1MRCL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL01
3SKOB 2Y9RT 3NOIA 1BVZA 4GG6F 5T1KB 4L8CA 2NY7L 2VDQL 2ESVA 1OSZB 1FFOA 1CLOL 4X99B 3SPVA 1KCUH 2YA0A 4NHUA 3HI1B 1KYOK 4NFBA 5B38G 3B3IB 3BEVA 3F65A 1BQSA 1FNFA 3FRUB 4HJ0D 4XPTH 1LQSR 4NQSA 4BSVB 4WEMB 3HG1D 3QT2A 4WW1A 2HTLD 2I24N 3EKCA 2DD8H 2J8OA 3N06B 2R69H 4O5LH 1AJ7H 4FQXB 1JZ5A 4WW2A 1DLHB 4W81A 1E6OL 3FN9A 3TT3H 4K8RD 2FHBA 5C9JB 5LQBH 3C9NA 3FCTB 3RTQB 1P69B 4WO4A 3BT2H 4I0KA 2V9TA 5GGTL 4K7PH 3BQUD 4HZLA 1HSAA 1MCIA 2ID5A 1C1EH 3RGVA 3ULSB 5F7EL 3O2DL 3DX7A 3MRJA 3OPZL 5FYLD 4O51B 5IW1B 5FF6B 3TF7C 2FCBA 4JZJB 4YQXH 2MKLC 4HIXL 4L4VB 2J12B 1Z2KA 1YNLL 5GGVH 1T03L 4PTTB 1SYVA 3K2MC 5DK3A 5EBWB 3RY5A 2BMKB 3IDYB 4QHMA 5A2LH 4HQQH 4TTGA 1U93B 3AMLA 3H9ZA 5HYQB 2HJFB 2Z91A 3CFEA 1CR9L 4YDLC 5IOPB 1A5FH 4K2UL 1GC1L 4PJHE 2OL3H 5C0ND 3FOMA 5DRWA 4M02A 3UMTA 1CD8A 1KJVB 4UB0H 5TE7L 4JPVL 3GSWB 2UY6A 3QYCA 4DKAA 1ZANL 1W0VB 1X4ZA 4YXHL 3CMOL 5DD5H 1KENH 3OZ9H 5L8JB 4G9DB 2BJML 3VXOB 1WAAF 4PGBA 5DEZA 1S7UB 3OXRB 5EZIH 4MJIE 5MENE 4L9LC 3WNLA 1K8IB 4HX1B 2A83A 5E5MA 2HTKC 4ZAKC 4RQQA 3RY6A 5CIPA 5JOFA 3LZFL 4PBXA 3VXQB 1R0AH 3GO1L 5HGAB 1U8HB 1OW0C 5D93B 4JHZA 3P3YA 3D3VA 3LB6D 4X7SH 1YDPB 3IJSA 4YHNB 4GRMB 4E41D 3IXTA 1X5GA 1YMMB 3U0TB 5K9KA 4PD4J 6CGTA 3HAEA 5IFHH 4BH7A 5E6IB 1F8TH 3EIFA 1GAFH 4LASH 3OF6A 3P0VL 3FB5A 5SWZB 4K94C 5DJCB 3NAAL 2ZUVA 3BKCL 3RVWC 2IQ9L 3LCYA 1FFNA 1ADQL 4RNRA 4RAUA 2H26A 5C8JA 1MY7A 3H3PL 4K7FB 5L0QC 5F1IB 1I3UA 5HGAA 5HI4D 1LO3H 1CXIA 3V6FB 2KQNA 5EOQL 4S1SL 3QDJE 1S8DA 3VFMA 2I07B 1MFDH 1DE4B 3N9GH 1LDPH 5EC1A 1IGTB 4PD4K 4XPBH 4Z0XA 3WNNA 5F3BA 4NZDA 4KJYB 1TQBB 2BFVH 4E42A 1NBZA 1X3DA 4GMTH 4G8GB 4U3HA 3FB5B 4PGEB 1AGDB 3KPQB 4C56B 4NQDE 1EEQA 1A7PL 5DD5L 2HLAB 4OBSA 4Y5YB 1T66C 4RMRA 1IZJA 2P47B 5EU5A 4HH8A 1S9YA 4PREB 3FHAA 4JCLA 4N0UB 1KFAL 4YWGH 2I9TB 3D6GA 4LFHG 3VGFA 1JI1A 4NC2B 4XMLL 2OL3L 4R97B 1CQYA 1IGYB 4ODHL 3EOBA 3U7YL 2FL5A 4ELMB 1B0WA 1ZKAA 4NO5A 4FFZL 3TO4C 2FD6H 3T1FA 2MWCA 4OZIE 3CLFL 3CVIH 4G42B 1JJUA 2CIIB 4XP1L 4XH2B 3QAZC 3TBWA 3SE8L 3OAUL 5D5MA 3DMMB 5BJTA 3GI8L 4JREC 2KZWA 4NZTH 4R0LB 3NH7L 5GRVL 1X4YA 1QFWH 4YQXL 3SQOL 1QFUL 2DL9A 5BCAA 5JZ7D 1EVUA 1Y6KR 2AGJH 1EXUA 4AEIL 1JPGB 1DN0B 5I1LA 3LN4A 1RK1A 4NJAH 2BNRD 2CLZA 2Y5TA 2ORBH 4RMSA 3KYAA 1MFEH 5IBTL 4K23L 2LAAA 4IOIB 5DVNA 4WHCA 2IG2L 1TJHH 1AR1D 1MI5E 2NY2B 2YD6A 5DO2C 4ZTPL 3D0LA 3KXFA 3ILQC 5D2NB 5C0CB 5C0IA 1U8MA 2XWBB 2FJGB 2OZ4L 1OAQL 2VZVA 2DLTA 4ZYKA 3RNKB 3UBXA 1UGNA 4PLKC 3O6FA 5HHOD 4F2MB 2IPKA 4W4OA 3C5JA 3QXTA 5IV2A 1P7QB 4RMQA 1K4CB 3AS0A 3P9MA 4FZ8H 1EVTC 4EIGB 2NY3B 2UWEF 4L8DB 3DVFA 5EU6A 1CLZL 2V2WB 4PRBB 2C3VA 3T2NL 5JORA 4DAGL 4XPTL 1IT9L 4X5XA 2R2EA 3EAKA 3DBXA 3SGJC 1RZ7H 1UJ3C 1DL7H 5E99L 1L0QA 3MGTB 4MA8H 2AJUH 3Q1SL 5EZLB 5F88A 1KPVA 3RVTD 4PRNB 1DQQB 3BKYL 3IF1A 3CDYA 4P46D 3HS0A 4JY4A 5CJQH 1F90H 5MHSD 1W72H 2P5EB 1AD0B 2YUWA 4Z7UA 4CVXB 3UO1H 3V6OC 3BSZH 4UT9H 4JRWA 4XVJH 4DEPB 4EUPH 3DURA 4ERSH 2X4RA 2IPUK 2V5RA 3Q6GL 1OARL 2XXCB 3RWJA 4MQTB 4H26B 3TBVA 1TZGH 3T8XA 3VFOA 3GRWA 3WFHA 1P4LB 1NL0H 3VG9C 1HZHL 3MRDA 3W5MA 4NBXB 4XBGB 2E7LA 1NCAL 3FKUS 4XNXH 2Y36H 2BY0A 1YDPA 3O9WA 1CR9H 1F3RB 3OTTA 1G7IB 5TPWH 1IGFL 1OM3H 1EX0A 1MCKA 1GZQA 3GSUB 1CK0H 4G6JH 5T3XL 3M8OH 4DVBB 3LRSA 4NO3A 4I5BA 4OLVH 4HWEL 4Q7DA 2VZOA 3KPQA 4IS6A 4CUCA 3VG0L 1QHOA 4LSPL 5BVPH 1JHTA 3TZVA 5IJVA 3HTLX 3H3BC 4XPGL 3HB3C 1MCRA 4NQEA 4TVPD 3D2UB 1YEKH 5F96H 3EJYC 3V6FA 2NYYC 3KAAA 4NQVA 5HGGS 3BISA 5F7EH 4FQHA 4H88L 2E7HA 1PG7W 3TO4A 1TPXC 3HR5A 2PXYB 5EO0A 3GKZA 4NT6B 2I9LA 1RZFL 3G04A 3BD4A 3HZMA 5I1DA 3ZHKA 4WFEE 1HSBB 3H9SD 3LS4L 4PR5A 2X42A 4Y5YC 2H9GB 4BH7B 4HIIB 3PP4L 3VA6A 5BRZB 3D18A 4J2XA 4Z7UF 5TQ0L 2QKIB 3QHTC 1HHGA 4Z7WE 3MO1A 3QA3A 2DQGL 1I3GL 3ZL4L 5JNYA 1Q9KA 3ULVF 4KAQL 4KDVA 2MCPH 4IRZL 4K7FA 4YPJA 1YEJL 4JO1L 4FQ1H 4PS4L 4RMVA 1JZ4A 3GMRB 1KIPB 3MV9D 4XAWL 4R2GD 5BV7B 4U2YA 4L4TA 4HXBL 4JFYA 1A1OA 1IM9B 3HE6D 4NN5B 4M48L 3MGTA 5F3BB 1SM3L 4V1DA 5GRUH 3DRTB 4X7DC 5AUMB 4O00A 4ZO6A 5HHVL 3GUTA 4UQ2B 4YHIB 3ARYA 4P2QB 4N0YH 3UXFA 1G7MA 2MFNA 3T0EB 2Q3AA 4K9EC 3MRNB 5JNYB 4GRWH 5CZVH 1F11A 1H3PL 3OR6A 1R24B 4L3EB 4KHTH 1MH5B 4JG1H 3M17A 1TJIH 4PJIE 1FL3A 2C1OA 2C4FT 3QQ3B 2YXFA 1KBGH 3HZKA 3BGFB 3MRRB 4R3SB 4DOHB 1U0QA 3K4DA 2GFBB 4ODTH 5J06A 2AXFB 5E9DE 5DA4A 5DZNA 4OLVL 3U4BH 5B39G 1I8LA 4PTTA 5F70A 2AJXH 2DYPA 3G6JB 4HUXA 1D5BB 4P5MA 1F3DJ 1AQKH 1OGAD 5J6HB 1U8HA 2P4AB 4U1HA 4DJMA 1MLBA 5KSUA 1NCBH 2OI9B 3HAEG 1J8HD 4NFCA 1JPGA 1NC4B 1T20A 2XWJB 3MV9B 2ZOKA 4U6XA 5DJ0B 3TFKC 2X4RB 2GJ6E 2EIBA 4TQEH 3A6BL 2HFFA 3FZUD 2G2RA 2IADA 2HJLB 2V6HA 4RZCA 4NO0B 1M7IB 4NZUL 4N90D 5HGBA 4F7TA 3BWAA 1XH3B 4R4BA 4MD5B 1Q9WA 2CJUH 4WUUB 4Y5YA 3STZB 1R6VA 1QEWA 1OQOA 4YPGA 3QQ9D 4ODSH 4YGAB 4Z7NF 3SBWA 1VACA 1ZLWH 4ZUUA 3L5IA 3HE7C 1OT1A 4FTVA 2GCYB 4OUOA 5TDNA 1T21B 3VWKD 1H3WM 3DURB 2BK8A 3V0WL 3IXAB 3DBXB 4J4PC 4ZXBA 4P4KA 3MV8B 2AJ3A 1UM5H 4AT6B 3ZKNC 1JP5A 4PJHF 4LBEB 4G43B 2MSPA 