1JRHL

Complex (antibody/antigen)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
167
Chain Sequence
SVEMTQSPSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETEVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTWTFGGGTKLEIKRADAAPTVSIFPCFLNNFYPKDINVKGVLNSWTDQDSKDSTYSMSSTCEATHKTSTSPIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antibody/antigen)
molecule keywords ANTIBODY A6
total genus 36
structure length 167
sequence length 206
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL01
1QVOA 4P2YA 1S7QB 2XOTA 4ELME 4OZIE 2AJXH 3LQZA 3SY0A 4OGXH 3DPBA 5AD0B 4XAWL 1KC5L 3BN9C 2SEBB 2X1OA 2C26A 5HDLA 3BXNB 2YD1A 1S5HB 5MEPB 4XPHL 3UJTH 1AD9A 4LSPL 4OFVA 1R3HB 5ESAB 1ZA3A 2PTTA 5KTEL 4MJIA 1A64A 2Z4QA 2IF7A 5D70H 3TJHD 4LF3B 2ENSA 3NTCH 3HNSH 5I73B 1PY9A 5D93B 5D1XA 5CEZH 1E4XH 4JR9L 2VXSH 4KDVA 3OR7B 2DQGL 3MGOA 3IKCA 3FMGH 1YEGL 4OLUL 3V2AR 1KCVL 1F3DJ 1VFUA 4HV8A 2LAAA 2BVUA 1BGXL 4LKCA 5EUOE 1PSKH 2NY0D 3U7AA 4WO4C 2LQRA 1QVOB 4JVPA 1IAKA 2OZ4H 4UDUA 2DQJH 3QUKA 1MJ8H 5GSVA 1OGAA 3PQYA 2DQHH 2ID5A 3VFPA 3MRPB 4QHLB 3L6FA 5K59F 4NO5A 4DN4H 3VRJA 3VXMD 1BD2E 4LSTL 3MRQB 3MFFA 5HYSA 5F6IB 3VRLF 3BDYL 1RIHH 5T3XD 3CMGA 1QKZL 5FYJL 1S7UA 1FNSH 3Q5TA 1AR1D 5IROA 2F19H 1QHPA 4HUUB 3NN8B 1BFOA 4XPGH 1JPGA 5DHYB 1Q94A 1J18A 5BVJA 3L9RB 4P2RA 1H8NA 2GJZB 4O2FA 5FO9B 4PY8J 3JWNC 1H3PL 2VMFA 2FGWL 2HG5B 5F70A 2A74B 5CZXC 4DK3A 2HFEB 2WW8A 2AW2A 2GSGA 4GXVL 5I8KL 1G7JB 2C3VB 3EDFA 1ZLSH 3TPUA 3GMRB 5AD0A 4QWWC 1OPGL 3JSSA 3NOIA 4OLZL 1A4KB 5CILL 4X4MA 4QHUA 1DE4B 4G7VL 4KXZI 1ZHBA 5KSVA 1EGJH 3ECBB 2MHAA 3P4MB 1PBYA 2IC2A 1N6UA 2ESVD 3D0LA 3A6OA 4JGJA 2R9HC 3UJJL 1PLGL 4QT5B 5EO1A 2QHLA 3QUXA 1NCCL 3K46A 5D6CB 3LEXB 4Y8DC 3PQYD 3VXUD 4H0GA 4OF3A 3CZJA 5IQ7L 1NCCH 5FYKL 3LEVH 2GITA 3I3BA 4ONHB 5E8DH 1F3DH 3DSFH 2R0WL 3OKMB 3NN8A 4PJ8D 1UWGH 2ZP0T 3MLXH 4PUBL 1U8NB 2ZSVB 5DJ2A 1NC4A 5JHDE 4NRZB 4R8WL 3Q6FB 4M4PA 1BFVL 3GZKA 4IBLT 3UTSD 3QDJD 4KVNH 3VFWA 5JIIA 2CXKA 1NDGB 2CUMA 5GSVB 2YPLD 2F9BT 3NH7H 4J6RL 2XRAL 4HWEL 3FJTA 2FEDC 1EPFA 3MFFB 4WW2B 4EI5B 1INEL 3IT8D 3O6ML 5ESVA 3NGBB 4XB8A 3ZT6A 5SWSB 3PV6B 5FGRA 5GZNC 1JK8B 4RISL 2X2YA 4YHIA 3RZCB 2XRAH 3T0EE 1BBDL 5E8OA 1OQOA 1OM3H 4KHXH 3EYOA 5C07D 3EYVA 4PG2C 1MHEB 4ETYA 1ORSB 4XPAH 2B7DT 2XACC 1IEHA 4Z0XA 3W2DL 1KELL 1KXTB 3V5HB 3KXFE 3MXVH 1YECL 2HLFC 1J8HD 1OTTC 1U91A 4XNQA 1T0NA 5ADOH 4OF7A 4DGIL 4HK0B 5KS9A 5D6CA 4TVPD 4R97C 5C0BA 5D4QA 2ZG2A 4R2GB 4R4NC 4M7LH 3ZDYF 4JFDD 4NBXB 2VN7A 1BQSA 4WFEE 3CAFA 2VL5B 2DJ4A 1F3JB 2R4SH 5MI0B 4HKZA 3SDCA 2OJEB 5D5ME 1NBZA 1B0RA 3E3QC 5SWSD 5DVNA 1FYHB 1X5XA 4MA3A 3LS4L 3BVNB 1VESA 3RTQA 1D5XB 4MNQB 3R0NA 5CJOH 5IWLA 1KCLA 1IGYA 4R90L 4ZDHA 2GSIB 5GGSA 4MQSB 4LEOA 3MLSL 3BPLC 3KR3L 4GAYA 2CO7B 1RIVL 3TBWB 4IOFC 4DQOL 4KVCL 2DWEA 4YXHH 4X9BA 2PUQT 5JPNB 3WNNA 3T08A 2YZ1A 5CSZA 4X4XA 4NQDB 4FZEL 1FV1B 5F7UA 1KCRH 1XF3A 2L4OA 1F3RB 5HHXH 5KSBB 4DGVH 1L7TL 2NW3A 2I9LB 5GS0C 2FD6H 1CU4L 4CVXB 5KS9B 3RA7H 1FDLH 3C9NB 4UAOB 3G04A 5F6IC 4YHZH 2JELH 4F9LC 4YXHL 2E9JA 1ZWIB 3PQYB 3OAUH 4PG9B 4JFYB 4Y4FC 3RVWC 4HXBL 4ZYKB 4F2MA 5FUOL 1S7WB 4Q9QL 3BOVA 2M26A 5D7IE 2NW2A 1CBVL 1E4WL 4UILH 1J0KA 2C3VA 4WO4B 3CVHH 4Z0XB 3U1SH 1L7IL 2KKQA 2BVQB 1ETZA 4RMUA 3ULUH 2IBBA 3ZL4H 2R2EA 2HT3C 3SJVA 3BIKB 2D0GA 4E5XB 1XGPA 5TDOB 2QKIB 1ACZA 4QGTA 4Q58C 3WIHH 4U1SB 4WDIA 1RJLA 4S1SH 3K80A 3TNMA 4HUXA 5E99L 5F9OH 2H45A 5EBGA 4QT5A 5EO1B 1R3IH 1CG9A 2R69H 5JDJA 4JO2H 1JFQH 4GW1A 3SKOA 5CD3A 5AYQA 5CEYA 2I9LA 4ORGA 4QXUL 4G6FB 3ARDC 4P5MB 5AUMA 2PYEB 2P8MA 1D5IL 2V9RA 1KFAH 1QPXA 5KSVB 1NEZA 3ULUE 3EYFA 4S1RL 4NN5C 4JZOA 5IV2B 5H8DA 5C92A 1KPRB 1GVIA 1MEXL 5MEOB 4NUGL 1XZ0B 3SQOH 1N8ZB 4MD0B 3EDJA 3PL6C 5H37G 2IQ9H 5EZOL 1WFOA 5DS8B 4LAQL 5K9OB 1RUMH 3ARUA 3O8XA 4YFLI 3W9DB 5DF0A 1EAPA 4AQOA 3T04D 1T7YA 1EHLH 1J11A 3X12B 5DJCB 1MFBL 3HE7D 1CDGA 4G80A 5ESVB 1AGFA 2YA0A 3U82B 3O6FD 3PV6A 4I2XE 4YDVB 1CG9B 1QFOA 2KH2B 5JXED 4RFEB 4KXZH 3U6RB 3G5ZB 4FFVC 2YK1H 3TH4T 4Z95L 3EBAA 2CDEB 1T6WA 2ADGB 3ARFB 5TFSL 5I8OH 2Z93A 3GJFA 4ORZC 5H35A 1QRKA 1S9WA 2PKDA 4WCYH 4Z7VA 4PRAB 3OKDB 2BY0A 4PRHA 4TSCH 4QTHB 3T2PA 4YDKH 2QADB 5JW4Q 5D1XD 5ESQB 1FC2D 5JQ6L 2VITA 4GKNA 3SDXE 4G9FE 1KTRL 1EA9C 1O7VA 3UMTA 3CFJB 1S9VA 1IKFL 4F57H 4AJ0A 1RVFL 3WDJA 3F8UB 3QEUB 1PYWA 3IU4H 1GC1C 2M8XA 3MNWA 5BJTB 3SKOB 5CD3B 1CE1L 4N0FA 5EC1A 3U4EA 1W72B 3CLEL 3D69B 3T3PF 3I02B 3QG7L 3QDAA 3U9PL 3WIHL 2XN9E 2DQFA 4K94L 1BMGA 4YDVA 1UEMA 4L8BB 4XC1L 2HVKB 3QXWA 5D1QA 1ZS8A 3KJ6L 4GG6B 4PLKD 3QIUB 3WHE0 1G6RB 4ONOA 4NBZB 2H3NA 4WTWA 1YMME 4U1HB 3VMOA 4FNLH 1U58B 3ARWA 1CF8L 2A9MH 2FYYA 5JW4R 5DUML 2NY2D 5IVXB 3MRMB 4P5TD 2VXUL 1BEYL 3QEQA 1M6OA 3O9WC 3EO9L 2A6IB 4HBQA 5GJSL 3P73B 1TJHH 1B3JA 2NY4C 3F62A 3CDFA 1X5KA 2ZUVA 4B41A 4PRIB 3S34H 4YO0A 1C7SA 5BZDA 4EZMA 4JHWL 4C57C 3G04B 3QUKB 3RPKA 1JV5A 4G3YH 5B8CB 1UACL 2HRLA 5JOFA 4YXLL 1LMKA 1I7ZB 5B39A 2XKNA 5E2VH 4DGYL 2Q3AA 3Q48A 2FJGA 1HHIB 3BWAB 1ZGLA 3IDJB 3GSRA 3BP4B 3S4SA 4BA8A 5JDSB 4DTGH 1WC7B 1YPZF 4ZUTB 3QWRD 3DTXA 4KKAD 