1MRCL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL01
4PJBA 4UTBL 3ZKND 3NVQA 4FQLL 4KJYB 4PFEA 5I1CH 3SQBA 4P23D 5ERWA 2DI7A 4Z7UF 1QRKA 4PRHB 5HPOA 1N3NB 5E2WL 1HE7A 4WI4A 4JQIH 4LCWA 2VDKH 4X99A 3NCYP 4BH8A 5FHBH 5B39G 5JUEL 4HWBL 1W2KT 4QHKJ 4WUUD 3I75A 3W81A 4QXTB 3L3IA 3ZKXB 1JCKA 1QVOA 3GSNA 3DUUA 3VDBA 1M71B 1UJTA 4MJ6B 3K7UA 2EE2A 1C7SA 1NBQA 4DOHB 5TE4H 1HIMH 4R97C 3IJYA 2DBJA 2CLRB 2NX5B 4V1DE 3GMLA 5C3TA 4ZYKB 3SDAB 1RK0A 1T6WA 3TN0D 1FE8L 3LSOB 3CDYA 4NN7C 3TYFB 2E6PA 3DSNA 3LH2L 3GB7A 3WUZA 1VA9A 2CK0L 1IAIL 4P57B 5IOPB 4I18A 4O00A 5B4MD 1RZJL 1OAQH 2ICEA 4I48A 5DRXB 1FNAA 4M62H 1TPXC 1OAKL 4XCCH 5GS2D 1YEHH 4ODSL 4W4OC 4M6NH 3VGBA 1TCMA 2L0DA 5CIPB 1FZJA 2B4CC 3F7PC 1UB6B 5HGAB 3RU8L 3K4ZA 1GGBL 1C8PA 4OAWB 4IDLA 1OAYH 5FCSH 4MQ7B 4QHMA 4CKVX 1EAPA 5C0AB 1FFOA 1DN0A 5K9KB 2CKBA 1KIPB 3OKKA 3TBVA 5J11C 3NCJH 4C58B 5EZOH 2YMXH 4RGNE 3BP5A 2GFBA 4PP2B 2NW3B 4XPBL 5HVFB 2D7TH 3WN5B 5MP6L 1G7HA 3TIDA 1CDUA 3QIWA 3TO4A 1A6TA 4GLRH 5I2IA 3UPCA 3PGCB 3ROLB 5KSVA 4KKLC 3RTQA 4GQ9L 3GDBA 3ULUF 4JRXA 1B0RA 4MQXC 3BIKA 4ZUUB 3NPZB 3T77A 3CFDA 3JTTB 4JDTH 3MLSL 3TIEA 2PW2A 4XWGH 3IU3B 3MV9B 1A2YA 2HKFL 3QUMA 2UZXB 5EIVA 3BP6A 1FV1A 1HHKB 2AK1H 4XZUB 4HKBB 4ZXBC 3HA0A 5C0NC 2X9WA 2DLEA 2EXWC 4RMTA 2FHCA 1MFNA 3P2TA 3TCLB 4ZTOL 1A0QH 1OT2A 1WC7A 3X11A 3ZKMC 1JNHB 4U1MB 5BQ7A 4BQ9A 2VXTL 3CPLA 4LU5H 3MRFA 1VPOL 5CBAB 5D6DC 2ZZUT 1ZXQA 3DHJA 1E0OB 1OSPL 1GGIL 4O2CA 1Y6KR 3IJHA 3JBG7 3L95B 1MHHA 4GBXB 4LSTL 3PGFH 2I9TB 4AH2A 4NQSA 1X6NA 4RRPG 5IBLD 1MEXL 3HRPA 3SKNA 4UINH 1K8DA 5F1IA 3MNVA 4KUZH 3BZEB 1J1OH 1L6ZA 4KKBD 4F7MB 4ONGH 3HC3L 5EPMB 4PG9A 4Z76B 1EVUA 2ARJA 1DQJB 4MCZA 1JF1A 2P5EB 4RIRB 3T2NL 1T03L 2O5YH 3C5ZD 3GSVB 4FRWA 1NAMH 4MZ3A 3OF6A 1A9EA 5FDWA 3MRPA 4N0YL 4XB8A 3AM8C 4J23A 1IC7H 1S7QB 1BBJB 4HS6B 1F4AA 4PJGA 1S78C 1MOEA 3NIDF 3L5WA 2ICWA 4MJ5B 3G9VA 4DUXA 3VU2A 2Q7NA 3T2PA 1G6RA 3BGFC 4JAMA 4N68A 1PEZA 2NXZC 2ZKHL 4ACPA 4OSUH 4QHUB 4AIOA 1UA6H 4HSQA 1PKQE 4YXLL 1INQB 1CIDA 4ELMF 1DQTA 3L3GB 1JFQL 1HK6A 1MLCB 1AO7E 4U1IA 2NTFB 2MQCA 3UMTA 5ESVA 1RJYA 5F21B 4YO0B 2VLKE 1UH4A 4H0GA 3O6FC 4NQDA 2W38A 4NP4H 5E5UB 3SJVE 2FWOA 4L4TA 3UDWA 1NFDB 1D5IH 4X6DE 1A3QA 1OD9A 1HSAA 1TPXB 5E5RB 2DQTL 3PWNA 3FTGB 2HFTA 5ENWA 5M7QA 4YUEH 3CLFL 5I74C 4G9FB 2DIAA 5CCKH 3RWDA 1IC4L 2FIKA 1KB5B 3ARED 1HYRC 5AYUL 2NY7L 3WHXB 1AFVL 1VESA 3PHOA 3T8XA 4Z7WE 3V6ZB 1CXLA 3UTPD 3QDJE 1FH5H 2G5BB 2ZCLL 3MOAL 1CCZA 4WDIB 5D7KD 1BWWA 4HCRH 3RVWC 4ZFOL 5J11B 1NPUA 4L3AA 3TYGH 2YUWA 3D3VD 3EYUL 5L6YH 2HFFB 2Z35B 1KBGL 4IOSD 2J4WL 1Q9LB 3EYQD 4JY4A 4WV1C 4Y4KD 5DI8B 1QBAA 4OM1H 2D7QA 3OKOB 4K7PH 4L9LC 1F2XK 4IRJD 1G1YA 4RFOL 5IM7B 4DUWA 5I8OL 1DLFL 2EDQA 3QFJB 2VXSL 1FYTA 1G9NC 3UROR 4LCYB 3O2DH 1LO0H 1CYGA 4Y2DD 4F15C 4NSKA 4PRNB 4BQCA 3RZCA 1NCAL 1NEZB 3MQIA 4GKZA 4UI2A 4OCMC 4ZFZB 3DMMD 3N1PC 2XTJC 1RZIA 2VLMD 3GNMH 2NZ9C 3OKDA 4MS8C 5EU4B 4BJLA 3HG1A 3GKWH 3WFHB 4FZEL 3AUVA 1KEGH 4YXKL 2CGRH 5HYSB 2R0KL 4ESKA 3WUWG 1T21A 1GPOH 3CSYA 4P48A 2AQ3A 2XZAH 4G9DB 2LABA 4GUPB 1GZQA 4OD2A 1PLGH 4PRPB 2R1XA 1CFBA 5J1TC 5DYOA 2VDRL 5J6HB 2HA1A 2Z4QA 1BZ7B 1JL8A 4I77L 5EO9A 1OF2B 32C2B 3S5LB 5GXBB 3BRGC 3MV8D 1SM3L 3HE6D 2HMID 5E8PA 3LMJH 5DD1L 4XVUC 2J8UE 1KIQA 1DQDH 3WE6B 4NUJB 5D7IF 1W0WB 4D3CL 3GJEA 1U8OB 1TJIL 4XNUL 2YBRA 2R9HD 1EEUA 4LQFL 3MLUL 1E28A 1VSCA 1WBYB 5EWIH 3OG4B 3MLYL 4FMFA 1LE9A 5EN2A 4PR5B 5IG7A 1T66C 2P8PA 5LWYL 2IF7A 2V9RA 3FONA 4I5BB 1KF9B 5HHVH 2OSLB 4Z7QF 1XIWD 3KHQA 4ODWA 5DJ2A 5LJYH 1Z0MA 1OCWH 5GS2H 1HHJB 4XNXH 4JKKA 5JR1L 3BGFB 2NXZB 1H3VA 1AHWC 2R4RH 5M95B 4I4WA 1GAFH 1I1FB 1KPUB 1IZKA 4JRXE 3IJSA 4NGHL 2N7BA 4O9HH 4POYA 4OZGF 3RA7L 5C0RL 3MOBH 3DI2B 3BT2H 3FFDA 2XA3A 4YHNA 1QFUH 3DHMA 3IDNB 2NLJA 3O6FB 4J7RA 4TUJB 1V7NH 1X6LA 3C5SB 1MH5A 4MXVE 1FZMA 5H94A 4PTUA 4E5XB 1QBLL 5IT2H 1KT2A 5GZOD 2XWTA 1T0NB 4M1DH 5ITBH 1VCAA 5EUOF 1RUAH 3H9YA 5H37G 4X6FB 4LEOA 5I74B 1AGFA 4ZSOE 2B8OT 1B4JH 2HJKA 1JI1A 3QQ9D 5AD0B 2PYFB 3IF1B 2X44D 3R06A 2EE6A 4NKDA 1BAFL 1FFRA 4OCRL 4N90E 3V5HA 1A4JB 4EDWL 1KB9K 1G0DA 3GSQA 4NT6B 1AR1D 4LPUA 3U4AA 3TV3L 2YD5A 1EBPA 2FZ3B 2R8SH 1BFOA 1MCWW 3GSRA 4ZFGL 2GSIA 2R0LL 4NN5C 1NL0H 3ZSSA 3P0YL 4GJTB 5D7SL 2IANB 5TQ0L 2HH0L 5D2NC 3WFCH 1MHCA 4WV1B 1F3JB 2HVJA 4K8RC 1NCBH 4L9LB 2XACC 5CINH 5CZKA 3UO1H 1VKXA 3QEQB 4NQCD 2EYRA 1ODAA 2DQDL 1ED3A 2VDLL 3ZKQD 5C2BH 5JPNB 2UY6A 4P2OA 4OT1H 3SO3B 3KXFA 4PGCA 2CMRL 3P9MA 2VAAB 4F15B 1UCBL 2F54A 2EDWA 1T5XB 2IG2L 2YPVL 3DVGA 3Q1SL 4NQUA 3TM6A 5F7EL 1YEFL 1Q38A 1DL7H 5FYJH 4Q7DA 1S7TB 2DJSA 3MJGX 2ZSWB 4AL8H 3RVXD 4PLNC 4HULB 3RWIA 2XTJB 4PJGE 1IM3B 1L7IH 4UDUA 2O93L 2DM2A 4MNGE 3GRWA 4J3TA 2XKSA 2HWZL 3IDGA 4F7EA 2CRZA 4Y4FD 3DOSA 5DJ6B 1ERNA 2AJ3A 4LAQL 2AK4B 4LLAA 5BV7H 2UVFA 1S9WB 4F7PA 3UBXI 1WF5A 5D96C 4GXVH 5FKAA 2BNRA 1JZ4A 4TTDC 1T1WA 3TA3D 4EI5D 4NHUA 4F33B 2PCPA 3TBSA 3ROOA 1MI5A 4ONOA 2IWGA 3H7LA 4WW2F 4OV5B 2E7BA 1TZHA 4F8QA 3KPRA 5EU3B 3CDGA 5T3XH 3EYFB 5IQ9A 4NDMA 3D48R 5FYKD 1MPAL 