3ARED 3ULVH 1IGCL 1KN4H 3ULUL 2EZ0D 5D96B 1DBAH 1OWRM 4J23A 3PL6A 4FQCH 5DDHA 5C08E 5JXED 5KSVA 1B4JH 4RWYH 4UNVA 5DLML 5D9SA 4O2FA 3MNVB 4OQTL 2PO6D 2YZ1A 3KDMA 3W39B 4MJ2A 1GC1H 3MCG1 2UYLB 4WEUD 2E9JA 3IDGA 1G1CA 1MVFA 1YYMH 5EC2A 2CDGB 4U33A 3S96B 1CI5A 2X70A 2OJZL 3WYRA 5ITFB 4XP4L 5F6IC 3C60C 5SWZA 2YRPA 5KVEL 3L3JB 1VFAB 1JZ3A 2V7NA 1V3MA 4Q6YA 4RDQG 5E8OB 1DN0A 1QSFD 3BPLC 4JN2A 1ZGLP 1IGML 5FHBL 2HRPL 4ONGH 3RGVD 1F2QA 5B38B 4I13B 1NAMB 3DVNB 5FYJH 2OK0H 1NCUA 3HPJA 5CEYB 1T0MA 1BECA 4M48H 5EFIA 5AYUL 5GS0C 5F1NB 3D39A 4LSQL 3NA9L 3U7AA 3ZDZF 3FO2B 3OKEA 3VA2C 1K6QL 3MJ7B 1Q9LA 1OF2B 5BZWA 1JGUL 1WJ3A 1A0QH 3VWJC 4ZUSB 5CBAA 4WTZA 5LBSH 5L88H 1NAKL 2R0LH 3HLAA 2DLFL 1PG7H 3VXPB 5F7HA 5FA4A 4G6KL 2G2RB 3FO9B 5F9DC 4LHUB 4OB5H 5T5FL 4M3JA 1QA9A 1UM6L 3L5JA 1CDHA 2BC4A 3KLHD 2QSQA 4HUMB 3CLEH 3P4OA 5GGSB 1EA9C 1KCLA 3O4LD 1OGTA 1V8HA 5EUKB 4WFHD 1QBBA 1DZBA 2F8VA 3L7FB 3TN0B 4CVZB 5CJ5A 1FO0B 3INUH 1DUZA 3MRKA 5IMOB 2EH8L 4LVEA 4GAJL 1SYSB 2VXVH 5A2KH 5K9JH 1EZVY 1YN6B 1LD9B 2APFA 2EYRB 1CFBA 4Y16D 1CFNA 3CH1A 3SKNB 3G5YB 4PTUA 4KROD 4HPOL 1INDH 3VRJB 4WRLA 4OSUH 4FQ2L 1QP1A 2HAZA 2D4DA 4FRWA 4HSQA 3V5DB 4CBPA 3KYKH 3MLRL 2P5ED 3O6KL 4UU9B 3FFDA 3MA9L 4FFYL 4NQUA 5AEAA 3SGKC 4CDGC 3WIFA 1KTLB 4DGYL 3QIUC 4HKBA 3HFMH 5J3HC 3GSNH 5KBNC 1TTFA 2AQ2A 4O9HL 1IGIL 2P46B 3C8KB 2AXGB 3BP6B 2IAMC 4LCWB 3FB6A 2WBKA 2XTJE 2EC8A 1UZ6F 4NZJA 1G0DA 1PX3A 3J7HA 3HAEH 4AT6A 3DXAE 4LNRA 3EHBC 1DEEB 2RCSL 4WEBL 5EUOE 4LU5H 4UU9A 3GSNL 5JIPA 2V2TA 5DLMH 3IDYC 4JRXD 3CFIC 5DWUH 4NN5C 3A6OA 4XC1L 2DICA 3NMEA 1OAUL 4LCCA 2WQ8A 1JZ6A 3BRDA 1A3LH 4KPHL 4XBGA 1SEBA 5CIPH 1FAKT 4G7YH 5B39A 1VACB 1HHGB 4HJGB 4H88H 2AEPL 1MLBB 3T08A 4ONFL 3C5SB 3THML 2AJZB 1IL1B 3EO9H 5B3NA 4KI5F 4LPCA 4LPWA 4H1LA 4MSWA 3E6HB 3OG4B 1UH2A 4D94A 3DX6A 4IRJC 1XMWA 2Q6WB 1CWVA 1CLYL 3V4VH 5H37G 5KAQF 3EJYD 4B7IA 1MJ7L 5ID0A 2GQHA 2OTPA 2ZJSH 1H3GA 2X40A 3PQYD 2MTPA 3LKSA 4R96A 4G5ZH 3IDXL 4GUPA 1DQQA 1NANI 4JO4L 1NFDF 3S36X 3REWA 1PQZA 1M4KA 2HH0H 3RIFK 4KVCH 1MRDL 1XGRA 1CL7L 4PJAF 2DDQH 4DKFL 1KIQA 3B2VL 3MBXL 5JO5B 5FFLA 3FTGB 5DUBA 3BP5A 5MEOB 1Q9LB 3NZ8A 4NN6C 3OJDA 3ET9F 3HCVA 1PG7X 2DS4A 4GW5A 1JRHI 1JN6A 4MA7L 5FK9A 1WBXA 3MRQA 1T7WA 3I6GA 4PJXE 4YEEA 3QFJE 4X0KB 1JTOA 3TIEB 1K4DB 4XI5C 1B4RA 1FYTA 4JPIA 3LIZL 4FFVC 4M6AA 2E7MA 3L9RA 2O26U 3WXVH 3LSOA 5GZOC 2H41A 3VFRB 1KGCE 4Y8AA 3QIUA 5D6DA 2VC2L 5DRZA 1YEFL 3P0YH 4NQCD 3O8XA 1PY4A 1S9WB 2BNRB 3R4DA 3KPOA 3PQYB 2VLJB 4GKZB 1JF1B 5CZXD 3VFGH 5EU7E 3KR3L 2R0ZH 1YEJH 1YN6A 2NY4B 5DMKA 5FGCE 4EQ2A 5EOTB 2Z31D 3QXDA 1I9RH 5HY9A 4RA0C 5I74C 4I48B 4PJFB 2JF1A 4PJXA 1YC8A 2Z92A 4HIJA 4NJ9L 4G8IB 1ZLUK 5JPNB 4WO4C 3ORJA 4M62L 2EH7L 3MRLB 2WM0A 5KSAC 3T0DA 3D9AL 4MJID 3FFCD 4YE4H 1AP2A 2HT4C 4O02H 4O2CA 1AGEA 4POZC 1EPFA 2W65A 1CGSH 1TXKA 2YEZA 5LWYH 1DBAL 1I3GH 3ZL4H 5JW4N 3D85B 1QRKA 3BW9B 2APBA 5FB8A 5HHXL 2E6JA 4E41E 5ECJE 3HE7A 3KPPB 3VCLA 5BO1L 4QTIL 3ZDYF 3CSBA 1YEEH 2E27L 3V7AE 5KSBE 3E6HA 4ZPVA 3DXAA 2OJEB 5F6IB 3FRPA 4FQJH 4OJFH 3UPRB 4L9DA 3OKDA 1OSZA 2BVTA 2P8LB 4KROC 1X5KA 4P3DA 5C92A 2Z4QA 4KWUA 4LL9A 3MLSL 4WI4A 4Q6IC 4FMKA 2EKSB 4RGMC 3GMNB 2RFXB 3CX5J 5TPWL 4H20H 5I18L 4AEHL 3LH2H 5D7IA 2X4OB 1ZS8B 1GIGH 4HIHA 2WBWB 5I8CA 4KGJA 4M1CD 3RL1B 5D6CA 1OTSD 5J3HD 2GHWB 3MOAL 5T3ZD 2ADIA 1RULL 4Y19E 4CW1A 3N1QC 4XP6L 2GW5A 4HWEH 4DUXA 4LSVH 3E8UL 3OKDB 5GS3A 1S7QA 3KPTA 3QDMB 1NCCL 5JXAH 2YR3A 4J4PA 4KRPC 4ERSL 3RNQA 4KUZH 5ESQA 2W92A 4NWTL 1C5DB 4OZFA 2DQDL 3O3AB 4YFEA 1XIWD 4OF5A 4JFDB 1NEUA 5GGRB 2QSTA 4F7EA 4X4ZA 3CD4A 4LMQI 1KTDA 1E4KA 1BD2E 1NCCH 4P23A 5TE6H 2LABA 2NY5C 4G8GA 5KZCD 4LVOC 1MWAL 1U41A 3BP5B 1W0WA 4HMEA 3FRUA 2R1WB 2R4RL 1X44A 2DQHH 2X1WL 2NY0D 1OGAA 2VDRL 3WNPA 5DMIH 1FVEA 4MNGE 4NHCL 3OXSA 3CC5A 4KI5D 4UINL 5ICXB 1QTYT 5JDSA 1UXSA 3REWB 3VXTB 4PJBB 4AENB 3OKYA 3I50H 4PJ5B 4HCRH 2VLKA 3VXSD 4JFZL 1PZ5B 5C70A 2BC4B 3QDMD 1RZ7L 2HRLA 4XMPH 5D2LE 5E8EA 1VDGA 2D7QA 3F7VA 4PRHE 5F97E 4NWUH 5JO5A 4LPYA 4AG4H 4R4NC 3AMKA 5D5MB 3SDXB 1S7SB 2P8PA 1VA9A 4KC3B 5J57B 4N8CH 1ZHKA 2CDFB 3QIBB 3RA7H 3PWPD 5J0BA 2C1PA 4I18B 5HHOE 1A7QL 1SJHB 1NFDE 2DQGH 4JZJA 2IALA 1PKQE 4OLZL 2FJFB 3O4OC 3VXTA 3RUGE 5INDA 4X6DE 2A6KA 4ZFFB 4HFWB 1WT5A 2Q8BL 4AM0B 4NT6A 1M1SA 5BS0E 3CXHJ 1GGUA 3I3EA 3TYGH 3SDAC 4PJCF 3QAZB 3LQMA 3SY0B 4FFWC 2NY0B 4ZXBD 2H2PD 1QUNA 3NIGE 4XCEB 1K8DA 4HK0B 5SWSE 4ZS6D 2EKSA 3W0WE 2YEZB 3SGEI 1U8PB 3DJ9A 2R0KL 2CLVB 4K3GA 1CDJA 1MNUH 1X5ZA 5J11C 1ZT7B 1T6VN 1G6RL 5D8JL 4PJ9A 3FOMB 2VQTA 4ZUVA 3OGOE 1O0VA 2CO7B 5DRNA 3DX8B 2EYTB 5ID1A 4MDIB 1A9EA 1EJOL 5I1LB 3EOBB 1KEML 2FBJL 4XNYL 4Y4FC 2H32B 4M7ZB 3QRGH 4XXDA 1T66D 5EUOF 3QDGD 1J5OH 3WIHH 1G7JB 1PLGL 3GJEA 3MBEC 1QBMH 1C5BH 4EN3B 1CCZA 5E8NA 3CVHL 1UYWH 1WZMA 5F72S 4QRRA 3VXSB 2Z4QB 1FAIL 7FABL 3WFEL 2DMBA 3QXVA 3BT2L 3BE1L 5C07E 1NBZB 3TH2T 3FFCE 1JI2A 5FYKD 1UCTA 2XA3A 1MFAH 4WUUD 4FABH 3ULUF 1EV2E 5IFJB 3D87B 2XTLA 4PJIA 5CILL 1MH5A 4UT7H 2IAMD 1FNLA 4UOW0 2GUOA 2MPAH 4G5ZL 