2WTRA

Full length arrestin2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
394
structure length
356
Chain Sequence
KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSSDVAVELPFTLMHPKPKDDIVFEDFARQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BETA-ARRESTIN-1
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
total genus 58
structure length 356
sequence length 394
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrA01
3UGXA 4GEJA 4R7VA 1JSYA 2WTRB 5F0LB 1CF1A 3LHAA 1ZSHA 4ZRGA 3LH8A 4JQIA 4R7XA 5F0JB 4GEIA 4LL1A 5F0PB 2FAUA 3GD1C 4LL4A 3LH9A 3P2DA 1AYRA 1G4MA 1G4RA 2R51A 3UGUA 4GFXA 4J2QA 4P2AA 3GC3A 1SUJA 5F0MB 2WTRA
chains in the Genus database with same CATH superfamily
1SRDA 4WI0B 2X6UA 5HD8C 1GOFA 1MI5D 2M26A 2E7DA 4XP4L 1R3IL 4XWGL 2HFTA 3MLWH 3SQRA 2BVOA 1CTNA 1RLWA 2NY0D 1KTKE 4HKXB 5IBUG 4F33B 1RZJL 4JCMA 1EEYA 4KXCA 2BSRB 5BRPA 2B0SH 4PBVC 3W0WD 1P5UA 5IB4A 3STLA 3BSGA 3ZQWA 4K8RL 1CO1A 1T5XB 2J21A 3ARRA 4HT1L 2YEZA 4L4TA 4CN6A 5HVFB 3VH8B 2AQTA 1BW8A 1GW6A 1BMZA 2NCMA 3OAUL 3UC2A 2WWOA 2EIEA 2LAAA 3SO3C 5HYSA 2MH4A 1XAKA 1T3FB 1C5DB 2LT9A 4NUJA 1JF6A 3ARZA 4ZXBD 1NCNA 3VO0A 5FLUA 5A2IH 3L7FB 3M86A 4P5RA 1P2CA 1FN4B 4AV5A 3D25A 1KACB 2OMUB 1DQQA 4PP1C 1IEHA 4QRSB 2X6AA 5I1JH 3RURA 4OGXL 4QD2E 1UXMA 1MWAL 5AB1A 4GMTH 4PI2A 2HLEB 1E6JH 4JFVA 1A65A 3V0VA 1ZSDA 2VQ1A 1MHHA 1AGFB 1NBVL 3HNVL 1IM3D 1BOYA 1P4IL 5B3JF 5GQBA 1IO4C 5B38A 3EHBD 3AQDA 2A9CA 5KVEH 3KPSE 4HUXB 5HHXH 1MCHA 4KUZH 2WIMA 4XWOC 5E8EB 1XGYH 2GTWB 3OF6A 2BNRE 4MAYC 1LMIA 4TUOA 2FATH 5DLLA 3TGXA 3VUAA 1UXWA 4RBPK 1EX0A 2NSMA 4H5SA 4YHPA 2QSCL 2VDMH 5KS9B 4RAHA 1HN1A 5L4IA 3G6JF 3CG8A 3VQLA 2AEPL 2VLRE 3HI1A 2VXQL 1F90L 5HSFA 4UDUB 3F7QA 3VH8G 1JGVH 4PREB 2BM3A 3TNMB 3KHOA 1AGBB 3C5JA 1TJIL 1SHXA 1FIGH 1BVZA 4XNUL 4YDIH 2E7LA 1V3MA 5T5FL 3KD4A 3ES6B 3NJKA 5MHSE 3WTUA 3LH2L 1RHFA 1OCRB 3GINA 4NT6B 5IMKA 4UT6A 5SV4A 2VRAA 5EEYA 1B4TA 1HNFA 1J1PL 2UY6A 2YMXH 4BFGA 2K9FB 1OTUC 1DN0A 3WS6C 2UWEB 2FD6L 3I85A 2J88L 4Z95H 1RZQA 5E5UB 3LQZA 4Q9QL 1TQCB 2DH3A 3MOBL 4KK5D 1IAKA 4PJCE 1KB5B 3JWNG 4WTXA 5J11C 3SDYH 3L4YA 2YD6A 3T6WA 3II2A 5HHOD 1KT2B 3IPBA 1Z0NA 4OJCA 1A1MB 1B0IA 4GP5B 4NNYA 2X70A 5KSUA 2BINA 5F21B 2BVQB 1QBLH 2QVKA 3K6DA 2IDSA 4PHZA 2YRLA 4FTVA 4HJ1A 2BDNL 1A8ZA 4MNQE 4KFZC 3DUHA 3D39B 4TPRH 4WI4A 1DQDL 3SDXB 1LE9B 4CN1A 4HWBL 1EHLH 2G30A 5BUAA 3ZDXB 1V5JA 4QRUB 2OMXA 4IKKA 2EACA 3MV9A 1LO4H 4PJDB 3NFPB 4P2CG 5D5MF 4PLJC 3P2BA 4DN4H 3IB4A 1AQDB 1MCWW 1J86A 1HTYA 2WTRA 3FZUC 32C2A 2B7DT 1YPZB 3T2PA 4RZCA 3WCYA 5KSBB 4NM8H 1E27B 3BH4A 1DQLH 4Y4HC 2VISA 1BCIA 3HC0B 5KSAD 1KGJA 1L5GA 2GAZB 2H5UA 5CCGE 2I9TA 3EBIA 4C55A 4M7LT 2D03L 5BCAA 1XAUA 4HUMB 4JGJA 4XI5C 2PO6D 4P5TB 3L8QA 4KFMA 3BDYL 1OP5K 3UTZB 4G43A 4XAKE 1DBKH 5D1ZA 4AM0A 1F11A 1MCDA 2QDVA 4N9OB 5E6IB 4NLHA 1U2YA 5T3ZH 3SGEH 2Q7YB 3S0PA 3MI6A 4M6OL 3N5AA 3IJSB 5FDWA 4PG2A 4Z7NF 1LQSR 2H6OA 4K8RC 3VB8A 2ED6A 1A7OL 3CFJB 4OY9A 5DVPA 3V5KB 1R3HB 3CC1A 5IVXE 3H9SB 5TDOA 3H42L 3K2MC 2LFEA 3EDJA 2V6HA 1FZOB 3MNZB 3VM5A 5F7HA 1X6NA 3CSYA 1YYMH 1LO3L 1BG1A 3TCLB 1FE8L 1TJGL 2BVPA 8FABA 1FNSH 3HLAA 4GMSL 5FUOL 1RK0A 1XZ0A 2CBMA 3R1GL 5JUEH 5FKPA 1GW0A 2PWFA 5E5LA 5HGBB 4DH2A 3SN6N 3DDFA 3U48A 4KO5A 2VR6A 2YAHA 2GT9A 3D1MC 3UROR 4J39A 3JTSA 3L48A 4JKMA 5DWPA 5DRNA 3QWOA 4OKVA 5DRXA 3B2MA 4OLUH 4FXGB 4FG6D 2CGYA 3AABA 3AUVA 4PJAF 5LXVA 3GSVA 4WV1A 2VUOA 3ZR6A 2IPTL 4ZFZB 1AXTL 2AZUA 4KTDL 3F6IA 1LK2B 1SFHA 5ADOH 1BECA 1N64H 3FFDB 2H8PB 1Y0LB 2FSDA 2ZCZA 2E75C 1LGVA 1A47A 3FRPA 2Y7SA 3WDJA 2YPKA 4UYQA 4JQIH 4XVTH 1EBPA 4PWKA 4HIEB 1TEGA 5ICYA 1O7DE 5B4MD 1RZ7L 1XEDA 1YZZA 1XGUA 1ZANH 4UT9A 4K73A 1Q94A 2R4SL 4KU1A 4U2YA 3EXLA 4QRPB 1AH1A 3U79A 2OKMA 4C56A 1UOLA 4WGVB 3B3BA 3QDMA 4DKDC 1PIFA 4OZHA 5FYKU 4GAFB 4J8QA 3P11L 1AKJB 5LHDA 2XA8H 1CGWA 4LDCA 4WI7A 1NMAL 1IKFL 2DQTH 1OCZB 5IREA 3QUHA 5LCVA 2DBLL 3GGWB 4FKHA 3SGEI 2HH0H 4QRRB 2ZAHA 4B9GA 3ENEA 5AB0A 4YL9A 3VWKC 4JG5A 5AYTA 2HTKD 4CVZB 1BD2D 1VENA 2E27L 4QIRA 4OCNC 3SCMD 2GY5A 3UYRL 4KKNA 4G1EB 1KLFA 3DUUB 1G7MB 4K5MA 4L3CB 4K2UL 5FEBA 3FN3A 1C9SA 4RQQB 3GTTA 3LRHA 5IQOA 4R8WL 3IMRA 3TO2A 3DO7B 4LHUD 5L4JA 3PWLB 2G3ZA 1L3NA 3QQDA 4HT1H 1SM3H 5DK2A 3LKRB 1N5YL 1PVHA 1NEZA 4KXZI 4RAVB 4UDTB 4ZSOA 1I7UA 3PABB 3GSWB 2PR9A 1P1ZA 2V17L 3O9WD 2HG5B 4P5SA 2C34A 3PHSA 4LEBA 3UEQA 4AYGA 1U8QB 3D85D 3NA9L 4FXKB 4ZTEA 3LXAA 3L3OA 15C8H 4L4VE 1DLFH 1IBYA 2QL1A 3DX9A 3WN5A 1IKNA 2VAJA 4LOEA 3H3BC 4PD4J 4XVSH 1CN4A 4JY6B 1MH5B 1F58L 3F3HA 2CRMA 3HS0C 2GBAA 1P84J 4K5PA 3WFDH 3RI5K 4OUUA 3MODH 3QEQA 2CLZB 2HAZA 1MG3C 1VA9A 1AS7A 4LEOA 2Z7WA 1K72A 2P5WB 1LEIB 1BYNA 1TSHA 1CXKA 5F6IC 1FFRA 3SPIA 1EDHA 2Y5TB 3PV7A 4Y19A 1V54B 2WN2A 1I7ZB 4NPKA 1XMWA 4RGOH 4P23C 4XPTL 4MRBA 1KBKA 1SEBA 1KCUL 3B9KC 5LBSA 3UTQA 5E94B 1NCWH 2FSEB 4XXCA 3QG6A 1JWMB 4ANUA 4DERA 1F90H 4GSDL 3E80A 2VH5L 4BCZA 1J0IA 4ZYKA 4X9IA 1NICA 1S7XA 1DSWA 2XNAA 4TNFA 1YA5A 5AD0A 2WZ6A 4N4YB 4W81A 4R7DB 2GABA 4R90L 2V2XA 3V6ZB 1DQTA 2MCG1 3TLRA 1MFEH 4LCWD 5DU7A 1LMKA 1TZIA 5C09E 