1JRHL

Complex (antibody/antigen)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
167
Chain Sequence
b'SVEMTQSPSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETEVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTWTFGGGTKLEIKRADAAPTVSIFPCFLNNFYPKDINVKGVLNSWTDQDSKDSTYSMSSTCEATHKTSTSPIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY A6
publication title Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antibody/antigen)
total genus 36
structure length 167
sequence length 206
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL01
3ULVH 1IM9A 3VFNB 3FT3B 4XMKL 1MNUH 4NO3A 1IGTA 2ED9A 1A8JH 4XC3H 1F3JA 2W0FB 3R4DA 4QXTA 2X4OB 4GMTH 1NBZB 2OCFD 1KJMB 1M71A 3T0ED 8FABA 1JUFB 3LH2L 3WMSA 3DVIA 5D6CA 2OR7A 1ORSA 3MRPA 1JYNA 1KB9J 3UPRB 5EC1B 3LAFA 1KENL 4FN0A 4DVBB 2LU4A 3B2VL 3BEVA 2X1XR 3W2DL 5TH2B 4JY4B 4FTVD 3O2DL 4M1DH 2H3NB 1T5WA 1YYMH 2YEZB 4YR6A 2ADGA 4ZSOE 2DQCL 2ZJSH 3SJVB 1G7LB 3PXJA 5C2BL 5JIKA 4XZUB 2DM2A 35C8H 1FC1A 5IJKC 4P3CL 3RDTA 1CD0A 1O7SA 3IU4H 4K3DL 1UZ8A 5DJZB 5DMIL 4ONFH 5C0CB 3C5SA 3QDJA 5DRNA 4KK8D 3VFRB 1HEZA 5IW3A 4APQC 1ZXQA 3C08L 2B1HL 3SGDI 3EIFA 2BSRB 4LF3B 1UENA 3DOSA 5F96L 3BQUC 1F6AA 2BJML 1WGOA 3ULSA 2F54A 2VZ1A 2VLJD 4QRPB 1AKJB 3KLDA 4LHQB 3L3HB 4ERSH 5DK0B 3V0AC 1FZJB 2RGSA 2UY6A 4YHPA 1BIHA 5JXED 1XF2A 2PYEE 1A5FL 1MAML 4YDJB 3FT2B 4YXLH 4Y88A 3KHQA 3TT3L 4IRJC 3SHSA 3BE1H 1Z2KA 3TFKD 1T83A 5A1AA 2CRIA 4LHJB 1DBML 4X7CC 2UWEA 4G42A 3L5XL 3G6JB 2BX5A 2CLRB 3QEUB 2IH3B 3K4ZA 1FZKB 1Y18B 4KJWD 5GGTA 5FGRA 4K3JH 3FOMA 1N64L 1RIVL 4MXVE 1PKQB 1DQMH 3O45A 1KJ2B 3CUPB 4JFOA 1NLDL 3X3GL 3JV4A 1GC1H 3HE6A 2BC4B 3GSWB 3H0TA 1MY7A 5EUOA 2XG4A 3V5DA 5IHUL 1Q9OA 2G5BA 5CGTA 4OFYD 1FGVH 2X2YA 1S7RA 4LPWA 1IBGH 3MLRH 1PX4A 4YHOH 1ITBB 3BKJH 1DQJA 1T1XA 4KUCF 5EBGA 2ICWB 1KCRH 3UJJH 1NFDB 3MOAL 3FN3A 4OCNC 5DFVD 4C56B 4D94A 2V5SA 5I1CL 4ZUWA 2WW8A 3BH9B 4WI5A 1IGIH 3FQTA 1H5BC 4IDLA 2DQJL 2C3XA 3IDYC 2YN3A 2EE3A 4JZJC 2VQUA 1XGYH 4HZLB 1E4WL 1G9MH 4IS6A 1YDPA 2VQ1B 3MYJB 2MKWA 1Y6MR 2FSEB 2YUVA 3QIBB 4YWGH 3BIBX 1V7NL 5DFTA 5D7JA 4HEME 4D0CB 1XCTA 4X99A 4ZDHB 3WIHA 1EVUA 4NO0A 5CJBA 3NTCL 3GO1H 5EOQL 5EN2B 2AXFA 4U05A 2P8PA 4X6CB 2NZ9D 4ZD3H 4JRXE 1AGDA 3LVEA 1EMTH 1OF2B 4AEIH 1I1CA 3REWA 3OR7A 1BM3H 2BMKB 1FZOB 4PV9A 3P40A 5EIQA 2VIRA 3E2HC 4HFWB 1A9BA 1S7VB 5DEGB 3WHXA 1NCWH 3O6FB 5FDWA 2HKFL 5AD0B 2P8MB 3IXTA 2IWGA 4KC3B 5IB4A 1IM3B 5DVKA 1NC2D 2YD6A 1LGVA 3K4AA 5T5NG 4NQEB 2D4FA 4D8PB 3IGAA 3LKRA 1UXSB 1RUQL 5F6IB 1BZ7A 1P4IH 4O4YH 4GLRH 2YA2A 3E6FB 3KYKL 2XV6B 1NBVL 4KTEH 2CDFA 3MRBB 2A2QT 5BMFH 5JHDB 1REIA 12E8L 1TXKA 1B0GB 4MD5A 4XPFL 4AIZA 3BZDA 1H3TA 2VKXA 1FVCB 3PG2A 5I0DA 5CGYC 2GIYA 4P5KA 5JA9A 1WITA 1T04A 4L4TA 4OV5B 4LLMA 1A7QL 3T1FB 2DQDH 1HNGA 5EU6A 1KNOA 2HG5B 3LMJL 4NN6C 1CFTB 4YDIH 2J7LA 2X4UB 4JPIB 1U8NA 1DSFL 4X6DE 4LQ1A 1PEWA 4PJXA 3D3VA 2GSIA 3NIDE 3TO2A 1U92B 1WBXA 4LLQB 1JF5A 5ID1B 4U6VH 2AABL 2OM5A 3SCMA 3RX8A 3SKUD 2JIXD 4WFGE 4OKVA 1CD8A 5DUBA 3WNNA 5CUSL 4JO1H 4X7EC 3C6LA 2AK1H 3VGHA 1R3LB 4YX2L 1GXEA 1QNZH 2YPVH 4Q74A 4Z78B 2A74B 4NQDE 3FRPA 5E03A 4D3CL 3T1WA 3TBYA 4QOKB 3KXFD 3BVNB 4N1HB 4GT7A 4Q0XH 2C3HA 2Y36L 2BNQE 4OF7A 5IMKA 1BFOA 1CCZA 1V7MH 3OKLB 3ZKXC 3IFLL 4BZ2H 1CR9H 4I8DA 3T65B 1DVFD 5DUMH 4BK4A 1YYLL 1MQ8A 3VXPA 1RULL 1D9KA 1MFEL 3BAEL 1J0ZA 2NY5C 4U3CA 3S88L 4PJ9A 2HFFA 3UTOA 5BV7B 1G9EA 5T33L 3QDME 3RTQD 1WAAE 3AUVA 4ZNCD 4Z7NF 3K3QA 4LLAA 4S0TD 5JO5A 2ZZUT 4ZFOA 4LGPB 2HLFD 5DF0A 4N8PA 4A6YL 2MJWA 4ORGB 3FN9A 3BGMA 3HAEH 2PYED 4KKNA 3CVHB 3Q1SH 4GBXB 1TCRB 3N9GH 2OK0H 2BVQA 4JG0L 2X09A 1GGUA 3MUHL 4GKZB 3M8OH 3NACH 1NCCH 5IKCA 2ADIB 2JE8A 2BNRB 2OJEA 3LIZH 2DL2A 2B1AL 1T22B 2A9MH 2XPGA 4NM8H 5FHBH 5LXGH 2OL3B 5LKNA 1N4XL 5E8DH 1QKZH 3SPVA 4PB9L 1HSAA 2VC2H 4Y16A 4ZAKA 1U6AH 4KKBD 5TQ2H 1UJTA 2GTWA 5BQ7A 1J1XH 1WBYB 1VEPA 4JDTL 4LP4A 1MCWW 5FUCC 3BKYH 3L3JA 3ZE2F 4X6BA 5INDB 3O4LD 5IUSA 5HHPA 2P24A 1A6TB 1QO3A 2FZ3A 4V1DE 3QG6B 1FYTA 4OD3H 5FKPA 3HPJB 3EZ8A 2RB8A 2J8UF 1Z3GH 1O7VA 3ROLA 3TESA 3GDBA 2ZUQC 2F58H 3L7EA 5E7BA 5I8OH 5J3HC 3LKPB 4MSWA 4JY5L 3RZCB 1UM4H 2H9GB 5IB2A 3UTPD 3C2AH 5ETUA 2EH7L 2QV2A 5H8DA 1Q0XH 3CCHA 3S3PA 5E2UH 4MNGE 4O02H 1C16A 2BY2A 4F57L 1VGEL 5A2JH 5CLWA 1P6AB 1VKXA 5IB3A 1HCVA 5DQDH 3ZMRA 4POYA 2J4WL 4HS6A 1F3JB 1CLCA 4K3HA 4WV1B 4QXTB 3UP1A 5T3XH 2X70B 1K5NA 3LQAL 5SWQA 1FN4A 1M71B 5SV3A 1U3ZA 5E2WH 8FABB 3O6KH 2ZG2A 1MUJB 4JFEE 4LLWA 4HWEH 1F8TL 4QXGL 4QNPF 4R4BA 5CSGA 1RZJC 4P5MA 4BQBA 3PJSB 2Z31A 3PV6B 1Q72L 4GRLB 1QP1A 1U8MA 3BEVB 1U8KB 3QCVH 2H2SC 3A6CH 3PGFH 2G2RB 1ZHNA 4IEFB 4QHLA 3S97C 1KIQA 3TV3H 1D5ZA 3CX2A 3QWOB 4YR6B 3DYOA 4P2RD 2ADGB 4FQPA 4S1RL 3GNMH 4RMRA 4P4KD 5KSAD 2BY3A 5I2IA 3QWRA 4N5EC 3MACH 4JFDE 2HAZA 3WKML 4NNXB 1KG0B 4G8IA 1UZ8B 1J9CT 5CEZE 4DN4H 4HQQL 2ZCKH 3QISA 3T2QA 2HRLA 3C5SB 3QDJB 2PXYB 3GMLA 2GJJA 5DRNB 2A83A 1RJYB 4NFDA 2VLKA 2NY1D 2P49B 2WWKT 5GRWA 4K8RH 4H20H 1ERNA 4S0SD 1ZLSL 4KI5E 5CEZL 1NC4A 2CDGB 5KVEL 5J13B 3DETD 1MH5B 1MJ8H 2G5RA 5DD3L 1YEJH 1F6AB 5D96C 5MEND 3ULSB 3TBSA 