5J13C 3ARBA 2DI8A 5JLZA 2EIEA 1QLRB 2UVEA 5GHWH 3AM8C 3L3GB 1UC6A 2F53D 2LTQC 1CL7H 2OR9L 4XMKH 2DYPD 4PP1D 4UDUB 3BGFC 5EBLA 2F5AL 5DD0L 1OLZA 3OJ2C 3QHZH 3B9DA 2VXTL 4AZ8A 2PCPA 4KJYA 4KKCD 1RURL 2A0LD 1AGEB 1AHWA 1M7DB 1LO3L 2VERN 1UB5A 3VFNA 1GSMA 3KGRA 2NNAA 4EI5C 3FQTA 2PETA 1NGPH 5D7LA 4WHYH 1E4KC 5DSCA 5IVNA 4NNYB 3QEQE 4PJ7E 2ENSA 1G9NL 3MRKB 1J1OL 1DQMH 1DUZB 5DRWB 1F4WH 4P23C 4WVRA 3H9SE 5DVOA 4OF0A 4EZMA 5I71B 2B20A 2DJSA 5L8LB 4JB9H 4P2RE 4LLWB 3T3PE 1U92B 3WSQL 1BQHB 3HHRB 4YHPA 4KRPB 4Y1AD 4RRPG 5LXGH 1BBJB 4NRYA 4AK1A 4U1SA 2NY2D 2OJZH 2EE9A 3VG9B 4FOMA 4KKNA 5FOBB 1I7UB 4JPWH 2NLJA 4QHUB 1U8IA 5MEQB 1U8MB 1WIUA 3CLEL 4JPVH 1CE1H 2WWMD 2AAVA 5KW9H 1D5ZB 5M95B 2DQJH 3HFML 5J1SC 3IJYB 3CFCL 3WIIL 2C3GA 4O58L 5EU6D 3GSOB 4DZBB 3BD5A 2AJXL 2NX5E 2GK2A 1F6AB 1I1AA 2A38A 2KKQA 3ZTJG 5T5NF 3ARUA 4N0FB 3PUCA 5ALBH 3KS0J 4XWGL 2C1PB 3UCRA 3KPRB 3BKMH 4QHLB 3VMPA 4XNYH 1DEEA 2AGJL 3TNMB 4Z5RB 2QQQA 3BFOA 4HS6A 3IS1X 3NABH 4CVUA 3CFDA 4Z7QF 4ONHA 4D3CL 4OI8A 1MCPL 3RBSA 5ELIA 4JM4L 2YD2A 4MA8L 4I3RL 4NO5B 3CDFA 2KBGA 1IM9A 1QSZA 4X6EA 1XF2A 2WSKA 1YNLH 2MHAB 5JHDA 2BDNL 1TQCB 4RGMB 5BVJA 2XACC 5JPMB 1AGCB 4OTXL 2DF3A 2HJKB 3DX6B 4X80H 5F3HB 3BWUC 3EBAA 2BOBA 2XN9A 5SWQA 5KG9B 2J7LA 1A21A 3JWDC 4L9LA 1FFNB 2J8UB 4LKXA 2UWEA 2IEPA 2VLKE 5D1ZC 2Z9TA 1A7PH 3JTTA 3SDAB 2JJUA 1KIPA 4MQ7B 5DJAB 2NY0C 1GGBL 5DJ2B 1RAMA 1BMGA 3OB8A 1Q0XH 3HB3D 4QRRB 1AKJB 2Q8BH 2AK4E 4YXKH 3I6KA 4X7TB 5HDBE 4ETYA 5AZEL 4ZQKB 5BOZG 3PNWB 1MFEL 5GIRA 1YA5A 4ZFZA 3D18B 4HCRL 1HWGB 1S7QB 2NY1B 1YUHB 1YMMD 5ERWB 1QRNB 4C59B 5C2UB 3QUKB 3FQXA 3LKQB 4WJ5A 1JPST 2G60H 2CQVA 3K2UH 3EFDL 3PWPA 3MREA 3SCMA 2BRRL 5BW7A 5IR1B 2XTJC 1J88A 3IKKA 3L6FA 4JANA 1U8JB 5DHXB 2LVCA 3MR9B 4UV4L 1E27A 4QNPE 1I9IL 5C0CD 5F9WB 1RU9L 3GRWL 4RGNB 5A2FA 3D69A 1SY6H 2GTWB 4TSBL 1Y6NR 2VAJA 1X5FA 1NMCB 5AUMA 4BFIA 3OXRA 4Y2DA 3M45A 4X4XA 3STLA 3IJYA 1RUMH 4TPRH 4MD0B 3MCKA 5E08L 1V5JA 3BUYA 1WTGT 4DVBA 4HG4K 1CXFA 4XNZB 2AJVH 3MV7A 5CLTA 1FBIH 1L6ZA 4M7KH 3ROOA 3QDGA 5EPMB 1RMFH 1A7QH 1VPOH 2GSIA 1NLDH 4JQVC 4QHLA 2BFVL 3P30H 5E4IA 4PV8A 2XY1A 4PYGA 1J05B 5KVMC 3NIDF 1WTLA 4Q9QH 3CMGA 5LKNA 1NBVH 4M7LL 2X4NB 5T3XE 1CE1L 4ZFOA 2PKDA 3LH2L 4AENA 4U7SA 1A9BA 5HHPB 1WEJH 4ZOBA 4QHKJ 5CJOL 2B0SH 3HN3A 4ENEC 4H0IA 1BFVL 1OPGL 1YECL 3PABB 4NHCH 3CVHA 4EVNA 2C3WA 5J11B 1WFUA 4OKVB 4QRPB 5JORB 4KHTL 2ADJB 4Y4HB 3U79A 3V0VA 4UV7H 4NKDA 4G43A 5DHVH 1RD6A 5SWQB 4OGYH 5HGHB 4C4KO 3RAJL 3N0PB 5DK2A 3H7LA 3QPXL 3TPUA 3DRQB 1H9VA 5J12C 1ZT1B 2X9XA 4BSWA 3S5LA 1IKFH 4AQOA 2AS5M 1I8IB 5BMFH 4XCNA 5FYLH 1A6WL 4ZUUB 1CD0A 4Z7UE 1BIHA 1VGEL 1AY1H 4KK9D 4OCSH 1FFPA 1MQKL 3TYGL 2GIYA 4XNUL 3UJTH 4MMXC 2VZUA 1BD2A 3QCUL 1QO3A 1WFTA 1YEEL 4V1DB 5HVGB 3STBA 1MAKA 2XZQH 2IG2H 1GGYA 4MXQC 4NKDB 5DO2D 3E3QC 3CVHH 4U6TA 5DRZB 2D7MA 5E8NB 2P45B 1TZIB 2YSSB 3OGCB 1G0XA 4P4KB 5J89A 2IADB 2M26A 3QO0A 5TE7H 3OKMA 4Y89A 3FONA 3KNBB 1EFXD 4F37F 4GRLB 1INQA 3PP4H 1A22B 1ZA6B 2C7UB 3EO0B 3GGWA 4GLRH 4ZFGH 4GAYA 1J0IA 1CFQB 1GHFL 2P1YA 4QYOA 3VJ6A 3IAGC 4YBQC 4UT6H 3RDTA 2N56A 4DN3L 1EEZA 1G6RH 3O3DB 1FCCA 1D9KD 4XVTH 1WCBB 3O8XC 4NCDA 4RMUA 2XNAB 4CMMA 1LO2L 3RPIA 2CXKA 3L3HB 4Y5VA 1TZIA 1IJ9A 2YSSA 4TOYL 1FO0A 5MP6L 1KLUB 4HK3N 3RVTC 4JQVA 1MCSA 4LPUA 2WANA 2LU4A 5I73B 3CXDH 4D0DA 4MQ7A 3GK8H 1T20B 2XWJA 3UTSD 2DKMA 2X4QB 3PV7A 4IIQB 5EOCL 3JV4B 5EBGA 1PAMA 1UH4A 1CK0L 1MIEH 4YO0A 2E8ZA 5DJZB 2ED7A 3D39E 2O5XH 3SJVA 3TC9A 5F1OB 3ARFB 4C57C 3ARBD 4ZOEA 4K55A 1XH3A 2NTSP 2AK4D 4M7LT 2A9MH 4QRSB 5IJKC 2VYRE 5BZWB 4OLZH 4BFEA 8FABB 4ZTOL 4OCLC 4J8RA 5ETUB 2F74A 4U6HB 2HG5A 4NQED 1EBAA 4Z0BH 4PB0H 3EYFB 1DBBL 2R0LL 1LNUB 3TM6A 5ISZD 2PW2B 3KPSB 3K8MA 3AY4A 2Z92B 4HIJB 1FRGH 4NQDA 1MI5D 2ARWA 1NCWH 2AK4A 4MJ6A 3KJ4B 4JB9L 4Z77A 5FDWA 3GIZH 2V9QA 5TDPA 5CJQL 5C0CA 3LEVH 1NMCC 2EXWD 1KJ2B 3EO9L 5DF0A 4OIBA 4WO4B 1G9NH 1IAII 2YPLE 2Q8AL 1A14H 2JCCA 2V9RA 5D1XD 1WEJL 4LPTA 5FO7A 1T0PB 3MNVA 3KLDA 5FYJE 4GKNA 4M4PA 1VEOA 2JJSC 3V4VL 2VDKH 2ILLA 1YMMA 3VFWB 1LD9A 5CCKL 1KCKA 1GOGA 3BH8B 1T04A 4LU5L 4KMLB 4PY8J 5DC0A 4NCC2 4RGND 2EDRA 1CBVH 3ELAT 1C16A 4NQXB 2F9BT 3DX9B 4GW1A 3ZKQD 4R7NA 1GPOL 4XH2A 2YRZA 4M7KL 1IGFH 4P2YA 4LSVL 2WWMC 3DV4A 2NY6C 1FFOB 1DFBL 3QUXD 3RIFF 2MHAA 1Q94B 2A9ML 4BH8B 1WBZA 2XKNB 1TTGA 3GSQB 2V5SA 1QLFA 4GUPB 5F1SA 4DGYH 3BEWA 3P73A 2Y1VA 5FYLL 5I8CB 3RVVC 4M1DL 1TJHL 4QF1B 2GAZA 1R3HB 3RU8L 5EORL 3VRLE 5C0EB 5MEPA 5EOCH 3L7EB 4TYUA 4NRXA 4N9GA 2O5ZL 4HXAH 3QI9A 3B3IA 4ZNEA 3N1GC 5C0RH 3TBVB 2HT3C 2VLMD 1IM9D 1HHJA 1OWWA 3C08L 3NH7H 3K2UL 5IFHL 4FQQB 1CQKA 1R3IH 1MLCB 3T0VA 1CLZH 4KRMB 4F7TB 3RY4A 3BOVA 3EJZD 4GRLD 3KYKL 2AEPH 3MUJA 3HMXA 3I6LD 5DJ2A 5C0EA 1E4XI 3D3VB 1FG2A 3TA3D 2AJZA 4H8WC 3T3ME 1MCJA 2QADC 3SJVD 1QBLH 1LO0L 2VITA 4S10A 4YXKL 2FX9L 3OKLA 3Q48A 3WKML 1RIUH 5EO1B 5DYOA 3N1FC 2AABL 4PJ8D 2QQKH 4LVOB 1QBAA 2JCCE 4H0GA 1KENL 2WBJD 3T0BA 1KT2A 3QWRD 1A4KA 4F7MB 3EOAA 2V7HB 3V5HA 2J3SA 3QG7H 3CPLB 3D69B 1WV7T 3ARGB 4ODWA 1P4IL 5L88L 