2WTRA

Full length arrestin2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
394
structure length
356
Chain Sequence
b'KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSDVAVELPFTLMHPKPKDDIVFEDFARQRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN-1
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 58
structure length 356
sequence length 394
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA01
3P2DA 5F0MB 4J2QA 4R7XA 3LHAA 4JQIA 1AYRA 2WTRB 5F0LB 5F0PB 1ZSHA 4GFXA 1G4MA 3LH9A 3UGXA 4GEJA 1G4RA 5F0JB 4LL1A 1CF1A 3LH8A 4GEIA 1JSYA 4R7VA 3GC3A 1SUJA 2WTRA 4ZRGA 3GD1C 4LL4A 2FAUA 4P2AA 2R51A 3UGUA
chains in the Genus database with same CATH superfamily
3B5HA 4WWKA 3HS0B 3UPCA 4N87A 3BUIA 5FUCE 2IBZY 3WXWL 5AALA 4P06A 4E9YA 3RGVB 2ZUQC 2NY2D 3QUXB 1UWGH 4EAEA 3T6QC 2P24B 1D6EB 4NQDE 3R0NA 3QQ4B 2YD6A 1S46A 1JNNL 2EEBA 1G7PA 1TU2A 4OIIL 3QFJE 1IKFH 5DJDA 5KOMC 1HNGA 1WIOA 4MVBC 4ZQTA 5FXCH 3G6JA 2ATKB 3B9AA 1A65A 4M6NH 1AAJA 4X6DB 4GB9A 1T1YB 2YRPA 5I30L 2C9VA 4WO4C 4KXAA 3VFOA 2CUHA 1O6SA 4NP4H 4OCYL 3LN4B 2OYKA 3EZJB 1IGFH 4A55A 2Q20A 2WO2B 1ETZB 4UT6H 3MRPA 5A16A 4X6CA 3KXFE 1BFVL 3MRLA 1F00I 3V4UH 4XC1H 4B9IA 2XV2A 4PM1A 1G94A 1Q72L 1FGVL 3MUJA 2E5EA 4HEPG 3CSYA 4YXHH 1TLMA 4C58B 4PWJA 3ZT6A 3ABZA 4W9FC 1TCRB 5LAXA 3SZKC 4F24A 1XGRA 1ZT1A 2NNXA 3PDOA 3KYOA 4U6VH 2IANB 1P5UB 3QIUB 4I4WA 5IBTH 5J6GA 4KRPB 2ZSVB 5HVWA 3DROB 3RU8H 1R3HB 1BIIA 5BO1H 2BY3A 3WIIL 1KB3A 4JM2F 2C1PB 1AHKA 2XWTA 4MNQB 1TVHA 1QBML 5GRYA 3F7LA 5I1DA 3MGTA 4JO2H 4PY8J 4JO1H 4XMXA 2APTA 4QRSB 1LNUB 3NPSB 5F7DA 2RQEA 4HOMA 1TTRA 3JWOH 5I2IB 1E67A 1AS6A 1OK0A 1J05B 2Q6WB 5ADPL 2BZDA 3BUYA 4OGAC 4QRUA 4HLJA 1NWPA 4O2EB 4XXDB 1KWGA 1DBKL 1GYUA 4IMKC 1ZTXL 1TZGH 2CMRL 4H26B 2HVKB 2EIEA 3GGWB 4AQEB 5ES4B 3OXSA 3DJTA 2VDNH 1DQJA 4G9FA 3U7AA 5FYLH 1U92A 2QR0A 1FL6B 4G42B 1AZBA 3FOLB 2VL4A 4MS8D 3ARBD 4D9QE 4DGVH 4G8EB 4P57A 3NABL 2XPGB 3ARFD 4LK4A 5SWQA 2XG5B 1JPTL 2YR3A 3T3PE 2O26U 3KGRA 4M61B 4HUCA 3M8OH 3MCKB 4ZXBC 2DQEL 4BFIB 5C71A 5BV7C 4WI6A 4XMVA 1XR9A 3DVGA 1IGMH 1TVBA 2P80D 4F20A 4JR9H 4Y19E 3REWB 4Z3HA 1ID2A 1N59B 3AM8A 4QOKA 4WGWB 3BWZA 4OFYA 4MCZB 4NQVB 4KKAC 4JQIA 3LCYA 2ENQA 4LOUD 2XC8A 2V3FA 2OMBA 4JJOA 1I9EA 1Z5HA 2YGOA 2LU3A 3FRUB 4K8RH 4NZFA 4GSUA 4G6JL 3ZQ9A 2EEXA 2R69H 1OT1A 2O6EA 2Z1PA 3NZUA 4N6RA 4JRYB 4HFUH 3S37X 1SYVB 4D0DA 1CVRA 1LQSR 3VQ1C 4X98B 4XODA 3RNKB 1JPSH 2IGLA 2WGNB 1MCIA 4LPYA 3UYPA 1F4WL 3R1GH 5GJSL 2JFCA 1DQDH 2CGRH 3IDNB 3MA9L 4U3SA 3P2TA 5HI3C 1UT2A 3QSKB 1K6QH 3DMMB 2VDQL 5K1VA 5F0LB 1MEXL 4Y4FB 3JTTA 3PNWA 4U6HB 3OAWA 2EXYD 3C09B 2F7OA 1KT2A 1HHGA 4KX9A 5I8CB 3EFDH 2D4FA 5I6LA 4TULH 1MW1A 1PCXA 1ZOXA 2J1YA 4XMKH 4UNIA 2AKRA 4M7LT 1Z3GH 2GBVA 3PUCA 1DEEB 1QHQA 2VUKA 1E4KA 4JQVA 1CICB 2CD0A 2BMKB 4LVHB 2FATL 2XV3A 4WFFD 1FSKB 1WFJA 3NSFA 4AQAB 1NCDL 1CLOL 1URLA 1T89A 3AT8A 1YEIH 4HD5A 3BAKA 4G43B 3MSPA 4YHMH 1WYJA 3NJJA 3Q43A 4W6YB 5ERWB 3CHPA 3FB8A 4MMZC 2UUDH 4XNZC 2ZT9C 3C6LD 5A2KH 4YHLL 2CO2A 1T6BX 2WZ5A 2GT9B 3MLTA 4MJIB 4N68A 4DCQB 3RZWA 1KEGL 4UF7C 4JZOB 2ORBL 4G8FB 2Y1VA 2ZG1A 3FCGA 1S7RB 4PGBB 2W9EH 2ZUXA 5JDSB 4JLRB 2D73A 1L6ZA 3LRMA 2GK2A 4F33A 1S78D 5C1MB 3MV9A 4N0UA 5L2KE 1N8OE 3ARZA 1U8MA 2R0LH 4FQXB 5EC2B 3WBDA 4F9LA 3MV11 1OANA 3DRQA 3HS8A 3O3DA 3RWCA 1MJ7L 3OMNB 4OCMC 5EDXA 3T0DA 3AWGA 1G4RA 5I1KL 1TMCB 5A6MA 1BOGB 3SYAA 4RRPM 4QJ4B 3PGFH 4LF3B 3SD5A 3EJYC 1HKFA 3UIYA 1ZGLP 3THML 4LSUL 4JL2A 3LRKA 5IJBC 3FO9B 1CXFA 4UQAA 5DMGD 2N56A 3RX9A 1KZYA 2XN2A 2O6PA 5JW3L 4NKDA 3ZKMD 4E41E 2XBDA 3D05A 4KV5E 43C9A 4EKXA 5EU6D 4ZAKC 3SD2A 2B20A 4Y9BA 3QEHB 3HE6B 3QZMA 3INUH 3PIQA 3OJ2C 3EGDB 4TNVK 5K1NA 1G5GA 1BGXL 5EHFA 1FYTA 3HOGA 4MB3A 3QIBD 3H2WA 2XQYG 2DL9A 2ZUWA 4PWIA 2R4SH 2ZIDA 1FLTX 1CIUA 4DN4H 1IEAB 2K70A 2F1AA 3LD8C 1YCSA 4HIIA 3VB8A 2BJML 3ATBA 3B3BA 4OSUH 2XWDA 4AVIA 4OV5A 2DWDA 1N70A 1BQHG 1HH9B 2ZZUT 1KV3A 1A7OL 2Z35A 4U1LB 1L9MA 3O9WA 3W39B 4ANKA 3TEUA 4Y5XC 5EN3A 4YFDB 5INDB 2OCCB 3H9SE 3CHXA 1MCCA 4KK9D 4KRLB 2GJZA 4F3FA 3W2DL 4TVUA 2I5YL 4PP1C 4MTMA 2VLKE 3ZN6A 4EN3D 4OLEA 2PMZA 1KDJA 3UJIL 3L7EA 3BE1L 5BVJA 1IGYA 5F0MB 4V1DA 3LPPA 5T3ZH 4APQA 5H35A 4K9JA 2E7DA 2CCLA 2CRYA 1WGVA 5DRNA 1R3IL 1TTBA 2KKQA 1NDMB 1PLGL 1QZ1A 5IQ7L 4NCDA 5A6IA 5I8KH 4JY4A 4UQ2A 5CO1A 4XGZA 1J11A 3H9YA 1LE9B 1E5CA 3GSRA 2G3XA 3GF8A 4AC4A 2A0LC 4M03A 4J3BA 2XKNA 1NPUA 3P4OB 2CIIA 1IAKB 5D55A 1TO5A 4L4TA 4HWZB 2NW3B 5HHMB 3SEPA 4BSWB 4QYOA 3WIHH 1Y6NR 2D7NA 2AJZA 2E4TA 2HJFB 2ZXGA 4EZMA 1VF5C 3EBGA 5E6UB 2QSVA 2X0WA 1QKZL 3T77A 2XN1A 4M7ZB 4XN4A 3W3BA 1O9ZA 3O4OC 3EDDA 2VMJA 3SDDB 5LGHL 2AVFA 4AKPA 3ULAB 3ZDXF 5ANMA 3U2SB 4Y2DA 2FWOA 2NYZA 3WNNA 1ET7A 5KBMA 3KWXA 1IO4C 1CWVA 3TBWA 4XPAH 1JMZA 2CBMA 3KPOB 4N1HB 2JV6A 4RISL 2B1AL 2P5EE 2HJKB 4S11A 3S96B 3KPMB 5IV2B 3L1EA 5BZWA 2A74C 2HT4C 3K6NA 3MRGA 4GBXA 4HZLB 3V0EA 1USQA 1RJYB 3KBHE 3E8VA 3EYUL 3VGAC 3CAFA 3FFOA 4MQXD 3A4FA 3QDJA 4QRPA 4WHDA 4AIZB 4ZMXA 1SDAB 3WMPA 3OKEB 4OI7A 1M1XA 5C70A 3L3OC 4FQQB 2VAAA 3BFWA 4AENA 3Q48A 2OP4L 3O2DH 4WFGE 