5I9QB 4N8VA 1YY9D 2RHEA 2VDOH 4PRHE 3UBXA 3CZFB 3EJYD 4YHPB 3EO1A 2NX5E 1WZ1L 2RQ8A 4M7KH 1HH9B 2IFGA 1OLLA 3KJ6H 3HB3D 1TPXC 3O11A 3NN8A 1D6VL 4LAJH 3GSVA 3N1MC 4PJEF 4KK8C 2A73A 2D7TL 3U0PA 2UWEB 4G42B 3GSXA 4RFOH 4EDWH 2Z35A 4R26H 5B22A 4M8QA 4Y8DC 5C0BD 1ZT7A 2HWZL 1S9WA 1X44A 5HGDA 3WFCH 3WN5B 4R7DA 2IBZX 1JK8A 5HDLA 4RNRA 4P2CG 3HG1E 3KPPB 4JPWL 5DEZA 4D2NA 5CHNA 5HYFA 3O45B 1CGTA 5JUEL 4JFOB 3QUKA 4U1NA 2PKDA 4XMPL 1OCWL 3HE6B 3RWFA 5HY9B 3H0TB 3ZYJA 4LSPH 3V5DB 4PJIA 3SE8L 4YO0A 1MHEB 1S7RB 3VXUE 1OGAB 2OX5A 4X6EA 1DQJB 1T1XB 4BFGA 2ENYA 2DQTH 3OXRA 1I7UA 4MNQE 2DTSA 2WAHA 5IBUB 3TFKC 4ZUWB 4LMQI 3DWTA 3IS0X 4OCXL 1AQDA 1U8JA 2YPLD 5DVMA 4M6NL 4KQ3L 2VL4A 5D4QA 5E2VH 2LTQB 3VXOA 4PREB 4GQ9L 2X89A 4L9LA 3MRJA 5HHQA 2Y07L 5MI0B 4OZHF 1LO0L 3U7WH 4KHTH 3KPRA 4X5LA 1N2RA 4FXGA 5I1GL 1NAKL 2JB6B 4JVWA 1DZBA 2AP2A 1YZZA 4EUPH 3NFPB 1AGDB 4NBXB 1QEWB 3ZL4L 1X6NA 3MLSH 3REWB 1DBKL 5DT1L 5DFVC 3KG5A 4PV9B 1MHCA 4XNUL 1MFBL 4JLRB 2VIRB 4X7SL 1A9BB 4EDXB 4EVNA 3WHXB 4N1CA 4Y4HB 1BAFL 4PJ5E 3IXTB 3G5ZA 5IB4B 2XRAL 1IEAB 1XF3A 3MV7B 1KCUL 5D7LE 1SY6H 1OHQA 3LKRB 4PGDB 3KGRA 4F7CA 5TE6H 2XKSA 1VESA 4MVBD 3OR6A 3Q5OA 4GRMB 4X5XA 2VXSH 5JDSA 2MPAL 4QTHA 1HI6A 4QTIH 4ZO7A 4LNRA 4GQPH 5IG7A 2GT9A 2D7MA 1A1MA 2P42B 1FE8L 1NANI 1T04B 1WT5C 2OTWB 4LLMB 4LASH 4W68A 1KNOB 1UT9A 3OB0K 1YNLL 3SDDD 3RVXC 3H9SA 1UADC 3V5KA 3T8XB 2W0LA 2IC2A 4RCAA 5JORB 4KGJA 3TO2B 3RUGF 1NSNL 3QCTL 2VZVA 4YDKH 1JIBA 1HQ4B 4KMQA 3H2WA 5HI4D 3SDAD 2PR4H 1NCBL 1NQBA 3GSOA 5DUBB 4XCFH 3QEQE 5D70L 4UOW1 3C6LB 2FLBT 1H0DA 3GMPA 1AI1L 2VWEE 2EDRA 1IMHC 3TBYB 1JGEA 2YA1A 5DHYA 3KPQA 1AXIB 5IMKB 1BFOB 4M00A 5CEZD 1TENA 1VHPA 4OZFG 2LU7A 5D7SL 3EYOA 5BO1H 3B3IA 4H88H 4JY6B 3VXPB 4XHJD 1UH4A 5F9WC 1D6EB 5F1SA 4JZOB 4JQVA 4PJ9B 4L4VE 1BREA 1WUNT 4ZQKB 3PDGA 1KBGH 2BVOA 1BEYH 5HDQL 3CH1A 3OWEA 3KNBB 2YHGA 2R9HD 3U7YL 4OZIA 2VO5A 1EHLH 2QSVA 4WNQA 5JO5B 3B5GA 4JM2F 5CP3H 2SEBB 1H8OA 3VXRE 1UCTA 4GAGL 5GS2D 2FR4B 1BWWA 4WFFD 3BGFC 1KV3A 2FIKA 1BLNB 3HPLA 3UTSA 3BPNC 1KIRA 5DHVH 4FFYH 4NUGH 4HPOL 5IKCB 3O4OC 1K8DA 3N85H 4X4ME 2OJEB 5H2BA 43CAA 3GI8H 2CIKA 2DTMH 1SMAA 2XPGB 4RMWA 4U7KA 3I84A 5SWSA 4Z7VA 4NC2B 4UQ3A 3SPVB 1PG7W 4Z7NE 1HSAB 1BJMA 1GIGH 4Y16B 3QUZB 2AAVA 1M4KA 3DJ9A 2GTWB 4M02A 4C54A 3RTQC 1RZGA 5BQ7B 4X7DC 2J6EL 3C8KA 3P4MA 3L3JB 1QFWH 4K07A 4X6BB 4UUJA 5HHPB 5F7DA 3D69B 3HNTL 1JPGB 2F5AH 5I75C 3MNZA 4LSSH 5EU4B 1XGRB 2FZ3B 1IQWH 3MX0A 4Y4KA 2HLFC 1C5BL 2B0SH 1WTGT 3MPCA 5IGXH 2VJXA 3BW9A 1A1NB 3K8LA 3VXTA 4LSUH 3S8WA 1FGNH 2C9AA 4PRIB 4XPBL 5T1DH 3ROLB 3OSKA 1A7OL 3L7EB 4L3EE 5E1HB 3D2UA 4PJBB 4MSWB 3GMRA 3LS5L 4L29A 1H8SA 1G0YR 2G75B 3NPSC 3J8F7 1OQOA 1G7PA 1RV6X 4JHAL 3DUUA 3ZE2E 1Q8MA 4YQXH 2DLHA 3CCHB 3WS3A 3TN0B 1X5AA 1CGSH 4C57C 2HFGL 4KKBC 1QBBA 1HINH 2Q1EA 1J0KA 1VKXB 1A6ZB 3V6FA 4J3SA 1T1ZA 1BVLA 5GRXG 4WU5B 3KPOB 3WIFA 4FZEH 1K5NB 1BF2A 5SWQB 5AAWA 1FN4B 5L0QB 4HPYL 4OBSA 4KUCD 3IDJB 1NEZG 2R0ZH 2DI8A 2ILLA 4LPYA 5JR1L 3ZTJH 4NN5B 2IANA 5DJAB 4R4BB 4CN4A 3BOVA 1CFQA 3LN9A 1AIFA 3F58H 2Z31B 4RDQG 4WRLA 3O41B 1U8MB 5CEXA 4O58H 4X9HA 4TSCL 4G8GD 1ZHNB 1T6WA 4IRZL 4MJIA 4QHLB 4FQIH 1KIQB 3FQXA 5D2LA 5GPRA 2AXGA 4AENB 3K1KC 4PJ5D 4YZFF 1ZE3C 4X98B 3WNKA 1AKJD 1RI8A 1TETH 2E9JA 2OBGA 4L8BB 1I1AB 2DJSA 4PGZA 5T3ZE 2PO6A 3P9MB 1BVKA 1WC7B 4BH7A 4G8IB 2DM3A 4FQ1H 4PJHF 5JZ7D 5F7HA 1AR2A 1R5WA 1UXWA 4NHCH 4PJFA 3WSQH 1QR4A 2AI0L 3GMLB 1YMME 3PQYE 2A83B 1T21A 2OLDA 5FO8B 4I18A 4MCYB 1OAQH 2V7NA 2Q6WB 1FVDB 3VMNA 1HHIB 2XQYK 3CVHL 3ZLQC 3CSPA 5A40E 4R4FL 5F7UA 4FFZH 3AREA 3G9VA 5T1LA 1CDBA 2MQ0A 1NC4B 3IFOB 1QFUH 4OJFL 1TJHH 5DRZB 2H8PA 4P48A 4LCWB 1G9NL 4GJTB 3MZGB 3I50H 3MXVL 4HLZH 2DYPA 4OGYL 3TBSB 4U0RB 2XXMB 4J6RH 5F70A 2OL3L 1P4BH 1IAKA 2YRPA 5L88L 4MZ3A 2D0GA 1EVTC 1FBIL 3ARGA 4P4KC 5KSAC 1OB1A 4RAUA 4L8DA 5T5FL 4OF5A 3VH8A 2HJKA 2D7PA 4YGVB 3NN8B 1F4YL 2R0WL 1MCWM 2X1QA 4EUPA 3GSVB 1XGQA 4JVUA 2WQ8A 5L2KA 2IMMA 2NY1C 2BHZA 4TULL 3FB7B 2DLFL 3GSXB 2Z35B 4QGTA 4M8QB 1NEZA 1S9WB 4R7DB 1JK8B 2FATH 3RWCA 5FDYA 4GXUN 4G9FA 1KIPA 3RX5A 4UV7H 5CHNB 6FABH 3RZWA 1RUPH 3VGDA 1SY6A 4U1NB 1HHGA 1I8KA 1WWBX 4ODSL 2IALA 2P5EA 4JN1H 4PJIB 3EJYC 2JCCB 4YO0B 4IJ3B 2XOTA 4ISVA 4RMQA 1G6VK 3HB3C 4G6ML 1OP5H 3UC0H 4KI1A 3S4SB 5E9DD 1U8QA 4XI5D 4YDLC 5IW6B 3JVGC 5JXAH 2EXWD 4PRBB 1T66D 4MDIA 4N0UB 3EDDA 1HSBB 1U8JB 5HYJE 1CF8H 4HWBL 1NGZB 3DBXA 1YEKH 2AJXL 2BSED 3VXRD 3VXOB 4CNIA 5D5MB 1UB6B 2JELL 1A21A 1T20A 1A7PH 4MA8L 5DZLA 3STZB 4ALAL 1IGFH 3RNQA 3MRJB 5IVXF 2IG2L 2D4DA 4Y2DC 5KSBE 2XQBL 4F8TA 2DQIL 2DIJA 3KPRB 3FO0L 4DN3H 4I2XE 1N2RB 5EU7E 5DMJB 2EC9T 5B8CC 4HJ0D 4BK5A 4DAGL 4DZ8B 4Y19E 1WSST 4TPRL 4QHMA 3QXAA 3VXME 3QDGE 3HUJE 2OTPA 2J1KA 4PGBB 4U7MA 3BKCH 5KW9L 4Z7WB 1U8PB 3KPMB 3P4NA 2Z8SA 3WUZA 3H42H 1JF6A 2RIKA 3AVEA 4HK3N 1L7TH 3SKJH 3RL2A 1MY5A 3G5ZB 3HFML 4WJ5B 4GAYA 4N90D 1B6UA 1JZ3A 4OZHE 2WLYA 3NFSH 3LOWA 4OLXL 5B39G 2XACC 4NGHH 4F7CB 1YEGH 1RJZB 1NJ9A 3OR6B 3KPSA 4L3ED 2EH8L 4UU9A 2BSTB 4NZUH 4M7JH 3U9PL 3TYFA 2CRYA 1KTKE 2V9RA 1X5FA 2ADJB 2VNCA 1ZA3B 4KVNL 