3MBEA 3ECVA 4XNDA 4HUUB 2VQ4A 4WTZA 5CD3B 2Z31B 2HWZH 4D9RE 1DVFA 1SLUA 2E46A 3A22A 4U3CA 4EI5B 3AB0C 1TZ8A 3HRZB 4ZUTA 5FHBL 5DRZB 3ZN6A 2O72A 2IANB 2J88H 2WLLB 4UQIM 5BVPL 1K2DB 4M1CD 3MOBH 5LN8A 5B8CB 4NCDA 2UV3A 4PB0L 3WXWL 5EOTA 4LLYA 4HUVA 1J8KA 1UZ8A 1SOSA 4M1GH 4WK4B 1PD6A 3MRPA 1TZAA 4WNQA 3MUJA 2RH0A 4IJ3C 3L3HB 3V7AG 2NW2A 5ANMB 1FZJA 3LN5B 3W5MA 2YO3A 4U3XA 3EOAB 4ACTA 1OPGH 3D69A 4IYKA 3EBAA 4OTXH 3KDMB 3T08A 5TDPA 3B8SA 4HWBH 4XP5H 1S9KC 4N3UA 1HCYA 2W88A 1FZKA 4XRCB 2W0FB 1AP2A 1AS8A 4AGPA 3MR9A 1NDTA 1TZHA 3VFVA 1H5BA 1HWGB 2XQBL 3VFOA 4U6VL 2DJUA 1ZGLA 3VSTA 3S36X 3MCYA 4HP5A 3WUZA 5C0RL 4GB9A 2P3YA 4I4WA 2YHGA 4KPHL 1MXGA 3SYQA 3V5DA 2RGSA 2CRZA 4Z7QE 2PPCA 4FEMA 3LS5L 1OZUA 3OC5A 2V7HB 4XNQA 4HXBL 2OXHA 3VFSA 4HSCX 4LCUA 1U95B 1RK1B 1HU8A 2LLNA 2CDEB 9CGTA 2D03H 2IVFC 4NQED 3VRIA 3OWEA 3TASA 4KDTA 1WFJA 4N0UB 3ISWA 5EBLA 5E8NB 3RVWC 4XO3A 4QF1B 4AYBA 3CFUA 4Y2LA 5JXEC 3TZVD 3GXFA 1JL8A 2MRYA 1ACCA 4LBEB 4JO3L 4IBYA 2XPGA 4K7FB 4WIQA 5DK3A 3ZZSA 5AKTA 1OAKL 5H37G 5KG9A 2R1WB 1T20A 4CC0A 3BWAA 4AQOA 3X1GA 2A6KB 4AJWA 2ROYA 4GRWF 3MJ9A 3CDFA 4U7SA 4GG6F 4FQXB 1SQ2N 4HS8H 4N0RA 5EO0A 4JGNA 1WCBA 1BOGB 3BLBA 5CEZL 5FA3A 4XMWA 5CP3A 3COOA 3ARFB 3H42H 2QQLL 1CGTA 1Z5HA 1QSEA 3RTQC 1C8PA 3ECBA 4OZ4A 1LO3H 1MCLA 2EE2A 3OPUA 2H4EA 3CHOA 1FE8H 2DQUL 3WFEL 4HGWB 5CINL 1BBJB 4GMSH 1T7WA 1UD2A 5FUOH 4LGSB 3ARVA 1T2XA 1L9PA 3R1GH 1J0YA 1EMTL 4DN3H 4PLKC 5D4HA 5EUOF 1PEZA 4ZFOL 4MJ4A 1L4IA 3E1ZA 3KGUA 4F20A 1BVOA 5C0BA 1CD9B 4OLXL 1G9MH 4YPJA 3ZJAA 1SDAB 3EO1B 3P69A 4TS6A 3GSNA 3Q2LA 3IK2A 4OIAA 3TN0D 5E8PA 3HN5A 3H7BB 5IB5B 1DSFL 1ZLUH 3FQWA 3VI3E 2R0WH 4LL1A 3GI8H 4J8RA 3DUSB 2WXJA 1QI5A 5DQJA 3VJ6B 4UQBA 3TONA 3MKGA 3JWDL 3TO4C 2CBTA 2N56A 2X5PA 4ZFFA 3LIZL 4E9YA 4G6MH 4YDKH 5HJ3A 3UZVA 1U3HA 3LRLA 4A7GF 3IMTA 5CR8A 3RWFB 2R0LH 2YZ8A 5AW6B 3BPOB 1DBBH 5FOJA 5DJ2B 5IVZB 2TRHA 4LCYB 3W38A 1GYCA 4FXTA 5DURB 2ED7A 2EYTB 2XN1A 3HMXA 2NSXA 4PJ7E 4AZ8A 4KNQA 1G5GA 4PGEB 2HKFL 1L0QA 2XFGB 1JPFB 1EUTA 4R5VA 2CO1A 1MAMH 5TE7L 2PTUA 3BHBB 4QHMA 2IH9A 4GXFA 5I2IB 3ARPA 3GBLA 1RULL 4RFOH 5EDSA 3P11H 2FYYB 2CM5A 3PFQA 2RQ8A 1IM9D 4UTBH 1IKFH 3R06A 5IJBC 4RGMC 1NIDA 5AVUB 2HVJA 3MXWL 3U4BL 1DJSA 4F7MB 3TBVA 1BZQK 2F6AA 3PWNB 4E41A 5HYQB 1NA8A 1I9IL 1BFVL 2B1AL 4LVOC 1FI8C 1BVNT 2GFBA 1R5IA 5CHNA 4LSVH 4OLEA 4K2UH 3I6GB 4X6FB 3U9UA 2ZKHL 5F3HA 4XN9A 1ZVNA 1JP5A 3H9HA 3KBPA 1XL6A 5CCJA 3A3YB 1GGIL 4HLZH 1CBJA 5D1XB 3DRTA 3N1QC 2AQRA 3P4MB 4F8PA 5I1CL 3VG0L 2SEBA 1JVLA 2VLMD 1MDTA 2QLYA 3AT0A 2XC8A 4HH9B 4FABL 5ACLA 5ICZB 4APQB 5F7KC 4YXLH 1N5YH 1IC0A 5HPOA 4BQCA 3PPEA 5D1QD 2XN9D 1N3NB 2NYKA 1INQB 4BKTC 2NR6D 5MERA 2ODIA 2P48B 3ESNA 3UDWC 2QKSA 4PCTA 4ISVB 5D2LA 1A21A 1Q9LB 4TNWF 4RIRB 1HOCB 1S5IH 1SY6A 1IE5A 3UPAA 1B0WA 3UADA 2BFGA 1BXUA 3GIZL 1O9ZA 1PG7L 2P7TA 3IF1B 3NQKA 4G9FA 4UQEA 3IDYC 4JFFA 5DJCA 1RJZA 2W9EL 2NX5D 5HI4D 2Y1VA 1JOIA 1TETL 3CFTA 2ESVA 2GKIA 1HJCA 3E2HB 2WO3B 4L37B 1U3ZA 4MMZB 4OCRH 1UA7A 5C0CA 4Z6AT 2HKAA 2YOCA 2QT6A 4P57A 5D7IF 4LDEB 5A43C 1ZTXL 2I25N 1FNEB 4YSRA 4GRLA 1A0QH 4YIQB 2NUPB 3TFKC 4GAYB 4XPTH 3K6SB 1ZAGA 1MF2L 4HJ0C 3HZKA 4K71C 2BOBA 4AQ1A 3LD8C 1NEPA 4GSDH 2BMKB 3CV5A 4MHHI 4GPVA 3S4SB 5DHVB 3KPQA 2X6VA 5JQIB 1FYTE 5GGVY 3GIVB 3RWHB 1Z9SB 2G60L 1E9OB 1QYGL 3ARBA 4G8IB 4Y4HB 2EUXA 4Y4KA 1BVLA 1T1ZB 2NY4D 2X1OA 1ORQA 5E8DL 4Q89A 3W9EB 3MUGB 3TYGH 2IAMD 3HW7A 3T6XA 4UI2A 4M7ZB 1C8QA 2C4FU 3MZTA 3KCPB 1A14H 4D7PA 1WLHA 1NFDB 4HEMA 4PCKA 3B5HA 1LNUA 2EKSB 5AW4B 1Y6NR 4JKWA 2JI2A 5CS7A 5ECJE 3TYFB 4WF7A 4M7KL 5AENA 3WHXA 4HK0B 1GH7A 2CHZA 4G42A 2FZ3B 2IMMA 1A7RH 5F6HJ 4ZO8A 1WAAF 3SKOB 3BGMB 1W91A 4HGMA 5AW7B 3HHSA 3MV7A 4EZLA 3FHAA 4AV0A 3JWDC 2YK1H 5BW7C 1I1AB 3FB7A 4WI8A 2K8MA 2VRQA 4R2GC 2XU9A 4XVOA 4A7VA 1D7BA 1UHVA 4P9HL 2AJSL 2OPCA 4RX4A 4TVUA 2C9UA 3O45B 4G6FD 4PWJA 2ZUXA 4GXUM 1XQ4A 2HX9A 2JB5L 4OD2A 5ESAB 1CFBA 4HZAA 1H0DB 4JRXD 3LV3B 2FJGA 2DMBA 2BVYA 2LU4A 3HC3H 3C5ZC 4HD9A 3QR2A 4U6VH 2YD2A 3PQYA 2OI9B 4P2QE 4P5MA 3VD4A 1NMCC 4AQAB 4PU2A 2YSSA 4JPIB 4AE1A 4MDJA 3SJVE 5K9KB 4Y2DA 1PGRB 3LS5H 4I3RH 3IKCA 4HXBH 1H3PL 4BSVB 1WA2X 4OIBA 2G2RA 2QJDA 5IBLD 1QTPA 2ITEA 5LQBH 4HIPA 12E8L 4ZMVA 3LNFA 2UZPA 4RSVA 1I9EA 2ZJSL 5E2VH 1RZ8A 3BW9A 4JFDA 5FK9B 2W60A 4YLCA 1H3VA 4HX1B 4UQCA 5L9DL 1QRKA 1SYVB 2VM3A 4QMEA 2ZCKL 3S8GB 1CL7L 3S35L 4P9ML 4XVUD 3VSVA 5AZEL 4G8EA 1EV2E 3KPSB 2DN7A 3FB8B 2BNRB 3AXLA 5INCA 3ZE2B 4EIUA 3CU7A 1KCVH 1OAKH 1R3LA 4XMLL 4AZUA 3UO8B 2JJTC 4JG1L 4IKJA 2Y1ZA 5HPMB 4LPUA 4JG0L 5MENA 4PY7B 3BPLB 5I8EA 4PS7A 5I1DB 2BIOA 3H6AA 3SE3C 1S7QA 4L8BB 5EZOL 2XT1B 2VLRB 3WSQL 5CEZH 5I0VA 1G7JB 4RNRA 3AGVA 5I74B 1MCCA 2AV1B 1MFVA 3BGFB 1NCHA 2ITDB 2JLLA 1YY8A 2AMUA 2YEVB 4KXBA 2JJVA 2HXAA 1GCYA 4XMZA 1QHPA 1LO5B 3MACL 4G71B 4G6AD 5SWZD 4GSRA 5JXAL 3KPOA 3G9AB 1NDGB 1NGYB 2BSED 3UBXA 4ZW7A 5HGGS 2JIXD 2OV0A 3OAZH 3VGDA 3GC3A 3JWNC 4PJCB 3IFOA 4LSPL 3NUKA 3C08L 3TEUA 3NABH 3DVIA 2DEYX 1TCRA 5F96H 3WNOA 3HNSL 3T2OA 5T3ZD 4JFED 3BSZA 3NIGE 3N42F 4NKDA 2VDQL 2ADFL 1KXQA 3BI9X 3JWDH 4MAYD 