2B15A 2R0ZH 4WFHD 3HI1A 3BKMH 1F86A 4L2LA 4S0SD 3CN4A 3JUYA 1I3RA 2R59A 1KCRL 1WBXB 5C2BL 2ZX7A 3QFJA 3VFSA 1A0QH 2GTZA 4RAHA 4O02L 4XPFL 3F58L 3EJUA 4CSPA 3ROOB 1MI5A 5JW4M 5F21B 5B1AB 2BRRL 3FMGL 3SGKA 4AUUA 4UQBA 4N9OB 2GBAA 3OZ9L 5DRZB 5KZCB 1GGIL 4YQXH 3EHBC 3B7TA 3QUYB 2VZ1A 2EIKB 2JI2A 1T1WA 1YEDA 5CBEB 5IVXA 3W0WE 5DHVB 1UCBL 2ZJSH 2BOBB 1EXUB 2RACA 4Q6KA 3O81A 5JYMA 4HJ0D 2O1AA 35C8H 2FH6A 4LKCA 3U0TB 3JXAA 5AB0A 4L1HA 4X7EC 3CPLA 3WIFB 5IB3A 3CDZA 4QRFA 1CDGA 2D7TL 5IFAH 3NCWA 1UADC 2OW7A 3LOWA 2DH3A 3T0EE 4LAQH 2GJ6D 2VXTH 4IRSC 4HPHA 1TKWA 1RULL 1ZWIA 4ZS6C 1NMBH 2X4PB 4G8GD 3RVTC 3WEXA 1Q9WB 2TRYA 3P2DA 4OFQA 1DTUA 2AI0H 4OM0H 4Y1SA 1S8DB 4Z7UE 1U8JB 5LBSA 3DV4A 4GKZB 3PCYA 4U6YB 5F7NC 1NA8A 2VR8A 2YKKA 2MQ3A 5MI0C 4UNVA 4L8CA 3P9MB 1IAOA 5DHVH 3VTAA 1ERNA 3RWHB 1CFVL 1QEWA 4HV8A 4U1HA 2EIBA 5IEHA 5L9DL 4MS6A 4S2SA 3ZYOA 5KSAB 1JHKH 3SOBH 2IAMA 1SMDA 5DYOB 2CBQA 4UWQB 3PUUA 4K0OA 1A21A 4MJ5A 3CDYA 1L9TA 3I9AA 2VABA 4FKKA 4LPTA 4APXA 3BP4B 4AYDC 2AJ3A 2X4OB 5E6ID 1KGCD 5GGTH 1X9LA 3MPCA 3RWEA 3KPSD 3KHOA 4AGLA 4I77H 1BJ1J 2HRPL 1BZ9B 1CIDA 4JDZA 1NSNL 2DQHH 3OAYH 1THAA 4GLRH 4JHWH 4WUUD 4X4XA 1WAAF 4GRWE 3OMAB 4X6EA 1JV2A 2AHIA 1P7QD 2VO5A 3AADB 5CR1A 2G4EA 2C3WA 4P5TA 5DD6A 5LLIC 5IREA 1E27B 1HEZA 3KLAA 4AL8H 3N85L 2DN7A 2Y25A 1Y7VA 3DOSA 1JZ6A 1YYML 4TPRH 5HY9B 1JWSB 3VWJC 1JZHA 1M2VA 1QLRB 1WBZA 4NQDB 5KVEH 5C86A 4HCRA 1IKNA 1SJMA 4KHTL 1UWYA 2R27A 3IFNL 3TH2T 1RUKH 4LHUA 5F7UA 4DZBA 3KLQA 1CFSA 2HN7A 2F7PA 4KXZH 4P23C 5IVNA 1ZY9A 1IM9D 4EDXA 4KAQH 2JCCF 2Q7NA 3Q6GH 3KVDD 5D7IE 5GRUH 4AYID 1MH5A 3SKMB 1CDYA 2HTKD 5E2VH 1DQVA 4Y9EA 3UG5A 5M94B 2D2OA 4O58L 4P3CH 5D7JC 1N19A 1VGKB 1LWHA 3KXFB 2JQMA 5JXED 2EDNA 1TZHB 4FFYA 4PBWD 5EU5B 3UIZA 4L3CB 4MB4A 4PB0H 3LEXA 5I0ZA 1DVUA 3IPEA 3GRWL 4MLIA 3T3ME 1PQZA 2BDNL 2GY7B 1FFNB 1PSKL 2WQUA 3BGMA 3FT4A 3Q8CA 5KVDE 1M05A 4ONOA 4FAAB 2W59A 1GOFA 4X4KA 3V9CA 4JPVH 3ZDXB 4L37B 1IEBA 4Y5VA 5FKPA 4G9DB 2UUDK 4EUPG 3DVNA 1UFUA 2CHNA 4K23H 1PX3A 1E5AA 3BUTA 4NI6A 2E59A 3SDXA 4LARL 3TL5A 4UAOB 2Z31C 2VIRB 3SGJA 2RCSH 1NFAA 2HP4A 2XXCB 5TPWL 4CN1A 1P6WA 1EDYA 3LPFA 4HMEA 3VSQA 5DA0B 4TNFA 5CZVL 4OF8A 1ZA6A 4FFZA 4NGHL 2FEDC 2AV7B 2E9IA 2WLIA 2ZF8A 2F54A 1KC5H 3F2LA 4IOIB 4JFYB 1JZ8A 3S36H 1FVCB 2WVSA 1J0YA 4H8UA 4OT1H 1A14L 1MHHB 5CJOL 2JKJA 4FGMA 1QSFD 1DZ0A 1KN2H 2PTVA 2AJUL 1RU9L 4L8DB 1RZQA 2C3HA 3GLAA 4XCYB 3ZT5A 1AS7A 1E4WL 3VWKD 3QGVA 1G7LA 2CE6A 2DIEA 4PJHE 3LDBB 4XMLL 5LBSH 3U1QA 3ASWA 2XICA 4JM2D 3DV6A 2F6AA 4M93C 1N10A 4JM4H 3K72B 5C0EA 3EO1A 4B7LA 2VM4A 2AK4D 1WICA 5BRZB 1OWWA 3PXHA 2X44D 4QHUA 3KDMA 2R7EB 3ZY7A 2IEPA 3AG2B 1QABA 2XJLA 5AOJA 4YH6A 3QULB 1CI5A 15C8H 5GS0L 3NIFE 2AXFA 2YMXH 1Q8MA 2HYMA 2SEBA 3RPKA 2C9XA 1JZEA 1NFIA 3ZDYE 4YDLB 4QHNB 4GO8A 2ZX9A 1I1AB 3Q3GB 2IJ0C 3ARDB 3P0VL 2CDGA 1N7ML 5BO0D 3VFVA 1J5OH 3AG4B 4E41A 1F0LA 1E2WA 1W72B 1Z9SA 5DRWB 3UJJL 1UGKA 2MHAB 2IGTA 1OAUH 3LJ3A 3FH7A 2GCYA 4ACPA 1RP9A 2Y2WA 1BQRA 1CN4A 1MLCB 3OL2A 4DN3H 3ABGA 1ZVYA 1QW8A 1AHMA 3D9AH 1UB6B 4LRIA 4KKLD 4PJGF 1T66D 5C9JB 3KCWA 4QRTA 1SXNA 1IJ9A 3ZR6A 1UOWA 1D5IL 3P4MB 4R96B 1EK3A 4CBPA 1OGAB 2WIMA 3T0VA 2BSTA 3LS4L 2CDEB 4HOWA 1FH5H 2DQCH 2A83B 1HXYA 5F9JB 4R2GC 3H9SA 3MBXH 3QRFM 4ZW8A 3CDGB 3G5VB 2ERJB 4KNTA 3LNFA 1DJZA 3HFMH 2HKFH 1DQIA 3GD1C 5F1IA 4XNXH 4PBDA 2BS71 1G6RA 3HR5A 1S9YB 4YHZL 1JPST 4AIXA 2DI8A 1FE8H 2IALA 1OCOB 1FNEB 3ABKB 4G5ZL 4PJAF 3V6ZA 2P8LB 3WN5C 1XR8B 5E1IA 1DO5A 3RPIB 3OJVC 3SBPA 1ECYA 5L2KB 1FV1A 1PZUB 4Z0XB 1JF5A 4XE5B 3PY9A 3T0XA 1CPUA 3IVKA 4DEPC 5KW9H 1RUQL 3R4RA 4YHIA 4KOBA 4MX7B 3HE7C 4Z7QB 3JV0A 2JCCB 1AQKL 3F7VA 5HDRA 4FFWC 2Z4QA 1O5PA 3T8MA 1OGTB 3QXWA 1CDHA 3WMSA 1AGEB 1B3JA 2V9QA 3BN9D 2BSRB 4Q9BA 1OARH 1I1YB 1WBYB 1NCHA 2ESVB 3LRLA 4GIPD 5KVFL 2P5EA 1I8MA 1ZXKA 3CZKA 1KG0B 5BVPH 1CC3A 1NEZB 1KGWA 1G9MC 2QHRH 4BZ2A 3GLEA 3H9HB 1G7JB 3F7YA 1FO0A 1NBQA 2FJGB 2DEWX 3KBEA 4QRBA 3U4BH 1UJ3C 1D9KA 4IBLT 4RGND 3GSOB 1J8HA 5EDSA 2K6ZA 5IHHA 1FDLL 2BVOA 2WYZA 4G59C 3T4AC 3P0YH 3HUJE 4NOBA 4U1KB 4GQ9L 5AAMC 4GAJL 4K55A 1UCTA 2I60H 1H3XA 1UH2A 1JK8A 4YC2B 3FTYA 3BH8A 4B27A 3PS6A 5FX3A 4LGRB 4AITA 4AVHA 3SHSA 5GPRA 1FAKT 2WKOA 3ALPA 5CGYD 1TSRA 1CLZH 1U3HD 4JKWA 1Z5LB 2BS9A 1XGZA 2VWEE 4MD5A 4P2OC 3BOVA 4PJDE 2VOTA 2QFRA 3VXPB 3TIEA 4B7IA 2CNYA 3L4TA 3W0WA 1WZ1L 4GAGL 2WMPB 2OV0A 3QG7L 3OKMB 4F58H 5JORA 4RH4A 5IB5B 1DVFC 3GSWB 1CGYA 1KLUB 3C8DA 5JQIB 4YE4H 4BQ8A 4ZTEA 4WHTB 4YAQA 2QPSA 1NCBH 2HZHA 1NFDE 3NZ8A 1ANUA 4FXKA 5E8NA 4XTRC 4FNLH 4HIEA 3UCRA 4FLQA 5AKSA 5FA3A 2ZUUA 2G2RB 4HIJB 2Y7LA 3ZK0A 4NKMB 5CBAA 5AUMA 1B4RA 5GS0C 4FQ1L 3U4EB 1BYNA 5KYXA 43CAB 1JN6A 1N64L 4Z7UA 1KCSH 3MUGB 2AV1A 2F15A 2Q3ZA 3FUNA 3SQOH 5ICYB 3TOPA 1HWWA 4WI0B 2AGJH 2OJZH 2BVEA 2OULB 1CT8A 4HU2A 1T7YA 2JMRA 5I1HL 1WWAX 3HG1D 1H8NA 5D1XA 1UZGA 3DBSA 1YNKH 1CYGA 5AW8B 3REVB 3QQDA 4L3FA 3PWLA 1JI1A 4XNMA 1G6RH 2EDJA 3RTQC 2RFXB 3OAYK 5E6SB 5E8DH 3GO1L 3BZFA 5EEZA 2LAGB 3LD8B 1V55B 4UM9A 4WU7B 4LPUA 5ANHA 3S7GA 1DUYA 1SXSA 4JKMA 3QDAA 2PYED 2JJWA 2G75B 1PGRB 1MCBA 