4HXAH 3UTZA 5J0BA 4WJ5B 3ZDXF 1RZGB 4OCXH 1PG7W 3EYSH 3X13B 3DIFB 2V7HA 3QDGD 5A2JH 3LQMA 2GI7A 1UXWB 2B1HH 2HT4C 3BPLC 5GZNC 1HNFA 1EFXA 1ZVSB 2X1PA 4PGBB 2PYEE 1FVDB 3OGCA 3INUH 5D5MA 5HPMA 5T33L 1WT5C 2UWEB 5A16B 3AU1A 5HHXL 1KYOJ 4X6CF 1A7OH 4APQA 1MAKA 3F7YB 3DUHA 4LK4A 1NAKL 5DHVB 4YC2C 5JW3H 5DD5H 1WFNA 4ETQB 5LBSH 4QY8B 4TVPE 3UTTB 3UXFA 4L9DA 1YJDH 4FNLL 3V79C 2XZQL 5EBMB 2WWKT 4QWWD 3FAXA 4HWBA 1ETZB 4Q58C 5AWNH 5FECA 2YOCA 4LNRB 1XGRA 4P2QE 4P4RA 4KKCC 3G5YA 3P77B 1FYTE 2AEIT 2C4FU 3IAGC 2R0WL 4HKXA 1AHWB 4Y5YC 1JRHI 2PXYD 2E6QA 4L5FH 4PJ7A 1YMMD 1MCOH 1GC1C 4ZDHA 3CU1A 1KFAH 5B3JE 2R1WB 4R6UA 4OKVA 3H3KA 2BCKB 3SBWC 3L5XH 1GCFA 3LCYA 3R1GL 3QG7H 3GHBL 4RGNC 5EZLB 1AQKH 1V7ML 1F11B 3VWKA 5A3ID 2EKSA 3C9NA 3UAJC 5TPWH 5I1KH 5EOTA 1DUYA 1EO8L 2A9NH 4GRWF 1UWGH 5F7UA 4MA8L 4TSCL 1A7RH 1F3DJ 4Y4KB 3C2SA 4X4XB 4BZYA 5MHSD 2GY5A 1CR9H 1AE6L 4ORZC 4U0RC 5SWSB 1P7QA 3QEUA 1A14L 1T7WA 3UJJH 1N0LA 3HI5L 3HPLA 3V4VH 3SO5A 4GAGH 3KYNA 1S5HA 4OZFA 3BKML 4CVZA 4NKOA 5DC0A 1SJEB 4RWYH 1VGEH 3QYCA 1RZ8B 1OOAA 3LDBC 2VWEE 5J8OA 4X4MA 4LGSB 5D2NB 1HOCB 1SVZA 2Q20A 3TNNA 4LCWD 3BKCL 5IGXH 5FYLL 1P4LB 1IFHH 3RVUD 1B9ZA 5EO0B 2XKNA 3G9AB 4FMKA 4FQHA 1J1PL 4OD3L 4N8VB 1XF2A 3MGOB 1NANI 3FOLA 1S3KH 4H8WL 5GGVL 1DCLA 1UZ6F 2VDOL 3WJLC 5DRZA 2NY1D 5D9SA 1UM6H 1SEBB 2GJ6E 4CN1A 1KN4L 3U2SA 3SKJH 1RAMA 1UGNA 3GMRB 4MJIE 1F8TH 4MD4A 4P46D 4KC3B 8FABB 1ADQL 4EI5C 2Q86A 5F7MC 5TH2A 5BZWB 5EB9A 1VHPA 3RL1B 3KLHC 1MNUH 2VMFA 5I8EB 2ZUVA 4CVWA 1H9VA 4URTB 5H8DA 1N5YH 1ZANH 3O2VH 3HTLX 1N8ZA 2BSSA 3VRIA 4F9LA 3CXHK 4UIMB 1C08A 2NZIA 4DCQA 3BYYA 5IV2B 1EVTC 4HD9A 1I3GH 3WKML 3KYKH 5D96B 2YPKA 3P4MA 1CFNA 1K4CB 4FABH 3LKQB 4FQ1L 5GS0H 1DANT 1Q94B 4XXDB 2VABA 4HW6A 5JW5B 2VZSA 5L2JB 4FQCH 3IXTA 5EBWA 1JGEB 2IADB 3P11L 2VXVH 4PJAF 2YPLA 3RJQB 4JRYE 3X14A 1I4FB 5IB4A 3UC0L 2E7LC 3A6BH 2W60B 2Q6WA 2N56A 3OXRB 3I9GH 1YPZE 4K9EL 3LKNA 1N7ML 2QKIB 3BPLB 1W72L 2EZ0D 1X4YA 1KPVB 5HDOA 1U8MB 4DZ8A 4KZEL 3ZLQC 4WTZG 2X05A 5DO2C 5DK2A 4ODHH 3B6SA 1XR9A 2HT3D 4V1DB 5CEZL 4MA3B 3QCVH 3PQYA 5I19L 4NRXA 5D1XA 4PJEA 4Q2ZA 1UACL 3ZDZE 4YC2B 1R5VB 3QIWD 4Z7VA 3MXWL 4O02L 3RY6C 4WEBL 3G6JA 3RTQD 1TETH 1ZSDB 5B21A 4PJ9A 4GAJH 4TPRH 5DFTA 5ID1B 4YEFA 3REWB 5GGVY 5IMLA 4C56A 1XGPA 5JIIA 3RJDA 5CUSL 2WBWB 3B9KA 2R56L 2UUDK 2OTWA 3OKLA 3RAJH 1DBAL 4KHTL 2D03L 4PS4L 4ZNEA 1UM5L 4LLDA 5ETUA 1XR8B 1OAZL 4A6YH 1JK8A 1EJOL 2I9LA 1FO0L 5MERB 2YRZA 5KSAC 1PKOA 1T1XA 4Z95L 4K3JL 1T20A 1PX4A 3QULB 1OQOA 4RGNB 1MHEA 1D5ZA 3RWJA 5D70H 5E2VH 5E4EC 3RWFB 1WAAF 4WHCA 1CXHA 3PGDB 3QRFM 3BVNB 3VRJA 5JOFA 4L8BA 5HHOA 4X83A 3BKJH 1JNLH 1T1ZB 5LAXA 1PZ5A 2WK2A 4X6BA 3BZFA 1NUNB 4JJ5B 4DGIL 2QADC 4HK3J 5HHME 4LPXA 1E4WH 1EHXA 4XC1H 3L7EA 1Z5LB 4IIQC 9CGTA 1KJ3L 4P3CH 5L9DH 3BWAB 1MWAB 4XNMA 5CJOL 4ZFOA 5BOPA 1FGNL 4NCC2 3EFFB 1X7QB 1G7MA 3ULVL 5SWZE 3VD7A 2FBOJ 3MRRA 2KBGA 3MRNB 4AZ8A 5DJDA 3NAAL 4S10A 4ZUSB 2CJUH 1IBGL 2JCCA 1C5CL 5F9WB 5IJVA 1ZVHA 5HVGB 3TT1H 1M7IB 1M7DB 1JYXA 2BERA 1EGJH 3D25B 4YBHA 2EDNA 4PJ5A 2Q3ZA 1P69B 4ZTPH 3I6LD 4G7VL 2FX8H 4Y16C 3U82B 1UKTA 4NKMB 1X5KA 4XPFL 1J88A 2RQ8A 3H3PH 2W07A 2BNUB 5FYKH 1EV2E 1XCTB 5ICXA 4EI5B 1IGIH 1JN6B 4KTEH 2V9TA 5HGBB 2EYSA 3GMMA 3LKRA 3P9LB 3GI8L 3PNWB 4MA7H 4NNPL 5I1JL 2PO6A 5HDBF 4E0RA 1DQMH 1BFSA 1LO3L 4M4RA 5GSRA 2P7TB 5C9JA 3FOMB 2IAMC 3OAUL 3ARYA 5K33A 1U91A 4NQDD 4JKWA 1UFUA 4R7DB 3HPJB 4L4TD 3KLAA 2VH5H 3EO0B 1RQ5A 4IJ3C 1KJVB 2Q76A 4U6VL 4D0CA 2H32A 3FFCA 1JPTL 3K2UL 4CNIB 3VWJC 4HHAA 1MFDL 1DBKL 5E00A 4EOWH 5IHZB 1NLBH 3TO4C 3EZ8A 1D5BB 3DUSB 3V2AR 5E99L 3OTTA 3DTXA 2NQCA 1PKQB 4K94L 1INDL 1WZ1L 2W9DL 1AO7B 1FVEA 4R4BB 1HQRB 3N06B 4S1QL 1TJGH 4WCYL 5C70A 3SDYH 3MJ7B 1IC1A 3VXQB 4LIQL 1T89C 1KPRB 2XFXB 1FYTD 2ZUTA 3D39A 3SJVB 1U2CA 1R5IB 3GMPB 5EFIB 4X6DB 5K59E 3KYOA 1XF3A 3K8MA 5GRJH 2ZCKH 3RZCD 2DQUL 2ZCHL 1R3IH 4HDIB 4CMHC 5BVJA 5K9OA 3RL2B 1UCTA 1EHAA 1TZIA 3KR3H 3LN5B 3SDXF 3HG1D 3MLRH 1CGUA 4ZS7L 4Z7WB 2ZPKH 3QDJB 1I7TB 4RISL 3V6FB 2P5WE 1NEZG 1YQVL 5KSAB 4WI8A 4WI9A 2A6JA 5GS1A 1BEYH 5CWSA 3WS3A 4KK8C 5K9JL 4F80A 1BJMA 4NO3B 4UZGA 5E4EB 2QQKH 3S36H 1YYLL 2W91A 4PJIA 4EN3A 4U1GC 2BX5A 1QLFA 2EEAA 2Q1EA 2X4NB 5HYSG 1GL4B 4JHAH 2DIBA 3TBTB 1TENA 4LCWB 5HGGS 1NMAL 3O3UN 4PBWD 4H5SB 2QADB 3LQZA 1YY9C 3GM0A 3B5GA 4IIQB 1GHFH 4YXHL 3LD8C 4YHOH 1LDPL 3CSGA 2GY7B 2OK0L 5E1HB 2ED8A 3S5LG 1CE1H 2J88H 3O11A 1QVOB 1KELL 5CD5C 2LU4A 5CJBA 4HIJB 1NBYA 3QISA 3TFKD 1O5DT 2O5XL 1NGYA 1DE4B 5IQ7H 2E5EA 3NFNA 1QPPA 4YBQC 4PYHA 3IJYB 3OJVC 1XMWA 2E9WA 1D6EB 2GTZA 3GMLB 5L8LB 3O3AB 1UENA 1RK0B 4PJEE 2NY2C 4ZMAT 4K3GA 2AJXL 5KVMC 1QKZL 3CC5A 2CRYA 1HHHA 5LGHH 4LOUD 2AI0L 4FTVA 2H1PL 2A9ML 4PGEA 4Z7VE 4CDGC 2FECL 1U8JA 2UVEA 3R0NA 1CD9B 1NUGA 4OGAC 5A2LH 1NC4A 2ICEB 4X80H 1DQLL 1I85A 4WU7A 1I1AA 2J8UB 1FG2B 4KUCD 4C83A 4D8PA 1YMHB 2Y07H 3B4NA 3VFWA 4IRSC 3RI5K 5KS9F 2YEZB 4J2XA 4C56E 1XF5A 2ZSVA 4EDXA 4H0IA 5GGRY 1MCDA 3WHE1 4F7CB 5CGMA 4OGYH 5J3HD 2IAMB 5DR5L 1JJUA 1LO2L 4ZNEE 2OL3B 