3SE4C 4IBQA 2YMOA 1TJXA 2RIKA 3F7YA 5DJXA 3F84A 3ABLB 3QUZB 4KY1H 2AJZA 4WUUD 2C3VA 5E7FA 1AYRA 3VCLA 2DJ4A 3EH3B 2HLFD 3DX8B 2IEPA 3PGFL 5BNXD 5DD5L 3RWJA 1Q9OB 1VACB 5T3XE 2V9QA 1AANA 3SIKA 4MXVE 2G0LA 1BMWA 4NQDA 4ZPVB 3QH3A 3SDXF 4DPCX 1GMEA 1JFQL 1PFOA 3MTXA 2C3WA 5TE7H 3IMUA 3ATBA 4TNWK 2ZF8A 3ZDXF 4X8JA 5M94B 2AK4D 4GKZA 4TSCH 1IL1A 1AG6A 5E9DE 5EZIH 4Y1AD 4JO4L 4NUPA 1XR8B 3EFOB 3CLFH 3U7WL 4N8CL 1YPZF 1X9LA 5EH1A 1FL6B 2F7RA 2V9RA 1NAMA 5T1KA 2FJFA 3MXWH 1PY0A 1V3JA 3AAZA 3DPBB 1WZKA 1XH2A 2PYEA 3B3IB 3U6RB 1RZGB 1N6QL 1MCOL 3AVEA 4LGRB 4TUKL 5F88A 2B1AH 1GIGL 2CJUL 2XWJB 3WAJA 3HI5H 4IIZA 3BO8B 4GKNA 4HJJL 4V2BA 4NS0A 4A2MA 2OCCB 2X4SA 4N6QA 2ZKHH 2ZNWA 3MV8D 2H32B 4GYBA 4P9HC 1B4JL 1J5CA 5IJVA 5ICXB 3TXAA 1J5IA 1G7LA 2VWEE 3B9AA 2ED9A 3NJMA 5AWNL 4HJUA 1QFPA 5FB8A 1GY2A 5E4AA 4Y5VC 3ZBMA 3NTCL 3JTTA 4Y2OB 4NKQB 3NG5A 4N3TA 4JQVA 5DRWB 3FZUD 2XPZA 2ADGA 1KTDB 2VR7A 3AB0B 1FORH 5DA4A 3HUJA 4BKLA 5B7FA 4OM1L 2OMWB 1ZKAA 5EU3B 1QLEB 4PRHD 2UZIL 1KBBA 1PG7H 4GW1B 4DTGH 2EZ0D 3T1WA 3CZKA 3DHMA 1Q9WA 4U2ZA 5BPPA 4AVHA 1DVZA 3QJOA 4PB9H 2HZHA 2CHWA 3DOIA 5IMMA 1JHKL 1VDGA 3C6EA 3JWNH 4F57H 4JLRB 1CGSH 3KLAA 4HMDA 2IADA 2OYLA 5I24A 2DQGL 3FU3A 1F86A 1Z7JA 3HVNA 2F2HA 1NFKA 3QNYB 1XHHA 3WJJA 3WTXA 3DJ9A 1BPVA 3TPUA 1J88A 4TF4A 3UIZA 4GI9A 4ZUVA 2ENPA 5E2TL 3HZVA 2QQKL 4XNZC 3ZVVA 4OGAC 2YR3A 1JNHA 5BOPA 3UTTE 1FL3A 3VXRB 3FB6A 3KE0A 2XYBA 1E9QA 3IN0A 4XVUC 1MRDH 4R26L 4IRJD 4HFUL 3P4OA 4FFYH 3HRPA 1XL4A 4F9LC 3F12B 4MLSA 4Z7UB 4JZOA 5DCCA 2UZXB 4U7KA 1A6ZA 3SE6A 1QYGH 5KVFH 4Z18A 5E8DH 2YARA 4QXGL 2P46B 1QFWH 4UAOB 2DD8H 1I53A 2R0KL 5I1GH 3SDDA 4O2EB 3BJ91 1EEZA 1I8IA 2CNZA 1TZGL 3RVXD 1WBXA 2AKRB 4NM4H 1F3DH 4PJ5D 1CD8A 2E74C 3BEWB 2YQ3A 5E4EC 4IBSA 4N6RB 5B39B 2WVTA 4JQXC 4JFYB 3MVSA 3FN9A 3FFOA 4PJ6A 1LDSA 2OJZL 4AKPA 2FJHA 1LE5A 3HOGA 5KBNC 3WEOA 1LO0H 4MNHA 4RRPA 2HJLB 3TJPA 1IEAB 3HG1A 1EGJA 2CKBB 2IAAC 1W72A 4PRID 1OP3K 3FS9A 1YNKH 5C08D 3W39A 3ARXA 1KJ2B 4ZTOL 3E1F1 1MCSA 4KRPC 4P9HH 1G7PA 3N1FC 4WEBL 3O11A 5I0WA 4D0CB 1NFIA 1UOKA 3HKZA 4X99B 1FFNA 4X8GA 5F0JB 2JB5H 1CLYH 5F9JA 3AY4C 1BVNP 3AS0A 3EFDL 4JR9L 4XZ4A 5DD1H 3VX0A 4Q9RL 3LKPB 3QARA 4HWNA 5EO1A 3RAJL 4F2ME 3VW3H 4M8RA 3NBNA 5GS1C 1FVEA 4PTUA 2EIDA 2X9ZA 1ZMYA 4NIYE 3CDYA 4FQ2L 2AQPA 4CKVX 4DVBA 1M3JA 3QHFL 2BZCA 5HXMA 2ZE0A 1ADWA 5DGQA 3DTXB 4L4VB 5EUKA 4PR5B 4NXSA 4P4KC 1SDDA 4B7IA 2ZTBA 3CFMA 4IMKA 3VXSD 3KPTA 3FCTA 2FO4A 5CU5A 3SGKC 1KB9K 3WDHA 3QPKA 3HBQA 4WJ5B 2Q76A 3HPLA 3U4EA 2YAQA 4UQAA 4YHIB 4HDIB 4AEFA 1F18A 2W07A 1ZV2A 2ZJSH 3LN4B 4IGBC 4LASL 4A7TA 1M1XB 4K9EH 3UMTA 3THMH 5ANHA 5HDBB 3FOLB 2ZCKH 3UL4A 2OSLA 3S35H 3D0VB 2PXYD 3EYQC 3TO4B 4YHLL 1JPSL 3H55A 1NLDL 4LRNL 4WQOA 3KYOA 4QOKE 1VGEH 4J3OC 1D5MB 2ICWJ 4XMLH 4JX0A 4NSKB 1PLGH 2YXFA 4RMQA 1QZNA 1QSZA 4GG6A 1DLHA 3QA3B 1U8HB 4WHCA 4LLWA 5JHDE 3WSQH 3GFUA 3T0EA 2VDPH 5DDHB 1LL1A 2VO8A 2BP0A 3RP1A 4ZG1A 4HF5H 2FX7L 2OMZA 4PRAB 2QVMA 1NCUA 2HLAA 2XACC 5EB9A 5LB1A 4NO5B 1JXJA 4X5WA 3BN9C 5C0EA 1NIAA 4ZXBA 1JNJA 1A6UL 1JPGA 3IU3B 5KBDA 4IDLA 4CMHC 3C60B 1ZV5A 3KL5A 3B9EA 3IJHB 2Y7QA 2Y23A 4OM0L 3TVMA 5CN1A 2B39A 2AJXH 1TLMA 5EC1A 3W2DL 3MRCA 3M7FB 4EN3C 3LNIA 4DF9A 1HEZB 5L2KE 4N87A 1O6TA 3C6LB 3A6BL 1HH9A 1YUHA 4LDLB 1IBGH 5LN4A 1ZVSA 3C08H 4FYSA 2WWNA 2X3AA 3HNSH 1KELL 4PGDB 5D7SL 2ADFH 2VMJA 2PCXA 6TAAA 3FT2A 3IGAA 3JSSA 4KNSA 3EW3B 4OBRA 4CNIA 1NGWA 4DQAA 1NGPL 3FU7A 1J11A 1LO2L 1ZHKB 2HT2D 3B9KD 2Y22A 2B5IB 3ZKXB 4OB5H 3PGFH 4OFIA 1Q0EA 1QLFB 4UQ3B 3SQOL 3WMPA 1QATA 2F53E 3DMMB 1YLBB 1H3WM 2YUVA 4LEXL 1JFQH 3FTYA 3NIDE 4IOIA 2QPSA 4Z7QB 4XN8A 3S98A 4I18A 1JN6B 3O4OC 4N2CA 2D3JA 2EE6A 4LKXB 1QFWM 3L45A 5AG9A 2AQ1A 1P7HL 4LCIL 2A7BA 3WNIA 2WXIA 3IJ7A 2A9ML 3H8NA 3KEDA 2WSKA 4NGHL 4GUPA 4ZMLA 5MEOA 4N8CH 4KWUA 4JRYE 4BKSC 4UUJB 3QXAB 5SX5H 2WWMC 1IX2A 3Q0HA 3VWJB 3FK3A 3WUWB 2F1AA 2K9UA 4HS3A 4BZ2H 1IARB 2APSA 3VVWA 2NTFA 3FHQA 2YSTA 2DZEA 1VFAA 1U30A 4LRIA 4WGWB 4N9GA 4FNLH 3SBWC 4Y4FB 3RVVD 3JWOH 3C09C 3DROB 1B4JH 1DFBH 3DJTA 4EZKA 3QIBC 3CZJA 2AXGA 3K0YA 4E0RB 5FGCE 5H8DA 2UYLA 3IDJA 3WXVH 1MLBB 4DSYA 1T1XB 4MMXB 1ZHBB 3GT6A 4HBCH 5AVWB 2B9AA 3BP6A 3NOIA 4WFHE 2ZWYA 3K72A 1WIUA 4TSBL 4KZCA 3GSQB 3PJNA 3CFNA 2PWDA 1E2ZA 3U0PA 1U8CA 1DUZB 4NO3A 4H1LA 5CJXC 4F3FA 6CGTA 4RMRA 5DZAA 4EI6B 4DOHE 4G5AA 4R4BA 1X5JA 4LQFH 1JRHH 2X9XA 4DZBB 3ZMRA 5DHYB 2UZIH 4DAGL 1TU2B 2ZWLT 4N2MA 2DQJH 1I3UA 4DVRL 3NIFE 3VFRA 3EKCA 3WKML 2BSDA 2NY5L 2OMNA 2OW6A 4HV8B 2PO6A 3BH9A 4HMEA 4EDWL 3X1FA 4PGBB 2ARWA 1EO5A 2GUYA 3PDDA 4YR6B 5C0AA 2AV7A 1FNGB 4RGNE 4K23L 4ZI8A 4B97A 3BQUA 4JKKA 3VI3B 5JYLA 5JXED 4PY8J 2DQGH 2L4OA 3C2SA 4V1DD 2BZ7A 5D7IA 5DZOA 1V7ML 1RFDH 2Q7AA 3U1SH 4O02L 3MO1A 4O9HH 3S88L 3BFOA 5LG6A 3DETD 2HSIA 2ZKWA 43CAA 2DWYA 2R29L 2Q3ZA 4P46C 3RA7L 3IMBA 1G6RA 4WY7L 4YZFF 2WIIB 3I75A 4BFBD 3TF4A 3PL6A 1OAZH 4QHPA 1JK8A 1U6AL 5GRUL 2NY7H 2QQKH 4QYAA 4JDVB 1TR7A 1G0XA 3GXMA 4H88L 2W9DL 4KDVA 3PHQB 3CN0A 4UF7C 4XC3H 2YFOA 4PJ7B 1FPTH 2WYTA 1E6OH 1TTBA 1OHZA 3IEAA 4HFUH 3CN4A 3F58L 4M7JL 5F44A 3UAJC 