4X7SH 3HI6H 4JB9H 5EA0H 3NZ8A 4LHJB 2AJUH 4PJGE 1CZ8H 1ETZB 4GAYB 3VXRE 1HN1A 1IAOB 4XPFH 4FQ2L 1DLFH 2A83A 5KVDL 3KYKL 4CNIA 5C6TL 4XWOC 3QNYA 3QDJA 4QY8B 4FTVD 4I4WA 4MCZA 4NQCB 2W60A 1IZJA 5I19L 5CEYB 4O02L 3BIBX 4L8BA 3B2VL 5FHAH 2E3VA 5K9JL 2HKHL 1KC5H 5C6TH 2Z8SA 2BRRL 4NM4L 2BNUB 2MQCA 3U0WL 4HKBA 1C5DA 1UM6L 3PJSA 5DA0B 1YNKH 1MI5D 4KTDL 1ACYL 4I3SL 1M1SA 4OCRL 2ICES 1UCBL 4NKOA 1BM3H 3WO3B 5BVPH 4KROB 4MNQE 1SMOA 1NGWA 1NSNL 4LL9A 1HHJB 4RNRB 1KPUA 5F21B 5C9JB 4UOW0 3M1BA 5ENWA 4BH7B 4WUKH 5J3HC 1N8ZA 1FBIH 1QHOA 4L8DB 1KCSL 1BBDH 5C09A 5D2NE 3WV0A 4KRMB 3HE6D 4ZUSB 4FZ8L 5EU3A 1OARH 1MCSA 2ITCA 4GH7B 2EYSB 2PYEA 3QIBC 1RMFL 3EO1B 5AZ2L 5ACLA 3BXNA 4HGWB 4QRRB 3I6LD 1AXSA 3CSPA 1WBYB 4EQ2A 2J6EA 1JPST 1X5HA 3QAZB 1AGFB 4OAWA 4XNMB 1FL3A 3ROLA 3TV3L 2GQHA 3I85A 1KJ2A 5CCKH 3TO2A 3CFDB 3B5GA 2CIIB 4ODSH 3WFHB 5HYQA 1H3WM 3T3PE 1A7QL 4OF0A 5TQ0H 4C55A 3U6RA 1OF2A 1CICC 4IRSD 5F6HJ 3P4NA 1XGTA 3SCMD 1RUPL 3D18A 3EYVB 3FB5A 1YEDA 4LAJH 4U7KA 1JNHA 1FAKT 1XIWC 3MXWH 5ENWB 5DD6B 3OR6A 1S9XA 4LSUL 2XWTB 1KG0A 4U1LA 3MXWL 3EGSB 1MAKA 4YHYC 3SBWA 3F12A 1FFQA 5DWUH 4RFEA 1U8IB 3STLB 4D0BB 1A47A 4WU5B 4JM2D 3RWEB 3CFBB 5CP7B 4NOBA 1P84J 3DXAD 4RAVA 5IW1B 4ODTL 5C0AA 2HWZL 3QEUA 3KPRA 3UPRB 1SJHB 5F9WC 5IESH 2R2BB 1QLFB 1TJGL 4K7PH 1WBYA 3W11D 5DVMA 4HH8A 4ODVL 3GK8H 4J12A 5HHVL 3DGGB 4D9QD 2XQBL 4LDOB 1J5OL 2FATL 2BFVL 2O5XH 3DYMA 3TBSB 5I1AA 3QZWB 4CRPA 1AJ7H 1PFCA 2V2XB 3AB0B 3P30H 2G5RA 4YDLC 4KU1A 1T21A 4N0CD 4YHZL 4MNHB 2HVJB 5ELIA 3MNWB 5D7LB 3D25B 4YDLB 1I8IA 4WTZA 2G9HA 4GUPB 1MHCA 5DMYA 5JOFB 2DQJL 5F3BB 3EOTL 1LE5A 3JWOL 4PREA 1Y18B 3MLTB 2FH6A 5D1QD 1ED3B 5D7IF 1K4DA 5HPMA 2ENYA 4O2EB 2EDOA 1NFIB 3MCLH 2EDHA 4M6MH 3D0VA 4MCYB 2CIKA 3P77A 5JORA 4NKMA 5TDPA 4NO0A 2HFFB 2J4WL 1F6FB 2R2BA 3V0VA 5A40E 2D3VA 1JGLH 2WINA 1FYTE 2Q6WA 3ARED 1A3LL 5ERWA 4JQIL 3WLBB 1TQBB 1QBLH 2H26A 1KFAL 2AV7B 1EEZA 3AFLA 1MLBA 5INDA 2ZKHL 1XGQA 2B4CL 4FFZL 4LBEA 3HUJB 5E7BA 3OJDA 2R4SL 5T5NF 4WGWB 1AD0A 5B38A 1JHKH 2NCMA 2BHZA 2EEAA 4KROD 4U05A 5B4MD 2HVJA 5DJ8B 3N0PB 4V2BA 1FC1A 2WBJA 1TVDA 2VLKA 3NAAH 4NKIH 4I0PA 1BZ9A 4OLWH 1CD0A 3QZWG 5JA8B 2IG2L 4ZPTA 5D6DA 3IAQA 1D9KC 2BY2A 4KTEL 2DTMH 3GSRB 2K3TA 5HPOA 1A6WL 4PJXE 3MUGB 4N0CC 1F90L 2VXQH 1E4WH 4UILL 3W9DA 4XBGA 2YOCA 4YZFF 2NNAB 4JFEE 4NKIL 1EX0A 4AIXA 4HXBH 3TJEH 4KKBD 2Y36H 4NZDA 3G6JF 2F53A 4PJFE 4O2FB 3BZ4B 1UZ6F 5TE6H 5TFSH 3S3SA 1Q9LB 3VXSE 4RIRA 1YDPA 2IAND 4LPTA 4PS4L 1NC4D 4P4RB 4XP5L 5F7EH 1QR4A 3BHBA 3WFBL 5IBTH 2A77L 1HILA 2H2SD 1IAII 2VB5A 2DJSA 4RAUB 3SDXA 2X4SA 5LGKA 3NFSL 4G8GA 4RNRA 1J8KA 4G8GE 5JPMB 1UH2A 4HWEH 1ZT1B 5FM5M 1NFDB 4NJ9L 4I3GA 1H8SA 4PRHE 5I1KL 1KJ2B 1S78D 3L3JB 4IHOA 1NBQA 2ZUQB 1JWUB 2P49B 2Z91B 1OAZH 2A9NL 2R1WB 4FHBD 4XMLH 5B8CC 2O61A 1U3JA 3CDCA 4V1DD 2ATPA 2BNRD 4XCCL 5HYFA 3UBXB 4AG4H 3K4DA 1CGXA 4NQXB 3GMMA 1X5ZA 4OFKA 43C9B 4JANB 3BYTA 3MLZL 1CD9B 1F2XK 1FCGA 4XC1H 1J12A 4OM1H 1FVEA 2DQCL 5BJTA 1ZE3C 4FQXC 4N0UA 3WNLA 5DXWA 4CMMB 5DJ8A 1VACA 5C0EA 2O93L 1LO5B 5JZ7D 1SY6L 3P11L 1U3HC 4K2UH 3MACH 4OFIA 2AQ2A 2R69L 3FT3A 1AFVH 1YECH 3GO1L 3I75A 3W0WD 1NMBL 2OTUA 4M1CC 3TYFA 3INUL 1KELH 2HTKD 2QR0B 4JM4H 4NUJB 5MEQB 2YBRB 3EJZC 1G7PA 2YUVA 3FB7B 5FUCC 4PJ9D 3VDAA 4YX2H 4GAJH 4JRXE 1BLNA 2F15A 2BSSB 4P59H 3MBXH 4HS6B 2ICWB 5CIPA 1F11A 1KCUH 1MCFA 4I48B 4FQIH 1ZWIA 3M07A 2X1WL 3DO3A 4DFIA 3OAYK 3J8F7 4OLXL 2IGFH 1QRNA 2JB6B 4UB0L 4HAFA 2JJSA 5T1LB 2BVYA 2KQNA 4P9HL 2NZ9C 3O0RH 2X4UA 5ID1B 2B1HH 2VDOL 1I8IB 1BWMA 4Q7DA 4PJ5A 1KB5H 3SDXB 3OG4B 5DD5L 3E6FB 5I1EH 2B1AL 2J5LB 3D3VA 5EO0B 4Y4FB 3D39A 1LO5A 1JWMA 4HWZA 3LSOA 2IAMB 4DVRL 2IBZY 4JCMA 5BXFB 5EUKB 1BJ1J 3BP6B 2DYPA 3WS6A 1AI1L 2J1KA 2AVGA 4NQED 2F8XC 4M3KB 2UZIL 4KJQC 4PJ7F 2BY1A 3OB0H 2G60H 3VI3E 1HOCB 1TZHB 1A6UH 2OJEA 1E4KC 1F11B 3BD4A 2MPAL 2R56L 3H0TA 3O6FB 3QJHA 4WWKB 4XH2B 5HPMB 4KTYA 1VFBB 5T1KA 2ESVB 3FOMB 3MRIA 3TO4D 2UUDH 1N5YH 1KIPB 2VLRA 4NFCA 3SJVD 1EFXA 4RMSA 4PB0H 4IDJL 4KRPD 2R9HD 4MB3A 2F58L 4GRMB 3EJZD 2QV2A 4PBVC 2MWCA 4IOFD 2MKWA 4U2YA 4JGMA 5B4MC 4LSPH 5T1DH 1Z9OA 4TSBL 4X83A 3VGGA 1S9KC 2GHWB 3GHBH 2LABA 1A22B 5AWNH 2QADC 1IC5L 2VZOA 4M1DH 1CDCA 1VGEH 2BP3A 4HBCH 5GGVH 4M1GL 1KENH 2NZ9D 1JPFB 3TNNA 1HH9A 3FQUA 3MJ6A 15C8H 1KOAA 4ELMB 3OAZH 4FRWA 5EULV 3SGKA 4BSVA 2CDFB 1FO0L 1MIML 1R3LA 4P5TC 4JB9L 3PDDA 1OW0C 4QEGA 1BQLH 1AI1H 1HOCA 2DLIA 3PJSB 5AWNL 1WAAA 3UTTE 3EDDA 1AY1L 1BF2A 5H94A 2X4QA 4R0LC 4P9MH 1NCDH 4G6KL 3HZKA 3T0DA 1IGJB 1U0QA 4HDIA 4YXLH 5B3JF 3ES6A 2OCFD 3GBNL 1IM9D 4X0KB 4YK4C 3VFUA 4DOHB 1VFOA 4WO4D 1U8PB 4LOUD 2DLEA 5TDOA 4HCRA 3IRPX 4GKZB 5IHBA 1YEKL 4U0RC 4P5KA 4PTUB 4ODUA 1JRHH 5HY9B 2VABA 2BNQB 3E1F1 4CJ0A 3MGTB 1DVFD 1NEUA 4K7FB 5MHSE 3K1KC 1KEGL 4ELMF 1N5AA 1QSEE 2W9EH 1ZS8B 1T83A 5MEND 4WEBL 4YXKL 4NO2A 1GZPB 5T3ZL 5EU6D 5GS1B 4TN9A 1T0PB 1KV3A 1LILA 5EZLB 4RWHA 2Z31B 4HIJA 1I9EA 5DJDA 1RZJC 5I6XB 3OXSA 2E7MA 4ZMAT 1NCBH 1QR1A 3PWVB 1K5NB 2VIRB 3FT3B 3AM8C 4K3JH 3VFMA 5I15H 2VE6B 4TVPH 1RZKL 3REVB 1YEDB 4M6OH 3GFUA 2CK2A 3LIZH 4RWYL 2FR4B 