2HLAA 4IJ3B 5DD6A 5SX5H 5ANME 3BMWA 5I8KL 5KAQG 4M5ZL 3TBVB 4EXKA 5GRXG 2HG5A 2BJML 2XN9A 2X1WL 2GJZB 4Z7UE 1QBML 3U36B 3VWJB 3EYOB 1I9EA 1G7HB 1PJ9A 3TIDB 4CW1A 5EC1A 1A7NL 3TO4B 2YWZA 2AJVH 2DTML 4MNQD 4OM0L 5I2IB 2DM7A 4K7FB 5KSVB 4XRCA 1F3DH 5LKNA 4KY1H 1J0HA 1LE5A 4XP4L 3VFRB 1LHZA 5C71A 3O8XA 3CVIH 4JRXB 3BIKB 3OPZH 5FF6A 1MRDH 4X7SH 5EC2A 1KGCE 4OCWH 4U49A 2CDFB 3V4PH 2R4SL 5T5FH 2FX9H 1QO3A 1J8HE 3BP6B 1IGTA 3W9EA 4A2LA 4FQJH 3FQXA 1UH3A 4M93C 4P2OD 3KXFD 1NKOA 2F54D 5GGUB 5DFVD 2AV7B 2JCCE 4CMHB 4TUKL 1L4IA 4I2XA 4ZSOB 2DQJL 1P9MA 4HJGA 3O6ML 1FDLL 3MRFB 3RPKA 4AJ0A 4Q0XH 2VQ1B 4GLRI 2PETA 2EO9A 5L88H 3PV6A 1HYSC 5CZXD 5FB8B 4MSWB 2HFGL 3LN4B 3IJHB 5KTEH 3MNZA 4RAUB 5ESAB 3BEVA 3C60A 2H2SC 4AH2B 1CT8B 4NQSB 5CIPH 2VWEC 2X40A 3SKNB 2BNRD 1R3HB 3EOAB 3U6RA 1K8DB 5F1IB 5KVEL 4R7NA 1MI5D 4MGXA 4HUMB 1ZA6B 3DYMA 4PG9B 5IMOA 1ND0B 1D6VL 3KPRD 4FS0A 3T3MF 3UTSA 1JF1B 4HF5H 1OAUL 4MA1C 5IESH 3QIUC 2C3HA 5FDWB 3MRPB 1BIHA 5FM5O 3MRBA 5E9DE 1C12A 3LB6C 3VH8A 3LD8B 1BZQK 4PJGB 4OZIF 5GIRA 1EFXD 1YDPA 5CP7B 5LQBL 1L6XA 4MNGB 1P4BL 3ULUE 3GSWA 1YN7A 1FN4A 1G6RB 1WWCA 3HNSH 4BZ1H 2JJSA 3SDCD 4HJJL 4XBEH 1D5MA 3HUJF 4PJDF 2Q3AA 2R0ZH 3TVMC 1ZA3B 4MLIA 4YHIB 5IW6A 4PBXA 4H1LH 1A3RL 4KQ4L 1G84A 2NY3C 4O58H 4U1IB 3T0DA 4JANA 4IMLA 1FL6A 5ESVB 2G75A 4JZJA 3VFPA 2QSVA 2R39A 3IFLL 1PY9A 4MAYA 4QRRE 4MZ2A 1CFVH 1JPGA 2H2PC 4HQQL 4D9LH 3HRZB 3T4YA 1KCKA 5D72H 4PP1C 4MX7A 4OD1L 4OCSL 1BX2A 4IRSB 3CXDH 5ENWB 5JXEA 3GIVA 2VIRB 3CSPA 2HN7B 3NZ8A 4QRSB 1H0DB 3RDTA 3VGGA 4ODTH 1T5WB 4HUVA 3QR2A 1K6QH 1S7SB 2FIKB 5DQ9A 4R90H 4QRPA 3LEYL 3T8XB 25C8H 5FUOH 4JG0H 2BNQE 1MAMH 5C0FA 3VWKD 1HINL 1DZBA 4ELKA 1YEDB 4DKFL 3PF2A 4KXZI 3BPOC 3WFBH 3ARRA 2BOBA 3WEXA 3DRQA 1I3UA 4JO3L 5E5MA 2ITCA 4JFEA 1AY1H 5I15H 1RK1A 3F6LA 3MLZL 1FSKC 4JY4B 3MA7A 4P2QB 2APBA 1H8OA 1JWUA 2Q8BH 4GMTH 1P7QD 4EVNA 1FYTB 3ARBC 1IGML 3S3JA 1W72A 4DGVH 4TUOA 2DI8A 4NSKB 4R96A 3ZDYF 1MFBH 2D7NA 1IAOB 4LKCA 2ZWLT 5I1CL 3NIDE 2IPKB 4W6YB 3RZCB 4BFBD 4GKZB 4Q9BA 3OAZH 3FMGL 4B5EA 4JQIL 1FFNA 3EO9H 2VDKL 4JFDA 4U6YB 4Y88A 1U0QA 5FHBL 3CFKB 3W39B 4OLZH 3C6LA 2VYRE 2A0LC 4I1NB 3PUCA 1S9KC 5IROC 1X5YA 5C09E 2VO5A 3CSYB 4OF7A 2AP2A 3ZL4H 4G3YH 3UBXA 4OD2B 2R1XB 3MLWH 5DYOB 5TE4L 1HIML 1RFDH 4RFEA 4FTVE 3QB7C 5FO8A 4NQTA 4DKEH 1FO0A 3D0VB 4OGXH 3H42H 4HWEH 1CD1A 2YZ8A 1MCEA 4PJCA 3KDMB 1QRNA 5F72S 4HKJA 1KIQB 2B4CH 2LFGA 4PJ8C 3GJEB 4CN6A 1VGKA 2YBRB 4FXKB 1KB5H 1WEJL 4M62L 2WQ8A 1E28B 4XCCL 1KTLA 2DQGH 2NY6C 1YEHL 5F96H 3V7AE 2ZJSH 2EIZA 2YPLD 4M6NL 1M1SA 1LK2A 5EN2B 5IG7B 3BIAX 4JN2A 2WIIA 4TNWK 4MA1B 1ZT1A 1WBZA 1OAXH 3QIUB 2AV1B 2GJ6B 4APQC 3FONB 5I71B 5L2KD 3ZE2F 1OAYL 3ZYZA 3OKNB 2ARJQ 4H26A 3PWPD 5AYQA 5T1DH 2BY2A 2W9EH 4O51A 4X9IA 3UJIH 4CADB 2AW2A 3NCJL 3PQYD 2APXA 5D1XD 5EZOL 1R0AH 1S5IH 5ESQB 5EIIA 2AXJA 3JVGA 1SY6H 2CRMA 1IILE 3TVMB 3WSQH 3WV0A 3WS6A 1D5XA 4POZD 2DJUA 4R4ND 2D7TL 3VFMA 3FO9B 2CDEA 2NY3B 3TWCH 3OKMB 4DK3A 3EKCA 3KPTA 4K7PX 4JPIA 1FNEA 4PJ9D 3FFDB 1OP5K 2NLJB 4G80B 5KZCD 3TPUA 5H94B 1MH5B 1RIVH 1FZMB 4PTUB 4NPYB 4JDTL 5F9OH 4JG1H 2DIJA 4XAKE 5DMYA 4XWGL 4Q74A 3SE3A 2XWTB 2DQCH 1YPZB 4HS8H 2EDHA 2AK1L 2MHAA 4NKQB 5C0GA 4HJ0D 3U7WH 2OJEA 1AGFB 4I2XE 3VFOA 2R2HA 3VXRD 1QR1A 3BPCA 4HWNA 1A0QL 2XWBA 3DURA 1J87A 1NFIB 3HC0A 5MEPA 4HPOH 4NKDB 5F88A 1X4ZA 3V5HB 4U33A 5IB5A 3BHBA 4LU5L 5JDSA 4KTYA 5JO5A 5D7IE 1KB9J 1MFCH 4WW1A 3BPOB 1BFOB 5KAQF 3ZE0F 4LNVA 5HHOD 4UOJA 5HI3C 1RIUH 4LSPH 1WCBA 1MHCB 1FSKB 3U30C 5A2KH 2HVJB 3PGFL 5HBBA 1U58A 1HWHB 1KGCD 3VFUB 3VXSA 3MYJA 2VLLA 4WFED 4PLOB 4M8QA 4UINL 3MCLH 3UTSE 1Q9WB 5HI5D 2Z8VC 4KUZL 3DVGB 1U8LB 1DR9A 4ONGL 1RULH 2A6DA 2KDGA 2XQYK 3ZO0A 1E4KC 1QFWM 2NCMA 3JWDC 2E8ZA 5DGRA 5E8NA 4WVRA 2O5YL 5D7JC 2H6PB 3RWIB 2ESVE 1NAML 2IBZY 3MRGA 2OLDA 1IC7L 3IDGB 3AAZB 4F7EB 1S8DB 4KZDH 2AJ3B 4PJ5D 4NO5A 4F9LC 2ADGB 5GJTL 2IGFH 1ZHBA 5TF1H 4M7JH 3VD4A 3P4NA 4JHWH 5FYLE 1LDSA 4F7PB 2CDGA 4RMQA 1UWXK 1VDGA 5I1DA 5FKAB 2BNRB 5GRVL 4JFXA 3NA9H 3CFBA 4ZAKA 3CX5K 4OSUL 1T1WB 4NHUB 5HHMB 2PCPB 1NJ9A 2CK2A 1UA6L 4JVPA 2DMKA 4GH7B 1J5OH 1TZHB 4LDOB 4HWZA 3CDGB 3A67H 2PO6D 2QR0B 4WWID 1OTUC 3HAEA 3FQTB 2FCBA 4KKAC 3UTZB 5IFJA 2WINA 5SWZB 5TDPB 5TFSH 1U8HA 1EEZB 3MODH 5IF0B 5E08H 2V7HB 1I9RH 4QHKI 1A7PH 3D9AH 4NP4L 4PJ8B 1MJUH 4HV8A 3EJZD 4KAQH 4YGAB 4BFGA 1D5IL 2NXYC 4FFYH 1AD0A 3OSKA 3OGCB 5JW4Q 2NY6B 5JXAL 4K3HA 3QJHA 5HPMB 1XF4B 1G0XA 2W65A 3FFCD 5I66B 2A73B 2H45A 3AU1B 1VEPA 2FB4H 3NPSC 1OL0A 5CCKL 3OV6A 4APQB 1DJSA 4POZC 3VI3F 2G2RA 2AEWA 4U0QB 3AY4A 1R5WB 4PRIE 3RNKB 1TVHA 2VR5A 3AROA 4JFEE 4YZFF 4I9WE 1FH5L 3VRLF 4RQQA 4HCRL 5FECB 4IEFB 4WFGE 1XGRB 4ZPTB 3TYGL 1G9NH 4KV5F 5L6YL 3G5YB 2BMKB 4OIIL 5GGTH 1F5WA 1MFAH 4OI7A 4G6AC 2C1PA 2FJFB 3B9KC 4XX1G 3PHSA 4OM1L 2XQBL 2JJTA 3WDJA 1IEBA 4JHZA 4K7PL 4EUPH 4PJ7B 3O45B 3D39D 1JMXA 4OKVB 3HZYA 3O2DL 5F3HB 5TQ2H 1LO0L 3B8SA 2HT2D 2WW8A 5KSBA 4Q9QH 5FIEA 2BSTA 2UWEF 4NFDA 1B0WA 3V5KA 1JF6A 2FH8A 4LVOC 3GMNB 1HSBB 3T0BA 1F58H 1YECH 4XCYA 3VDCA 