4AEFA 4HKXA 1S7TA 3TO2B 1WIOA 3MUHL 4BUGA 2OMBA 4TPRL 2HVJA 3RQ3A 3AROA 1BWMA 4O2FB 3MRCA 2HH0L 3ZDXE 3IJHA 4JKKA 4CADB 3TFKD 1CDIA 2CGRL 2IWGA 3ZTJH 4C56A 4PGEA 1C5BL 5HI4C 4WDIA 1RZ8A 2Z91B 1SY6L 2W0KA 1J1XL 1IAMA 1HINH 2OCFD 3NIFE 2E9BA 4DUVA 1D9KC 3FTGA 2X70B 4LHJB 5ACMA 5CEXA 2DJUA 2W91A 2VLRE 1ZSDB 4UTBL 3NAAH 2QTEA 4XPGH 3T0EE 3KG5A 4AIXA 5MP6H 3QUMA 1IC5L 2RBLA 5I1JH 4X83A 5L8KB 4Y19D 1JCKA 4B41A 5DRXB 2J4WL 1WT5C 2NZIA 3HS0B 5F9AC 4M7JH 1SJVA 3VWKC 2AV1B 3QIWB 2V2XA 3BZFA 4NQTA 1J05A 5CKAA 4BZYA 1I1FB 5DFWH 3HAEB 2ZOLA 2Y36L 5DEFB 1A7NL 3QDGE 4M6NL 2B1AL 1E4WH 1HZHH 1AY1L 4JDVA 2O61B 1AGBB 1T4KA 4MNQE 2APWA 4NWTH 3K74B 3QO1A 1Z9MA 3QI9C 4L8DA 3UC0L 4Y4FA 3S3PA 4NQDB 5FUCE 5DRXA 2CLZB 5A2JH 3DUUB 3P9LA 3WHXA 2P24A 1YY9C 3G6AB 4JO2L 4LCIL 5TF0A 4QXGL 1OOAA 5ISZE 2R8SH 1GGIL 3SGEH 4N0UE 1BX2B 1C08A 4HV8A 3DTXA 4OUUB 2Y5EA 5AZ2L 3GEWB 4QT5A 1YEIH 3QG6A 1ZK9A 4Z76B 1CFSB 1U91B 2BSTA 3WNMA 5I18H 4JGJA 1AGDA 2CSPA 1OPGH 3S8WA 2ATKB 1ZT4A 4JPWL 3IYLW 1CZ8H 2XA8L 5T1DL 4OIIL 1J11A 4NQCA 3C5JB 5J8OA 2GITB 1U42A 3O41B 3ARBC 1A3LL 4M00A 3BN9D 4RISL 4UIKH 4POZD 2VQ1A 1A4JA 5KVGH 1IGYA 4XCYA 4G3YH 3EFDH 3MXWH 3CSGA 3T77B 2XZCL 3BXNB 1JZ8A 1NC2D 2AK1H 1HOCA 2DWDA 4YIQB 1LEGB 2BXYA 4LNRB 3U7WL 1DBBH 4EEEA 1N2RA 3H9HA 3QH3A 3MRDB 3ZZ1A 2NR6C 2ED8A 1VFAA 3FT4A 1RIHH 3RPIB 3RZWA 2ICES 3F5WB 4K7PL 1XZ0A 2IH3A 2QR0A 5DWUL 1FE8L 3NIDE 1E4WL 1VADB 1A6ZB 3BDYL 5L2KE 2A9NH 4P9HL 4YFDB 5D7IB 4UBDD 1A5FL 1ACYL 5FM4A 2AKRA 5DUML 3ZTNL 4PJGA 1FSKC 3RIAK 4F7PB 2DLFH 3RKDD 4QXWA 1FBIL 1D5MB 1R3KA 2V17H 3ZYOA 3VD3A 2J4WH 4I77L 4XAKD 1LK2B 5GGVL 4KKBC 3NBNA 4ZAKB 5CCKH 5IEHA 4LSTL 4XI5D 2IANA 1U6AH 5HGDA 4HIXH 1H3PH 4WFFE 1DUYA 1T1WB 5T1LD 3LMJH 1HH6A 1B0GA 4GS7C 4JHBA 4LVNC 5TFSL 3U46B 1EGJH 2OTUA 2R23A 1K85A 2YXMA 4TVPE 3VXRD 5C0DB 5IQ7H 3T4YB 3QUZC 3T4AA 4GAGL 1CD9B 3O2DA 5FB8B 4QNPF 1FLRH 4FXGA 4JM4H 5INCB 5DVKA 5CBEA 1INDL 4X6CB 1MCNA 4MCYA 1A6TB 1F97A 4W68A 2BOCB 5H8DA 3CSYB 5CHNB 4FNLL 4G8GD 2V5YA 4NUGH 7CGTA 2P5WD 1SJHA 1KC5H 3BJLA 2R8SL 3HNVL 4WFFD 4YHLL 1JYWA 4MD5A 4N0YL 5TH2A 4P59L 5L6YL 3CUPB 4KK5C 5JUEH 4D9QD 5E2TH 3BZEB 3LKNA 4G9FD 5I9QC 1FN4B 1Y0LA 1MAMH 1EXUB 2XN9D 1NDGB 1ZA6A 4OZGF 2Q20A 4KQ3L 2X89D 5CILH 4J12A 1N5YH 1ACYH 5FGSA 1N3NA 3VMNA 1LP9F 4NNXA 3R8QA 1CGTA 2K1MA 2A74A 5DZLA 1B6UA 2ADFH 1GGBH 3BHBA 3KPNA 3V4PH 5MERA 1D9KB 4UIMB 1IAIL 3QIUB 1ZT7A 4O5LL 1JPSL 1MCEA 5J6HA 3MLUL 4R7NB 1OCWH 5JZ7C 5MEOA 4OV6F 3EFFA 4I1NB 4L3EA 5D1QD 1FN4A 3OGCA 2VABA 4OGYL 1XR9A 2IAMA 5FA3B 4J3TA 3G9AB 1MRCH 3B6SA 1K4CA 4LASL 4WWKB 1B9ZA 4Y1AE 3KJ6H 3P73B 4JFPB 1MHCA 2QSCH 3NFPA 4NRZA 4Z9KB 3B8SA 4FMFA 3HRZA 4C56E 5FYJL 2OK0L 1JGLL 5IIEA 2BSTB 2XA8H 5T1DH 2CKBH 4F33A 3NCJL 3BEVB 4X5LA 3WN5A 3DXAD 4PLJD 4L3ED 5D1QA 1G7MB 4Z7QE 1BEYL 1CLCA 2VKXA 3HPLA 1TVDA 1UADC 2QHRH 4P9ML 4ISVA 3UYOD 5BXFA 4JKMA 3QPQD 4M3KB 3WKNA 4POUB 1SBBA 3P9MB 2R4SH 4PTUB 3DLQR 1IFHH 1HIMH 5D6CB 1FVCA 4JFPA 4LP4A 3PABA 3QI9D 4LCWE 2UZXB 4OCYL 3U0WH 2XTJB 1KCSL 4IDLA 3VI3E 5C2BL 1CDGA 4LQFL 3IU3B 2HWZL 1FE8H 5D2NA 5C0IB 4NP4L 3U2SB 1KG0B 5HSFA 3BE1H 2VLLA 3QUZA 3SE9L 3BUTA 1KTKE 1DSFH 3HZYB 4PLNC 2VZTA 1U8NB 4FP8H 4JVUA 4MX7B 5EN2B 5FF6A 2JCCF 2C3XA 4TSBH 4QEGA 1QFWM 1PD6A 2FLRT 4P5TD 2DBJA 1RPQA 5FOJA 5EPMA 3WFBL 3NTCH 5J1AB 3FQRB 3SDCA 2N1KA 5C09B 2BVPB 3U6RB 4BJLA 2A6DA 1S5HA 5IMKB 4MJ4A 1N26A 1DEDA 2F5AH 1I85A 4A2LA 1H15B 4AIOA 3F7QA 3FO0H 4D9RE 2FR4B 5J7CC 3RTQD 2P48B 1YMHA 1FYTD 3ECBB 2C5DC 1BQUA 3ALWA 1MF2L 3BIAX 4FQQA 4BH8A 4EI6B 3UTZB 4MQSB 5D7JB 2EDOA 4XP5H 3PGCB 2N7BA 4APQC 4NC1C 1VENA 2R2BA 4HLZG 3N1PC 2D7PA 1U3JA 4Q9RH 2DM2A 2FX8L 4GAYB 1QEWB 5AZ2H 4BELD 3TWCH 3H9SA 3GSUA 5DMYA 3DIFA 4HD9A 4R4FH 4WI3A 1R5VA 2E7CA 3VXRB 3SDXF 4OCYH 4NKOA 3VE0A 4UBDC 1QQDB 1SYVB 5EBWA 3GUTB 1A7RH 1XGUB 1D5IH 2XRAL 3MLXH 2GTZA 4Y5VB 1CD1B 3L95B 1NGWA 2IANB 3PL6D 3W5NA 4NUJA 1UG9A 3D25A 2XG5A 1N2RB 3H9HB 3TESA 3N85H 3L1OH 1UEYA 3OAZK 5CWSA 4EDXB 2OZ4A 4HUVA 1CFTA 1L0YA 1QFWL 2ZSWB 4FFWD 4P4KD 1RZJH 2VB5A 3LKOA 1YEDA 2NY2C 3SGKA 3VH8A 4NNYA 3R1GH 3QCTL 2EZ0C 4LVHB 4OLXL 4GAGH 4PRIE 3REVA 1H0DA 4I0CC 1I1AC 4OD1H 1J0ZA 4XB8A 3ARDD 5F1KC 1F4YH 1OF2A 4YHKL 4N9OB 4HGMA 5E4EB 1MRCL 3HR6A 4GBXA 4JM2C 1UQSA 5D1ZB 4QT5B 1FVEB 1DQJA 4LP5A 2C3HA 2E9IA 1LO2H 1WF5A 2OSLB 4IRZH 4UNUA 4OAWB 4UILL 2ED9A 2BNQE 1J1XH 3TO2A 3NIGF 3ZMRA 3U48A 3RL2B 4DQOL 4HXBH 4PJCE 4GMTL 3H7BB 2ICEA 3MXVH 2CK0H 4UDTA 3GBNL 2XZAL 1FCGA 5IG7B 4U49A 3O8XB 4PR5B 1UKQA 3QWOB 1JNLL 1CGYA 4WIQA 3S9DB 3KHQA 1LEGA 4QLRA 4NNPL 5JXAL 5F7UA 2YD1A 1Z9LA 4WWKC 2DIBA 5GS0D 2AI0H 1ADQH 1WC7B 1S7XA 5DQDL 5KS9A 1HQ4A 2VZ3A 4HKJB 4DEPC 3VFWA 5I1KH 5L2JA 3FO0L 5DUPH 1T5WA 2H6PA 2C26A 4HJGA 4D0CA 3TVMC 4AH2B 1B6DA 4MJIA 4S2SA 2CDEA 4M5ZL 2QEJA 2HJFA 4EI5D 5TGBA 2NXYB 2XQYG 5B8CB 2R1YB 1RHFA 2CR6A 1CTNA 3EOYG 3PWLA 2EC9T 4K8RC 1CXEA 1T0NA 2ICWI 3LEVL 5HDLA 3UJIL 1OB1B 3IETA 4DCQB 3U7YH 3IS0X 2YOCA 5EIIB 1CS6A 3LHPL 1KXQE 1OP3H 1B2WH 3B2UD 1R3HA 1YEHL 5DR5H 5BZDB 4J4PD 2P8MA 3SKMA 