4JFQB 3DYOA 4FNLL 4KUCF 5FGCE 3T0EB 1MOEA 2FNBA 2NXZC 4X5WB 4HBCL 5GGVL 4ODUB 1YPZE 3WSQH 4RZCA 3B9KC 2HTLD 3GHBL 4NFBA 4V1DE 3CFBA 4JQVA 5CP7A 5IW1A 3HNTL 1HHIA 1V7NL 3BWAA 5KJRL 1ZGLB 2V2WB 3KPRB 4ODSL 2W59A 3UPRA 5H35B 5KVFH 4X7DC 1F5WA 5H37H 1YQVL 1SBSH 5DSCB 1CVRA 2FGZA 2ADJA 4Z76B 3ILPA 1ZA6B 3G6DL 2Y25A 3TF7C 3HC3L 1UB6B 1YYLH 4JAMA 3V5HA 2B2XH 1REIA 1RIHL 5I1CL 3UXFA 1I1RA 4F3FB 2FB4L 3AVEA 4NWTH 1F6AB 3HAEG 5C0CD 1AGDB 4XCNA 5H2BA 3SKNA 4DAGL 5CBAA 2HJFA 4H5SB 5E9DE 3H8NA 5DJXB 3BPLB 1FBIL 1CQKA 2DQHL 4OTXL 2UZXB 4NZUH 3JV6A 3OTTA 4LLYA 4FQCL 2PYFB 1WJ3A 3RI5K 4DAGH 2XY1A 4KZDL 3L3IB 3MJ7B 4JGUA 4R7NB 1OQXA 1CT8A 4NO2B 3QDHA 2IAMA 4PRHB 4DKFH 2HJKB 1P84K 1NJ9A 1JUFA 4QRTA 4BFBD 2VXSL 5DMGC 4WUUD 5ILTL 4Y2DD 5DJDB 2P1YA 3BZFA 3CCHB 5T5FL 4YHMH 3O3BB 5IB4B 4JFFD 2JJVA 7FABH 3VGDA 4PJHF 1E6JH 1QBAA 1NC2A 2HKHH 5E03A 3RWDB 2P7TA 1FFNA 2CKNA 5TE6L 1FPTL 1F45A 1XGQB 2APVA 2ZKHH 2BVEA 4LBEB 3QH3B 2DLGA 1PDKA 1MRCL 5B38B 2D9CA 4XBEH 4M7KL 4HCRH 4LCIH 4XP6L 2Q76A 2OXGA 4NP4L 3JV6B 5FUOH 2IPTH 2VQUA 1KN4L 3TBYB 1JNLL 4FXGB 3ZYJA 2FDBP 5HHPB 4PBXA 2HMID 4MDJB 2VDPH 4JZNA 4NHCH 1GOHA 5ICZB 1J8HB 2CR6A 3V5KA 3BEWB 2DWDA 3S4SB 4HC1A 4L4VB 3KDMA 4WHTA 1EFXB 1CLZL 1DQMH 1AKJB 5D8JH 5C0GA 5DURB 5E5RB 1Z3GH 4LLUB 3VI4E 1FNFA 5IBLD 1EVUA 4G8GB 1JHKL 3WFZA 4HG4J 1ZT4B 5C9KA 2NW3B 4PR5B 3HR5B 3AU1A 5I9QC 4L5FH 4P2QD 1CGYA 3KR3H 1IEAA 2X05A 1LO0H 3HCVA 1ZANH 1CN4A 4HWNA 1CBVH 4L4JA 5KAQG 5HD8D 4LLWA 2GTWB 3CDGB 1HH9B 3FQUB 4NJ9H 1JF6A 4BSJA 1DTUA 2ADIB 1MRDH 1KPRA 3BT2L 2JTDA 4J1UB 4E41D 2FSEB 3BDBA 4JZJA 1JF5A 3RGVD 3G5XA 1H5BA 4WVRA 3OKLB 1E4KA 3NFPA 3EOBA 4M9PA 5C0BD 3BKJL 4LGRB 1A6TB 3TT1H 3WIIH 2EXYD 3OG6B 2QEJA 1ROWA 3X12A 2W60B 3ORJA 5GHWH 4DQOH 4YHML 4DKAA 4D94A 3QQ9C 5T3XL 5C2UB 2JCCE 3T2QA 4XAKE 1I7RA 4HC1H 4P99A 3L3DA 5DJZB 3OL2A 2FATH 4QKXB 1RZ8B 5HHVH 1JJUA 2AJZB 4U1IB 2FHCA 5IW6A 1TVHB 3FQNA 2R8SH 2IFGA 3X3FH 4XI5D 5ITBH 1SYSA 1P7KA 2I07B 2XTJC 2H1PL 4JHAL 4OZGE 3RWCB 5J6HA 1CD8A 4NM8H 1A6PA 2XQYG 3EOTH 2EH7H 3TA3C 1G9MC 3OKEA 4X80H 4LASL 4U4BA 3F5WB 5DI8A 1BLNB 4HJ0D 5F89B 4PRDB 4N9GA 4TULH 3MV01 2BVPA 4Y5YC 3UX9B 3Q1SL 2Z31A 1I8LA 1ZT4A 4GW5A 5E2WH 1E6OH 4XI5C 2W0KA 2YK1L 3VWJB 1JNNL 3EFDL 2V2WA 1CIDA 3VA6A 5FGSA 4KKLD 4ZOEA 4F33B 3NA4A 2DQEL 1AGCA 1JPTL 4MQTB 2WQRA 3ZYOA 3CVHA 1VB9A 2W0FA 3ZHKA 4QGYA 3QXAB 4N5UA 4OLVL 2IPUG 3ARGC 4DVRH 4M8QA 1IL1A 3MJ7A 1F4AA 4G7YH 1JWMB 4R7NA 3MRDA 2VYRE 1AGDA 4XCNB 5DRXB 3S36H 1T2QL 4BQBA 2WNGA 4XP4L 4YE4L 1ES0B 3P0YL 3QFDA 3LRGA 3CLFH 3U4BH 1VERA 1AHWB 5FYKH 1NC2B 3VXOA 2ZUWA 2PR4L 2PW1B 4OQTL 4OZFB 4JFHD 3CFEA 3RDTA 3S37L 4WU7B 3JTTB 3DVNB 3TCLB 3U4EB 2OI9B 2IPKB 4LHQB 3WNOA 3ET9F 4UV4H 4LCWE 4NKQB 4P59L 5L8JB 1P9MA 4OI8A 3GI8H 3IGAA 1YMMD 4XVUD 3PDOA 3RWIB 5F7YC 1FQ9C 4WRLA 3HC4H 4S1SL 5F88B 1OAQL 2EYRB 4JRYA 1R0AH 1TMCB 3GSNB 1IAMA 2PYFA 3VWKC 3NBNA 1VDGA 4Z7VF 5DO2D 2J88L 3V79C 3OB0K 5C0AB 4UV4L 1MFDL 1NAML 2BCKB 2Q86A 3QJFB 8CGTA 1NFDA 5L2KD 1CGSH 3RWHA 4D3CL 4YPGB 3WKML 1GC1H 4YHIB 4YAQA 1CFVH 4Q9QH 4F7PA 1S5IH 4JDTL 5EIIA 5EBMB 3BKJH 3C5SB 3BP7B 2UYLB 1LK3L 3GMMB 2C1PB 3IJSB 3MV7A 3OGCB 2X4QB 1FIGL 1H5BC 4KMTL 4XX1G 5IK3B 2AJYH 3V5KB 3WXVH 5BS0D 5I0DA 4MJIE 1I3RB 3OKNA 4NRXB 4RX4A 4A6YH 3D85B 4POZD 3TH2T 1ITCA 4OLUH 1AD0B 5GRVL 1CFTA 5C08D 2NY1C 3CSYA 2VRAA 3ARBC 2Q76B 5CLWA 1LEIA 2DM7A 2DQEH 4JRYB 3C8KB 4OCSH 1CS6A 3B2UC 3TBYA 4E41A 1MQ8A 1V3MA 2A77H 4NFDA 4JPIA 4LLDB 3KLHD 5C0IA 4HHAA 3QDJE 3KXFD 3IF1B 3IXTA 3V6OA 1IC1A 4OUUA 3H9YA 5IB3A 4PTTB 5T1DL 3PWVA 1CDHA 1KJVB 4NQCD 1MLBB 2BZDA 3DRTA 3VA2C 4QOKA 1DSFL 3REWA 2VTFA 3U9UB 2JB6A 3TC9A 1X9QA 2V5RA 2C1PA 3P9LA 4OGYL 1DJSA 1P5UA 3RL1B 1CYGA 4F37F 2NY4D 4NNPH 7CGTA 4HJJH 5F88A 4FMFA 1X4XA 1YEGH 3WUZA 5IQ9B 5DUMH 4M1DL 4R3SB 5ICYA 1MRFH 4PBWD 2CKBL 1NMCB 1KACB 4ENED 3MROB 1BZQK 2P8LA 4M1CD 4QRRA 15C8L 3QCTL 3T0EA 1B2WH 4PJBB 4IMKA 2Q87A 1UACH 1WAAE 3UTTA 5HHMB 3L3DB 3SDXF 5D96B 3QUXC 4LEXH 5JR1L 4HHAB 3VXUA 4PJAF 2DQIH 4JAMB 1KPVA 2NY3C 4YFLF 4S2SA 2ZUSA 2IQAA 4Y4FD 3U2SA 1J8HE 3Q0HA 5HGGS 5J6HB 4FMKA 4UT7H 1HCFX 1T2XA 2AJXL 3NCYP 3MRIB 4PGEA 4IDLA 4K3DL 1EHLL 4ZXBD 4Z76A 4PRPD 2W07A 4PRNA 3ARBA 3MCKA 2W0FB 4UTAL 1CTNA 4Y2DB 2WAHA 1KNOB 1IAIH 2VDNL 3KYMB 1WBXB 5JW5B 1HHHB 1MCLA 4KK5C 1SJVA 4HWUA 4WU5A 1YC8A 5L88H 4OKVB 1BVLA 4RAVB 3O3UN 4NO0D 5GJTL 1EHXA 1MCPH 1TQCC 5BRZD 4KRPC 5I8OL 1T1YA 2O5ZL 3I50L 1EBAA 2GITB 2RFXB 5ALBH 4B7IA 5DI8B 3TBVA 4TUKH 1RHHA 3WDIA 3QI9A 1BX2B 4F7TA 4WV1A 3FB5B 1LHZA 3DSFL 4JRYD 3IU4L 4S0SD 2OR9L 2P7TB 2VLJE 3O8XC 1JZ2A 3CSBA 4YH6A 4LPXA 3MRDB 1NUNB 1G7QA 4P5TB 1R3JA 2Y5EA 4QHMB 2YPLB 4L8SA 4F7CA 4EQ3A 3DNKA 4WW1A 2IPTL 4QRQB 4AMKH 5TGBA 3PDOB 4LCCB 3QFDB 1MI5A 2VC2L 3QIBA 4NGHL 4PRNB 2XT1B 1G7MA 1TNNA 1MFAH 5L2JA 2CLVA 1MRCH 2X89D 5E2JA 1XFPA 4YDJB 1UB5B 1NMBH 3RJDA 1G6VK 5JOPE 1U95A 4NGHH 2YD5A 4NZRH 2X42A 3BPOC 5I8KH 2EIBA 4D2NA 1MCHA 1L4IA 3LQAC 4IRJD 5CD5C 3VXUB 4WI9A 1CI5A 1T7XA 5EBMA 5C0RH 5DJYA 1LO4L 3ARQA 4PY7A 4YWGL 1D5BA 4ETQB 5J89A 3ARVA 1INQB 1OSZA 5SWZE 4NZJA 1NFDE 1QEWB 3C5ZA 3D39D 