3C9NB 4WHYG 3GNML 1U3YA 2O26U 4JFYA 3U7YH 1P1ZA 3TJHD 3GKWL 1ZLWH 4RA0C 4GRMA 1DUYB 2XV6B 1KEGL 2CGRL 1CK0H 4OZFH 1JZ6A 3MO1B 5C0DA 4P3DA 2YXFA 3VW3H 4HK0B 4RAVB 2R23A 5IUSA 1OLLA 3MROB 1GPOL 4LGPB 4TULH 5JMRA 3QEUB 2BK8A 4ODUB 2XZAL 2APVA 3G5VB 3HPLB 2RAMA 1PLGL 4EN3D 3TBWA 1CICD 4NQVA 4CVZB 4NKOB 2WZPD 5C0IB 1QRNE 4UT9H 3O4OC 2P24A 4XHQA 3OL2A 3NH7H 3TNNB 1XAUA 3U30B 1IMHC 4UV4H 3RY4A 1GIGH 2XKNB 1KG0B 4FQHB 2A2QT 2BVOA 1DBBH 3FOLB 1DQDL 3HNTH 3N1QC 4EKXA 1R6VA 2DN7A 5DRZB 1CL7I 2WM0A 1QHPA 5L7XH 5DHVH 4JZOA 3VD9A 2DQEH 1S9XB 4IOFC 5EWIL 1CGVA 1I7RA 5EA0H 3BD3A 2XPGB 1EZVX 4QXGH 2P5WB 2F53A 2P8MB 4TTGA 2C7UA 1FCGA 4P2YA 4LEXL 2R1YA 3HHRB 3QDHA 5D7JB 5FO7B 4U1NB 4G5ZL 5TH2B 1FGVH 2Y36H 1T22B 5HHVL 5IHUH 3RGVA 3G6DH 2K7PA 5JA9A 4OLWL 1PFCA 2XYCA 1QQDA 2AJZA 4JFZH 1OCWL 3NFSH 2BSSB 3B43A 2P46B 4N5UA 4XNXL 3MMEB 3H9SE 3NCYS 5EO1A 5C08D 3V5DA 5INCB 4JO1L 4KK6D 1CFNB 3BYTA 4M5YH 5DMGC 4YDIH 3X3GH 1NC4D 4M61A 2R4RL 2VABB 4UT7H 1DN2A 1I1AD 1HH6B 2MNUA 5EBWB 1ZLUK 1HDMA 2YPLB 4N0CD 4O9HL 3X14B 5IB1B 3MPCA 5IB4B 4GRWE 1S7RA 4Z0XA 3MOBL 3CFCH 2Q6WB 3BT2L 3EYVA 5A2FA 4P2RE 3ULUC 3RIFK 1QFUL 3QNYA 4S1RH 4QTIH 1V7NL 2Z31A 4P59H 1WLHA 2BOCB 2NXYB 4X7TB 5IT2L 5DK2B 1LD9A 2BC4B 1XGUA 4M1DL 1XR9B 5ITBL 1KNOA 2VDMH 1RUAL 3PQYB 4NRXB 3DGGA 2XN9D 3RWHA 4PJEB 5C07D 4ZUVA 5C6TH 4Q2ZB 3V0WH 2YHGA 2Q87A 5C6PB 4P99A 3NPSB 1MFEH 1B4JL 4BUHA 3QI9C 3KWWB 3PDGA 2X10A 4HAFA 4Z7VB 1SJHA 3GFUA 4LGRB 3G08B 2C4XA 2D31B 4K8RH 1CF8H 5I16A 1UJ3A 2R8SL 3O8XD 1A3LH 2XZCH 5IMLB 3BUYB 4C56B 4OCNC 1NL0L 2Y5EA 3CIQA 3WFCL 3B9KB 4Z77B 1RJZB 1QOKA 5CKGA 3SHSA 5CINL 3OKLB 4Z5RA 5CMAA 5JQHC 3S4SA 4NOFA 5C2BL 3EOTH 4NKIL 4OT1L 4PTTB 1UC6A 4ODBD 1FC2D 5ANMB 4XBPB 2E7HA 3SOBL 4LPVA 4LIQE 1T1XB 4X7CC 2HLFC 4R2GC 5GS1C 1MUJB 1DL7L 1MIMH 1J05A 5DURD 4BSVA 1HEZA 2D7MA 3LS5H 4AL8L 5ADOH 4FQPA 5CJXC 1VEMA 3VRJB 1OTSD 5JOFB 4L8BB 1JUFA 4KK5D 4PJAE 1D9KA 4LRIA 1A7QH 3HE7A 5DC9B 5BV7L 3C60D 3MRCB 4XGZB 4NM4H 1FFPA 3C8KB 5BW7C 3FB6A 4GXVL 1QFWH 2AXFB 1PX3A 5F9DC 1J8HB 4ZFOB 3WL9A 43CAA 4R8WH 3PWVB 2FL5B 5T3XL 4L8DA 4PB9H 3K4DA 2NNAA 2DYPA 4LF3A 5JOPD 3LKPA 5EBGA 4HXAL 4HZLA 4YGVA 2JCCB 4XVSL 3PXJA 3EYSL 1MVFA 2OMBA 3DECA 2HTKC 4N1CA 4A2MA 3QXAB 1I8KA 1XGQA 5LGJA 2PTTA 4NBXB 4NZJA 1C5DA 3E2HB 1JGVH 3INUL 3VA6A 3EJJX 5DF0A 4P5KB 1D3CA 1NGZA 1SHMA 5E1AA 2FBJL 3ILPA 4RFNC 5DD5L 2EYSB 2OM5A 5LBSL 1YJDL 1X44A 1U8NA 4E0RB 5GSRB 1II4E 4HFUH 5AWNL 1BQHA 1S9VA 1GC1H 4MAYD 4P5MA 3ARDA 1TTUA 1U91B 3DBXA 4MXQC 1CFSA 2Q76B 4JFFA 3GJFB 1ZHKA 2XWJA 3O4LA 4L5FL 4RNRA 5E9DB 1MCOL 3B5TA 1DSFH 1EEYA 3PIQB 4D0CB 1KFAL 1R3JA 2H32B 4Z7OF 4WHDA 1A4KA 1BD2A 2C4FT 4OZHF 3RDTD 3L5XL 1SEQH 4HH8A 2DD8H 1YUHB 3QG7L 2AAVA 4OCYH 4QRPD 1AQKL 4X98A 3CH8A 2VE6A 1NC2A 4KRLB 4S1SH 1F4XL 2UV3A 2AJSH 5I1KL 1OVZA 4NOBA 4JFED 2A9NL 1AD9B 2WSKA 3PHQB 3OR6A 4P4KA 1UWGL 3MOQA 1JHLH 1A7RL 3I02A 5IWLA 3LKSB 4YDJB 3QI9B 1Z2KA 1CR9L 3V6OA 4QRRB 3PJSA 5FFLA 2YXMA 3UJJL 4G6KH 4I3SH 3V4VL 4YDVB 4PJXA 3NZHH 5FA4A 4GAGL 4XNQA 5SWQA 3QPQC 5D1QD 3BO8B 1QTYT 2Z91B 12E8H 2VKWA 1J10A 5CEZD 3PP3H 2V2WA 4RWYL 1VGEL 1EZVY 5BVJB 4PREA 3WFDH 2FEDD 5K9OB 2FGZA 3GO1H 5IGXL 1TZIB 4CAGA 4JFDD 4GKOA 4Y19E 1BGXH 4ZG1A 1IFHL 4G6ML 4AT6B 4GFTB 3L6FA 2BNQB 1S3KL 3QDAA 2VSCA 3KAAA 3D18A 5HDBE 1UM6L 4R2GB 4NQXB 5GS1B 4QRQA 3SKJL 5DT1H 4EEEA 4NRYA 1U8IB 3QUZD 4G8IA 1F8TL 2PF6A 1AKJA 3HCVB 3GZKA 4KROD 3CGTA 4WI6A 4X4YA 5JZ7D 1YY8A 2JK5B 1N5YL 1ZANL 3O2VL 4IMKC 1DLHB 1KOAA 3LQZB 1NCDH 3KYMA 4KJQC 1I1YB 3KYKL 5IVNA 1MQKH 1FNFA 4DVRH 2FO4A 4KRPD 4UQ2A 4FABL 3WYRA 1ZLVK 4Z7WF 1SYSB 1VENA 4FQCL 2F8VA 2VXVL 4QXUH 4OIBA 4NO0D 2IALA 2JJSC 4CU7A 4IOIB 1LGVA 1NBYB 3A6BL 3BI9X 3CCHA 5HGDA 3NFNB 1BVLA 2R2BA 2XT1B 3I9GL 4PJBF 4WTWA 2GTZB 4H8WC 1N6QH 3PDOB 3O0RH 1AXIB 3T1FB 2DTSA 3OHXA 2LU7A 4ODHL 5ECJE 3ULVD 1HHHB 3U7AA 4FTVB 4UQ3A 4FXGB 2MMXA 4LARH 4WHYH 4PGEB 1R3LA 5IP4A 5ABDE 1NAMA 4CMMA 3QO1B 3MUZ1 4WU7B 3QUXA 5D8JH 4C83B 4RFNB 5CGYC 5HYJE 4YFLF 2F5BH 3VFWB 5JXEC 2K1MA 3WDHA 4BQ6A 2VKXA 1XF5B 2VN7A 5C8JA 4EDXB 1TETL 2A83A 5CSZA 4UOW1 4GAJL 4TPRL 1N59A 1UQSB 1TTFA 2V2XB 2HLAB 2VLRE 4PRDB 2E6JA 4XVJH 3JWOH 3K46A 1NDGA 4XMPH 3RAJL 4KK9C 3FB5B 2XN9B 3BW9B 1S7WA 2UZIL 3TZVC 1VFUA 5JHDE 4I0CC 4D0BA 2EIDA 4CW1B 2HVKA 4HBQA 4NZUH 5D70L 3Q6FA 3RKDD 5E2VL 1C7TA 4ZPVB 2EDOA 3O8XB 4D0DB 1OQXA 3BKJL 4WGWB 1FORL 1JNLL 3S36X 4R0LA 1Q8MA 3ES6B 2ZG3A 3VXSD 4XC1L 4UU9B 4HFWA 1BP3B 3FQXB 3C6LC 1R3KA 1JYNA 3FQRA 1FAIH 4P3CL 5L9DL 4GAYA 4HCRA 2M26A 5HHQB 4M1GH 1WWWX 2XA8H 3VD5A 4WW2C 2NY4D 4I2XB 1Z0NA 4HJGB 1J0IA 4E42A 2F8XC 4GW4B 4WFHE 3GI9H 3WIIH 2CJUL 4U1LB 3L3DB 1X5LA 3PV6B 3TT1L 3B9EA 3O2DA 1E6JH 5KS9E 1HHIB 5D7IB 3KGRA 4ZTPL 5ELIA 1RD6A 3HI1A 4OUUA 4U2YA 2FX8L 5F7NC 3PDDA 3D85B 3OB8A 4C57C 1QR4A 4U1HA 1I8MB 1FZKA 5FYKL 3U6RB 4AEHH 4ZAKD 4IS6A 2HKHH 3MRHA 3PWJA 1IGIL 4MXVF 4OLUH 4DOHE 3QPXH 4NQEA 4TRPH 4KTEL 5FYJU 5IMOB 1UKSA 2OL3H 2P48B 4MA7L 4BZ2H 3UTSB 1WCQA 1DQML 4AEFA 1XGTA 5HYFA 4GQPH 4BA8A 4JFFE 1DVFA 3MRBB 4JFHE 