3M17A 1YSOA 4HISA 4JDEB 3RTQD 1H9VA 1EHNA 4AMXA 1HC1A 3CZUB 3OKKB 4HIIA 3LVEA 4QHNB 1CDUA 3OHXC 4L4TE 2QTVA 3KYNA 1KJVB 5BQDA 2EEAA 1EDYA 3NCMA 3MCKB 3A21A 2OSWA 3U83A 2BHZA 5J7CC 2H26B 1WICA 2Q2LA 3KHQA 5JOPD 5M95B 4YC2C 4YSTA 3RL1B 5ACZA 3CCHB 5I1EL 1WAAA 4JM2B 1FGNH 1JVKA 2GIXA 4Y16B 4QRBA 3RY5A 2WWKT 1NLBH 4ORZC 1SXAA 5F7AA 4HZLA 4TQPA 2A1WL 5H37H 3TA3C 2VOTA 1OGAD 1QD0A 2NTSP 5ECGA 4GAAA 1FA4A 1T6VN 3D8MA 2W0KA 3BKML 4HKXA 3PJSB 4F33A 4WRLA 4LE8A 3UZQB 3B5GA 5F7NC 3AS3A 2VZVA 4FQHB 5BV7B 1UM5L 2AJ3B 3OAYK 4L3FA 3RAJH 5IK3B 2WVUA 3T4YB 5CD5D 4J3UA 2CO7B 3X13B 2XXGA 3IFNL 1JRHI 1UWXK 5FYKE 4ALAH 3US1A 2X1PA 1U8IB 2NXZD 3QAZC 3HE7D 4KKPA 3FF7A 1C5BL 3K71B 2XTSA 4F8NA 1N0LB 1ZXQA 1NGZB 5D70L 4HOXA 2AQQA 4TNEA 4UOZA 4L2YA 1C5CL 1URIA 3PNWA 4JHAL 3HI6H 1VEPA 4WNSA 1FN4A 3TBSB 1DBAL 1I1FB 5GISL 4JO5A 5LAXA 3VGAB 4GUQA 2J44A 5I76B 2CGRL 2L8AA 2QDWA 3DOSB 5KUKA 1JPSH 1HE7A 1BD2A 5ABZA 1NLDH 4LRNH 5EF3A 1X5MA 1UCBH 5LAPA 1YHPA 3BIBX 3GXUB 4MA8L 4ODHL 5D93C 3H7LA 3N0AA 1SJEA 5C07D 2ICEC 4FQQA 4PVLA 1EZUA 1MVFA 2GTWA 3RNKB 3WFZA 4TVPE 4IJTA 4NUGH 4LHUA 1A9EB 3IDNA 3S8WA 2IDQA 3WOVA 2D7PA 4MWFB 4GNKB 4YXKL 3B2VL 2P24A 5CF3A 5K1NA 2ZYIA 1QHQA 5IROC 2EYRB 1FYTB 2FX7H 4FTVE 2VR9A 3D33A 4P3CL 4UDUA 1WBZA 3JQOB 1KCBA 1BQRA 4PREA 1OOWA 4WO4D 3OMZA 1N70A 3D85A 5E23A 4HCRA 2Y7NA 2GSGB 4X98A 1UYWL 2E47A 2NNRA 3QUXA 4OCYL 4RSYA 1QG3A 4X9YA 4ZW5A 3MV9E 4ZAKB 3LPPA 4K7PX 2GY7B 1EXHA 1Z5YD 2NY5C 4R5TA 5CIPH 4U1JB 2YWZA 3W2DH 4AV4A 2I32A 4PP2B 2IWFA 3PHAA 3FYIB 4XNYL 3QUYA 2B14A 2OR7A 3DTUB 3K5SA 3F04A 3BE1L 3VG9C 1KB5A 1F1AA 3BP4B 1RIHH 3DHJA 2YUZA 4S1SL 5INDA 1E43A 3GMMA 1DL7L 5IZ7A 1KT2A 1D5BA 4J2QA 4NC1E 1A1MA 1NGPH 3TFKD 2VSDA 4N0FB 4WFFE 2ZWSA 2BVQA 4HJ0D 5CEZD 1F97A 2FIKA 3EYFA 3MLUH 4UZSA 4ZTPL 4F9PA 1JYNA 5E5RB 2AMGA 3EFFB 3WYRA 2DYPD 1CFSB 2PCFB 1PAZA 2ZXQA 5GZOA 4PHXA 4QRQB 2YGNA 3BUBA 3ESMA 4P2QB 2VMFA 4QRUA 3HB3B 2XQ0A 3KL3A 3SJVB 1SOQA 2WBJB 3BPNB 3NFPA 3SY0A 2BY2A 3MLZH 1JZ2A 4UNTA 1ADQA 1AGDB 1CYWA 5D72H 1MFBH 2I7SA 3BPCB 4I2XA 3FU8A 1FVCA 1YPZA 2BVUA 4NGHH 2A9MH 5J89A 2QV4A 1NL0L 1NPJA 4GINA 3AFLA 1Q72H 4ZMTA 3ULVE 5E8OB 5EMYA 5FM4A 3VXPA 5J3HC 1QWHA 3DVGA 3NFSL 1JDDA 2V2TB 4YDZA 2X2YA 4M3KB 1MJ8H 1OT1A 4G11A 4AJ0A 2VLLB 1T03L 2GVYA 4OJYA 2AANA 2DLIA 5AZ2L 3HFFA 3D2UD 4XNZB 2Q1EA 4I9WE 4R2GD 3LPWA 3SDAB 4UTAL 1HX0A 2Q7YA 1JGEB 2J4WH 5J1AA 4HCIA 4TNGA 2APVA 3WKQA 4JVWA 3IJSA 5FUCC 3ZE2F 2BP3A 4GI6A 1TKWB 4QO1B 4Z3EA 4GXVH 4PEEA 5IY5B 4TNVF 1ZE3H 4W9IC 1XIWA 4K94L 1J0HA 2JELL 5BQ7A 4MXQC 1PDKB 4W4NA 3CFJA 4BFEA 5E2UH 2ORBH 4WKZB 4XBMA 3ZDYE 4LCCA 4M3JA 4U0QB 1SF5A 2Z8WC 1FZOA 1PKQE 3MNZA 4HALA 3Q8BA 4IKIA 4NQCD 1BQHG 5DHXB 1MJJB 5JA8B 5EU5B 4AH2B 2AERT 3UJTL 3MLSH 1W6WA 1YMHA 5CEYB 2DIEA 1UG9A 2HT3C 1J5DA 4JRLA 4B27A 3WKMH 1FFQA 2NY5H 3CSFA 3O81A 2EYSA 4C56E 2VR5A 2R69L 5HGBA 3QDME 2PPEA 3NFNA 5FXCH 4F80A 4LF3B 5DVLA 4EIGB 2DQMA 3HCVB 3MA7B 1L9TA 3WO3B 4RLDA 1EEQA 3QFDA 1R5VA 1D9KC 5F9WC 1ECZA 4EMZA 4PJCF 4A67A 3QJFA 4NRXA 1YO4A 3UO1L 3N44B 4N0CC 3S88H 4OI8A 1AZZC 2KZWA 3H85A 4POUB 4ABQA 2EDHA 2R29H 3AQXA 4URTB 3CX2A 1BG9A 3MRBA 4U31A 3SQBB 3ETSA 2XWTB 1BAGA 2DM2A 2WUCL 1LK2A 2EO1A 2X7LB 2P8LB 4JANA 3O8XC 3L5WA 2FUQA 5SV3A 1Y0LA 2XTJE 4NEHB 5DHVH 3ZK0A 2BVEA 5JR1L 3B6SB 4DO4A 2JKNA 4NKOA 2WQSA 3BH8B 5L7XL 2PUQT 4PJ9C 2H0EA 1O9VA 3QORA 3KVDD 5EZLB 5I6PA 2R8SL 5E9DB 2VKXA 4Z3HA 5I15L 3H0TB 3GWJA 3L3GB 3IDIB 3NCYS 3QZMA 4I0PB 1MZZA 2P8PB 4KRNA 4QRPA 4ZSOE 4IGBB 5DJ8A 3WTVA 2CPUA 5A3ID 3LRGA 3SYCA 1RU9L 3EGDB 1XGRB 4YHYB 3RGVB 5DEFB 1KLUA 5JHLA 2OL3L 2BSSB 2PR4L 5DF0A 2ZX7A 5DMGC 3WNPA 2YD4A 5I1EH 1TYJA 2X3CA 3CMGA 4JPVH 4M3HA 1R19A 2X38A 4AGMA 1KG0B 4QRRA 1OP4A 4KJQD 4Z7OF 5BS0D 4Q97A 2GHZA 3AWEA 1BBDH 2IIJA 1DQMH 1MQKL 5DS8A 1XB6A 3PGCB 5EOQL 2Q2EB 3QEQE 5IFJB 3AREA 2WXQA 5ICUA 4G1EA 2R1XB 3ARDA 3DUUA 1BF8A 3GS0A 3ARYA 5F1NB 2KKQA 4KROC 4RQQA 1I82A 2X1XR 4YFEA 3JZYA 4Y19E 4JZJC 4QY8B 4Y7MA 3FO0L 4XNMB 2YPVH 2FB4H 3E8VA 1JGUL 1ZRUA 1JV5B 3APNA 5ADPL 3LKRA 4X83A 1OL0A 4S2SA 1F3RB 5ABDE 4UDTA 2VQTA 4MX7B 3A0OA 3PABA 2PNDA 1I8MB 2FLMA 3DI2B 1M7IA 2FEEL 4GI8A 4JHAH 1DQJB 1BZOA 2A38A 2COQA 3G04B 5EWIH 3BYTA 4X7DC 5EFIB 3BIKB 4FFWD 1ED3B 2OTWB 3AU0A 3MRKB 1DO6A 4OCWH 1MH5A 1NFAA 4U1GC 2Q10A 2HPOA 4ANXA 3QHZL 1VGKA 4N2NA 5HJBA 3ZL4H 4YVUA 4Y5XC 5CSBA 5KAQG 3CBJB 3BWUC 3LZQA 4XAWH 3QCUL 3QZLA 2X88A 1BAFH 4YJZL 4EZMA 4ZZKA 1LEIA 3JV5A 3G5VB 2MOGA 3D39D 3F64A 2Y5TA 1SYSB 3U7YL 2BHFA 4OF8A 2JQAA 4K94C 4ZUSB 1CC3A 1JHTA 3VI4F 3W1ZA 3FNKA 3B2VH 3O6LH 5LLIC 5E94A 3LZFH 3P0YH 3WGUB 3QXDA 2EDRA 2P80D 4J3WA 1OOAA 3B7UX 4N22A 3IRPX 3Q05A 1VPOH 1RLBA 3VTMA 2HFEB 1DQKA 2E8YA 1TQBC 5D7JC 4YSCA 1I7TA 1ZS8B 1TG8A 4Z7UF 3MA9L 4YDVA 1KIQA 4F27A 3VQMA 1DE4B 5MI0B 2EVGA 5CD3A 3OSKA 5JIPA 4EDXA 4I48B 4EI5A 4U1KB 2NX5A 3LX9A 1P4LA 2IBZX 2Q0ZX 2M83A 5I30L 5DRZA 4J4PD 1NCBH 3NCXA 2EE3A 1KTLA 3CN1A 3GM0A 3OLIA 3DBXA 3FQ2A 2E6JA 2ZX5A 1A4JA 4FMVA 4W9GC 5B8CA 5I28A 4G7VH 2K1MA 2WXMA 3UTSD 4HXAL 4KZ0A 3HZMB 3UG4A 4N5EC 3VFUA 3QB7C 1S8DA 4FG4A 1F02I 2CKNA 