1FVEB 3OF6D 4F15C 3NZ8A 4LNRB 1A6AA 1B4JL 2N7BA 3ARYA 1HXYB 2I5YH 1ORQB 2HT2D 1EEUA 5CP3A 5ANME 4WVRA 4JO3H 1GRWA 3HAEB 1N0XL 3ILPA 2GSGA 5IBTL 1MHHA 2XN9D 5BOPA 4LDOB 5DHVA 4MXWH 5ISZE 1FRGH 2E7CA 3MJ9A 1JHKH 1EUTA 4PB0L 2O5XL 4D9QD 4GG6A 5D1ZD 4PRPA 2A6KA 3G5YB 4BSWA 4LMQE 4NRYA 5BJTA 3MLWL 4ZOEA 4LLUB 4MVBC 4BKLA 3C09C 3GMMA 3QO1B 1IFHH 2R29H 1Q1JH 2DQUH 1EHAA 3P2TA 5FGBA 1AJ7L 1JHLL 4TUJA 4EBQL 1H0DB 4BA8A 1KN2L 1RZIA 1Z9MA 4JREB 3LQAC 3S7GA 1EO5A 4F7PB 3VFGH 5ICXB 4W6YB 4XP1L 1I3VA 5L6YL 3QQ4A 3KPQB 3RUGE 3MLYL 3QXTA 4OCMC 1P1ZA 2VLME 1KFAH 3AAZA 1WAAA 3B3IB 3EFDH 3EOTH 3EDFA 4UT7L 5J11C 3ZDXF 1GGBH 3S36L 3FFCE 5HI4C 3SDAC 2BVOB 5ERWA 4CU8A 3MREA 1LK3H 2CLZA 4N9GA 4OZIB 2ADFL 4X8XA 2R1XA 1T2QH 3TNNA 1WIPA 5SWZA 2Z9TA 1CTOA 5D7IA 3CZJA 4PGCA 4HUVA 3L1OL 3CXDL 1RIHH 4RFNB 3WJLC 2W38A 4L8SC 1DR9A 3CFCH 4WTZG 3KWWA 4LLVB 2FIKB 1KIRB 5DO2D 1TITA 5HI3D 2VXTH 4C4KO 4OM1L 2DBLH 3HCVA 4X9IA 5KVFL 43CAB 3IKCB 4UV4L 2CIKB 1A0QH 5DUPH 4OLEA 4XHJC 5HGHB 4Z7VB 5SWSB 4UQ3B 1E28A 1QFWM 5LWYH 3NCYS 5DDHB 4HUNB 4Y1AE 3D0LA 4V1DA 2FJGB 3VA6A 1RZGB 5KVDL 3C8KB 2OI9B 3P4MB 5DA0B 3CFKB 2R9HC 4KDWA 4UUJB 3WO4B 2CIIA 1T03L 4XPTH 3UTTB 4AM0B 4Y4KB 2N1KA 1NMAH 2FIRT 4U2YA 3BHBB 5BRZA 1MI5D 3WDJA 3QNZA 5FHAH 3S9DB 5F7LB 2CXKA 3TBVB 3BKMH 4P99A 3L6FA 3INUH 5I1AB 1NH6A 4M43L 4N0FB 1F4AA 1NGQH 3BMVA 4L29B 1G7PB 2OMBA 4PJAF 4XRCA 5DZNA 1OARL 3GRWL 4HAGA 4LRIC 2NY5H 3P4OA 4OGXL 3WS3B 4JFZL 7FABH 2FBJL 1BFSA 3MRIA 1J05A 3WS6A 4NIKB 3WHE1 3DNKA 4UDTA 5K9JH 1BVLB 4K23H 2RAMA 4Y5VA 3KVQA 3T0VA 2YK1L 3NIGF 3ARPA 2XQYG 1ETZA 1J1PH 1ED3A 2AW2A 1T7WA 2GAZA 2F9BT 2PXYD 1S7QB 2IANB 3QI9D 3SGEH 1FL6B 4AEEA 2A9NL 2QQKH 4K94L 4Y19D 1CFQB 1KSRA 1NFIB 4Z7QF 4JFHE 5D1QD 1AIFB 1AD0A 4XWGH 5C0IA 3QDGD 4G7VH 1UEMA 1FORH 2MKLC 4HIXL 3N1PC 5CFHA 1ZVSA 5C0AD 4KPHH 5CEXB 1ZEAL 5TPWL 4JO2H 4MJIB 1OAUH 2VYRE 1HWGB 1TVHA 4ZS7L 4F9LC 1HYSD 1MF2L 4O00A 2R69L 4WFHE 4KZDH 5JHLL 1Z5LA 4TUOA 4OTXL 4XBPB 2PO6B 4TN9A 4K9EC 4ODBD 3H7BA 1BVKB 4ZUSA 5DJ0A 1QR1A 1J87A 4BH7B 4PS4H 4YHYB 3D9AL 1RY7B 4OGAD 3MBXH 1BZ9B 3G6DL 1T21B 5ENWA 5IJKA 4YNYA 1JMZA 5BZDB 4JJ5B 4ZFFA 3BWAB 2X4QA 3GI9L 4FQLH 1D5XA 3KYOB 3U0TB 3OXSA 5T1LB 3W9DA 1Z9SA 3JV6B 4F7EA 1M7IB 4XBEH 2H8PB 5I6XC 5DMKB 5AAMA 5DJ8B 3I6KB 3S96A 3C6SB 3T2NH 1V3KA 2DYPB 4TQEH 1LO5B 3MGTA 3X12B 1BWMA 3BP4A 1GOFA 4YHLL 1E4XH 1IAKB 5ISZD 3O8XD 4PJHE 1D5BB 3EGSB 4HKXA 3BQUA 2X05A 3H9HA 3U46A 4RAUB 3QIUD 1MFDH 3VG0H 4NC1C 2R2HA 4M6ML 4YHZH 5JQ6L 5TDNB 25C8H 5I73B 4TVPH 3RP1A 2QEJA 5JZ7C 3FQWB 2CJUL 4EUPB 3SY0B 3HNVL 1XGQB 3RIAF 1GSMA 4YBLC 3C9NB 3QHFH 5L2KB 3G6JF 4IRJA 3W5MA 5F7EH 4XCYA 3TJHD 4ZUUB 3LKNA 4LKXB 1RZJH 4OB5L 1PSKH 2XNAB 3G5VA 3BD4A 3CDFA 4PJ8B 1KUMA 2Y06L 5GS1C 3IETA 1W72H 5E5RB 1SEQH 2VL5A 2IALB 3SDXA 4MA1C 1KGCD 2VDKH 3B9KD 1JPTL 4OCYL 3DV6A 1AC0A 1NFDF 4N0CD 2XZCL 1J0YA 3X13B 1BD2A 3HC3H 2P1YA 1EBPA 3D85D 4MDIB 4U31A 1DE4B 5FYLE 2OYPA 1JZ5A 3HNSL 4X0KA 1CLOL 4Y4HD 3R0MA 5INCA 5E5MB 1E27B 5ALBL 4LSVH 2G9HA 1MVFA 2EYTA 3OZ9H 4JFFE 1AO7D 1H5BA 2I9LA 1T20B 1X5GA 3HMXH 1I8IA 5JW4R 5FYLL 2NNAA 4JZJA 3O81A 5IFAL 3ARVA 4BQ8A 4NKDA 1CXLA 3KYNB 3TO4D 1OAXL 2YBRA 4X6CF 1JGLL 3OGCB 3QXWA 1ADQL 1T0NA 4HD9A 2J8OA 4QHMB 1LHZA 1S3KH 1JRHI 5B38A 4P23B 2H1PH 4PP2A 2NMSA 1OP9A 3V52L 4XI5C 2E3VA 2XKUA 3P4NB 2EXWC 3F7VB 3D39D 2F53E 2YSSA 4MA7L 1E0OB 1GZQA 3RL2B 1C12A 5GGVY 1CFNA 1DBJH 3O6FC 4DUWA 3MRLA 4Y5XC 1DN0B 2XZQH 4E0RA 1E4JA 5I18H 5C07B 1N6UA 5EO1B 3DHJA 2ICEA 4JZNA 4LPCA 4OFIA 2XXCB 2AERT 3C87A 3ZKSD 5GRUL 1KB5B 3MFGB 4LQFL 3TYFB 2HRPL 4YEEA 1ZT4B 5E1AA 2DQFB 3LEVH 3MRCA 4HJ0C 3JV0A 4R9HA 3D0VA 1ZHKB 2J12B 4YFDB 3PL6D 1L9MA 4LCIH 1A4JA 4OZ4A 4KK9D 3LV3B 1R3IL 1LE5B 1KYOJ 3SQBA 1ZSDB 2DN7A 1GVIA 2B8OT 4I3RH 1VACA 4G6JL 3EYUL 4NRYB 5BJTB 4LPUA 3PWNA 4X5WA 4BKLB 5HPMA 2YN5A 4YC2B 3FOLA 3OKDA 4ONGL 4NZTH 4NP4H 1EZVX 4NFBA 2GCYA 4Q6IB 5GXBB 1M7DB 2WWMD 4UDUB 1A4KA 1M05A 1NBQA 3OKOA 1LO4H 5JIHA 1DANT 4A2MA 1JPSL 4WFEE 2HT2C 3UJIH 2AEIT 4MJ6B 2R1WA 1FIEA 1PZUB 2Y25A 3LN5A 3RY6C 4B0MM 4AG4H 3PP3H 1IC4H 1P1ZB 3BEWA 2VDRL 3MJ7B 4ZOBA 5CLTA 2Q7YB 2BDNL 1MFCL 3BO8B 5HHMB 4OGZA 3QYCA 2EDYA 5C08D 3RX7A 4PJGA 4B50A 1WWCA 5BV7C 1AGEB 3MREB 4N9GB 1TZHA 2DLEA 1JGUL 5LGKA 4BJLA 3TNNB 1FH5H 5FYKL 2HFEA 5CD3A 4AYFA 2YMXH 1CE6A 2E27L 1A6UL 4Z5RB 4Z8FL 5GGVL 1TCMA 3L95B 2X9YA 2OP4L 1KCVH 3S37H 3ZDXE 1S9XB 4UT9H 1S5IL 3I6GA 3EYFA 2Q8AH 3H7LA 3A67H 1MRFH 1E28B 2JJWA 1UWEH 1AC6A 1TTGA 2ZP0T 2WP3O 1VFMA 3O9WB 5E4EB 3DVNA 5IEKB 4NRZB 4BQ6A 4QF1A 4OI7A 4Z6AT 2EKJA 1B88A 5TFSL 3QQ3B 2CIIB 3EHBD 5ACZA 5JOEA 1YN6B 4HLJA 3NCJL 2VZSA 5DQJB 5BRZB 3VXNB 1E6JL 3QNZB 3X11A 3ZKND 4LCYA 3BUTA 4LDLB 1NCAL 2DAVA 3LH2H 5SX5K 5HD8D 2AV7A 3L6FB 1ACZA 5HI3C 5HSFA 4NQCE 3N50A 4KJQD 3MV8E 1ULVA 3EYVB 3MLVH 1WQVT 1YQVL 1KENH 1AP2A 1BQHG 3DRTA 1I8MA 3SOBL 3RZCC 4RGNB 1KF9B 3F7YB 3O2DH 1HIML 3LY6A 5EZIL 1RVFL 2X4TA 2WM0A 3MRIB 1XZ0A 4UOJA 2DQCH 4PRNB 5C2BH 1NCDH 3I85A 3PWPA 2XY1A 4P3CH 5CZXD 3LEXA 3GFUA 4WV1C 3QQNA 2IAMD 1ETZB 4K3DH 5DURB 5DMIH 1H3VA 3CD4A 4DGYL 3IS1X 5I1JH 3ALWA 4PJCE 5C0IB 