO0L 4H88H 1JYNA 4IBWA 4U1KA 1J1PL 3U7WL 1IBGL 2ZSVB 4I5BA 4X50A 1EFXA 4JK0D 4JAMB 4UQ2A 4CKQA 2CUMA 4WFEE 2PWHA 3FUMA 4PJAB 5IEKA 4OJFL 4F93B 4GH7B 4HHWA 3JT2A 4WU5B 5IHLB 3VDCA 2IPKA 3BWZA 3U2JA 3F01A 1BDYA 5JXAH 3MO1A 3RKDD 4Z5RB 2BP8A 4H8QA 5AZUA 5F21B 1ZLSH 3O6LL 4LLYB 4YO0A 2F7OA 1AANA 1G7HB 2WP3O 3IFNH 3MBEC 3N3EA 1PGRB 4M5TA 4XNMB 4OIIL 1A7QL 3GRWH 3SDAD 3QEQA 2E59A 4LIQL 2Y7OA 5HHXH 3TNNB 2DMKA 4N8PA 3H4HA 4D9LL 1J5HA 3E8VA 2OL3A 3KYMB 5F6IC 1UOWA 4N28A 4FHKA 4CSTA 1VFUA 2WIIB 3DETD 1OGAA 2FO8A 4Z7WA 3CSFA 4DN4H 5BUPA 2NXZD 5DD6B 2BP3A 4NJ9L 3FFOA 3PWJA 1TQBC 5A3IC 1CFNA 1M6OB 4H13C 4KY1H 4ZXBC 5F9WC 3BYTA 4KDTA 1RLWA 5FGSA 1BLNB 2R69L 5KSBF 4UOZA 4MB1A 1MPAL 1QBMH 4HAGA 5EU7C 4Z3GA 1SBSH 3MCLL 4LPTA 1IKNA 1ZY9A 1MWAB 1KDIA 3P9WB 3WUWA 5HHQB 1CBVH 1HS6A 3LNFA 5IFAL 4LCIH 5I1DA 5A7EA 1HSBA 4TQHA 2YD2A 5IWLA 4RBPK 3BZDA 1X9UA 4FQ2L 5AZEH 3Q5TA 4EUPG 1S2EA 2FCBA 5F1IB 2CBTA 3FUKA 1YEIH 1WVZA 3GYRA 5I2IB 3ZKMC 3QJHB 2Q3XA 4PRHD 4I2XB 1AGFA 5HHVL 3HI6L 4B5ZA 2WN3A 5FUOH 1KJMA 4YBLB 3SO3C 4IOIA 3ISWA 2H1PL 2P5EB 1OE2A 4R4FH 4LLWB 1XCTA 4S1DD 4WHCA 3S5YA 5CP3H 1L6ZA 3VWJC 4XCCL 1S7UA 2OR9H 4P9HC 7CGTA 2FGWL 4MS8D 4AQ1C 2H0JA 5ALCL 1X7SA 2J20A 1DL7H 1MDTA 5D8JH 1CR9L 1JXDA 2EE2A 4YZFE 3VGDA 1S9WB 4YXKH 3ESOA 1QLEH 4YSRA 2LR4A 4XNZC 2BVUA 3KPRE 2BIPA 2Q7YA 3FTSA 4PJBF 2FLMA 5IHUL 1SQMA 2G60H 4XP1L 2D3VA 2Q9OA 4XMPL 4AH2B 1IGFH 4OZHE 1IGJB 3NGBC 4U2YA 3SB3A 4XR8C 4DP7X 4P46D 3KBEA 3MYJB 4JDEB 5HPMB 2NY7L 4KQ4H 3V5HB 3EJYC 1BCIA 3DVNB 2GJ6D 3HB3C 4RFNB 4JFUA 4UV4H 1UYWL 2OZ4H 2DRUA 1TTAA 3MOAH 2OCCB 3FQNB 1GYAA 3SDXB 5CCGE 1JP5A 5KJ4A 2R7EB 4Z95H 1A7PH 2ENJA 