2HLFC 3NZHL 5IW6B 3QR2A 3EYOA 3KS0H 3WHXB 3ZYIA 3QQ3A 4AL8H 1TFHA 1KPRB 5F7DB 3LV3B 1ZWIA 3H0TB 4JFOA 4P0DA 1LE9A 2K9UA 1RQ5A 4Y19B 1A6UH 4Z0BL 2FWOB 1LK2A 4UQ3B 1JPFB 5I9QB 5JXEC 4U1MB 4H0HB 1V05A 5IVZA 5IB3B 2DJ4A 5E00B 1IGIH 3BGAA 3DV6A 1JGEB 1WBYB 4UT9L 1MHEA 2G75A 1RUML 3I2CH 1U8KB 3DGGB 1OAXH 4Z6AT 5IB5A 1BIIB 3UBXI 2RCSH 4IDJH 4WEBH 5B38A 3MX0A 5SWZE 3GFUA 5F7NC 4PJIB 4YPGB 1A6ZA 1FL5A 4F9PA 4KQ4L 2ORBL 2CKBL 1FQ9C 1BD2B 3E8UH 4UUJA 4JAMA 1ITBB 3X12B 4NM8L 4GW1B 4BZ2L 1QD0A 4J1UB 4WHDA 4YIQA 4OZFB 3AREC 3FONB 3KNBA 4P99A 5CP7B 2BX5A 4D2NA 2V7HA 3V5HB 3IU3A 1KJ2H 4MNGB 1D3CA 2X7LA 4Z8FL 3VXQA 3MV01 4LLAA 4TUOA 4G6MH 3CCHA 1KPUB 4GRWB 3VJ6B 3DSFL 1MFNA 1UWXH 2VLME 4CVXA 3GI9L 3HNTH 5EU4B 3LZFH 1R0AL 4PJ5E 3T0XA 1NCNA 3HC4H 4N1HB 4XPFH 3QNYA 2Z35A 1UA6H 5E70A 4G80A 5I1AB 1QR4A 3MRHA 1UWEL 4QXGH 3U9PL 4CVZA 4ELME 4IRSD 3P11H 2JELL 3PIQA 2V5MA 3KYOA 1FVDA 4NKMB 1NFDB 1UB6B 4U1GC 4U1NB 2NW3A 4KY1H 3O3EB 1EO7A 1PKQB 3FRPG 5GQBA 4IIQA 4J3WA 4X80L 4JFHD 4LHUG 4LKCB 2AEWA 5C0AB 1GOHA 5B4MD 1JWSA 4X4YB 3QFJD 2A6JA 1XAUA 2J88L 4HT1L 4GXVL 1NFIA 4OF3A 1HHKA 3VXMD 2FJGA 2EEAA 3S34L 1F58H 3QZWG 4N0CD 2HLAA 3WFZA 5IOPA 1TENA 3LQZA 1II4E 2QKIA 4LARH 4P59H 5L6YH 4G7VH 5B3JE 1ZHNB 2BVYA 3T8XB 3TJEH 1DANU 3LEYL 3WFDL 2CKBB 4PY7A 2HTLC 3MSPA 2W07A 4XXCC 3UYRH 3CDGB 3ES6B 4YUEL 3T2OA 4XGZB 2JIXB 3U2SA 4EBQH 1ZVSA 3TT1H 2VC2H 4LCCB 5JLZB 2HVKA 3OPZH 4Z77B 4WENB 2W9LA 2X4OA 2P5EA 3NFNB 1BZ9A 3PHQB 5L2KA 1IQDA 5ACZB 4WU7B 3RX8A 3QQ4A 4MA1C 5FHBH 4OF6A 4X4MA 2VH5L 4F9PC 4J7RA 3VXNB 5DMGC 4CU8A 4YDVA 3WLWC 2YD9A 3DHJA 4RWYL 3TA3A 1KTRL 1D6EB 5IROC 4KAQH 2VOTA 5GZOD 2AQ3A 4D9LH 3RHWK 4FQHB 1NMBH 5FCUL 2HA1A 3OJVC 1F4HA 2A1WL 1JGUH 4WW2B 3FB6B 1BFSA 5CZXC 1ZHLA 3VXMB 1QFWI 1ADQA 1GAFL 4K9EL 4U3CA 1P4LA 1KCUL 2V5TA 1FIGL 3QFJB 4WV1C 3MA9H 4FFYH 4KTDH 4FQIL 4P2OB 3L3KB 3ULVL 2X89A 1BJMA 4KV5E 3WDHA 1D5XA 2VNCA 1K2DB 1I4FB 3O3BB 4HIHB 2HMIC 4X9GA 3K4ZA 3EO1B 5EO9B 1Y18B 3BKCH 3B8YA 4WHTB 3G6AA 1XT5A 4F9LC 4H25A 4CMHC 5I1EL 1SEQL 3FMGL 3KPSA 1LE9B 3UDWC 3VGDA 3C60B 3H8NA 4XRCB 5CGYD 3BVNB 4LDOB 4ZPTB 4XBEH 5I1KL 3EHBD 4H26A 1JNHA 2OBGA 1U8PA 4PIRF 4PV8B 3IFNH 4DUWA 1FZMB 4F58H 3WEXB 3M1BA 4XHQA 2WV3A 3GMNA 2EO9A 4PRPB 1ONQB 2EO1A 3CFCH 3QQNA 4QRTA 4RFEB 1UH3A 3U4EB 5IWLA 3NGBB 3QUYB 1AGFB 3HG1B 3K0WA 3MGAA 1AD0A 1UM6H 4JKLA 3LB6C 1BJ8A 2EDJA 5TDNB 1PQZB 5I19L 4MD0A 4KUZL 3HI6H 5FCUH 5AAMA 2JB5H 1A3RH 3C60A 4XRCA 5C08D 1Z3GL 5HD8C 5FKAA 2ZCLL 1HIML 4IRJA 4C83A 4OCMC 2Y07L 1BVLA 2Q76A 1T1XA 3S88H 2N7AA 4I18A 1UEMA 4XVUD 4E41B 3RVWD 5JPMA 1SVCP 3GZKA 1QFOA 1JRHH 4OSUL 3B2UC 2UVFA 1D5BA 4DTGL 2YN5A 3BIBX 3UTQB 2H8PB 4YBQD 2VH5H 1LGVA 2Q86A 3G08B 3L3IA 5GZND 4W4NA 1IEAB 5FECA 3K46A 4RRPA 1NGPL 2WW8A 4ODXB 3O2WH 3E6FB 3Q2CA 5D71H 3MRLA 3GSOA 5FYKU 4K3JH 5I8KH 4YBLC 3WUWG 4HS8H 4W4OC 3LMJL 1IC5H 4EUPA 4JJHA 1P84J 3NABL 1IGJA 3BKJH 4E9LA 3RPKA 4MNQD 3CPLA 3B9EA 1EEUA 4LHQB 1AXTL 1G9MH 4JN2B 5H94B 3P4NA 3VI4E 4GBXB 1WK0A 3UTSA 1E4XH 2YD7A 5GS1A 2F5BH 2X4SA 1NKOA 3MRQB 4Y4HD 1A2YB 1O7VA 1H5BA 4LLVA 1ZLVH 3E6FA 2VLKB 4PJEA 2XZQL 3MRCB 2XY2A 3S37X 3GJEB 2PXYA 1MFBH 2AXJA 2FX9H 4EQ3A 3GKWH 4ZUWB 3OX8A 3I9GL 2H3NB 4U0RC 4MD4A 5TDOB 4P2QA 4MXWL 3QG7L 4WWKD 4ZMAT 4ZUVB 3GHEH 5HDQL 2HT2D 1ERNA 3C6SB 3X13A 4ZNCD 4ZAKD 3W9EB 3OHXA 1VESA 3BPCA 3MJ9A 4MYWB 3W0WA 1V7MH 4TNWF 3WSQH 4LEXL 3MRIB 4P57B 1MHEB 2G75B 4LPVA 3BRFA 3B5TA 2HP4A 1M71A 5F9JA 3ARVA 5IESH 2GYSA 1B90A 3NCFB 3LKPB 5E8PA 4OF8A 5IB4A 2YHGA 1JNJA 4QHKI 5E8DH 2R39A 4PJHA 4Z8FH 3HI1A 1BFTA 4MJ5B 1EMTL 1MI5A 3GSQA 3MV9E 5LG1A 2Y7QB 5BRZA 2VDRH 5MEND 3SDAD 5CINH 2NW2B 5CSGA 5T3XD 5C0BD 1F6LL 5IMMB 4PJCA 1R3JB 5I74B 5D5ME 2PR4H 4LLUB 3L7EA 2O5ZH 4BK5A 5DD6A 4HKJA 1KSRA 2VE6B 4YXHH 4TUJB 4BQ9A 1S9XB 1IFHL 2XWTB 4NSKB 5LCVL 5KS9F 4Q6IA 3VWKA 1WAAA 2A9NL 4P9HH 5HVWA 4FTVD 4RX4A 2OQJB 1CDUA 2P8LA 1LDPL 4O2CB 1HSAB 2FX8H 5F8QC 5FECB 5I6XC 5JW4R 1KLGB 4LAJH 3SOBH 1AC6A 4LOUC 5IVXF 3DO7B 43CAA 2XPGB 4HQQL 1KB5L 1PLGH 3IDGB 1F11B 1A14L 4WI6A 1LO4L 5J9PA 1TIUA 3BH8A 3GNML 3PXJA 1J9CT 3PWUA 1UJTA 5DMIL 1QO3B 1N59B 5B21A 5C08B 4R3SA 2VDKL 2DKSA 5ADPH 1P2CA 3P4MA 1L7TH 3GMPA 4QRPE 4KI5C 2QHLA 4TQEL 3EYUL 3QDJA 4GRLC 5GSRA 1A1OB 1CVRA 3P4NB 4G7VL 4NKMA 1F2XK 1WUNT 3O3AA 4LCCC 1TZHB 3JTSB 1JVKA 3DO7A 3FQTB 2QADD 3RRQA 1INEH 4KXZI 2ZG3A 2J2ZA 2GCYA 1S9VA 5HDOA 2HWZH 1UENA 1U9KA 2A0LC 4Z7UB 5BRZD 3QZWA 5C07B 1DBML 3MA7A 4OI9A 2WP3O 4YX2H 3CU7A 2MCPL 5GHWL 1ETZB 1YNKH 1H0DB 5DJCA 2LV4A 1ZHNA 3L3JA 3L5WA 4BUHA 4Z78A 1NDMB 1P5UA 3HE7D 1U8IB 3MJ9H 2PF6A 1I7UA 3DPBA 5BW7C 2WWKT 1PW3A 5T1MA 3SCMD 3SE3A 1TJIL 1A1MA 2Z93A 2RHEA 3BUYB 5D7JC 1P7KA 2CIKB 5LVEA 3JV4A 1ZLWK 1SJEB 1WZKA 4C56D 4ZS7H 1F3JA 3QHFH 3SDDB 2NXZC 1HILA 1I9IH 3KYMB 2F54B 3MLTA 4LSSH 1KBGL 4G9DA 4JRYD 4NQSB 1U6AL 1JGVL 3TBSA 5HYJA 2R15A 1R3JA 4MLSA 5FOBA 3KWWB 5ID1B 1NFDA 1UB6A 3MBED 4RBPK 3IDJB 1RZJC 5HPMB 2Y07H 1DANT 5T1KA 3MLVH 3QEUA 4GJTB 3CCHB 1MSPA 2J88H 5AG9A 4HULB 2H3NA 4ZFGL 3CFJA 4PRHA 1G7QA 5TE4L 1U93A 