1JRHL

Complex (antibody/antigen)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
167
Chain Sequence
SVEMTQSPSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETEVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTWTFGGGTKLEIKRADAAPTVSIFPCFLNNFYPKDINVKGVLNSWTDQDSKDSTYSMSSTCEATHKTSTSPIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords ANTIBODY A6
publication title Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 167
sequence length 206
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhL01
2FX8H 1HZHL 5BMFL 4UT6H 1T22A 5DHXB 4X98B 2A9MH 2VQ1B 4KI5F 4MAYD 4ZQKA 1P9MA 3BZEA 3FT4A 4J8RB 3CK0L 5I1LB 2W1NA 4X7CC 5J9PB 1J11A 4YXHH 3HKFA 2R0KH 4JRYE 4YDVA 3DIFA 1C12B 2DWDA 1CFNA 3NFSL 5A16A 4O4YL 4GMSH 4LDLB 2GEEA 5LAXA 2VYRE 4UIMA 2VLLA 1D5BA 2A9ML 4J3VA 1KT2A 2YZ8A 3DO7A 3PABA 2VWEC 3QHZH 4JQXC 3NACH 1QHPA 1Q9KB 1QO3A 1UM6L 2XA8H 1W8NA 2WWKO 3GSVA 2NY5H 3FB7A 3QUYB 4NKQB 1S9XA 4UAOB 5T5FH 5HVHB 1AHWB 2DYPD 1IRAY 3LQAC 3O4OB 4WCYH 5A1AA 3JV5A 3QUYC 1Q9OA 4UAOC 4O00A 5HJ3A 5HVHC 3LV3A 1AHWC 3IDGA 5FGSA 3QHZL 3WNOA 3O4OC 5I1DA 5C0JB 2Z9TA 2DAVA 1RHFA 4HIXL 1W0WA 1H3GA 2NY5L 3X3GH 2HLAA 1HQRA 4XNUL 3GIVA 5IHBA 5T5FL 3CSBA 4QRRD 1WWCA 2AV1A 2EIZA 3L7EB 3WXVL 4JFPA 4RX4A 5LBSH 5JNYB 4UUJA 2JB5H 1ACZA 5H35B 2G9HA 1WC7A 1XF1A 3LY6A 3RPIB 1Z5LB 1E4WL 2KUTA 5IB4A 4C56D 3X12A 1XR9A 2EDBA 1QRNB 1D6VL 3HS0B 3VGEA 4OCNC 2CSPA 2VZ1A 4JZJB 3T2NH 1XGYH 3BPCB 3QPXL 1JZ2A 5SX4I 2DL9A 4KKCC 5DA0B 4F80A 1S9YB 2NX5A 3AU1A 2JB5L 4QHKJ 5MENE 2VZUA 1G9EA 4JZJC 4OZIE 5K93A 3WNMA 1VSCA 5DD6B 5E6ZA 3B5HA 1JYXA 3ARZA 3R1GL 3TNMA 3T65B 3A67L 1FNGA 1SEQL 4CRPA 5I0DA 4FQXD 4B5EA 5DK0B 1XGYL 3RWGA 1JF1A 5DMKA 1RJLA 2QADB 3O9WA 1KPRB 1D7FA 4KI5C 1PZ5A 5HHME 3SE4C 4B50A 4PTUB 2ORBL 1FFNB 1MCSA 3NCCB 2W9DL 2R4SH 4BSWA 2QADC 5HGAB 5EUOA 4JRXB 4TVPH 5ECJE 32C2A 3K1DA 3WLBA 4AEHL 4JAMB 3QDJA 4UOW1 3S4SA 4CMMA 4ZXBD 1BEYL 2NY5C 4ZNEE 1HH6B 3HG1D 1RD6A 4DTGL 5C8JB 3QFJB 1I7ZB 1YECH 2XPGA 4AEFA 1A9BB 2Z4QA 4TVPL 1G7MB 1JE6A 1UJTA 3VWKA 4M8VA 1UXWA 3NFPA 1YEFH 3QWRA 4ORGA 4X4ME 4H1LG 2IPTH 3JZ7A 4M9PA 3QUXA 1FL3B 1YECL 2P7TA 3MJ8B 4Z7OF 1GZPA 4OTXH 4XCFH 1YEHL 1QACA 2LVEA 5B4MC 4TULH 4DCQB 4LVHB 3RZCD 3C60B 5K9JL 2AQ2A 3ULUF 1MI5A 3ZKND 2IPTL 4LVHC 3GNMH 3MLVH 3LSOB 4NQDA 3HMWH 3C60C 3P77A 1IQWL 1H3VA 1C5BL 5ISZA 1U93A 4MX7A 5IB2A 2Q7YB 1JRHI 4RGND 3FN0L 3ULUH 2J8UF 3P4OB 1RK0B 2YC1A 2FB4L 1FVCB 4XRCA 4LNRB 1DR9A 2GJZB 1TZHB 5HYIA 2Q76B 3KYMB 3GNML 3MLVL 4M62H 1NDGA 3WFBL 1C16B 2VLRA 5CD5D 2ZG3A 1ZEAL 2D4FA 3QHTC 3ZTNH 4LSRH 1HOCB 1CFVH 4LHUA 3ULUL 5GRUH 4HUNB 4S1DD 4APQA 1E4KC 4YBQD 3MJGX 2XN9D 2X4OA 4G7YL 5DJAA 4OLYH 4V2BA 2VMFA 1FO0H 4M62L 4F2MA 1OOAA 3IDJA 1ROWA 3BP7A 3HFML 1HXMB 4NFDA 4NQVA 3FZUC 4LSRL 3D0VB 4Y16D 3M17B 4QEGA 1CFVL 3HZYB 4RISH 4G9DA 4F57H 1T20A 3RNKB 1UH3A 1IAOB 1IZJA 4JPVL 2W07A 1X5HA 3S35L 3KPQA 5CEZH 2WBWB 2UYLB 1FO0L 4WWKB 1L0XA 4MAUH 3PP3H 3K7UA 2WBKA 4A6YA 4LSSH 1I4FB 3FQWB 1EEYB 2IADB 4ONOA 4JG1H 4WWKC 5CEXA 4F57L 3OR6B 5L8LB 1FCGA 3WIIH 3G5YA 4ZS6C 1X44A 3HNTH 5CEZL 4GBXA 4Q0XH 3ROLB 5AYUH 1I1AA 3FB5B 4MAUL 5J12B 5IB1A 4ISVB 5DFVC 3U0TA 4XP9H 4R0LB 1HCFX 4HCRH 1WZKA 2V5SA 5J12C 4P23B 4LLMA 5D7IA 4EN3D 3T09A 3HE7B 1BLNA 3FQUB 3WIIL 4R0LC 4N8VA 1UQSA 3OGCB 4RMQA 3HNTL 4M02A 4QCIA 4P23C 3T0XA 2YN3A 5AYUL 3PWVA 3HE7C 1VFBA 5DC4B 3WIFA 4XP9L 3MUY1 1U8MA 4G8FA 5JQ6H 1IT9H 1S9VB 4HCRL 4X99B 4OFYD 4CDHA 1L0QA 2ZCHH 4FTVB 4LPTA 2AXGB 3HRZA 3UJTL 1MJJB 4KMTH 3D2UB 4JDZB 4TUJA 3P2TA 1I3RB 1WWWX 5TDOA 4S10A 2B4CL 3W5MA 2NLJA 3GSNH 4N0CD 3WSQH 5IB3B 4D9QE 2UZXB 3Q0HA 4J3XA 4EI5A 5I19H 1OPGL 3O3EB 1M1SA 4LQFH 1MQKH 4NJ9H 3ARFA 4UU9B 5DJ6B 1A8JH 3I6GA 3KXFD 2WIMA 1BQSA 4L3AA 5C92A 5GGVY 4Z5RB 2AJUL 4IRJA 4GT7A 5IG7A 3BPNB 3AFLA 1KBGL 4QOKA 3QXDA 2GTWA 3T0WA 3WSQL 4GXVL 5T1LA 2ZPKL 3LN5B 4RFOH 3MRDA 3BPNC 3FONA 5I19L 4Z7VE 1DUZA 2ADIA 1U8QB 1S5HB 1P5UA 2XTJB 4X5XB 5DHYB 1YQ2A 3HCVB 4PJXA 3ULSB 2Y7QA 5J06A 1A02N 1OLLA 1V05A 3SE8H 2ICEB 2XTJC 1ZSDA 4MNQE 3N1GC 4UDTB 2RCSH 4YIQB 3KPSA 1GJIA 2Q6WB 2B20A 1P84J 1T83A 4LLWB 3SY0B 5E00B 2IQAA 3CLEH 3KLHC 3MJ9A 3LRSA 2W9EH 3AAZA 3FFDB 4KHTL 4WFGE 5IMMA 3BWAA 2LAGB 4Z9KB 2X4QA 4HJ0C 5FGRA 3EOAA 2UWEA 2J1KA 3KPLB 2NZ9D 3SE3A 4I18A 3I75B 3AXLB 4Y2DB 2OQJA 4O58H 2W9EL 3P9WB 4R4NC 7FABL 3UC0H 4WI2A 3M1BB 1WTGT 1FP5A 4X5WA 2BRRL 4Y2DC 5AWNH 3GSNB 4F7PA 4JFDB 3AGVA 2H3NB 5DT1L 5DSCA 4QRUB 3RL2A 3ARBA 1ZA3B 3QO0B 3BD4A 4WI5A 2R2CA 2JCCB 4M1CC 4MMZC 3C2SA 4O5LL 1J7VR 5C0BA 1KYOJ 1J05B 3FB6B 3UTTD 4JFYB 3TYGH 4DGVH 4O58L 1F11A 3MX0A 4BA8A 1GVIA 4PGDB 3DJ9A 4JKLA 5CZXC 3RY4A 1MHEB 4X98A 2D7QA 2VQ1A 5I15L 4J8RA 5I1LA 1IGCH 5DDHB 2D0HA 5J9PA 3QG6B 4ERSL 2YD2A 1MCKA 2IBGA 4ORZC 5E1AB 2UY7A 3WDHA 4O2FB 1C12A 5F71A 1ZTXH 4JQXA 4LSPH 4M48L 2AJ3B 2AK4B 4HEME 4JO1H 2W0FB 1RZJH 2BOBB 1Q9KA 5FGCB 4HK3N 3G6JB 3QUYA 1EV2E 1U36A 5E6ID 1AHWA 3RTQD 4KV5F 3MTRA 3JWNC 4NCC2 5TQ2L 1U41A 5SWSD 2E7HA 1KJVB 3MV7E 1FQ9C 4YHLL 5C0JA 5JPMB 4YHPB 1MCJA 1P4IH 3PDDA 3DTXB 1JBJA 4XMLH 3NCMA 3QHFH 4I1NB 2EDOA 4OCYL 3JWOL 3L7EA 