1K85A 3LKOA 3VH8B 3T0EE 2ESVB 3RX5A 5CD3A 5GIRB 2VH5L 2CXKA 1AGEA 3DNKA 3QIBA 3GSWB 1FN4B 35C8H 3GSXB 4BK4A 4G8EB 3EGSA 1CLYH 2D7PA 4L3EA 1QYGL 1D5MB 5LCVH 1TQBC 4AEEA 4XAWH 3EO1A 3U9PH 1QNZH 2X09A 4BM7A 4EOWL 4LFHG 5GGQH 5DXWA 1NLBL 2ICCA 1JMZA 5C0AE 2IH1B 5ICYA 5MEOA 1FL6B 1U3HC 1JTTA 4XNYL 2BZDA 3WLWD 3WXWH 1DANU 5GSVA 1TJGL 4QCIA 5BJTA 1LK3H 1P53A 5HD8D 5F9AC 3TJEH 3T4YB 2CRIA 4EI6A 1T7YA 2VERN 1R24A 1ZT4A 4PJGF 3IETA 1BX2B 1B0GB 4Y0GA 1S7XB 1K8IA 3GIZH 2P8LA 3RVVC 3I6GA 4EBQH 1PYWB 4PGZA 3F5WA 5GRJL 2UUDH 2ZCKL 3S96A 3P4OB 1R3IL 3QXDA 3STLA 4B7IA 3Q3GA 3FRUA 1MHPH 3QNZB 2Q8AH 1ACZA 1B2WH 3KR3L 2BOBB 4FQXA 4PRIB 1LO4H 3WEXB 2W0FA 4HBCH 2VQTA 2C1OA 4JFEB 5E5MB 5IEKA 2ZPKL 2JIXD 4RX4A 1RK1B 3TZVB 1FLTX 3T3ME 4OFKA 3QEHA 3MA7B 3MRLA 1JWUB 4N1EA 2JB6A 1W72B 1ZHLA 4JM4H 3RPIB 3BRFA 3BEWB 2APFA 1OY3B 2QQKL 3S36L 3Q6GH 4J3VA 4OZIE 1T1YA 2IPTH 4LKCB 3VGDA 3KJ4C 1TTGA 1EERB 1F00I 1AI1H 4JHAL 3DX8B 2EDDA 1FFNB 3I84A 5BRZE 1NGWB 3HUJE 4PJDE 2GT9A 3GSNL 3O3BA 2GITB 4HUXB 5MEQA 4ZUTA 2R29H 2VLJA 1KLGA 3C6LB 3O81A 4LPYA 1GHFL 5EIQA 5CKAA 3QDMD 1JYVA 3E0GA 4YHOL 3AC0A 1I3RB 1A64A 1CE1L 2N1KA 3B3IA 3BAEH 1QA9A 2J88L 4WW2B 2F53D 1LNUA 4M48H 2RHEA 3V0VA 1U6AH 5DZNA 2BVTA 3VXOA 2FGWH 3MREA 3W0WA 1NGPH 5IQ7L 3FB7B 4RFEB 3MV7A 3RGVD 1QSZA 3MRDA 5HJ3B 3NTCH 5FO8B 1QBBA 2DLHA 1FO0B 2X4OB 1XZ0A 2ICES 2XZZA 1U93A 3DXAE 5ID0B 5LGHL 3NCMA 1QRNB 2HAZA 3CFJA 2I60H 5KOMC 4FFWC 1F6AA 4MD0A 2Z92A 1Q9KB 4WENB 5E8EA 2P4AB 1OSZA 4JCMA 2ADJA 5IBUG 1GGYA 3L5HA 2Y07L 2MPAH 4U6XA 2WIIB 1QPXA 4OGZA 1ZT1B 1WBZB 3STZA 3ZTJG 4OGYL 4KJWC 3H9HA 4TVPH 3SY0A 3VXUA 3ZMRA 1T0MB 3QUYA 3VMPA 2Z31D 4Q6IA 1KULA 2ZNWA 4YEEA 3F7VB 4JCLA 4ZQKB 3T3PE 3GBNH 3SCMC 2A1WH 3U46A 1JRHH 2VISB 4JY5H 5C0EB 3ZDYE 2KL6A 4RBPH 4N8CH 5EIIB 2G60L 5F3BA 4R4FH 1TQBB 4M7ZC 3O2WL 4FFVD 5C2UB 3FO2B 1NH6A 1HWGB 3H9SB 5ACLA 4H88H 4HLZG 3IVKA 3U0PA 4RMSA 2AJVL 1OGAE 3BXNA 4J8RA 2P47B 2JELH 1KTKE 4KY1L 1FNEB 2DRUA 4QF1B 4WWKC 2X7LA 2GSGA 4W81A 3CH1A 3CVIL 1E27B 3OAYK 1WZKA 3FT4B 3QP3A 4CU8A 3OPZL 1JHKH 1MRDL 4X7SL 2YN5A 1G9MH 4OCWL 4GRWB 2LVCA 2EEDA 4GKNB 4P2RB 5T5FL 2MKLC 2FX9L 2QSCH 4ZOBA 4XPHH 5IB2A 5DUPH 4FQJL 4QRUB 1AP2A 1AGBA 3H9ZA 4X9BA 2R2HB 1QR1B 3KPLA 1MCPL 5T1LB 5JLZA 2XWBB 1LQSR 4N5ED 5MEPB 2NYYD 1IM9B 5F88B 3D69A 5GRYA 5CGTA 3ARFC 2B2XH 1T6VN 5DS8B 4KUCF 5EBLB 3AREA 3IDJA 4MDIB 4Q0XL 5L88L 2F19H 4X5LA 3IGAA 1NANH 1WCBB 2A74B 5KTEL 1D9KD 3FQUA 3HE7D 4XXCA 3IFPA 4MD5B 4PD4K 1IGJB 4FP8H 4OFPA 1ORSA 4KKNA 5GJSH 2RCSH 2ZUSA 3VXSB 1MJJB 4YHYC 1WVZA 1LEKB 1QSVA 3EDDA 4HIIA 3ZE2E 2C5DC 3RNQA 3MLTB 3I3DA 1HNGA 4KVNH 5DUBA 1OWWA 1NLDH 3RI5F 3O3EB 3RVTC 2QBWA 4LMQE 4RGMB 4Y2DA 3U0TA 4LHJB 2DYPD 4HF5L 5E8NB 5F97E 3ILQC 4OLVH 4NC2B 3VXPA 5IESL 5DMJB 1K9TA 3BMVA 3GGWA 3WUWB 3QQ3B 4G42B 3T2QA 4YPGA 3AMLA 4WFHD 5EG6C 3SE4A 1NGQH 1SMOA 4NO5B 3MRIB 1FRGH 4WUUE 5JHLH 2WBJD 1FNSH 4I0PC 4WIQA 3P4NB 1A02N 4U1JA 1DBMH 5I1DB 3HNSL 4HK3N 4BZ1L 4JFXB 3T65A 3CFBB 4XBEL 4ODVH 2VC2H 1CLOH 3CVHH 3BN9D 1NJ9B 5I1AA 1EJ6A 2G9HA 3EJYD 3W2DH 2GCYA 4GG6A 3X3FH 5DJZA 4HWZB 5IK3B 4O58L 2LE9A 2XQYG 3BOVA 4TYUA 4Y1AA 2WINB 4DGYH 1U8HB 1G7LA 1BWMA 3ARDD 3BPNB 5TDOB 3MV8A 1CFVL 3HE6A 4N0RA 4QOKA 3HZMB 5CBEA 5J6GA 3O4LD 5D72L 2XKUA 1EXUB 3SGDI 5FYKU 5KG9B 5J06A 1KN2H 2J3SA 5J12C 1BD2D 2YRLA 1KIRB 1JWMA 2J7LA 2BVYA 4ODTL 1K6QL 1MELA 2RFXB 4R90L 4P5TA 4MAUH 1KUMA 25C8L 3L3HA 1VADA 5FGBC 5FUOL 4JG0L 1MAML 1M05A 1RURH 4LLYA 1JGDB 4F2MB 3WFBL 5I1EH 4RMWA 2KQMA 1AY1L 2ZUQC 3QZWA 43C9A 5I15L 3QH3A 4M7ZB 3S37H 5IVOA 2EC9T 1J18A 1JZ5A 4G8GD 2Q8BL 5FGRA 1MY5A 2YC1A 4LDEB 4JKLA 5ADPH 3K80A 2BY0A 3ZT7A 2H9GB 4DGVL 2X4SB 5D5MF 4WWKB 2BSTB 1MFBL 1ITCA 2KPNA 5D2LA 4YR6A 4ONHB 2MFNA 3EO9L 4JFYB 5KN5A 4PJHA 1A6PA 4GRMB 4OLZL 4NUGH 5DK0A 3D2UA 5FO9A 2OJZH 5I30H 4KDTA 4KH2A 4FZ8L 1Q9OB 5C0DB 4P3DB 4XVTH 2R23B 2VL5A 5DJYB 2BFVH 4JDZB 3ZL4L 2APWA 4G3YL 3SDDD 5H2BB 2IFGA 2V5TA 2ADFH 4PJ7F 4XWOD 1T2XA 2EE3A 3KPOB 5FUCE 3TBWB 2VZOA 3MLWL 2KKQA 2DLFH 4WNQA 4PV9A 3WNMA 5JQ6H 4A6YA 4PJFA 2P24B 4DKEL 3E6FA 4GRLA 4YHKH 3L3KA 4OGXL 3H42L 4HWEL 4PG2A 3UJTH 3DX7B 5DEGA 4IHOA 1IT9H 3VI3E 1M6OB 4YHYB 1MSPA 4M6OH 2WWMC 1KXQE 3MRMA 4JVWA 1OW0A 4YZFE 4LLQA 4JZOB 1KB5L 3UPRA 3DETD 1I7RB 4CVXA 5TGBB 2ZJSL 3U4EB 1HH9A 4HIEA 4KV5E 4HPYL 2R1YB 1OAXL 3T04D 2FR4A 4AQ1B 3G5ZA 4YAQB 5IW1B 1T7XA 5T1DL 1QQDB 3U9UA 2W9EL 3UJIL 4XMKH 1HXMA 3VFTA 5DJ0A 2QJDA 5GRVK 2AS5M 3SDAC 5EO1B 1R0AL 1S5IL 2UWEE 3NCEB 5JTWA 1PGRB 3MFFB 5EU6D 3LH2H 1SY6L 2BVQA 4YLQT 3WSQL 3THMH 4S1DD 3CZFB 1AJ7H 1NDMB 3QUXD 4LKXA 5FCUH 4NHCH 3T0EC 3TWCL 4ZO6A 1EGJA 4PBVC 4Z0XB 3CK0H 3MTRA 3EYVB 4LVNC 1MVUA 4WRLA 1GGUA 1KLUA 3VMNA 3ZSTA 1RIHH 1RIVL 4MVBD 1FL3B 4KDVA 5FDYA 4ZO8A 5F9OL 1A6AB 3IDYB 2FX7H 1XH3A 3KPMB 5DSCB 2DQCL 4HS8L 3MRKB 3BESR 4CN4A 4AK1A 1J9CT 3B2UD 3LEXA 1X5XA 3MCKA 4P4KC 4QTHA 3U7WL 5J12B 3S88H 3FB8A 1N4XH 1A6ZA 5IWLC 4S2SA 5BS0A 5I1GH 1I75A 5I8CB 3IYLW 4LSDA 1BBDH 4HPOL 4OQTH 5GHWH 3F58H 2CSPA 4E9LA 1SJHB 3D1MC 1TVBA 3UTPE 1WIUA 4X5WA 