1MRCL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL01
3H8NA 4GG6E 1BM3L 4NZTH 3MLYL 4UTAH 4X8JB 4JFEB 1BF8A 3IB4A 3NZ8A 3U7WL 3LPGA 5TE6H 4FQXD 5D1ZD 2A1WH 3DX8A 3MLRH 5HDBF 4HBQA 1TCRA 5FYKU 5T1KB 1DL7H 2VDKL 3D25A 4GBXC 3ZKXC 3JVGA 4MVBC 2W65B 1FL3B 1UACL 4HX1B 1EERB 4P3WA 1FZMB 4NC0B 4JRXA 1X5YA 3RVVD 1M6OA 5CZVL 3SJVB 1S9XA 1BQLH 4QHKI 4O2CA 2R56L 4JDTH 3C6LC 1CN4A 3TH3T 1IL1A 2DM4A 4NOBA 3O3EA 1SYSA 5HHPB 5KW9L 1BECA 3BAEH 3UZEA 3QUXC 2IF7A 4MDJB 5C7XL 2FATL 2P48B 2DQFA 5D1XD 5CJ5A 2GSIA 1QSVA 5GJTH 4CVXB 3FQXB 2QJDA 1R3KA 4PJDA 3IF1A 3N1GC 4LDOB 4G8IB 1I3UA 1BJ8A 1NFDB 1REIA 4PJEE 4UT9L 3X17A 1I1AC 2VTFA 4M61A 5GGVL 3MRFA 1IGIL 1UB6B 2FGWH 3RNQA 3ZHDA 3KPOB 4XTRD 5DD3H 3MRKA 3WFDL 4L4VE 5FHAH 2E7BA 2NX5E 4NRXA 3EBAA 5FM4A 2O61A 4ZUSB 4EI5C 4UNVA 5JIPA 2ERJB 2XXCB 3A6BH 4QHNA 4N8CL 1MCKA 4HCRL 1PBYA 2GTZA 4PJCF 2AJUL 5KS9B 2D9CA 1D5ZA 1JGEA 1I8MA 1BQHB 3O41B 3O4OB 3KYMB 3RWFA 4H8WH 4P57B 4U1MA 3HE7D 5IQ7L 2CK0H 3RUGB 3ETBF 2A9NL 4YHOL 5C0BE 5EU7C 2EDOA 1CDJA 4TUJA 2D7TH 5F6HI 1KCKA 1HH6B 4LCIH 4RAUB 3SDDB 2C5DC 5D4QA 1LWRA 4OLXL 2BC4A 2ZUQC 3H7LA 2B5IB 2GITA 5DD5L 3LRHA 2BNRE 1GZPB 2EZ0C 2ZSWB 4NNXA 1XR8A 3VFVA 2APXA 3IVKB 1L6XA 1ZLVH 5I6XB 1BBJB 4EI6A 1JP5A 1K4CA 1J0HA 1VESA 1OF2A 1MCHA 3OBAA 3S36X 4ZODA 2G60H 5EBMB 5FKAB 3BQUB 3D39E 4H1LA 5B4MC 1OARL 1FVCB 5DMIH 2MQCA 5GGQL 2DYPB 4R26H 2P5ED 3K3QA 3KPSB 4XMPL 2MQ3A 2PNDA 3L7EA 2FO1A 5E6YA 1JGDB 4OFIA 1LE5A 4FQCL 1WCBA 3GK8L 4Z8FH 3DV4A 3MJ9A 3RAJH 4MMXC 1RUQH 4U6XA 4K23L 5TF1H 2AK4E 3UBXB 3QI9A 4RGND 1NDGB 1LGVA 4JKLA 5FK9B 4L8BA 3GUTB 1BBDH 3DTXB 3QH3A 1AHWC 3STZA 1IQDA 3NPSC 2DMBA 2BCKB 1LP9F 3R8BB 4KMTH 3GSOB 1T1YB 3WE6B 1OGTB 2XZQL 1KIPB 3L3HB 2K7QA 2OTWA 3S9DB 3LB6C 3ZKMC 4I0PD 3VFPB 1S7RB 1CK0H 4X4XA 4HK0B 4G9FA 2A9ML 5HXMA 1DQQA 4PR5A 3M8OL 4K3JH 1FO0L 5BS0B 1XGQA 4M5YL 4P46C 3L1OH 3U0TB 1ZHLA 2UZXB 5AYQA 1DDHB 2Z31A 4LP5A 2J88L 1A6WH 4OD3L 5DUPH 3OHXB 4V1DE 1MQKL 4CGTA 5GQBA 1FN4A 2WBJA 1T22A 5SWZB 3HPJA 4F9LC 4LCWA 4L3CA 3F12A 4JHAH 1KJVA 1U3HC 1AO7E 3EAKA 4LOUD 1A5FH 3Q0HA 3AY4C 3MNWA 4LSQL 4HUKB 1G7PB 1EDQA 2VLKE 4Z7UE 1RURL 2BSRB 4LEXL 4OBRA 2ZSVB 5D9SB 1RZIA 3GIZL 1CD1A 1ZLSL 1J1XL 1XF5B 2ZCHH 3ILPA 2AJXL 3VXOA 1KIRA 3RY4A 2ID5A 1LNUA 4I3RL 2YKLH 2R4RL 3QWQB 3EYOA 3W9EB 5EU6E 4K71C 3R06B 2KH2B 4X6EA 1GHFH 4TPRL 5E5RB 2IALA 5K93A 4OZGB 3TZVA 2BY2A 4DN4L 5F96L 3E3QE 1CE6B 1OW0A 3TA3C 3KXFD 3FQUA 4LQ1A 5J6GA 2Y5TA 1W0VB 2EXYD 4ODUB 5CJBA 1H9VA 3CUPA 1CG9A 4AIZB 5CGTA 4OD1L 4K8RD 3ARDD 4JQIH 3GBNH 3GMRB 4TN9A 3WD5L 2DI9A 3HC0A 3LD8B 4KI1A 4R6UA 4H1LH 4JPVH 4QOKD 4JANA 3H2WA 4XXCA 1MCJA 3Q6GH 4ZO6A 1RMFL 2NR6C 3HC3L 2BOBB 3KDMA 2DQJL 4TSBH 2IGFL 3PXHA 4R7NB 3BI9X 4OUOA 4H0HB 3MJ9H 1QLFB 4MNQE 4PJFF 4M6MH 4K7PY 4ZDHB 5FA4B 4XVUC 1PYWB 4YEEA 2E8YA 4BK4A 4OZHA 5IB1B 1CL7H 3QPXL 3WDHA 1YJDH 4YDVA 2V2XA 1VDGA 4XMLL 1JFQH 1WK0A 4OIBA 1BX2A 3FQNA 5I8CA 4N0CC 1VEMA 1AR1D 4M7LL 4UB0L 4HKJB 