5I1KL 2CLRB 5E9DB 4DQOL 5JNYA 1RURH 5CP3A 2XV6B 2VXUH 5DD0H 5H35A 1MAKA 2P5EE 2F8VA 3RPIA 1EFXB 1Z5LA 2Z31B 5F9WB 3T3PF 4F58L 4I8DA 3C87A 3JV0A 3GSXB 3SGDI 1QRNA 2BNRB 3HS0A 1P4IL 4NCC1 1AO7D 4XMLL 4JZJA 5L88H 2Z31C 5F9WC 3BX7C 3BPCA 1S9YA 2FNBA 1RURL 2FECL 1O0VA 5DD6A 2EDTA 1ZWIB 4U2ZA 3T65A 5T5NF 4MJ2A 3RL1B 1PEWA 2GW5A 3SE4A 1SVZA 5DK0A 1X6LA 4HMEA 4IDLA 4KKLC 5L88L 5JHLH 1MFCH 1VGKB 2K3TA 5BVJB 1KPRA 2XZAH 1CR9H 3I6KB 3KJ6H 1DBMH 4PTUA 1FFNA 1KFAL 1ZK9A 2EC9U 5B3NA 4LSUL 5HGAA 4LVNB 1RZJC 5D8JH 4JRXA 2D7TH 2VO5A 4JAMA 4WTZG 3MV9B 4LVNC 3NGBB 1F45A 1MFCL 4D0CB 4G8GE 5BRZB 1DQDH 2XZAL 3HMXL 1CR9L 1HH6A 5D70H 4LSQH 2D2OA 4YHIB 5C8JA 3NGBC 2EE6A 1I7ZA 2XQYG 3QFJA 1F58L 2WMPA 4PLJC 4TRPH 1A9BA 4QTIH 5D8JL 1G7MA 5D5MF 4U4BA 2D7TL 1SJHB 5HGBB 2CXGA 4JG0L 4YHOH 4W4OC 1M05B 1QPPA 4N9GB 2E27H 3U7YL 4ODHH 1W0VB 1TQBB 1FZJB 4TOYH 4LSQL 4C4KT 3TJHD 4AYFA 1FL3A 2E9WA 3MJ8A 4TRPL 1RMFH 4QTIL 1TQBC 1T2JA 4PJ7F 5E94B 2VDMH 5HHPB 4DCQA 5GPRA 5LCVH 1KCUH 2A1WH 1OAXH 5T3ZE 4NM4L 2X1QA 4Y4HD 2E27L 3D85B 4R8WL 3REVB 3WUWB 4UT9H 4ODHL 3QDMB 1CL7I 4TOYL 3LSOA 4RFEB 1UENA 1YPZB 1JV5B 1FORH 4KUCD 5GS1B 2Q7YA 1RMFL 5HHQB 3RVWD 3OAZH 4W68A 3P4OA 1RK0A 2JELH 4GQ9H 4HFUL 1KCUL 2A1WL 1OAXL 3V0WH 1FVCA 4YDIH 4U1MB 5GS1C 4CMHB 4MJ6B 1SYSB 1EHNA 1UWGL 4LNRA 2GJZA 3KNBB 1TZHA 4GKOA 2Q76A 3KYMA 3WFZA 3OX8B 1C16A 4FP8H 1NPUA 5MP6L 1FORL 4CMHC 1E4KA 2W9LA 4PJ5D 4LVEA 1HOCA 1BVKB 1T4KB 3HPJB 3MLXH 3V0WL 1YYMH 4IBLT 4R6UA 4YDIL 4YGVA 1HI6B 4FFZL 4U6YB 5JO5A 3WD5H 4AK1A 1B4JH 3ZE1E 5BCAA 2H9GB 1HNGA 1HXMA 3WUZA 4NZTL 3D0VA 4OLXH 3M17A 2F8OA 5DYOB 3HZYA 2CIKB 4M00A 5CZVH 3OBAA 1GIGH 1JP5A 5FV2A 3MLXL 5T3XE 3RNKA 1IAOA 5AAMA 3RA7H 2NW3B 2R4RH 4PJFF 2UYLA 1B4JL 4WWKA 1I9JH 3LVEA 1FZMB 1RUMH 4L5FL 2F5BH 1I4FA 3FQWA 1EEYA 5HYJE 1JGDB 4P59L 5IBUB 2LV4A 5FA3B 1AY1H 5CZVL 3Q3GB 3FOMB 1DCLA 1T7WA 2NR6D 3OR6A 4WI8A 2R39A 1MIML 5JW4M 2E7LC 4IDJH 1JMXA 1U92B 4GJTB 3ROLA 4KKAC 1I9JL 1HIML 4Y5XB 3FB5A 4Z7WF 1RUML 4ISVA 2F5BL 2VQUA 1U6AL 2RGSA 4X9IA 3MCKB 4OGAD 4R0LA 2X4NB 4R9HA 3T2PA 3D25B 5DI8B 5CJ8A 3NBNA 4Y5XC 3LKQB 4P23A 2KQMA 3HE7A 1XT5A 3FQUA 1A7QH 1BREA 4LHQB 3OGCA 4IDJL 5C0AB 3SDAB 3VFMB 5HDQL 4G6FB 1KGCE 3P0YH 4PGCB 2FJFB 2CUMA 5F3BB 1QBMH 1S7QB 1AC0A 4F7TB 3TC9A 3SDAC 5EZIL 3BAEH 1S9VA 2VDPH 4X99A 1N4XL 1MFEH 5E7FA 4FTVA 4NQEE 4W4NA 1UZ6F 2VUOA 1A7QL 2AXGA 2HKHH 1MJJA 4U6VL 3D2UA 4JDZA 2DQJL 2YK1H 2HTKD 3SKMB 3P0YL 1OGAB 1I3RA 4Y88A 1MRDL 1DBBH 4HS8L 4MA7H 2C3GA 1KB9J 3BAEL 5IB3A 3N1PC 2VDPL 1MFEL 3MLUL 3MBEB 1P53A 3O3EA 3UXFA 4UU9A 5DJ6A 3MOAH 3F7PC 5JOEA 3MBEC 4Z5RA 3NA9L 1DBBL 5MERB 3O4LE 1TJIH 5CSZB 4YEFA 3LN5A 3TBTB 2YPLD 2X1WL 3TNNB 2CKBH 1JZ8A 1X5FA 1U8QA 1S5HA 3NH7H 5DHYA 4X5XA 2DS4A 4D2NA 3QR2A 3SDYH 3MOAL 2AS5M 3HCVA 3ULSA 4OSUH 4JQVC 1WGOA 1NCUA 2ICEA 4JHAH 4Q97A 1MCRA 5CP7B 2QSQA 3ZDYE 1KEGL 4UDTA 3QQ9D 4KK6C 4X8XA 5E08H 4YIQA 5H94B 3WMSA 2Q6WA 4LLWA 3SY0A 1XGUB 5E00A 2LABA 3EDFA 3NH7L 3STZB 5ETUB 3SDYL 4WFFD 3FFDA 3KVQA 4OSUL 1WIUA 1NANI 4PRIE 3MREB 4JHAL 1A7OH 1KXVC 4K9EL 4HV8B 4AMKH 1FHGA 4HBCH 3KPLA 1RJZA 2X9XA 2AVGA 3RUGB 1DQMH 4F37K 1OAKH 3I75A 3AXLA 4Y2DA 4AIOA 2VNCA 4OQTH 5HSFA 3M1BA 4RNRB 1PG7L 3ULVD 3GSNA 4JFDA 2H3NA 1JTOA 5LGHH 2BVEA 4AMKL 4QRUA 1OAQH 2P5WD 5EIQA 3RDTB 3QO0A 1ZA3A 2JCCA 1DQML 1J05A 3FB6A 1JWSB 4L29B 4JFYA 3S96B 1KB5B 4X7FC 3RDTC 5C9KA 2DMKA 4MQSB 5C0CB 1AGFB 5GGVH 4PGDA 4ZYKB 2P44B 1CD9B 5LGHL 3HE6B 1MHEA 2FSEB 4HX1B 4WW2A 3S36X 1A22B 2CKBB 4QRQB 3QFDB 3DUUB 4U05A 4LFHD 4AEIH 1UWXH 4XNZB 5DDHA 3HE6C 5D7LB 3QG6A 3O2VH 4Q2ZB 5E1AA 5EBMB 3IB4A 4O2FA 3UPRB 2FBJH 4XNZC 1XMWA 2EECA 4PRPD 4MJ5B 1DEDA 4XVSH 4XI5D 2AJ3A 4G5ZH 2AK4A 5C86A 1WZLA 3OB0K 2W0FA 2BOBA 2ZCLH 5B38G 4PFEA 5EORL 3G6JA 1LP9B 1MEXL 1ZE3C 3EGSB 5D96B 5IVNA 3LPGA 2EC8A 5BS0E 3TN0B 3RVTC 5IFJB 4XVSL 4Y4FD 1MVFA 1LEKB 4G5ZL 4U1SB 3BHBB 1TCRB 3VFVB 5D96C 2G60H 4GKNB 2VZVA 2ZCLL 3TN0C 1XF2B 4RZCB 4NNPH 1KJVA 4I48B 5JPMA 4YHPA 1SJXA 3DTXA 4GSDH 3MZGB 4LLUB 4PJDE 2NXYD 3NIGE 4OUOA 3MLWH 3I3DA 4NHCL 2CLRA 5E9DA 2FO4B 2G60L 5T1KD 4P2CG 3K4DA 1JI1A 4GG8B 1YUHB 4L4TB 4NNPL 1EFXA 2Z31A 2K9UA 3NTCH 3GSXA 5C07B 2BNRA 1AD9B 4GSDL 4X6DF 1IGJB 5FKPB 5EOTB 3GO1L 2OL3H 3MLWL 1A0QH 5AD0A 3TBWB 5KVDH 4L1HA 4HAFA 2C3VB 4LRNL 5CHNB 4YXLH 1T21B 4ENED 4QNPE 1ZWIA 5K9OB 4RAUB 1EMTH 3H9YA 4MLSA 3RL1A 3MRCB 2VUYA 1ZMYA 3RWCB 1A0QL 1VGKA 4P3WA 5BVJA 5KVDL 5IFHH 1JZ3A 2E7BA 3I6KA 1N64H 3C09B 1CN4A 1RZGB 5JZ7D 4YQXL 1F97A 5IK3B 5I1GH 4TTGA 2DMBA 4ODXB 2XWTB 3C09C 1MFNA 5F8RC 3MV9A 5HDLA 4JPWL 3MLTB 4D0CA 5BRZA 1A6ZB 5IFHL 2GJ6E 2HTLD 3RVXC 4P5MB 1OAZH 4AL8H 1UADC 1OAUH 4DK3A 4YHIA 4GRWE 1T0PB 1CFTB 4OLZH 1SYVB 1DSFH 4W4OA 1S9KC 4OCSL 1NC4B 1SJHA 5HGBA 2ICES 2IH1B 2PETA 4MWFB 4H20H 4MJ4A 2BSSB 1M05A 4N9GA 5D2LF 3QT2A 4P2OB 1W0VA 5GRXG 1OAZL 1FZJA 3L5HA 1OAUL 2NY6B 4DAGL 3OG4B 2PF6A 2DDQH 3DNKA 4QGTA 2EYSB 2OP4L 3ETBF 4P2OC 2NY6C 5I8KH 3G6DL 5E94A 5HHPA 3DVGB 2DQCH 2OL3B 3LPFA 3DHMA 2CLVB 5DK2B 2OM5A 3D85A 3REVA 4WFHE 3WUWA 2R2BB 4UDUB 3QDMA 3NIDF 3L5IA 4RFEA 1YPZA 1JV5A 4FFVC 3ZLQC 5GS1A 