5T1KB 2C3VA 1JXFA 4JDEA 3R7QA 4IRJA 2MSPA 3HC0B 1IQWH 3FQWA 2VDKL 1AJ7H 1OALA 4LEOB 3CFEA 3DHJA 1E4HA 3B1UA 5F7HA 1MCPL 2D7MA 1Q0YH 4AXWB 1NC4B 1T4KB 3OWEA 4Z3JA 1Q4NX 2DQUH 3QRGL 2OMNA 3GMOB 3HHMA 4PI0A 2NCMA 4OBRA 2J2ZA 2RA1A 1BX2B 1FBIH 4RDBA 2A2QT 3VQLA 5KBLA 1RPKA 3VXMD 2XTJC 3AS3A 4P2RB 3OC5A 2FEEI 1T2XA 3FU6A 4P05A 3GHBL 4HLEA 1NCJA 2QDWA 3C12A 3OKKA 3BDXA 5F0PB 3O45A 1NH6A 3N44F 2H32H 1TEGA 4YJZL 2JI1A 5DD5L 3IU4L 1CMOA 3RLSA 3PAYA 3ZDZF 1EO8L 5D7IA 1BXAA 4BZ2H 5BUAA 2FX7L 4PJAB 3BGFC 1AXTH 1FO0H 2BRQA 3TH3T 1OVZA 4L5FE 2P26A 3QO1A 5JW5B 3LQAC 4IJ3C 1MY7A 3ZRCC 4NM8L 3HC3H 4FQIL 1VA9A 4MVBD 5DHYB 2XFXB 3TWYA 3WLBB 2B1HH 1DR9A 1G1OA 3BSZA 4ODUA 2E9GA 2K0RA 4HPYL 4Y5YC 5FM5O 4WO4D 4FQJL 5HDQL 2OFQA 3TA3C 3T0EB 3GBLA 1HKLL 2ARWA 2OL3H 3X1EA 3FU0A 3DPBB 4GW1A 5GHWH 1QPKA 3MLZL 2A74B 3C6SA 4YDZA 2WHVA 1YQVH 3IXTA 2GBTA 2V8MA 4WCYH 1JGUL 4JFDB 5EZIL 4N2EA 4M48L 1V7NL 2YAQA 3WJMB 1DQTA 3OF6D 3UH8A 3MLUL 1ZLSH 2VCOA 5C6PB 3FB5A 4TUKH 2GB2A 3QEQB 3QNXB 1NAKL 2TSBA 4G8GE 1HJCA 1ZMYA 2P4AB 4LLDA 4MHHG 2OCFD 1E9QA 1IC4H 1P69B 2CJSA 1A4KB 1S7WB 5DO2D 2Z8SA 2GSIA 3CN1A 1R33A 1OAZL 3TTSA 4EDWH 4OCSH 1TQTA 3QFDB 4MQSB 4ZFZA 5C0AA 1UVQB 1IM3D 1MFDH 5SWSD 5HDLA 3RAJH 4BRJA 4GW5A 2AERT 4HOZA 4HWBL 2YHGA 2MCG1 4IOSA 4YHNA 3L45A 4OGAD 5D71H 4NQEB 3EHBB 4J2XA 1QLFA 4MXWL 4B97A 2VZOA 1KGUA 1SOQA 2IFFH 3WFEH 2E6JA 2F08A 3VRIB 2EO1A 1OQXA 1A6ZB 3O3AA 4J4PA 4S1DC 2OQJB 1XF3A 1GAFL 4PJBE 3GRBA 3KPSE 3O8XC 4XO3A 1H3PH 1P7KB 2NUPB 4QT5A 1BPVA 3F6JA 3KEHA 3NFNB 1DE4A 1CGVA 1WCQA 2YGPA 3EOBB 1MFCL 5E2UL 4WUUE 4YLCA 4UT9L 1F3DJ 4LIQE 4ZXBD 1YY8B 3TYGH 3O6KL 2FYYA 1HU8A 1G9NH 4E9SA 1GZHC 1RZGB 4G1MA 3UADA 3K2UH 3FQNA 4QTHB 3JTSA 3T2OA 5B3SB 3CFBA 3MYJA 4KKAD 3I9GH 3EXJA 1NDTA 2NY5L 4PR5B 4C83A 4GRWH 1EFXA 2FE0A 4M6AA 5DZ9A 1HFUA 5ABDE 2IDFA 4JB9H 4GI9A 5LN8A 1HL8A 1IJNA 3EW3B 5ITBL 1ZGLA 1E4XL 2XDHA 2Y24A 1R4XA 3T3MB 5GS2H 3Q5OA 4N2IA 1PDKB 2J88L 4MQ7B 2VLRD 4QRRE 3LKQA 4AG4L 4KKZA 5ICXB 4WW1A 3ZTNH 1AFVH 1M6UA 4F15C 2R0WH 3LHPH 4OUOA 2GVYA 5HYJA 1D5MB 4JN2B 4UOW0 3NEXA 5HI3D 3RQ3A 2FD6L 2Q9OA 2GTQA 1P2CB 1YPZF 3RUGE 2X6CA 4NPKA 3LEVL 5GS1B 3ZSTA 2QGEA 3Q9QA 3BXNB 3CFTA 4TS6A 4W9KC 3LZNA 1S7TA 2ZAGA 3WS3B 2EIDA 4Q6IC 3QJXA 1I31A 1U3JA 2BHYA 5D2NE 5DYFA 3ZQWA 2FYVA 2XWJA 3MNWB 3PXLA 4JO3L 5F7LB 5IHUH 4DVRH 3QORB 5EEXA 1WG3A 2HKHH 4GINA 3E9UA 1U95B 2WNWA 2YGVA 5TQ0H 3EG9B 2ZX5A 4LSTH 4F7CA 1FHGA 3BZ4B 3KJ6L 2H1PH 4JGJA 5FYKU 3ZUNC 4ZMLA 5KVDH 1I9JL 2VTFA 3WI9A 5DJ2B 4E36A 4DK6A 1DUZB 4NO3B 2NT0A 4LE8A 1NAMA 3L5XH 1U4FA 1XTLA 4O51B 4PJHB 3WFHB 1UB5B 1JWMB 1C5BH 3MJ9A 5EIVA 2MMXA 2D3LA 4HFWA 4ZX3A 5MEOB 4ZNEA 1B3IA 4Q2ZB 3SYPA 2FCBA 1G87A 1NPJA 5CD3B 2PP7A 1QSFE 2Y5TB 5I18H 3NIDF 5JUEL 3AT0A 5MP6H 1Z1WA 1TEFA 2A77L 4GG8A 5FIEA 1PY9A 4OZHE 3TBVA 3HHSB 4AEIL 1X5GA 4UQDA 3TBCA 1C5CH 1JXGA 3CLWA 4J8QA 1KIQB 2X89D 2CUAA 1A3RL 2ZXCA 1KTLA 3COOA 4KXDA 4Y4HA 5IWLA 5LBVA 3CCHA 5JIMA 4YSQA 2VH5H 5DK3A 3K5RA 4U1NB 4LCWD 5K1JA 5F7WC 1GSKA 4YIQA 4OJFH 2IPKA 3PFUA 3I2CH 4Z7VE 3W11C 2ZOKB 3HIZA 4OJCA 5FCUH 4I3RL 2F58H 2H5UA 3BEVA 3ZHNA 4DWHA 3A6OA 1BQHB 4NBZB 4NZTH 4QMEA 4J2QA 3EJYD 3G6DH 4MJ6A 4PJ7F 1MPAL 4XXWA 5HDOA 2WP3O 3WNOA 4A66A 2DWYA 2QPEB 2VM9A 4U3HA 2J1XA 2GJRA 3BKYH 1E2ZA 1EAPB 2CLVA 1K9TA 1PZSA 1TTAA 3C60B 5JHLL 3L48A 2ZXBA 1JV5B 4FE9A 5EU6A 1ETA1 4ZAKD 1KZQA 1RFDH 3AG1B 3FBKA 3ARGB 3MOAH 3RFZB 3O6FC 1N8ZB 2W07B 2XACC 3R8BB 1B9ZA 1NIFA 4N2BA 3BKJH 1S5HA 5AZEH 3ARUA 1UXMA 4W93A 5DJ6A 4KVCH 3ARRA 1XH0A 4MHHI 2DMKA 4HK3N 3QIBA 3WAKA 4CVZB 1E6JH 5F8QC 4JRLA 5K9JL 4XVSL 3FHQA 5LQBH 2IOIA 2CLRA 2WXKA 4GKLA 1BA9A 2EDHA 2N3JA 2W0FA 1IGTB 3B2UC 4CSZA 3VI3B 4UQIM 4PJ9B 3OHXA 2WVVB 4X2UA 2QKIB 2AK1H 5DZLA 4ONHA 5AWNL 1B4TA 1LEKB 1U8HA 2AS5M 5AZUA 2FAUA 1B0RB 4HK0B 1N5AA 4RRPG 2Y3AA 2DRUA 4KX8A 4E9RA 2QADB 3Q6FB 3TNMA 1DJGA 1X44A 1JFQH 4JFHD 4PP1D 3N5AA 1ZA3B 4F37F 4GS7B 3SJVD 2K4AA 4BQCA 4F27A 3C6LB 1K5NB 3EH3B 4HAKA 4R7DA 3SPCA 5I17B 3EFFA 4ONGL 1MHCB 1RZJH 2DWXA 3GMPB 3OX8B 3CZNA 4CMMA 1ADQL 1WE5A 2OMZB 4IHOB 5I16B 1FJ1B 4Q14A 1OCCB 2A0LD 3AXLA 3D39B 2X4QB 4D7BA 3WNKA 3VXRD 3CE1A 2HMIC 3QUMA 3NFSL 1JGEA 1G7QB 2IGFH 3R7RA 5KSUB 4KUZH 3SQBB 2ZX6A 1G1KA 3QUXA 2OMUB 3DSNB 4OM1H 4HS3B 3DJRA 3Q1SH 4J3OG 4YXLH 5DMKB 1UM6H 1NAMH 2JK5B 4R26L 1H8OA 3B2PA 1ADWA 1QR1B 2L8AA 5L7XL 5CNHA 4U1GB 2EUZA 3GHEH 1T1YA 1NBZA 5B39G 1IGJA 2APWA 4LLQB 1BLIA 1QW9A 4PJ8B 2Q87A 1KB5L 1KYUA 1QYGH 4NKIH 5KTEH 2QLYA 5ACZB 1YPZB 2LGNA 5I6OA 2WBJB 2ZWLT 3L4XA 3O11B 2JB5H 3HUJB 3LKPB 2B3IA 3AW5A 3TBTB 3BPOC 1ZT7B 2HT4D 1W0WA 3KLSA 5EU4B 4G7YH 4MNHB 3V5HA 3SKNB 1I8IB 1EXGA 4ABQA 3FQXB 3I6GB 4ZUSB 1SHXA 1G43A 4JM0A 2WKLA 3NEOA 3FQTB 3LIUA 4OCXL 4RGOH 2FO4B 4RGNE 1CFTB 4UILH 3S37H 5J57B 4MA8L 4FG6C 5AVZB 2J8UB 4PP2B 2UWEE 4FA8A 4OGXL 3QIUA 1P5UA 5E6RB 2QV2A 4PJDB 1DQML 3DROA 1Y0LB 3GKWH 4UV7L 1R3HA 3PHOB 32C2B 2MOQA 4EUPA 3GMQB 2Y7MA 1OPGL 4WJG3 5LCVL 1JGDB 2HWZL 3KM1A 3DX1A 4XBEL 4CNIB 2EIZB 1LNUA 3UYOD 1FHNA 1X3DA 1OP3H 1W0YT 1AC0A 3B7RL 2HG0A 1U8PB 5EU3A 1MRCL 3NIDB 3HJ0A 4XXDA 1ORSB 