3RWDA 1BREA 3G9AB 5IMKA 4PJAB 1FRGL 3GSUB 1B9ZA 3P4NB 4LEOB 1V3LA 1A1NB 1F4YH 4GS7B 1A6AB 3AMKA 2BNUB 3FO9A 3S4SG 2H32H 3WNKA 4HF5H 2WV3A 3BN9C 5JW4Q 2EDBA 3MRDA 5HPMB 3Q6FA 2HN7B 5EB9A 4G80B 5FUZL 1F4WL 3QDAA 1VEPA 3VU2A 2AV1B 3RGVD 1MRFL 3LEYL 1NCBL 1JYVA 4DVBB 5I1AB 43C9B 3QZWB 1IC7L 3UYOD 1HZHH 4XVTH 4MJ2A 2Z8RA 1CZ8H 1XEDA 5ADPL 2IPKB 2KUTA 4OKVA 2R1XB 3QDGE 4NCC2 2H2PC 2I5YL 2X09A 5D5MB 5IVXE 3RL1B 3MRJB 3QUKA 4JM2D 3D18B 1ZVSB 4MA1B 1OT1A 4K07A 3VGGA 1RAMA 5A2LH 3CFEA 1E4KC 5CBAA 4RMWA 5C0CD 1DTUA 1NKRA 1TJGH 2QSQA 5BW7C 3G5ZA 5C0IB 3WS3B 3KYNA 3QXUA 4I3SL 3PWNB 4P59L 5DT1H 4BFEA 5HVFB 5DJZA 3OGOE 3G04A 4MNHA 5DUML 5IKCB 4EZMA 4EUPA 3FKUS 1HSAA 1YEKL 5KOVC 4JFEE 5BMFL 4M62H 1FL5B 5HHQA 1NEZG 3OKMA 1KB9J 5TDPB 5HYJB 1ZLUK 1ETZA 3MR9B 5KSAA 3F58H 4IOSD 3ILQC 4IOFD 3BISA 3HZKA 1J9CT 4NC1E 2VYRE 4N0RA 1RIHL 1NMBL 3SJVE 3N06B 2EO9A 2CLZB 2JJTA 5DDHB 3BZEB 5L0QC 2XNAB 3FZUC 4JQXC 5F72S 1IM3A 1J0JA 5EBLA 5EU3A 2DKMA 2VXSL 1UM6L 2Y7QA 3TWCH 2I9LA 2ERJC 5H37G 4OGAD 4OM1H 3QEHB 1MELA 3NH7L 1UWXK 1P4LA 1U8LB 2DBLH 1GSMA 2NW2B 4UV7H 1VADB 1AFVH 3IFLL 1I1RA 3O4OC 2A0LD 4RBPH 4G6AC 1Z9LA 4JFFA 4WCYL 2O5YH 4YLQT 5D7LE 4OZIB 2FECI 4QO1A 2GJ6A 3CVHA 5D71H 4S2SA 3FT3A 4TVSa 5LKNA 4DUXA 2AJ3A 3PNWA 5D2LA 5K33A 4KQ3L 1LE9A 2O5ZL 1YNTB 4DN3L 3SDDC 4MQ7B 3GSRB 3GJEB 1E4WH 5E2VH 4F57H 5JPNA 4UV4L 2B5IC 3N9GH 5FECB 1MVUB 2RFXB 5F8RC 3GJFB 1J0KA 4PRHA 1JNNL 1PZ5B 1G7QA 1GGIH 4XWOD 3QFJE 5I6XC 1IGTA 5DWUH 4HKZB 1DJSA 1RZJH 2ZOKA 3O11A 3LV3B 5F1KC 3RUGE 3KPPA 5EC2B 2EH7L 3BQUC 1N6UA 4B41A 4U1SA 1RIUH 1L0YA 2B4CC 1ORQB 1OB1B 1NGZA 3PP4H 4K9EC 1FHGA 1OT2A 1GC1H 2EDFA 5JW5B 4YHPB 5IWLC 4R4BA 2Y1VA 4N1CA 2VDPH 4XC1L 3UTTD 2BX5A 5IFHL 2YD2A 3DX7A 1J5OL 3VGAB 5CINL 4GT7A 1N2RA 2CIKA 4AMKH 4NNPH 1JGVL 5JDSA 3L3IA 1GGUA 4P3DA 3CCHA 4OQ1A 2NW3B 5C0GB 2HTLC 5DC9B 3RX5A 4RMRA 4OLZH 3MJ7B 1LK2B 3QDJA 4D0DB 5D7SL 4AENA 5IHZA 1FNHA 4XNMB 2CDFA 4EUPH 3U30B 1HKLH 2Q8BH 4UOJA 3S96A 2AXFB 2NXZB 3O6FD 3FB7B 4TUKH 4NC2B 3JWOH 4WTZA 5H35A 5ANMA 5CKGA 1EHAA 3CJJA 4O02L 5F70A 4RAVB 5C86A 4JZOA 5L9DL 1A7NH 1DUYA 2R0ZL 4NT6A 5CLTA 4Y5VA 1AXSA 5J56B 1ERNA 1MCIA 3QNXA 4QXUL 1RULL 2FL5A 5DJAB 1TTFA 3LN4A 5MEOA 3ULVC 2R29L 1OM3H 1FLRL 1A9BB 4PJXA 4CDGC 1XGTA 3PJSB 1J05B 2EC9U 4LLYB 4X6CF 1AP2B 3RJDA 1Q9KA 1CD9B 5IR1A 3FO0H 5FGCB 1EHNA 3P30L 2E27L 2X4QB 4KZEH 1UEMA 4WFED 3A6CH 5E95B 4W4OC 1DUZB 3BIKB 5DK2B 1B4RA 1I9RL 2FBJH 4NQCD 4F58L 3V5DA 2J8UB 4KK5D 5MEPA 3HI1A 1G9NH 3ULVE 3CVHH 1B2WH 1Y18B 3HI5H 5SWZE 5ISZB 3C8DA 1WSST 1T21A 4L4TE 3LKPA 5JHDB 5IHBA 3C08L 1GGCL 1CFTA 2YRZA 3ZTNL 2PW2A 3IDNB 1GAFL 4XPGL 3NZHL 5D7IB 1CGSL 1AGBB 1MRDH 5DFVD 4XCYA 2CKBL 2ZG2A 3ARFB 4LVEA 2ZPKH 5DHVA 4Q2ZB 1K3ZA 1NH6A 3RVXD 4HHAA 1VA9A 2O93L 1YY9C 3KNBB 5ICXB 4Z7VA 1ROWA 4EDWL 5JNYB 2JIXD 3LD8C 5C0AD 5M94B 1BD2A 3D5OF 3FFCB 4CUCA 2Q76B 4HBCL 4JQVA 1OTTC 4PP1D 5DI8A 5C07D 4A6YL 4OGZA 1BMGA 4ZNEE 2OYPA 1KJ3L 3QUMH 4MAUL 1MPAL 