1JGUL 1K3ZA 3FFCA 4R0LA 5CZXD 3ZJAA 2Q10A 3D85D 2VLKE 3U6RA 4PJ8D 4QUOA 3ASOB 1FV1A 1N70A 5F6HJ 2UWEF 1YQ2A 1D6EA 1EJOH 4K8RD 4HLJA 2JK5A 2CD0A 5G2NA 5EIQA 5HHNA 3T0AA 5FYLH 3WUWG 4BUGA 3VB8A 3JWNG 4ILDA 3RURA 4P23C 4LPXA 4QXGH 4FNRA 5E2UL 4X6BB 3D0AA 4RMVA 4KH9A 4G6AD 2ZTBA 1J8HA 3LH2L 2EEDA 5HVGB 3RWGA 4OLXH 1AKJB 5B7MA 4DEPC 2O6DA 1KB5L 3KVQA 1T03L 2A6JB 1EHXA 1GW6A 2RMNA 4YOKA 3VXPA 4NN6C 3T0EB 4IJ3C 1R3JA 3VXSD 2AABL 4YFLI 1K4DA 4HA1A 3MODL 1O6SA 2EUWA 3DIFB 2V5MA 3FTYA 3D18B 5LN4A 3UDWA 4KRLB 3MV8D 1OTTC 3SDCD 1N5YH 2YD0A 4HJ0C 3K81A 4CVZA 4X80L 1EAPA 3V4PA 1U3HD 4WFFE 1A9BA 1OD9A 1OF2A 1R3IH 1CFQA 3ATEA 4KNUA 4BKSC 3MRIB 1MQKL 1FJ1B 3RZCB 1JHKL 3SY0B 3F7KA 1PVHA 2IDFA 1CU4L 3DX0A 4U31A 5DMIL 1E7VA 3RUGA 1RZFL 4DTGL 4L0PB 4PJGA 1MAMH 1I8KA 2BOCB 5DJAB 2PTUA 4ZMQA 2DJSA 4TNWF 4BJLA 43CAB 4ZFOA 2X4UB 1FYTD 2LLNA 2V9TA 3GMRB 2KBGA 2PNDA 1F3DJ 2FQFA 3CTTA 3AU1B 5FKPB 1TMQA 2OK0H 3V4VL 2AJYH 3A22A 4AOFA 4AXWB 3PFUA 2HJLB 2BFVH 4WKXA 1SLXA 2CDFA 4HWUA 4JY4A 4D8PA 1V3LA 1BGXL 2GKIA 4KJPC 4AYEC 1IAKA 5KG9A 2N7BA 5CHNA 1NEZB 4R97B 1TKWA 1W0WA 4OI9A 5CGYC 3LKNB 2ZG3A 4LARH 4WV1A 1PBYA 1QW8A 4EIUA 4LSSH 2JKJA 3GXPA 4ZFFB 2NY0D 3QG7L 2IMMA 1QYGL 3HS9A 2APVA 2J6EL 4BFBD 5DTFA 1U2HA 4N2HA 4APQB 5HY9B 1F11A 1Q9OA 1UACL 2CR3A 4KJWD 5J13B 1YSOA 4WHTB 1CZ8H 1MRCH 3BKMH 4LSPH 5CCKH 2WNKA 3E9UA 4L3ED 3T77A 5M94B 4XNXL 4PRPB 1RZIB 4OM0H 3N44B 4RX4D 2IAMB 5IB1A 4J27A 1JUFB 4HKBB 4XC1H 2VW4A 4P4KB 3VI4B 3DK0A 2FSEB 5L0QB 5INCB 1DJSA 2L04A 1FLTX 1LEGB 1H3PH 3GXIA 1XTMA 4K23L 5L8KB 1L6PA 2WQUA 3FQRA 5ETUA 4F5CE 1H3UA 3B7RL 4MJ5A 3S3PA 1SXBA 3D5OF 3GRWA 5C92A 1HWHB 5IB5B 4WFGD 