3QAZB 5J12B 2IO5A 5DVLA 2CXGA 4X6BA 4LLWB 5L88L 1LO2H 3ECWA 1KCVL 4L4VB 5C09D 2FO1A 3HBQA 2JSFA 2UY7A 4YBQD 4CC4C 4Z7NF 4YL9A 4FABL 4LEXH 1CFMA 3HC4H 2WN2A 4XN1A 4KROD 2JB6A 2NXZC 3U0PA 2CAKA 4MAZA 1F97A 3CVIH 1FL6A 3FOLA 1C16B 3RDTB 4D0BB 2GJ6A 2XG5A 4IIQB 4IRSD 4J3WA 3KWWB 5BS0D 4ZS6D 2IMNA 1TNMA 4G8GA 3ESUF 3RVTD 3SOTA 1UXSB 1PEZA 4BFIA 1FFPB 2WSDA 3CLEH 4M6MH 3UZVB 3AAZB 1CF8H 2J6EL 3U0WH 1NANI 2D31B 3VYPA 2ENJA 4PJ7B 1CL7L 3O2WH 4WEUD 5F88A 4JFFB 3KVQA 3IDXL 5H37G 1RUMH 3N9GL 4CN4A 2FBRA 3IDIB 1E7UA 2DH2A 1MLBB 3WE6B 3BIKA 3HG1E 2IG2L 3JYBA 2ZXDA 3D18B 3CVCA 3FRUA 4A63A 3CK0H 4PQXA 3O4LD 4JPKL 2H45A 1ET8A 1WA1X 1Z0NA 2WKGA 1R34A 3N1FC 3E6HA 3WG7B 2R8SH 3DVIA 1SYVA 3P9WB 2PYEE 2CHZA 1LQBC 4HSAC 3AUVA 3U83A 2ATPB 4X98A 4ZO7A 2FJHB 4FERA 2NYYC 1JD9A 2GK0B 3FTSA 4JCWA 3I6SA 4KO6A 5HHVH 4ZMWA 5JA8B 3DX8B 5KWYC 2YXWA 1ESOA 3CVHA 3V0JA 5JQ6L 3AT9A 3DMMA 1PZ5B 3X12B 1KY7A 2BX5A 2C4FT 1U8OA 3QXAB 1T6WA 4FQLL 4E5XG 4ZW3A 1MCQA 2IMMA 1HINL 4U6HA 3E80A 3C5JB 1P7QA 5DR5L 1T20B 5I8CA 4DP4X 2J20A 1RJZB 4AGQA 2AABL 4ICWA 4JHBA 3VXME 3ILDA 2WQRA 1RIVL 3VWJD 2DLGA 5DMIL 4P5KB 3WTWA 1DFBL 2KERA 3QFGA 1A7PL 5A2LH 1CICA 3C8KB 1OWRM 2BMKA 2X6VA 5IBUG 3NK3A 2GQHA 3LAFA 2EUWA 5T1JA 4AQAA 1TETH 4P23D 2IV8A 4FG2A 4PJ5D 3B9VA 3B1TA 3OG4B 4F9PC 1IM9A 4I18A 1FH2A 5ERWA 3TPKA 2HFEA 4KHXL 4JRXD 4K15A 3WNMA 2XIBA 5D4HA 4TOYL 5D7JD 4NZRH 4TLKA 1FIGH 1KV7A 4WNJA 1DBJL 4GFXA 2YUVA 3S2AA 2F2HA 3QA3B 4NYLA 4PGBA 3B37A 1RZIA 5EV7A 5JDSA 1G7IA 3L1OH 3ULVC 4FLSA 4MXQC 1IFHL 4U05A 3ROLA 1MWAL 4L5FH 2NPLX 4NN7C 4EUPH 3ZJAA 5D2NA 5EC2A 3W5MA 1U8NB 4HLZG 4HVBA 1XEDA 1TJGL 1UACH 3JSSA 4FI6A 2I9LB 3KLKA 3V9FA 1BOGA 2D4DA 2OZNA 2CNZA 3WY1A 4BH7A 4HU8A 2B0SL 3OM3B 4BZYA 5I73B 1XD0A 2Z31D 5EZJB 3GIZL 5FR3A 1T0NB 4ACTA 2AJVL 4AMKL 3VNZA 3RP1A 3DX6B 2MWCA 4F8QA 2VSKB 1AZRA 3FO9A 4I9WD 3BUBA 1CURA 4JFEB 2FEDD 5FA4A 1U8LB 5E2TH 3M1BB 3SO3B 1EZVY 2XCMC 1MN4A 4RZCB 1FRGL 3HRZC 5TGBA 1WFUA 3RA7L 1DP0A 4GAYA 1QSFA 5SWSE 4XPHL 4EI5B 2FVNA 4I1NB 1BQLL 4N26A 5IB4A 2IC2A 4UANA 3VWKA 3QEHA 4FRWA 3GSNL 1ZSDB 1E40A 3QH3B 2HT3D 3VXUB 4JM2A 4XZUB 2YFOA 1GIGH 4B41A 1OOWA 2AQ1A 5ID1A 4K4KA 2VKWA 1X4XA 3D33A 3NJNA 3WO4C 3LKSA 4D8PA 1Z3RA 1DLFL 4XOBA 2AK4A 2VLMD 1IEAA 5J0BA 5TTRA 4FKHA 1F90L 1LVEA 2AXHA 2VLJD 4PS3A 3SDYH 2RALA 4ELMF 5LUMA 5G5DB 2PW1B 1KJ2L 3DJZA 3NCFB 2N4IA 5D7LD 4ZMVA 2WQXA 1KTRL 1NDGB 3PV7A 1GCYA 4N1CA 4Z18A 3WKML 2X2UA 5F96H 5IF0A 3NACL 3DYOA 3MUZ1 3QG6B 4PSPA 4U6XA 3M86A 2XQYK 6PAZA 4HKJA 2XY2A 4AUYA 4RA0C 4JQXA 4R4FH 5I1EH 1CU4L 4LU5L 4JDVB 5CZRA 2GSGA 3CVHH 3HPLB 3TVMB 5C3IA 2YPVH 3II3A 4QRRB 3QNYA 3M6DA 1EANA 1TTFA 3BAEH 3L5WB 1WAAE 2BK8A 1QACA 4LIQH 3MRNA 4XBGB 2NX5D 1SFDA 1WFTA 2VDPL 3FHEA 4NHUA 4GP4B 1BREA 4JN1L 4MASA 1P5VB 4WK2B 1AQDA 1S7VB 4YGVB 1ED3B 2EIMB 5C07B 1S7QB 3WUZA 1GZPA 1YNTF 1O6TA 3CX5K 2VLRE 3IXAA 3FKUS 3LY6A 5EO0A 5ALBH 3FSVA 2BWIA 4HWZA 4Q74A 1D3CA 2HJFA 1BW8A 2Y6TE 5TE7H 4BK4A 4D2NA 4L1LA 1PY0A 2EINB 2WLNA 4MAYB 4P59L 1CFQB 3GI8L 4ENEC 4F93B 2UY6B 4ERSH 2WZAA 2YIHA 3HBZA 4B5ZA 1VIWA 1E9OB 1FG2A 4NJ9L 4X9BA 4R2GD 3UPRB 1UD8A 1GGTA 3OV6A 4XO9A 5KANG 1P84J 4JE4B 1V54B 3O6ML 1XEUA 1NCAH 2IH3B 2UXVA 3KPOA 4I8DA 3IRPX 3W1ZA 1E8YA 3S96A 3KPMA 5IV2A 1KDIA 4J6RL 2BNQB 3CFNA 1RJYA 1VSCA 2XPZA 3V7MA 1YMHA 2B4CL 1K4DA 1M7IB 2JE8A 4AIZA 2WXOA 4HUUB 2DMHA 1YDPB 1J7VR 3GMMB 2PTUA 3HMXA 3RPBA 3CH8A 4FQQA 5DJAA 4BSVB 4N90D 4PW4A 4WV1A 1JP5A 2G9KA 3FTGB 3LX9A 1TQCC 4F15B 3D25B 4WLCA 1T5KA 1ROWA 4M8VA 4U7SA 4XHQA 4YVUA 1CFBA 1IAMA 3HE7D 2ZX8A 2EVIA 2ZG3A 1SM3H 1QBLH 3GJFA 1EHAA 1PEWA 7TAAA 1BBJA 4P99A 4FFWD 4TXVB 4PHZA 4RETB 3EIFA 3P3TA 3PV6B 2OZ4L 5JOFA 4OLZH 5DRZA 1AXSA 1WPCA 2VDKB 2YN5A 3G5YA 4ZPTB 5LJYH 3QUYA 5CU9A 5I6NA 5I9QC 4YHYC 2E4FA 2EUVA 3SKOA 2WCGA 3K8MA 4Y2LA 4TKWA 4DAGH 3QHZH 2O93L 3OVUB 3MUY1 4AM0A 2NNAB 3I84A 3TN0B 1HWHB 3VFTB 3DJ9A 4BSJA 4F7TB 1CE1L 2PPCA 1NIEA 2IDCA 3WIFA 2GW5A 4NAJA 2EDMA 5IM7B 1EGJH 5B3NA 2OLDA 1IC5H 2G9HB 3P11L 1TQBC 4P4RA 1CO1A 3U7YL 3NSYA 1FUNA 3OPZL 4U4IA 2G60L 3T9WA 4MD4B 2F1EA 1A7RH 5E9DB 3FN3A 1F4AA 3NAAH 5IQ9B 3QUZB 1IVLA 2BY2A 4Z0BL 1S8DA 1XGTB 2VKXA 4DGIH 1U8QB 1U8JA 4U6YA 3P3SA 2LVEA 4AY0A 2KI6A 3UAAA 2VQ4A 3P9MA 5D1QD 1QWHA 1U3HA 4W68A 3NFPB 2Y9RT 5BJTB 4P07A 4P2OD 2QBWA 4KBPA 4JFTA 3CMOH 3RZCB 2BP8B 1GHFL 3L9RB 1OB0A 3TO4B 2XY1A 1I4FA 1U8KB 1DL7H 5DJZB 3TM6A 3AS2A 4EIUA 3B9EA 3OQ3B 1GYWA 2X4OA 4KI5D 2O61B 3BZEA 4IBVA 1DVFD 4CADA 1SJEB 3TYFA 4N0RA 3ZL4L 3E0GA 1PTZA 4PJGE 3ZE1E 4GMSH 2ZXAA 1BZ9A 1FGNL 4XTRD 5SWZB 4Y16C 5K5YA 1ZDSA 1V3KA 1LE5B 4GT0A 3R8QA 4FULA 4JAMB 3DA0A 3KH4A 3U7WH 2YPLD 4JFHE 4W9CC 4M7JH 4ZBJA 3U9UA 4XPGL 5IHZA 1JWSA 5E8OA 4OQ1A 1QLRA 3PRZA 5TF1L 3SCMC 1W9XA 3QO0B 3IETA 5FO2A 4J8RB 1U2HA 4OZFG 2Y07H 5D1ZB 5E8EB 4GSQA 2OSYA 2W92A 3JQOB 1XGPA 3QWRD 2B5IC 1FFOA 2Y7QB 4MFHA 3IGAA 4Y4KB 1XF5B 3RTQD 3VXRE 4KVPA 3S4SG 2X1QA 1DDHA 1BVNP 3BP6A 2QFPA 1H3GA 1SBSL 2FLBT 5I1LA 3VW3H 4UMGA 4LLUB 3HMXH 1X5FA 1SVCP 2UX6A 5DK2B 1TZHA 2ADJB 2PWGA 2NY3B 3CG8A 2CHDA 3ZU8A 5HP5A 1HYSD 4JZJA 2ED9A 4YHOH 