5DD1H 4WV1A 1QSEA 3EDFA 5ABDE 5LGHL 4LCUA 3ZDYE 2HYMA 5EZJA 4LVHC 4R0LA 4G6AD 4HK3J 2OYPA 5EU5B 4OKDA 4PFEA 2SEBB 1NAML 3P2TA 5IBLD 3QUKA 1AC0A 2ZCHL 3P11L 3FAXA 3UTSE 3WUWA 3QH3B 3Q5YA 4URTB 1JNNH 5IHLB 1VKXB 3MOBL 5E94A 5LBSL 4XVJL 2CRMA 2ZG1A 4N8CL 1FVCB 3JWDH 1FL6A 4NGHH 4QRRD 5DK0A 4LLWA 3RA7L 2GT9B 2NQCA 3T65B 1S7VB 3KPRE 1QFUH 1RIVL 2FATL 1FGVL 3FO9A 4XXDB 3FMGH 2NY6B 4PRHB 5H35B 4JFXA 4EXPX 3SDXE 1MUJB 4OFPA 1RZKL 3W9DB 4YDLB 1XCTA 3KLAA 1U58A 4JRYB 5I2IB 2NY7H 4PJDE 1OGTB 5EUKA 3WFCL 1N4XL 5IB3A 3P4OB 3C5ZC 3RKPA 1OLLA 2RR3A 1P7QD 2BNRA 4YFLF 4P2OA 2ATKA 4U1KA 1H3VA 4K3HA 4FFZH 3DI2B 2BOBB 2XN9B 4X6DB 5C86A 2YMXH 1I7ZA 1KB9K 2AVGA 1LO4H 2MQCA 2ZSVA 4FS0A 4WWKA 1BJ1H 3A6BH 4X6FA 4BZ2H 3B6SB 4KRNA 2HKFL 2VJXA 1M71B 2H32A 4JFXB 2HVKB 1OTTC 5F9JB 2ESVE 2WUBL 1LILA 4HS3A 2HFEA 5FCSH 3PGDB 4YR6B 2FH6A 4HUNB 4R4ND 3KXFB 4Y16B 3TVMB 3VD4A 2VXQL 5LWYL 5T3ZE 1T89C 4OGAC 5D7JA 4DGVL 5LGHH 1NUGA 1T1YA 2XIDA 5B8CC 1CGUA 1ZT4B 1KB5B 4AEEA 1XCQB 3RJDA 2DM4A 3TBYB 5J13B 1T0MB 1O7SA 5DJXB 5HD8D 3D0VA 4G8EB 4YHYC 3RI5K 3CMOH 3OSKA 4OFIA 1BJ1J 3HLAB 4P3CH 1ZANH 2R4SL 4Q74A 2B5IB 4PJAE 3J8F7 1VGKA 5DD6B 4YEFA 4OGZA 4XCYB 5I76B 5I15L 5EA0H 2IMMA 1XGTB 5FKAB 4M61B 4P5TB 5IP4A 3MJ7A 1BD2D 4E5XA 5ESAA 1GIGL 1HYSC 5GS1C 5IK3A 2L7JA 5HHOA 4FZ8L 4X7SL 4NYLA 3Q6FB 5DJXA 4ZG1A 3OR6B 4ZODA 4XZUB 5KSBA 3I3DA 1CGXA 5MEPB 1BBDH 2CIIA 3PWJB 4TNVF 3QDJD 1QYGL 2VR5A 4HG4J 4KI5E 2CMRH 2WLZA 1Q9OA 4HHAA 3PDOA 4F57L 3UPRA 5T5FH 3PWUB 2EICA 4Y5VC 3OKNB 3BZ4B 3E2HB 1ULVA 4G6KH 3MOBH 2VQUA 1KLFA 2W60B 5D1ZD 2HJKA 4ENED 4QHMB 3SGDI 3ARZA 3ECBA 1MRFH 4L8SA 1KACB 5C0FA 2KZ1B 1DUYB 1T1WA 4PJFA 4EOWH 2P42B 3MBEB 4HF5L 3JVGA 4YBHA 4YHOL 2ZUQC 1TETL 4X4ME 3PQYE 2ZOKB 4U6XB 3WXWL 4XHJD 5I1IH 2JJSA 3PDOB 3B9KA 2H1PL 3MA7B 5FGCB 1E4XL 2XICA 1VFOA 3FZUC 5E4EC 4G6ML 5A3ID 2VDLH 3QPXH 4HUWA 5F9OL 3MRMB 5I16A 4CJ1A 1CDYA 6FABH 4XX1E 1M7IA 1OAZH 5DJ6B 1H8NA 5I1JL 3FQWA 5DMKB 1EFXA 3OKMB 5C0BA 3MROB 4PGDB 5CWSB 4HUUA 1MCBA 1BVKB 1XGQB 1K4DA 1CF8L 5D71L 2DMCA 2X4SB 5JOFB 3MV8D 5L0QB 3JWOC 4LAQH 2R2BB 3QXUA 3BRGC 2EE6A 1OT2A 3B9KB 4PJDA 1HHKB 3LSOB 5IMLA 3VRIB 5I30H 5IW3A 4RFOL 5F7LB 5F88B 3WIIH 3SE9H 4LLMB 3B5HA 3T0ED 1IAKA 5E0QA 3ISWA 2DQJL 2ICWB 3L3KA 1GC1C 5KVEH 2FB4H 4FFVD 3STLB 2FEDD 4XGZA 4YDKH 3C6SA 3X13B 1CFVL 1X9QA 3PWNB 4NCC1 4RMWA 3MUZ1 4XTRD 3ZHLA 4PRBA 5IBLC 2ITCB 3GB7A 1YNKL 5C3LD 4L5FL 3LV3A 4OLYL 1O5DT 1CGVA 4EOWL 3ARQA 5ISZB 4OCSL 5HHQA 3CX2A 5K59E 4Q9CA 3PJSA 3FQUB 4HUXB 5BQ7A 4J3SA 1E6JL 4PG2C 3RZCD 4MVBD 1T7ZA 1V7NH 3IFNL 3WEXA 1LO5B 1VFBB 5M7QA 2EDFA 4BZ1H 2NW2A 4JY5L 2H45A 3QDME 3PHOB 3V8CA 1ORSB 1XF4A 3DWTA 4O51A 4HPOH 2C1OB 3OR7A 4X5WB 5T1MB 4ZPVB 3QI9B 4FG6C 3MACH 2VDNL 3NPSB 2AK4B 4M4RA 4K94L 3L5WB 2FHCA 1Z9SA 4QTHA 1DDHA 3EZ8A 3WL9B 1CZ8L 5JW5A 2ESVD 3ALPA 5ILTL 1JPSH 4CU6A 4NIKB 2H9GA 1HK6A 5I8EB 1BFOB 4QWWD 1QRNE 3MRGA 1SHMA 2APVA 3BGMA 2EE3A 1BOGA 4QRSA 1RFDL 1NSNL 3UBXB 3QNZB 2D31B 3GMLA 4OCNC 1NEZB 3WDJA 3U0WL 3A0OA 1H8SA 3BP7A 3QXWA 2FGWL 4N8VG 1MIEL 4Y0GA 5E2VL 5C09D 2R69L 5C9JA 5I1AA 5I8OL 4IRJD 2EDXA 4F80A 1ZWIB 4JFOB 1N6VA 5A16B 4CNIB 1RULH 1OP5K 1IQWL 3EOAB 1E0OB 2HN7A 2YK1H 4CKVX 1MFAL 4JJ5B 1Q9WB 4J6RL 1PGRB 1UJ3B 4KK6D 5IHUL 3BGMB 1I3VA 1QLEL 3WFEH 1S7TB 3DGCR 4HBQA 3NVQA 4ZNEE 1HYSD 1AIFA 3MPCA 3UJJL 3HZYA 1EHAA 1WICA 5I1GH 2FO4A 1W72B 4JRXB 4DWHA 4ZO8A 3GRWH 4XP1H 3G6JF 3KPMB 4KKLD 3ARFA 3C2AL 3MQIA 4PJGB 1QHPA 2YPKB 3IDIA 3BDXA 2WAHA 4IRJB 1ND0B 5EOCJ 3SDDA 4L4JA 3RUGB 5I1HL 4Q0XH 3UTTB 1KPRA 2HFTA 1ZEAL 5IEKA 2ZKHL 3JWOH 1V7ML 2PUQT 4Z7NE 4BKLA 3S4SA 2F74B 1YNTA 3MROA 4JZNA 4JZOB 4MS8C 4NOBA 4NUJB 3FJTA 4PGDA 2DLEA 5HHVH 3LEXB 3G6JA 4ODUA 2ZCLH 1JTTA 2OP4H 5C0NC 1VCAA 3BQUC 4S1DC 4JFFA 3ILPA 4JFEB 1QR1A 1N6UA 2DDQL 4GBXD 1J10A 4G6FB 3C8KA 1NSNH 3QIWD 2I5YH 3OB0K 1PVHA 1U92A 4MNHB 1F3JB 3MFGB 4BQCA 4GO6B 3GMMA 2OMNA 4ELKA 4FQLL 1UVQB 1P4IH 3OKEB 4E42B 2BSED 2AJ3B 4PJ9B 2DD8L 4PGBB 4U1HB 4YH6A 1AGBA 1T4KB 3C2SA 3OMZA 3IETB 4LSRL 2KL6A 2BVEA 3EYSH 1H3TA 1CFSA 1U91A 2CMRL 5D1ZA 1ACZA 1AHWB 1M7DA 2XZCH 3SEPA 3TIDB 1QBLL 4I0PA 1QLFB 5HHNB 2W0PA 5HXMA 1ZV5A 3H0TA 1IKNA 4NM4H 3DROA 3EYQC 3O6ML 1EO8H 4F7CB 4BYHA 2PXYC 4V1DE 5MERB 4R4BB 2ICWJ 4L3CA 1M05A 5T3XH 5GGRA 2OXHA 2JB6B 2EIZB 3EFFB 4HJJL 2VLLB 4G9FB 4TUKH 1AI1L 1XF4B 4LSPH 2CKBA 4P9HC 4PY7B 4CJ0A 3GHBL 1JTPA 2R56H 3W82A 1S7WA 5JW3H 1RZKC 1X5JA 3VW3H 3HC0A 4YHPB 2FSEB 3MUGA 5EO0B 3GMRA 4HWBL 2B4CC 2E3VA 4NO2A 5BV7C 3CFJB 4S0TD 4KVCL 4K3DH 1NC2B 4JFFE 5KW9L 3TN0D 3ULVE 3DV6B 7FABH 2K3TA 4LLYA 4P2RB 4HKZA 5DMJB 1D6EA 2ZUQB 3ULUH 1UYWL 1DVFD 2Q87A 2CPCA 4YX2L 1KIRA 1MOEA 4QXUL 1UM5L 4J8RB 1QVOA 4RMTA 4P4KC 1FZOA 1R3LA 2DTSA 3P9LB 1MCFA 3DUUA 2FL5B 5DD3H 4XBEL 1DL7L 3DI3B 3G5YA 2A77L 3BSZL 5IW6A 1YEHH 5DR5L 1RUKH 2XWTA 4NSKA 5KVDH 3G6DL 1TLKA 4NN7B 1FGNH 4QTHB 3VXRA 1EJOH 4JHAL 2FEDC 4Z7VE 1ZA3A 4XB7A 1JWSB 1HCFX 2NY6D 3OG6B 3MLYH 1A02N 5H35A 3GSRA 1JPFA 4Z5RA 5JIIA 1CE6B 1RJYA 1YY8B 4ODWB 2VDOL 4CDHA 1PKQA 2CJUL 2NX5B 4NKQB 