1IM9D 2XFXB 3F58L 4XP6H 4M48L 4OZGE 4HPOL 1U8KB 3OF6A 1QLFB 3CQPA 4R7XA 5C0JB 1DFBH 3SE4A 3QK0A 4BFIA 4TLUA 4GI9A 2V2TB 2JJVA 2A74B 4X9BA 1E42A 4XXDB 5MI0B 1EHAA 4DO4A 5DD0L 4ICXA 5LAPA 1CLVA 4JEGB 1HYRC 1B9ZA 1ET5A 1G9NC 4EBQL 1EEUA 1TTRA 3PXLA 4HJGB 4IGBC 3SYCA 4K3EL 2O61B 4AENA 3E6FB 5I76A 3E2HB 1JDDA 5IGXH 1IAOA 4KKPA 1NGQL 3G08A 3MUGB 4XH2B 4IOFC 4NUGH 2C34A 1FVEA 1ZS2A 2BPBA 3MV9D 5E5MA 1EEZB 3GXFA 4F8QA 3IETA 3O4LD 3EW3B 4HU8A 3FTWA 4AYFA 1AGBA 1K8DB 2VDMH 3L9EA 2QVKA 4LCWE 5FF6B 4FLRA 2QSVA 5D7JC 1IV8A 4LLDB 3BIKB 3RLSA 1OSYA 4UIMB 2EDNA 4ZFZB 2X4RA 4ZX6A 1U41A 1R6VA 1TJXA 3GBNH 4P59L 2EACA 1THAA 3S4SA 5CD5D 5KTEL 1KCUL 2AJXL 5INDB 8PAZA 5CP3A 2W94A 2OR8A 5EO0B 4PJDF 4BE5A 2LOEA 3P9LA 3QARA 5DZ9A 4YZWA 4JN2A 4HUKB 4PTTA 3ROLA 1OK8A 3EIFA 5LGKA 2X70B 1UH3A 4K9EH 1JNLH 5FGBC 1UKTA 3O3BB 3QB7C 3VYPA 2BVPA 2N01B 1BJ1H 5I5JA 4YFLF 5D6CB 2ZSVA 1NLBL 3TOPA 3DWTA 3FQUB 1W8OA 4O02L 4Z77A 4ZQTA 4PJAA 3Q6GH 1UXWB 4ODWA 2OZ4A 1KPRA 4OCRL 4YUEH 3T3MB 1DZBA 1OGSA 4OT1L 5F0MB 5CIPB 2R4SL 2Y06L 3FCBA 5B3JF 2YR3A 3L2NA 3ABGA 5T1LB 3WFEH 4Q6YA 1XD1A 2BERA 3C6SA 3ARGC 3BKCL 4JO1H 3CFIC 2J57A 4B0MM 4A2MA 3C2AL 4J3XA 1S9YA 1G5AA 1G7HA 4LDLB 1LDPL 4A7GA 5GGVH 4U0RB 1KT2B 1IQWL 3L3OA 4XNMA 2Y1YA 3D4ZA 2VUOA 5BZXA 4I8DA 4MMZC 3MLXH 1V7NH 4NENB 2Y36H 1G7IB 4NAQA 2XXCB 4NFDA 4G43B 5CD3B 4L37A 4Z7IA 4PVMA 1D9KC 3FU3A 3P73B 5AVUB 1YJDH 1BEYL 2QV4A 3MAWA 5DD6A 3F7RA 5IQ9B 3QDGA 5HVHC 4XXWA 4HUMB 3LHPL 2Z7UA 2VDOB 3VI3A 3H85A 3S4SG 3K7UA 4YHLL 4OLYL 4EAEA 1KXQA 1CDGA 4X7TB 3W2DL 4RWHA 5LG1A 3D2UD 4NI3A 4BELD 4HZLA 1DQJA 3MNWB 3EGDA 3ARWA 3BVNB 4MD0B 5D7LE 1QVOA 3CSGA 2QSQA 1F4WH 1V3MA 