2AZUA 4DH2A 3HBPA 5CINL 2DBLH 4YHKH 1FFNA 1R1CA 3BWUC 2EE0A 1QG3A 3KPLB 2DB8A 2C1OB 5EWIH 2W95A 1OAQL 2UWEB 4S1RL 4DUVA 5FOBB 1RI8A 2B59B 1ROCA 4F2EA 2VUYA 3MVSA 5K39B 2XTJD 4JQVC 1LDSA 3QI9B 2RAMA 3ISRA 3RWIA 3F04A 1HK6A 1DCEA 4IKJA 3KCPB 1T89C 3GMNB 5BUPA 4G8IB 4XVJL 5DK0A 2WGXA 3DUHA 1CE6A 2V2TA 3KPQA 5KANI 4X4YA 3I74A 5E24E 2V4LA 1Q94B 4HQQL 4UI2A 1PLAA 4N0YH 3ULVF 3GXIA 3QVAA 4JJ5A 4JFYA 2QEJA 2FX9L 1IZKA 1JL8A 4HJUA 4HMCA 4IOIA 5EF2A 4ZI8A 1T5XA 3PGCA 1MHHA 5IW6B 2PWEA 4M43H 5I1IL 2E6QA 4TM9A 2VN5A 3NIGF 4XPTH 4XCYA 5E4IA 2F5AH 3MKGA 2JH2A 4WO4A 3UJTH 3FL7A 1Q1PA 3TA3D 1KCBA 3FUIA 1HZHL 5EG6C 4UTBL 4AT6A 1X4YA 1KFAL 3IU3B 1XGUB 3GMRB 3AMKA 2JXMA 3K72A 5JLZB 2YA0A 3WHE0 3GBEA 5C09E 1CQYA 1DQLL 1QRND 3R19A 3G9VA 5J06A 4E68A 4M29A 2YLHA 5GGSA 1N5YH 4OFIA 2R7EA 2MQCA 4M7KL 2E76C 1X9QA 1CGSL 4ZZFA 3OF6A 2F53D 5T5NG 3QULA 4XH2B 3H3BC 4S1QL 5BS0E 1I8KB 5DHDA 1JTTA 1LEGB 3DIDA 4PREA 4X8XA 3DI3B 4FCHA 1J9SA 1H6FA 1YHPA 3Q3GA 4NIKB 2Q0ZX 1BYOA 4M8UA 3ARDA 1GH7A 3F5WB 4HALA 4FN0A 2FIRT 4ES8A 3VG0L 4OZIB 2D3VA 4AEFA 1IM3A 1W72A 2W8CA 5DRWA 3D50A 4DHLA 5DTFB 5FKAA 2E7MA 1R24B 2C9SA 2X7LB 5J1TC 3VD0A 1LK3L 3SPIA 1E5BA 1HILA 2W1NA 3IRZA 4NBXB 3O4LE 4PRHB 4PWEA 4B9KC 4IMKA 1BEYL 1QUNB 4DPBX 1UB6A 4IBYA 5GZOC 2R56H 2FECI 1I85C 2X87A 3G5XB 4RIRA 4S1DD 1A6WH 4X5WA 1J1PH 3O8XD 3SDCB 3P4MA 2DYPB 2OCJA 4NB7A 4B6ZA 4LFHD 2VSDA 4NN5C 4YK4C 3FN0H 4MZIA 1OGAA 3QJSB 2IOOA 2ATAA 2I32A 1NGPH 2CDEA 3CFJB 4NT6B 5F9JA 3T6VA 4ZXBA 2Y06L 3KWUA 3CDGA 4MDRA 4BK8A 5IMLA 3FO0L 4KH2A 3NCYP 3ZKNC 1QSED 4EMZA 2XIDA 2Z7YA 1MRFL 3MOBL 1J9RA 2ADIB 1XV8A 2PXYB 4X7CC 2Z92B 1HQRB 5JW4R 4FQHA 3MTXA 4APQC 1S9YA 1WAAA 4JFSA 3FU7B 4XP5H 1U9KA 3HJEA 4NDMA 4PJXE 5GRJH 2B9AA 4QHLB 1P9MA 3B4NA 2P8LA 4PJ5E 2ZYIA 1XR8A 3FT9A 4ZUTB 2N0KA 3MLSH 1AGFB 3MYZA 4P5MA 4MDJB 2PPAA 5AB9A 1NEPA 1UA6L 4JRXE 4TSAL 4MSWB 4F2MB 4NZJA 1UUSA 3D2UB 4Z0XA 4R9HA 2LU7A 3IJSB 1NGQL 2R0KL 3T1FA 1I3GL 3KJ4B 5J7CC 1I9RL 4KZEL 5I74B 4JPWL 3ZDZE 2JCCA 4OLUL 1MCWW 3EO9L 4PTTB 1A3LH 2X4NA 2BVUA 5T5FH 2MQGA 2EVGA 4HG4J 2Q7AA 2ZPKH 1BZDA 3L3JA 1OSPH 3STLB 4OCNC 2ZCLH 1CXKA 4JKPH 4MAUL 4A7SA 4M5YH 1I1YA 4DOHB 1M1SA 2XT1B 5IFJA 3L4CA 3D51A 4M00A 3IJ8A 2OR7A 1AGDB 1ONQA 2Z6FA 1W2KT 3FPXA 4NM4L 2VXUH 3K2IA 3CSGA 1NEZA 2EIJB 4RFOL 2BIPA 1MVUB 2PO6B 2V37A 5DWPA 3H9HA 1EMTL 4G6AD 5B8CB 2FJGA 5JOEA 3FULA 3AJ7A 5KSBE 4K5OA 1GGCH 1RPQA 3GSOA 1FNFA 4ANXA 2NY0C 4OAWA 4JHAH 2ETWA 1HSAB 3MRKA 4FXGB 3JV4A 5E08H 4MMYA 1VGEH 1Z7JA 4Q4IA 5JNYB 4AI7A 3QT2A 1NOFA 2XN9B 3T8XB 3ZMNA 4K3JL 5DUJA 4YSPA 5D5MF 5FHAL 1EHXA 3I75A 2EKJA 2XA8L 2X12A 4AYFB 3OKDB 2IBBA 1AKJD 4LQFH 1WD9A 3F64A 4KO7A 2XRAL 5KSVB 4K71B 1JZ4A 3MXVH 1OKEA 1Z5LA 4LCWA 2BHFA 2VLME 1F13A 4JGNA 3VFUB 1EERB 3NSXA 2VLJE 1PY4A 1KB5B 3W11D 1EPFA 1J5HA 3BJLA 2WPGA 4XPBH 1D2PA 4EBQH 3EYSL 3OKMA 4DP5X 3IFPB 1LO3H 5D7LE 3U6XS 4P3DB 3VUAA 5CCKH 4P2QD 2DPKA 4ZQKA 3PWPB 4QHPA 4LNRA 4NKOA 1R0AH 2ICES 1CG9B 2CRMA 1UD2A 2Y72A 3KDPB 4XC3L 3A6BL 5AOMA 5E8PB 2X2JA 3IDYB 3ALWA 1BG1A 2G2RA 2JTYA 2H47C 1WCBB 2CA4A 5HYSG 1S7SB 1XGYL 5IEKB 3U4EA 2W0KA 4HBCH 2VLRB 1A5FH 3F7PC 4QTIL 3EOAA 3ZX1A 4ZAKA 3WKPA 2NX5E 5ICYA 3ARXA 3O6FD 2BNUB 3MV01 3UBGA 5FGBA 4K2UL 3WLWC 3GBML 4LVOC 1P4BH 2EO9A 1F4XL 4UQ3A 3ZTCC 5EEYA 2NLJB 2YJQA 1QO3A 1LWJA 3DK0A 3WUWA 2VSMB 5B7FA 3OR6A 3U2JA 2OYLA 4WU7A 3GJEB 4D3CH 2LU4A 1T03L 3QQ9C 2H3KA 5CLZA 4Z7WF 4E9VA 4MXVF 5A2JH 4ENZA 2H2PC 3B2UD 2G75A 1K3IA 3LIZL 4LLVB 3GMLB 4KZDL 3AWFA 1DQQA 1QWNA 1UH3A 1YAZA 4RMTA 4PJGA 3D12B 1S9XA 3QCVL 3U46B 2OMTB 2AXGB 3QZWB 3SPHA 3CFQA 3L1GA 4AXWA 1T4KA 5ELIA 1OCWL 3VI4B 5DGQA 2I25N 1XL6A 5F3FA 3SJVA 1BX2A 1S7UB 1N2RB 1EEYB 3IEAA 1UM5H 2CK2A 2BOCA 4BH8A 4PVBA 1FWXA 1IKNC 4P2RA 3AREB 3L1FA 1KELH 3AQXA 4DP7X 1M9SA 1TG8A 2G5BB 3VH8B 5DURB 3QEUB 1DJXA 3HB3C 4N90E 3VXRA 8FABB 2HMID 3FT2B 4P5SA 3VFRB 4Q4EA 5B3JF 2H0JA 3CXDH 4M1DH 4PJAA 2V7NA 2NXYB 1H6EA 3K46A 2X3CA 3KYNA 4WNQB 5JW5A 5C0CA 3LZQA 2XFXA 5IQNA 3WLBA 2IXQA 1YEEH 4PJ6A 1JRHL 3KYKH 1JNLL 3V4VH 3D52A 5CEXA 1I7TB 5C7XL 2O4EA 4QDGA 5DWUH 5INCB 1HOCA 3DPBA 2LR4A 3QEGH 4QYAA 3HS9A 2A74A 1HNYA 2O5ZH 2C26A 3BSGA 3E8UH 4BFEA 1LMIA 2FT8A 4KQ3H 5DT1L 5ECGA 3PXJA 3RJQB 3STBA 4ZPVA 4ADGA 2N1KA 5F9WB 1NC2D 5I30H 5J9PB 4I5BB 2V9UA 3ESOA 1MHPL 4FG6D 4HXAH 3MJ8B 3H7LA 1F6AB 1V7ML 3QEQA 5F2FA 4DJMA 4MMXB 1A4KA 1S7WA 1GTFA 3TBBA 1VFOA 2WP3T 1NL0L 4CVUA 1RUPL 1D2OA 2EH7L 4R7LA 1L9NA 2I26N 3IMVA 5TDPA 5C0RH 4G7QB 4KC3B 4RFEA 1OW0C 3CIAA 1A64A 2AAAA 4GY4A 1EEUA 5D1QE 1OY3B 2ROYA 2FNBA 5ALCL 3Q0HA 4KTDL 5KVGE 2HT2C 3VNYA 3ZE1B 2XFGB 5LDSA 2OX5B 1TJXA 5ESAA 2EDEA 4NQEA 1BWMA 5B1JC 1ZCRA 4Y1AB 2PPEA 3UO1L 4QXTB 3HG2A 3RWJB 3VRIA 1QWUA 1BBDH 1XIWB 2A6IB 5JZ7C 4ZZKA 1MWAB 2BY1A 1TPXC 4DKEH 3D85D 1BZEA 3K8KA 4ZYKB 4KI5E 4M7LL 2NXZD 4Y7OC 5F3BA 2EDRA 2NT1A 4FQCL 3C6EA 3ZE2E 5J1SC 3L2NA 1OHZA 4UBDD 3NFNA 4RCAA 3EOBA 2Z7UA 3A67H 3AACA 5GGVY 2CK0L 4NO0D 4WK0B 5KVMC 1MIML 1PNDA 2WXPA 1BJMA 1QEXA 5CSGA 2YPLE 1UH4A 4E5XB 1EJFA 2CMRH 5GRZA 3ZKXC 5H37H 4PW9A 3DYMA 2ZNXA 3VQMA 3QUGA 1QFPA 4NAMA 4JFUA 