5BOZG 5E8PB 1CE6A 3LRSA 3MREA 1EEZB 1KLUB 1OOAA 3EYSH 3QAZC 5IMMB 4DUXA 4LSSH 5AZEL 4S1QH 4AIZB 1QA9B 2DBJA 4MLIA 3WEXB 2IH1A 3I2CH 3O9WD 1DP0A 3TT3L 2IADB 4UTAH 1ZT7A 5EU6B 1WBXA 2AEQL 4WNQA 2QQLL 2AJSL 3WNMA 3NCBB 1DBBL 4KGLA 4WFFE 3LD8C 5C09E 2FX7L 1OAKH 4KK5D 4ZAKB 4MNGE 5T1MA 1NUFA 5I18H 3L9RA 4H25A 4P2RB 4LMQE 1A9BB 1OWWA 5ACMA 3QUML 2J8UA 5ALBL 1FGNL 1JGVL 5AYUH 4C56A 1SBSL 1A02N 4PPTA 4GOSA 3LVEA 2ADIA 1P6AB 1S8DB 3W0WA 1C5BH 3QDMB 4LARL 4WI5A 4IRZL 2VLKE 2FRGP 1DBML 2WK2A 2VKWA 2CLZB 4NQDD 1II4E 1KN2H 4XB7A 2YUWA 12E8L 2YS4A 3WSQL 2VH5H 3HPJA 4O58H 4Q6YA 4R2GC 3TIEA 4DW2H 4FQQA 2AJZA 1P7HL 4TTDC 4NQDA 3LKSA 3QXTA 5EOQL 1C12A 1BIHA 3BZEA 5IUSA 5FF6A 3SE8H 2R15A 2RCSH 4R4FH 5CINL 1P4LB 5K9JH 3I3DA 3BMVA 4LQ1A 3LY6A 3BQUA 1DR9A 3WLWC 1CDUA 1OD7A 4KV5E 4YO0B 4IRJB 4O58L 4N8VB 1HNFA 4N9OB 1R5IB 4UQ3B 3FFDB 1HI6B 4PY7B 1XIWB 1YN7A 2XICA 1OTSC 4QTIL 4G8FA 1N5AB 5FUCE 4LLVA 5HGDB 5BOPA 1Q72L 3BSZL 1YUHB 1DEEB 3MRBA 4K71B 4ZTPL 3RUGE 1BD2B 5DZLA 1RJYA 1I9RL 1FVEB 3DJ9A 3QO0B 3RZCC 4FXLA 4PJBF 4F8TA 4G43A 1P7QA 2ZUQC 5LBSL 1CXFA 2J4WH 2AJ3A 3C6SA 2IMNA 3CVIL 4XP9H 2VLLB 5FDYA 2VR9A 1QBLL 3CVHL 4MXQD 1UXWB 4ONFH 2F53D 1ZANL 3X11B 1FFNB 3RIFK 3BZEB 1JK8A 3REVA 4NQSA 4Q6IA 5IGXH 4L5FL 5DURD 4NUJA 2GJ6D 4KHXL 4KKCD 1XEDA 2Z8RA 3ZKSD 5GRZA 3U36B 3ZMRA 1DL7H 1YNLH 3H3KA 4JRYE 2NLJA 4XCYA 4AEHL 5C0JB 2Y23A 1S8DA 2VOTA 3WFDH 4RDQG 1M7DB 4K23L 5HHPA 1ADQA 4FZEH 5DEZA 4ZTOL 4H26A 1CXHA 2O5XL 4D9RD 1HKFA 4W81A 2VQ1A 4UB0H 1J5OH 4MJ5A 2VAAB 1R0AL 5EBLA 1AE6L 5J1SC 2F5BH 4NKOB 3VI3F 1TZIB 3M8OH 3CDYA 1IGIL 1P4LA 5EO0A 3GBML 4F9PC 4PR5A 4WHDA 2QHRL 4RGND 3DRQB 3GI9L 1IILE 5IG7A 5D2NC 2P44B 4MA7H 4MA1C 5IJVA 3PWPA 4YBQD 3MO1B 3KYOB 1MHHB 3V6ZA 3OXRB 5DQDL 1T5XA 3PV7A 1OAXH 4MQXD 4CN1A 3QQ4B 2CKBB 2JKXA 3EOAA 2V5YA 4Z7WF 4I77L 3TIDA 2WUCL 3DYPA 3MLPA 4LVOC 5C0AE 5EIQA 4FFYH 1A1MA 2BMKA 4GKNB 3W2DH 4HT1H 5C71A 4JRXB 5BMFL 3CU7A 5DC0A 3B2UD 3VE0A 1XGTB 1RD6A 2W1NA 3FFCB 2C3HA 4NQSB 5GS2H 5DUBB 4HIIB 2G5BB 3MODL 2DM2A 1I3RA 4NRXA 4L4VD 1MCNA 2BERA 1IEBA 4EN3D 3HMWH 5TE4H 2Q7YB 4P3DB 4P23B 3OB8A 3C09B 3K2UL 1XGRA 1G6RH 4P0DA 4ZFOA 4Z5RA 2XTJE 4Z9KB 3K74B 3SE9L 1G6RL 1XF5B 4EI5D 4YHNB 1UQSB 3RTQC 4AEHH 4ZFFB 3PWLA 4CL7A 1K3ZA 3HLAA 5AEAA 3LB6C 4K9EC 1T1XB 1K2DB 2Y36L 1W72L 4HDIB 2FIKA 3WL9A 2DLHA 4WV1C 5CGYD 3VXUE 4HS3B 4X6FA 4JO4L 5SV3A 3RI5F 2OQJA 3THMH 1VFAB 1DUZA 2IBGA 1V05A 1XF4B 3QCTH 4PP2A 5CLTA 4AM0A 5ITBL 5LG1A 4D0CB 1IQWH 4IS6B 5D2NA 2BRQA 1Q0YH 1JTTA 3SQBA 1PD6A 5ITFA 3LS5H 3MZGB 4PJCE 3WD5H 2AJVL 3B9KD 4NKDB 3VWJD 4K9EL 1AGCB 3SDCC 3MRNB 2VUOA 1CFNA 3FN0L 4LLQB 2R2CA 4L4TE 4PGCB 2KL6A 3HAEA 3P11H 1F58L 5DEGB 3TIEB 3MRGB 5EIVA 1QBMH 4I3RL 1X5AA 1NUGA 2X10A 3MOBL 3O4LE 5DQDH 5FAAA 3U2SB 2FO4A 4PREB 1NGZA 3KPQB 3O41A 4M7JH 4PYGA 1J8HA 3P9MB 5F3HA 4X9IA 2VZ3A 3RY4A 4M6AA 1DEEA 4RFOH 1SM3H 4NZTH 5DRWA 2WWKO 3FT4A 1FH5L 3W39B 1F8TL 1TETH 5LGHH 3O2WL 4X7SL 2HH0L 1LP9A 2FEDD 1GGBL 1R5IA 4UQ3A 1YEEH 2MPAH 2R56H 1QQDA 1A6UL 4L9LA 4FQ2H 4CDHA 2H26B 4M61B 3RTQD 1HH6A 1C5CL 5DTFB 3MV8D 4UT9H 2X44D 4KY1H 3NFSH 3LN4A 1L9MA 1TIUA 2X1XR 4JN1L 1DQTA 4Z5RB 5HD8C 1ZVHA 4KKBC 1OB1B 1OWRM 1TPXB 1WZMA 4ZFZA 2BNUA 2NXYC 5MENB 3VU2A 2W38A 5I1DB 2EE2A 4ZS6C 5DEGA 4MAUL 3NCFB 4I0PB 3GMLB 4ZQKA 1BEYH 3QIWB 1MRDL 1XR9A 4KWUA 2LTQB 5KSAA 3RGVC 4QYOB 4PLOB 2XA8L 3L3OA 32C2A 3X13A 1DVFA 1K8DB 2W9DH 1I4FA 1LDPH 2UWEA 1XF4A 4KI5E 3FCTA 1JCKA 1TITA 1IKFH 5E9DB 5D2NB 4NC2B 1Z5LA 2ZJSL 3PUCA 1F4HA 1FVDA 5TDNA 3NABH 3QB7C 3LKQB 5TH2B 1LD9B 3X3GH 1MJUH 2ADFL 1I7RB 2VC2H 3GSNH 4EVNA 3QQNA 2ZCHH 1F4XL 3FAWA 4RX4D 1CFQB 2C3XA 3VFVB 5IB1B 3PHQA 1E0OB 4PRBA 2EYSA 5KAQF 4HEME 3EZJB 4JLRB 1F2QA 1DFBL 2X4SB 3KPQA 4WW2F 4GKSA 3QISA 4R4BA 3T0XA 4CU8A 5SWSA 4QNPF 5DD1H 4RQQA 1D5MA 1OAUL 4R26L 5SX4I 1CD1A 4Y19D 2BSRA 3V5DB 5E56A 1MFEH 2DD8H 1Q9KA 4Z77B 3CLEH 2JE8A 5DHVA 5C2BH 2ZCLH 3ZHLA 3LKOA 5JHDD 1JWUA 5LCVH 4OUUB 4Y4KA 1JTPA 4JRXA 1QACA 1M4KA 3WJLA 3ILQC 5LJYH 2AK4A 5ADPL 1SJEB 5DJXA 4Y1AD 5D2LE 3FCTB 1ZGLM 3TN0C 1RZGB 5D5MB 4JKLA 3VD7A 4YDKL 4WUUE 1FZKB 4QF1B 1VACB 4PJEB 5C0EB 4MJ2A 2IADA 1JHTA 3QHFH 3OX8A 2JCCB 5ISZD 3QHFL 5BV7C 3VXSB 5SV4A 1UXSB 1I3VA 1WT5A 5BO1H 1IC7L 5C0FA 4TUKL 5D1XC 1NANH 1NLBH 3DMMB 1J1PL 3O3BA 4NZRL 1LK2A 1PQZB 3BEWA 2HT3D 2BFVH 4N0RA 2IANE 4UOW1 1A0QL 4R9HA 4ODWA 3ULVF 1V3LA 4YPGA 5A43C 2VNCA 5AG9A 4W68A 3RWGA 4GBXD 3UROR 2YC1B 3HNTH 3JTTA 2R1YB 3TO4C 4AM0B 4LEOB 4JVWA 4RMVA 3LKNA 4G9DA 1MRFL 4XXCC 2J6EL 5HHQB 4MAYC 4R96A 1U58A 5B39G 1IAIL 2PO6B 2E7LA 2RAMA 2CLZA 4UBDC 3MUHL 4G9FA 4NNXA 3S37X 1T1XA 1QD0A 1YYLL 4NT6A 3C08L 3OJ2C 3WNPA 1CQYA 5GRWA 3G6DH 1RIUH 5J7CC 2ATKB 1IGTB 5E94A 3BGFC 2Q3ZA 4NO3A 1PLGH 5LAXB 3O2DL 1RPQA 1MCBA 1P2CB 4CVXA 5KSBF 2NY6D 5IVNA 4R26H 1MCWM 2LU3A 4LPUA 1JV5B 4J1UA 5FCSH 5GRUH 3IDMB 3B5HA 35C8H 3PABA 4LLDA 3FO9B 3ZKMC 1H0DA 3QSKB 3NIFE 3D87B 3TBVB 2DKUA 1GIGH 1QYGL 1KBGH 1YN7B 5IB3B 5C0DB 1WEJL 3M1BB 2HG5A 1RZGA 5EA0L 4X6BB 5EH1A 5E2UL 4KJWC 3FT4B 1NKOA 2GTZA 1A1NA 3TPKA 4BELD 1J1OL 5A2KH 5BV7L 4TPRH 1OARL 2ZOKB 5HXMA 