1T0NA 4JAMB 4MZ2A 4KKLC 5GRUL 3CC5A 1I9IL 4H5SA 3QG7H 4PD4J 5EUKB 1N8ZA 2HH0H 2N7AA 2VLJD 4KC3B 2YUZA 1ZLVK 1SJEB 1LVEA 5TE4L 1S7WB 5LGJA 2I27N 1ZHBA 4JZNA 4G6FB 3JV0A 3MPCA 4K3EH 4HH9B 2I07A 3G08B 4NN7B 1DZBA 4MCZB 3WFZA 4D2NA 2VDQH 5JORA 2Y23A 5JXAL 3NACL 1YMME 1S7QB 3QFDB 3OV6A 1KB9K 1KJ2L 1XZ0A 4GS7C 3EKCA 4U1HB 4WFHD 1UH2A 3GHBH 3T0WA 2BXZA 4QXGH 3RZCD 1DQLL 5BXFA 5GRVK 3BD3A 1QFUL 1R5WA 1X3DA 3UC0H 3QXDB 1IKFH 3H3KA 2P7TB 4LL9A 1OPGH 4I8DA 1KLUA 1OTUC 4XP6L 3ARGB 3LS4L 1EAJA 3NTCH 5IIEA 3N85L 5T1LB 5EZOL 3C9NB 4NKOB 1HN1A 4U33A 4DQOH 3STBA 4NZDA 1UXWB 4D8PA 4GBXD 4MVBD 4PJAE 4BSVB 3EZJB 5FF6B 4F7EA 4M3KB 5SWQA 4OCYL 4OIIL 4JZJB 4KTYA 2IC2A 5F89B 1QFWH 1EMTL 4FFYL 4Y4FA 2P8MA 2NY1B 1E4XH 4MA1C 4U7MA 3VFRB 5DJDA 2MPAL 3MROA 5DEGB 2QSCL 3MRHA 4O9HL 1EUTA 4YQXH 4JKPL 1K2DB 2DIJA 3VRJB 2XTJB 3GKWH 4ODSH 3IDJB 3KAAA 5GIRA 1AD0B 4ZS7H 4UQ2A 4HWZA 3UZQA 3IDIB 1Z3GH 1H5BB 5I1DB 1QBLH 3UCRA 3NFNB 3DX6A 4P5MB 2HJKB 1I1AD 4WI6A 1DSFL 4YHIA 3KPMB 1QSFB 4WIQA 3O3DA 1PAMA 3KLHC 3GZKA 1ZS8B 1FBIL 3PHOA 1MJUL 1QLEL 3SN6N 4P9ML 1I8LC 5HJ3B 3RFZC 4AYFA 3BGMA 3MLVH 5DHVH 4NYLA 1PY4A 3OPZH 4PUBH 4XMKH 3RDTB 5KSVB 4TOYL 1FORH 4LLUB 1UM5L 3BVNA 4HKXB 4MD4B 2VXUH 2N56A 2UV3A 4NSKA 2P5WB 1WLHA 4M6NL 4JJHA 4PJCE 5E9DA 3P0YL 3KPLA 5F1IB 1INQB 3D39D 4LLWA 4OLWH 3QHZL 3VI4E 4GKNB 4GW5A 5IQ9B 4G3YL 4JO1H 3I3DA 2IADB 4PG2A 1XCQB 4QY8A 4Q74A 3G6DH 2JELH 3QUYA 4J4PC 4PRIE 1NC2B 3PUCA 1ZHNB 5IEHB 3ARXA 2JJUA 2EZ0D 5FYJE 2E8ZA 1ZSDB 2VABB 4HPYH 1U93B 1V7MH 4FQ2H 1I8IB 4PGDB 1CLZH 3VG0L 5FO9B 1XAUA 3OF6D 4HMCA 2X4PB 2VZOA 3MX0A 1FFQA 2IAMB 4XH2A 3OJVC 1T5XA 1H0DA 3QJFA 1UZ6E 1CL7I 1URLA 3IAGC 4NO2A 2VQTA 4GRLA 4P3CL 2F54A 1IGFL 1D9KA 5D7KD 5I1CH 3I85A 4HWNA 1DBBH 5BV7B 1A4JA 3SGEH 1W72B 8FABB 5IB2A 1NJ9A 4Z0XB 5TJWK 2I60L 3MV01 3ORJA 4PRPD 3K81A 4QRRD 5MERB 4HMDA 3V79C 4XVJL 2VLRE 2AXJA 2R23A 5DJCB 5CD3B 2ZG1A 4UILH 5HGBA 3S5LB 3TBVB 3T65B 4E41A 2XWTA 3T0DA 3B2VL 3DJ9A 1CXFA 2YD1A 2BSSA 3TT3L 1BVLB 1EHXA 1XGUA 1MJ8L 1YDPA 3QUZA 2FWOA 4FN0A 1G7JA 2LAAA 3DGCR 3THML 3VXSB 2VLLA 1AY1L 3VGAC 1IEBB 1B0GA 3LB6D 5T3XH 3ZKMD 3MOAL 5F7EL 4X6FB 2Z93A 2XFXA 2Z4QA 3LKSB 3Q1SH 3SQBA 4JVWA 3K46A 1AQKL 1AXTL 1GZQB 5C0RL 2VLKD 3SDAC 1NFIB 3G6JA 4P46D 4LLDA 3IDXH 2PYFB 1S5IH 3U30C 3MLPA 1HILB 3HG1D 1HXMA 2NXZC 4FTVD 5DRZB 2GSGB 3DI2B 4G6KL 4D3CL 4H25A 2VRAA 2XQYG 3MRLB 4NO3B 5FYJU 5EU6D 2B4CL 5DD6B 3RA7L 1PX3A 3MZTA 3MV8A 4K9EL 5L2KB 3RWHB 4EDXA 3N1PC 4LHUB 4NQDE 4EEEA 3PGFH 1G1CA 3WXVL 2DLIA 2H9GB 2XQBH 1GCFA 3PHQB 1JWSA 2VE6A 4HUVB 3GSWA 3S7GA 3V0AC 5IF0A 1T3FA 1K3IA 3QIWA 4X80L 5I1JH 3L3DA 5DVKA 3JWDH 3VXRD 2HG5B 4FQIH 5EOQH 1GIGH 1XIWA 1K8DA 4CMMA 2CMRH 4PD4K 2HFFB 4QHUA 2DAVA 4PJ5A 5HVWA 2V17H 3LN9A 2JCCB 4OM0H 4XCFH 1M71A 4DUWA 4P4KD 3AM8A 1ZWIA 2H6PB 4X5XA 5F9WB 1YUHA 1QP1A 2BFVL 4P2QD 1PG7L 3L95A 5IJVB 2EEDA 1O7SA 2P8LA 4LSPL 4LIQE 5EZJB 4Z95H 2V2WA 4JY5H 3LKOA 2VR5A 2VDOL 3QIUA 3TA3D 3RX8A 