5D7KE 1RZFH 1UJ3B 2QQLH 3WIFB 1RUQH 4MMZC 1JPFA 5HYJB 4PGDA 3D3VE 4RZCB 3DO7B 4PYGA 4H25B 1KCSH 3MUGA 4JDVB 4HG4K 2EYTA 1RIUL 2ZUQB 4LSPL 3S6CA 3IRPX 1LO5A 4HGWA 3ARXA 4Z5RB 1MJ8H 2KZ1B 3JWDH 3PWUB 3BH8B 3I3EA 3FQNA 2Z9TA 2B0SL 4UBDC 2BRQA 3DVNB 3MCLL 2FJGA 4JM2A 2VDQH 4PJEF 1RULL 1BLNA 1RI8A 2VXQH 5D1ZD 1VEOA 5TE6H 2AERT 4LSQH 3C5JB 5JHDB 4BSVB 4TNWF 2VLME 3O6LH 1S7UA 4Z7VF 2X1QA 1IKNC 3JV4B 4NNXB 3G6JF 1U8QA 2VXTH 4OI9A 3REVA 4KZDL 2IJ0C 3K1DA 1UG9A 5DMKB 3TH2T 2IGFL 2N7AA 2UYLB 1FLRH 5TF1L 2NY0C 3IKCB 1L0XA 3N0PB 4JHWL 3QUKA 1FFPB 2AKRA 4U1SA 3FB6B 3VXMA 3MACH 4F9PA 1ES0A 3SGJA 1L7TH 4Y1AE 5BVPH 4NQED 3HZVB 3TNMA 1OD7A 5IJKC 3FT2A 1J5OL 3T4AA 3DI3B 1IEHA 3A67L 5AUMA 4DFIA 2NNAB 4LF3B 3MV8E 3LKPB 4OCLC 3HC3H 4HZLB 4YGVB 5TFSL 3MODL 5E08L 1DVFD 1I9RL 4HLJA 4NZRH 2V7NB 2Y1VA 5CP3H 4U6HA 1A7PL 1S9YA 4D2NA 1MJUL 4KAQL 1I1CA 1K2DA 3FAWA 1OLZA 1XGQB 5LGJB 4FFYL 2PTTB 2O61A 3QIBD 1C5DB 1ACYH 5KS9B 1U41A 2ATPA 4L3ED 3O41B 1JV5A 2FB4L 3LEVH 4AENA 4MCYA 1KEMH 1NGZB 1I7UA 3VH8G 3X12B 2GIYA 3ILPB 1OGTB 1QFWI 4P46A 2ZKHH 1G7JA 1MCWM 4PLJC 3DX6A 4KTDH 2EXYD 4L29B 4Y4HA 5I0DA 1S9VB 1GH7A 3QNXA 3IDMB 2YSSA 1G9NL 4P5MB 3SDXA 1ZT7B 4NM8H 4BH7A 3DBXB 5GGTL 1A1NB 1MFAL 1CFSB 5C0CA 2JCCF 4LCUA 2A6KB 3WJJA 1WICA 4JFFB 5DLMH 1IAKB 3SKMB 2QHRH 4JPVH 5HHNA 1ZHKB 2JF1A 3O4LB 5AZEH 5C0BA 1EEYB 1R3JB 3T0EB 3DROB 3LHPH 3MXVH 5TQ2L 1C5BH 5BXFB 4MQTB 5JA8B 4Q9QL 3HKFA 3ARGA 5H35A 4LVNB 1I8LA 5ISZA 4PJHE 3BX7C 4X98B 2F15A 2VE6B 1F58L 1YECL 1DFBH 3I2CH 1NCUA 1NC2B 3OXSA 3U7YL 4F7TA 4FQXD 3EOBA 3VCLA 3PABA 1LEIA 4RX4D 4P4KB 1CK0L 2ZCLH 3OR6B 4ENED 2ZOLA 5IR1A 1EUUA 3OJDA 3FCTB 3I02B 4R0LC 3VW3L 2X4QA 1CFQA 3A0OA 3HR6A 4JB9H 2F5AL 3EYUH 4Y5VA 5EOCJ 1T83A 2FJHB 3GK8H 2GHWB 4JQVA 4JE4B 1VFBA 5FA4B 4PJXB 5ICZA 3NBNA 5FK9A 4XTRC 1DLFH 1Y6MR 1FFQA 2OTUA 1FHGA 2V2WB 3O9WC 4NRZA 4KMTL 5CEXB 1EHNA 1TCRA 3UYRH 4UT9L 1OT1A 3L9RA 3WD5H 2FIRT 3NH7L 3K8KA 2MCPH 4KJYA 4N9GA 4UV4L 2YKLH 1GIGL 4NQCE 2VLJD 4PRHA 1DBBL 3HNTL 4E41A 1RUPH 5IMMB 3DVIA 1BM3H 5FOBA 2FO1A 2DQEL 5EA0L 3QQ4B 5E8DH 4QXGL 1H3PH 4NRYB 2Y06H 1AKJB 2YD3A 4PLKC 2IFFH 4XHJC 3MR9B 2BY3A 2HRPH 3JV6A 3W0WD 5IIEB 1FGVL 4XI5C 2Y36L 4WFFD 6FABH 5IHUL 3MV7D 4K23H 1YEEH 1P6FA 3G6DL 3FO1B 4MJ6A 1YY8B 3C09C 4OTXH 3ZKNC 4Z7OE 4OZIB 3NFSL 5ILTL 3GJFH 2CLZB 1H15A 4P23C 3E8UH 4OZHE 5ALBH 3CFEB 2NY0B 3KYMB 2CLRA 2NX5A 3DSFH 2VAJA 4V2BA 2GAZA 5FYJD 4ZYKA 3BP7A 3CZJA 4M5YL 3LSOA 3HNVH 1SM3H 4YDIL 3TYFA 3RKPA 3MBEA 3X3GL 5BRZB 3HUJB 4PJDB 1Z6JT 5DQJA 3ULUH 3BKYH 4ZUWB 3F7RA 2BHUA 3FZUD 4P57A 1VACA 5IOPA 4J4PA 2IALB 5CEYA 4W70A 1TJIH 4X0KA 5FYKE 4YDLC 1FNGB 3CFCL 1CDCA 3QDGE 1BVLB 3VXUD 2R2BB 3MX0A 5CIPA 3QUYD 4S1RL 3S98A 4WTZA 5HXMA 4QTIL 2VUYA 3QO0B 2YD2A 4PJIF 3LQAH 4ZD3H 4JN1H 3KG5A 2NY5C 5HGAA 4BSWB 2VDML 1ONQA 4MQ7A 5T3XD 3TN0C 4TQEH 5C6TL 1BREA 5D6CA 2DBLH 1QHOA 4RMUA 3V0WL 1MFEL 1KIPA 5KVFH 3DXAB 1W8OA 1K5NB 4CMMB 1TQCC 5DC4B 1NBZB 3V52H 3ECBB 4XX1E 5B4MC 2NW3A 3W9DA 3HMWH 2A83B 2V9QA 3KYAA 4K8RL 1CF8L 3WN5A 5CSZB 1NMCC 4KXZH 1LEGA 1A3LL 2XZCL 3M1BB 4QLRA 3PGCA 5DGQA 1QACA 5I1LA 1BIIB 1Q0XH 1YMME 2FNBA 4ZUUA 5LG1A 3CMOH 4H1LA 3JTTA 4KJPD 4WO4D 3HS0A 1CS6A 1W0VB 1HHKA 1EO7A 4XZUA 4NZTH 4HKBA 2HFEB 2HVKB 2WIMA 2YA0A 1P2CB 1MIML 1ZTXH 2H3NB 3UZEA 4XMLH 3LS5L 5ADOL 5F9JB 4L8SA 3GMQB 2VR9A 5B8CA 2EDEA 1JNHA 1OGAB 5B38A 1KJMB 3CUPB 5CBAA 4R0LB 2X4RA 1A7QL 1WQVT 5MHSE 4ZFGH 1NSNH 3D0LA 4HFWB 2Y23A 2L7UA 1R3KB 1QFWL 2X4UA 4HX1A 1MREH 4PJBE 1QZ1A 4GBXA 4KGJA 4ALAH 2I9TA 4NYLB 1KTDA 1LWRA 2NW2B 4R8WL 3DVFA 1WGOA 3O9WB 3SO3C 5EUKB 1BQUA 1Y18B 4PB9L 1YZZA 3BZEA 4LCWE 4LLUB 5F1OB 2VITB 5F7EH 3RIFF 1XGYH 1DQJA 1C16A 2P5EA 1Y6NR 2YUXA 1SYVA 5DHYA 2WV3A 2PUQT 5FUCC 2Y72A 3OB0K 3HI1B 2GW5A 4OUUB 4YHPB 5E03A 4M00A 5DJCA 4ZO9A 4YFLI 1JGVL 1S7QA 1BBJA 3FRPG 1Q1JH 2XG5A 1A6WH 4Z78B 3N9GH 4HUWA 3JZ7A 4O5LH 5IBLC 4F37F 4NO2B 4F58H 1CG9A 2Y5TB 2J8OA 3C09B 4KKBC 4Y1AD 4HFUL 4P23B 1XGTB 3QHTC 1ULVA 1INQA 1GC1L 3ARQA 4YFEA 3W5NA 3L3GA 1DVFB 1F6LL 1CDYA 1ZLUH 3C5ZC 4Q6IC 2YD1A 1SVCP 4QOKD 5CD3B 3ZT6A 4DAGH 4JFQB 4YO0A 1AGEB 5F7LB 1ZGLA 3HAEG 5J1SC 3QIBB 2OXHA 1DSFL 1JZ8A 2Y6SD 4GKSB 3IAQA 5DD3H 4G6JH 2J8HA 1NFDA 4WUUB 5SV4A 4YDLB 1SEQL 1QLRB 1AIFB 2DD8L 4W4OA 3FTGA 3ZHKA 4OCYL 1QP1A 4P5TD 1UEYA 2ORBH 5C0JB 4KHXH 3MA9H 3P30H 3HLAA 5GS0D 5ICYB 5MEOB 1P84K 4QT5B 1KB5A 5HI4D 4S1SL 1HKLH 3WHXA 5HYIA 1QSFD 2AJSL 4MLSA 5HHPA 5GSVB 3TN0B 2DQIH 2XXMB 2G5BA 4WDIA 4Z0BH 1JHLL 4FQ2H 4GMSH 1TQCB 2I5YH 3H0TB 2YD9A 1ZT4B 2HFFA 4YHZH 3IETB 1Q9LA 3NOIA 4G6KL 1K8IB 2RBLA 2P8LB 4I3SL 4BUGA 3NZHL 1FNHA 4W6WB 3OKOA 3E3QE 2X9YA 5IM7A 1NMCB 4AMKH 3QFJA 12E8L 1CIUA 1DDHB 6CGTA 3V6BR 2P44B 2V6HA 3WFDL 1WFUA 1SY6A 3GO1L 4F3FB 4PRNA 3AREC 4I13B 1OB1B 1BGXL 5I17A 3TC9A 4D9RE 5TDNB 5IEKB 4WY7H 3D2UD 4ZFZA 2DWEB 2Q7YA 5EU4A 2OQJA 2CIKA 3QEHB 1QEWA 3WFHA 3MRLB 4ZXBA 3HR5B 1EO8H 5DT1L 3EYQC 4MA8H 4TSCH 4Y4KC 3OX8B 4IRJC 2IMMA 2CUHA 1PG7H 1T1YB 1A14H 4MNQA 5D71H 4L3CA 4G9DA 1PZUB 2H26A 1JGLH 4Y2DC 4LASH 4PRPA 5D6DA 