2YEZB 4I5BA 2NY3D 2X7LB 3QDJB 2A6DB 4JPWL 4DZBA 1TCRB 4LRIC 3KPOB 5TF1L 4XP5H 5F7EL 3ESVF 4TVPE 3O11A 1P2CA 2SEBA 1F97A 2AXJA 5DEFB 1XCTA 5EU7C 4KPHL 4IJ3C 2W65A 3L1OH 2Z92B 4OT1H 2BX5A 2X40A 4H0HB 1U8HA 2D7NA 1OGAB 1SBBA 1WWWX 1MCOH 3QFJA 4JCLA 3FQXB 3RNQA 5BS0E 5HYJD 3KVQA 4GMTL 4AH2A 2NTFA 4GO6B 2F5AL 3WJJA 3ZYIA 2ZPKL 4PJGA 4ZTPH 1BBJA 2OYPA 4U6HB 1KBGL 4MAYD 3GEWB 4MJ5B 3HRPA 5HHOB 1ZEAH 2IANB 4M6NH 4OQTA 4XX1E 4XVJL 2F8VA 4ELKA 3ZSSA 2NX5E 2HRPL 4TNVK 1SJHA 2C5DC 2OXHA 3FZUC 4RQQB 4X5XA 1C1EL 5KSUB 3GMLA 3UTTB 1AGBB 4ZAKA 2UV3A 2Y9RT 1UKTA 1YEJH 3BISA 4OKVA 2BOCB 3ECBA 2NZIA 4PJIE 5CMAB 4Y19B 2JB5L 4OM0H 3HE7A 3H9SE 4ZAKD 4HKXA 4X8JA 2R1XA 3IDUA 1I1AD 3F7YB 1T21B 1U8MB 3NIDF 4KI5D 3OKKB 3KPMA 3EZ8A 1AC0A 3PP3H 3O8XD 2VITB 2P5EA 5FO9A 5J0BA 5C3TA 3BH9A 3WYRA 4Q9RL 1FL5A 3OKMA 3O6KH 2P45B 4KJQD 3DUSB 2JIXB 3OBAA 5SX4H 3E6HA 4M7ZB 1DBKL 1KTLB 1OP3K 2APXA 2BHYA 2MHAB 1AGEA 2OZ4A 2L0DA 3D0LB 3BAEL 1U95B 3FRUA 4Y19E 3O6LL 3IDNB 2Q7YA 2KBGA 4QF1A 3CXDL 5I74C 4I48A 4YAQB 4Q2ZB 1IFHL 5HVHB 3V7AE 2R8SL 3HUJF 3SGJA 1LQSR 4LPYA 3G6AA 3QXDB 4PJCF 4NWUH 4QHMA 6CGTA 3IJSA 4FFYL 4YGAB 1F6LL 4AK1A 4F7CB 1KIQA 1QEWA 4E0RB 4LCCA 2FEEI 3B83A 2AJYL 5I1EL 3CJJA 1SEQL 5DJ2B 2VDQL 1P4BL 3SGDH 4OD2A 4F9LA 2XKUA 2AQ3A 4LVNC 2FIKB 2E8YA 4DVBB 1TVBB 5J11C 1UWXH 2JJTC 3VCLA 1FN4A 1P53A 3D39B 3WE6A 3JV5A 5FFLA 3KLAB 4HUNB 2LVEA 4JO2L 3BPNB 4U2ZA 5MENE 2BC4B 1P9MC 4TULL 3RWJA 5F9JA 4JPIB 1OAXL 1QKZH 1CFSA 2J7LA 1YEHL 4WW2A 4OF6A 4EI5A 4AG4L 4EUPG 1WLHA 5JQ6H 5GSRB 3O3AB 3IVKB 4XMLL 2VDKH 2N7AA 4Y16D 4FFVD 1BHGA 4UNTA 5AG8A 2W0LA 3EW3B 3SE4C 2FGWH 3K1DA 3U1SL 1PKOA 4WO4A 2PNDA 1HXMA 3ZKXB 4Y89A 3IDGB 2I25N 2V7HB 3SOBH 3QWOA 2N56A 4XCFH 4KRPB 2Y6SD 4KI1A 5EBLB 4RFNC 5KSBE 5T3XH 5JOPD 5JPMA 1QQDB 4ZPVA 1JNNH 1FL6B 1HQRA 3W11C 3MV9B 4MCZB 1RJLB 1D5XA 1KTLA 4I18C 5D7KE 5K93A 3RBSA 3GHEH 4KK6C 3KGRA 5LKNA 3HAEH 4J23A 1S7XB 2OTWB 3HI5L 3SDAC 3GMNB 1A9BA 5CAYB 3RGVB 5HJ3B 3QCVH 4G6AC 3DXAB 4QHLA 43C9A 1RHFA 1U8OB 1I7TB 2BVTA 4P9ML 2GT9A 4QHKI 3VGEA 2IQ9L 3TJEL 3SQOL 3VWJC 1ZVYA 3IDYB 5EU5B 1XR9B 3TA3A 1JPSH 4GW4B 5E7FA 5IOPA 4U6VH 2F54E 1MIMH 4M7ZC 4BFIB 2OL3H 1GGBH 2EDDA 3CMOH 1NGXB 1RJYB 1TETL 4WGVB 2K9UA 5LGHL 1U8NA 1AKJA 2V9QA 1P7QB 2GIYA 3QUYC 2X41A 1LP9F 1HYSC 2YKLH 3TP4A 1QSEA 2BDNL 4PJBA 2HJLA 5C07A 3MOBH 3ARSA 3QG7H 4YEEA 3TN0A 4PJFB 2CQVA 3BHBB 4U6HA 3VWKD 4JG1L 1CTOA 2ORBL 4KRNA 4ZFOL 3KS0H 2E7LC 2X4OA 2AS5M 3KYKH 3ZT5A 5E00A 3U0TB 2AXFB 1EAJA 1J10A 4JQXC 5HVWA 2B4CC 2NXZD 3MNVA 2FH8A 3OJVC 4X8JB 3QA3A 3RX8A 2AK4B 4WY7L 4HZLB 1M71B 1GZPA 1I7TA 3CFDA 3MJ9L 3MLWH 4P23D 2AERT 2NTFB 3C09C 3EO0B 3MJ8A 3W9EB 3HC0A 3DWTA 1UVQA 3LKOB 2PXYA 2X70A 2YPLA 2BOCA 2B0SH 1RV6X 5IHZA 1VADB 3O2DA 4MJ6B 4WHYG 3MOAL 3BKCH 3U83A 3U30B 5BXFA 2NR6D 5ID0A 1S9XB 4OZIA 1P7QD 2QLVB 1UGNA 5HI3D 4LHUB 2RFXA 1TZGL 3BQUC 2HJLB 4OCSL 1JL8A 4FFWC 3U48A 4U6XA 4Y5VB 2DQFB 1KJ2L 1JGLL 3VFRB 5CHNB 3T4YB 1R3HA 5ESAA 1KXQE 2J5LC 3QJHB 3O6FA 3H0TB 4AENB 5I0ZA 1DVFC 3DROA 1VFBA 1HQ4A 4MD5A 1YEFH 1JF1B 1GAFH 1I1CA 2ESVA 3CSGA 3BWUC 4Y16B 3PG2A 3PDGA 4G80B 3TA3B 3A6CH 3I9GL 3F7YA 1OHQA 4POUB 3FO0L 5KVEL 3QCVL 3HR6A 1M71A 1C16B 4LOUC 3SDCD 4Y4HB 5ADPH 1MFAL 4L9LC 1NCWH 3BESR 1T5WA 1BFTA 3IDNA 3T1FA 5BS0B 1ADQH 2ED7A 3KHQA 5E8NB 1DQDH 3UEZA 4OZFH 3HRZB 3MV9D 1DBAL 2DIJA 5T33H 3AXLA 1JHLH 2J8OA 5IHUH 5TPWH 3LB6D 1LO4H 4JY6A 4MNGB 5ESQA 3RZWA 3LPGA 1RZIA 3VGAC 1FORL 4JY5L 3IDIA 3BYYA 4F57L 4PV8A 1ZLUK 4ZG1A 4GAFB 4DVBA 1XF3B 1HE7A 2WV3A 5HYSB 2R29L 3K8MA 1UWEL 1CXEA 1VPOH 5GGSY 5T1KD 2DJUA 4ZS7H 3S35L 4ZD3H 3TIDB 4H8WH 1NJ9B 4JN2A 1TXKA 2CD0A 2HFFA 4MXWH 1HXMB 4A6YB 1I1AC 4S0TD 2FX9H 1IE5A 1ZHNB 1A7PH 1TQCB 3PABB 5HI3C 3RIFF 1NBZB 1G7HA 3TV3H 2XZAL 5E5MA 2QJDA 4PJCA 5I1CH 4JRWA 1ZVSB 5HYIA 1G7JA 4YE4H 1F02I 4LVHB 5D1QC 5E9DA 1BVKB 2HFGL 4XBPA 4ZOCA 2QL1A 2E6QA 3EAKA 5K9KB 5A2FA 3R1GH 5J13C 4Q0XL 2VDLH 2FJHA 4KFZC 4LIQH 4PGZA 4NRYB 1MVUA 4IOSD 5EU7E 4BUHA 5INCA 3WS6C 5T3ZH 1RK0B 2DQTL 4UTBL 4TUJA 4WTXA 4JN1H 4Y5VC 4HUMB 1MJ8L 2VLMD 4OFYA 3FFDA 4BSWA 4F58L 4X4YA 5IM7B 4L8CA 3D5OF 3FQTB 2EZ0D 4JM2B 1HINL 1YNKL 4YBQC 2I9TA 4PJDA 1A5FL 4G5ZL 5F7MC 4ELMA 3K7UA 1Q38A 4HMEA 2DICA 4EN3C 4G6FD 3C6LA 1U8HB 1R3LB 2E27H 1LE9A 4NBYB 1MLCB 3FN3A 4BKLA 4DZ8B 3NCYS 4D0DA 5I1LB 3T1WA 3HI1A 1T89C 1OGTA 1I7UB 1UFUA 4QTIH 5A2IH 3L3GB 1J0YA 5F1KC 5D7KD 4M5YH 3IAGC 2YZ8A 3IDXL 5B22A 1S5HA 5MEPA 3C60C 1T1ZB 4FQXA 4G7VH 4GXUN 1FFRA 3CDGA 4PJIA 2DRUA 1U41A 2FO4B 4Z7UA 3GIZL 3GGWB 3G08A 1KJMA 5L7XH 1I1FB 2Y5TB 4MJID 2V5MA 4GXVH 1MCOL 3H7BB 4LRNL 1RY7B 2E5EA 1GCFA 3KPSD 5DK0B 2I9TB 1YEJL 5B39B 1OP5K 1I8LC 4P5MA 1UEYA 5L7XL 4P2OD 1LVEA 4K94C 4Y19A 1IGFH 3U0TA 4QYOA 2APBA 4DTGL 4I8DA 4KMLB 2XFXB 3RU8L 3SKJL 4HKJB 1MAMH 3KYAA 3QIBD 4JFEA 1TFHA 4GRLA 3LN4B 4QRUB 3IJYA 4F8QA 2VN4A 5HHXL 5KVDH 4PJHA 2VR4A 4YHOH 4WW2C 3OV6A 3ZLQC 3ZTNH 4EI5C 4CVZA 4JKPH 1XH3A 2P24A 3PWPB 1G0DA 4XNXL 2PN5A 1N4XH 5EOCL 4FXKB 4J6RH 3JV0A 5I8CB 1BWWA 2NPLX 3SGDI 3MLUL 1XGYH 5CFHA 2VLJA 2MCPH 1LWRA 2EDFA 4LKXA 3MOQA 4B53A 2XQBH 3UZVB 3PP4L 