4Y5YB 4BZ1L 5HHQA 1EO8H 2HT2D 4XWGL 1Y18B 3I3EA 4AG4L 3NCYS 5DO2D 2DQCL 5HHXH 2X89A 4U1MA 4Y5YC 4IRZL 4MJ6A 4X9HA 1SYSA 2YHGA 4UIKH 3KNBA 5KW9H 2IBBA 3UTQB 1ZVYA 2VDOH 1JGVH 3OX8A 5MENB 2GSGB 5E4EB 1BGXH 4XVUC 1CL7L 1BVKA 1T4KA 3HNVH 3HPJA 1G6RL 3F6LA 1HI6A 5E4EC 4U6YA 3V0AC 4UIKL 3GIZL 1CQKA 5KW9L 1PSKH 5HHMB 4BKLB 2VDOL 1A3QA 2H9GA 1ERNA 4M1DL 3SCMB 2OZ4L 1MIEL 4XP6L 1KF9B 2PN5A 1BGXL 3FAXA 5DYOA 3P0VH 4PREB 2CIKA 1XIWB 35C8H 4X6EB 3HNVL 3SCMC 2WV3A 5MEQB 1ZGLP 3TPKA 2NW3A 1XIWC 1PSKL 4KTDL 4HLZG 1FZMA 1KCVH 1OTUD 4ZAKD 1A6VH 2DLEA 1JGDA 3PWPD 2E7LA 1P6AB 1DVFD 3P0VL 5FA3A 3Q3GA 35C8L 3FOMA 2SEBB 3MXWH 3HG1B 3PWUB 4LU5L 4QRTB 3N50A 1U92A 1IFHL 4GAYB 3ARTA 5ADPH 4DN3H 1RIHH 4HT1H 3H7LA 4Y5XA 4HG4J 1KCVL 4GMTH 3EYVB 3FO2B 4GUPB 1ORQB 5E5MB 5JW5B 3VXRE 3MCKA 2X4NA 3CH8A 3D25A 5DI8A 2HT4D 3LKQA 3SDXE 3MXWL 5FYLD 2CRMA 1F2XK 2LFGA 5C0AA 3SDAA 3VFMA 3SGEI 5ADPL 3F5WB 2G2RB 4V2CB 3MRIB 4PGCA 2FJFA 1RIHL 2X05A 5F3BA 3G9VA 4P9MH 1S7QA 4F7TA 5AG8A 3GRWA 4NO2B 3UZQA 4HWBH 2D4DA 5TE4H 2NY7H 1WLHA 3GI9H 4NGHL 3WLWC 3D9AH 5JW4N 3O8XD 3GMMB 4XPAL 3SKMA 1OGAA 3ZKNC 4ELMF 4X4XB 3RP1A 1ND0B 3PWNB 1CG9B 2BXYA 4P9ML 3C5ZD 1QFWM 3OKEB 2APXA 3OF6D 4XC3H 5ABDE 3BYYA 5FHBH 1G7PB 4HWBL 5TE4L 5HYFA 3UDWC 5EU6E 2WUCH 3MBEA 2VDRL 2R1XB 4PGBB 5DD1H 3MODH 1F02I 3K8MA 2IJ0C 2XG5A 2Y9RT 5F97E 5MERA 1D9KD 1FNAA 5CSZA 1KLGB 1MRCL 4XC3L 4ZUWB 1CDYA 3NIFF 3TBTA 1BM3H 4MSWB 3TNNA 4OCLC 4JQVA 3PQYE 3MODL 4CN1A 1FYTE 5DJZB 4GOSA 2BY2A 4XPHH 1L6ZA 4Y16B 1QSED 3QNXB 4ZODA 1H3UA 5CP7A 5F93C 1UACH 3JUYA 1J9CT 4Y16C 1HDMB 4TSBH 5H94A 1T7XA 5HYSG 1XGUA 5JIIA 4KJWD 3STZA 5ETUA 3IKKA 2GFBB 3TZVB 1M6OB 1KPVB 3I50L 4MJIE 4LP5A 2EE3A 2PXYB 2BVOB 3MREA 2I26N 3OKLB 1MCPH 3H9SD 1IGTB 2HLFD 3TZVC 4HV8A 4JFFE 2PXYC 3NABL 3RUGA 3V7AG 4ODBD 2R0WH 3WKMH 4LPCA 1IEBB 1UCBH 5CKGA 4RNRA 5C1MB 2Z93B 4KK5D 3RDTA 2FZ3B 3D87B 3WFCH 4L29A 1JWSA 3S96A 1KB5A 4OZHF 2R0WL 4F7CA 3WKML 4FG6D 4HIEB 1EEZB 2EH7H 1AGFA 2VH5L 5C0CA 4RBPK 4GO6B 2EICA 4ZYKA 2C5DC 1INDH 1U8HB 3HE6A 3VFSB 5L0QB 2FSEA 4HX1A 1O7VA 3OSKA 3CFIC 1MWAB 2CKBA 4QRQA 1YNLH 3QFDA 3DUUA 3WFCL 4U2YA 3Q2CA 4EVNB 5D7LA 5L0QC 1XH3B 2W0LA 1I9EA 4CVUA 3QG7H 3VRIB 4Q2ZA 5KZCD 3VXUE 5EBMA 3HB3C 3UPRA 2EH7L 2BY0A 4H5SB 4MJ5A 3UZVB 1INDL 4Y5VB 3UTZB 4Z7QE 2DQTH 5LQBH 2X4PB 3NAAH 1LO4H 4XC1H 3LMJH 2I25N 4Z18A 2EE2A 2YA0A 1YNLL 3LN4B 4Y5VC 1U8OB 4FFWC 3LHPH 4PG9B 1DZBA 1FBIL 1LP9A 3EGSA 4CU8A 3IFNL 2CGRH 3TN0A 4LP4A 4POYA 5IFJA 4MNQB 1WBXB 1RZ8B 5LQBL 1NAKH 1LEKA 4XC1L 1LO4L 3LMJL 4U1SA 3MROB 3BHBA 1TCRA 3VFVA 4GKNA 5GRWA 1U3HB 3U30B 3X3FH 1T0MB 1XF2A 4RZCA 5IESH 5C2UB 2XKSA 2E5EA 4PJHF 3S6CA 1B6DA 3QNZA 4WEUD 4AJ0A 3RWJB 4OQTA 4I48A 2L7JA 1U3HC 3U30C 4S2SB 2P4AB 3KYAA 2NY2B 2A74B 4ZNCD 4LLUA 1NAKL 4ZDHB 2FO4A 4FQHB 4L9LB 1CIDA 2NY2C 3X3FL 5I18H 5EG6C 5E2TL 1W8OA 2CXKA 1YUHA 4GG8A 4M4RA 3W11D 4L4TA 5J0BA 4RIRB 2YUWA 4L9LC 4R4FH 2DWEB 5L2KE 5C07A 2VDQL 3O6FB 3C08L 1AD9A 1IGJA 4MDIB 4GW5B 1RIUH 5EOTA 5FKPA 5I16B 1EO7A 3TBWA 3VD7A 2C3VA 3K80A 1DBJL 3O6FC 4MXQD 1MCEA 4LNVA 5CHNA 1T21A 4N0YH 1ADQH 3EJJX 2ZUVA 4KDTC 4XBEH 4OB5L 4BH8B 5K9OA 4RAUA 4R4FL 4NNYB 1NQBA 3MRCA 2PTTB 1FN4B 5JA9A 1N6QL 3RWCA 4PIRF 4GLRH 4JPIB 2BK8A 1KCRH 3TIEB 1UM4L 2W92A 1ADQL 1UKSA 4JO4H 4KU1A 1TETH 1RZGA 4X9FA 4G9FD 3WEXB 2I24N 5IK3A 1FNFA 5F7EH 3TA3D 4ODXA 3ARDD 2XWTA 5FM4A 4XCNB 1OARH 2DQHH 4N90D 2VXQH 3MLTA 1UC6A 1A6ZA 5E95B 4P5MA 3GKWL 1KCRL 4I0KA 1R0AH 2Y6SC 1CFTA 1TETL 1SYVA 5A3IC 4U1HB 1NC4A 1F3JB 3MV8E 5F7EL 5EH1A 4KFZC 4TNVK 2IH1A 4KRPD 4MWFA 4P46D 3AMKA 1OARL 1AD0B 5I66B 2DQHL 1HHGB 2BSSA 3QCUH 4P2OA 3IDMB 2CKNA 4ETQB 2V5TA 4QXTB 4QO1A 1BJMA 3K2UL 1AQDB 1A14H 1ES0B 2EYSA 3MV7B 2W60B 5C08D 4OD1H 2ZJSH 5EBLB 4FN0A 3QPQD 3B6SB 2WM0A 4KVCH 2DLFL 3DVGA 4G6AD 1AC6A 4G6MH 3QZWG 2OL3A 2PO6B 3D6GA 4ZS7H 3ARGB 2CLVA 4HXBL 5DK2A 4OM1H 4C83B 4PY8J 2BJMH 2R2BA 4GH7B 4UDUA 4ZOEA 2DI8A 2PO6C 4MNHB 4E41D 3ARGC 3HC3H 2P5EB 1DLFL 3TJEH 4Y5YA 4OD1L 1QG3A 2ZJSL 3R06B 1QLEH 3C8DA 5GZNC 1Y18A 4XZUB 2QQKH 2VERN 4BQ9A 4G6ML 5J13B 5FGBC 1FGVH 4ZS7L 5T3ZH 4DUVA 4OM1L 1K5NB 4CU6A 3IJSB 2BJML 3UTQA 5F7YC 5J13C 5MENA 1A47A 2GSGA 4BELD 3TJEL 3MRHB 4KUCF 4AQ1B 2HJLB 1QLEL 2IFFH 4RAHA 3ARSA 4U6HB 2A77L 3UTSE 3D3VD 4X9GA 1NJ9B 2MQ0A 4AIZB 1F4AA 5IVXE 3WIHA 4NQXB 4BKLA 2AJXH 3VXSD 1MNUL 3SCMA 3S88H 5HTSA 1AR1D 2K7QA 2QQLL 4Q74A 1TZGL 4PREA 2VXVH 8CGTA 1SJVA 1XIWA 4P3DB 4X6EA 2IFFL 1P2CB 5J3HD 1HYSD 2KH2B 3NFNB 4CBPA 5MEQA 1NC2B 2V5MA 4ZNEA 1MCOH 4G8GB 5DUBB 2AJXL 5GJTH 2DTML 2ARJQ 3L3DB 5C0IB 5ITBH 3S88L 4J3SA 5E8EB 4D0DB 4ZO8A 4X7TB 2SEBA 5HHVL 4ZOBA 5IF0B 3D5OF 4QRTA 3MRFB 1NGZB 1MCOL 4X4MA 4B7IA 4GAYA 5EUOE 4P2QE 3V5KB 2V2TB 1WFUA 3BD3A 1YYLL 3QDJE 3EYVA 3FO2A 4GUPA 3MFFB 1ORQA 3PP4H 5E5MA 5ITBL 3OWEA 2BVTA 5JW5A 1BPVA 4M93B 3ZYIA 1AJ7H 1R3JB 1I3VA 5T5NG 1IC7L 3C6SB 4KROB 1AR2A 3ZL4H 2WSKA 1K85A 4XVTH 3QDGE 4M93C 1G9NL 3F5WA 4UQ3B 2G2RA 4KROC 3MRIA 1JZ4A 5FAAA 3N1FC 5CJXC 4NO2A 4Z78B 2VLKD 2XNAB 4FXLA 3ZL4L 1BD2E 4XVTL 3EYOB 3GMMA 1QFHA 2VE6B 4LVOB 4X4XA 4PJCE 1ND0A 2LU4A 3PWNA 2DLGA 1CG9A 