4LLDB 3LN5A 4ZTPH 4TNVK 4TUUA 4F2MB 3H9SD 5DEGA 1QPXA 4BH7B 4FLQA 3J2PA 3OGCB 4LVHC 3VSQA 3HJ0A 2FH8A 4MQ7B 1OCWL 1N0XH 2G5BA 5CLXA 3RY6A 2B4CL 1PZUB 1FRGH 1KEMH 4U3SA 1PD1A 4JFSA 4NQQA 3NSXA 1QSEE 1UM4L 1ODAA 3NJGA 4M5YL 4POZD 5CO1A 1KJ3H 4KKCC 1YEHL 4ZQKB 3SOBL 2PW1A 3ZUNC 1G43A 2H9GA 2DM3A 3IJ9A 1U95A 1NANH 1MCNA 2WB7A 3BZFB 5JYMA 4R6UA 4S1DD 4KAQL 1DBML 1DBJL 1HL4A 4KXAA 4QOKB 2AGJL 5C0BE 1RUAL 5E8NA 5AZ2H 5GRVK 5HHVH 3LPOA 5HDBF 5CEXA 1NCTA 5IUSA 2BFVL 2BIIA 1A9BB 1XF5B 1JZFA 1NC4D 5F89B 3WIFA 4UTAH 1X4XA 4KRPD 3F7VA 2BRRH 1BYPA 5JHDB 2Z7UA 1I4FB 1UB6B 2TAAA 1HSBA 4W1TA 2A6KA 3DYPA 4JL1A 1WC7B 4JRXA 1BZ8A 1G6VK 3TWCH 1KPVB 3LKNA 1MFDL 2E8ZA 5J6HA 2DICA 2YGQA 5D71L 1HHJA 4N26A 1JZ4A 4OF6A 3ARFA 5D2NC 2OS7A 3GPSA 5DYOB 1MAKA 3ALXA 1AKJD 1FFOA 1SF3A 2OM5A 2WV3A 4N1CA 4YC2B 4R0LA 5H2BB 3WL9A 5I19H 4NJAL 4W68A 4ZMZA 4ENED 5JIDA 1I3GH 2VN3A 5L2KB 1XH0A 5IEHB 3GHBH 1IFHH 2DTMH 3AXIA 4M6NL 3FSVA 3QQNA 4PJBB 2LE9A 2MKLC 3VFNA 4RA3A 5AW2B 2X4UB 1MUJB 5CSGA 3PDOA 5IB5A 4GBXD 1K8DB 1IGYB 4QTIL 3DUSA 4E41E 3BZEA 1CLZL 3O3AB 3OC8A 2X1WL 4AEIH 3MFFA 3ABZA 3D3VA 1IU1A 2F7OA 2WUCH 3L95B 4K3JL 4IOFC 1M7DB 2WZAA 3QAZB 4P04A 4BFKA 4CW1B 2F53B 3O2VL 5EF0A 5DJ2A 5EORH 4LCYA 4DZ8A 1XF2A 4LHJB 2I69A 3BN9D 1L0XA 4U1MB 3NIDB 5DD3H 3T0XA 1A66A 2AJUL 4OAWB 4MJ2A 3I6KA 4OIIH 3VGEA 4LLQA 5I82A 2R8SH 3L5JA 4B9FA 5SWZA 3ZHFA 5DGRA 2ZIDA 5C0JB 4XO5A 3B2PA 4JKNA 3MRHB 4R4NC 4BFJA 3S36H 3NJLA 4R84A 4MQSB 2IWEA 3L3IB 5I2IA 1F1DA 5DEZA 4Z7QF 4JRYB 5TE6L 3MGAA 3OKMB 5I75C 3KPRD 5D2LE 2PR4H 2FYYA 1X9UA 2VW6A 1G7HA 1CU4H 3MN8A 3EO0A 3MU3A 4JKLA 2X4RB 4YBHA 1RZFL 1U3NA 4G9FE 2DB8A 2P5WD 1B0RA 4JFEA 3OMAB 2YS4A 3DBSA 1ZLWK 2GW5A 2CKBH 2OP4H 4JFFE 1VCBC 3LEYL 1DHKA 2ZAGA 4MAYA 4X8CA 5B3JE 3N91A 3BUDA 4NWTL 5F7LB 1W0WB 2ESVE 3ULUL 4WDIB 3UZEC 1J0JA 4KKAD 4ONFL 5KSVA 1L3WA 4OZFB 5FGCB 1T21A 3I6GA 5C0CE 1F4WL 2DKUA 3LRSB 3RG1C 3NRQA 4XODA 3P4MA 4WW1A 3STBA 3NEXA 5L88L 4NO0B 1OD9A 2MOQA 4GQQA 1S9WA 1A4KB 2VDKL 2WXLA 1S78C 4JFZL 1JGLL 1ODUA 2B4CC 3QJVB 3QIWC 4DOHB 1IC4H 4PBDA 3VGHA 1ZLSL 2FE0A 1S7SB 4X7CC 3RWDB 1T2QL 2YOAA 1R24B 2X6CA 4ISVA 3NIFB 1TLKA 4RIRA 3V8CA 3DIFA 4DT2A 1HOCA 4LP8A 5G5DA 2EDBA 2IAND 5GJTL 3WS6A 4MS8C 4L1DA 1YC7A 1CZ8L 1E2VA 4RGNB 2OXGB 2B1HL 3ROLB 4PIRF 4OJFH 2J73A 2BSBA 4HEME 4KC3B 3U2IA 4Y8DC 1MW3A 3R4DA 3RHWF 4M43H 4DP2X 1KOAA 2K45A 3C8DA 3KWWB 1SZNA 1P9MC 3UCQA 3L5IA 3VI3F 1QI4A 3HS9A 2F5AL 3MAWA 2FR4B 2BPBA 1CICB 4YO0B 2IXQA 5B1AB 2JKSA 3QIBD 3MV7E 4V33A 5C0GA 1FNEA 2EDKA 4YIQA 2ATPA 2BVOB 1F56A 5DJ0A 1EEYB 5TQ2H 1FWXA 5K59E 2ZG1A 3U0WH 3FCSA 1WS7A 1P5UB 5IB4B 3KYMB 3QFJD 4DFIA 3STLB 1TPXB 3CVHA 5LGHH 3S4SA 3QW9A 1AD0A 3AGWA 2A9NH 4QRAA 2E7HA 1E4XH 3GLEA 3LXBA 3QEUA 3RWHA 3HZ3A 4Y4HA 5G4MA 1N6UA 4EOWH 4PRHA 1OAXH 4UQ9A 5CJOL 2IO5A 3MUGA 3GKWL 4R7VA 2OR8A 3V95A 2R15A 3PQYE 4G7RB 5D7KE 4NUJB 1I8UA 1YN6B 1P2CB 3GZQA 2Y2WA 2JK5A 4RISH 2EKSA 4RFNB 3TYFA 2CHNA 2DF3A 4XXWC 5C2BL 4HK0A 4GRMA 4UV4H 4UILL 4F7CA 5ALBH 3SKOA 2RACA 2R7EA 1NINA 2VQ1B 3BGMA 4JM2F 4JFDE 4PRDA 1K8IA 3VXMA 1I9RL 2VCOA 4HXAH 1KXVC 1EWHA 4FQXD 5BRQA 2OZ4L 4XMTA 2EDFA 2F7IA 1V05A 3HG4A 4XMKH 1DQIA 1X5XA 1P0SE 2KQNA 4GH7B 2Z35A 4TUOB 1UENA 4KBPA 2VC2L 3O45A 1KZQA 4H5SB 4IMLB 4DEUA 2GITA 2YLKA 5ESAA 4MD4B 5AAWC 4KNUA 5MENE 1RUQL 4F58L 1XCQA 1R75A 4MFHA 1H0DA 5AYUH 1OCWH 5GS0C 1TYEB 3VXUD 3A67L 3HI1B 1YYCA 2B4CH 1OWWA 2Q9OA 1K5WA 4CVXA 2XZQH 3L3JB 3C5JB 5JW4M 5F3BB 4P48A 1PSKL 4JPIA 5K9KA 1MWAA 4PJ5A 4WNJA 5HYSG 1YEHH 4U05A 4A1RA 4FJZA 5CZRA 3GLAA 4QEGA 2E7BA 4BSVA 1MN4A 4FCHA 3RPIA 2XZCL 5IMKB 4XMUA 1BWMA 1OCCB 2V5YA 5DJAA 3B7RL 2VXTL 1QSFA 4OD3H 2IMNA 1DBJH 1DN0B 5F1KC 2QHRL 5DQDL 1RUAH 2CD0A 4P2OC 4D9QE 4DUVA 5LWYH 2AHIA 4DJMA 3PJLA 5HDLA 3RE0A 1IC1A 1JPST 4P2RE 3TA3D 5LGJA 1IAKB 2VZ3A 4OLWH 2BFVH 3GRBA 2CDFB 3ULUC 5B38G 1HCFX 3FB8A 4S11A 8CGTA 4PVNA 4P99A 3MYJB 4WHDA 2FYVA 4FF9A 1F8TL 2VXQA 4U1NA 5HPMA 4IRSC 5C86A 1IAIL 1KXQE 4ILDA 2X70B 4PY7A 5KSUB 5I1DA 2ADIA 3OWRA 3WFHA 1COBA 5KYUA 4L8BA 5IM7B 4DPAX 4FTVB 4Y0GA 1MFDH 3M88A 4L0YA 2J5WA 3AZUA 3RIKA 1KJMA 3QWRD 5FDYA 5D71H 1KYAA 1G7JA 4GW5B 2F8IA 3WU1A 5T5FA 2QSTA 1A7NL 2OMXB 3WEBA 4K3HA 3MV9B 4LSSH 4NQDE 4JE4B 1WPCA 4NJAH 4N85A 1XF4A 1VFBB 1OTSC 3ATEA 2ZKXA 4OLVL 32C2B 3I9GH 4OQTL 5IHUH 4JFHE 4RZCB 1N6VA 1NDGA 2VISB 4MSWA 3BZ5A 3KH4A 4M6NH 3T2NL 2JJWA 4LSRH 1SLVA 2VDNH 2HFGL 3A6CL 4NJ9H 3VWKA 5FFGA 3D30A 3ESPA 4G8GD 3FUIA 3KS0H 1QKZH 4BE6A 2PYEE 3K8KA 5D1XD 5D1ZB 5I8KL 4AM0B 4FHBD 3K80A 3EYVB 3UBGA 3KR3L 4FQCH 2EVFA 5EEWA 4HWBA 3CXDL 3LNHA 1ZIBA 1UZGA 5IF0A 4APQD 4CDGC 4H13C 4K3JH 3IAQA 4AQEB 5DVOA 1DYZA 2OAAA 3KBEA 4FNPA 2OJ1A 2DY2A 3SBQA 2Z1PA 1D5XB 2FAUA 1Q9OA 1QNZL 1P53A 5F9OH 3WNMA 5KVGE 5BZXA 2AJUH 4FRWA 5GS0H 3B5TA 3FONA 2APBA 4A39A 5G4OA 5TDOB 1EAOA 1T7ZA 2FT6A 1P7QA 3UEZA 1E5ZA 3CSYB 3MRFA 5EU7C 3NJFA 3VRLE 8FABB 4BDVA 5TE6H 1H8SA 2DQIL 3HS0A 3PWPE 3HLAB 3WNLA 1RK0B 2K0RA 4EUPA 3ECWA 1XGZA 1XR8A 3HUJE 4Y2NA 3EFOA 1MELA 1PX3A 5FKPB 5GGTL 4HKJB 4JAMB 4OZGA 3RHWK 5DFVC 4GO6B 2VKWA 3B3IA 2I7OA 1KUMA 3BDBA 2WNGA 