4PJAE 3C08H 2B1HH 1MFAL 1EV2E 2YD7A 4CW1A 3MUY1 3QPQD 1ZLVK 5F96H 2BJMH 1Z5LB 5E6IA 1W72A 3MUZ1 3QNYA 3DX7B 3NIGE 3U36B 4ELKA 5DJ0B 4RGMC 1QR1B 3R06A 1A5FH 3TZVD 1MAMH 4NOFA 3OGOE 1JNNL 2CH8A 4Z7QE 4X4ZA 4M5ZH 2BK8A 2AJYL 2XZAL 4HMCA 5ENWB 3MRKB 3F5WA 3TT3H 4YNYB 2PXYC 4ZFFB 3QI9C 2X4QB 2XICA 4L1HA 1DBMH 5D1QC 3OXSB 3W9DB 3SJVE 4F7EB 1WK0A 4OF3A 3L5XH 4APQB 4WU7B 2J5LC 1ZGLA 5IV2B 3QULA 5HYSG 4QWWD 1HYSC 1N64H 3OAZK 1RIVH 3HMXA 5I9QC 2YD1A 3QZWA 4OI8A 5C0CE 4IOIB 4HKXB 4POZD 4FTVA 3U46B 3X3GH 5J1TC 5F6HJ 2HT4D 1IGYA 4MMZC 3SDCD 5IHUH 2E9BA 1AD9A 3QXDA 4J2XA 1CI5A 4JHWL 4AEHL 1J8HB 4NDMA 3AMKA 4OGAC 1S9YB 4M62H 2B4CL 3KS0J 2APXA 4V2CB 3PNWB 3MOAH 3GSRA 1T1WA 3KDMA 4M6OL 4IRJB 5I16B 4W4OC 5I1CH 4XCYB 4H25A 5JOFA 5MEOB 2KQNA 3LKNB 2DQJH 4ZUTA 3IFNL 1O5DT 4WFED 1Y0LB 2ZUSA 3WN5C 1CL7I 2AEPL 1E4WH 5EUOF 2JTDA 1F3RB 4E41D 2GITA 4DW2L 1T6VN 2ESVB 3W11C 5CMAA 3MUJA 3QUYD 4HZAA 3O8XC 1V7NH 3QIUC 2BSSB 3EYQD 2V7HA 3VGGA 2VLJA 3NTCH 3DV6B 5EOQH 5FYKD 3UZVB 5DD6A 3MCLL 1C08B 1RD6A 3P0GB 1BD2B 3G6JE 1ZGLM 5DD5L 3PHOA 3FAWA 3HI5L 5E8NB 1JV5A 2AXHA 1FFOB 5KSBA 5INCB 1I75A 2FHCA 2NYYD 3TJHC 4G5ZL 3GGWA 2G9HB 3EDEA 1X5KA 5CAYB 1CGVA 2NXYD 4XNQA 2HKFH 4I2XA 4RBPH 5IHLB 1H5BB 3P9WB 1NGXB 3IDYB 4K55A 2BVTA 5EOCL 3FCTA 3EO0B 3LRSA 2GJ6D 4MX7A 4NYLA 3GSNL 3QDHA 3FONA 1CLYL 1RUQH 5DEFB 3HUJA 4NZJA 5MI0C 1IE5A 1NFDE 4C56E 3KYKH 2QADD 1NBVH 1T0NB 4MA3A 3SKOA 3B9KC 5IM7A 4G43A 2HYMA 3D25B 3AY4C 4J4PC 2FGWL 12E8H 2YPKA 5SX4I 2YXMA 2EDFA 4N0CC 4XPFH 5FF6B 4ZFGL 3EDJA 4X4XA 1NDGB 2H32B 4DKEL 1UJ3B 1A6VL 5D2NB 1K8IA 3MRRA 4X9FA 5E56A 1A7QH 3GJFH 4P9HL 1CGXA 1C12B 4OIBA 3GSUB 2MQ3A 4TSBL 1RMFL 3ARBA 4Y4HC 5JNYB 3MRLB 4I0PB 1DSFH 4CU7A 1OTTD 3E2HB 2KPNA 1UA6L 3S6CA 4YAQA 4MHHG 4E0RB 5KN5A 3GMOA 4X6CE 5GGRA 3P0YL 5HHVL 3DMMD 2AABH 4NQCD 5FA3B 4L3CA 5D9SA 1YMHA 3W0WE 5A2IH 1U93A 4NKOA 3TO4C 4JFYA 3QXVA 3UXFA 5IOPA 5ACMA 3QAZB 4XNZC 5CUSH 1U3YA 3PWLA 4OV6F 1QRNE 4OZ4B 1OAYL 3VGAC 1FNSL 5DD0L 2ZPKH 3RY4A 5CIPB 3AM8C 4D3CH 4NQEE 5IBLD 2IBGA 3WYRA 2VLRB 3QJHB 4PJXF 2C1PB 1WT5A 5KS9A 1D3CA 3OKKB 2Y36H 4WDIA 5I0ZA 4GOSA 4XH2B 5GRYA 4NN6B 5DRWB 3MGOA 3WFDH 3IFLH 1EEYA 5JHDE 4U0QB 4CVXA 5EB9A 4YK4C 1YYLH 1A14H 1W0WB 4BUHA 1RULH 3BAEH 1IAIL 1MFEH 1KACB 3JTSA 3PWNB 1OP3K 4UILL 1NC2A 5HPMB 1NGPL 4FP8L 3FOLB 5IHZA 5T33H 2ICCA 5DJDA 3DSFH 1IKNC 4KMTL 4LSQL 5E4IA 2P46B 1MREL 3I6LD 4OSUL 2GCYB 1S9KC 3RGHA 1A4KB 3OKOB 4EN3D 1MLCA 1VSCA 3PL6C 3OB0H 3RU8L 4KK9C 3OX8A 4RFEA 2BZDA 4A6YH 2R1WB 2BVEA 1UGNA 5LCVL 4K94C 3LN5B 4U3XA 1WLHA 3QIWD 4UNUA 1UKQA 2ICWJ 2IPUK 4XB8A 1E6OL 3BEWB 3G6AA 4JG0H 1LE9A 1CVSC 3E3QE 2P48B 5IMMB 3BIAX 1HH6A 4LU5H 3F12A 3U9UA 2VDPL 1W2KT 2B1AH 3U6RA 1G7JB 3HI6L 5JMOC 4G6KL 3B83A 4PJGB 2QSQA 1N4XH 2YC1A 4RAVB 3O2DA 4PB9H 4QOKE 1JRHL 1Z9OA 4KZEL 5ABDE 3V4PL 4PUBL 3ULVC 3OJDA 4JDTH 3AC0A 2VN4A 5EA0L 4FQHA 2WWMC 2JIXA 5GGUB 5CD3B 1AGBA 5FK9A 3M1BA 4EOWL 2ZUUA 2AV1A 4OCRL 3CC5A 3PABA 4FQXB 3DIFA 3HC0A 4R0LC 4XVSL 1T1YA 3NCBB 4M4RA 4JKLA 4Y1AA 1UZ6F 4TRPH 3S34L 5BS0A 5FGCB 3I6GB 3EYFB 3KXFA 4NSKA 2DD8L 2IJ0C 2X1OA 4YFEA 2I60L 4TOYL 3V5HA 3R1GL 1FQ9C 4JY5H 3G08A 1QSEB 1XGTA 2Q86A 2X7LA 3F6IA 2M26A 1B4RA 3DVNB 5EUKB 4BH8A 4QRSA 2EH7H 3HR5A 5F9OL 4DKDC 1R5VA 4LVOC 1G7QA 4JRYA 3SGKC 3FTGA 1WFTA 4F57H 4GW5B 4UI2A 1QLFA 4GUPB 3RTQA 4Z7UA 3PWUB 5DA4A 2J4WH 4UB0L 1WBZA 4Q6YA 4O5LL 3C2SA 3X11B 3RA7L 3NCCB 3LQAH 4PP1D 4YUEL 15C8L 1HDMA 2AV7B 3HC4L 4PLNC 4OLYL 4KKAD 1LP9A 1F8TH 4LIQE 2PN5A 1MCSA 1ZTXL 3V4UL 2VAAA 4UQ2A 3FB5A 1AP2B 2HN7B 1Q72H 1LO3L 3DRTB 5FEBA 3WUWG 1I8MB 2XZZA 1CTNA 1KC5L 2LV4A 3AS0A 2QHLA 2W60A 5M7QA 4QRRB 2FX7H 2A1WL 1XZ0B 4LRNL 4S1RH 2MCG1 1FDLL 4WUUD 1JP5A 3UBXI 3CFDA 3ECBB 3LEXB 3EHBC 4ODXB 3VWJD 2DDQL 4UINH 3WKMH 1GHFL 1NAMA 2DOCA 1VADB 5F71A 4HQQH 5L0QC 1INEL 2ZCHL 3O4LA 2WANA 4NN5C 5HD8C 5E6ZA 4KUZL 2P5WB 4KJQC 1PJ9A 2DQHL 1ZLSH 4H5SA 3FAXA 2V17L 5BZWA 5LQBL 1FFPB 3B43A 1UWXH 4EI6A 3GKWL 1YEDB 4XX1E 2KL6A 3V0WH 3WV0A 2YD4A 5GZND 3O3EA 4EI5B 2IQAA 3R06B 2IADA 1WZ1H 1S5HA 4KRPD 3WCYA 1RHHA 5MEPA 5CZXC 3ZE1E 3OKEA 3KS0H 1A6WL 2IAMC 3FQUB 5I8CB 1D6VH 5E8EB 1D5MB 4XWOD 1JF1A 1TNMA 3MOBL 5GS2H 5FFLA 3T0EB 3Q48A 4LHUG 5GIRB 4CDGC 2ZCLL 3VFUB 1NUGA 1ZGLB 3RIAK 2XFXB 2VQTA 1E4KC 2APBA 1A7BA 3RJQB 4JPWH 5L9DL 2AJZA 3QPQC 4U0RC 3QZWB 3QDJE 4XMPH 4FTVB 2ICES 5F89B 1R24B 5D96B 1OCWH 3EOBA 3DTXA 3I75A 3D5OF 4P2RA 3W9EA 2EO9A 3ULUF 5LAXA 5I1IL 3PGDA 3IU3A 2KZ1B 2PYFA 4NDMB 4P4KA 5KSAA 2RFXB 5MEQA 3L9RA 3OAYH 2VDML 3P3YA 3QSKB 3GSRB 2LAGB 1A2YA 3L5WB 1MWAL 2Z8WC 2F54E 4I4WA 3DRQB 5HHOD 4P49A 4H25B 2Z92B 3AS1A 4OCXH 4XP5L 4YE4L 3GJFA 3KJ4C 3TPKA 4NQSA 4M6NH 1RAMA 4WHCA 4XNMA 4KQ3H 2OTUA 5FYJU 2APWA 4XNYL 2Q3AA 5J8OA 5FKAA 3P11L 4GQ9H 4EJ1C 4QWWC 4PJIF 2GITB 4BUGA 5BXFA 4HKBA 5CMAB 1LO0H 3QEGL 5EIIA 4POZC 5MENA 1I4FB 3GIVA 4IJ3C 1S7XA 1C1EL 2VLJB 2UWEE 2HT4C 5DD6B 3SDCC 5I1GH 1R5IA 1URLA 1NAKH 4K9EH 3FB8A 5DJCA 4RIRB 4P23D 3PHOB 1G1YA 4JFFA 1GGTA 1MFNA 3ZL4H 3SGDH 2C3VA 4ZNEA 5DT1H 4H0HB 4JHBA 5IMLA 1ZVHA 4ETQA 4XNUH 4ZPTB 5FXCH 3JVGA 2CGRL 1U95B 4X7SH 3T77B 