2WOBA 1MAKA 2BY0A 3QDJA 4I9WE 1ZGLB 2C1OA 4O2CA 1MFAH 1TF4A 2W9EH 4ODTH 1JRHH 4RA0C 4LOVA 3TXAA 5BZZA 5HYJE 4GKOA 3T4AC 3BPCB 3V5DA 4OFVA 3B2XA 4JFEB 3VO0A 1BWWA 4FTVE 2NR6A 1FAKT 3APMA 3JYCA 2EZ0C 1Q72H 1NINA 2QQNL 2A9ML 2Q86A 3QJHA 3W1ZA 3AACA 1Z3GL 2FB4L 4AYGA 4HOXA 5DO2C 4UANA 4A66A 1JMXA 3FQWA 4YBQC 2IGFL 2XN0A 4AYMC 2P5EA 3QWNA 4XMLH 2DQHL 2J43A 4GBXB 4LHUA 5AYTA 2JTYA 1ZHNB 4P2RD 2A9NH 4PJXB 4MMYB 1AJ7H 4JG1L 3BUDA 1GC1C 4J3TA 4QYAA 3SKNA 2FR4A 3DX8A 4G6KH 4LVOC 3RB5A 1UA7A 2IBGA 5EOCL 1LQSR 3UCRA 1SOKA 1U8LB 3GLDA 3RY5A 4HIEB 2XZAL 1M7IA 3WJMB 3B9VA 1E9OA 4UZUA 1XGRA 4G8GB 2J56A 4ISVA 2OXHB 4PLJD 4IIQA 2FSDA 3V5HA 2P52A 4UT9L 1BFSA 4YIQA 2PTVA 5F0PB 3MZGB 4LESA 3KLQA 4CN6A 2PO6D 5I17A 4NWTH 4R5VA 4PV9A 5FV1L 1KLFB 3QG6A 4EI5C 5ITFA 3AM8A 1JXJA 35C8H 3ZO0A 1YEGL 4MAUH 3LEXA 5IVZA 2B1HL 3JV4A 1PZ5B 1F0LA 2VXVH 1G7QB 2IANE 3VE0B 1NFDA 3MLTB 1VFBA 1OSZB 4KKAD 4A2HA 1HAWA 4Q9CA 4RWYH 5JW4Q 4Y7MA 3FN3A 4GG6B 1EBPA 4Y9FA 3CFQA 3FN9A 1U2YA 4AIXA 3UTTA 5D1QA 2DTML 2PP7A 1VLXA 2HTKD 4BUQA 1RFDH 1SDAB 4KH2A 3DGDA 2A6JA 4ZS7H 4KJYB 2KUTA 1YG9A 3OQRA 5E8NB 3GTTA 4G59C 5DZLA 5FLUA 5I5RA 4MLSA 2IXQB 5FA4B 3H42L 2BNQB 2VOTA 3AG4B 3DUSA 2VDOH 5DC9B 4N5ED 1QSFD 1NCAH 4ZO8A 3MCKA 2WGNB 3LN9A 3DV6A 3DX1A 4XODA 4LHUG 3RRQA 2ZUSA 4U1GC 4ZFGH 5KVEH 2DYRB 2A9CA 3RNKB 4HCRH 3B9KB 4LIQE 3RZCA 3JYBA 3J27A 1UT1A 3D0LB 4M1DH 4PG9B 2DIEA 5ILTL 5E6ID 1WA2X 2TAAA 3ZO9A 2BOCA 1N0XH 4JY5L 2FECL 1TETL 1QP1A 2FD6L 2A83A 1I8MB 2W0LA 4QOKD 4WTZA 1Q1JL 4XBMA 3FW6A 4KO5A 3K2UH 3AU1A 5IQ7L 1KZYA 2J21A 2VDKH 3EO1A 4MQ7A 1P9MC 3NA4A 5DDHA 4F24A 3HS0A 2OMWA 3ESPA 2ERJB 3NSXA 4JRWA 5GS2D 2YPLA 