3H42L 5IK3B 4MX7A 5EN2A 3FO2A 2UUDK 4TTDC 4Z95L 5IKCA 3B9KC 4GSDL 1JMZA 5DA0B 1C5CL 5AZEH 4JDVB 3QHZL 5DZOA 1LE5B 2C4FU 3FQWB 3V4PL 4M03A 4OFDA 4OIAA 2FZ3A 4DAGH 2PYEE 1R5IB 3K81A 3QDGB 5E2JA 4OLUL 3MR9A 4F9LA 4I2XA 4BKLB 4OCXH 2MPAL 1EERB 4ZUSA 5FO8A 4P23D 4QHUA 5E8OA 1I8KA 2QBWA 5KSAB 3PGCA 1Q94A 4FZEL 1YEGH 2CR3A 4MNGA 4ZFZB 1W72L 1LP9B 5ANMA 1QSFE 1UKTA 1VB9A 2EH7H 2X4TA 3QUMH 4XMPL 4Y4KB 4YHNA 3WHE0 3O3BA 3EJJX 5I0DA 2IQAB 2BVOA 5JHDB 1QBML 4HMDA 4OT1L 4Y5XB 5KOVC 1A4JB 4QWWC 2PYEA 3X14A 5F96L 4TNWK 2ARJB 4H5SB 4PRIB 2FECI 2W9DH 5EBMB 2IBZX 4JY6A 2D2OA 5AYQA 1CN4A 5EU6E 3OKOA 4Y4KD 9CGTA 1KPVB 5HGBB 4LBEA 2AXHA 4R7DA 5HYQA 1GRWA 3SKJH 3UTQA 3F58L 4ALAH 2VR4A 4XWGH 2R0KH 3L3GA 3QCTH 3QSKB 3T2QA 3EGSB 3IFPB 3O11B 4YAQA 1I8MB 4IMLB 2CLRA 3M8OL 2QL1A 2BNQB 3OX8B 1XF2B 1D9KA 2EDQA 2IGFL 2V2XB 5DGQA 1MJ8H 2NCMA 4CVWA 3QEGL 1JV5B 5FYKE 4HHAB 5JMOC 4KRPD 1FFRA 2MKWA 2Q1EA 4KY1L 4EJ1C 2DM7A 2PN5A 3TYFB 5D7IE 1LEKB 3OL2A 4JO4H 3VH8G 5CEZH 5IBUG 4XP9H 3MLWH 4ODVH 1NGYA 1RFDH 5HJ3B 4XP6H 2J8HA 2HKFH 3BPLB 1DBMH 1I8LC 3V0WH 1J18A 1ES0B 3A6CH 5CLWA 3HC4L 3RZCC 4GSDH 3UJIH 3HMWH 1IKFL 3V52L 4CADA 3SE8H 2OL3B 3ARDB 3K7UA 1XGUA 4KK8D 3V6BR 2AJSL 4HZLB 2L7UA 4EXKA 3GM0A 5ICZA 3DO3A 4N1CA 4I0PD 1OGAB 2XQYK 5DJYB 4MCZB 3BW9A 3EYUH 2G9HB 4JFED 3CK0H 4OZGA 1KULA 5ITBL 2VABB 3MCKB 1RURH 3D2UA 4P49A 3MRPB 2NYYD 3TBYA 1BGXL 3O2VL 3LPWA 2DQHL 1NGQH 4QY8A 4YHZH 1KNOB 1G7LB 1KFAH 2IFFL 3PWPB 3T1FB 3THMH 1CDCA 5DJZA 2P24B 2AI0L 2P43B 2ZP0T 2NR6D 3EYVA 2G5RA 1MUJA 1XGTA 3F7YA 4QOKE 4OI7A 5INCA 4YHMH 1ED3A 3DVGA 2WMPA 2I26N 3GMOB 5KANI 5FKPB 4HH9A 4NHUB 1MCQA 4ZQKA 2VLRB 4R8WL 3GBNH 2EDYA 4GKZA 3VD7A 1OD9A 3CFBB 3C5ZB 1BOGB 4ZO9A 1OTUD 3TN0C 1NBYA 1UWXK 3CSPA 3Q6GH 4OM1H 3VD5A 4PLJC 1ZLVK 5E7BA 4XPAL 2BOCA 5GRXG 5B4MC 1C12B 1S9XA 3RFZC 4ELMA 1IGJB 1DQLH 1K9TA 4NPYB 1CXHA 2PW1B 4DK6A 1CICD 4N0CC 1HHIB 5HYIA 1FFQA 5D70H 2J5LB 3SPVB 2XXMB 4ZFOB 3T2PA 4LGSB 4WY7H 4IJ3C 3WN5B 3JTTB 3SDAA 2EXYD 4MNQB 1RSFA 4PB9H 4UZGA 2DKUA 1IC7L 1FYTE 2HG5B 3PV6A 4F3FA 3L3IB 1KB9J 5JIHA 3MGOA 3W9EA 5HYSG 4M5ZH 5DHYA 4NZUH 3REVB 3IDUA 1QQDA 3GSWA 2F58H 2YWYA 1PYWB 5K9JL 2FRGP 4HCRA 4NN6B 2XG4A 3BXNA 3GHEL 3VFUB 5SWSA 2ENYA 5TF1H 1JZ2A 3QDHA 1E4JA 1WCQA 1T2QH 4ZAKA 5GRJH 3SE3C 1OP5H 2JJTC 4PJ5D 3UTZA 2NX5A 5GS1B 2ADFL 3BQUA 1RIUL 3RDTB 3QUZD 1MFBL 4PGJA 2O5YL 3RVUD 1FAIH 4ETQA 2ITDB 5GGUA 3LPFA 2F5BL 3TCXA 1XF5A 2NZ9C 3IJSB 1RVFL 1EEYA 2DQUH 3ZT6A 4BFBD 4JFZH 5HDBF 2BVQB 1RHHA 4JHWL 1MF2H 4MJ6B 1TCRB 3B9KD 3K80A 3V5KB 1REIA 3HNVH 4MWFB 5CMAB 1L7IL 5FYLE 4NN7C 1WBZB 3BAEL 4JVPA 1FVDB 4HS8L 3ME0A 1BQHG 3AM8A 2WNGA 3TBTB 4K3JL 1INQB 3QUZB 2E6QA 2KUTA 1YEFH 2DAVA 1UM4H 4N5EC 2OJEA 2X09A 5AWNL 5EUOA 2YZ8A 3RL2A 2VDQH 1VERA 2GSIB 4XP4H 5TDPB 1UKSA 3ZKMC 1CF8H 1S7RA 4PUBH 1AKJD 5GRUL 5CJXA 5TFSH 4NO2B 3AS3A 3KLHC 1KJVA 5EORH 5JQ6H 5ISZA 3B83A 3VFVA 4ZD3H 3TCLA 1QKZL 4LCYA 3HZVB 4TSAH 3HUJA 1URLA 4MGXA 4GG6B 2F19H 1IEBB 4R26H 3DNKA 4U1KB 3OKKA 1K5NB 4NC1E 5F7MC 1F58L 1KIRB 3V4UL 1PY9A 2H1PH 1EUTA 4MB5A 1DQTA 5DUMH 3ZTNH 4CMHB 1V3LA 5FGBA 3TPUB 1GH7A 1NUNB 4TSCL 4L8BB 3AFLA 1SBSH 4DKEH 1SJXA 3IAPA 5FDWB 3O4LA 3S5LG 2UV3A 4JFYB 2YC1B 4LSUL 1HN1A 1VHPA 4F7CA 1LWRA 2A74B 2WINA 4YHML 4Q6IB 3O6LL 4HBCH 2AERT 2EKJA 5E2UH 3V79C 1RZFH 1DVFC 5EH1A 4YZFF 1QNZL 4ZYKB 3RP1A 2DQIL 1A8JH 5JA8B 3U7WH 3VDCA 2VUYA 4YGVA 3TN0A 5DQ9B 4G9FA 1SEQH 4Y5XC 1KCRH 2DLHA 2EDEA 1N8ZB 2B4CL 4PBWD 4OLWL 5HHME 2AV7B 4X0KA 3ARPA 3H9YA 1KEGL 2XI9A 2Y5TB 1IMHC 2X4QA 4S1RL 4OFYD 3VG0H 3RWIA 4QYOB 4LFHD 1MHCB 4OIIH 1WWCA 3G04B 5F8RC 4Q2ZB 4M9PA 4K8RH 5IJKA 3X3FL 1GL4B 4YDIL 4YDJA 1MHHB 1I4FA 2VXTH 3BEWB 4K9EH 1DBJH 5EA0L 4M43H 3FN0H 1QSFA 4KI1A 1NL0L 3D5OF 3RWGB 3MRFA 4BFGA 1WCBA 2FYYA 1NC4A 4Y1AB 4WFGD 1NLDL 4OZIA 5LGKA 1BQHA 3OKLB 1Z6JT 4D9LL 2F53A 3MMEB 4M61A 3V7MA 1ND0A 5IGXH 1ZTXL 4KU1A 1OAXL 3VGBA 3QEGH 4WU7A 3KJ4C 5CP3A 4XCFL 3D3VE 1A7NH 1FC2D 1I1YB 1QSEE 4JLRB 3PNWA 4ZFOL 5IB1B 2EDKA 4P5MB 3U30B 1H5BC 3UO1L 4LDLB 1HKLL 4FNLH 4KH2A 2HT2C 1DLFH 4NUGL 4PV9A 5E7FA 4HC1H 2IH3B 2QR0B 3DRTA 4LSQH 1TPXB 2AQ1A 4HFWA 2OR7A 2YD3A 3Q6FA 5CD3B 3LQAL 5LAXB 1MEXH 1U8NA 4CN4A 3QDAA 4JY4B 4U0RB 4CU7A 3ARDC 3VFTB 2ADGB 4WHYG 5IM7A 4GRMA 1N0LA 2D0HA 1JPTL 1QSED 1T5WB 2H6PB 3CK0L 4MD4B 3S3JA 5EDXA 4PRHD 4Z7VA 4RAVA 1UWGH 4UTBH 3PL6C 3BZFB 3O4OB 1MEXL 3ES6A 1CT8A 1UB5B 1LNUA 2QQNH 4MAYC 4DW2L 1UQSB 1AE6H 3NACL 4NKIH 4PJBA 4PRNA 1TETH 3ZYZA 5EZOL 5L7XH 1FGVH 3T09A 5IB5B 1DP0A 2BSRB 4WI8A 1BLNA 2D7NA 3RZCA 1TJGH 4F2MA 3SDDD 4EN3D 1KUMA 4PJGF 3MV7D 3W9DA 1FFPB 1E6OH 3TT3L 1T1ZA 4Y5XA 3DIFB 3L5HA 3EJZC 5SV3A 3WLBB 3AVEA 3GBML 2C3VB 3VXUA 3IDXH 5LGJB 1MREL 1FNSL 1HHHA 3TA3C 5HYSA 4MDIA 4KTEL 2GJJA 1KT2B 4XPHH 1FH5H 3UPCA 1ZGLA 4I4WA 4AMKH 4WTWA 1MAJA 1LO0H 1S5IL 2AK1L 3D25B 3RUGF 4U1IB 3WJJC 3O4LE 2EECA 5A40E 4OLEA 4F7EB 3F6LA 5T1LB 4YK4C 1F8TL 4MB4A 5K59F 1I7RB 1FDLH 5ACLA 1NJ9B 3QJFA 5KJRL 3DTXB 4OUUA 5HHQB 3JXAA 5DS8A 3I50L 4X99A 1C7SA 1N6QH 1G7PB 3EDDA 4N0FA 2PTUA 3CVIL 