1IQWL 5IVOA 4NRYB 2GT9B 1QR4A 2X89D 1A7PH 1JWUA 4JDTL 1X9QA 2VXUL 4DEWA 3GXNA 4PSPA 4JFOA 3JTSB 3BFQG 2IFGA 3QWOB 3ISYA 2V5SA 4OKVB 5DRNB 2XWJA 1M6UA 5D4QA 1DDTA 1RIVL 4P23A 4GY4A 3K7UA 4L8SC 4ONFH 3V4VL 3B9KA 4ZMPA 1A4CA 2H32A 3WIHL 5BV7H 1J5OL 1NJ9A 3FDWA 4X4KA 1B3IA 2MPVA 5ICXA 4K5NA 2VUYA 5L88H 2XG5B 3S97C 2ZUVA 4YE4L 2HFFB 3D9AH 3QZWB 1JGLH 2JF1A 2YPKB 1NIBA 5IQMA 1SJVA 1PKQB 4R4FL 4Z8FH 4Y2OA 3LZOA 1CB4A 1T2QH 1OAQL 3R0MA 5B7MA 1KTDA 1U2HA 1Q94B 3QI9C 3FRUA 2X87A 5GJTH 2OMWA 4YVNA 5ALCL 2Z93B 4CSPA 4QGYA 1CXIA 1R5WA 1MFCL 5IMOA 1B3JA 2FEDC 4GW1A 3V4PL 2B1HH 5J3HD 4KX7A 4L0PB 3TJHC 3LYRA 1I1AD 3ZKMD 1JTPA 2ZYSA 1GGUA 2HKHL 1E3XA 3GBML 1MJ7L 1T4WA 2BH0A 3PWJB 4L29A 2R4RL 5AOZA 3L1FA 3HA0A 3FT0A 3OMIB 1ASOA 3N44F 4LSQH 3HG1E 1KLFB 4X9FA 5IW3A 2VLJA 3VI4A 2DQFA 25C8L 5C9KA 5F8QC 4MXQD 4W6YB 2IDFA 5HY9A 3DXAD 3VXRA 5FM5M 3FRPG 4XOBA 3Q6FA 5ID0B 1V7NL 3GM8A 1BJ1J 3F12A 4Z7UA 5DK2B 3ZYJA 2J25A 1W80A 4M48H 2I07A 2OL3B 1NEZB 2ILLA 4CJ0A 3FB5A 1I7UB 2EINB 1JNLL 2L3BA 3UYOD 1P1ZB 2HT3D 1QRND 1PS3A 1NOAA 5TD4A 1AS6A 4P3WA 3UBFA 2I60H 1MHCB 3S5ZA 1KENL 3DX9B 3T65A 5HVHC 1EHKB 2VLKE 2YLHA 4H0GA 4N6RA 5C2BH 5B1JC 5ITBH 4MZRA 4LPTA 2Z0BA 1WISA 5B39A 2BNRD 5EPMA 4JK0D 5J5EA 1D9KD 2ZSWA 3HHRB 3QXVA 3IETA 4J1UB 3PXLA 3VD0A 1OM3L 4OUUB 2WLHA 5K39A 5E00A 1M9WA 3CFIC 3UYPA 1I9RH 1F2XK 4K3DH 3QEQB 4HK3N 3JYCA 5E9AA 5E99H 5F1OB 2VLRD 5TF0A 5KAQF 2ZXDA 2V9UA 4J6RH 4DW2H 4HWEH 3H2PA 3DGDA 5TF1L 3HC4L 1IGFL 3X2QB 4Y19B 4PRNA 2QPEB 4LT7A 4GRWE 2FHCA 1FLTX 4GG6E 1SEBB 4F58H 4RAUA 5TPWH 3GSRA 4XOCA 2R2EA 1NGQH 1E8YA 1NCJA 3QG6B 4PJ9D 5H35B 5T1MA 5FGBC 3T0EE 1INDH 4UQ2B 3SO5A 2QFPA 1XSIA 4OW6A 35C8L 4ZYKB 3N6YA 1S9VA 1S7XB 4LLUA 5EZJB 2JI3A 3VFMB 5AD0B 1ET5A 3SD5A 7PAZA 1FH5H 5DVNA 4Q6YA 1B0GA 1TZIB 2FVNA 1NUGA 3WNKA 4CUCA 4UT7H 4LU5L 5DMGD 5J6GB 1O7VA 4ES9A 1DVFB 5K33A 1VKXB 3GSXB 2WOBA 1Y7VA 3LN4A 3SPJA 2TRYA 1XB3A 2GIMA 2QVFB 4FNUA 1EZSA 3RDTC 3KPLA 3TO4A 5DT1L 4NQSB 1OGAA 1WDAA 3QUZD 5CSZB 4F7PA 1A6TB 4MNQD 4ZBJA 3RKPA 3V7MA 1F4YL 5C6PB 1OAUL 4BSJA 2AQNA 2LLGA 5DMKA 4LLYB 5EOTB 1AQMA 4HUVB 1D5MA 2DPKA 1IJ9A 1UZ8B 4ETQA 3TT1L 4NSKA 3MRPB 4WNQB 1FAIL 3KYAA 3QA3A 2NW2B 2VNCA 1FZJB 2P28B 3ATFA 1IZJA 2K6WA 1CS6A 2N0MA 3ZDWA 3D69B 1UTDA 3RJDA 4NHCH 4HKZA 4MVBD 4LSTH 3ROOA 5J12C 2QGBA 1J8RA 2PP8A 5KW9H 1CQYA 1FZKB 1A7NH 1AP2B 2Y69B 3MR9B 4FG2A 3MRMA 3SGDH 1KLGA 1TZHB 1E3ZA 1A6PA 3VFVB 5I75B 3VFOB 5T1JA 3C2AH 1CXLA 2VXVL 3C60A 2AQ3A 4OD1L 5IFHH 4I4WB 5EV7A 3ARUA 4ESKA 4OQTH 4WTZG 4XAKD 2ZOKA 1RSFA 3QO0A 4Z7VB 3MZGB 1YY9D 4QHKJ 1LK3H 1S2EA 2Q8AH 3O4LD 2GYSA 2OXHB 2VDRL 3VFSB 4LCUB 3IU4H 1HEZA 1UACH 1URZA 2ZKMX 4JPKL 4XP6L 4PLNC 1SJHA 2KHAA 4K5LA 4U0RC 2WUBL 2N7SA 3C75A 1RVFH 3QS2A 5EBLB 2A6IA 4OT1L 4PGDA 5MP6L 4WGKA 2XWBA 3UG3A 3D05A 5FV2A 2KPNA 2WQAA 1G84A 2XPGB 1EZVX 4H8QA 5T3XH 5EBWA 1T20B 3BWAB 3Q2WA 3G7TA 1M71A 4QRFA 1SEQL 5IESL 1CFMA 2N7BA 4Q8BA 5ISZB 5DR5L 2B8OT 4XO9A 2CRYA 1BREA 4YSAA 3CFBB 5EO0B 1WCBB 3UDWA 1CK0H 3ARQA 2GC7C 2GHWB 4PJ8C 2DQCL 5D7JD 3QDJB 1WZ1H 5KYWB 3ECBB 3OKNA 4FE9A 4OZ4B 5DUBB 3MJGX 1JN6A 3DV4A 4H7VA 1U0QA 2B16A 1IBDA 1C7SA 1E40A 2CGZA 2H2PC 1U2CA 2XKUA 4GKOA 5GS3A 3EIFA 3R7RA 3BN3B 5C0BB 4OSUL 1TIUA 3WUWA 1P4BL 5C0AE 3GSNB 3PP4H 2XLLA 4IBTA 3MREA 4EZJA 3QUMH 1T1YA 5TE4H 5H94A 4URKA 2MPAL 3GDBA 1RIVH 2BNUA 4J8RB 4N5ED 5DQJB 4WWPA 1ZJAA 1IKOP 4U4BA 1RJYA 1GYAA 4TXVB 3UAFA 5DA0B 4IRZH 4ZFFB 4H2CA 1ZOXA 3V0EA 3WJMA 1J5OH 5HJ3B 2C3GA 4E0RA 1SLXA 2DYPA 4JY5L 5FYJE 1MLBA 2A99A 3LJ3A 4BE5A 2NY0C 1YAZA 2V3DA 4YE4H 1KFAL 2K7PA 1CFNB 4XCNA 1PKOA 4UIMB 2BNQD 2W92A 3LDBC 3C8HA 4Z77A 5AOKA 1DUZA 4B7LA 1O7SA 4AZ8B 1OAQH 2HG0A 4GKLA 4EI6A 3LXUX 1B6UA 4XMXA 4KKCD 1S7TA 1MFCH 4M8VA 4DK5A 4HV8A 1KGYE 2Y2YA 3GMOB 3L3KA 3SB3A 5H4ZA 1FNGA 3HN3A 5BW7A 1MCKA 2A77H 1NBYA 1FDLH 5F7EH 1HAWA 3EOTH 3LIZA 3TIDA 4PJBF 1WAAE 3LEXA 1PIGA 4E41B 4ZW3A 3GXDA 1D6EB 5D7HA 4LIQL 2R4RH 4X4XB 2MIZA 2GFBB 5IMLA 4ODUA 5HDRA 3ZYZA 3EHBC 2WIIA 2D7QA 2ALAA 3U9UB 1PF3A 1OARL 25C8H 2A74C 5F3HB 3H9HB 2B2XL 3ZKSD 5IV2A 2OSXA 4N1HB 3C5ZA 4KVPA 3NSJA 4K3EL 4G82A 2APWA 1KPRA 3ESVF 2O30A 4MJIA 1V7NH 2APFA 3V52H 2X28A 1RUPH 5C9JA 4NQCA 4JDEA 3HG2A 3WMSA 4P49A 1HSAA 2LGNA 4EJ1C 4XCFH 3NIDF 4QHNA 1JNLH 4A2LA 4DGIH 3CBRA 2CO6B 2FLRT 4AVJA 5D2LB 1FCGA 5FWRA 4I7ZC 3NCBB 2YGPA 1TENA 4YBQC 4BQ8A 3DGGA 1NPUA 2P7TB 1BFTA 4G9FB 3SKMB 5I66A 1U4EA 4KY2A 2O6EA 4JFFB 4BYHA 5D9SB 3WS3A 1RJZB 4I3SL 1ZPUA 3VFGL 2R39A 3AM8C 4GAGL 3VFTA 2JJTA 4YFLF 1FGVL 5HDQL 2ESVB 2QR0B 3T1FA 1T66D 1J10A 3JUYA 5FKAB 3QO1A 3QDHA 3SE3A 2JNZA 3BAWA 1BD2E 4P3DB 2A0LD 5C0CB 1DJIA 4ZX4A 4KKLD 1MCPH 1MHPH 2VDKB 1LVEA 1KTJA 1UWFA 4O00A 4FFZL 1FSKC 3LMJH 5C0DA 2N59A 4GRLB 4M62H 3UZQA 4Z1PA 3VGBA 4BUHA 3UCRA 4MZIA 5BUGA 3ALWA 2AJ3A 5C09D 4W9DC 5IK3A 3WELA 1T89C 2BOBB 3X13A 1S7RA 4D9RD 1CDBA 1CG9A 4EKXA 3FT9A 4MMYA 4YPGB 1MSPA 2QELA 2XTLA 3KPQB 4Z5RA 1Y1DA 1NBQA 1N0LA 2F68X 3WIIH 3ARBB 5F7BA 5CUSL 3BFWA 4Y4KB 1CDGA 1ORQB 2WLMA 3BVNA 2ZXEB 4LFHG 1H9DA 3AITA 3IVKB 1J48A 3C6LD 4ODSL 4E42A 3AQZA 3RPBA 5I71B 2LU7A 3NIFF 