5EUOE 4XNQB 1BAFH 5KSVB 2XRAH 2DWDB 5F7YC 1KCUH 5I76B 4PTTA 3FCTB 3IDNA 3LRSB 4F7TA 5IEHA 5C0BA 3FONB 1EO8L 1SEBB 1TZGL 4P2OD 4LKCA 1F5WA 3QUYC 5GSRB 3JZ7A 3TBWA 3VD7A 4Y2DA 2W59A 2V2TB 2MSPA 2MPAH 2Y5TA 3D18A 3EW3B 1FC2D 5B8CA 3MLUL 4MNHB 1SHMA 5IFJA 3HLAA 1BBJA 1FE8H 1K8IB 3MRRB 3C60A 2ZG3A 4LDEB 5DMGD 4JE4B 4A6YA 5E70A 3NCMA 1UVQA 4K71C 2NYYC 1LMKA 3FQRB 4XCCL 5C3LD 1SBSL 2YD5A 4R4ND 2YPLA 3C8DA 4GRWH 3GMOB 1NSNH 3QCTH 3LHPL 1XR8A 4DFHA 1HHHA 1WWAX 4L3CB 2Z0BA 4JFYB 2QADC 1XEDA 2C5DC 4PJ7B 2DJUA 4M61A 3VD5A 5D70H 1YEIH 3PWLB 4I3SL 2D0HA 3MV7E 3VMOA 5EWIL 1DQTA 2IPUG 5ICZA 4G8FA 1GOGA 2PF6A 1L0QA 4S1QL 1YPZA 3MV9D 1CL7L 2K7QA 1MRCL 4JKPL 1ZLUH 3MGOB 2OSLB 3K80A 4CVXB 5F3HB 1OTTC 5D7SH 1FAKT 4H26B 5EC2A 4NKIL 4MWFA 2O5ZL 2BRQA 3BT2L 1NC2B 2HJFB 4B7LA 3DMMC 4L4TE 3VRJA 1N8ZA 5EU6E 5HDQH 1GGCL 5EFIB 3U7YH 2KH2B 4XNXL 1HE7A 5FECB 2ATPB 4PJXE 3D3VE 1KT2B 1I1FA 5I17A 4HGMA 4JREC 4RFEB 3B6SB 5IR1A 4WCYL 2GFBA 4RA3A 3CDGB 4U1IB 4GAGH 4UNVA 2Z91B 3HE7A 1TQBC 3NCYP 3VD4A 1MCHA 4UIKL 2GK0A 3LPGA 5GSVA 2EDBA 3BH8A 3BJLA 3U6RB 4M3JA 1DUYA 4Y5YC 1IGJA 2AK4A 4OZIF 2H26A 5MHSD 4XVTL 4HH9A 3RDTD 2J6EH 2FWOA 5ID0A 4QCIA 3JUYA 3SDAA 5I15L 2BFVL 1I9RL 4WHTA 5EORL 3SE9L 3OJVC 5FK9B 4EN3C 1CLZL 5L8LB 2Y5EA 5C0GA 2QQLL 3HNTH 3TVMD 2I24N 4V2BA 5HI5D 1BX2A 3PABB 4XMLL 3DIFB 3HC0B 1C5BH 4M7ZC 4MQ7A 1T1YB 2ARJQ 3QG7L 1TIUA 3Q5TA 3TA3A 1BBDH 4XPBH 2MFNA 2PTUA 4NSKB 4Z7VF 4L8SA 2B20A 3BGFB 1R3KA 4G80B 3V5HB 2NY2D 4JDZA 3L3GB 2F54D 3G08B 3LS5H 4WO4B 5ESAA 2Q86B 5A2KH 1DVFB 4RGND 1AH1A 1DEEA 4JCLA 4BH8B 5CBAA 4MD4B 5DVNA 5I1HL 1RUKL 4OCSL 3HR5B 1R5VB 1G7QB 2HFGH 2L4OA 4OIIL 1HQRA 1MNUL 4NO2A 7CGTA 4BELD 2VE6A 2VXVL 4HT1L 3LSOA 2PW2B 1ZWIB 5EO9B 1WBZB 4ZFOL 2B4CC 2ZWLT 1N59A 1UZ6E 2VDNL 4KKCC 2GTZB 4OI9A 4GMTL 1U8IB 3GUTB 2YUZA 4HPYH 4S1SL 5I75B 3W5NA 3LKQB 1HDMB 5J12C 5JR1H 1RURL 1LP9B 4NQXA 5FM4A 5F1OB 3RAJH 1NBYB 2PYEB 2VAAB 4KKLD 4P5TD 3O0RL 5DI8A 1FPTL 3VFWA 3ZKQD 1QSFA 3HR6A 4TSCH 1CGWA 4OFDA 2W60B 4IRZH 5F88A 4KRLB 4OQ1A 5HVGB 5J6GA 1FYTE 1I7ZA 3NPSB 4IMLA 4LSRL 2ZJSL 1TNNA 1X5LA 2YZ1A 5BV7H 1AY1L 1RZ8A 4LRIA 4PRIE 5JDJA 3CFDB 4PJCA 4S2SA 3FT3A 3IU4L 2NY6D 4WI2A 2NQCA 1LQSR 4MAUL 3TPUB 3O4LB 5C09D 1UB5B 4QHNB 3BP7A 4F33B 3DXAD 3HZMA 3NH7L 5GRJL 3CVHH 4KKAC 1NBZA 3DO3A 1MCFA 4MAYB 1KJMA 1RFDL 4R4FH 5CCKH 2YXFA 5D2LF 1KTLB 3FO1A 2XA8H 4H5SB 3PWVB 2MWCA 4OJFH 3GM0A 3CLFH 3MC0A 1GOHA 3MSPA 4ELMA 3NA4A 3HA0A 1PD6A 3L3IB 3MXVH 3WD5L 5EC1A 5D7JD 3T4YB 4OGYH 4EI6B 4F58L 4DVBA 5GRVK 4NO0D 3V2AR 2OL3H 5TH2A 4P2QD 4JY4A 2VR9A 4F9LA 5L88H 2HVKB 5H37H 2IQAB 2IADB 2YEZA 4PJFF 5T5FH 5MEPB 4YHYC 4RWHA 3VWJC 2UVEA 1I9JL 4XZUA 4JDVA 1F4YH 2R0WH 4GFTB 1LEIB 1K2DA 1JF1B 4C4KT 3DECA 4TULH 4IIQC 2DLFH 1X7QA 5C0CA 3VFRA 2ZOLB 4JRXB 3U0WL 2AJZB 1DQML 3DX6A 5DK2B 3R8BB 43C9B 4G8GA 4ODSH 4GSDL 3EOBB 1CBVH 1X5HA 2VLKE 4RGOL 3I75B 3TBTB 2QQQA 3AFLA 2KZWA 1PBYA 3BDXA 4I1NB 4P2RB 2VAJA 3W9EB 5GZNC 4JRWA 4U3HA 4KRPC 4QRPA 1AKJA 1XR9A 2B2XL 3ET9F 4P4KB 5KSAB 4XP6L 3L3HA 1P7KA 4FQCL 3BKJL 1DQDL 5EU6D 3OG4B 3P0VL 3F7RA 1A2YB 3E6HB 3SO3C 4YDJA 3FT2A 4XWOC 4DKAA 3GJFB 3D3VD 3MLTB 1GCFA 4HWBH 2X4PA 2AJXH 2NY1B 3RWHB 4RDQF 1QA9B 2E7LC 2HJLB 4Y7MA 3LEYH 5FKAB 2JELH 1DCLA 1UWGL 4MA8H 4ALAH 5BXFB 2P43B 4HKBB 3ALXA 2IG2H 3IJSB 1FNEB 1FZKA 5EIIB 4YWGL 4HF5L 3GBLA 2XQBH 2XTJE 1UKTA 5MENB 5GS1A 1PKQA 2DQIH 3GIVB 1NCTA 1KJ2A 3CUPA 1R5IB 4DAGH 3FB8B 4I9WE 4HIIA 3ULUL 2BC4A 4KDTC 4O2EA 4TPRH 1I85C 3U30C 4AEIL 2C3VB 5EZOL 5E8PA 1GZPB 1QFPA 5KW9H 2IFFL 4S11A 1PY9A 2VUYA 4YDLB 4LCCB 2N7AA 2ICWA 1MELA 5CZVL 3VRLF 2NXZD 5E99H 4PJIE 3HFMH 4I0PD 4HWZB 3BH9A 4QLRA 3WLBA 2DKSA 3IDNB 4U1GB 4KJYA 4F7TB 4OLXH 4P0DA 2PTTB 5I74C 5C0BB 1EZVY 1CFSB 1H3WM 4WEMB 3ZHKA 1IKFL 4EIZC 3Q3GA 4HZLA 3O2VL 1T7YA 2EH8H 3CIQA 4M7LL 3MYJA 3U9PH 2V6HA 4OQTA 1YN7A 1A47A 3QIBA 3B5HA 1EFXB 4D0CA 4KVNH 4ZDHA 1BQSA 3NOIA 2Y5TB 4R97C 5B8CB 4P23C 5EN2A 1AGCA 3DYPA 3HLAB 1B4JH 1QFWI 4K7FA 5ADOL 2UZXB 3QDMB 2DQDL 2DMBA 4UTBL 5I30L 4WI7A 3CPLA 4A6YB 5E9DA 1JZ7A 1FCGA 3MNVA 5IFHL 1N0XH 5IESL 4IRSD 1I1YB 4M1CD 5IBTH 2BMKA 3KPRE 1P53A 2DJ4A 1FZOA 4FZ8L 2YPLB 3K2UH 4HFWA 1XR8B 1S7VA 1HHHB 2O5XH 5C2UB 3O6FA 1JTPA 1IM3A 2D31B 1G1CA 3TH3T 4P2OC 5C6WH 2LVCA 3C5JA 3MLWH 1U36A 2BNUB 4BYHA 4X6DF 1UXSA 1YNTB 5I8EA 3NIDF 3OG6B 1PQZA 3E6FA 2HLAB 2J6EA 3WDIA 1FYTD 3MRBA 1OT2A 3VXSD 1AJ7H 1JHLH 4EBQH 5JHDA 1KN2H 1EFQA 4LVHB 4HJGB 3DO7B 2QHRH 5ICZB 4N0RA 1B0GA 4G8FB 4F15B 3KYMB 1G0XA 4XP1H 3B9DA 5L6YH 3FQNA 5DMGC 3MLYH 1LDPL 1CDHA 4GG6F 1V7ML 4OV5A 5ESVA 3T1FA 1CXKA 4BZ2L 3I2CL 5DXWA 2OZ4A 3BI9X 1CFTA 4R4NC 3VA2C 4MWFB 4UT7H 4LLYB 2CMRH 3S37X 3ARSA 5KBNC 1N8ZB 4M1GL 1U92A 4ZYKB 1C7TA 5LGJA 2P7TB 5ID1A 1P84J 3H9SE 1U42A 1V3MA 5I1LA 3WNOA 1QLEL 1EGJL 2ADFH 4Q6IC 3C09B 3GMQA 1IZKA 2UUDH 1I1FB 5I17B 1OW0C 2W0KA 3IJHA 5H35B 5IR1B 2W07A 2A0LC 1R3LA 3OF6A 3L1OH 1D5IH 1JGVL 3CXDH 1WAAF 4Z78A 3Q1SL 3N9GL 1F4WL 3SEPA 3LZFH 3NACL 2R4RL 4OM1H 4FFVC 3BVNA 3RWIB 2GK0B 3SDDB 2I07B 5KVFH 5GSVB 5CWSA 4UV4H 2QBWA 4R96A 2ARWA 3CSGA 2J8UA 4ODVL 3OKLA 1J0IA 1U41A 4XPAL 