3LS5L 1OVZA 1HILB 1YEKL 3MRMA 3UPAA 1BAFL 2QADB 4GRWE 3HUJE 5H2BA 1FIGH 4WI9A 4D3CH 2IANE 4M6OL 4OZHE 4M1GL 4GQPH 3ZKXC 3RWFA 5DVLA 3RWJB 3RWGA 4XHJC 5CD5D 3MLZL 3GSXB 5I0ZA 4LSDA 4XMKL 3TIDA 4P3CL 1I3RB 3QEQD 4B5EA 5DHVA 3ZE2E 4PRPA 1FV1B 1RMFL 1U8JA 3ZLQC 1F4XL 4MZ2A 3BIKB 3FOLA 3UC0H 2ZZUT 1WWAX 1G7JA 5E8PB 5FXCH 4BQ8A 3HR5B 1NCBL 3KDMB 3IU4H 3W39A 3KXFD 4RDQF 2EXWC 3O81A 4DKFH 2QQLL 1A3QA 4LKCA 5C0AA 4XNXL 1DJSA 5DEGB 4GKSA 3VFSA 3ARSA 5C7XH 1RJLA 5T1KD 2IBBA 4FHBD 1MY5A 4X4XB 4BQBA 3PV6B 4P46C 5DFVC 1QOKA 4ODBD 1GPOH 4OM0H 3L5XH 3U4BL 5I71C 1ZLUH 1OTSC 5KVFL 2W59A 3C09B 2Q7YB 5GGQL 5DMGD 1CICC 3GSVB 3L6FB 4HJJH 4MAYA 4GQ9L 3SKOA 1S7VA 1C12A 4AQ1B 5ILTH 32C2B 2VL4A 3LKRB 1MCWM 4H20L 5JW5B 2DRUA 3V6OE 1J0JA 2YKLL 4LRNH 1BZ9B 5L2KB 3AU1A 5SX4I 43C9A 1N6QL 5JQHC 2DQTH 2BVUA 1WITA 3BP4A 3V52H 1YUHA 1CG9A 5FV1L 2GI7A 4HKXB 4NFDA 3PWLB 3MLPA 2LU7A 1FNAA 1IC1A 1NEZA 2Y6SC 2BNUA 3R06A 5DQ9A 4MXVF 3WD5H 1KELH 4EDWL 3SJVE 1F6AA 1I1AB 4MVBC 4QO1A 3NFPB 2ADJA 5F44A 1N3NB 2DWDB 2P7TB 1FNHA 1MCOL 2ATPA 2FDBP 4NP4H 2FEEI 4QRUA 2WIMA 3K1DA 2FGZA 2MOVA 5KSBF 2QQKL 3RWCB 1C5DA 1AIFB 3S36L 3SQOH 4XBPB 4TSCH 4J3OC 3RWHA 2X2YA 1ZHBA 1FG9C 3QEHA 4TRPH 1JK8B 1AO7A 3CX5K 1MVUA 1HYRC 1LEIA 3L3OB 3VXUD 4P23B 3HZVA 3V0AC 3CLFH 4UINH 3MV11 4GLRI 1VGKB 2YD8A 4FQXC 1MQ8A 1RHHB 3VWJB 1R3IL 4WO4D 4E41A 2WQRA 4TOYH 4HS6B 1A1NB 3C5ZD 4FXKA 1XR9B 4NO0A 1YZZA 1FZMA 1MLCA 4OLXH 5HTSA 1CXLA 4NQCE 3TBTA 1P7KB 4Y2DB 5C6TL 3KJ6L 4R90L 5D1XA 4XVUC 3LIZH 4IHOB 2BHYA 2IPTH 2CGRH 3O3DA 2FNBA 5LAXA 1AGFA 3HG1A 2B2XH 3BH9A 4U6YA 5ALCH 3PP3H 5CBEB 3BAEH 4FZEH 2JKXA 1HQRA 2YPKA 4PJ9C 4HFUL 2YBRA 4XMLH 1NCTA 1NFIB 3I2CL 3ROOB 4XPAH 3SDDC 1PYWA 3K4AA 3MV7E 1B4JL 1S9YB 4JDTL 3DUSA 3LDBB 2Y06H 5I1IL 1YQVH 4R7DB 4WJ5B 3CUPA 2V7NB 4YXLH 3B2VH 4I0PB 5HHNA 1KJMA 1UJ3A 3G9VA 2WZPD 3UTSB 3KYOB 4U1NA 2YWZA 2W9EL 5J1TC 5EC1B 3NPZB 2VDML 4JFQA 3FQNA 4ZDHA 1BZ7B 4I2XE 3H7BA 1P1ZA 5T5NG 1S9KC 4Q9RL 4KK5D 3ZO0A 1MJUL 4GH7B 4X7TA 4FXGB 4FTVB 2O93L 1U3HC 3BP7B 4ODSL 4U1JB 2AEQL 1NCDH 5DVMA 1KLGA 1TQCC 2XYCA 3W2DH 4PG9B 3X3GH 4KZEH 2IJ0C 1XGYL 4POYA 1IGMH 2OM5A 4AIZB 4KHXL 4MB3A 5IEHB 1D6VH 3OHXB 5KG9A 2C9AA 2IAMB 3DUHA 5C0RL 4JY5H 2Z93B 4OZ4B 3NTCL 1CFNB 3CH1B 4HIEB 3CZFB 2BXZA 4TUJA 1YN7B 5DJDA 3WUZA 2BVPA 1IBGL 4JFDD 2DQIH 5JPNA 2JK5B 2IBZY 1JE6A 2ESVB 1WLHA 1ODAA 4RBPH 4PGCA 4NPYA 4N0RA 5EO1A 4OFYA 2GK0B 3KXFE 5FUZH 4P46B 1T6WA 4P5KA 1F5WA 4XNQA 4QRQA 1KXVC 3MRBA 1MJJA 3K8LA 2VL5A 5F21B 4P2OD 5GIRB 2BHZA 3NZ8B 5EIVA 3KWWA 1W72A 4JRXA 3UTOA 3BN9C 1R5IA 3LKNB 4WCYH 1X6LA 5CS7A 1ZE3C 4PRID 2X1QA 1KGCD 3WJLC 5DHVB 3MLZH 4R2GB 4MA3A 1MJ8L 4TULL 2QJDA 4Y88A 4YJZL 5DJ0A 4UQ3A 4XAKE 4P9MH 4UOJA 1LMKA 1WIPA 2CDEB 4ZPTA 5A16A 1QA9B 4K8RL 1U2CA 4XNMB 5DC4B 1IZKA 1P5VA 2CUIA 4MNHA 2DQCH 5F9WC 4QRPD 3WLBA 1BM3H 3HI5H 4OD1L 3RNKA 3VXRE 1MNUL 4P2RA 2Q86B 1KLUA 1FP5A 5CAYB 1K2DA 4M5YH 5IVOA 3BO8A 1EGJA 1HEZB 1JF6A 4HC1A 1L7IH 2FEEL 3FQRA 1ETZA 4QRPA 3WIHA 4B7LA 2AXGA 3BP6A 4R97C 1JGDB 2VIRA 3KHOA 4W70A 4AH2A 2E27H 3C60D 4MAYD 1DE4A 3UTTA 3P77B 4CNIA 2NY4D 3WJJA 1OCWL 5FIEA 3VWKB 3IB4A 4P5TC 1C1EL 3WXWH 4KGLA 5FA3A 3O6LH 2C7UA 3ZKND 2CRYA 4BSWB 4M93B 1EFXB 1KG0A 1TZHA 2J5LC 2X4NA 3FQNB 1GOFA 1ONQA 4U4BA 3UJTL 1Q0XL 1XZ0B 1I7ZB 4AYFA 4W6XB 2XOTA 1OHQA 1FNSH 1V3KA 4A2MA 4HWZA 3BYYA 3IGAB 1Q8MA 4M62H 4N5UA 3WE6A 5HVHC 4JAMB 2Y72A 4KQ3H 5GJSH 2VTFA 2LU3A 2VIRB 2P5WA 4XP5L 2GY7B 3CVHB 4EVNB 3OAZH 4JEGB 3CXDL 8FABA 1A0QL 3I02B 4AEIH 4TSAL 1S3KL 1C8PA 5I73C 4JGMA 3QEQA 4PJ7A 5IVXE 3E2HC 5JHLL 4NQEB 3WV0A 4PJCB 1JBJA 2QSVA 2NNAB 4ORZC 4IIQC 1CFTB 2ZSWA 2GITA 1XR8B 3BX7C 4IHOA 2W0FB 3QJHA 1UM4L 1VFUA 2VDPH 4PJBF 1P7QA 4HK0A 2FD6L 2NY5H 3RL1A 2YPLA 4XWOD 2P8MB 3SKMB 5IB4B 4OFVA 3DYMA 3PJSB 3RGHA 4LRIA 4FQPA 4WUKL 1ZAGA 3UBXG 3Q3GA 4V2BA 3F7PC 1PX4A 4WI2A 4TVSa 1T5XB 3HA0A 2DB8A 4A6YA 3QA3B 5J6GA 5F6HJ 3QUYD 3S88L 2DTML 5FYJD 2ZUXA 1FO0L 3CNKA 1A3RL 2UZYB 1FL6B 3A67L 1BVKA 1XGQA 1YPZE 5MHSE 1YYML 3MNWA 4Z7OE 3UEZA 4HF5H 2A73A 3OF6D 3S35X 5FM5M 2H2SD 2I07A 1CFQA 1U95B 5FUZL 2QHRL 5I1CH 2VISB 3IXTB 4U05A 3L9RB 4FQCL 1KN2H 5K9QG 1MJJB 2F54A 3FB8A 3ETBF 1SMOA 3MFFA 3V95A 5T33H 1N5AA 3TZVB 5IJVB 4M6MH 4OZFH 1B2WL 4QXTA 1S9VB 1QRNA 1QRND 3UZEA 1N0XH 4RX4D 3ZE1F 5GZNC 4I4WB 4PJ9D 2A6IA 2RGSA 4JM2B 5L2JB 3HZKB 1RK0A 2LVEA 1S7XB 3WDIA 5KS9B 4LNVA 2LAGB 4KKLC 1MHPH 2GKIA 3AXLB 4OQ1A 3PGDA 4YR6A 1IC7H 4GG8B 5CUSL 5KTEL 1HXMA 4JPIB 3RBGA 4JANB 1WFNA 4QRUB 3LKPA 1CIUA 4S1RH 1JHKH 4UAOC 5KJRH 3MYJA 3P4LA 3DETD 4PGZA 1Q9OB 1OAUH 2ARJA 2D9QB 4YDVB 1YEIL 1F00I 3EYSL 5E56A 1R24A 1ZHBB 4UTAH 2BJMH 3ARGA 1BP3B 2GJZA 2A1WH 3V9FA 4IRSA 4L8SB 3A67H 1I1CA 4OAWA 3UDWA 3G5ZB 4GBXC 4I0PC 1A7OH 4JDTH 3BMVA 4ZSOA 4I48A 3S97C 5I1CL 5ESAB 1NAKH 5E95B 2B1AH 3BHBB 3KPNB 3FN3A 3S98A 4I3SL 3W11D 3MTRA 4NBYB 1NQBA 4D0BA 5I6XB 5DEGA 3VFSB 2P5WE 3F5WA 5SX5K 2AW2A 1CDBA 5D1QC 5D93C 3LQZB 1N7MH 5EWIH 2P44B 5D7LE 2J6EL 1FLRL 3BPOC 3MLRH 2IH1B 3SO5A 2BNUB 3WO4C 3BN3B 1FORL 1U3HB 2A6JB 4WUKH 3LN5B