5CKGA 3VE0B 5CZKA 4JKPL 3WFCL 2EDNA 1LNUB 2P43B 4EAEA 5I76A 5HGHA 3P30L 1S9YB 4D3CL 1DZBA 4A2EA 5KSAC 3I9PA 4G42B 3SE4A 3E0GA 1Y07A 3FBKA 5CGTA 1UH4A 3FMGL 3TIEB 2J1YA 1UA3A 4A2DA 5HGAB 3HHSB 3MV7B 5CCHE 2RBLA 3BP5A 5F7YC 3FB7B 2VJXA 4ODXA 4LNVA 1FAIH 4N90D 3RNKA 2OTPA 4HC1L 2VJ8A 5MEPA 1KCRL 1A9EA 2J56A 3U9PH 2VDLB 5DSCA 1NOFA 2VZSA 5AKVA 1TO5A 4MWFA 1GC1L 2WLIA 4OD2B 4JGUA 4RMTA 2H6PB 1NCOA 2WCGA 3QIWD 2JKJA 3MOAH 1Q0YL 2FX8L 3EH5B 3QVAA 1MHEB 3ILQD 2FJGB 1G1YA 3WNJA 3BVXA 3RFZC 5HGDA 1U8LB 4X50A 4DP6X 3GO1L 2OK0L 3L54A 4HQQH 5C0ND 4LLMB 4OD1H 4P5MB 3UP6A 3E9UA 3I50L 5JORB 4ZAKA 2YSSB 4MS8D 5DVKA 3VWJD 1MIEH 4NKIL 1O5PA 1FYHB 4FKEA 4U1JA 3IKCB 1GGCH 1K4CB 3QZBA 4I2XE 2F19L 1BVKB 1CF8H 4MGXA 4AVIA 4JPKH 5DFAA 2GBVA 3OXRA 4A6YL 2DWEA 3NAAH 1OGTB 2KH2B 3WEMA 4AJYV 1RZ8B 4JFDB 4Y4FD 1YEWA 1VSCA 2W60B 1YUKB 1JZDC 3WNNA 2EEDA 3HE6D 2GCYA 4OT1H 5HI3D 1FJ1B 3SKNB 4OFYD 3QDGB 1NAKH 4Q9BA 2H3NB 2PETA 3AXLB 3Q3GA 5INCB 1R3LB 2EXYC 1HT6A 4N0FA 2E7CA 2X4PA 1M6OA 5MENB 4Y5VA 5E0QA 5IESH 2LAGB 3LEVL 1VESA 2J5LB 3I3DA 2HJKA 1S7QB 1ZA3A 3EFFA 3SHSA 5CKAA 1BQLH 2I5YH 2R23A 1B2YA 1CFSA 2PCFA 3NDYE 3QJRB 3W82A 4QRQA 3QI9B 2DQCH 5GXBB 1HNYA 3SJVA 2ZPKH 1YY8B 1M4KA 3FFCD 4HUCA 4M4RA 3QNFA 1AR1C 5B4MC 2HMID 2J57A 1A3LL 2J55A 4OKDA 2VR8A 2YBRA 2ICWB 2O5YH 2IH1B 4QGTA 1S3KL 5I16A 1CVSC 5CJBA 3KPOB 3MLYH 1XMEB 5SX4H 4BZ1L 5E8OA 5AW8B 3OJVC 4UIKL 3UBXB 4OSUH 4F7EB 2V2TA 1P5VA 4P2RB 1NM9A 2UXGA 3IFOB 3SYOA 2F5BL 1BF2A 4TUJB 3UTSA 2BHUA 4Y9GA 4YQXL 4PJFF 4WK2B 1TCRB 3OR6A 1TEYA 2EDWA 3LS4L 4JN1L 3H9YA 1Z3RA 2HRPH 4NKDB 4NN7C 2PP7A 1JG9A 1Q38A 3SDAA 4KVNL 3IDUA 5K93A 2HTKC 1BEYL 3SCMC 4JY5H 2AJZB 2AXWA 3IM1A 4F9LA 2C3VB 2WQWA 3PYCA 1HKLL 1XH1A 4OCSH 3VCLB 2CBOA 3P1VA 1SMDA 5DUML 5GS0D 5JNYA 2AEIT 4CA4A 3RWJB 4M02A 2O93L 5GRJL 4I1NB 1FO0H 2VRKA 2N1KA 1SFDA 2P5EA 3K2KA 3L4VA 2Z34A 3FBQA 1A4AA 4NQDB 4ZUWA 3GEWB 2D73A 4UT9L 3RLSA 3S37H 1PCXA 4X6CB 4XX5A 1IC5H 5F1SA 3TL5A 5FA4A 1MJJA 1MZYA 2YIHA 3TESA 3O6FC 3ARGC 4DCQA 3VYOA 4JQXA 4Y16D 1IL1B 1ZVHA 3O9WC 3HS8A 4WI2A 4ACPA 4K7PH 4MQTB 2YBGA 2J12B 4QRPE 3FUDA 4F93B 3TJEL 3NPSB 3UBXG 1WP6A 3BMVA 4WWKB 1NAMB 4PJEB 1JZEA 5T1KB 5J56B 2RQEA 4P2OD 3GS4A 3AU1B 1QW8A 3IJ8A 3NH7L 4ZNCD 4BRVA 4LIQH 4R5XA 3GHEH 4QKTA 4XOEA 2ALWA 3RZCB 4IS6A 3AY4A 2J6EL 5TJWK 4L3AA 4WI3A 3BKYL 3L16A 2BK8A 2X4SB 3MSPA 2B2XH 2X53A 2XWTA 5AOJA 5GS1A 2V5MA 5IJVB 3TNNA 1GC1C 2ZUTA 3O3BA 2R1YA 1G7LB 4K3EH 4BSWB 4E42B 2I27N 5FF6A 1YCSA 2XBTA 1H15B 2O6PA 3BVUA 3MJ8A 3MLPA 3SGJC 3BH8A 3CZNA 3MLRL 2J8OA 4DUWA 3B43A 2NXYD 5E2WH 1MWOA 4P4KA 3JTTB 1AQKL 4LAQL 4L9LC 4QXVA 4E9SA 2L7UA 4PS8A 1ASQA 2EABA 4YFLI 5EIQA 3S3DB 5SX4I 1ZJBA 2BLFA 1OTSD 1Q0XL 2Y36H 3BUTA 3PWPB 4Y1SA 2ADGB 3IDIA 3ZO9A 1KC5L 5C0FB 4IGBA 4M61B 6PAZA 2KI6A 3HUJB 4APXB 1CTOA 4Q14A 1XGRA 3V5HA 4UWQB 3RGVA 2Y6SD 3OAWA 3C8KA 1OD7A 3EJTA 1GYUA 1T4KA 3VM7A 2C7UA 1Q9WB 4FZ8L 4TV3A 4KQ4L 4JHWL 5IMMB 1EFXA 1UGNA 4NXKA 5JW5B 5I0YA 3KLAB 2DQEL 3HN8A 3OKEA 5EBMA 1KYOK 4F8LA 1J9TA 3BXNA 5C0IA 1J1OL 3VXNA 2R1XA 3TPUB 3Q1SL 3QIUC 1DEDA 3F5WA 1MJUH 5F1NA 2WY3B 2UUDK 5FYKH 2CO3A 3HZVB 1YC8A 2FNBA 2NCEA 5LBSL 5TQ0H 2D2CC 4I0CC 5EF1A 1JNHB 3LKSA 4OFKA 4QY8A 4WW2C 4D8PA 3D12B 5DMJB 3PAYA 1UA6L 3FB6B 4C47A 4LLVB 3PP3H 3VGGA 5CGYC 3AS1A 4PAZA 4Q7DA 1IIKA 1BAWA 3N85L 4JZOB 4KV5E 5KUMA 5I1HL 2NY6B 1R3JB 4MX7A 5SWSD 1I8MA 2OYKA 2ICCA 3EBHA 3KH3A 3RU8L 2WBKA 1F5WA 4EN3A 2W0LA 3G04A 2WZPD 3ML8A 2LR4A 5J13B 1I8IB 3E8UH 4XN5A 2J1XA 3BIKA 2ZYHA 1HILB 1WBXB 1T6WA 3WFCH 1FLRL 1RZIB 1N9PA 2DIJA 2YUXA 4D3CH 4ZMQA 5KYYA 4ADIA 4UOW1 1PY4A 1RV6X 2NX5E 3M1OA 3MQIA 4GFTB 4I3GA 1FZMA 1E4WL 4FDWA 3Q01A 1VLXA 3MUZ1 4LPYA 4TVPH 4YGVA 1LE5B 1F3DJ 5IBTL 1CYXA 1PPIA 3H2WA 4B60A 5IHZA 3EO9H 1UKTA 1CDJA 4IOSA 3TZVC 2R56H 2LW3A 3T3PF 2CJTA 1SYSA 1Z9NA 2XRAH 1G7PB 4P2QD 1NFIB 4XN1A 4ZUSA 1FFNB 1Q9KA 1B6DA 4NRZA 5F9JB 5KJRH 5IQNA 3O6MH 2JSFA 2WBJD 1J8HB 2B0SL 3N43B 4HUWB 5EO1B 1Q0YH 1XV8A 2FX8H 5E6SB 2O61B 3M8OL 1H6UA 1UURA 1FVEB 4PTUB 3NYKA 3PWVA 4G9DA 1S6NA 3FPXA 2XN0A 1P84K 3G6DH 3IGFA 1E67A 2D31A 1O6SA 3QQ9D 1J1XH 2G0KA 3I50H 2WXPA 1U93B 2YAPA 3FN0H 1CWVA 5EUKB 1DE4A 5L0QC 2VLKB 1JFHA 2F19H 2V9TA 3TJHD 2XX0A 3V6FA 4NQVB 4HHWA 2Q76B 3HPLB 4G6KL 4QUOA 3U4EB 5AVSB 5I17A 5MEQA 5I23A 4NHUB 3HPJB 3SBWA 1GGYA 3CFQA 4GMTL 4F2EA 1KPUA 2OSLB 1E6JL 5HDWA 1GXEA 2XX1A 4RRPG 5AW0B 1E90A 5KVEE 2QKIB 2CUHA 4HD5A 3TN0C 5I8OH 2D8KA 1CI3M 1RK7A 4IDJH 2GQHA 2NY0B 4E9WA 4F24A 4QXTA 5HHXL 4FYRA 4KUZL 3K2UH 1D7DA 1AIFB 4GG6B 1H3GA 1XGYL 4LLDA 3W0WB 4UOJA 4NX0A 3P77A 2CPCA 5CJXA 3T0EB 5TFSH 3KLQA 4JRXE 5E1IA 3HAEB 1II4E 3IXAA 4MQ7A 2HLAB 2ENSA 2Q86A 1M56B 5GGQH 4ABWA 4X5WB 4XVJH 1JGVL 3QCVH 4L8DB 5DC9B 4ZXBB 1JPGB 2X42A 2CHXA 4QLRA 5IHWA 3L3OC 1M53A 2F1BA 3WN5C 5B3SB 3ULVH 4DETA 2WP3T 2HX7A 3PV6A 3VQ2C 4PWIA 4YDIL 3K6OA 5I1KH 5AKSA 3TVMB 2X4TB 1XXFC 1S3KH 4YUEL 4Y9FA 2VXSL 5EC1B 4UIKH 1QUNB 3MRCB 3VD3A 4LZKA 1QW9A 4TLSA 1AHKA 1HAUA 1QQDA 3FU5A 2YMXL 2XZAH 1IM3B 2HJFA 1YUHB 4KI5E 4P46A 1ZVSB 2FWLB 3EHBB 4U1IB 4Z95L 2CMRH 5T5NF 4ZOEA 4R7LA 1A9BA 