1FSKB 1FZKB 5A2JH 1RUKL 5INDA 5JOEA 5D70L 4GW4B 5FHBH 4Z5RB 1KTDA 1KYOK 1XR9B 5FGCE 3NA9H 1CCZA 4LP4A 5FO8A 5IESL 1A3QA 4M4PA 4X98B 1J0ZA 1OAYH 3ZYIA 4FXGA 3HS0B 1QLRB 4U6HB 2ICEB 3ARFC 1F3DH 2NR6D 1KN4H 4Z18A 4QYOA 4RBPK 1NGPL 1CFQB 1P1ZB 5GGRY 2Y6SC 3H9SD 1CGVA 4JN2B 4LLVB 3V5KB 1KIUA 3LSOA 1IILE 1FNAA 1VEOA 4JY6A 4NFDA 1DE4B 5FAAA 4NQEB 2F53B 1KF9B 2VSDA 4XVUD 4GRWH 2BVEA 5I1GL 2Y5EA 2X4NA 4Y1AA 1EEUA 5IBUG 5HGHA 2X6MA 1ZGLM 2AABH 1PJ9A 3O4LB 5JHDE 1EH9A 4HPOL 4N0CD 1BZ7B 3GHEH 5BQ7A 3HMWL 1JPFA 3DLQR 1JN6A 5CSBA 4M3JA 5DJYB 4LSTL 4NKDB 4MNGB 3CFDB 3ESVF 5DJXA 2FHFA 3RNKA 3TC9A 1KB5A 5FYKH 1RJLB 1IKNC 4PJIF 3TBYA 4M6OH 4N90E 1VKXA 4Q6IB 3BN9D 3WJJC 1BIHA 5F3HA 3K1DA 4NN7C 4PY8J 3FFCE 5EU5A 1JI1A 4H26A 4IMLB 3GGWB 3WMSA 5D93B 5ESVB 3C09C 1KPUA 4DGIH 3V4UL 5D1QB 5EG6C 5FUCC 4GSDL 1FYTE 3SQOH 3MV7B 4EQ2A 1YEJL 5F1NB 3VMNA 3W9DB 1ITBB 1PQZB 1KBGH 2DD8H 2F5BH 1U95B 3H7BA 4YDKH 3PGDB 4LGSB 5C0BA 4ZFOA 3C8HA 3MXVL 4JFED 5IOPB 2GAZB 4X0KA 3RL2A 2H2PD 1QO3A 3T0EB 1BEYL 1JPSL 3ARZA 4Q9CA 4PP2A 2I9TA 4KY1L 3UTPD 2R0WH 1JGLL 1T7VA 4JJ5A 4DK6A 1TIUA 2HKHL 5BZWB 5ENWB 5FUCE 4JZJC 3P73A 1IFHL 4YHNB 1UWGL 2XZCH 1E6JH 2CJUL 1IGCH 5EH1A 5A2IH 4ESKA 1D6EA 2NY1C 5K9OA 3UYPA 2JB6A 3R0MA 3HB3C 3UX9B 1H15A 2BJMH 3ULUL 2VB5A 2EDQA 5DMKB 2OP4L 1WIPA 1J10A 4TNWF 2WUBL 2XTJC 4FFZL 1GVIA 3EFFB 1EO8L 2JJSA 4GH7B 5E1HB 5IK3A 2QL1A 2MMXA 1H5BC 1F02I 3ILQD 3TO4C 1F8TH 4B0MM 5FYLH 2WWMC 2P49B 3SKOB 4JR9L 3FZUD 2X10A 1CTNA 1CDBA 1WAAF 1V7NH 3UJJL 2MOVA 4GXUM 2Q6WA 3HE6A 2VXVH 3UO1H 5DF0A 5E24E 1FFRA 3RDTC 2BOCA 3EYQC 1HNFA 3ULUF 2Z8SA 4MWFB 4L8CA 2ZJSL 3EOTH 1A7QH 4G6AD 5IHUH 4JPKH 1EEYA 4CW1A 5EO0A 3S36H 3PIQA 3LMJH 2V9TA 4R90L 3GIVA 5CJXC 3HUJB 1JZ3A 4OSUH 5JO5B 4XBPB 3SDDD 1IGML 2IANB 1IC5L 3B3IB 5F9AC 1VPOH 5BJTB 4XXDB 1ZEAL 1UB5A 3DVFA 4XP1H 2XRAL 4V1DA 4LASH 5EC1B 1C1EH 3FONA 1CE1L 4P23A 4HULB 4JGUA 3SPVA 3O2VH 1KB5H 1MNUL 3MBXL 4OZ4A 4HD9A 1AO7A 4JFHE 2IAMC 4FABH 3DVNA 1ONQA 2QADD 5I1EH 5KSBB 4M5ZH 4MD5B 3VCLB 3BH8A 4N0FA 2NY5L 4J12A 4UOW1 3ULSB 5I76B 1KTKE 4L5FL 2DQUH 4L3ED 1A6UH 3KPSD 3F7VA 4G8GE 4ZPTA 5BV7C 4P49A 3OR6A 3D69A 1J1PH 2VOTA 5DLML 4DAGL 3CH1B 1U0QA 3F7YA 5CP7B 3RVWC 5HDQH 4LHQB 7FABH 2YPLB 2Z91B 2OZ4L 3CX5K 4RMSA 5F9OH 2KQMA 4HS6A 5MI0B 2NY3B 1P4IH 1CYGA 2GK2A 2VH5L 3D9AL 2FEEI 3F7RA 3HAEA 4WWKC 5FGRA 5HHNA 2FJFA 3IRPX 3RWEB 5JOPD 4J7RA 4O00A 1X5LA 2HTLD 5IROC 5DR5L 4PJGB 3HNSH 2EYTA 4J1UB 3CXHJ 2PTUA 4G7VH 3MRIB 1F3DJ 2R0KL 1QFWI 1NCAL 3LDBB 4XNXL 4PS4L 3O6LL 5I15H 1E4XI 3EYFB 4O58H 5BS0D 3ROOA 5C2BL 2HT2C 2DM2A 2OTUB 2VSCA 1QQDB 5DQDL 1NDMB 4Q9RH 1T1ZB 4PG9B 3QULB 2LAGB 4YPGB 3SBWC 3BPCB 3ULVD 1FNGB 4U1LB 1ZVYA 5EFIB 5EUOA 4R2GC 1EXUA 1TXKA 3EO0A 3IAPA 1KCLA 1IRAY 2OLDA 3VXSE 4JY4B 3T2NH 5GGRB 3WDJA 4JHZA 1CGXA 1WTLA 2E7HA 5E5MB 4ETQB 4KMQA 5FXCH 1G84A 4PTTB 3V8OA 2WW8A 4O5LH 5E1AA 3TF7C 4JGMA 4UT7L 4X6CE 5TFSH 4U1NA 5DTFB 2YK1H 3JUZA 4KI5E 2QV2A 3BWUC 4P5KA 