4IS6B 4OUUB 4ZSOE 3SBWC 3UDWA 3RFZC 3ARXA 2R9HC 3OKEA 1H3PH 3TEUA 4M6ML 4LVOC 1G7PA 2HFGL 1X4ZA 4ZFGH 4IOFC 2WWMD 2R1XA 4PGBA 1T1ZB 3L6FB 3LKOB 1Q38A 1HSBB 4QWWD 4IRSD 4TUKH 4MQXD 3G9AB 2DIJA 2XZQL 1ZGLB 2EYRB 4YO0B 5IVZB 3MRJB 1H3PL 1KLGA 4ZUWA 4ZFGL 4MSWA 5B39B 2VLRE 5CS7A 1S5IL 2A38A 2D7OA 5DJZA 4J4PC 4Y16A 1JFQH 1L9NA 3QNXA 4KY1H 5HYJB 3I3BA 3BOVA 3BUTA 1HDMA 1W72H 2HRPL 2X42A 3IJHB 4Y0GA 1OT2A 4X8JB 1MOEA 2MCPL 5J56B 1U8PB 4S1QH 4P5TB 4POZD 1QNZH 4M61B 3TZVA 2GFBA 2A6JB 2P8PB 1M6OA 3MOQA 1KPVA 4O9HL 3S36H 1JFQL 4P3CL 2PXYA 2BVOA 3W9DB 3OKLA 4P5TC 1IGTA 3HR6A 3CFJB 3ARED 1W72L 2ICWB 1LEIB 2HFEB 2V2WB 1SBBA 3QI9B 4X7EC 4S1QL 3KPRB 1QNZL 4HBQA 1BZ9B 2NXZD 1IEBA 1BOYA 1JIBA 3BH8B 4MCYB 3QI9C 4YLQT 4PJIE 2XY1A 3DX9B 2Z93A 1NUDA 4HDIB 2FZ3A 4RGMB 1JHLL 1MUJB 4DGYH 3PHSA 4RGMC 4CKVX 4HIEA 1EEZA 4TNWK 4NOBA 5DJXB 2CQVA 3CH1B 1ULVA 1OSZB 4FQPA 1U8HA 3ULVF 3EYQD 3VFSA 3O2DL 5GRJH 3QYCA 1BHGA 4KKBD 1MWAA 4P2RD 3UP1A 5SV4A 1RZFH 1H3XA 4DGYL 4PJGE 4EVNA 1QSZA 1XH3A 4FQ1H 4KGJA 2FHCA 5F1KC 3VRIA 5I17B 3ULVH 1IEHA 4YZFF 2MMXA 1CTOA 4H5SA 4YHKL 5CFHA 1I9RH 2D7NA 5I1HH 5GGTH 5DGRA 1E4XI 4Y5VA 3UTZA 5CEYB 1W72B 2X4PA 5GRJL 2A83B 4P99A 4PS4H 1CGWA 5DJ0B 4A2LA 2VDKL 5K59F 3ZKMD 4JZOB 3LN4A 1RZFL 1U8OA 5EO1B 4FQ1L 3IJYB 4PG9A 3HTLX 3S4SG 2MQ3A 2BNQE 4H0IA 5HGGS 4I9WD 5I76B 5DC0A 5M7QA 4DKFH 3ULVL 1XZ0B 3V4VL 5L8KB 3ESUF 3T3ME 4MNQA 1WBXA 1RZ8A 1UGNA 5I6XB 2J6EH 3MROA 4PS4L 2VZOA 1IC1A 1U3HA 2E9BA 1T0MA 2GY7B 4U1JB 1CZ8L 4XP5H 2N56A 4J6RL 4JDTL 5I6XC 3RWJA 1CD8A 3P9LB 5IB5B 4NQCB 4S2SA 5D7KD 4DKFL 2A74A 3GB7B 4PRIB 1QBAA 4U6XB 3RKDC 1KJ2H 5HI3C 3DBXB 1BFSA 3CVHB 4ZDHA 4JO2H 2RQ8A 5JIHA 2J6EL 4BQBA 5JW4R 4FQHA 4L9LA 2BDNH 2V2XB 4RIRA 4KVNH 4EBQH 2DWEA 4MVBC 3H6JA 3O6FA 2DQUL 2EH8H 1NEZB 4KPHH 4MDIA 4GW5A 5I16A 4KDTA 1EBAA 4JO2L 2E8YA 1SHMA 4R90H 1V3LA 4PBVC 1S7VB 1Z3GH 3HRPA 1A7PH 3FMGL 4EBQL 1PLGL 4KVNL 4BH8A 2VN4A 2W0KA 5JHDE 4GAGH 4NNYA 1F4HA 2EH8L 1M7DB 2PTTA 2VR5A 5HPMB 1FN4A 3ULVC 4HC1H 3V52H 4JPIA 3FN3A 3NPSB 3TIEA 4LHUG 5BXFB 2Q8BL 1CGVA 1JF6A 6CGTA 3S9DB 1A7PL 3WEXA 5F9JB 1RIVL 1VEOA 4QRPD 5JPNB 3NPSC 1JNNH 2C7UB 4KK8C 4QYOB 1B90A 1OM3H 4XCNA 2ZUQB 4LPYA 1B4RA 1Y6KR 5F21B 5C0BE 3PDOB 3V52L 1JWUB 4RWHA 2H2PC 4UB0H 1EHAA 1VCAA 2ZUQC 1PVHA 4MXWH 2J4WL 2DL2A 4X6CB 4U1HA 1LO0H 1F3JA 1XF3B 3MPCA 4ZUUB 1KJ2B 5BS0B 1AD0A 5I66A 1HHGA 1IJ9A 4I0PD 1YA5A 4MS8C 5CCKL 3IDMA 3BYTA 1OP5H 4UB0L 4QXTA 4D9LH 3B9KB 1AQDA 4YFDB 4MXWL 4GRWH 2JIXD 1ES0A 3VXTB 2MQCA 3MV7A 1DBKH 2W60A 4S1SH 3MRQB 5EBLA 3BIBX 3B6SA 3B9KC 3DSFL 4PJDB 2PO6A 2CR3A 3ARGA 3SKUD 4C83A 4KMLB 1TIUA 2NTSP 3U0WL 1CFQB 5KS9F 4D9LL 1C5CL 2DQIL 4MNHA 5FO8B 2P5EA 5FGBA 3L1OL 4S1SL 4ZTOH 3R06A 4N8VG 4UV7H 3WNNA 4GRLD 3OAUH 4XZUA 3BKCH 3B83A 3W82A 3F7QA 5D6CB 1GGBL 1K5NA 2I27N 3IJSA 2JLLA 2DLHA 4OZGE 1N26A 4XNYH 3ZDZE 3CAFA 3P73B 3MRHA 4BSJA 5TDNB 2HJLA 2YPKB 5FM5O 4XPFH 3OAUL 1T03H 4N0FB 2GJJA 5ICYB 4PJEF 4U6HA 4HH9B 2JJTC 1NJ9A 4AIZA 3BDBA 4WY7L 4NQXA 4OV5B 4XHJD 1AXTL 1CLZH 3IS1X 4TYUA 1K4DB 5F7LB 1V7MH 1OB1B 5IMLB 4P3DA 1P2CA 3FFCD 4HLJA 1ZLWK 1IEAB 5KTEH 3NFNA 1NC2A 3EJYD 1J12A 1F8TH 5MEPB 1SBSH 3VGBA 4G8GA 2GJ6B 4NQTA 4KAQH 5DUBA 3LQZB 2J5LB 3GMNB 4GRWB 4KI5E 1CLZL 5DMJB 3L3DA 5C0IA 4ODVH 1YQVH 2PNDA 2R0ZH 5E8EA 2J5LC 4D0DA 4RMRA 4X7TA 1NCDH 3U7WH 5CUSL 5FUCE 4HULB 4YPJA 5IF0A 4N5ED 4FZ8H 3IFLH 3MRFA 4F9LC 1F8TL 5BOPA 1EK3A 1NGZA 2NY3B 4JRXE 5E56A 5F6HJ 3V5KA 2VR4A 3FKUS 2DICA 2V2TA 3FL7A 2CMRL 2M2DA 3MFFA 2OR7A 2NY3C 5DQJB 1MCHA 1R3JA 3DPBA 1GRWA 4M5ZL 2Y1VA 1NCDL 3U7WL 3C6SA 2Q3AA 3ES6B 1YMMD 4FFYL 1ODAA 3GBNH 5CJXA 2AERT 3QEUB 4UQ3A 4LAQH 4NN6B 1DQJB 5ACLA 1G1YA 4Z78A 2XNAA 3B4NA 4NN6C 1Q0YL 5JW3H 3EYOA 3SBWA 2CDGB 2PKDA 3GBNL 2EXWC 2F19H 2QTEA 4XWOD 4LCWD 4WUUD 2HRLA 2VE6A 2A0LD 1LNUB 2YD7A 4IS6A 4OUUA 1LO2H 3CMOH 4U1NB 1TVDA 4NP4H 5FYLH 5GSVB 2Q87A 2ED7A 1RUPL 1T1ZA 4FNLH 3L6FA 3LKOA 5JW3L 3ARRA 5GGUB 4M7LL 5IHUL 3BXNB 1MCLA 1HSBA 3BE1L 2F19L 5IFAH 2NY1D 4FMKA 3ZHLA 1BVZA 1CDUA 1ZGLA 2EYRA 4YO0A 5IVZA 3DXAD 3MRJA 5DEFB 4NP4L 5FYLL 4ODTL 3T0ED 4J4PA 4OCWH 4LOUD 3MRRB 5B39A 4K7PL 1X7QB 4FNLL 2YZ1A 2ZNWA 5D71H 4B7LA 1IM3B 4OJFH 4TVPE 5IFAL 5J7CC 3CLFL 1T04A 3UEZA 3SJVD 1UKQA 5ITFB 3QEHB 5GRYA 3U36B 2FO1A 4OZIF 5HYJA 5KG9B 4PJ9D 4KHXL 3U46B 1IAIH 1JGUL 3L3KB 3IJHA 1Z9MA 1TITA 4X8JA 1WIOA 1FFQA 3HI5H 5D71L 4P5TA 4OJFL 4U3CA 4ZPTB 1MFBL 4M61A 4WHYG 2A6JA 2P8PA 4GKSB 4FQLH 4TPRL 3V9FA 3W9DA 4BFBD 3VI3F 1K3IA 1ZA6B 1OTUC 3VXRB 2Y36H 3CFJA 3P11L 2ICWA 1BJ8A 3ORJA 3VMOA 1LEIA 2HFEA 3SDXB 1GGIH 5AZEH 1QOKA 2R0LH 1J87A 3P4MB 2V2WA 3QI9A 5TQ0L 3HI5L 3S97C 3KPRA 4Q9QH 4NUGH 1BZ9A 4XNMB 3BQUD 3WO3B 5F8QC 4GW1B 1G7HB 3BH8A 4MCYA 1GPOH 3IDXH 1LDPH 3MOBL 4WUKH 1DUYB 3DX9A 1HKLL 3VFPB 4HDIA 1IGMH 1GHFL 5AZEL 3Q1SH 4YDJB 1MUJA 1A6PA 1BF2A 5F89B 4NUGL 4KQ4H 2AEWA 5E2UL 3ULUE 1ORSB 5DJXA 5HD8C 5J1TC 4BM7A 3CH1A 3IDXL 2XTLA 5GZOD 1OSZA 5JUEL 5F96L 1QSFD 4R26H 4RWYH 5L9DH 1KJMB 1SMOA 3RAJH 5EU6B 1WFOA 2J8UE 3Q1SL 1S3KL 3K74B 3PF2A 5I17A 4KQ4L 2H32B 4JFEE 1U3YA 4FTVE 5I1IL 5JR1H 2X70B 4HWZB 5CEYA 