4UZSA 4QTHA 3H4FA 4PLJC 2DIJA 1AH1A 1VKXB 3OXRB 1HCFX 3BUPA 4IM8A 3DIFB 3QDMB 4ZS7L 2K7PA 2R39A 2WLYA 4WW2F 5EBWB 4UCFA 4LDLB 2BIIA 5AOLA 1U3NA 5HPMA 5IBUB 5HYQA 4ZSOB 1N4XH 1YMMB 5IW1A 1PDKA 3LXAA 4H88L 4S1SL 3STZB 1MCWM 1OOAA 3TCXA 4Z6AT 1XF1A 4Y2NA 1MAMH 5ICXA 3K6SB 4OD1H 5LG1A 1TYEB 1MKFA 4TVPD 3IDGB 2NYYD 1EDQA 3GBNH 1T3FA 3JT2A 1D5MA 2WQSA 4JN2A 3U4AA 1MJ8L 3VFGH 3A47A 3VVWA 4BFNA 2WN3A 5GS1A 2RH0A 5EO9A 5I19H 4OI8A 1N6QH 1KJ2B 4FYSA 1GGYA 1KLFB 1TZIB 4M6OH 2QQKL 5EUOB 3WS3A 3NA4A 4A2MA 4B9ZA 3S35X 2DQGH 1KXQE 1MREH 1ETJA 2GAZB 2YEZB 3QORA 5CMAB 2XTJE 3WTTA 2YAMA 3CFDB 5E0QA 3FT3B 4P9HC 1Q9OA 2Q3AA 2V2XA 3TCLB 5DJ2A 4P23A 5KS9E 2DBJA 2TSAA 1DUZA 1OAYL 3H7BA 3WFHA 5FFLA 3D09A 4MNGB 2VAJA 4D0CB 3BPNC 1G9HA 1RZKH 5MEOA 4TRPH 4IGBB 1CBVH 2X6MA 1UOLA 3S0PA 4Q2ZA 5D7JA 2BXZA 3H85A 5KYUA 5CD3A 3S8GB 4HC1L 1MY5A 2Y5TA 4LSRL 3UTOA 1A6VL 5T33L 4RGMC 3SY0A 1W0VB 5L8LB 5DDHA 3MRBB 5D7SL 5IOKA 2W0LA 5I1CH 5B4MC 4AIEA 4HLZH 2W81C 2BIMA 1I1RA 3ULVD 4MXQD 1HH6B 2HTLC 5JHDD 3QJTB 1LD9B 5F72S 3NDZE 4I0PB 1A4CA 2A9CA 2XQBL 4U1NA 1QRNE 9PCYA 3BPCB 4AJYV 5C0FB 1FNGA 1MXGA 1FZKB 3DC0A 5AW6B 2ZOKA 2ORBH 5D72L 5KUMA 3FFCE 2F53E 5JHMA 3WMQA 2Z31A 4XNUL 4YXKL 1KYOK 3BN3B 3X1BA 4Z7NE 1MFEL 4PJFF 5D2LE 1U21A 3W9EB 2IWGA 3T0WA 4JO4L 1U93B 3UGUA 4B0MM 3EBHA 1JERA 5D93B 1EAPA 1BXVA 3C60A 3J8F7 2G2PA 5J1AB 2VN6A 1NCGA 5CJQH 3FB6A 1JV5A 2VW7A 3BAYA 3QXDB 3RFZA 1FLRL 4LVNB 1ZE3C 5IESL 3ABLB 3ECBA 2W07A 3CBJB 3S3JA 3IKCB 4KKPA 4HJIA 3GUTB 2WLZA 4WO0A 4O02A 1AR1B 5ITFB 1XZWA 4K5MA 2EDXA 3KH3A 3SY6A 1T7WA 2ZKYA 1GVIA 2FB4L 4CVZA 3N50A 4I3SL 4LZKA 3B56A 1IGTA 3APFA 2WVVA 4P46B 2QKIA 4NBYB 2QPFA 1LEKA 4AEHL 2V9TA 1UD4A 3RWFA 2GPZA 3H42L 4UB0L 2PCPA 2ARJB 4LCCB 3CBRA 1YEKH 1QSEE 3B3IA 3KEDA 1TOXA 3BI9X 3Q6FA 4BWUA 5AENA 3BVDB 1XH3B 5J6SA 2MTPA 4K7PX 4JRXB 3TASA 3VFWB 1RXLA 2J5LB 2FEJA 3S3BB 4PGJA 3GMPA 3OX8A 3OPUA 1E6OH 1WFNA 1JFHA 4YE0A 4IHOA 5I16A 1FJ1A 2K6YA 2QTVA 4G1EB 5I5RA 3N43F 1OQOA 3BMWA 3D39A 4K9EL 3L4UA 3TCTA 2ZXEB 4NPJA 3ZKSD 2X2IA 4WW2B 1AG6A 2EEAA 5KSUA 3MUUA 2HH0H 4YFLF 3DSNA 3CHOA 3DDGA 2EDKA 5DMKA 4M5TA 2JK5A 3EBIA 4AYGA 2Y5QA 4ENED 3CMGA 3PL6C 2GC4C 1QR1A 1LO5A 4XO8A 3M88A 1WS8A 3KD4A 4OZFA 1E3XA 4YPJA 4HH9B 5E95B 2ZKXA 1FVDB 5KSBB 1NGXB 1TR7A 5GZNA 1OEZW 1BD2D 1GC1L 2NDFA 1C1EH 4XNQB 3TBSA 1YPZA 4XMUA 2DDQL 3HCVB 2WBJA 2WXRA 4M3HA 4WWOA 1PBYA 3LKPA 3P73B 3TBTA 3X1GA 2KMWA 2NY4B 1C8PA 5I0WA 3D3VB 4MNHA 1SXAA 3SKNA 5LWYL 3V5KB 5E0FA 4WWKD 5FM4A 4O5LH 2VITA 3I6GA 4F1ZA 3WN5A 2VQTA 4ZFGL 4ZFOA 4ZMNA 4ZUSA 5HHXH 2EYSB 1D6VL 3FQTA 4EOWL 2FO4A 1CFTA 3APNA 4GO9A 4HISA 1PFCA 4R90H 5CLTA 1HHIA 2LFGA 4PP2A 2X4UB 1WGOA 2P42B 1E8XA 1MELA 1BZQK 4BCXA 5A43C 5DSCB 5IJVB 1PJWA 5C0GB 5I6XC 1Y0LA 2DEYX 3PHOA 4YX2H 32C2A 1L0QA 1UM4L 4W6XB 2VLJB 4TQPA 4UM8B 1CJYA 1RJCA 1C7SA 2ISDA 3HHRB 1HAWA 2YSSB 5JTWA 1NFKA 2OI9C 4IKLA 1JGDA 1V3LA 4AYBA 1A22B 3FQRB 3J07A 4C4UA 1HL5A 5EU7C 3ATEA 5FYJL 4O4YL 4L3AA 1OM9A 3VFMA 4JGUA 5I0DA 2MPVA 4HS8H 1QA9B 1ORSA 3GRWA 4NZUH 3L17A 4PRNB 3VACA 4G7RB 4O9HL 1NLBL 3RKPA 3NTCH 4J3SA 4L3EE 1F45A 4L4VA 1WRFA 2PETA 2E27H 2ZKHH 4KKBC 4HIXH 1HHHB 2COVD 4C56D 4O02H 4XPFH 5EIIG 3MBEB 5F70A 3ZR5A 5JPMB 4BFFA 1LO0L 1C16A 1ND0B 3CUPB 3DTXB 4OGQC 4HUMB 2R9HC 1O9WA 4MDIA 4P9ML 1QTPA 1R19A 4ELME 3GLZA 4WNSA 3T4AA 2YD7A 2E75C 3RWDB 1BFOB 1IILE 1F4HA 3VM7A 4OCWH 1OB1A 3AAZA 3G3LA 1HDMB 3LHAA 5F6HJ 4PJCF 2D31A 2VE6B 4PJ7A 4L29B 5PCYA 3CN3A 3WJJC 2YS4A 4JFFA 2WQAA 1OD9A 2Q76B 3FYIB 3QZPA 4ABVA 5F3HB 3CH1B 1BM3H 3IDIA 4JVPA 2CRIA 3WE6A 1RZ7H 4Q89A 1O7DC 2GIXA 3MRHB 4A6YL 4FFVC 3E3QC 1AP2B 5E6ZA 5KJ7E 2QPUA 4WTXA 3T6ZA 3DWTA 3QQ3A 2NUTB 1PKQE 4NQUA 1YEHH 4FADA 3V4PA 5LNDA 1UWGL 4J4PC 4ANVA 3S4SB 3Q9PA 3X17A 4WKXA 4G9FD 3B8SA 4OF5A 2MTAA 5B21A 4Q97A 1DVFA 1ZHLA 2GK0A 1EXHA 3DX8A 1IKFL 1ZLVK 1RQ5A 1C8QA 5FWRA 1TYJA 3D06A 1T4WA 4Y16D 1PZ5A 4M6NL 1F1DA 3X12A 1M42A 2DLIA 3FJTA 2EC9U 3QJUB 4P4KC 2WXMA 3C5JA 2CO7A 2VQ1B 3SPJA 1P6FA 4KO9A 4NP4L 3NH7H 1IGFL 1BXXA 1IU1A 1RJZA 2FWSA 4FMFA 4W1TA 2B39A 4QOKD 4UT6L 3MRMB 2X3BA 2UXTA 4OZFH 4NENB 1A6UH 1VJSA 3V4UL 1CDUA 4XC1L 1CGTA 1DSFH 3PYCA 1Y6MR 2HJLB 4OR1A 1J18A 2E0PA 3A24A 2WZ0A 2ZUVA 2WM0A 4YXHL 4HJTA 2AAVA 3RTQA 4LRNH 1QFUH 4X99A 4FTVB 4HP5A 4E2OA 4OZGE 1TJHH 1F3RB 4IDLA 4POUB 4U6VL 3MRJB 3MO1B 1MNUH 2DQFA 4X6FA 5IBTL 4PRPD 1K8DB 3RU8L 3N43B 4K9EC 5BO1L 4HZ1A 3HI5H 5FFOA 1SXZA 2YBGA 2MKLC 4IBUA 2OMXB 1OZUA 2HFFA 4JO2L 5I28A 4JO1L 3CZFA 1MSPA 4JFXB 2CH8A 3JWOL 3TWCH 1F4YH 2OR8A 4YZWA 1NGWA 4ODVH 2WCPA 5DQ9A 1ZHKB 4MCYB 4KVNH 1EUTA 1U8NA 2NNFA 4X8GA 2GBUA 1TZGL 3GM8A 1FFQA 3O3BB 2R23A 3QW9A 4AK1A 1MJJA 3MRFA 4O58H 5GRVK 3WN6A 2I9LA 1GC1C 2YZ8A 3HLAB 1IE5A 3CN2A 4XAKD 2IDTA 4H13C 4QY8B 5FYLL 1UQSB 2X4RA 3R4DA 5FK9B 3DYPA 2E3VA 1INDH 4DGVL 1JF1B 5D1QB 5TDOA 1TNNA 5I26A 3DX6A 1T0MB 3M8OL 1G9MH 3E2HB 4HJJH 5C08D 2K9FB 4BZ1H 3CLFH 4JFEA 3TNNB 2F0CA 1IGML 2VR4A 3AVEA 5E00B 4JR9L 5CFAA 1K85A 4X5XB 4RZCA 5AL8A 3NRQA 4U1IA 3GS7A 4HJGA 4EI5A 3HR6A 4DUWA 2W80C 3LXUX 4B96A 2J25A 4Y5YA 3MV9D 2YC1B 4WEEA 1H9VA 