4YHML 5KW9H 5KSVA 2R0WH 3BISA 3HHMA 2IG2L 3GPEA 2V2WB 3NOIA 1F3JA 2R0KL 2J25A 3BUBA 3QEHB 4F27A 1JHTA 3D0VB 4DCQA 2PYFB 1UM4H 5EZLA 4Z7NE 4L3FA 5ANMA 1HNFA 2L8AA 3TN0B 4J4PC 5DI8B 2I9LB 4JZOA 4XI5C 3ZU8A 4B9KC 4M03A 1E6OL 1MCKA 5T3XD 3BD5A 3IDNA 2VZUA 3LQAL 4JJOA 3RGBA 3UJIH 4LLVB 5AW2B 1U3JA 1KEML 3GJFB 3WKML 4X6DB 1Z1WA 4TQEH 4N0CD 5EO9A 4A67A 2EIJB 1RJZA 4FRWA 1USQA 2X3AA 4J3WA 2XJKA 2WINB 4HKBA 4XCNA 2N59A 5BRZD 4V2CB 1SXNA 2GBAA 4P4KA 1RUPL 4QRSB 1EZSA 4TLTA 2FSEA 5IT2L 2VR8A 2F58H 4TQIA 2EE6A 4PJIA 2JCCE 4B9FA 3BD3A 2NYYC 4IRJB 3QDMA 3F5WA 1FZOB 4AK2A 4DGVH 3MNDA 4AZ8A 1QRNE 1J5DA 1D5IH 1PYWA 3I50H 4UDUB 5IJBC 4M3HA 5CLXA 3QPXH 1T7ZA 5HGBB 2GJPA 5DFTA 1XSIA 1CD1B 2B4CC 2HT4C 1U3ZA 2XFXA 4HBQA 4PWJA 1OCZB 1M9WA 1QLFA 1J1OH 4MX7B 1KC5L 1OP5H 4OGYL 1I1RA 2ZAGA 2XLLA 4YSAA 1L4IA 2X7LB 3P3RA 4LSUH 4WTZG 1QNZL 2A74A 1H15B 2E5EA 2EINB 4XXDA 1TTBA 2Z92B 2CBMA 4UU9B 4NUMA 4XOCA 4GUCA 2HFGL 5GSVB 1YPZA 1F41A 1I3GL 3VXMB 1I9JH 2O61A 2WCPA 3FTVA 4BFJA 3SDYH 1XBRA 1DSFH 2FX7H 1VADB 3EH3B 3PHQB 3VD4A 1JCVA 2UYLB 4JGUA 2BCKB 4NFBA 2CU9A 3QZWA 1NJ9B 2DLFH 2YAFA 3GSOB 2G2NA 5C6TL 5LXVA 3QYNA 2ZXBA 1FFNB 2AZUA 2IDTA 1K8DA 2P5WB 3QIBA 5DVPA 2YEVB 4Z9KB 3QUXA 4MXQC 1PD0A 4KTYA 2BM3A 1BMGA 2CLZB 4OM1L 3GWJA 5AW4B 2MHAB 2XX1A 1D6VL 4FXGA 3BCDA 3ILQC 5A40E 3VSTA 4A6YA 2NNXA 4HKXA 4N0UE 3CUPB 1CD8A 3D39A 2QPFA 1SM3L 1CYWA 1DJZA 3ISYA 4L1DA 3MRLB 5AB1A 1I3UA 1NOFA 3L5IA 1QHPA 3KPTA 4H8HA 3I75B 1NC2A 1WBXA 1AYOA 5F9DC 3VQ2C 2CALA 1LEKB 4BFEA 1MFCL 2ADGB 5J06A 4JDZA 2X0UA 4DP2X 4YSOA 2EXWD 4XN8A 1CGSL 5B4MD 2G5BA 2ZIDA 1UT9A 2BNRB 1FC1A 4PVLA 4YR6B 2OSWA 4Y4HB 1KYDA 3IDJA 5J4MA 