1MHPL 1U9KA 1W72A 5GJSL 2I60H 5L9DL 2VAAB 2A83A 3ESVF 1ACYH 5DJ0A 4JZOA 1VEPA 5EO1A 3BN3B 5E2VL 1P4LB 3PQYB 2E9JA 3IJYA 1ZANH 1FYTB 4PPTA 3ZT6A 4AIXA 3FT2B 4KI1A 5I76A 5M94B 4F7EB 1UXSB 1XZ0A 1L7IL 4C4KO 4XT1C 3X17A 5DHVH 1SQ2N 5C0DB 5AUMB 2ED8A 2I60L 3LEVH 5CEZE 5KSAD 1ACYL 4EI6B 1O5DT 1RU9L 4KRLB 3AB0B 3O81A 4U1JA 3FQXB 4PJ8D 4KTEL 2BMKB 1N8ZB 3P9LA 5IB5A 3RJDA 4NQCA 4XP1L 4MJIB 1EVTC 3AB0C 2AK1H 3GB7A 4PRIA 3SQBA 4U6XA 2G5BB 2H8PB 1NLBH 3DBXA 2YSSB 4G7VL 3CVHA 1FG9C 2XTJE 3LEVL 3BEVB 1LE5B 3ZKXB 3EYSH 4GXUM 2D9QB 5JXEC 2V2XA 2MKWA 3TVMB 3ZKXC 3F7VB 4W6XB 1XGPB 1FV1B 1X3DA 2VZSA 2WUBH 4U33A 1WFNA 1OF2B 1NEZA 3TVMC 2UUDK 1NLBL 4OF0A 1NGYB 4HUVB 5D6DC 1S7VA 3UAJD 2AAVA 1MQ8A 1L7TH 3QIUB 5IQ7H 1TVHB 2FL5B 1QFPA 4D3CH 3S35X 2F74A 1A1MB 3F58L 1QEWB 2OR9H 5A2IH 1Z6JT 5GGTA 3QIUC 1M7DA 5DD5H 4GG6F 1G1CA 3D39E 2WQRA 5HPMA 4F37F 1JNLL 3CX5K 4UILH 2HKFL 5C0RH 1S7TA 4K3JH 4TSAH 4EEEA 1HE7A 3MUHL 2F9BT 2ICWI 1L7TL 1T5XB 5BXFA 5IQ7L 1FCCA 3I6LD 5F9JA 2A2QT 1DEEB 5JPNA 4NN5B 3VXUB 5SWZD 2C7UA 4QYOA 2Q8AH 2IANE 1FC1A 1EJ6A 1ITCA 5DHVB 5IHZB 4YAQB 1FLTX 3PDOA 4UILL 4XPGH 1UCTA 4DVRH 1JWUA 4NN5C 5C0RL 1KC5H 4LASH 1G9ML 4K3JL 3WDIA 2MFNA 4DJMA 4RRPA 2R56H 3VWJB 4X6CA 5HPOA 3X14B 1XF3A 3B3IB 4ZUUA 1EGJH 1KJ2A 3VWJC 4E42B 5BS0A 5AYQA 1S78C 1R5IB 4LASL 2C4FT 4HUUB 3B9KA 5IV2B 3GMPB 3QQNA 2R56L 4HGWB 1LVEA 3VXTA 2VDNH 5HVWA 2MKLC 3MRQA 3OR7B 4HKJB 2X9WA 1JPGB 3QJFB 1IGFL 4PLNC 1RJCA 4URTB 1LEGB 4PJDA 3PNWB 5HGDB 3GJFH 5FGCE 3DX8B 3OKYA 1CFQA 1CCZA 3OB0H 1BBDL 5FO8A 1YEIL 3OKOB 4Z7VF 3PL6D 3ME0A 1NCCH 2N7AA 1L6XA 5D6CA 4HC1A 4U1GC 3EYFB 3INUL 2E9IA 5I73B 2RR3A 1J8HE 3O6MH 1PAMA 4GG6B 4HKZB 2CUIA 5I0ZA 3U9PH 3P73A 1NCCL 5TDNA 5I73C 2ATKB 2DBJA 4Y4KB 2YPKA 2JJTA 4WHDA 3IDYB 3VFGH 1CICB 4KJQD 4C55A 4N0FA 4XCCH 4N8CL 5AEAA 5ICYA 4HH9A 4Y4KC 3VDAA 1OTSD 3TV3H 3IDYC 3OTTA 1CICC 4GAJH 4OV5A 3UYRH 2ZKHH 5D4QA 4R4BB 5C0ND 5MHSE 4UTBL 2PYEE 1K4DA 1CLOH 3OG6B 3U4BH 1OB1A 5IMLA 1EAPB 1IEAA 4XCCL 5CGYD 4L3EE 4EQ2A 5MEPA 1I1CA 2DRUA 3OKMB 2IGFH 2GIYA 3OQ3B 4OIAA 2GJ6A 2X1PA 3V4PH 3BP5B 4P4KB 3LQZA 3GMNA 1UZ8B 1KPUB 2ZKHL 4XCYB 1V7NH 5CINH 5IHLB 3ARDB 5EC1B 3ILQC 3BGFB 1EA9C 1CLOL 4F9LA 4P4KC 3MV8B 4RAVB 5D1XB 2JTDA 2I5YH 3ARDC 5K9QI 1JK8B 3BGFC 3GJFB 4UT7L 4JO3H 1ZT4B 1TCMA 5D1XC 4XB8A 1NFDF 3ALWA 2HN7B 2B1HL 1V7NL 5CINL 4DZ8B 5E4IA 5LKNA 4HIJB 3HUJF 1E28B 4BUGA 2XXMB 5C6WH 1TNNA 1F6AB 4P46B 5DQJA 5DWUH 5H8DA 1UH2A 5BRZE 3RZWA 1GOFA 2FD6H 3Q6GH 4WI3A 1VA9A 3ES6A 4P46C 4XVJL 1NMAH 3SDCD 4CGTA 4LCYB 3MRNB 2V17L 3QEUA 5HI5C 5F72S 2QQNH 4Y19E 3AS2A 1CVRA 1DQJA 5IKCB 5E2WL 2M8XA 4M7LT 2HT3C 3P30H 2B39A 3MUZ1 4JKPH 3QPQC 2FD6L 3Q6GL 1D3CA 2PR4L 3L7FB 2CDGA 5HHOD 4E41B 3NPZB 1OP3K 3SDDB 2PW2B 5KANG 1YEDB 2QQNL 1BAFH 4MHHG 4PGEB 1LNUA 4KDWA 2YA2A 3LCYA 4U1NA 2GT9B 3P30L 3SDDC 3QIWD 1YN7B 5GSVA 1XF4B 1EVUA 3QDME 3S37L 1KYOK 3O0RH 1FC2D 3MRPB 4Y1AE 1YPZE 3QXTA 5GGUA 2FGWH 3BXNA 3UTSB 1RJYB 3U0PB 5IVXB 1CE6B 3AM8C 1I7TB 1BAFL 2UZIH 3RNQB 3WBDA 3GSWB 5DEFA 4BQ6A 4OLVL 3F62A 3MRRA 3O0RL 4ALAL 1X7QA 1KELH 1R3IH 3MA7B 2DQGH 2FJHB 5DA4A 1IM3A 2WK2A 5LG1A 5FIEA 3VFNB 3EDDA 1LK3H 4U49A 3UX9B 2GK0B 5ITFA 1I3GH 2ESVE 3QEHA 2UZIL 3MNWB 3U36A 3X11B 3IU4H 2YXFA 2R8SL 1CLCA 4NO3B 2P42B 5KG9A 1AKJD 3U46A 1CE1H 3L3KA 1ZXQA 1NFDB 2O26U 1KELL 5J3HC 1HYSC 5MI0B 3EJZC 5JXAH 4ZPTA 4P2QB 4GKSA 2AEPH 4FQ2H 3VXMD 1I3GL 1YC7A 5MI0C 4JEGB 5DMIL 3IU4L 3QSKB 1ZA6A 4X6FB 1I1FB 2FIRT 3VXRA 2OMBA 3OV6A 2KKQA 1J1OH 1EXUB 5C0EB 1BFVH 5D5ME 3SDXA 4NM8L 3TT3H 4QXWA 1YNTB 3P4MA 5ACMA 2NYYC 5EN2B 2DQEH 3L3JB 3QDGB 3VFOB 2D7PA 5I1JL 1DP0A 4XNMA 3ARVA 4R3SB 2AEPL 4FQ2L 3W0WB 4GW1A 1G7HA 5C7XH 4WHTB 2F53B 4MA3B 3NOIA 3SO5A 4PV9B 3QH3A 3VFPA 4LPXA 4G6JH 3CD4A 1BFVL 1NFIB 4HZLB 4M3KB 4PJ7E 3TT3L 2GCYB 4YDJA 5T1DL 1BD2B 3KYKH 2LE9A 2DQEL 5F89A 4CVXB 3V4UH 1LGVA 1ORSA 4LIQH 4PJCB 4C57C 5EZOH 4ZSOB 2NY0D 1IBGL 5DRWB 3IU3B 5ERWB 1KJMA 4G6JL 5C0AE 3U4EB 1AE6L 3P0GB 4BUHA 5EU6A 2EDKA 5DMGC 2X2YA 1Q94B 2GUOB 4Q9RL 3KPOB 4MMXC 1LWRA 1MLBB 3KYKL 3W81A 3V4UL 4JN1L 1P5VA 2H32A 5JORB 1TNMA 4LIQL 3MLYL 3EOTL 2X70A 4HWZA 1K4CB 3IKCB 2VAAA 4JFQB 4RX4D 2ADGB 1ZV5A 2AQ1A 1OGAE 4I2XB 3VW3H 3KYOB 4WRLA 2E8ZA 4K3EH 1P4LA 1XCTA 3PQYA 1LHZA 1T66D 1E6JL 1FYTA 2A73B 3EHBD 3FT2A 2PW1B 1UB5B 4F7EA 1UXSA 1YDPB 4KZEH 5C0DA 3O11B 5AUMA 1EZVX 4M6AA 2NX5D 5C6TL 4EI6A 5TPWH 4N9OB 4M43L 3IF1A 4QHUB 2EDEA 3RU8H 3FQXA 1WJ3A 2BMKA 1N8ZA 4YPGB 4MJIA 5IOPB 2NY4B 4UNUA 1JUFB 4J1UB 4KZEL 2G5BA 5JXEA 4G42B 1IARB 2B1AL 2H8PA 4Z95L 2YSSA 2WAHA 1H15B 3O9WD 1LE5A 3BEVA 4BFEA 2NY4C 4K8RD 1BQLL 4K07A 3RU8L 3TVMA 3E3QC 3F7VA 3ZHDA 1XGPA 4PJAF 1FV1A 4L8DB 1P69B 3BUYB 3THML 1OF2A 1QKZH 5D6DA 4Z7WE 4PJIB 1NGYA 1OD9A 1ZHBB 1QR1B 4MA8H 4HUVA 4K3DL 1UEMA 2Y06H 1GSMA 5ESQB 3QIUA 1TVHA 2FL5A 1XR8B 1NL0H 4DKAA 4K94L 3HZMB 3ROOB 3LS5H 1A1MA 3VWKD 2R29L 4KH2A 1QEWA 5I1AB 5FYKD 3RUGE 2JJSC 3QWRD 2VLJE 4J3WA 2DTSA 2WNGA 4XH2B 1TTFA 4U0RB 3QUXD 3E0GA 4LL9A 1OVZA 1T5XA 4KRMB 4CDGC 4PJGB 1UZ6E 2XRAL 1IM9B 3LS5L 1DEEA 1EO5A 3VXUA 4U0RC 1KIRB 1U2CA 3S8WA 1A6TB 3I9GH 4X7SL 