3T65A 2VISA 4KHXL 5C0EA 5J11B 2H26B 4JFEB 3VCLB 4FQQB 4HH9B 4YDVB 2MNUA 5TQ2L 1J1XL 5D7IF 4QCIB 3SDAB 3WKNA 4WHTB 1NANH 3WL9A 4MGXA 3THMH 3HZKB 4F37K 4O51A 1T03H 3S5LA 4AT6A 2FJHA 1LEKA 5FYJL 1I3GL 1K4CB 1UKSA 4XX1G 2FBOJ 1Z3GL 3ARUA 3CXHJ 5C6PB 4L8SB 4JJHA 2F58L 3CVHA 4Y4FB 4OZIE 4M43H 1TCRA 3QCUH 2DBJA 2I26N 3BP6A 2Y1VA 3JTTA 4GKZA 1CS6A 5GZOD 1F2XK 3MRGB 2WIMA 2ADIA 4S1DC 1OARH 2BNRA 3GRWH 3C2AL 4OGXH 3TIEA 1T22A 4JFZH 1Q0XL 1IC1A 5T3XE 2FBJH 4K7PY 1HQRB 3RDTC 2OL3A 3IFPA 2ZUTA 2VE6B 3UTSE 4DTGL 1KPUB 5TE7L 3ULUD 32C2A 3MNWA 3HKFA 3TVMC 2XTJD 2YK1H 4OLWL 5T3XL 4Z7VE 5SWSE 5HI5C 5INDA 4P59L 2V5MA 4FOMA 4PRHB 3HS0A 1A6TA 5J6HB 4FRWA 2XKNB 3FHQA 3IJYB 2A9NH 1OSPL 4K94H 1JYXA 3FFDA 3FO2A 1J86A 2P5WD 3HPJA 2PCPA 4FQJL 3NABL 2NY2C 3MV11 1UQSA 3JUZA 1F11B 2N4IA 2OR9L 5F88B 3CMOL 1IAOA 4RGNC 3UDWC 1TFHA 4ZS7H 3TV3L 1MF2H 4H1LH 1I7ZB 5E2JA 2R69H 3WNLA 1A6PA 1KEGL 3LKPA 3O3AA 3GNML 1CK0L 3RZCA 5JHLH 1RZ8B 3V6OC 4GXVL 2H9GA 3LD8C 2FL5A 4OTXH 4ZTPH 1J5OL 3ZDYF 4EI5D 1WICA 1L0XA 2Q7NA 4S2SB 3T3MF 2KDGA 4J23A 3D9AH 1RIUL 4DN4L 1Q94A 4PG2C 3W39A 2ZCKL 3G6DH 5F7NC 3BP7B 1CT8B 4WV1A 3HZMB 3WXVH 4JPKL 2X70A 1MI5A 3GI9H 4HKJB 3FO1B 4KKLC 4P5TC 1MUJA 2HTKD 1OTSD 2ZNXA 1MJ8L 4ELMB 1FO0L 4U1KB 4U6TA 4P57B 3PJSA 4MNQB 3PV6A 1PY4A 4GRLA 5KTEL 1KTDB 4YHLH 1U8KA 2G2RA 1JHTA 2IANE 2CRZA 1KXQE 3QRGL 4KI5F 3HRPA 3QWOA 5E6YA 2BVYA 4M7KL 2X44D 4M6MH 5JQ6H 3V95A 4JAMB 1JWMA 4JDVB 4KY1H 1F02I 3AU1B 2P45B 5D7KE 4MJIE 1K2DB 1MCIA 3HNVH 5D2LE 5IWLA 2DL9A 3MV01 4NNXA 1KG0A 4I0KA 2ZKHH 4WW1B 5DC0A 1QSVA 4NT6A 3MUGA 1X7QB 2ARJA 2PXYA 3UYOD 3PGCB 4K3EL 1RJYA 3QI9A 4OB5H 1CE1L 3DYMA 2FX9L 2WP3T 4BFIB 3OHXB 5I6XB 2DB8A 3DX6B 5C0AA 4PJFE 2Y06H 4K7PL 2CDGA 3ARFD 3U4AA 3VD9A 1AXSB 4G8GB 1MH5A 5JIIA 6CGTA 4KRMB 4PJ5B 5AZEL 1IVLA 4MB3A 3PDDA 4MJ5A 1XGPB 1XR9B 1JPTH 5GRZA 4OCYH 5HBBA 1ZAGA 2FH8A 1P7KB 3CZFA 3OJMB 2XZCH 1HH9A 3H9SD 5JOPE 4LEXL 1QHOA 1YJDL 3SDYH 3B8SA 4YBLB 2X4PB 1SJEB 3HNSH 2N56A 1QQDB 2AEWA 1KOAA 1CLOH 3ESVF 5ALBH 1VFAB 4M9OA 3OPZL 4W4OA 3HZVA 1VB9A 5EZJB 3FKUS 2EE6A 1F45A 3CU7A 3SDXF 4GRWB 1TJGH 4ORZC 1S7TB 3WN5A 2HFTA 2FHBA 4HXAH 1V8HA 1AFVH 5ALCH 5IP4A 3KPPA 5GS1B 1HKLL 5L2KE 1OAXH 3SE3C 3FHAA 1ADQH 4PG9A 3B9EA 3QUML 3QP3A 4MA1B 4HIIB 5HY9A 1CFVL 4O2EB 3QIUA 5FYJD 4NBZB 1MHEA 4G9FE 1XF5B 5E8PB 1KCSL 3V52H 5I19L 1YEHL 1YEFL 1OGAA 2DI9A 1N5AB 1S7UB 4MA7H 2P5EE 1CQYA 1EX0A 1KTRL 4I48B 1SYVA 1Z0MA 2JF1A 3WLBB 5KOVC 4ZMAT 4KJYB 4X80H 1ZS8A 4QRTB 4WI9A 4G9DB 3RVWD 5TE6L 4WHYH 4PREA 3Q3GB 5EOCJ 2YA0A 3CX5J 5GRUH 1Y6NR 4LQFH 3E8UH 1SMOA 3U1SL 2HRPH 2XT1B 1YN7B 4Q9QL 4LP5A 2A77L 4ZS6D 3P77B 3FRPG 1RHFA 1VFOA 2EEBA 5T3XD 1AGCB 1LO2L 3Q0HA 3QFJD 5A16B 3AY4A 4XPGH 4J4PA 4K7FB 2JB6A 4MLSA 3VRLE 1UJ3C 1R3IH 3LB6D 1VEMA 4LASL 4MYWB 5D2NC 1H15B 3CPLB 3NFPA 5E9DB 1BQLH 1QEWA 3MNVB 1KEML 2JJTC 1QYGL 4DEPB 4N0YL 2A6JB 1U8OB 1Z0NA 4JQIL 1TDQA 4I0PC 4JLRA 4G6JH 1BJ8A 4EDXA 1CD1A 1F42A 4LVEA 4Y4HA 2X4SB 4Y8AA 3VXRB 4Y5XB 1IEAA 1NEUA 3MV7A 1P7QB 3C5JB 4OFKA 3EYSL 4PGDA 3V8OA 4ONGH 5I8EB 1PQZB 4LPTA 5EBMB 2CKBL 3QAZC 4GRMA 4HIJB 2OJZL 1RK1B 1NMBH 1JPSH 4BZYA 5HTSA 5C07E 2FX8L 2AJ3B 3DURB 3FQNB 3KPSE 3AM8A 3D2UD 5E08L 4IRSC 2OTWA 5ESVB 2P8LB 5IQ9B 1SBBA 1IAMA 3SN6N 2VMFA 2FO4A 1TJIL 2JKXA 2VDRH 4HIEA 3T8XA 1KB9K 1DQLL 1HILB 3TCXA 2BDNH 4TYUA 1MFCH 5JORA 2E6QA 2QR0B 1B6DA 5B4MD 4ZOAA 3UAJD 5LGJB 4YJZL 1S9VA 1BEYL 5I1LB 4PRAA 1HQ4A 4S10A 3A6BL 1JGUH 1AGFA 2HT3D 4L3EB 3OAUL 3GMQB 5JLZB 1IKNA 1P2CB 5CEYA 2UY7A 4GKNA 5IVZA 5FYKH 2D2OA 5IJVA 3IJHB 1CGYA 4GG6E 4PRPE 5CJQL 2E27H 2IGFH 1A6UH 4RQQB 4Z8FH 3QH3A 3PL6A 5BVJB 4JGUA 5GGVH 2GYSA 5HHXL 2OP4H 4FFYL 4NUGL 2GJZB 5K9KB 1S5IH 4XB7A 3MJ9L 5L8KB 5CWSB 4PJGF 2XN9B 4R96B 4IMKA 2J8UB 4I5BB 4WO4D 2VISB 5C0EB 1JVKA 4JY6A 2VXUH 4GKSB 2O5YL 5D1ZB 4YXKL 1D6EA 4H1LA 4JZOA 2EDJA 3R8QA 2D9CA 1SJHB 4B41A 3Q6FB 1FFQA 3WFZA 4ZQKA 5TFSH 1PEZA 4LNVA 3WL9B 1VENA 3FB6A 4O51B 3DUSA 3KNBA 3S5LB 2FJHB 1UFUA 4AT6B 4PD4J 2R1YB 1LEKB 4OLVH 1IQWL 3NCJH 2DLTA 1EJOL 4J1UA 3QUXD 2VN7A 1E6JH 4HXBL 5HHME 5IGXL 4FQXC 2LU3A 1YECL 5E94B 1NCAH 2SEBA 3VW3L 4JN2B 5T1DL 4R0LA 3CMGA 2FR4A 1MAJA 3O3BB 3RVVD 1YQVH 1BLNA 3BP6B 5SWZE 3JTTB 4QO1A 4ZPVA 3ZZ1A 5LJYH 3BUYB 3WIIL 2RJMA 3SOBH 5D7IE 4Z7OF 2F15A 3QA3A 3ARGD 1MCQA 4Y0GA 1HIMH 1ES0A 3DV4A 3F65A 3TIEB 4WW2C 5EZIH 1RVFH 1W0YT 4HCRL 3IFPB 4PLKD 5C08A 5L2JA 1NGYB 5MP6L 1UYWL 2BY1A 3QUZA 2C4FT 1CICD 32C2B 3MNWB 3MR9A 2JK5B 3SGKA 2E8ZA 2E9WA 3D69A 3HS0B 1JPGA 4PY8I 5EU4A 1XGRA 5JW4M 4DGYH 3FFDB 3FO2B 4MAYD 4G9FD 2PCPB 1A1NA 1MFAH 1QUNA 4NO5B 1UQSB 4PRIA 3WEXA 3STLB 4BFBD 1IAOB 5J7CC 2R56L 3KR3L 3L3KA 1KJVB 5GZOC 4PJBA 4N8VG 5BRZE 3O3AB 3UBXG 1KCKA 2YWYA 1JTTA 2G75A 4G7YL 2FL5B 5E24E 1LK2B 4XPHL 3TN0A 1FV1B 3ULUC 1Q0YL 4LOUD 1Q94B 3W39B 1A6ZA 5I1KL 1JNNH 2XZAH 2AJYH 5DWUH 3LN4B 3MROA 1T3FA 4WU5A 3KPOA 1MI5B 1K6QL 1MCPL 3IDJA 2AQ2A 4FFZL 2NTFB 3IT8D 4PJEB 1QFUL 1WV7T 1TJHL 5DJAA 4JRXD 3EBAA 5HYQB 3H6JA 1OAKL 3ZDYE 3O41A 5I1EH 1JL8A 2EE2A 3T3ME 5HYJB 4ODHL 3Q6GL 1JHTB 2BVPB 1CDYA 4AENA 4EI5C 1A7RL 1Q9LB 4X98A 5AUMA 3MMEA 