2H2SC 3GK8L 3RWDA 3MLVL 4JFPA 4AENA 2GAZB 3GMQA 1TJGH 4K7PL 4Z7OF 5EOTB 4AEEA 3L5JA 1SY6A 1X5FA 4WEUD 3O2DH 2C3WA 2Z35B 3KNBA 2YPKA 1EMTH 4K55A 5IFJA 2Q1EA 4DOHE 5HI5D 1T1WA 5F9JB 4ZO8A 3PHQB 1OP3H 1G1YA 4Z8FL 3O81A 2NY1D 4XWGL 3T0VA 2OP4L 2ERJB 2FJFA 4RCAA 3CD4A 2K7PA 4JZNB 1IL1B 4MVBC 1AQKH 2A2QT 2DYPB 1ED3A 3GIVA 4LU5H 2DDQH 4XVTL 2VXTL 4C4KO 3KYNA 5HDOA 4R7DB 3GSUA 4Z7VE 4J2XA 3CNKA 3RPIA 5IP4A 3S3PA 3PWLB 4ONHA 1D6VL 3D2UB 3LEYL 3V0VB 3DMMA 4NHUB 1PQZA 2FJGB 1FL6A 1H3PH 1U8IA 4RGNB 7FABL 3AUVA 3PL6D 2PW1A 3RWEA 1KIPA 2VLRB 2P4AB 4WU7A 4JFEB 3TCLA 5ILTH 1GYAA 4Y2DC 2AV1A 1IEBB 1PX4A 4O2CA 5DJAA 1MIEH 1NMAL 2MCG1 2LTQC 1XGPB 4ZNEA 3CX2A 2HLAB 1ORQA 4LLQA 2P5EE 1NGPL 4QXWA 1SVCP 3QNYB 3QIBB 2QADD 1S7QA 5I1IL 4X80L 3O6FC 4L3CA 3RWFB 2V2XA 2CJUH 4BK5A 3S36L 4TVSa 1R3KB 2EH7L 2RGSA 4CVUA 5EORH 3U7WH 2WM0A 2E6PA 4U1JA 2J3SA 5IMOB 1QPPA 2VXQL 3HMXH 1A6WH 1HYRC 3B4NA 5DFVD 4KK6D 4MJIB 2C7UB 2H32B 4AY0A 1JPTH 3B9VA 3HNVH 3MCG1 4LMQI 1KLGB 5J56B 5D7JC 5C70A 3VFGH 3TN0B 3L5IA 4Z7OE 1KLUA 1NFKA 2D4FA 4HPOH 5ICXA 4LFHG 2JJUA 3VH8G 4MAYA 1X5YA 2LU4A 4OM1L 3H3PH 1EBPA 2H1PH 1IGTA 4JHAH 4Z7WA 2HTLC 2JIXA 1P7KB 4BH7A 4PP1C 5GS0D 2DDQL 4XVTH 2HFEA 3QDMD 4RMWA 3Q5YA 1I1FA 4ODHL 4UDTA 4W4NA 3HUJA 2VLME 3RPIB 4FTVE 4KK9D 1U3HB 5FOJA 3FO1B 4APQA 1GHFH 2XA8H 4MMZC 3O4OC 5LWYL 3HS0B 5EUOB 5FYLD 2LAGB 1RFDL 5GIRB 1SJXA 5L2KA 5ANMA 3MCLL 1NFIA 4M6ML 4L3EA 4MCYA 5HI4D 3X13B 3DURA 1IJ9A 4ZTOH 1VEPA 3STZB 2DL9A 5IFAH 5D5MF 3QFJB 2OLDA 1FNEB 4K7PY 3LV3A 4HWBH 1U8QB 4J3VA 4UV7L 5TQ2L 2C1OA 4X98A 1KLGA 2R4RH 3IAPA 1YNLL 4KJWD 3RY6A 3TT1L 3WIIL 4Y5VA 2BDNH 3DBXB 5JLZB 3GSNL 3HE6A 1AHWC 3L5WB 2NNAA 2YKLL 3ZL4L 3JUYA 3V6FA 1T22A 4HWBL 5IB1A 1NCWL 4P46D 4PRBB 3RDTD 4F7MA 3V4PL 1JF1A 1YNTB 5DMIH 3KWWA 1X7QB 5IFAL 2Y07L 2OL3L 1KCKA 4M03A 3QDGE 3VFWB 3HFMH 1PW3A 2D4DA 2N4IA 2VLKB 3BQUB 3EJYC 3V4PH 1MWAA 3OAUL 4U1IA 3T4YA 4D9LL 4UT6H 5CKAA 2NW2B 2Q20A 2FZ3B 2H3NB 3MUGA 4XXCA 5EFIA 5DD0H 3EYQC 1FNLA 1ERNA 3C6LC 5T1LA 3VG0H 3AM8A 3BRFA 1EO7A 5D2LA 3OGOE 4X98B 2AXGA 2DI9A 2A6IA 1R24A 1FFPA 1AP2B 2V5SA 2X9XA 4U1KB 3KPTA 4NQXA 1WQVT 3STBA 5JW5A 1SEQH 3IYLW 1MFDH 4HAGA 5HI4C 3FN0H 5E1AB 5JHDB 3QI9C 4GAGH 4LVEA 3TWCL 3PGFH 1DBJL 5HVHC 5IT2L 3O45A 4TSBH 1A7BA 5EU4B 3MRRA 5IBLC 3QQ3A 4XCEB 1MPAH 3R06B 3JV4A 2ZG3A 3OAYH 1TTFA 3CX5J 5D7SL 1NBVL 5DVLA 1WCBA 2QQQA 5CGTA 2PR4H 4OQTH 5CP3H 1ZAGA 4J8RA 4G8IB 1SVZA 4X5LA 3C8HA 3HE6B 1BQHG 4GRMA 1MCCA 2J2ZA 2DLFH 3RNKA 1IQDB 3TN0D 3VXOB 4M02A 3GM8A 1Q0YL 4KUZL 1AXTH 2RBLA 3SOBL 1MUJA 5K9QG 5IEHA 5M7QA 5LAXA 2MFNA 1MFBH 2A0LD 4LSQH 2H41A 3WMSA 4UTBH 2YWYA 3FQRB 3NCCB 1RJCA 1M7IA 6FABL 1BZ9B 3LPFA 1S9WB 5MEQA 1LE5B 4HUWB 3SE3A 1U8KB 3BKML 4HWZB 3TYGL 1MREH 5SWSE 1INQA 4NUGH 4M43L 4XTRC 2CK0H 3ARBD 1F3JA 5JW3H 4OLEA 3LRHA 3DX7A 3MV8B 1GC1L 2D31A 3LD8B 3MJGX 5ICXB 5IR1A 4D3CH 4ZXBB 3VWKB 2ZNXA 1PG7X 4PJ8C 4FQJL 4K3HA 3IETB 5JHLL 1ZLUH 4LCCC 1Q1JH 3O4OB 4WNQB 1EJOL 3K81A 5FGBC 5IMLA 1F4YH 5IFHL 5CGMA 3O3EB 5JPNA 1IMHC 3ZKMD 5GISH 4R0LB 1F4XH 1BJMA 2R23B 5CGYC 3V6OC 2V17H 3EO1A 5IESL 3DV6B 2DQUH 3OAZK 2NY5H 1NBYB 3UYRL 5GGRA 1OW0A 3BRDA 3P0VH 1CICA 2NY7L 1U8LB 4PRHD 3PGDA 4KH2A 4MWFA 1JPGB 4BJLA 3U0WH 3W0WB 4FG6C 3BGAA 3JWDH 4JPKL 1MCJA 2XPGB 4QRUA 2VERN 5ECJE 4GW1B 3EOBB 1O7SA 1P69B 1GOGA 2GI7A 1YA5A 1FAIH 1K3IA 3D85D 1TCRA 3D18B 3NGBC 3OKYA 1PSKL 1GGCL 2NX5B 4G6MH 2Y1VA 1FGVL 1ZHBB 4YUEH 5ETUB 5D1ZC 3PP4H 2CGRH 1A7NH 2XZQL 1QFPA 1U3HA 2V6HA 5BCAA 3VXQA 1Q9OA 4OM0L 4M48L 3H42L 5HBBA 1Q72H 3BSZH 4BM7A 5FCUL 2AXFA 1FNSL 4ONGH 3DV4A 3WN5B 5I8CA 3VFTB 5D7IA 1GGCH 1YEKH 4LLVB 5CZKA 5EU5A 3V52L 1E4XL 3PWPD 1BZ7B 2D31B 3ULUC 2VZTA 3GSXB 4MA1B 1TDQA 1RULL 2ZUTA 3L7EA 1U8QA 1MFNA 4MSWB 1ZA6A 1RZ7L 4RFOL 3KPLB 1IGFL 2H9GA 4XVJH 3AROA 2OR7A 4HF5H 5H94B 4QRPA 4Y5YA 1BQLL 4YR6B 3DI3B 5DGQA 4Q97A 1QRNB 2EE6A 5IHZB 2VISA 3FHAA 1UA6L 3ETBF 1NCDL 4JO1L 4JFFB 3P4LA 4OCMC 4EIZC 4R97B 4Q6IB 1HH6B 3LAFA 2XNAA 4M93C 5D2LB 1OP5H 1DBMH 3QQ3B 4XCEA 3GMPA 1CICB 4S1DC 4X6DF 1ZLWK 1EK3A 4LQFL 3IDXH 4KK8C 4LRNH 4O2EA 2M1KA 5E2VL 1OSZB 4ZFZB 4NM4H 1WIUA 3I6GB 5D70L 2GKIA 5E8PA 1XR8A 4ZUVB 3TLRA 1RZFH 5B3NA 1XIWD 1J7VR 3GIZH 2GFBA 4O00A 3SEPA 2Y7QB 1R6VA 5D7IB 4K94H 4NNYB 5DK2A 4XNUL 5CEZE 3CU1A 2VSDA 4PRID 4PV9A 1N5YL 1UH4A 3GSXA 4IRSC 5I18L 5IB4A 1KGCD 4Q0XH 1EEYB 2B5IC 1WBZB 5INDB 3NFNA 5BS0A 1FZJB 4IDJH 5D71H 5J1AA 3EYUH 4MZ2A 3QUZD 1OAKL 5IMOA 1CR9L 3T65A 4I13B 3FO2A 3FT2B 3LKPB 4BFEA 3DROB 3LCYA 4G6ML 1Q0XL 1RZIB 1LO2L 3ARGD 4OZHF 4X6DB 4MQXC 5GSRA 5KZCB 1ZHKA 3LSOB 5EC1B 3VW3L 4CUCA 1BFVH 3WFEL 3CFCL 4TNWK 3ULVE 4XWOD 3WFHA 4JHWH 3O4LB 5DQ9A 5D8JL 1L9NA 4PRIA 2HT4C 1U9KA 5EIIB 4I77H 5I17A 4TUOA 3VCLB 4BZ1L 3UCRA 2YUZA 1P1ZB 4HGWA 3HN3A 5IQ7H 3EIFA 1OT2A 3DHJA 3O2VH 2VR5A 3RKDC 4EI6B 4PJCB 3NVQA 5LWYH 4PB9H 3UAJD 3TO2B 5DUBA 3AREA 1IBGH 1MFCH 1P4IL 1AIFA 1DN0A 4HCRL 2UVEA 4X7CC 2BVQA 2APTA 3HCVB 3MV11 3F6LA 5FHBH 5E4EB 1MAJA 5FHBL 4MGXA 4JY5H 4Z7UE 5L2KE 1FPTH 4HLZG 1BOYA 2GJJA 1NMCC 1DDHA 3RKPA 4OZGF 3RAJH 3B8YA 2F5BL 3G5YB 4NNYA 4NQCA 4P48A 2EYTA 