1XF5A 3ARTA 2A73A 3PWUA 5T3XD 3FT2B 2CA4A 3IGAB 4KVNH 2OMYA 3SDYL 4CNIB 5I6NA 4DHLA 1AHWB 1NGWB 1I4FA 1UB6A 2F15A 4GIOA 2E76C 4XGZA 4NBYB 3UAJA 3NQIA 1JZGA 4A2FA 1QBLL 2GTZA 1KPVA 3D3VE 3VXUA 4JFUA 5E9DD 5JQ6H 1UZ6E 1FH2A 4I0PD 1XGPA 3TV3H 1BZ7A 1I8LC 1EHLL 1RJCA 4PGCA 4UT9H 3MBEC 4KKQA 3VD9A 4PV9A 4ADJA 4HGKC 2VDRB 4F37F 5HHPA 1FG2B 3I3EA 5D1QC 1LO4L 1X44A 4RWYH 4WUKH 4C83A 2YKKA 4I18B 4PWHA 5H2BA 2CDGB 2O5ZL 4DN4L 3CVCA 5SWZE 4R3SA 2XFXA 4XPAH 5D1ZI 1KGXA 4NM8L 1K4DB 5IEHA 5F70A 5MEOB 4GUPB 5LCVH 1AYOA 4W9CC 4Z7VF 4PJBA 2QPUA 4L1LA 1PYWA 3TA3A 4NO2B 2EVIA 3L9RA 2NT1A 3TCXA 2X4UA 3US9A 4M6AA 1MUJA 4ONGH 4HS3B 1FSKB 5HI4C 5T3ZE 2NTFB 5AVZB 4JFEE 3O2WH 1VFAB 1DBKL 1WHOA 4NFBA 2J6EH 3UGXA 2UX6A 4UOW0 4M1DH 2EP6A 3ZX1A 2M8XA 1N5AB 1UC6A 2WQUA 4S0HA 1WWBX 1JZIA 4N0YL 4J3BA 1EAJA 1QWNA 3D4YA 4YHOH 2UYLB 3IDJB 5ESQA 4MJ6B 3OMNB 4FNQA 6FABH 1HINL 4U6YA 3BP6B 3EJRA 3K72B 1W0YT 3VACA 4KTEH 2ITCA 4U1MA 3CTTA 1BZ9A 3DO4A 4LAQH 1U8CB 3S3PA 2IG2L 3T0BA 1EEUA 1U4FA 2FTAA 4H1LB 3L2LA 4F3FB 2C9QA 1Q0XH 2VDOB 2OYPA 1F42A 5IJDC 2AK4E 5EF2A 1YYML 4R4BB 3L3IA 3RL2B 2NY4C 2KLSA 2BSTA 2IAMC 4ZRGA 3RGBA 3VFRB 3E6HB 2PO6B 3BH9B 2X4RA 2A6JB 1BJMA 5I5JA 4FZEH 2PP9A 5C0AB 3WBDA 1DCEA 2AV7B 4U49A 3PAZA 4FNRA 4AM0Q 2AEQL 3BQUB 3EDDA 2ICEA 4MA3A 3UTTD 3HG3A 1AGCB 3BAEL 2GG1A 3MKKA 3R7QA 4OLUL 4FKKA 2WBXA 4PGJA 1M1SA 43CAB 5IROA 4DIXA 1S5HA 3SZ6A 7FABL 4ELMA 1H6FA 1JK8B 2Y5EA 2CCWA 5LBSH 4MCZA 2NY3C 3U25A 5ADOL 1N64L 4OFDA 4JFPB 5JPMC 1XFPA 2H1PH 1CGUA 1NPNA 2HTLD 4JM0A 4KKBD 5HYJA 3II3A 1FL5A 3M17B 3N85H 4JQIL 5I1HH 3VFPB 4H1LG 4GFXA 4XVTL 2KLRA 4A7UA 2Y7LA 4HIIB 3RU8H 3U2JA 2BS8A 3CVIH 2OMBA 3KYNB 4L48A 2PW2A 1F6LL 3G5WA 3N55A 3S5YA 4PRHE 2DMKA 2OXGA 3H54A 1TMQA 4O02A 1YMMA 1WCQA 1RERA 3MUUA 5IBLC 3ZHKA 3CD4A 1U8NA 5I73B 1E4WH 3KWWA 3AROA 3SDCD 2HH0L 5T1LA 4WSJA 5IGXH 5F7WC 3MRIB 1ZXKA 4UQDA 1YQVH 4I77H 1CICA 1QO3A 3DA0A 4WFGE 4YO0A 5FO2A 3ZIYA 3VXME 2X4NA 2IC2A 3LQMA 4FHJA 4L1TA 1GAFL 3D08A 2J72A 1KBWA 3BVTA 3U30C 4BUGA 2ZAIA 3FQUA 1CUOA 3ZSTA 1QAWA 3KZ8A 3INUL 3KYMA 3M8OH 1HXMA 5JPNC 3MRGA 3O3UN 3RPKA 1NMBL 3IJEB 2D4FA 4TRPH 1QASA 4JHVA 1A6AB 1SM3L 1FFTB 4RESB 1EERB 1G9NH 3UJJH 4WAFA 2OJEA 4AKQA 4OCMC 5C6TH 1GKOA 1X4ZA 5ERWA 4IEFA 3PNWB 4XT1C 4G59C 1Y6KR 4XMVA 5IR1B 1YN6A 2BRQA 4G6AC 1Z5LA 1CXFA 15C8L 4PJ5E 5D2LF 1DLFL 3H3PH 3LPFA 2NYYD 3V0WH 4G6KH 5LAXB 4R7XA 4XVSL 1A3RL 1YDPB 3DURB 2ZCLH 1GCFA 2AAVA 3WFDL 5JHDD 3ULUF 1QSFE 3B2UC 4FQPA 1BD2B 1OHQA 3MODL 1MKFA 1GGBH 3SCMB 2FEEI 4KOBA 2P1YA 1F45A 2MJWA 2WXRA 2E6QA 3P3RA 3L1OL 1SJEB 3P40A 3PLYA 4MA1B 1SHMA 3MRNB 4FQQB 3G5XA 3MJ9H 3NCCB 1HHHB 3PS6A 3ZE2E 1UJTA 4LHUB 5LNGA 3IDNB 4IMLA 4GP8B 4MD4A 2X41A 4RGOL 5ID1B 5CP3H 3J27A 2P24B 1CYGA 1XGTA 1NCWL 2HLFC 1UD8A 2HUHA 4NP4L 1NBZA 5EU4B 1WBZB 4F37K 2JCCA 2NY1D 3NRPA 4YX2H 5L2KD 1T0MA 3D85B 3L3JA 5IT2H 4QAMB 5KZCB 3P9WB 4J3TA 4X98B 5F3BA 3QUXB 1AI1H 1MFEL 1UUSA 3BKCL 1TJMA 3M46A 3VXSE 4YBQD 4ELDA 3O2DL 4YUEH 3S5LB 2O5XL 4J28A 2ZX9A 5JIQA 4MDRA 2VXSH 2HWZL 3NT0A 4NQUA 1OP5H 4ZMNA 4NN6C 3VMPA 2F61A 3GSNH 5IJKC 2YN3A 1L7IH 3LHPL 4PJFA 5BZZA 1DJWA 4U6XA 3QUYB 1NCAL 3DOHA 4TL5A 3N42B 1KIUA 4M5ZL 3RI5F 4HJGA 4KQ3H 1DDHB 2CDFA 3WO4B 2E7MA 3O8XA 3MYJA 5INDB 3VMNA 3GMMB 2NRDA 4M1GL 1D5BB 5F6HI 4GS7B 1L9MA 1TQSA 1ZHLA 2DRUA 4KKRA 4LHUG 4AQ1C 2EC9T 3IYLW 2ZOUA 4PJ9A 2BO0A 2FIKB 3VDCA 3EYFB 4GAJH 5IM7A 4L9LB 1OPGL 2QGEA 5K59F 3MRDA 4OTXL 2WYHA 3HMXH 1Z32X 4GW5A 1LEGB 2AEOA 4XP5L 2F08A 2GK2A 2YQGA 1E28A 3DX4A 1JTTA 4JRYD 3BT2L 5IB3A 2BIHA 1D5IL 3DHPA 3SY0B 1U8OA 5I9QC 4EQ2A 2O5ZH 5H4YA 1VFBA 2X9WA 3D6GA 4R7NA 4I2XB 1KN4L 1FVCB 4OBSA 5D96C 3I9IA 4QCIA 4PV8A 4WFEE 4Z7WA 1XBRA 4KO9A 4BA8A 3WY4A 5EIIA 4RDBA 3MUY1 3VXPB 2MTAA 2EZ0C 2QV2A 2IPKB 3DVGB 4WKXA 4WWNA 5FW7A 4OZGE 1WZMA 4MB4A 4X2UA 4ZW6A 4Z7OE 4AWJC 2MMXA 4WFHD 1KSRA 4FTDA 5ITFA 3EYVA 4YMPA 1YEDA 2CJSA 4NO0D 4JZJA 3CXHJ 2X44D 1KBGH 5I6XC 5J1AB 1UCTA 1A6WH 5L8LB 4N0YH 4AQEA 3LZPA 4OR1A 1L9RA 4FI7A 1ROWA 2K70A 1HINH 2GJ6A 4Z3FA 1XIWB 1D5XA 4HK3J 5FWQA 4HS8L 5BQ7B 3NEOA 5KYXA 1FCCA 4K4KA 2F18A 2JQMA 1W8OA 4BFIA 2IG2H 2E4FA 1HCVA 4MYPA 4IRJC 4OJDH 1ZGLM 1IFRA 4LCCB 5CLZA 5I5IA 3L5XH 2CUAA 4S0TD 4XPBH 4DP7X 1SY6H 3GZPA 4GP4B 4CADA 3FJTA 3FQRA 2DLHA 4NYLB 1E7VA 1YMHB 3K5RA 4ZFQA 4KXZH 5D7LD 3WG7B 4NQEB 4DN3L 2EYSB 4Y5XA 4HKJA 1T22A 4JAMA 3RVXC 1QEWB 4HHAA 3NFNB 3PNRB 4UTAA 1RUMH 2C9PA 1G9ML 2AEQH 4GSUA 4JFWA 4NRYA 3S2AA 1J5HA 3L4WA 3LPGA 3H4HA 3QFDB 1R5VB 5IHLB 1ML0A 1F6AA 3BAEH 4JO2H 3QJFB 3MRQA 4HPOH 4NRXB 3W81A 5C8JA 2V2WB 2BW5A 4QXWA 2EXYD 2R0WL 3GI8L 1KEGL 4CJ1A 2YWYA 3GK8H 1GKEA 5SWQB 2R2HA 7FABH 1G87A 3MRBB 4X7EC 3L2NA 1DVXA 4YDKL 4G6ML 4JN2A 4L4TD 2XG5A 2WSPA 4JANB 3VI4E 1UUNA 2VLJE 3L5WB 2R0LL 3HR6A 3SOTA 4N2IA 5D7JA 2HFFA 3EJYC 1DBBL 2DL9A 3QZWA 3ZGHA 4EE2A 3DK0A 4NKOB 3BQVA 3IBOA 3MRJA 1PKQA 3VXRE 4HAKA 1JK9B 4NUMA 1K6QH 1KYOJ 3QORB 1T04B 4KI1A 1P6FA 4AW7A 1AR1D 2R69A 4XR8C 2BY1A 4R97B 4Z7UE 2HVKA 4YDMA 1MAML 1CTMA 1YEEL 3N04A 4X6CF 3WENA 5DJ8B 2Z93A 4Z0BH 2IF7A 4RFOL 1HL5A 3GMPA 1KLUB 1K5NA 3L2MA 1AZUA