3QH3A 3VXUA 3QB7C 5IWLC 4XZUA 4UMSA 4Y4HC 4HGMA 4FD0A 4K8RL 1BVKB 1XCTA 1X5KA 3BDBA 1SYSA 5G4NA 2UXGA 2R69L 4N3UA 2HFTA 3ECQA 1UD6A 4YDMA 1QRNA 4HFUL 1FN4B 1LP9F 1ZGLM 4PV1C 3FSAA 4H5SB 5KVGH 2MEJB 1M2OA 1JPSL 2P46B 2PW1A 3F05A 1RU9H 2L7EA 1FCGA 3HVNA 4J27A 1DQDL 2CGRL 4JUSA 4OZ4A 3V4PH 4XP9H 1MRDH 1K6QL 4NUMA 2E7LC 1JDAA 3T04D 4XXWC 3SDAB 3QG6A 5AW1B 2DZEA 2P49B 2VMDA 4FZEH 4M3KB 1QRKA 5IR1A 3L3HB 3OJDA 4CKVX 1AHWB 1FNLA 3EFDL 2AJXH 2FZ3B 4XMPH 5CFHA 1JNJA 4TULL 5IUSA 3S48A 3TVMA 4XMKL 2F7QA 4UAHA 1E5YA 1QTYT 4PG2A 1Z3GL 3H3PH 2F5BH 2ROXA 4OQTH 4XBGA 1LLAA 4Q52A 3ESMA 3MRQB 2AZAA 1MWOA 1P5VA 5F9OH 1I75A 5HJGA 2F19H 4ZUWA 4PJCB 3CFKB 1YEIL 1FYTD 5C07A 3O3UN 1S7QA 1UGNA 4YHML 2Q7YB 2CIKA 3ZE0E 2GEEA 3CHRA 1IT9H 4WJKB 5GZOD 4NOFA 1L7TH 5T1LB 2UZIH 5LDUA 4ODHH 4TVPE 5KBDA 3UJJH 2ZXQA 1T5WB 1LWRA 4JX0A 3KBFA 3O8XA 3PU7A 3OHXC 5SX5H 2EKSA 1CFQA 2K9UA 4KKCC 2UY6A 3S5LA 4F7EB 1K2DB 3IDMB 5C0DB 1J1XH 1IBGL 4WI4A 4ZDHB 4F7MA 1X7QB 2W9EL 4UNTA 4GP5B 4KTEH 3UPRA 3I9IA 3PP3H 3ZKND 1QSEA 1GZHA 4UIMB 5J6HA 2R0LL 5AB2A 1HXKA 2WSPA 3HNVH 1CD0A 2EDOA 5E4AA 1XMEB 1XCQA 4V1DD 3T0BA 2Y2TA 4S0TD 4APQD 2BNQA 4G6FD 4L9LB 4R4BB 4GG6F 4AE0A 3QC5X 4U1MB 1GW0A 3HS0C 2FX8H 4FQ2H 2EVFA 3OGCA 1J5IA 3PGFL 1Y18A 3HNTH 1A9EB 3ENEA 5IKCA 4CUCA 3RGVC 3RI5F 3JWNC 3QUXC 3FTGA 4QXGH 5JMOC 3VDCA 3BVNB 5AW4B 2FDBP 5F71A 3MCLL 3MRRA 1AO7D 4PJIF 3QPQC 1TF4A 5DS8B 4GUCA 1H0DB 1GJWA 2ZXWB 2GIYA 5HYFA 3IWVA 4CDHA 3FFCB 4LT7A 3TZVB 4TQEH 1F11A 3ULVE 3NYKA 4M5ZH 3INUL 5JHDE 4Q6IA 1J0IA 1S3KH 3LQAH 4TLSA 3ELAT 2Q2LA 3ZDWA 2GYSA 5E4EB 5D2LB 5IB2A 5C0BD 3VSVA 3KLHC 2R4SL 4FL4B 1M6OB 4NLAA 4DN4L 2DWEA 5HBBA 1OTTC 4OSUL 4XAWH 5EPMB 3TN0A 1KIPB 4QRPD 4F7TA 2ZOLA 4HIHB 1PYWB 3NPZB 1R3KB 2AJSH 1EVUA 1BMZA 1KJMB 2F74B 4JHUA 1MCRA 4CKQA 5HJDA 2NY0D 3I3EA 3QIUC 1JHTB 3GNMH 2EYTB 4KRPC 5E9DA 5T1DH 4JRWA 5EZLB 3QZOA 1GS7A 5HYSB 4WDIA 4JVWA 4LKXA 3UTSD 3RFRA 5T3ZL 3II1A 3HI6H 1QLEB 3MLVH 3NPSC 1P1VA 4YNYA 3IF1B 1AKJA 1BAFH 4NJAH 4RMBA 3OKOB 4QCIB 4PTUB 4F8LA 3FBQA 5I8KL 1QP1A 3JV6B 2WUCH 1JWUA 1EH9A 3IJYB 3QCTH 4KJQC 4PWFA 4XNAA 4KY1H 2QMKA 5GGRA 3RZCA 2BP8A 2XETA 2EDDA 4NERA 4G8AC 2YGNA 1PG7W 4XVTH 1KB9J 4PGEA 1G7MB 5DJZA 3EOTH 3WIHL 2LFEA 3FK3A 5FDWB 4MB5A 4P2QA 5IMMA 3GEFA 2FIKA 3RKDC 3UAFA 4ZFFB 3US0A 5HDBF 5SWZA 5D96B 3UTTA 4ELMA 2C9QA 1MFAL 3KL5A 1SUJA 4PRAB 4JAMA 3GTNA 5IMOB 2WXJA 2EP6A 3DXAD 2O5XH 3O3EB 1A9BB 4XPAL 2F9BT 1M7DB 4OGYH 1QQDA 2E7HA 3FXIC 4ORZC 2G3NA 3T2PA 2CA3A 2PR4H 3T8VA 4ODXA 2P5WB 5L2JB 3BRFA 5BW7C 1RK0B 1ZSHA 2C7UB 3WLWD 2ZSWB 2IAMD 2B8OT 1ZV2A 1B2YA 2OSLB 2Y7QA 1KJVA 4W9IC 1CB4A 1E8ZA 1XF5A 4YDJB 5JO5A 5LG6A 2KHAA 4YPGA 3O2DL 4HGWA 2R0ZL 2CGZA 2BW5A 2Y23A 3QQ9D 4AV0A 1QX1A 3V2AR 3BKML 3WFCH 2Z8WC 3LN5A 2H2PD 2J73A 4CVXB 3L9EA 4XZ4A 1YNTA 1NZRA 5DK2A 3D69B 1A0QL 3DMMC 4WF7A 2QQNH 4Y4FC 2QPDB 4LP4A 4Z7OF 3GXPA 4UV4H 4FI7A 3KHQA 3C09C 5CN3A 3CX2A 1BD2E 1GY1A 4L2YA 4QRAA 4TV3A 1F8TH 5CEYB 3P4NB 4LCYA 2C1OA 4YQXL 3PQYB 4XWGH 4Y9FA 4ZOBA 4JKLA 3MA7A 3CIQA 1UOVA 4EQ3A 2ZJSL 1CICC 5AVUB 35C8L 1XB8A 1A6AB 4LVHC 3RGHA 2F1BA 1FSKC 2YKLH 5A6LA 4OIAA 1HHJB 3KCPA 3GMNA 2ZCZA 4G8IA 5IFAL 4NRXB 3H53A 3HB3D 4UTAH 4LAQL 2VXTL 1T22A 4OLVH 1F1AA 5TE4H 3WSQH 4GG6B 3MZTA 1ZV5A 3CDFA 1LEIA 4IU2B 1GPOH 1WT5C 2AI0L 4OM0L 4PJEF 3UTQA 3G6AB 5HHNB 5DRXB 5IHBA 4L3EB 1ZHNB 3DBXB 3G6JE 3S3PA 2CPCA 4ZMZA 1QFHA 3KNBB 4DVBB 4WHYG 2P8PA 4PJIB 3GB7B 1R5VB 3HZYB 2X70B 4EIGB 2H2SC 1JHKL 3CNKA 2VISB 3FTWA 4FQXC 3SOBL 3IU3A 1XGUA 5HHOB 3UTZB 4ILDA 3PHSA 2Z1KA 5JLZA 4FA6A 1R3LB 5CEZD 5I1JH 2VM3A 5C0NC 1DN0B 4C56E 4H1LA 2A5UA 4EN2A 5GGTL 2CJ3A 5DJ8B 4J1UB 1GJUA 3G08B 5DQDH 4TNVF 3EJJX 1NC2A 2ICWJ 4XH2A 5EBMB 3L6FB 4I77L 1M71A 5HDQH 1PZDA 1P4IH 5EOQL 1E9PA 3F8UB 3BGAA 2DQHL 1ZLWH 2A99A 3S3DB 4JHWL 4K94C 2Q8BH 2GFBB 1QVOB 4PW3A 2Z34A 3H54A 5CSZB 1HN1A 1AGBA 4JG0H 3VXQA 2F54D 1KLGA 3B2MA 3MJ6A 3RTLA 4AQZA 3B2VH 3GSXA 2Q3XA 3F5WA 4AL8L 2DQIH 3CSTA 4J39A 4TPRL 1CZ8H 2R15A 5E51A 1XBRA 2WCSA 3VXSB 1DLHB 3EO0B 1SJHA 5KVEL 4N0FB 4ZTOH 1A6PA 1RURH 3HE6C 1D5XA 1GA2A 2X7LA 4JFPB 4NC1C 5HGHB 1NCNA 2PCYA 1RUKL 1BLNA 2HT2D 2J12B 2IADB 4HKBB 3SE6A 4H8VA 4PRHA 5MENB 5TDNB 4KAQL 5J4MA 3Q6GL 5GRUL 4B3VA 1YEFH 5I1KH 3W81A 5JZ7D 5CS7A 3D85A 4G9FE 4X80H 4CC4A 2BVQB 4PH8A 5E2VL 3NCXA 4JY6B 4KKNA 1HT6A 4P3CL 4RAVB 1L5GA 4OF6A 2R1YA 1SQ2N 4HH8A 2TAAA 3RY6C 1ZAGA 2OAAA 2HX8A 4PB0L 2BW4A 4Z7WE 3ULUE 4NT6A 4J3TA 1WIPA 4N2GA 4DIXA 4JQXC 2WD0A 2W9DH 1T2JA 4XRCA 3AU1A 4RQQB 4QOKE 4CSSA 4OZGB 1H8SA 1U8CB 1MG2C 1J0HA 2PXYA 4LCIH 4H8HA 1LDPH 4JPVL 4PLJD 5HDBB 2F7RA 3M7FB 2ITCA 3FU7A 2H6UA 1G0XA 1OK8A 1OF0A 1KBWA 1QI4A 4K23L 3VG9B 2NZ1A 2BCKB 5JHLA 3K4DA 2YBRB 3IGUA 5SX5K 1F18A 2AXWA 2RCSL 1RCYA 4ZUTA 1V27A 3B8YA 3V0VB 5CJ5A 1ASPA 4F2MA 3CD4A 3R18A 3VXTB 3BEWB 3PP3K 5DHXB 4DW2H 4LLYB 3P1VA 1KC5L 4XCEA 3S36L 4M7ZC 2X9YA 2YOCA 4LHUG 5FF6A 4OT1L 3A6CH 5B3JE 3SDDC 3FYEB 3L5IA 3RVVC 1KN2L 5EUKA 5EZPA 4PLNC 1QFWM 3L2MA 1BVLB 5LBSL 1YECH 2EE9A 1EUUA 2WNGA 1YEWA 2WLJA 4FC3E 4KK6C 4YO0B 3UBXB 3ZTDC 2KT6A 3UEZA 6CGTA 4JM4L 2AJYH 