3QEHB 4L9DA 1TENA 3EGSA 3UTPD 5IHLB 4MA8H 1C8PA 3RAJL 1WZKA 3VW3H 3MYZA 1OTUC 4XP4H 2ZOLB 2YPVH 4QRSB 1NBYA 3IFNL 3MV9A 4O51B 3KAAA 1WISA 4L3EB 4DGVL 3I3EA 3VXRD 1FZOA 4JFHE 5BZWB 1WK0A 3BZFB 3S35X 3L3HB 2Z35A 2E9BA 3JBG7 4Y88A 1IFHH 3LDBB 3CIQA 1T0MB 3DGGA 3PP3K 5EBWA 1AKJD 1EXUB 5E6IA 5I1IH 1W8OA 1AXIB 1H3GA 4LSDA 1T22B 1WCQA 2MOVA 1CR9H 1K8IB 3BRGC 3EKCA 4X4YB 1K4DB 4WWKD 1G7PB 1KB9J 4OCWL 4KAQH 1KCSH 3FMGL 1KTDB 4OI7A 4P2RD 1KJMB 1BFOB 4I9WD 4PTUA 5DVOA 3QR2A 4ODXB 1T2JA 1OL0A 1Q94B 5KANI 5I30H 3OMZA 1HEZB 3BPCB 1P1ZA 4S2SB 4GRWH 2GCYB 5KOMC 1AP2A 1B0RB 5IBTL 4PLNC 2ICCA 4GQ9H 3UTQA 5D7SH 1OGTB 3EUUA 2DAVA 1A3QA 2WBWB 2D7TL 3L3GA 4Z7WE 1HHKB 3ULUL 2DI8A 3P9WB 4K9EH 3IJHA 5C0GB 3MXVL 2YMXH 1FJ1A 5BVJB 5HYQB 5IB2B 3QUMA 3RUGB 3C5JB 1F42A 3KYMA 2AXGB 1GHFL 3QA3B 4LHUG 4PJHB 1QR1B 5CSZB 2ICWJ 4YNYA 1CGVA 4WUUB 4QRPB 4Y5YB 3TZVC 3G08B 1F6AA 1A6TA 1WFNA 3U4AA 1CLOH 3P0GB 3ALXA 4AQ1B 3H7BA 1A7RL 1H3XA 2DTML 4G6JH 5DDHB 2VZ1A 3E8UH 3V4UL 4NSKA 2DI7A 1BZ7A 4JQVC 4JHZA 1CGTA 2XWTA 1H8OA 5BW7A 4WV1B 1TCMA 1JZ6A 3ARFC 2G2RB 5F9OL 4JQXA 1HIMH 3HI5H 1GGUA 1YY8B 3A0OA 4HFWA 2IAMC 4B7LA 5IW6B 3GHEL 2GCYA 3FOMA 1A9EA 3WHXB 4N0YH 5FO7B 2GFBB 1IC4H 2B4CH 2JK5A 4FFZH 4IOIB 3TVMC 4K8RC 3MODH 2ESVE 3G6JE 4OF8A 4XGZA 1KEML 2XN9D 3C8DA 3VI4F 1MHPL 3DHMA 4QXTB 2WUBH 2X4PB 1FJ1B 3T4AB 5I1JH 4GG8A 4KQ3H 1F8TH 5F7DA 3C5JA 3W5MA 3HB3D 1OGAE 3N06B 1S3KH 4OI9A 5GGUB 1SM3L 4PJ9C 1YC7A 5F96L 3IKKA 5CP3A 1CFVL 1CU4H 1KB5L 5D7LA 5A3IC 1NFDF 4GLRH 4M5ZH 5F6HI 4MXVF 4YPJA 1VEOA 4ISVB 1W0WB 2DYPD 3D2UA 4OFYD 5L8LB 2DQUL 2Z0BA 3BD3A 3IJHB 5EZJB 2V17L 2EDQA 3JWOC 1BVKA 5IVXA 4R0LA 3KPMB 3NA9L 4P2CG 3K4ZA 3UBXA 1RUAH 2VDKL 3OQ3B 3KJ6H 2FJHB 3L5WA 2MQ3A 4JJHA 3O2WH 3CSYB 1HSAB 4JKMA 3FOLA 3FFCE 4JM4L 2QR0A 4N5ED 3QPQC 1ITBB 1ND0B 2P42B 1HCVA 4LPWA 4L8CB 3AREB 1FVCA 3WKMH 4IRJC 4YHKL 4XC3H 1FZMB 4XTRD 3MLRH 2X1PA 4PTTA 2X1QA 4ISVA 3UTOA 1T20B 4GSDL 4FQLL 1VGKB 3L3HA 1INDL 4HIJB 4BQ9A 3IU3B 4FA8A 4PRPA 5ACZB 4PY8I 1KT2B 1NSNH 2PCPB 4PFEA 1H3VA 2D9QB 4Q9BA 4JO4H 4X6FB 3WFCH 5CBEB 4NQVB 3D3VB 3RTQB 5JHLH 3QPQD 4GSDH 4X6CA 4PJDB 5EUOF 1NGQH 5CIPH 5HHNA 5M94B 4N1CA 2YD3A 3ZDXE 1A6ZB 1UZ8B 1YZZA 1MCEA 2XZCH 3B9AA 3JVGA 3R4DA 3DMMD 3HG1A 3RHWF 3RX5A 3PE9A 4FN0A 2CK0L 4ZO9A 3I02A 1A4JB 3MRPA 2UWEB 5EU3B 3V9FA 3TYGH 2ITCB 3UTPE 5I9QB 3U0PB 2ZOLA 2MKLC 1N6QL 3CGTA 6FABH 5MI0C 2IQAB 3R06A 4OLXH 2FCBA 3LKQA 5TH2A 3VFTA 1JZ8A 1IT9H 1PVHA 4P46B 3RU8H 1I9IL 1DBJH 4MXWL 3RX7A 4GAGL 1RZFL 1FYTB 4PGDA 5E08L 3D1MC 2PXYC 5ALCH 2VO5A 4OGXL 5CZXD 3C87A 3G6JA 3GJFK 5I1JL 2XQYK 2BXYA 3E0GA 3L5HA 3FOLB 1INDH 1EDQA 5CJQL 3N9GH 3LKRB 2OK0L 3QRGH 1CD1B 3OKNB 5FUZL 5DD1L 5E8DL 2EIEA 3FB8A 1RZKH 5DHVB 1G9MH 3WUWB 3KPSB 5IHUL 1R3IL 2ZCKL 4KJYA 4U3XA 5AUMB 3T77B 2ICWI 3P4MA 4HS8L 2WWMD 3QIWD 4YHKH 3O3DB 5JW4N 1T3FB 5HJ3A 2ZUXA 1EEYA 3BPCA 4LCYB 4WUUA 3STZA 5KZCD 1K4CA 1KB5B 1QTYT 2H2PD 5C0IB 4JFPB 1PKQB 5KS9F 4ZUUA 4DN3L 4KRLB 2IAMD 3D9AH 4YXKH 4GG6F 2ITDB 2IH3B 2VLKD 3QUYA 4YHLL 4KK9C 5GS0H 3S88H 2VXUH 4YK4B 4LGPB 5J06A 1I75A 2Y72A 2AJSH 4YGVB 4N68A 2DQGH 2R0ZH 5MEOA 1S7TB 4NC0B 2NXYB 5EOCH 2DS4A 3QHTC 4YNYB 1NDMB 5GZND 3O9WB 2VH5L 1S7RB 1A7NL 2B8OT 1WEJH 1LK2B 3ULUD 1IGJA 4TNVF 1EEQA 3NIGE 3UTZB 35C8L 4LIQL 1WZLA 3KPSA 2W0PA 1RI8A 2C4FT 4WI4A 4H1LB 4MS8D 2YRLA 4G3YL 5F3BA 1J1OH 5DFTA 2VAJA 3PWUB 1YY8A 2R0ZL 4K3EH 4KKNA 4ETQA 1WWCA 2WIMA 5IGXL 3BJLA 4BYHA 3JV4B 2WP3O 4JPWH 2BSSA 4N8CH 5DRXA 5D7LD 3P77B 4JKKA 4XAWH 5GZOC 3WUWG 1QZ1A 3U46A 3OR7A 4LLAA 5F8QC 1YMMA 4TPRL 4HPYL 2PYEE 3FB6B 4XGZB 2F8OA 4FQIL 4JDZA 3UYPA 2AEQH 3QDGD 1KTKE 4P4KB 3MFGB 3F6IA 4PRAA 3KJ4C 1UM5H 2VLRD 5D72L 5DR5H 1LEKB 1IEAB 5HHOE 2Y06L 4ZSOA 4KI5F 1N0LA 3ME0A 3WBDA 3OJDB 3BW9B 2XXMB 3MA9H 4JFXB 1GIGL 4UI2A 4LCWD 3SDCB 3IGAB 4WCYL 3IFOB 1H15A 1F4YL 5GRUL 5I71B 2JF1A 1T0NB 3C2AL 3RVUD 4MDIA 5FUZH 1A1OB 5C6WH 1IM3B 2PF6A 2DIAA 2JLLA 2YSSB 4CADA 5JZ7C 5IVXE 4JQIH 2O5ZH 3WFEH 1OSPH 2AKRB 5A3ID 2QSCH 1JP5A 2WIIB 5D6DC 1Y6KR 3QO1A 3N1QC 3QHZL 4HULB 3NPSC 3WL9B 2WSKA 5L9DL 4PJAE 2CH8A 3VFNB 4DW2L 2YC1A 4J3SA 5DVKA 3HMXL 4LLMB 1G7QB 1UC6A 5J8OA 4NWTL 4F58H 1PEWA 2OM5A 5EZIL 3AXLB 1J88A 4JJ5A 5EPMA 4J7RA 1IM9A 1INEH 3O6MH 1HEZA 1FVCB 1QA9A 4JFED 3AS0A 4U0RB 4FZ8H 3ES6B 5AYUL 1U3ZA 4AEFA 3PL6B 3QUXB 5KBNC 1S9YB 4UMGA 1QFHA 3HC3H 3N50A 3MRKB 3CC5B 3OKEB 1P6FA 3T0BA 3DURB 4OZHB 5J12C 3DX7B 1GGIL 4CJ1A 2IANA 5L0QB 3KPNB 2EDLA 3LHPL 4A6YA 1UADC 1NC4B 4FQHA 1H3TA 4UQ2A 5I1HH 3C6SB 1YEIH 5FYLE 1AQKL 3LEYH 4QRPE 5CBEA 4CNIB 2IMMA 4XNZC 3VFNA 4F7EA 3TZVB 4JRXD 2DTSA 4UDTB 2ARWA 4CDGC 1EH9A 2ICEB 4E42A 1RK1A 4KQ4L 4F7MB 4P46A 1RQ5A 3C2SA 1X6LA 4HPYH 1QOKA 1UA6H 3HPLA 4LKCB 2P8MB 2YPVL 4JFOB 4X0KA 4Y2DA 5EZLA 3UPCA 4XMKH 2NTSP 5DT1H 3RGVA 4JZOB 3DECA 3O3DA 1T3FA 5I1DA 1IM3A 4ZO7A 1A4JA 4HKBB 2NXZB 1IAIM 1HDMB 1R5WA 1LEGB 3BUYB 1Z0NA 4I4WB 3ZYZA 5MHSD 5F93C 1YPZA 2DMCA 4FP8H 1QG3A 3VXMB 4DCQB 1LO2H 2BJML 2CRZA 5DQ9B 4O9HL 3MLVH 1YJDH 3SDYH 1AE6H 3EFFB 3GUTB 1MCWW 3IKCB 4X6EB 1MFCL 3ARPA 5F1OB 2F5AH 3QXVA 5TDNB 1Y6MR 4GBXA 4XWGH 2FECL 1RIVH 