2CWRA 2FJSA 4KK6D 4FQQB 1M1XB 1JPTH 3BQUC 4R8WL 3LPWA 2DQFB 3C09B 4H40A 4FYSA 2NW3B 4KKRA 5JLZA 4XOBA 5KYXB 3TCTA 1OM3L 4H26A 4PS3A 1JZEA 4UTCA 1H9VA 3I3EA 1D7FA 3MRQA 2AXJA 3ATFA 4AVJA 3CSPA 5DS2A 2I9TB 4BK8A 4JRYD 5I30H 1X5HA 2NX5D 4M9PA 4Q56A 1JE6A 1SXZA 4OI8A 4EDXA 4DN3L 3QYMA 2O5ZH 4MSWB 3AY4C 3O2VL 4X0KA 3ZMNA 5FV2A 2XTJC 2EEBA 2I24N 3QZWG 5FWRA 3BVXA 3TBWA 3WIIH 3P4MA 4RISH 4CNIA 4F7PB 3D6GA 3BAIA 5BS0B 5CD3A 3DK2A 4UB0L 5FFLA 2IPUG 4PWIA 3P73A 4K3JH 3ZL1A 4QCIB 1EXUB 3C9NB 4I0PB 1GGYA 3A6CL 4XNQB 1UADC 2DLHA 3CN1A 5KYNA 4OBSA 4G8IB 1MRFL 4X7TA 1E4XH 2VXQH 3PWVA 5E70A 2IH3A 2TRYA 3MNWA 4HCRA 2Z93B 2R2CA 4IKKA 3O9WD 5I1LB 3FMGH 1YMHA 2XPGB 4KV5E 1TZ8A 4AEHH 1TDQA 2B2XH 3VGHA 3V0WH 1DBML 3STZB 2WYTA 1NBVL 1PIGA 1IU1A 1SDDB 4TLSA 5BRQA 3NK4A 3T9WA 3ULUH 4GI8A 5ICXB 1NCTA 1OZUA 3IDMB 5DD3H 5ADOH 1I9EA 3VU2A 2C26A 4JFFE 2W92A 1NUDA 2WTRB 4FNSA 4PJCA 5HVWA 3NCMA 1NKRA 3MGTA 4KZEH 5I6XB 4N0FA 4AQEB 1OE1A 3GFUA 3QUHA 4L8DA 4NN5C 4S0SD 3TO4C 5C3LD 4PWEA 1AXSA 5DVLA 5E9DA 3VUAA 4QKXB 4YHOH 3H53A 1SHSA 4DW2H 1SOSA 4NPYA 1Z9LA 3MDJA 4RGNB 4HG4K 1CLOH 1OOWA 1N59A 4FQIH 4NIKB 2OFQA 3NAAH 1LTXA 4WIQA 1EK3A 1JZ5A 3D3VD 4UIKL 4C56E 3KCWA 2NXYB 2XQBL 1P7HL 3N9GH 2OXHA 3LXBA 3D05A 3RX8A 4LAQH 1WIUA 5EIIA 2CCLA 3UPCA 4PLKD 1JGLL 4NKOB 5AALA 3ARDD 3C8HA 4CADA 2NY5H 1PDKA 3ENEA 1KLFA 1R3HB 3IMWA 4MKMA 3TA4D 4XXCC 5K9QI 3VD5A 4QMEA 2MCAA 1USZA 3VXUA 2HCZX 3OD3A 1YEFL 3U25A 4JFHE 3GSQA 1MI5B 4NC0B 1TVHA 1HK6A 2CHDA 1G7QA 2WXRA 2ZWZA 3HC3L 1ZHKA 3L6FA 4IRSD 2P24A 1FHGA 4CBZA 2XA8L 3MV01 1CDYA 4GG6A 4E42A 4F2EA 1ZWIA 4WY7H 4O9HL 1WEJL 4JHWH 4JM2F 4DPBX 2O6PA 1QFOA 2VRAA 4N1CA