1EEQA 2K45A 3SKJH 5T3XD 4ZO6A 4OBSA 4H2CA 5FGCB 3IE9A 4XI5C 2LT9A 1KIRB 2YGQA 2O30A 1ZVSB 1AGDA 1T21B 3FO2B 4FFTA 4XAKE 3EH5B 4JNXA 1UENA 1TUPA 4YDKH 1MVUA 3BVTA 15C8L 3V5DA 2YMXL 3B9KB 4KFMA 1HCZA 4WGVB 5EOTB 1ADQA 2EXSA 2H6PA 2FLRT 2XA3A 3L3DB 4N2MA 3CSBA 5MEQB 5A1AA 4H1LH 2KZKA 4HHAA 4A7VA 4BFGA 3MODH 1HSAA 4X6DF 5DD3L 5DJXA 1CLCA 3DJSA 2XTLA 5GGUB 5GS3A 3UBFA 5JNYA 1EBAA 4E42A 3FRPB 3NJFA 3N42B 1KWKA 4PRDB 1J5OL 4M1GH 2XN9A 1JPFA 4I88A 4WI3A 3MZGB 1OT2A 3U25A 1CXLA 5HVGB 4OW6A 4AGOA 3BT0A 3MV9E 4N0UE 3S97C 3VO0A 5B4MD 4D9LH 3CXHK 2WXQA 3AG3B 1OAXH 2HTLD 2VXQH 5KSVA 2CPUA 5JHDA 4CAGA 3GSUB 4DN3L 1BQUA 3EJSA 3SO5A 2CKBH 1AG0A 3QUYC 5CIPH 3D9AL 4CU7A 2P5PA 5FO9B 4LDCA 1KB5A 4IRZH 1Q1JH 4M62H 4N4YB 3MFFB 1SOXA 3QIWB 1ML0A 4P3DA 4GQPH 1G84A 5JIQA 3H0TB 1FZJB 4AEIH 1TXKA 3BW9A 3X3FL 1CG9A 1J8HD 1RZ8A 3IYLW 5BZDB 1WWBX 2DQCL 1KBGH 5E8PA 3MNDA 3MBXL 3H2PA 4QGTA 5ETUB 2FJUB 1S7SA 1KACB 5IEKA 3MV8B 4GOSA 3HFML 1AZNA 2HKFL 1F56A 3HRZA 4XNXL 2WVUA 3CU1A 3MJ7B 1UKTA 5EIIA 1FE8L 2PCFB 3QHTC 5LCVA 4F7PA 4PRIB 5KSAC 1FYTE 5L6YL 2O6DA 1CXEA 2NLJA 4L23A 3IJ9A 5DUMH 3RB7A 2H26A 1GGBH 2BWDA 3ATDA 5F89B 4NSKB 2X6UA 5F9DC 3TP4A 3VYOA 2NR6A 3BKCH 4DTGH 3TLRA 3CC1A 1RSYA 4IOFC 4OY9A 5KW9L 4MA7H 4AVJA 2A1WH 2AXJA 3GMLA 3AY4A 4A2FA 5DD1H 4ZOEA 4NO5B 4JREB 2AXGA 3TO2B 5FUCC 2X40A 4TVPH 4OKVB 2ZKWA 1FZOA 2ZOWA 5DDHB 5CP3A 5A2CA 4Z77A 4XVSH 1OARL 3SPGA 4V1DE 1O0VA 1F6LL 2J72A 5ESVB 3KGTA 4J3UA 2CJUH 3UZQB 4AQ1B 1QNZH 2DS4A 3C5SA 2JKRM 1DANT 1H6UA 2XWBB 3VE0B 2J6EA 5BVPL 5D1XD 2YRBA 2QHRL 1D7DA 3UDWC 2G5BA 3QJRB 3VH8A 5TH2B 3WEOA 2J8HA 5A2IH 5CZXC 3U4BL 5AD0B 3QJZA 2D03H 4UDUA 2UV3A 5I1AB 3VFRA 1T04B 4UM9D 5KJRH 4W70A 3P0YL 3CWGA 5CZKA 2XXGA 2X1OA 1AO7E 3MV7B 3TEXA 5HI5C 1I9IH 3UERA 1FL5A 5IK3A 3VCLB 4TTGA 4ONGH 1NCCH 1NIBA 2BVPB 4WNQA 1JNHB 2I60L 1PFOA 3PL6D 4WI8A 4QHKI 5ANME 2H3NB 4Q9RH 1KENH 3KAAA 2YMOA 5DUPL 3GFUA 3JV5A 1CLZL 5ICZB 1I7TA 2I27N 1INEH 2VMFA 4DQOH 5ECJE 5KAQF 2YD0A 2E6PA 2XIIA 3DO7B 2EE6A 5JPNB 1A2YA 5K59F 3ULVH 1JZIA 3HLKA 1F3JA 3ULSA 1A1OA 3PWUB 3QDJE 1CD9B 2BNRA 3E1F1 4QRPE 3VGEA 1YJDC 2QDVA 4F58L 3GIVB 4UAOC 3M1OA 4YE4L 1P7HL 3GS4A 4YEFA 4I5BA 1NCBL 3EYVB 5D8JH 2CUMA 2WO3B 2OJ1A 2YK1H 3MJ8A 4ANWA 3FUJA 1WHPA 4BWWA 2Y69B 1G4MA 2YOAA 3OMZA 4MMXA 4UNUA 4NQSB 2G0LA 4XB7A 1NBYA 2NW2A 1BPLB 2BO0A 1NJ9B 3UTSE 2FHFA 1DBBH 1KCSL 1FNSH 1YUHB 4PJFE 4R8WH 1AOHA 5ENWB 1MI5E 3DETC 3SQOL 3IN0A 3ZHLA 1ZTMA 3S35H 1H9DA 4AKQA 1UG9A 2AGJL 2OJZL 2B3RA 2H4EA 2WJ7A 3LDBC 3NSJA 4DKAA 4AVKA 2R29A 4R5VA 5FYKE 1YNKL 2OX5A 4NRYA 3IJ7A 5IVXE 3M07A 1G6RL 5D5MA 3ZHFA 4Y1AA 4ALAC 3OD3A 1EFQA 5E8DL 3VFPB 2KLTA 1K4CB 2A6IA 1UXWB 4QWWC 5CCHE 4DP9X 1L0XA 4ZYKA 4BEIA 4Y7MA 1V3JA 4C56A 4A2EA 3ZL1A 3DKHA 4XBEH 5BQDA 1BVOA 5B38B 4JKNA 3X3GH 2HFGH 1IQWL 2R9HD 4UINH 1AJ7L 4KUCD 2VDNB 3V0DA 4CC0A 4YDLC 4EKJA 1S6NA 2D0GA 2CCVA 1Q0YL 4XN2A 3DXAE 1I1AC 1I8LC 4GKSB 2WBKA 2DQUL 3ARDC 4XVOA 1K5WA 2KS0A 2VC2B 4I2XA 4R5XA 1NINA 1FBIL 2X4SA 3MROB 3HAEG 5C0AD 1WUNT 4NNXB 5EEUA 3TA4D 3IAPA 4UOJA 3PPEA 3QDMA 4U4BA 3KS0H 5EC1B 4IOSD 3E1ZA 4FFVD 5GSVA 2ODIA 2IPUG 4RVBA 3CFCH 4ZSOA 2XXFA 1YYLH 3KLDA 1W6LA 1BD2B 3GSNA 3OSVA 4YDNA 4YN3A 3VJ6B 4J4PD 5ILTH 2OTPA 4BZ2L 2J5WA 4JZNB 1AXTL 4BD4A 4DGYH 3K6SA 3PHAA 4M4PA 3WDHA 2R1WB 2WO4A 3EH4B 3P40A 5GISH 3HC3L 2VC2H 4W9JC 4WWKB 5GGVH 3S5ZA 2B1HL 4J12A 4Y16A 4Z7WA 3DIVA 4P4KD 2WZPA 5AAWA 2ERJC 3BCFA 5EUOA 2WXHA 3EBAA 2VZTA 4GQZA 2OL3L 5D6CA 1VCAA 1PF3A 2A4ZA 3L3IB 5GHWL 1JYNA 4NWUH 4MWFA 5C0JB 1MCJA 1JGVH 4OLXH 2QQLH 2YEZA 5CMAA 3SCMA 1TU2B 1YQVL 5JQHC 3V52H 1EFXD 3CFDA 2AQ2A 4WCYL 5DJDB 2APSA 3FT3A 5TJWK 3U36B 1P9MC 3G6JB 3T65B 3TFBA 1I8UA 1ZLSL 1IL1A 3VFOB 4TUKL 3VQ2C 2P47B 4HCFA 2MNUA 5MEPA 4MNGA 2QVIA 1IC4L 3DGGA 2WQWA 4PRPA 2ZP9A 3LMJL 4X6CB 3MRLB 1IBFA 4YDIH 3Q05A 3FZUC 4EDWL 5HYJD 2YPKB 4OCSL 3NJGA 3EDEA 1MFDL 2HXAA 3RAJL 2AQ3A 2X6AA 3CSYB 3JYCA 1SEBA 2BSEA 3GXMA 3MRBA 4HT1H 2IAAC 4EI6A 5HSFA 1JGLH 4K7PH 2DMCA 1ZT1B 1TO4A 3PDOB 5BUGA 5D71L 3WNIA 4I4WB 2PP8A 1A7BA 5J6GB 3X11B 3T2QA 3LS5H 3WOVA 1JPGB 2NY6B 3MGOB 2IFFL 5F1NB 3WFEL 2JKSA 1BIIB 5CEZE 3D4ZA 1GSMA 3BPCA 2XWTB 1L0YA 2HPOA 4YSTA 5C0FA 2R29H 2DYRB 4XMWA 3SDXE 2VDOH 5DZOA 4YS4A 4P0DA 2R2EA 2WXLA 1H3PL 4P5RA 1L0PA 4PGZA 5C8JA 4LSSH 3BUYB 5FV1L 2HPTA 1KPVA 2UZYA 5L4IA 3VRJB 2LQRA 5DVPA 5LGJB 5C08A 4X9YA 3TYGL 2F54E 3B43A 2K78A 2BM3A 2HVJB 1U93A 1G9NL 5HGDB 5DVKA 1RLWA 3K2UL 3KYMB 3ASOB 4CL7A 1OE1A 4YC2C 1GOGA 5J1AA 2QR0B 3X14B 2BCMA 1IFRA 2GITB 3HG3A 2XWXA 1KSRA 4P57B 5L4JA 4PY7A 1ZKAA 2ED6A 2WAHA 1BV8A 1KEMH 3IKCA 4JB9L 2ZQKA 4Q58C 2R2HA 3C9NB 4Y4HD 5DQJA 2N7AA 5DVNA 4PMFA 3RG1C 1XR9B 1MFMA 1TVBB 5LB1A 5JIIA 1N0LA 2ICCA 3FUMA 4JPQA 2H1LM 5FYJD 2OZ4A 3WFDH 3MR9B 4IYKA 4L48A 3ZTNL 1AFVL 2WWNA 2R0WL 3LHPL 2Z3FA 3WCYA 2DJUA 2Z8VC 4JANB 4UQ9A 4BKTC 2X10A 4E9WA 4MBRA 1TFPA 1X5HA 3QJQB 2VDMH 4U0QB 5E5UB 3OKNA 3AUWB 3QDGB 2E7CA 3LXCA 4ISVA 2EDFA 5IG7B 1IVTA 1U6AH 2DM7A 5DEGB 1PLCA 5SV3A 3TGXA 4W9LC 5J11B 5FB8A 1XH3A 1ZIAA 1SEQH 2J4WH 4HULB 5IHUL 4DVRL 3X13A 1UZ8B 2G3MA 2CO3A 2HKHL