5DHVA 5IHZA 2XICA 1N6VA 4YAQA 1IC5H 4P2RB 3WN5B 3O3UN 4JN2B 1MI5D 3EYQC 3UPAA 4KKBC 4NQDD 5FB8B 5C0CE 5DURB 1OWWA 3WN5C 5DR5H 3VWJA 5ISZD 4PJBF 3SKOB 1HHJB 5CSBA 3X14A 2APTA 2BNQB 3B3IA 4FZEL 5FXCH 2P48B 1N0XL 4OIIL 4EXPX 4E42A 3WE6B 1BMGA 3EKCA 1R5IA 1WBZB 1YY9C 4HUUA 5CAYB 5IV2A 3GMPA 3D18B 4NT6B 3GDBA 4V1DE 4HGWA 1P7QB 4JGMA 4Z8FH 3VMPA 3W2DL 3OR7A 4HKJA 4LHUD 1JPGA 1KIQB 3QJFA 2YRLA 4APQD 3PP3K 2YD4A 4YC2B 1LEGA 3PNWA 1CYGA 5ALCH 5FDWB 5HGDA 5I74B 3X13B 3DX8A 1BP3B 3DECA 4XAKD 4OZFH 1E27B 4YC2C 2MWCA 3OKOA 5I74C 3LDBB 1HINL 4YHYB 1J0JA 4Z8FL 1QFWH 1K8IB 2LU3A 2I9TB 3LDBC 4PP1D 4I3RH 3T4YB 4YHYC 3K81A 5ALCL 3UTPE 3EYFA 4MD5B 4YHMH 4MB3A 2IPUK 3UTOA 3WNPA 2O5ZH 4U3HA 3RJQB 5LJYH 5CWSB 4GG6A 4HKZA 4S0TD 2DM2A 4HKBB 2F54E 2ATKA 5E70A 1QFWL 4Y4KA 5HBBA 1CICA 4LLVB 3DRTB 4I3RL 1D5ZB 5FUZH 4JHZA 2EYTB 4GBXD 3ZTJH 1NGPL 2O5ZL 1I1AD 4R4BA 1KB9K 4HFUH 4CNIB 3MC0A 5IP4A 5BMFH 4XMKH 2IG2L 1EGJA 1EAPA 4LLDB 4HUMB 3GMQB 1AQKH 5F6IB 4E9LA 4PJBB 4JM2B 2BNUB 3EUUA 3BP5A 1MFAL 2J8OA 4P4KA 4L4VB 2J8HA 1CDBA 1UZ8A 1KPUA 4XCYA 5F6IC 4OM0L 4QXUL 3NFSH 5DVMA 3HZVB 3ARDA 4LKXB 4O4YH 3L95B 5EC1A 4JM2C 1OT1A 1X4YA 2NQCA 4XMKL 3AUVA 3MV8A 4GKZB 4RAVA 5D1XA 4FA8A 5IJKC 4AH2B 1NGXB 1PG7X 1JK8A 3PWLB 1AQKL 1UYWH 3GJFA 3TYFB 1NCNA 1UM6H 1ZT4A 1SY6L 4C54A 4OZFB 3OL2A 1HHHB 2HN7A 4DZ8A 5LGKA 2DM7A 4HIJA 1E28A 4GQPH 1TZIB 1KNOB 1F6AA 2EDFA 4P46A 4D0BB 3ZDXF 3CSGA 4EI5D 3RVUC 4KTYA 5EB9A 1YEKH 1UYWL 3ARFD 4XPTL 5D7JB 3QIBB 4AEEA 1RFDL 2OSLB 4LCYA 3MRNA 4HIXH 2EO9A 5DRXB 4XNUH 2OXHA 4IHOB 4IRJD 4TNVF 5DEGB 5D7JC 5HI4C 3QIBC 5IKCA 1IAMA 4QOKD 3MACL 1WZ1L 4OGXH 1UFUA 1OTTD 2QKIB 3WXVH 5T1LD 5C09D 3EIFA 1YEKL 4WTZA 3CDCA 3L7FA 4E41A 4JKKA 3MMEB 1E4WH 3SDDA 3BRGC 3DGGB 1U8LB 2PW2A 1YEDA 4OZGB 1D6VH 4PGEA 1CDIA 1INQB 4OGXL 1UEYA 2GT9A 2FEDD 4QY8B 1YN7A 3QPXH 1NH6A 3KPSD 1XF4A 4L8CB 1IMHC 1OQOA 3AM8A 4ODUB 3MRPA 2EEBA 1YMHB 1Z0NA 4X6DE 3NIGF 3UTSA 1RJYA 3FJTA 3KPPB 3U0PA 3R1GH 4QRRE 5IVXA 1CE6A 1I7TA 3A67H 1SEQH 1DQQB 4HLZH 2IQ9H 4LCUB 3RNQA 3MLPA 3GSWA 1TTGA 1Y0LB 1GOHA 4C56E 3BKJL 2ORBH 3MUGB 2ITCB 5IBLD 3MA7A 2FJHA 2W9DH 1REIA 3N9GH 3VFNA 2IPKB 2BFVL 4RA3A 2GK0A 3WL9B 4AEHH 3X11A 2IQ9L 5C3TA 4NO3A 1BEYH 1ZLSH 5T33H 3ARBD 1NFDA 3C5JA 1I7RB 4DTGH 3HZKB 1RSFA 2VRAA 3QUML 3CFEB 3N9GL 4YEEA 3Q5YA 1D5MB 4P2QA 1HQ4B 5FUCC 4BYHA 3VD4A 2VZ3A 4X6FA 2L0DA 1EHLL 3FN9A 1I1FA 4HKXB 3ARWA 4HIIB 4KXZI 4OCRH 2D9CA 1K2DB 1ZLSL 1EXUA 4OV6F 5FYKU 4HS6B 5C0EA 5T33L 25C8H 2ID5A 2WW8A 1YNTA 5EN2A 4G43B 3L3JA 3QDGA 4I4WB 5CMAB 3VFOA 2YN5A 1PD6A 2M26A 4RSVA 3KHQA 1JHKH 5D2LE 4R3SA 1YEHH 3W0WA 1XAUA 4WTXA 1CD1B 4WHTA 1PFCA 3HG1E 2F53A 4MA3A 4PLKD 5K9JH 4PV9A 3LKRB 4OCRL 3GSUB 5EBGA 2HWZL 3GKZA 5J6HB 1NFIA 4HZLA 25C8L 2GCYA 3FQNB 1BD2A 4HPOH 1IQWH 1C5BH 4OKDA 4CVXA 4Y89A 1KENH 1F4XL 1JHKL 3QUYD 4PJCA 3FN0H 1MFDL 3BZDA 4X4ZA 3QBTB 2FYYB 2FB4H 4ZSOA 3NIDE 3FCTB 5DRWA 3IU3A 5ERWA 2CDEB 1O7SA 3LEYL 1HSAB 1GXEA 3U4EA 1N59B 5JDSB 4RA0C 4LCWB 1A3RH 3WFBH 1Q94A 2GUOA 4HPOL 3KPOA 1I8MB 1MLBA 1ZEAH 1F5WA 4KK9C 1KENL 1B88A 5JORA 3EW3B 5IWLC 4JCMA 2OBGA 3WFEL 3DV6B 1OQXA 5ICXB 3VG9B 2OTPA 1K4CA 3IKCA 1KXTB 4G7YH 4JFQA 1KIPB 2ADGA 3O6LH 4I2XA 1WTLA 3KYOA 4ZFOL 1A3RL 3HFMH 3VG9C 5SX5H 4MNGE 4RGNE 4Q58C 2P46B 1LO5B 2A73A 3R4DA 5IT2L 2PW1A 1UB5A 5INCB 4F33B 4KKCD 1QRND 1YDPA 1BF8A 1NMBH 3O11A 2VISB 4JPVH 4WTWA 3S35H 3K4AA 2YPVL 4NO5B 4I3SH 3O6LL 1IKNC 3IS0X 3OJDB 1M4KA 3MFGB 4NJAH 4QHUA 3VD3A 1C5DB 4OFPA 4YPGA 2XN9E 3WNKA 4PJ9B 3BFOA 1JUFA 4J1UA 2DQFB 3FB8B 1NMBL 4G42A 1SM3H 2V5RA 2QADD 1H15A 2ZOLB 1X9QA 4YR6B 3AY4C 4PJ9C 4I3SL 4RMUA 3FQRB 1Z9SA 4NJAL 2UY6A 3O3DB 1C7TA 1ZT7B 4JRXD 5TE6L 4L8DA 3BUYA 3GSOB 3JTTB 5EZLB 1NCTA 1QP1A 4PJIA 3CXHJ 4OT1H 1SM3L 4GFTB 4LBEB 4CUCA 3V2AR 1ZHBA 2Y5EA 1QR1A 4PGJA 1C7SA 4ZO7A 3QFJD 3MLSH 5ESQA 2QHRL 3MBXL 1XR8A 5DZNA 1F2QA 3HZMA 3ROOA 2EDLA 2GY5A 3BDYH 1RUKL 3RY5A 5I1AA 3FT3B 2VC2H 3VH8G 4OT1L 3UJTH 3ULUC 3OAZK 3GMOB 2VXTL 4XH2A 2J8UB 4BK4A 5HYSB 3MLSL 2B4CH 4PJGA 4NO0B 1IM9A 4KJPD 3BDYL 3HN3A 1KIRA 1A6TA 3EZ8A 4ELME 4JFEB 1OPGH 2VC2L 1H3WM 4P2RA 3WN5A 2QLVB 1D5XB 4JN2A 1R3KB 4NFBA 1FO0B 5DXWA 2BVYA 3RWHB 5FB8A 1MCDA 4ONFH 5KAQG 2AJUH 3S5LB 1KBGH 3SKOA 1HHJA 3QP3A 3ALXA 3W9EB 2BNQA 1JPFB 4GXVH 4HUKB 2ZPKH 4QHKI 1RAMA 3BO8B 3WE6A 1CBVL 4OZ4B 4PBXA 1NAML 3MZTA 1WBZA 3L3IB 1H5BB 3NIFE 5EA0L 3R8QA 3RGVB 2AXFB 4ONFL 3D18A 4NT6A 1P7QA 5D7SL 4P5KB 1H5BC 1KIQA 3RGVC 2YD5A 1QLFB 3KXFE 5FDWA 3X13A 1MVUB 4XHQA 5CGTA 3FZUD 4HG4K 4KHTH 1E27A 2YXMA 1I8IB 1CVSC 3RWEB 2ADJB 4KJYB 1MCCA 5BW7C 2V9TA 2I9TA 2AP2A 3T4YA 4WI4A 3HAEG 4MD5A 4NRXB 7FABH 1X4XA 4N68A 4WWKD 1NGWB 1WISA 2VN7A 3BP4B 5BZDB 5CWSA 2BRRH 2ED9A 1UM5H 4HKBA 1NCBL 5DT1H 4ZS6D 5JHDA 2FCBA 3P9MB 2B4CC 4JPKH 1V3MA 4LLVA 3DRTA 3D39B 1D5ZA 2LTQB 1UWEH 4O5LH 5DFVD 1FFOB 3CDFA 2APBA 2EYTA 1KLFA 1FYHB 1I85C 2PYFB 1PKQE 1AGBB 2LTQC 4CNIA 2DJUA 1UM5L 5EO0B 1KTDB 2MPAH 4OZHE 5J1SC 3BIKB 4JPKL 4P23D 4LLDA 2IANB 3SE9L 5I15H 3GMQA 4PY7B 4ONHB 5J4MA 1UWEL 1HKFA 4PJBA 5EU7E 4JM2A 2BNUA 2OMNA 4ERSH 3TO4B 4L4VA 5D1QB 1BQHG 4RDQF 