4PJGB 1PKQA 4JFZH 4WFHD 5HGDA 5E9DD 4A2LA 1YUHA 3KG5A 4Z78A 4M5ZL 5IBUB 4CBPA 1MNUH 5E1AA 4RGOL 5BQ7B 4HJGB 1LO0L 3ARBB 3MCKB 2QQNH 4P9HC 3SGEI 3T77A 5I2IB 1S9YA 3S3JA 3N1FC 4QXGH 2A38A 2JELL 3MRRB 1UWXK 1T5XB 4YDIH 3HR5A 3SPVA 4PJ5E 1FDLL 4HIEA 5J13B 4GMSH 3RA7L 3CPLB 3ARFD 3X11A 4RGOH 1Z3GL 3ARGB 2FD6L 4E0RA 1MWAL 3DX9A 1QBML 3BMWA 1NL0L 2GJ6B 1FCCA 1O5DT 1EHNA 5FYJD 3G5XB 4LNRB 2VWEE 4BZ2H 3IRZA 4KDTC 1IC4L 3P4NB 4XBGB 3PIQA 1HHGA 1G9EA 1Z9SA 2QQKL 3MJ9H 1MY7A 5GGSB 1F90H 2DBLL 3T3MF 3GUTA 1RZKC 2ICEA 1DQJA 3VXRA 5F71A 1CE6B 2ZSVA 3LRSB 1PZUB 4J4PD 3NFNB 3QEQD 4OZGA 4X7TB 5D1ZA 5D96C 2AK1L 4JG1H 1T7VA 4HIXH 2DMKA 4M7LL 4RIRB 4TTDD 1XCQA 1C08B 4KKAC 4UU9B 1ZT7B 5EU6A 3MRCB 1A3RH 5DMKA 4G6JL 5D1ZD 1D9KA 3VXSA 2XTJB 1K9TA 4H1LA 3CLFL 4E41B 3B3IB 4J4PC 4M4RA 3E2HB 5C0FB 4J8RB 1W8NA 1GH7A 5FV1L 4OB5L 4OSUH 3BW9A 3CMOL 3RHWK 1QO3A 2FX8H 3LPWA 4NPYB 1KENL 3B6SA 4OJFH 3MTRA 4IM8A 2J88H 1M6OB 1DEDA 1W72H 2HJKA 4LSRL 2GK0B 4TRPL 4HS3A 4QOKB 4JDZB 1UENA 3LS5L 4S1DD 3WD5L 1IQWL 4R4ND 5SWZB 4DGYH 2CUHA 3T2OA 2VAAA 1MHEA 2WIIA 4OUOA 3U7WL 2YA1A 2H2PC 5I30L 5HHOD 1LK3H 2HFGH 2A1WH 3SKUD 1AIFB 1DN0B 5I1GH 1MCRA 1D6EB 4NCC1 4YZFE 1ZHLA 1I1AA 1KIUA 1AC6A 1RJZA 3MBED 3SGKC 2IJ0C 3MLRL 4NN5B 1J0ZA 5I1GL 4HK0A 4L29B 4M43H 1W0VA 5BZDB 4XC3L 5T1MB 2G5BA 3DUUA 3KPNA 2XPGA 3S96A 3K8KA 4I2XA 1VPOL 3SE3C 5C0BE 1QO3B 1YN6A 4P3WA 1RUML 3MR9A 5KG9B 1A7PL 3BZDA 3LKRA 1BJ8A 4FQLH 3SDAD 1D6VH 5IFHH 4HH9A 2ZUUA 2EEBA 2PW2A 4LDLB 3CFIC 5HGHA 1SY6H 3MUJA 4U1NA 3T09A 1DCLA 2WBJD 3AB0C 4JFOA 1G7IB 5DJCA 4MQ7A 4PJ7B 1L6ZA 3MRFA 4M7LT 3AU1B 1BP3B 4Y1AA 1QSED 5GPRA 1B90A 3E6FA 4NO5B 4MNQD 3VFMB 3O11B 4K3JL 5CSBA 4F7EB 5C0BB 3DVNA 5I15L 5MENA 1LEGA 1XAUA 1Z6JT 2WLZA 1T04B 4KHTL 1R3KA 3VXME 4LPCA 3WUWA 3E2HC 3BN3B 1KCUL 2PXYB 4HLJA 3MA7B 1QFWL 3ZT7A 1JGEB 3L7FA 3CK0H 4KKLC 4D9LH 5T3XE 5C0CE 4FTVA 3C6LB 3FQXA 4K7PX 4KDTA 3EFFA 3UO1L 2R2HB 2IPUK 3S36X 4YGVA 3CH8A 1C5DB 4HFUH 1CICD 2K1MA 4YHYB 1R3JB 3O9WA 2A74A 2FBJH 4ZPTB 3FL7A 4YR6A 4QRPD 2GSGB 1TTUA 1BGXH 3M8OL 3MRBB 5TPWL 4U6XB 2VDRH 4U31A 4PJ7E 3RGHA 4FQJH 4G8EA 4ELKB 3QDGA 1N64H 1KJ2H 1ZHLB 5C9JA 3BIKA 1OLZA 2HP4A 2A1WL 5FYKE 1L6XA 3S34L 1KTDA 3R0MA 1AGBA 3HAEB 4X9GA 4ZUVA 3FO0H 5KVEH 5LGJB 4HXAL 2MMXA 4I2XB 2PXYD 5F96H 3ZDZE 3U36A 4XPHH 5KANG 4OCYH 1CVSC 2AP2A 2NY6B 3EYFB 2KPNA 4HZLA 3L3IA 3S97C 3EYQD 3MBEB 3HE7C 2GYSA 4XNMA 4IIQA 5C0AD 2IFFH 3MNZA 1T03H 3L3JA 5DRZB 2AI0H 3GKZA 5E6ID 3LV3B 5GRXG 5FO7A 4PGJA 5LQBL 1BOGB 1X4ZA 5HGBA 1K8DA 4OV5B 3OX8B 1XR8B 3QDGB 4P4KC 3LEXA 3QI9D 5J9PA 1QP1A 3KLSA 2NY0C 1GOFA 4P46C 1FVDB 2E8ZA 4ORGB 4PJ8B 4H25B 4P2OB 5B3JE 1WIOA 3UC0H 1G7HB 2WP3T 1U92B 3B6SB 3GRWL 2DM3A 3V0AC 5KVGL 4MD4B 1N0XH 1J0IA 3PIQB 3DTXB 4I1NB 3UC0L 1NDGA 4XPAL 3WKNA 4PLJD 5ALCL 3B9EA 3MYJA 5FXCH 4OQ1A 2W9LA 1KXVC 2EICA 1OD9A 4EI6A 3LHPH 3A6BL 4OGAD 1T80A 5EZJA 5FGCB 1B0WA 3U7YH 5D1XB 1WIPA 1FO0A 1E4JA 4JO3L 4POZC 3PGCA 3K8LA 2DQTH 3W5NA 2UYLA 5DMKB 5FA3A 1BVZA 1UCTA 1TJHL 1L0YA 2X4NA 1WAAF 5E6YA 2D0FA 3DO7A 1N64L 3QWRA 4QLRA 5ID1A 5D9SA 3ARDA 1ND0A 2CGRL 4BFGA 1LE9B 1DBBH 1T4KA 1W72A 3M17B 4OCNC 4Z7NE 2CLRB 3MR9B 3QWQB 3H9SD 3WDHA 4R90H 4I0PD 1N2RB 4IIQB 5D1QB 3CC5A 1RK1B 2E9IA 4K71C 4NKMB 1YMHB 2AEIT 3BP6A 4L29A 4RMTA 1MJ7H 4L8SB 5L9DH 4YBLB 5DJAB 1P4IH 1NEZG 1OAYL 2BXZA 3IU3A 4U3CA 1KSRA 4TVPL 5I6XC 1D6EA 1AJ7L 4XBPB 4NQEE 3HA0A 4WHCA 3PGCB 5K9KA 5MERA 2XY2A 3HPLB 4RMRA 3H6JA 3S9DB 3PHOB 3QRGL 1RURH 2CRYA 4G9FB 1KN4H 3SE4A 3I50H 3FQRA 5JA9A 3HG1B 3U79A 3C60A 1TJIH 4RSVA 2A73B 2VDQH 2AEWA 2QHRH 2J6EH 1FL3B 2RHEA 2GSIA 1ZLWH 1UT9A 2VL4A 2CUIA 1NQBA 4OLYL 2CLRA 1ZSDB 1NKRA 4CKVX 3BKYH 5HDQH 4AIZA 1HHKA 2PCPA 4I9WE 3KPRE 1AH1A 1XH3B 4N8CL 4N9GB 2V9TA 4O5LH 4HPOL 5D71L 1LNUA 3IFPB 3O2VL 3H9ZA 4OD3H 5D2LF 4J4PA 3RVTD 1AO7A 1RUPH 1I85A 1JZ4A 4LSTH 4LP4A 4M61A 4NT6B 5CJBA 1I8MA 4P4RA 2ZSWA 4GRWB 3MGTA 4OLVH 1RU9H 4OCRH 4WUKL 1QLEH 3V6OE 4NCDA 3V6ZB 3CFCH 1SYSB 3EHBC 3VXTB 25C8H 1HHGB 3H9SB 4M8QB 5JDSA 1KEGH 2F54D 1WC7A 4ZUTA 3UJIL 4N90D 2WMPA 2YSSA 1HXYA 1CLYH 4CADB 3MLXL 4PUBH 2GW5A 5IF0A 4U6TA 1K4CB 1KB5A 2E6JA 2Z8WC 4IHOB 3ZDYE 2AKRA 4PGDB 2P43B 1NGPH 4MHHG 4GW5B 5AAWA 5FDWB 3VFOB 1J1XL 2I60H 4OIIL 1CDIA 3ULSA 2DQIL 4YHOL 3QIUC 3TYFB 4QY8A 4M5YL 3C2AH 2YXFA 4XZUB 3BP5A 1A7OL 2AK1H 4W4OC 1YNTA 3NAAL 5AAMA 3LQMA 2YR3A 1CDJA 4P4KD 1LD9A 1MAML 1ZXQA 4I3RH 5E4EC 4CU6A 1A3RL 1FZKA 1BBJB 2VL5A 2XG5A 1F58H 4IRJA 4LQFH 4NHUA 3GBMH 2RR3A 4RZCB 5I76A 3UTZA 3L6FB 3ZE1F 3GSWA 1G7MB 5F7HA 3WO4B 4WEMB 1NL0H 4M48H 1FNAA 1CLCA 1S7UB 2WINB 3ZZ1A 1BREA 4OAWB 1J9CT 3Q3GA 1YY9C 4EN3B 2DWEB 1HXYB 5IF0B 1OTUD 5TE7H 4QXTA 4BK4A 3G5VA 1B88A 5DO2C 1KN2L 1C1EH 4JVUA 3VG0L 2X4RA 4AT6A 2VLLA 3CFEB 1X6NA 4EOWL 3OKLA 1S7SB 1NANI 4MSWA 4PJIF 3ULVL 1RULH 2H9GB 5ISZA 3JWOH 1DSFH 1EUTA 1BPVA 3MYJB 4NKDA 5K9QI 5J9PB 4NNXB 4PJXF 4L1HA 3JZ7A 4ZSOB 4PJ5B 1ZLVK 3NCMA 2OJZL 5CWSB 4XHJC 2E27L 1DLHA 1J05A 4G6AD 1FFOA 2AK4D 4UIKL 4QTHA 3I6KA 4GG6A 5CBAB 5LBSH 4K07A 2VJXA 3RIAF 3RIAK 4YIQA 1G0XA 1ZHNA 3UP1A 2JJWA 3VXMA 25C8L 3GDBA 5DHXB 3UO1H