1ADQA 4L8BA 1I1AA 1IC5L 1JWMB 3MXWH 4JHWH 4AEHH 3HMWL 4RGMB 4F3FB 2ITDA 5CSBA 3P9MA 1PGRB 2B4CH 1PG7L 1WC7A 5CS7A 4NT6B 3MUGB 4M6OH 2ARJB 3T0EC 3OKNB 2EDQA 5FO8A 4MCYA 3QI9B 1C5CL 2HTKC 1KPVA 4Y19B 2Q6WA 1FVDA 1HHIA 5D1QB 1OTSC 3QDGB 4ZTOL 3KPSD 4HKZB 5C0AB 2AEPH 3IFOA 1NL0L 3O3UN 5DRZA 4CAGA 2J5LB 4LCWA 4DW2H 4PPTA 4WGWB 4JN1L 3GEWB 3RL1B 4X4YA 1WIUA 5IVXA 4MJ5B 1JE6A 4ZUVB 4CDHA 3MCLH 2EDTA 3MGAA 5CBEB 1VEOA 5DD5H 5I66B 3T3PF 4YGVA 1MHPL 4WFGD 4NWTL 4J3WA 2ZUYA 1XGUB 4PRPD 2BRRL 3HZVB 5IMOA 5FA4B 3FB7A 4NQDD 2B39A 1J8HE 1B0WA 1FL5A 4X9BA 5EOCH 5FUOH 3ARFC 3GSNH 4JGJA 1CLYH 2BNQD 4CL7A 5CSZA 5ITBH 4PG9B 3RWGB 5ISZB 3O8XB 1EFXD 2FGWH 3QIUB 1H8NA 2JCCA 5JXEC 4HG4J 4ZFGH 1WEJL 5KSBF 3SDCA 4ONHB 3KLHD 5E00B 4DKEH 1C7SA 1XT5A 5J56B 3QDMD 4X7TB 1A6VH 3HAEG 3S4SA 2ESVE 3SDXE 5IW6A 1SYVB 5GJTH 1N6QL 4TSBH 1RMFH 4PRBA 5IB1A 4N0UA 5BW7C 1HSBA 3HUJF 2AS5M 1UA6H 1ZS8B 2R2BB 1NGZA 1FLRL 3F7PC 1BD2E 1N7MH 5D5MA 3P0YH 2W1NA 1UB6A 5HHVH 1DUZB 3RUGB 4KJWC 3STZA 4FS0A 1R3HB 4NZUL 4XP9L 1ND0A 4IHOA 5F7KC 4E41A 4LEOB 4I77L 4NNYB 4YBQD 3QUYA 5DGQA 4FXLA 3IDMB 2WUBL 4QHKI 4MS8D 3B9KB 4P4RA 1OAYH 1QBAA 1FNSH 3QXUA 5DD0H 2LFGA 4DZ8A 1IL1A 3PP4L 3U83A 3T09A 4DQOH 4KV5E 4MD0A 5FGSA 5GS0L 4PGBA 4XHQA 3D85B 4NPYB 3ZTNL 4Z7WA 1U8PA 3KPMA 1MCJA 3KPLA 2YKLL 1CD1B 5BVPH 1JHKL 1NKOA 5GGQL 3DVGB 4V1DD 4WJ5A 5EU5B 1IAIH 3JWDL 1AO7B 1O0VA 3RVWC 1QHPA 2A6DB 4UILH 1NGPH 1IFHL 2GJ6A 1RJZA 4LSQH 4MHHI 3UPCA 2E5EA 4OSUH 3TO4B 3VWKD 1WF5A 3M07A 2BSTA 4ZS6C 1FJ1A 1F13A 4XNZB 3RU8H 2ADJA 5KS9F 1ZA3A 3LB6C 3BDYL 2NZ9C 3VGAB 1FVEA 4JM2B 3TGXA 5LCVH 1RJCA 4DKFL 1ZLWH 3MRMB 1HXYA 1ORQA 1E6OH 2H6PB 3RGVB 4HIEB 2FO4B 3D39B 3EFDL 4W4NA 3HAEA 1OPGL 5CP7A 4GW1B 2JB5L 3ME0A 3HI6H 4YK4B 4G6KH 3B9AA 4JFED 4RISL 1S9VB 4G3YL 4PRAB 5HVHC 3G5YA 1AGFB 1JRHH 4P3WA 3DMMA 5IB5B 3V4PH 4PUBH 3BZEA 4LLUA 1T2QL 5CEYB 4GKNB 5IVZB 5EA0H 3QO1A 5IJVB 1CZ8L 5FCUL 4EOWH 4YEFA 3QH3B 3PL6B 2A6IA 2X4RA 4XVSH 1P6FA 4F7PA 1MIEL 4HUKB 5ICXA 3S34H 4WEBH 2BY0A 4JFDD 4Y4FD 2GY5A 4JGMA 3C5ZD 2DD8H 2OMNA 2V2XB 3VFVA 4NFCA 2I60H 4TOYH 3R1GH 3D48R 4DZBB 4BSVA 1KLFA 4D9RE 5IF0A 1MJ7L 1TTFA 5HVWA 5B4MC 4H1LB 3UAJC 3IDUA 1KB5H 1U8LB 5F9OH 2HT3C 1LWRA 4KI5D 3IRPX 2XG5A 3FB6B 3GBNL 4XAKE 2KKQA 3UX9B 3FZUD 3DUSB 4NUJA 4J1UB 4UB0H 4O5LH 1ZANH 4GKOA 3RA7H 5FHAL 4U4BA 4O2CB 1N6VA 3MLXL 4EN3A 4PRHD 1V05A 3QQ9D 4YUEH 1V5JA 4PJGE 4HBCL 2C4FU 2NX5D 3UO1L 5LBSL 3HC4H 4OLYH 2XIDA 4R0LB 4HUXB 3IYLW 1ZTXH 3MLZL 5DJYA 4LLVA 4ZPVB 2Y4SA 4RMTA 1B3JA 1LO3H 2ZSWB 4WO4C 3QA3B 3FRUA 1KC5H 1DVFC 5JW4N 3MA7A 5D1XD 3IKCA 1ES0B 3DV4B 5EG6C 1FG2A 1LNUA 2A1WH 2EDWA 5HGHA 4P46D 4Z7UF 4LRNH 4M48L 4U1LA 5C08B 4DJMA 5DDHA 1FDLH 3RKDD 5L2JB 4KJPD 2FJGA 4UMGA 3MR9B 4K23L 1JJUA 3BGAA 4LVOB 5C0DA 3HG1D 2BOCB 3MCG1 2DDQH 3CFKA 4I18C 2Y9RT 3EKCA 3DARA 1GHFH 1PFCA 5EBWB 1LP9F 3QUXC 1QSEE 1INEH 1YJDC 3BWUC 3ZO0A 1DP0A 3UTTA 4AM0A 3RWJB 1WZKA 4G6AD 5FO7A 1B90A 3BHBA 1FNFA 4Z7OE 3CFEA 4KUZH 4AQ1B 1T89C 3VXUD 2DQHH 3TBVA 3WEXB 2V17H 3MBEB 2WBJD 5DJXA 5I1AA 1UM6L 3B5TA 3L3KB 4C58B 5LQBH 4Q9BA 4MNQD 4N0FA 5FUCE 3ARGC 1EBAA 3GKWH 2Y6SD 1J1OL 1VDGA 1SQ2N 1JWSA 4LFHG 4PLKC 5ILTL 1YUHB 3TM6A 4Q9CA 3LQMA 3VH8G 5DVOA 1CICC 1BZQK 3MRFA 4AIXA 4EUPG 3MBXL 1A6WH 3QFDB 5HGBA 3MROB 1VCAA 1T3FB 2V5YA 3BYYA 2Z4QB 1JPFB 1OP5K 5GS0D 3V79C 4R7NB 3HZYA 2BHUA 3PWJB 1X9QA 3MOBH 4U1JB 1U3HD 4MAYC 1S7QA 2Y23A 3SKMA 1FL6A 2ZCLH 5I71B 1NFIA 1WVZA 1KJ3L 3PWPE 4ACPA 3HI1B 1T5XA 4TVPE 5L9DH 1EHXA 2V5TA 3GMNB 3GSNA 1FAIL 1J10A 2VITB 4UTAL 1CDGA 2VDLL 1CIUA 5AUMB 3MMEB 5I1IH 1A22B 4HJJL 5D7LD 4LOUC 5F3BA 4HHAA 4DWHA 1K85A 4XBPA 5JW5A 2ITDB 4WUUA 5DC9B 3B9VA 2VDMH 5GJSL 5KJRL 3VWJA 2IAMB 5FV1L 3RQ3A 1MWAH 1BZ9A 4HDIA 5K9QI 4YE4H 5T3ZL 1IILE 2D7NA 5BZDA 3JWOL 1TVBA 1KPVB 4JJ5A 1BIIA 3BWAA 1VFUA 2NY0D 2CDEB 4IIQA 4XNYH 5AWNL 2WMPA 1PZ5A 3KYOA 4OLZL 3U0TA 3GHBL 3BRDA 3IF1B 3JV6A 3P11H 1MIML 1M7IA 5DMKA 2DIAA 5DJ8A 3I6KA 1SEQL 5CKAA 3C6SA 1LO5A 3X12A 4X4YB 5IVXB 3PHQB 4KTDL 2LQRA 1C1EH 3O6LL 2YD8A 1D5BA 3EGSA 4Y89A 2NY3D 1OOAA 4JM4L 4X9GA 5LGHL 3UEZA 3TZVB 1QACA 5TDNA 5HJ3B 2FH6A 1EERB 3FQWA 4FXKB 3G9AB 3MCKB 3QEQD 3SY0A 1BF8A 4FTVE 2XWTB 2CGRH 2O93L 4PBVC 5EBLA 3C9NA 2C7UA 5IMOB 1N0LA 1JYVA 3KJ4B 3HMXL 1FL5B 4ZUUA 4LKXA 1EUUA 1UACH 2GY7B 2VZUA 4PV8A 5GGRY 2ZUWA 4LARL 1EO8H 2UV3A 2FB4L 1TZGH 2XNAA 3DETC 4NM4L 1S8DB 2GEEA 4PJ8A 4OFVA 5CSZB 2VXQL 4ONOA 1YY9C 3K2MC 3T3PE 5IROC 4LL9A 3RHWF 4JO4L 3SDCB 1CQKA 3MLUH 4L4VD 5A2FA 2VLLA 1DLHA 1GAFL 3AB0B 3PDOA 4KDTA 3K81A 1WZMA 3X13A 3KPNA 2CUIA 4XAKD 4HS3B 4LCCC 2X40A 8CGTA 5IB1B 2R15A 1R3JB 1DE4A 1TVDA 4OF6A 3RVTD 4XCCH 5KANG 2VLJE 4WHDA 1SBSH 4LLDB 1BOGA 4U1GC 5E5MA 1E27A 1W0VA 3LHPH 4BQCA 3BRGC 2PETA 5FO9B 1P7QD 3LRGA 2ERJC 1ND0B 4IHOB 4E41B 5GISL 2HH0L 3LEVL 3QUYB 3EOAB 4W81A 5C71A 1NCNA 3KYNA 5F7WC 1INQA 4P4RB 5E8OB 3OGCA 4I3SH 5EWIH 3BZFB 4LBEB 4K2UL 3KLHC 1UCBL 2UYLA 1IL1B 1VGKB 4PRDB 4P23A 1I7TA 4MD0B 4Z0XB 1IAIM 4S1QH 3PXHA 1HK6A 4JB9L 1CL7H 2EO1A 1G7HA 1MRCH 4JKPH 3F7VA 3KPLB 3SQOL 3GK8L 4RAHA 4K71B 2NXYB 2O5ZH 1DEDA 1LD9B 3BT2H 1DN0A 3LKOA 