4Q7DA 1E6OH 1NCCH 2W60A 2D7MA 4OZFG 1BJ1H 2ED7A 3INUL 4HIIB 2VC2L 2IFGA 5IVZA 5F3BB 1YC7A 5JUEH 1A1MA 4LLQB 4PBWD 4QRSB 5KSUB 1Q38A 3QO0A 5F9WC 3WL9A 5I1KL 2X2YA 4YXLL 3MNVB 3GSNH 1HDMB 4Y8DC 4NUGL 3S8WA 2G75B 3AREA 4FQ1L 3VXUE 5HGDB 3CSPA 3KG5A 4TTDC 3G5VB 1FSKC 1CLCA 5DZNA 1MFEL 2XA8L 3OSKA 4L8SB 2GW5A 4OB5H 3LS5L 3O2DA 3WV0A 1OSPL 1U8IA 2CUHA 3MCLH 4NGHL 5JA8B 2EDNA 4U1GB 3B9AA 3O81A 4JDVB 3PABB 1YY9D 3VXQB 5IBTL 1MF2L 1MJ7H 2UZIH 1TNNA 4NKMB 4JB9H 3C5ZA 2IG2H 4GKZA 1OTTD 4MAYA 3DIFA 1OGAA 2WIMA 4ZFGH 1JMZA 5ITBH 2X42A 4KKLD 4Q9QH 2HVKB 3ESUF 1Q9OA 5IW3A 4K7PL 2WBKA 5E5UB 2NY4B 5DMYA 1JZ6A 4AK1A 5B8CC 4XP5H 2LU4A 3AU1B 3P9LB 2RCSH 3T3MF 1BF2A 1AGCB 4I18B 3SGEI 1X9QA 2EDEA 1CFNA 1KXTB 4C56E 1UJ3A 4S1SH 1L6ZA 1SM3H 1XCTB 2R2EA 3A6OA 4GQ9H 3SDCA 4ORZC 4AG4H 1VFBA 5DZLA 4PJ7B 2CLVA 2X4SA 3QWOA 2OL3A 3WFCL 3MOBH 5A16A 1T5WA 1CBVL 1ZK9A 4OLEA 2E9JA 4CL7A 4OT1L 1BZQK 3QQ3B 2FCBA 3U2SA 1ORSB 4Q6IC 3UZVB 4L8DA 4YX2H 4P0DA 4PGEA 3T09A 4FZ8L 2FSEA 2VR9A 1JPGA 3SE8L 1M7DA 4Y2DD 4AT6B 2GHWB 2GEEA 3O4LE 4BSJA 1FFOA 5IEKB 4Q0XL 1OTUD 2D0HA 2QQNH 5HHVL 4MQXC 3HNVL 5D7LA 1SVCP 4RWYL 3LKQB 3VRIB 5F21B 3FT4B 3NN8A 3KLAB 5FDYA 2YZ8A 5ACMA 4GJTB 2WWKT 4ACPA 1I7ZB 1A3LH 4BQ9A 4WU7B 3CDGA 3EHBC 3GKZA 1CS6A 1T7XA 3T0EC 3U9UA 5TPWH 4QTIL 1FZOA 4Q9BA 4BK5A 4O2FA 4ELKA 2J6EA 1KCRL 1VB9A 3GO1L 1K5NB 2HLFC 1F90L 1HQRB 3DO3A 3OAUH 3QFJA 2VAJA 2X89A 3G6AA 4ZS6C 2CGRL 3CSGA 4WI7A 3WNOA 1INEL 1U8QB 3G5YA 3VGEA 2X4RA 2C1OA 3IJYB 3FO2A 4HAGA 2R2BB 1MHEA 1B6DA 1KENL 4P4RB 4ZSOB 5FB8A 1T03L 3OJMB 3OKLB 1U8OB 3CMOL 4LU5L 4LRNH 3FFDA 4DJMA 4Y5XB 1MVFA 4HZLB 4BH8A 2D31B 5HYJD 3LQAC 2RHEA 1I7RA 3G5XA 1C5DA 3PWLB 1YN7A 3B6SA 1NGXA 1KJMA 2F19L 5D1XA 2BNQD 4KQ4H 4UIKL 3O2DH 3GMNB 4ZPVA 3V6FA 3LZFL 3ZDXE 3QNZB 3EJZC 1DP0A 3IFPA 5FYJD 1LD9A 4XB8A 4PJHB 2FR4B 3ZTJH 1ZANL 4M1CC 2NXYB 4ZD3L 1IGJA 1TJIH 3L5XL 1SYVA 3B9VA 5CJOH 1X4YA 2PO6A 1MCCA 4PJBF 3I6LE 1ZA3B 4WEMB 1T0MA 5CIPA 3L5JA 1MSPA 2IQ9L 5IB5B 3SKUD 1I75A 1WUNT 4J4PD 5DGRA 3DMMB 4ZXBB 5ITFA 3O3BA 3U0WL 5ACLA 2BY3A 1WTGT 3NZ8B 4DGVL 2YRPA 5T5FL 1NPUA 3SEPA 1ZMYA 3CXHK 1JNLL 1AIFA 1IJ9A 4APQA 3DX8B 5DQJA 1TCRB 4YDIL 3MFFA 5FA3A 3D25B 1IAIL 3P4LA 3S34H 2OS7A 5ESAA 1F11A 4JRXB 4XP4H 1M6OB 3HMXA 2FDBP 4U7SA 4NQUA 3ES6A 1S9XB 4HKBA 3RU8L 1WBXA 1TNMA 4O2CB 5KVFH 1IL1B 3HUJE 1QBMH 1DBJH 5E03A 3P11L 3O3EB 1SYSB 1UH3A 3TP4A 2X7LA 3NCFB 1BJ1J 5HHMD 2BRQA 2DQFB 3BZ4A 4OFYD 5LBSL 4A2MA 2GSIB 4KJQC 2AXGA 3OKDA 1R3KB 4PJDB 3IF1B 5MENE 2VZSA 4EBQL 4HUNB 4K3DL 43CAA 5B38A 4L4TA 4J2XA 2IMNA 4XC3L 4DZ8A 4M61B 5GS2D 5MI0C 2J6EH 2NY3C 3MRFB 3AUVA 4HLJA 3WS6C 2ADFH 3MRKB 4L9LA 5GSVA 2EDRA 1JYXA 4NRXB 2O61B 1I85C 5IW6A 1TVHA 3PQYE 4QHNB 4MA7L 3Q3GA 1MREH 1QSEE 3SDAD 5C09D 3SE4A 4DCQA 3SKMA 2GTZB 2NY7H 5LGHH 3VFOA 1D5ZB 1JGEB 3E8UH 2NXZD 5HY9A 2NTFA 4OF0A 1I8MB 5BRZE 1NC4A 2WAHA 3BD5A 2AJYL 3RWFB 5BV7L 2IBBA 4U1MB 5C8JA 4ODVH 5F7HA 4YXKH 2GFBA 1T1XB 4DEPB 1OD7A 1R0AH 