4GRLD 1HILB 3BKMH 2MCG1 5J6HA 3TT3H 1NCDL 5MEQB 3MV11 4ZUTB 5D7LA 3DMMC 1WWBX 32C2A 1MQKL 4DVRL 1PD6A 3CU7A 3MGTB 1Z9SA 3KPQB 4OUOA 3EIFA 4PY8J 1U36A 5E6ID 3Q5OA 2M2DA 1G0YR 5L8JB 5I1IH 5GGVH 3WE6A 4NUJA 4QXUL 5I9QC 1W0WA 1LNUB 4L8CB 4GT7A 5CZVH 1U8OA 3VXOB 1DTUA 1A6UH 3MREB 1T04A 5MEND 3NIFE 3CFIC 1P7HL 1KTRL 3MV7B 2I07A 2APTA 2ENSA 4AIXA 1N6QL 3O0RL 5GRZA 3I6LE 3QXVA 3VFSB 2ATKA 4I5BA 3OQ3B 3VXNB 3AM8A 1RJCA 1UWEH 3WCYA 5KBNC 4LARL 3WHE0 2EDRA 2ICWI 1YNTB 2Z92B 3HE6C 2HMIC 2X4PB 1IEAB 4KGLA 3DARA 2VTFA 3WKMH 1GXEA 3BD4A 5D8JL 2ADJB 3RWCB 5KVDH 2CO7B 2F5BL 1HI6B 5FM5M 2R2CA 4WEMB 2R9HC 3P0GB 5BV7B 1CZ8H 4OFIA 1AGDA 1I1FA 4LVEA 1BVKB 3SY0B 3QCTH 4NQDE 5E94A 3QUYB 3WBDA 3C5ZB 4Q6IB 1J86A 4L4TE 5ACMA 1FVCA 4QYOB 5HYQA 5F7DA 4XVJL 4HUUB 3JWOL 3QWRA 3IDNA 4TUJA 1XIWC 3C2AL 1JWSA 4XMPL 3C5SA 4P9MH 5I1HH 5F3BB 4HXBH 4PJCF 4OV6F 5BS0D 2NR6D 3U0PB 3SDCA 1Z3GH 2OI9C 3TEUA 4NZUL 4J8RB 3I6KB 5AD0A 2C26A 2PYFA 2D2OA 2GSGB 1FJ1A 2PTVA 5EOCH 3OR7A 1A4JA 4I8DA 4NT6A 3RRQA 2YD6A 2NTSP 3BZDA 3J7HA 2FZ3A 3KLSA 1J8KA 1H5BC 2X9XA 1A1OA 5IB2B 1WBXB 3G5XA 2IANA 2DQHH 1U8KB 5CHNA 1AP2B 1AGBB 4WV1A 4D9QD 4ETYA 1F3JA 3KPPB 4FG6D 1DQQB 1FAIL 5GZOC 3ULVF 3EBAA 3WIHH 5JIPA 1AXSA 2EDBA 4JM2D 3QEQA 1E4XI 2D03H 4M1GL 5JPNA 2XA8L 1K4DA 3MJ9H 1T7ZA 3D69B 5GGTA 3IS0X 3WNOA 5DVLA 1BZ9A 3QQ9C 5BZDB 1U9KA 2RIKA 3AREB 3GI9L 4Z95H 3WIIL 4KI5D 3HG1E 1PQZA 3OGOE 5E8OA 4EUPA 2ILLA 3K81A 4XPAH 1S7TA 2BRRH 1KJ2B 3IGAB 1AR1C 1E6JL 1W0YT 4ZO7A 5KVGH 1CL7H 1T4KA 5T1KA 3D3VB 3IFPB 5E2TH 1TITA 4UUJB 1ORSB 2OXGA 1E6OH 3AXLB 3VXMD 1KV3A 4HIIB 5DJ6A 4M7LH 4TOYH 4AEHL 4U4BA 2AK4A 1A22B 4WI3A 2HKHL 4IRJB 4OLUL 3QPXL 1OM3H 2QQNH 2OL3L 5FEBA 4G6FD 4M7KH 4X6EB 5CJ5A 4Y2DB 1UKQA 2ZOKB 3U0TB 4F33A 2OZ4H 3VXPB 3P0VL 4OV5A 3DMMB 3RVXC 4ONFH 2I25N 2D0FA 5K93A 4YPGB 5DA0B 5K9QG 5IKCA 4WI2A 3WLBB 2A6IA 1RZGA 5F9WC 1C5CH 3X13A 3DIFA 4CGTA 1BVZA 1MCNA 4JREC 2IQAB 35C8L 4Y4FC 5I9QB 1BQLH 2CKNA 1A9BA 1CWVA 3LPGA 1WTLA 3C08H 5LCVL 1QFOA 4Z8FH 3V9FA 4XAWL 3Q2CA 5EOQH 2XG4A 2GCYB 4L4VD 1MCQA 3U9PL 5GGQL 5A16A 4GRWH 3TA3C 3TP4A 1F4WH 3BZ4A 4Y1AB 4P9HC 1BMGA 4Y4HD 5DHVA 1MRCH 1G7LB 4ETQA 4XT1C 3WXWL 4NNPH 3T08A 5EBMA 3MV8B 3HE6B 5C0CD 4LSSH 1CDBA 1CU4L 1LK3L 1ETZA 5CBEB 1RU9H 3FHAA 3TJEL 3LS4H 5J6GB 5J1AA 5C0BD 3P77A 1BQHG 1ZEAH 3GIZL 4NZDA 3CNKA 4EBQL 1WUNT 3ARGD 3GHEH 1CDJA 3FL7A 3ULSA 5ISZD 2R1WA 2JB5H 3KPSD 5CS7A 2BCKA 5SX5K 3QSKB 1M05B 4KQ3H 1MHPL 3T0WA 1J7VR 3F6IA 5L2KA 2Q8AL 1B4RA 1B2WL 4JHBA 1XIWB 1LO4L 2DJ4A 5DVNA 1B88A 3PWPA 4HBCL 4QWWC 3BFOA 5EDXA 1F11A 1UH2A 1P5VA 2IPUK 3AS3A 3W11D 4EJ1C 4GSDH 2OI9B 4FQQA 5I76B 4O2EA 2YC1B 5IHLB 4K3EH 4WCYH 4MNQE 4ZOCA 4JM4L 4EIZC 5KW9H 3P40A 4HH9B 2PXYC 3Q6GL 1JPSH 5SWSA 1X4XA 1AI1L 1FP5A 1AH1A 3KHOA 4HGKC 4X5XB 4TSAH 1SJEA 1H5BB 4PJHB 2R29L 4PRHD 2G5RA 5D2NA 5DK0B 1C1EH 3KXFE 4E41D 5A3IC 4XBGA 2F54E 1M4KA 2AJUH 4ZFFA 4D9RD 2VL5B 4N8VA 2Y7QB 3S34H 3TH4T 2P45B 3BSZH 3MGOA 2DM3A 5JNYB 2AJYH 3VXRA 3FO0H 4J1UA 4M48L 1OTTD 1IGCH 1U6AL 4PUBH 3SGJC 2FGWL 4M7LT 1SEBA 1NGPL 2CXGA 3QXWA 4WNQB 2EDLA 1MQ8A 3GMRA 3IDIA 1HZHH 5E56A 1B6UA 5KSBF 8FABA 3ZE1E 3NTCL 1U95B 3E6FB 4GRLB 1RJLA 4MQSB 4Y8AA 3BIBX 2X4TB 5EU7E 3RL1A 5DEGB 4IHOB 2NX5D 1CDGA 5AAMA 2I60L 2BNRE 3TO2A 1EHLH 3MCG1 3MBXH 3MBED 5IV2A 3GUTB 3MJ8A 3RVUC 1MI5E 4NQCB 1GGCH 4M1CD 4B41A 3UPRB 2J2ZA 1J12A 4MDJA 4N9OB 4CVXB 3KPRE 2MPAL 4HEME 4J4PD 1LDPH 3MZGB 2NY1C 3AVEA 4NFCA 3QJFB 5JW5A 5L2JA 1IGFH 1EEQA 1Q0YH 4P46C 2IH3A 3R8BB 1I7ZB 1LP9A 2W60A 4JGUA 4X8JB 3VFTB 3GBNL 3OXRA 2A1WL 1JRHL 4J6RH 5D5ME 4JY5L 4JREB 4HZAA 5EZJA 4TNVK 1T2QH 3MUHL 4Y4FB 4JRWA 5DJAB 1KPVA 3UCRA 4N8CL 1V5JA 4LHUA 1U8MA 1RZKC 2F74B 4R4FL 2BVQB 2JJWA 4OZHB 2V2TA 3DX9A 4V1DA 4MA3A 4H88L 3PXHA 2R2EA 4LKXB 3MNWB 3OKEA 1WT5A 4YX2H 3E6HA 4I18C 4XNZC 3TA3B 3S37X 1EFQA 5H37H 4LL9A 2JELL 3ESVF 4W68A 4J3SA 1Z9OA 1GZPA 1KLUB 4QGTA 5E2UH 3F65A 1G9ML 1WZLA 5A1AA 5D4QA 3QDGB 5ID1A 4PJ7E 1JYWA 3REWA 4XPHL 4BFIA 1RSFA 2EZ0C 5DUPL 3K2MC 4QRTA 3G6AB 3V4UH 3VFNB 3FB8B 3MV9D 4Y5YA 5BS0B 2HT3C 3DLQR 2BJMH 1XR8A 3QFDB 2CQVA 3GBLA 4EIGB 2B2XL 1YN6B 4BKLB 1WWAX 1IAII 5JPMB 3DJ9A 3QIWC 3QULA 4G8FB 1JPFB 1QSEA 4PGDB 2J1KA 3RBSA 3MUGB 2ZUXA 3QRGH 5F8RC 3RTQC 5DTFA 3RWFA 4X9HA 3E3QC 3PGDA 1LO5B 4ZS6D 4HGWB 1MCRA 5GJSL 2RCSL 2DL2A 3FQNB 8CGTA 3NCFB 1T1ZA 4GBXD 4JJ5A 2PXYB 2KZWA 1FC1A 1YMMB 2FJGB 4JM2B 2VRAA 4KVNL 1EUTA 4U05A 4DN3H 1BLNB 1MCFA 4HIXH 1NLDL 4X4ME 1ZGLP 3BWAA 3PL6A 1S7UB 4OLVL 2B39A 1X7QA 2H41A 3EFFA 3DYOA 4K2UH 4JPWL 2P5ED 1G7PA 1L0YA 1WK0A 5FOJA 4XP5H 4ZUSA 1NGQL 3QG6A 1FRGL 5JHLL 1FNSL 3QUKB 1M7DA 4Q97A 2AKRB 1DBML 3VXMB 3D25A 3WJLA 4XP1L 2ADIA 4ODVL 2VC2L 1CLOL 3CVHL 3NACL 3WNLA 3GM8A 3TNMB 4U1KB 3UTOA 3W2DL 4NKMA 5BOZG 3X3FL 3T4AB 4G6FB 4PJBB 3IAPA 5KVEH 3QCUH 1CICA 5ERWB 1JN6A 1CFTA 4DGYL 4M9OA 3EDJA 3P9LA 3FN3A 4U6HB 1S9YB 1WFTA 4X99B 3MZTA 4BH8B 2P7TA 2O61B 3BDYH 2YWYA 1PY4A 4HC1H 1CLZH 1I9IH 2YPLE 3FKUS 1AGCA 5HDQH 5E24E 1CLCA 1X5JA 3HPJA 2ATPB 4UNTA 1KN2L 2NY1B 4JR9H 3I75B 1TDQA 