9CGTA 1GC1L 3HZVA 4LKXA 1Z2KA 3RVVC 3WXWL 3L95A 1WEJH 3TO4C 4D8PB 2MPAL 4M48H 4M8QB 2GTZB 4GKZA 5D1QC 3UTTE 4WFED 1FAKT 1KCKA 1T7ZA 1NGXA 2AEQH 4AH2A 2P24B 1RVFH 3J8F7 1FH5H 3PWLA 3TYFA 1QBBA 2GQHA 3IRZA 1N6UA 3D2UD 4OZFA 3G6AB 4DKEL 1HHHA 1Q9WB 2CUHA 5ILTL 5GRVK 4JVWA 1TZIA 2F15A 4PRHD 1WEJL 1KNOA 4D0BA 3QWOB 5TQ2H 5DD3H 3F7RA 3KLDA 2AEQL 1RVFL 3SQOH 1FH5L 1JTTA 5A2KH 5D7JA 3QIBA 3VGAB 2OSLA 4YHLH 4Z7QF 5F44A 4F7MB 5DRXA 4IHOA 2B0SL 5DEGA 2VSCA 3VGAC 3VD9A 3BKMH 4NRYB 1JMZA 4FQCH 4HAGA 5L6YL 2QKIA 4PJHE 4OCYH 5I1KH 3JWOH 4DQOH 1OWRM 5DD3L 3ARPA 1R5WB 3SQOL 3RX5A 2XTJD 3MMEA 2B5IB 1U2HA 3DGGA 3IFOB 1U8LA 3QRGH 4I5BB 4F58H 1J8HB 4OZGA 3L3HB 1HN1A 3BKML 1INQA 4FQCL 2B5IC 2CK2A 1ED3B 1S7UB 4QY8A 5SWSE 3KLHD 4L8CA 2N4IA 4ODUA 4JCLA 1RUQH 1YMHA 2ZUTA 4BFGA 3KPPA 1JI2A 3QRGL 1DQQA 4LCUA 2PYEB 1NBYB 2C3XA 1Y0LA 4LHJB 4R4ND 2VIRB 3LS4L 4N0UE 4H0HB 3MUGA 1RUQL 2ITCA 1KFAH 4L3EB 4Y2DD 4LSUH 1AO7E 1MY5A 1NUGA 2IPKA 3FAWA 3IXAB 5SX4H 1J0KA 4DW2H 3WL9A 3BVNB 4Z7UF 4M1CD 1UWXK 4JFDD 3DO3A 1RUAH 1RV6X 3RIAK 3HMXH 1I7RA 3QUZB 2H1PH 3HZKA 4NHUB 3SOBH 3CFEA 5CZXD 1F58H 3EO9H 1PEZA 1D5MA 4PB9H 1HQ4A 4KUZH 3QUZC 4DW2L 3G04B 4JG0H 1SJEB 1TXKA 4HKXA 4HIIA 1RUAL 1K2DA 1EAJA 2FX7H 4HS6A 3U7YH 5BQ7B 2LVCA 2H1PL 4XP4L 3JWOC 3SOBL 5IR1B 1CGXA 1JTPA 4G43A 4I4WA 5CMAA 3EO9L 2ZNXA 4PB9L 4KUZL 4Y19B 1CD1A 1P6FA 3B9DA 4NM4H 3MGAA 3LKRA 2CO6B 5DMYA 1QFUL 2AK4D 3GSUA 1A6UL 3RRQA 5KBNC 4R8WH 2HMID 5J6HA 2FX7L 2FEEI 2WBJB 4PG2C 4UTAH 3LB6D 3HNSH 3FQNA 3HI6H 1HH9B 3DGCR 2WBJC 3QNYB 1TJHL 2JF1A 1CWVA 2GSIB 4LEXL 2J88L 2FYYA 4MXVF 1NMCB 4CAGA 3FCTA 3C60A 2CDEA 1PBYA 1HSAA 1UWGH 5B3JF 1N59A 5HHOB 5IWLA 5JDSA 1NMCC 4UTAL 2EDRA 3HNSL 3QWQB 3DUHA 1CGTA 4Y1AB 5MP6H 2HH0L 2EIBA 1I8MA 2YKLH 3HI6L 1A7BA 3RX7A 2Y07H 3KWWB 1FNSH 3DV6A 4DWHA 5GIRB 5ICXA 2RJMA 4FFZH 5E9DD 5F9OL 3STBA 1IE5A 1KIPA 1JRHH 5DGQA 3IGAB 5GGRY 1PKOA 2JB6B 4HHAB 3LN9A 1D5IL 1G6VK 4NZTH 2YKLL 5GGQH 1NSNH 1EFXD 2Z31D 1LO5A 3B43A 5FYJD 3H2WA 5INCA 4F33A 3KS0J 2DI9A 3UJIH 2XKNB 2BNRD 2Y07L 1FNSL 2ESVB 1GGCL 3ZE2F 1IKNA 1PG7W 5C0FB 2VISA 5I2IB 2AQ3A 2ERJB 1JRHL 4NO5A 4PJ5E 5ANME 3OJDA 3QUKB 1YJDH 2UZYB 3DURB 4L5FH 5GGQL 1NSNL 4KKLD 1C5DA 2ERJC 3GMLB 3IFPB 1Q72L 3B2UC 4P59H 4NWUH 1FPTH 4XAWL 3T0AA 2XA3A 3AY4A 3BGAA 4PJ9A 3UJIL 4UNVA 1MHHB 1MJ7H 2CH8A 2DQFA 3FB8A 3CJJA 3HC0B 1MIMH 2UVEA 2ZOLA 5C9JB 4YR6A 3MO1B 5IM7B 1XF5B 1FRGH 5D5MB 3FQRA 1HIMH 4XB7A 1YJDL 3V6OE 2A6IB 1QSVA 1JPST 1QFOA 3VXMB 1U6AH 3O3DA 1ZT7A 2QHLA 2IADA 5DJ2B 1MH5B 4NWUL 1FPTL 1MELA 3C6LB 3GSOA 3JTTA 4NZJA 5EZLA 1MJ7L 4JFZL 3GUTB 3MV9D 3LH2H 4LBEA 3C6LC 1A7RH 4PLJD 2ITDB 1FRGL 5HDQH 3RIFK 4PJ7B 3DWTA 2J12B 3H9ZA 4TSCL 2KQNA 2YMXH 5EZIH 5DVNA 1N4XH 1F4WH 1TLKA 3FT3A 3ZO0A 4JQIH 3LH2L 4ONGL 5EWIH 1T3FB 8FABB 3KPRE 4U6VH 1IL1B 1A7RL 4K3HA 3QISA 2DQJH 3GMOA 2AJSL 1VGEL 1MRDH 2J8UA 2F5AH 5HYSA 3JWDL 4HS8H 4NO0A 2DKMA 2YMXL 1F4WL 3QULB 3MLUH 4JFEA 4QHNB 4JQIL 3KJ4B 5FF6B 5EWIL 2B7DT 1D5XA 3D85D 1R3KA 4K8RL 1FO0A 1AGEB 3RWHA 3KJ4C 2VR9A 2XFXB 2F5AL 3NA9H 3S5LA 5DRNB 2D0GA 3W9EA 4LLAA 4LSDA 2W91A 1JPFA 5FYKH 1YJDC 3SPVB 3BO8A 1BX2B 3U82B 2X89D 3FHAA 4OZ4A 3U83A 1VPOL 1ZKAA 4ZFZB 2DQDL 1NCAL 2MTPA 3L3IA 1H5BA 4CW1B 1PY9A 3RGVA 2AXFA 2IAMB 3VGDA 4Q7DA 3PV6B 1KEGH 1L9MA 5F7DB 3O3AB 2WINB 4P5KA 5FYKL 4PJFB 2IAMC 2HP4A 1QLFA 4NKDB 5KVEL 4IMLB 1MVUA 5BW7A 5ID1B 2X5PA 5E24E 4QXGL 1I8IA 3RWEA 3SO3B 2ADJA 4KJYA 4JKMA 3S3PA 4K9EH 1JPTL 2YPLE 4HCRA 5FOBB 3SO3C 1DL7L 5F1NB 2EDWA 1PZ5B 4Z7WB 1A6WH 1WWAX 1HILB 4M6NH 3T1FB 4NRXA 4NQCE 1NGWA 2VAJA 3BP4A 5BZDA 5F7HA 1D6EB 1PG7H 3CDYA 2CIIB 3P9MA 4WGWB 2BOCB 4KKAD 1I85A 2HFFB 3D39A 3S3JA 4WFFE 1A6WL 2MSPA 1FFOA 2VLJB 4OFIA 3RHWF 5FO7B 4M6NL 2XPGB 2PYFA 1AGBA 1DN0B 5L7XL 1CXFA 1VFAB 5EO0A 1DQLL 1KTDA 2H41A 1R24B 5BV7H 5ICZB 3BIKA 3L5WB 2IANA 5F1OB 4PY7A 4ONHA 1BFOB 5C0AD 3SDAD 2O5XL 3TO4A 3ULVE 4A6YH 4G6FD 2AABH 5D1QA 5H2BB 2P5WE 4JGUA 3I2CL 3VRLE 5B39G 3DETC 4D8PA 4M8QA 2GTZA 5TFSH 5L8JB 5BV7L 1ZLUH 5FHAH 4HXAL 4R2GB 4YZFE 4MZ2A 2P24A 3OMZA 2XZZA 5D7IF 3CFCL 1QBLH 2X4UB 3ARUA 5EORH 3G6AA 4A6YL 4R2GC 2AABL 1MEXH 1Q9WA 4NDMB 3CVIL 5K59E 2VDLH 2XXCB 4V1DB 1U95B 1Y6MR 3QWOA 3KYNB 5TFSL 4JB9H 5FCSH 5B8CB 5FHAL 4K9EC 2BVQB 4X6CE 1QBLL 4F7MA 4PRPE 5B8CC 1A64A 5BO1L 5ESVB 2VDLL 2AV7B 4NRYA 1WT5C 4NHCH 4MB4A 2X4OB 4JB9L 2VXSH 1PYWB 2Z0BA 3MLZL 5CKAA 2VL4A 3A6BL 1R5WA 1WCQA 4NC0B 4AENB 3JV4B 3IFOA 4I5BA 1XGQB 2P43B 4KK6D 1J8HA 4XX1E 1WCBB 3L3HA 5FYJU 3QEQB 3H3BC 4NC1E 2Y23A 1RULH 3PXJA 3GO1H 1CDJA 1ED3A 1S7UA 2F54B 4HQQH 1F90L 2VXSL 4LRNH 3I84A 4BQCA 3M8OL 1V8HA 5L2JB 1Q0XH 5I71B 5DUMH 3AMLA 4YHZL 4PJXF 2EXYC 1BZQK 3G5ZB 4PLOB 1RULL 1LDSA 1A5FL 2PYEA 1NBYA 5I71C 4HQQL 2ARJB 4JVUA 4ZO6A 1VKXB 4LGSB 4U1KB 2VIRA 3SGDH 5JOPD 4L3EA 1J1PH 3I02B 4IOSD 4YQXH 5A2JH 1Q0XL 3IXAA 4N8PA 5DUML 2EZ0C 4ZTPH 3VA6A 3CPLB 3BVNA 4OLWL 4JPWH 2UWEF 5E8DH 4RCAA 3RDTD 3QUZA 4H8WL 4Z7NF 1DBAL 4NHUA 1I8LC 1NUNB 3CSPA 3PWVB 3DMMB 1J1PL 4RMTA 3TLRA 4YFLI 4E0RB 4OCSH 2IF7A 4U7KA 3P3YA 5C0CD 4ZTPL 5F7WC 3CNKA 3G04A 3DMMC 1JYWA 1SJEA 3LEXB 2ADFH 