4ZTOH 4TUJB 4HUWA 3PGCA 2G2RA 2BVYA 1KG0A 3D87B 4HSQA 3BP7A 5KTEL 4GAGL 1Y6NR 1MCQA 2BC4B 2EDJA 3VRLF 1UFUA 2GITB 2QQKH 3NCMA 1LO0L 4PJGE 4ERSH 2ZUTA 4NNXB 5KAQF 1XR8B 4R8WH 4ZFFA 3VFVB 1JGUL 3UJIL 5GRZA 5HI3D 2HRLA 4LAQL 4UT6L 3V0WH 1YMMA 4EI6B 3F6LA 1K4CB 1OF2B 1P84K 4JDZA 1RV6X 2R4SL 4HWEL 2EKSA 2VAAA 1IAKA 2JJVA 3OG6B 4I13B 5CIPH 4H1LB 3REWA 3L7EB 2YD6A 1LE5B 1ES0B 1WCBB 4NQSA 3FMGH 3DV4B 3QCVH 3S35H 2C26A 2CDEA 4XB7A 5ISZD 1OWRM 4U6XB 1ZE3C 1QYGL 3MCG1 3QI9B 1EUUA 3MLZH 4L8BB 3BEWA 4L8SC 3QH3B 3STZB 1IQDB 3ARFD 4J6RH 1FPTH 4C58B 3KXFA 4BQ6A 2Y6SD 3UDWA 2ARJQ 3HMXH 3GMOA 3L3OB 1KFAL 4ONFH 3LN5A 4N90D 2NZ9C 2OTWB 5CP3A 2GIYA 1CXLA 1NANH 5JQHC 1LO5A 3ARDA 1PX4A 2XWBA 1KT2A 5C08E 4X4XB 1U8MA 4G9FB 1NBQA 2CQVA 1DQQB 3MACH 4PR5B 4QOKA 3R4DA 4KUZH 2NY4C 1XGQB 5JHLH 1ZHLB 1SBSH 5ID1A 1IZJA 1UGNA 4YZFE 4I18C 4D0CA 2Z31B 3KPNA 3P3YA 2ILLA 1MEXH 4LFHD 5ALCL 3QQ9C 1FN4B 2WBJB 1PW3A 1T22B 3HPJB 4LCWB 2HFEA 4L3CB 2DQTL 3F12B 3OGCA 2PTVA 1KJVB 4NNYA 3MNWB 4PJIE 4NP4H 3EZ8A 4H88L 2IPTL 4DKAA 2ADIA 3MRRA 4EKXA 2JB5L 2DQGH 5KVGL 1RZIB 3U82B 2PUQT 1CD1B 4PJCA 2LABA 3ILPB 2BSED 1AI1H 3NFSH 3VXOB 1KIRB 3VMOA 1LNUB 2FIKA 2COQA 3EYOB 2XTLA 1RJCA 1DANU 3GI9H 3ZZ1A 4PRNA 2VDNL 3LEVL 4XAKE 4X6EB 1HINL 2IALB 2V7NA 4Y5YA 5CLWA 5EIQA 3TZVB 1MIML 4MX7A 3UJTH 4BZ2L 2DIBA 2D4FA 5IFAL 2AK1L 1XFPA 2F58H 1WT5A 4TNVF 1VSCA 5J6GB 2Y5TB 5AUMA 5C0FA 3PL6A 3CUPB 2NY1D 1CG9B 3HB3D 5DJ0A 4IIQA 5F71A 1AGDA 3WIHL 1BJMA 1C16A 1YNKL 1N5YL 4HCRA 1ACZA 3O8XD 3HC0B 1KN2L 4UAOB 2XTJD 2HWZL 4JANB 3U9PH 3H3BC 4RGMC 3I2CH 3O2WH 2H8PB 2WUCL 4FOMA 3NVQA 2DMCA 1U42A 2DKUA 3QXWA 4XPAL 3UPRA 4CJ0A 3L7FA 3TO4D 2MKLC 2DQDH 2WWMD 4HQQL 4Y5XC 1WICA 4OD2B 4H8WC 1QSFD 3UXFA 2VUYA 4OZHB 4G6ML 5L2JA 4M7JH 3MGAA 5IB3A 4YDVB 2V2XB 1GGTA 1NMCC 4F7TA 1BX2B 3FQNB 3X13A 2Y36H 1SMAA 3VXNA 5I8CB 1YEHL 2F5AL 4Q97A 3TH2T 3RDTD 1WAAE 3RWDB 1LP9A 3EYQD 5IMKB 2NXYC 4KWUA 2IWGA 3VFGH 3FCTA 1KLFA 2P5WD 4ZSOE 1LO3H 3FO9B 1ZKAA 4K8RH 3ULUE 1ACYL 3MRDB 3Q6FB 3RIFF 1PLGH 2BZDA 1U2HA 1BM3H 1CDHA 5E94A 3MLYH 1JRHL 2AV7A 3CFIC 1D5IL 4ZXBC 3DMMC 1S7UA 3U7WH 3LQAL 1I3RA 1JHKL 4PJHE 4QRPD 2FBOJ 4OKVB 3IT8D 3ZE0F 3LEXA 1S9YA 4N0YL 1OP5H 2VDKH 3TLRA 1UACH 5A3IC 3QUKB 2CUIA 4OCXL 2AJVL 5CZVH 4U7KA 2OJZL 3CFEB 3MRQA 3JVGC 5CBAB 3W0WE 5DSCA 2R56H 1TETL 32C2A 2A6JA 5IB4A 3G5ZB 1Z0NA 3KYNB 5CSGA 2YA2A 5KW9H 1H3VA 3CH8A 4NKIL 2XV6B 5DJZB 1A3RL 3O3UN 4OF8A 2FATH 5C7XH 5J6HA 1MRCL 1CFBA 4EUPB 1HSAB 2MNUA 1FO0A 5F44A 4FA8A 4UDUA 5HHQB 3DUUA 3A67L 1R3JA 4IRZL 3OKMB 4HGKC 1G7HA 3BEVA 4HLZG 4PJ9A 4UT9H 2J5LB 4WWKD 5DVNA 5IJKA 1ETZB 5GGVH 5KSAB 1U91A 4KFZC 1V3MA 1GPOL 1IGIH 3SHSA 4JFDE 3WFDH 3HZKB 4LPVA 3VXSD 1QA9A 3BGAA 4N8CH 1IM3B 5EBLB 2IH1A 3JV4A 5EU3B 4HCRH 3UTTA 1J87A 5CZKA 3AVEA 2Y7QB 3L6FA 2E9IA 2AJUH 3GSQA 2I9LB 2VQ1A 3BPNB 1A6ZA 3KPQA 2YSSA 2HT2D 3NCJL 4YNYA 1P4LB 4C59B 1V3KA 5IQ7H 2X4OA 4JG0L 2A9NH 4YHOH 2R8SL 1VGKA 4YHLL 1JTOA 4R3SA 4B7IA 