3EO0A 3ALPA 1KJVA 4AENB 3L3IB 1N0XH 3NIGF 3GSNB 5L2KE 3DUUB 4P46B 4MAUL 1IL1A 3PWPE 1B3JA 1SMAA 4G9FD 5F7FA 3DV4A 4CNIA 4AG4H 5FGCE 3DX6B 1RURL 4ZODA 5JDJA 5IHZA 1EPFA 3Q48A 2DDQL 3QNXB 3PQYE 5I1EL 1KENH 2YSSB 1D5BA 3DUSA 1UEMA 4BH7B 3BD5A 2Z93A 2XI9A 4LCUB 3S37L 1PKQA 3GB7B 3FN9A 4M03A 1A6VH 5C08A 3U4BH 1AO7A 4R4BA 1HQRA 4I18B 4XNZB 4YE4H 3UDWC 5ADPL 1JNJA 3G6JE 3M07A 3MJ7A 4I48B 5HGHA 4DJMA 2VLKA 2VL4A 1KPRA 3ARGB 3QFJD 1FZJB 3RY6A 3SJVA 5GRUL 5ISZB 4YHMH 4KKLD 1CVSC 4X6DA 1RUKL 4LSRH 4MQXD 4HDIA 4QHMB 3EOBB 1EAPB 3LEYH 3VCLB 3PABB 1QD0A 1FFOB 4NUGL 3RL2A 1DN0B 2OJZL 2CKBB 5I30L 2ZOLB 5IR1B 3VXRE 4HKZA 1V3KA 2CIIA 3OJDB 3OKKB 5IFAH 4YPJA 4JFPA 1CFQB 4XVTL 5TE7H 4ZXBD 5C07A 4ERSH 5FUZH 3BP5B 2BFVL 2GFBB 3QDJA 5C0ND 4YNYA 2EXWD 5ICZB 5KSAA 2ADFL 1FQ9C 5A43C 1IQDA 3QIWB 3ZKMD 1A6TB 2DLFL 4OF6A 2KQNA 4FN0A 4NRZB 5HHOE 4WGVB 5JQ6L 3RTQB 2X89A 4PRPD 3ARWA 2XY2A 2X4NA 4YHKL 1B0RB 4N9GB 3RZCC 4NJ9H 3T77B 3UJTL 3CFDB 3TBTA 5D7LD 4WFEE 1IT9L 2VZTA 3TIEB 1IARB 2PW2B 3FMGH 4M6OL 4E41B 1A2YB 3QUMB 3KPNA 4H5SA 1DEDA 3VA2C 3ABZA 3U1SH 1FV1B 5FOBB 3M8OH 2HJLA 4LVHC 2RJMA 2R69H 4IIQA 4Y2OA 4YQXH 1U42A 2XY1A 4GXUM 3BH9A 4PPTA 2DM4A 1WC7B 4Q9RH 3X11B 1LP9E 5GISL 4MWFA 3JV6B 1OARH 5BQ7B 3L7FA 4PJXF 4AQOA 3RHWK 3CPLB 4HIJA 2EO1A 1G6VK 4PJ5E 1DE4A 2IQ9H 1H15B 4O2CB 4XMKL 3QEGH 3JWNC 1D6EA 2GAZB 3O3AA 3BP7B 1S78D 1MHHB 4M3KB 4K3DH 1VFAA 2P1YA 3MBEB 5DQJB 4Y16A 3THML 2MTPA 1Q72H 3JUYA 5INDA 5I0ZA 1AJ7L 4XPGH 5FCUL 2NXZD 2VUOA 3MNVB 1VACB 4NHCL 4JKMA 1JVKA 4JKPH 5CEYB 2EDJA 4X0KB 1WEJH 2J8UA 3CK0L 5LXGH 1FG2A 2ARJB 1YMHA 4MCZB 3R4DA 4RGOH 1RIHL 2YEZA 3P73A 4XB7A 3AFLA 3TFKC 2QV2A 5F89A 1A9EB 2BHYA 3U48A 4F7CA 5I71C 2D9CA 2FX7L 3MJ6A 3QWRD 2IAMA 3O6FD 2X1OA 4GO6B 1ONQB 3QHZH 2OL3A 3FFCE 3I50H 5F6IC 1HCFX 5D6CB 1SJXA 3S88L 2RR3A 3L5WB 2ICWB 2DQFA 1N4XL 4XCNA 4LOUC 5I1GL 5KOVC 3L3OA 4JAMB 1BBDL 1OP9A 4OQTL 3B9AA 1A21A 3NMEA 1QSEE 5GHWL 3QAZC 3F58L 2GJZA 1YA5A 4O4YH 3U36A 3VWJA 4WHTA 3EYOA 3W9DB 1RZFL 3N1MC 2QQLL 5F44A 1RUQL 1LEGB 4UILH 3CDFA 1KCSL 3IFOA 2B1AH 4K7FA 3KJ6H 2ITDA 1RJYB 3RVWD 5J3HC 3VFRA 5I1LB 1WTGT 4MHHG 4Y5XA 2GYSA 4NQDB 5LGKA 1MJ8L 1FCCA 3JWDL 2XOTA 3D39E 4H1LB 2FWOB 1ZWIA 3P3YA 2IAND 2CDFA 4L4TB 3HS0B 3NA4A 4Z9KB 2ED7A 3F12A 1HSAB 1ZHNA 3PWNB 1T89A 3QEQD 2VDQL 1J0ZA 4JPKL 2VXQL 5TE6L 4LSQL 3RWDB 1YNLH 4L8SB 2DKSA 5GGUA 5B8CB 2AV7A 3O6LL 1ROWA 1ZLWK 2C9AA 1YYML 4LLVA 3ZYOA 2GJJA 3PHOB 2WLYA 2B7DT 4N0UA 4U7MA 4ZSOA 5B38B 5BCAA 2EC9U 1URLA 1OHQA 2XTJD 2X4RB 2NZ9D 4MS8D 2VQ1A 1ZKAA 2OTPA 2AXHA 1KC5H 5T1KD 3JV0A 1FLRL 3BWUC 2YZ1A 3D0LB 5FB8A 4MSWA 3LN4A 3MACL 2X4UB 4HX1B 2AK4D 2MSPA 4RAUA 5ESAA 4PJIE 1FNLA 4MNHA 1L7TL 1TVDA 2CUIA 1KTDB 5BVPL 1CT8A 4P2OC 2V5MA 3T3PF 1R3HA 3EOAA 1EX0A 5J4MA 4YK4C 5D1QA 5DFVC 1WFOA 3WXVH 4MMXC 1ZA6A 2VZUA 1ND0A 5T3ZD 5C7XH 2N4IA 1C16B 3M17A 4NZRL 1A5FH 1SYVB 1RZIB 5DHYB 3OKDB 3HG1B 3IS1X 3RWEA 1KLFA 4XVUD 5DJCB 3UTQA 4LVHB 5CZXC 4JGMA 3B8YA 5DQDH 1ACYL 2Z8SA 1NFKA 2HYMA 5EU7C 1T21B 5CP7A 4HUWB 5GJTH 3LEVL 3S35H 5CAYB 1KEML 4MNGA 2W59A 1TXKA 4JQXA 3QUZA 1CG9B 1GZQB 1T66D 5KANG 1ZA3A 4YHIA 2Z4QB 3A6CH 4KTDL 4R97B 1BF2A 1BJ1J 2Y25A 4M4PA 1BF8A 5C08E 5EO9B 3QWOA 3UTTD 1YEIH 4LDLB 4NM8L 3JUZA 5F1NA 4NN7B 5E8PB 4XPTH 3HMXH 1ZGLB 5DLML 2QHRL 4JPVL 5AZEL 2BVUA 1OAQL 1HQ4A 3LHPL 4YHLH 3HRZA 2E9JA 3MXVL 5C6WH 1C5BL 4U3HA 5B22A 1GOFA 4LSUH 1KIUA 5JXAH 4DK6A 4K71C 4NO0A 4IRSA 1LE9B 3SDCC 2VIRA 3CX2A 2P8PB 4HMEA 2HN7A 4NJAH 4QRSA 1H0DA 1F6FB 3RWGA 2ZUUA 3HLAB 5E0QA 1T5WA 2PYEA 1S7SA 1DFBL 1IAMA 3I2CL 1P84J 4ODWB 2Y4SA 5HHPB 5DJ2B 4RA3A 2XN9E 1VFMA 5C07E 5F6IB 4LP4A 4N0FA 4M6AA 2A77H 3IU4H 1YEDA 1EMTH 4JB9L 5HSFA 5E4IA 2YMXL 4OIIH 5DZLA 3QAZB 3KNBA 3GK8L 4HS3A 2OS7A 1JZ3A 4I4WB 2XQBH 4P2QA 3QZWG 5SWSD 3IJSB 2DF3A 4AM0A 4L1DA 3C6SA 3UYRL 3NN8A 1Z9MA 1EK3A 5I18H 4G43A 3WD5L 4HGMA 4OFYA 4NWUH 2MCPL 4YHNB 1IAOA 2YKLL 2IPKA 3EAKA 4FQIH 5I17B 1CGTA 1BOYA 3U83A 1BQSA 1RZJC 3VWKC 1RUPL 1KT2B 2Q7YB 4K8RD 4KRNA 4U6YA 3K3QA 2OQJB 2YUZA 2CIKB 1QEWB 1BM3L 3CFKA 4ZXBB 4LEOB 5EZIH 3W39A 3B5HA 3IXAA 4ODXA 5E8DL 3SQOH 2HJKB 1H3PL 1QFHA 2Y06L 4ZOAA 1MCSA 2DAVA 2IFFL 3R06B 2HRPL 2DMCA 2IC2A 4MNQB 6FABL 3I85A 4L3CB 4K23L 4S11A 1YEGH 3GSQB 4G7YH 1WIPA 1YEEL 2H26B 3N1FC 1TNNA 4OTXL 3GSRB 2GSIB 3E8UL 4MXWH 5ALBL 3IB4A 3DSFL 5D7LB 1ZLSH 3NABH 3PV7A 4B0MM 1DUZA 3HNVL 3D0VA 3RUGA 3EDFA 3SN6N 3ULUL 1N2RA 1VKXB 2EYRB 3BKYL 5DEFA 3KDMA 1ED3B 4R26H 4P2OB 5GGSY 3KXFB 1G9EA 4TTDD 4PGCB 2NY5H 3P9MB 3S7GA 1N5AA 1J1OL 2F54B 1MCLA 4YK4B 5JOPE 3DYPA 3BJ91 2D4DA 4FXKA 1T04B 2I07B 5FV1L 3ETBF 3LQAL 4ZD3L 1BECA 4JN1L 4LEXH 4UDUB 4P3WA 3QIUA 2AV1A 2GJ6A 4G5ZH 2ATKB 4UTAH 3O3DA 4MJIA 3OKNA 2HT4D 4OLWH 2F8OA 3SGDH 1DP0A 4UOW0 4LHUD 5GZND 4TQEL 2DBLL 4EXPX 4CADA 4UIKH 5KVFL 2Z8RA 4V1DD 1QLEH 3DPBA 1A1MA 1V8HA 4JO1H 3V52L 5ESQA 3TBSB 4PV8A 1MI5B 2EH8H 3ROOB 3HMWL 2ERJC 3TVMA 3VI4F 2W0PA 2MWCA 3DV6A 1AGDB 3KPRB 3FO9A 5IQ9B 4NDMB 1INEH 2ZP0T 2QLVB 5E94B 4AEIH 3OKMA 4Z18A 1FVCB 1F4HA 3CVHA 4LSVH 5HYQB 5F7DB 1Q0XL