3CFIC 2BERA 4XTRD 4R8WL 1PDKA 2GJ6B 2Q3ZA 5C07A 5EO1A 1NLBL 4LSTL 4TNVF 3NIFF 3K7UA 1GGCH 1EJ6A 2EXYD 4OFPA 2FEEI 4YBQC 1KB5A 4Z95L 4AL8L 4XNXH 2QADB 5A43C 4MS8C 4DVRL 1ZT4A 1YPZF 1FJ1B 1XMWA 2DQFA 4LVHC 3MRNB 1ZHKA 2H2PD 4WCYH 1WTLA 2AJSH 1FZMA 3ZE0F 3LV3A 1T80A 4ZO9A 3ZTJG 4TTGA 1T7ZA 1LE5A 4I0CC 1CDJA 1ZSDA 2APTA 3GSQB 4UIKH 5CP7B 5J3HD 3ETBF 5F9DC 4TVSa 2WIIA 3V4VH 4JKKA 1U2HA 3MOQA 4F2MB 1DBBH 5IT2L 1J7VR 3TNMB 4NCC1 5SX4H 4XVTH 2AQ1A 3PWPD 5CJXA 3DMMB 3N1FC 4NQCB 3MV8B 3BZEB 5KS9E 3DX9B 1IRAY 4OD1H 3L3OB 3VWKC 5I15H 2BFVH 1I9RH 5EORH 3SE9H 3FL7A 4HWUA 5ICYB 3H8NA 4LVNB 1CLZH 2EDKA 2VH5L 4U1MA 4WI8A 2QQLH 4EQ3A 4Q6IA 3B8YA 1M7DA 2A6IB 4XMLH 1KELH 2H32H 4PR5B 2X4RB 4UDUA 1MCOL 3QG7H 3B2UD 5T3ZD 2AXJA 4G8EB 5F9JB 3KPTA 1P4LB 5DLML 3U4EB 4MJ6A 2C1OB 1G6RB 1JNHB 3SDDC 4KMLB 5D6DC 1J8KA 1TQBB 3VFVB 3MV9A 2Q8AL 1MRFL 4BSVB 5IF0B 3LDBC 1YMMD 3PQYD 5E6ID 4HLZG 2NR6D 3MJ7A 4J3UA 3RPIB 3ZSSA 1RZKL 3WS6C 2JJSA 5T1MA 4OUUB 2Q7YA 4U6HB 1RUKH 4OCSH 4Y5YB 5I1HH 3BO8A 1RUML 4Y5VC 4JKWA 1ONQB 2GUOB 3T0XA 4OIIH 1AGEA 3FN0L 2VXVH 4HT1H 4N5ED 2DWEA 4LGSB 4ZODA 4NUJB 4M8VA 2CO7B 4N9OB 5F44A 4ZXBD 2VDNH 4AH2A 3P9LB 4EN3B 5B21A 5CIPH 4S1SH 4TNWF 2A38A 5HGAB 1RZ7L 4H0IA 5C0JA 3MZTA 1RURH 4G6FD 1OD7A 4JFXB 4Z5RA 5K59F 1EPFA 4M7ZB 1DL7H 2W65B 5A2LH 3QIWB 3L95A 5DJYB 3MLVL 4Y4FC 3O0RH 1FPTH 1CXIA 2DLGA 3C5ZC 4ZOCA 3ZHLA 1S9XA 3FRUB 1I1RA 3KLAB 3MA7B 4CU6A 2CLVA 1FG2B 1LNUB 4Q97A 4WUKL 5TF1L 4QRQA 4KWUA 4LSRH 5JPNA 4U1LB 2EC8A 1AY1H 4KGLA 3WFHB 5BS0E 4KI5C 3O9WA 1NCDL 4IOFD 5C0DB 3KXFE 4E42A 5IEKA 1UC6A 3FZUC 4NRZA 4CVZA 4RZCB 1IEBA 4XBGB 1U58A 3QQ3A 4ETYA 1M6OB 2EIZA 4MAUH 5AEAA 1JFQL 1YN6A 3RWDA 3BYTA 3QQ9C 3TVMA 5FO7B 4XAWL 4N8CL 5DQJA 5I1JL 3VXNA 3NH7H 4X7FC 5GRJH 4KAQH 3CFEB 1MWAA 4R90H 5DFWH 4JRYE 5J12B 3TF7C 1RFDH 2X10A 1IT9H 1WFUA 4Z7UE 3G04A 5DJXB 4DGIL 4NNPL 4JPVL 5C9JA 1NMCB 3I02A 4U6YA 3SBWC 3EYVA 3GBML 5D1XC 3WD5H 4U1SA 1CYGA 4F58H 5EH1A 4PJCF 3ZYIA 5HYJD 4P46C 4OAWB 3MRHB 3UDWA 3ZT5A 1JWSB 3F7YA 3RKDC 4KJPC 1LP9E 3BISA 3MRFB 3V6OA 2F74A 4PRNA 2J2ZA 4M5YH 1JI1A 5HGBB 1NGWA 4M5ZL 1I9JH 2D9QB 5DD1H 1ACYL 2MCPL 1JWUA 4PG2A 1YQ2A 4G6AC 3A0OA 3HZYB 1CWVA 1GPOL 4ELMF 5I8KH 5J4MA 3SKMB 5JPMA 2MOVA 2WINB 3VXMD 1WIOA 3ARWA 4MQTB 4RMVA 5K33A 4MZ2A 2WBJC 3U0WH 4P5TA 1T5XB 3EO9L 1OT1A 3MA9L 3O4LE 4KU1A 3GSNB 2NZIA 4GSDH 2Y6SC 4RGOH 4HX1B 1Y6KR 2W9EL 1NAML 5F3BB 4HHAB 5JW5B 3VE0A 1J11A 2B2XH 3DX7A 4WUUB 4XP6H 4Q58C 1MEXL 3U36A 4M62L 4FQCH 1DQDH 3VGFA 3BSZL 3P0VH 3VWJB 1XH3B 3SE4C 3ARBD 4R2GD 4HEPG 3VDBA 1FIGL 4HDIB 5FCSH 4FG6D 3L3DA 5GS0C 3BN9D 1K3ZA 3IXAB 3MRKA 4HUUB 5C09A 1U3HC 1TVBB 1LDSA 1S7WB 1BIIB 3UTPE 3DXAA 2ICWI 3BJ91 2Z93B 4IIQB 5FV2A 3ABZA 1PZ5B 1BMGA 3JWDC 5EO0B 1UWGH 1UH3A 4APQA 4WU7A 1Z9LA 1G7IB 4WWKB 2NW3B 5IV2A 4HF5H 4KQ4L 4CBPA 3ARDD 4GO6B 4P2QA 4IOIA 5B38G 4GW4B 4M9PA 3ULUH 1P9MC 2V9QA 4I13B 1PLGL 4ESKA 1VPOL 4KRPB 2DS4A 1TZIB 4B53A 5EZOH 1J8HA 3W0WB 3WNMA 5DJ2B 3S98A 2IFFH 1S9YA 3RVXD 3WFBH 1KLGB 4URTB 5EBLB 3SO3B 5CZVH 2C7UB 3PNWA 4GRWF 4LGRB 4P2RE 1U91A 1QRNB 5D72L 5I16A 4FMFA 2NY0C 3UMTA 5MEOA 2KBGA 4PV8B 4PIRF 1Y0LA 1L4IA 1IKFH 5AYUL 5HHNB 1A3QA 3O2VH 5C86A 3U2SA 1T0PB 1ODAA 4M7LH 1H3UA 4X8JA 2VLMD 2ESVA 1H9VA 4PLOB 3SE3A 2NY3C 3TLRA 2D7OA 3UROR 2BSSA 2VLLB 1DLHB 3CFBA 5DMYA 3FFCD 1C08A 3PDOB 3Q2CA 4NQVA 5ADOH 2FDBP 3KPNB 3U30B 4UTBH 5I30H 5CD5D 1T7VA 5IFHH 5IESH 5MENE 4BQ9A 5E8NA 2EC9U 5HHOB 4XT1C 1BOGB 4FZ8H 1FFOA 4CADB 3PP3K 1F4XL 1W0VB 4H0GA 2VWEC 3T0BA 2FYYB 3U82B 1NGXA 5KSUA 2PTVA 4ZNEE 2ZOKB 3A6OA 3QO0A 5I74B 2QLVB 3EO0A 1JMXA 3X3FL 5DEFA 1FNLA 1INQB 5D71L 3CK0L 3SGJC 2LVEA 1G7MA 2ZPKL 3BPLC 3D25A 5IK3A 2Z8RA 5FOBB 4Y1AD 2UYLB 4IOSD 5C0BE 1HZHL 5BS0D 2VB5A 4HS8L 4R97B 4JM2D 5FF6A 1I7TB 2FJFA 5IW1B 3VD3A 4OZGA 1NDGA 2H32A 4P2YA 1UJ3A 3H3BC 4DEPC 1G7HB 1LDPH 1KCLA 1T66C 5D2NA 3ES6B 1I7RB 3NFNA 3RGVD 5DTFA 4YHKL 3VJ6A 3RVTC 3WFDL 3I2CH 2JJTA 1OGTA 3GSUA 1A14L 4OCWL 5JNYA 3QRFM 4I0PA 1ZA6B 3LKOB 4JRYD 5TDPB 3V0VB 4M1GH 5L7XH 3DSFL 4AQOA 1XF1A 4P2OB 5FA3A 3AXLA 1QLEH 1EGJH 1NDMB 3O2WH 1JNLL 3UTQA 5F1KC 5KZCD 2RCSL 4PTUB 5GQBA 2EYSB 1OM3L 2YPLE 2DRUA 3NAAL 4MDJB 4YBHA 4L5FL 1FZMB 1JGVH 4FABL 3VFMA 5CIPA 1F4WH 1T0MA 2VLRA 2R4RH 3QJHA 4A2LA 2Y7QB 2C1PA 2V9TA 4IRSA 4LU5L 1OY3B 2WIIB 3OKKA 2EDLA 4ODVH 5C6TL 4XH2A 5DRWA 5D93B 2FEDD 3NIFE 2WV3A 4XPAH 2CPCA 2IEPA 4KHXH 2VOTA 1R6VA 1W0WA 3WXWH 4XTRC 4JFHD 4YFLI 5T1KB 1YPZE 3RIFF 3MRQB 2EXYC 5BOZG 3ZE0E 2NTSP 4U1MB 1EK3A 4O9HL 4NWUL 4C55A 2L7JA 1FSKC 5FYJH 1I3GH 1H3PL 1WZLA 3IVKA 4WFHD 2H2PC 3DVFA 4OT1L 3VXSA 4CKVX 5HYEA 3E1F1 4M93C 2EZ0D 3EFFA 4TRPL 1GGIL 1DFBL 3QEHB 5DS8A 3MV9B 5F1IA 3VMPA 5E5UB 5GGSB 4NN7B 4HAFA 5IMMA 3S35H 4NBYB 5T1MB 5D1ZC 2EEAA 1G7JA 2DQEL 1IM9B 1BVZA 4EZMA 1AE6L 2D0FA 5ITFA 4NO3B 1IGTB 4RAVA 4DTGH 2DWEB 4N1EA 5TE7H 4QT5A 4ODUA 4EEEA 4XC1H 1ZK9A 4AH2B 4OLWH 4BSJA 5DR5L 5GGUA 5C7XL 1JN6A 2AK4E 4OD2A 4P59H 1Q9KA 1ZV5A 2ID5A 5C0JB 3B2UC 5D6CB 2YR3A 3T2PA 1OSPH 1ZMYA 3JWOC 1ORSB 3MRPB 4FQXA 3UJTH 4YFLF 1QSZA 3PUCA 2GI7A 4FQJH 3NABH 5H94A 5ECJE 3MBED 2OR9H 1A64A