5GXBB 4JFFB 4R2GD 3QG6A 2GJ6B 3CVHB 5L2KD 4PJFA 5I73B 1MLCA 4S2SB 1OAUL 4LHUD 5KN5B 3KYKL 4OLXH 3PNWB 1BVKA 5MHSE 5D2LB 4DEPC 5DD5H 4ZAKA 5C0JA 1LE9B 5DUBB 3AAZA 2VIRA 1A7RL 1PY9A 1QPXA 4OI8A 1WGOA 2DLFL 5JPNB 1WWBX 1FIEA 5D7JA 3QDME 3DURA 1KLGA 2IFFL 4PRHB 1G7QB 2FZ3A 4E42A 4IDLA 3RY6A 5J8OA 1IGTB 1T66D 1OARH 4NZJA 4Z7NF 3E0GA 5GGQH 2ZOKB 3O11B 3QWRD 4XMPH 1FYTA 3V2AR 3KPPB 1TJHL 1HE7A 2ESVD 4FQCH 4LPCA 5CKAA 3E6FA 3GK8H 4N8PA 3C2AL 4LVNB 4RQQB 1OL0A 4LSSL 2DQEL 2L4OA 4U1SB 2IBZY 2WSKA 4TTDD 4K23H 4WEUD 2B2XL 1NGZB 5HYSA 1BOGA 1NLDL 5GS0L 2VZVA 3BDXA 4CN4A 3RZWA 4R4BB 3WLWC 3EOYG 3QI9C 3SGDH 1YYLL 4WTWA 3O6ML 4ZOBA 1YJDC 3DX7B 3DXAD 2XZQH 1N2RB 2CIKB 4QCIB 4RIRA 5JDSB 3DBXA 3L3IB 3GFUA 4P3DB 5K59F 2BDNL 3BFOA 3CCHB 3KHOA 1BQHG 5TDOA 2PXYA 2A9MH 3QDJB 4AENB 1HK6A 5IHZB 1S5HA 2AI0L 2CDFB 3M8OH 2B8OT 4NQED 4KVCL 1BAFL 1FO0H 2F53D 2DLGA 5IG7A 1AGFA 3S96B 4M5YH 1PKOA 4LCUA 2JIXA 4HDIB 3ZKSD 5AG8A 5H35B 5HD8D 2YUVA 5ANMB 5C07A 1HYSC 4HK3J 5F7WC 4JZOB 7CGTA 2J88H 4KHXL 1DUYB 4N5EC 4NT6B 4OD3H 3T3ME 1AXSB 1LQSR 4OFDA 3FN3A 1MQKH 3RKPA 2EC9T 1LEIA 1A64A 3QNXB 2FL5B 3LN4B 3MZGB 2Z31C 5IP4A 5MEOB 1UCBL 4PJXB 2VLJA 3QNYA 1U3YA 2WBJC 4LSQH 1XGTB 1BGXL 5GRYA 2CRIA 2X9WA 4TTGA 1RURH 2VDRL 4LEXH 1Q9KB 2WINA 5IR1B 3GIZH 1ZLSH 1J1XH 2B20A 1G9MC 1RVFL 2AJXH 4QKXB 3KWWA 2EE2A 3MV7D 4TVPL 4I3RH 4MQXD 2XZAL 2R4RH 3K4AA 5CCKL 4HV8A 1UKQA 3V7MA 3V5DB 5MEPB 4W68A 4M03A 3RZCA 4TPRH 2X4TA 3HI1B 2XQYK 3UBXG 5E2TL 3QCTL 1X5ZA 3EHBD 4DN4H 3T0ED 5F96H 4JFQA 4LCWE 3TT1L 1GOGA 3TBSA 4MB5A 3ARUA 4KROC 3TZVC 1WFUA 1I9JL 5E99L 3LKPB 4HIJA 1OW0C 2UZYB 2OMBA 4PRAA 1CFTB 2PW2B 1D3CA 2A74A 3U46B 4OD1H 4ZS6D 4GBXA 1EJOL 4XCYB 3WD5H 2H3NA 5I74B 4LHJB 5DHVB 4U0RB 1F97A 5EBWA 5EOCJ 4D94A 4HHAB 1RMFH 3T8XA 3JZ7A 3HC3H 4Z7VB 4POZC 4U05A 2GYSA 1BD2B 3P9MA 2IGFH 3MGOA 4XAWL 4QT5A 4G8GA 4XXCC 4QRTA 5DI8B 1ZOXA 2CSPA 2W0FA 5JPMA 1T0NB 1FDLL 3ISWA 3DVGA 1HSBB 5J0BA 5ID0A 3CC5B 1D5MA 3QPXH 1IBGL 1X5KA 4H5SB 2PN5A 4U6VL 4DW2L 3EJZD 2NTSP 1N8ZB 4XMLH 1DEDA 2YD7A 1YN6A 4M1CD 4M7LH 3FQWA 4UB0H 3CK0L 2MQ0A 3IYLW 4YHYB 5LGJB 4F7MA 4JZNB 3S37L 1FRGH 3ZT7A 2I07B 4WFFE 1D5XA 3ZYJA 2APBA 5JORB 5M95B 4S1QL 1XZ0B 5FUZH 1HIML 5E8NB 1F4WH 4U6TA 3UAJD 1MRFH 3OB8A 3LEYH 1NCBH 5CMAA 3U1SL 1MI5E 2XA3A 5BXFB 1RZJC 1R5WB 1UA6L 1IC7H 2PYED 2EDKA 4XCEA 2IAND 5ADPH 3ALWA 3M07A 2EE3A 3SE3A 1KLUB 5IIEB 1UVQA 4G8FA 3C5SA 3L9RA 3TGXA 2I5YH 1T20A 2OTPA 4YFLF 5LJYH 4FQQA 2YPVL 3RWJA 4D8PB 1IQWL 1GC1C 4FQPA 4F7EB 2R1YA 5SWQB 1K4DA 1HOCA 1LILA 1MCFA 3PP3H 4JFYA 2L0DA 4JO2L 4KK6D 1MY5A 4H0IA 4Y4FB 4X6CA 1D6VL 2P8MB 1DFBL 1KCUL 3OMZA 4I3SH 1JK8A 4P59H 4YHZL 3V9FA 4KZDL 3VD3A 5DJDB 5I8EB 1S9WA 1U8KA 3MROB 4HEPG 4YO0A 4NRYA 4BUHA 6CGTA 4EOWL 5DUMH 3MRHB 1YNLL 4M9PA 4EIGB 1YEKH 5BMFH 4KRPB 1A2YA 3HPLA 1OOAA 4DWHA 3BZFA 5ADOL 5GIRB 1YPZF 4UQ2B 3L3GA 4HWZB 2R2HA 4YAQA 5CZXC 2YPLD 4M02A 1ITCA 3DX6B 1P6FA 3VXUA 3JWOC 4YHIB 3FRPG 2NY3D 4NHCL 1YYML 