4MAYB 2H45A 3VFUB 2D03L 5ESAB 2FBOJ 3RKPA 2WP3O 3HE6D 3K0WA 4WJ5B 5E8DL 3NCYP 5BQ7A 4DAGH 6FABH 3B5TA 1FL5B 3PIQB 3MJ9L 4MAYC 5IR1A 5D7LD 4RMWA 2OP4H 5D1ZD 1HCVA 1B3JA 2V9QA 3G6DH 4X6BB 4OGZA 4Y19A 4PG2A 2VLMD 3LKPB 4EDWH 2ADFL 5C0GB 3V6ZB 3OKKB 2WBJA 6FABL 5INDB 3AS3A 2C1OB 2AI0L 4HJJL 1HH9A 1VFUA 3RVTD 4BZ1H 4B53A 3QNYA 2DYPB 2GSIA 4XWGH 4H0GA 4CJ1A 5KS9E 4AG4H 2DJ4A 5C09B 3TN0D 3GHEL 4EDWL 2QV2A 4IRZH 3RI5K 5HHOA 4AQOA 4PJXB 4Y1AA 4CJ0A 2QQQA 1RZKH 1T7YA 2XOTA 4X6DB 5IJVB 4HW6A 1FE8H 4QRRB 3KWWA 1CL7H 2NPLX 1RPQA 3KPSB 1G6RH 5GIRA 2OYPA 3PGDB 3HMXA 4LCCB 3GIZH 5C71A 1QHOA 3IGAA 1EERB 2JB6A 4HHAA 1KCLA 4C56B 4M1DH 4BZYA 2NNAB 4L4TD 1ZGLM 1RZKL 3VI4F 2OZ4H 4LCCC 1MIEH 4XP6H 4PJEE 4PTTB 1AIFB 1FE8L 1I7UB 4NKMB 4WHYH 5C07D 2XKNA 5I30L 3QCVL 1NBZB 1YNKL 2ESVA 5E7BA 5IMKB 4P48A 5GGSB 5C0FA 4YFEA 3SGJC 43C9B 4EKXA 5I2IA 4YDLB 4NKIH 2FH8A 3CSYB 2YBRB 1LQSR 1S7RB 4KTDH 1GGTA 3ZE0F 3QUKA 3MSPA 3DURA 5ENWB 4FQXB 4OD3H 5JQHC 4YDLC 5KSBF 3GMLA 3IFPA 1MHHA 2APWA 3HC0A 4FQXC 4LU5H 5CP3H 5C9JA 3MO1A 1BWMA 1IFHH 3EDEA 3KPTA 4NKIL 5IM7A 1XF5A 4OCMC 5D9SB 5D5MA 4OQ1A 4O02H 2A6IA 2X4TB 1MJUH 3VXMA 4OD3L 5DJ2A 1MH5A 4JRYD 1BJ1J 5D2LB 3C6LA 4ZXBB 1DFBH 1G7LB 5A2LH 3S7GA 3RVXD 3GUTA 3EO0B 3O3BB 2BVUA 4ZXBC 3B9AA 2ITDA 1CT8B 4PJ7A 3PWPE 4O02L 3CFKB 3BI9X 5D72H 1MJUL 4WENB 4Y8DC 4LKCB 3KR3H 3E6FB 1NC4D 2FX8L 4FHBD 2ZG2A 1DFBL 1QVOB 1JF5A 1G6RB 3RY6C 4UT6L 1CGYA 1RZKC 3PDGA 4NGHH 1QPXA 1T3FA 1Q8MA 2FLBT 3E1F1 8FABA 4PLKC 1IL1A 4OFDA 2Q86B 4P2OD 4XPAH 2NY6D 3MCG1 4YH6A 3B9VA 4YXHL 2G75B 2R0KL 5D72L 4DGIH 3KR3L 4GMSL 3RZCB 4K2UH 5FYLE 5CIPH 4U1LB 4UZGA 2CRZA 3QULA 1FDLH 2VDRH 4QHNA 5FF6A 4HF5H 3RZCC 5TF1H 5C3LD 3GBMH 4FFVD 3NACL 4LMQE 2XA8L 1AGEA 3TH2T 2XFXA 4MNGB 4RGNB 4RMVA 4DGIL 5DRNA 2FECI 4K2UL 2QBWA 1MRCH 3SPVA 4WCYL 1VADB 4RGNC 1BX2A 3CFBB 1FDLL 4HF5L 5TF1L 4NRZB 3GBML 4ZFZA 5KSBB 2UV3A 1CD0A 5DQDH 4CW1A 4XVUD 5MEND 3WCYA 3T0BA 3X3GL 2IAMA 1A2YB 1L0YA 4AY0A 3PV6A 5CD5C 5F7DA 2XN9B 3O3AA 2WINA 5FO9B 4PJFA 1CQYA 5LBSL 2D7MA 4NKDA 2VABB 3E2HB 2YUZA 4S1DC 1N3NB 4IMLA 4YBQC 1MHCB 5IW3A 2Y72A 5HHMD 5ID1A 3I50H 5DQDL 3E2HC 1NKRA 3SCMD 1U42A 4O2CB 3T2NL 5FOBA 1XIWD 5E8OB 3N0PB 3UROR 3NABH 4IIQB 3CDGB 5F1NA 2VB5A 15C8H 4Z7WA 1QSEE 2XG4A 5FK9B 3VI3E 1HILA 3KHOA 5GGRB 3T1FA 4M7ZB 4IIQC 1MCIA 3HLAB 4K7PX 5HVGB 1D6EA 4WNQB 5CIPB 3QCTH 2CIIA 4M7ZC 3ZYOA 1ITBB 2BOCA 2PUQT 2HFFA 1NANH 15C8L 4MCZB 1QUNA 3U6RB 2VLJA 4OKVB 1K8DB 4MB5A 2R4SL 4C59B 5FO7A 3H9SE 3U9UB 1DN0A 2VH5H 4OF6A 3JXAA 1VFAA 1G84A 4EN3B 4QLRA 1R24A 3QCTL 5ICZA 3FQTB 3L5WA 2C4FU 4M5YH 4ELMB 2ARWA 4P9HH 4EN3C 4QKXB 1BFOA 4JY6B 1KTLB 2APFA 5H2BA 3WLWD 5J8OA 1YEFL 3OJMB 4YBLB 4KJPC 4M5YL 1U0QA 4P9HL 2X4UA 4YBLC 1FBIH 1MJ8H 1MCWM 4N0RA 4NDMA 4OTXL 3IFNH 4XCFL 1WAAF 4TULL 4V1DA 1U95A 2YWZA 4R7NB 3QA3B 4NN7B 3KYNA 4PD4K 5IROC 4N0CC 4C58B 3UYPA 5B8CA 5F9AC 4B0MM 3CX5J 3KXFB 1TMCB 2BVQA 2GYSA 3HMWL 4NN7C 4X4YB 4WO4D 2BHYA 4F9PC 1WT5A 4YUEH 1MJ8L 1QA9B 1WK0A 2C9AA 3AROA 1JWMB 5ESVA 1CFBA 1ZVSB 2P49B 2LQRA 2AV7A 3OAYH 1A7NH 4Z6AT 3C5SB 1RQ5A 4YGVB 1J0HA 1PYWA 5JO5B 3DX7B 2FRGP 5E2TH 1B2WH 2WQ8A 4ZOAA 4AENA 3JV4A 5FUOH 5F1IB 1KLUB 2RB8A 4YUEL 2E7CA 3BSZH 3ZTNL 1XGQA 4HEPG 1WCBA 2VDQH 3QEQA 3C08H 5GRUL 3ZZ1A 1A7NL 2F54A 1E4JA 1DBJH 4WHCA 4OLYL 1B2WL 3ARYA 5JOFB 5FUOL 4OB5H 3TZVD 5L2JA 5I8CB 5M95B 3BSZL 5GS0D 4P9HC 2EDNA 1PKQB 1WUNT 1ZS8B 4R7DB 2PXYD 4RISL 3G5ZA 5DRZB 5GS2D 3IDIB 5HDBF 2R23B 1N6QH 1FFRA 3CMGA 2ARJA 4OZHB 4DFIA 4BH7B 1S9WB 5D2NE 3BW9B 5BJTB 1VKXA 3VFWB 4U1KA 1UM4H 4DFHA 2NZ9C 1Z0MA 2HG5B 4DOHE 4GG6E 3I02A 1KTRL 1VESA 4LSSL 4NWTH 2OCFD 5DVKA 4ZUVB 3F65A 3AS0A 4JG1L 1FJ1B 1P7KB 3CPLA 1I8LA 4U31A 4HGKC 5EU7C 2IC2A 4ZOCA 5I8OH 2HYMA 3UTTB 3GKWH 4HMDA 4Q0XL 4H25B 5FCUH 4YFLF 1DANT 2C4XA 3DMMA 4F15B 1KJ3H 4E0RA 4NWTL 3MGOB 4IJ3B 5D93B 3LEXA 4MAYA 4UOJA 3VFUA 4F15C 1Y6NR 1EPFA 3MA9H 5ESAA 5JTWA 5I8OL 4WJ5A 4D9QD 4G9FE 4IJ3C 1FL5A 3HB3D 5D93C 3PIQA 3K2UH 5FCUL 2JCCF 2X4RB 1KJ3L 4FABH 1EEUA 4PRHB 4N90E 5JQ6L 1IT9L 4X6BA 2DLFH 3LKPA 1C8PA 2ZCHL 4HXBH 3MA9L 5C0GA 4FFWD 3QAZB 4PJHB 3V6ZA 5EU3B 3TCLB 3OKKA 3QXWA 4KMTL 3UO1H 4WW2F 5INDA 3SGKC 2C1OA 5H37G 2FX9H 3QAZC 1DLFH 3D48R 5E6IB 4OD2B 3W39B 4FABL 3RTQB 2DYPA 2CK0H 3GSNL 5C09A 2I07B 1B6UA 4RDQG 4LGPB 5E6IC 4MNQD 4LQFL 3RTQC 1MQKL 4NJ9L 5SWSB 1I1RA 3UO1L 5C08E 1U3HD 1RHHB 2P8MB 2FX9L 4X6DA 3WS3B 4JY4B 5IJVA 4QRRA 4WFGD 2CK0L 3G6JF 2NY2D 5T1MB 4RFOL 4OFVA 3PGDA 2A77H 3E8UH 4E41E 4LCCA 3DROB 1G0XA 4N0UB 1MNUH 4C56A 4YNYB 2NNAA 4QHMB 3SE8L 4PTTA 1AO7B 3SGJA 1AIFA 2QQLH 3DVFA 1TZGH 4XBPB 1I7UA 4NKMA 3O6FD 4PRDB 2RCSL 1NBZA 4I13B 4NUJB 1S8DB 5IMKA 5GGSA 1RJZB 3L5JA 43C9A 3E8UL 3CLEL 3CSYA 5AAWA 2YBRA 1S7RA 2X9YA 3DHJA 4WEMB 2DTMH 5ENWA 1JNHB 4FQXA 4N1EA 3MCLH 3H9HB 3D3VE 4K7PY 5HHVH 2OTUB 3Q6FB 3VXSE 1PQZB 3CIQA 4WI9A 3RWIB 5D9SA 3RBGA 5FYJH 4ZUTB 2X4TA 1YYLH 4NC2B 3UC0L 2EEDA 4L8BB 4EUPG 5HYEA 3MCLL 3J7HA 5AWNL 5D2LA 1OP5K 4ZXBA 1G7LA 4GAFB 4WW2B 1NFDE 1IC7H 3EO0A 4FMFA 4JKWA 1KN4H 3HG1A 2Y6SD 3O3BA 3HUJE 3PWUA 1OGTB 1P1ZB 5A3ID 4NOFA 1G9NH 2IFGA 2NCMA