3NABL 2CO7B 2J5LC 3O3DB 5I1IL 1RIHH 3SGKA 3W81A 3PWPD 1NMBH 5EIVA 5KSAC 3PHOB 3BGMB 2VXSH 1UM6H 4Y19A 4NYLB 3S3PA 1JVKA 1C5CL 3NCEB 3HLAA 3NH7H 3BVNB 1DQJA 3DYMA 4JHBA 3WEXA 4C55A 3KJ6L 3MJ8A 4JFOA 2FEDC 1CT8A 4MLSA 4WI4A 3T4YA 4NSKB 2YMXL 2FJGA 4IDJL 1EBAA 3OG4B 3IFLH 5E9DB 3E2HB 3ARTA 2FH8A 3KPLB 2V2TA 1YY8A 3RHWK 4MDIA 4WCYH 4LLWB 2EYSA 3BIBX 5FUOL 1W8OA 3RPIA 4LSDA 1U92A 4QY8B 3VFNA 1P53A 4KQ3H 2O5ZH 3QUYB 4DN3H 4C56A 4PBVC 2JK5A 4FTVA 3EYSL 5I73C 4MXVE 2CO6B 5DRNA 3N1MC 4UV4H 2FHCA 4P9HC 4E5XA 4WY7L 1NAKL 4WGVB 4XH2B 1FC1A 1JNNH 1T5XB 1H0DB 1LHZA 1CGUA 3QJFB 3QRGL 5T1DL 4AEIL 1LK3L 1QRND 4NO2B 3FTGA 5DJ2A 1P2CA 4GRLB 3JXAA 2F54B 1D9KB 2EH7H 3V6OE 3QEGL 5TH2A 4JFFE 3LPFA 1A4JB 4JO3L 5IB2B 4A6YA 1NJ9B 4XX1G 1QRKA 1NMAL 2Q86A 4NQVA 1MFCL 4LVNC 4V2BA 4GRWB 4P4KA 3RIAF 1K6QL 1CXEA 4KGLA 4KPHL 2R23B 5KJRL 2X9XA 4P2QA 1QFHA 5HGBB 3LH2L 1FNFA 1G6RL 2P42B 4E41B 3R0NA 1EBPA 2XWTB 3VA6A 4JCLA 4XC1H 5IFHH 4Z7WF 3IXAA 3TA3A 3VFMA 1J5OH 3BKJL 5CINH 1C7TA 1JF6A 5DYOA 3WHE0 4XNQA 1JGVH 1XGUB 1YDPB 4WVRA 3QUZB 2FWOB 2NZ9D 4P5TA 1UT9A 4G42A 4LGRB 4U49A 1P4BL 2VLLB 1ZLWH 1B0GB 1HNGA 2GY5A 2DI7A 1KJ2A 2DLHA 3DGGA 3VXME 2Z93B 2XFXB 2Z4QB 2Z92A 5D7SH 4Y4KC 1YEEL 4X7TA 2DM3A 2X1QA 5E2UL 1JMXA 2IJ0C 3C60A 1NCWL 4PIRF 3G6JB 3ZHKA 4LLDB 3H9SA 4N9OB 5GHWL 4O02H 5L9DH 3B9KA 1HXMB 2WWKO 2R0ZH 4WUUE 1OP5K 4ZNCD 3RKDC 1RZFL 4H25B 4QXUH 2B7DT 1RULH 1YC8A 5J11B 1NLBL 2FYYA 3MV8B 5FO7A 1OTSC 2R29H 3AMLA 4EDXB 2ICWJ 4XAKD 4YGVA 5E0QA 1FLRH 3TBWA 1JZ5A 3DI3B 1FZJB 3FQRA 1JWSB 3PWUA 2HAZA 2VE6B 5IF0B 1T3FB 3QIWB 3D0LA 3IJHA 3P30H 2E27H 3L3DB 4GQPH 5E8DL 1J8HA 2LTQB 3FN0L 2IQAA 5DHYA 5GGSA 1XIWB 3ZE1F 1SEQL 4CMMB 3KVQA 4C83A 4F58H 4QHUB 2W59A 4PJ5B 4WW2F 5FOJA 5C3LD 3BP4A 1RUML 1M71B 1ZWIB 4X5XB 3FB5A 1YUHB 2V7HA 5IVOA 2PW1A 3L95B 2NYYC 4HZAA 2P8LB 1WZKA 2V2WB 3LKOB 5AYUL 3QIUB 1AD9A 4BUGA 5EU4A 4I5BA 1JNHA 5INDB 3C08H 1GGCH 2JKXA 3ZTNH 1GAFH 3QBTB 4XPGH 5ALBL 1KTDB 3NZHH 1CGSH 3BWAA 5FO8B 2CKBH 4HIHA 4B5EA 1T4KA 3S88L 4HXBL 4FXGB 4IS6A 1C5BH 3VFTA 1A7PL 5I8KL 4R0LA 3ARRA 4EDWH 3ET9F 4U0RC 4QYOB 1EZVY 2AJZA 3TO2A 4HBCH 1G9ML 3W11C 4G5ZL 5C6PB 4A6YH 5HHOA 4JY6B 1KJ3H 1NBZA 1KSRA 4MAUH 3NMEA 1MPAH 1K85A 4JQVC 5GRUH 2MJWA 3MLUL 4UNUA 1I9IH 2X4NB 1EEQA 3DROA 4Y1AB 5HGHB 4KDWA 3QIBC 2MSPA 1AJ7L 5MENA 5TE4H 3FQXA 3MV9E 4JPWL 2Y07L 2EICA 5BQ7B 1JPFB 1JN6B 2XKSA 2NXYD 2WIIA 4B7LA 1MWAL 4YHYC 3RNKB 5JXAH 1KB5B 3NACH 4IRSD 3TBYB 4OI7A 1VKXB 1KJ2H 2C3VA 5IMMA 5F3HB 3PQYA 5EU5B 1QSEA 2CIIA 3SGDI 4H26B 5F7DA 1DQLH 5TGBA 3FO1A 1KPUB 1BIIA 1AKJA 1H3PL 3BKYL 1QFUH 3SOBL 5D6CA 3T3PF 2VO5A 4ODTL 1FG9C 5BRZA 3DMMD 3EO1A 3H7BB 5T3ZL 4WFGD 4XP6H 5HVHB 3LS4H 5C0BB 3N85H 4ZFOB 5EZOH 2UWEF 5HHXL 1MCWW 3I6KA 4J3TA 4X0KB 1HI6A 3RL2B 4JGJA 2VKXA 1QO3B 1B4JL 4PP2B 5A3ID 4AM0A 5F9JA 2Y4SA 3ZE0E 2I9TB 4OCYH 4OIIH 3N1FC 1AE6L 4HLZH 5DK0A 1EMTH 4FFYH 4JJ5B 3L3KA 4QXWA 1FL6A 3TNMA 4MLIA 3P73B 4JRXD 2MPAH 4AQ1B 5AZEL 2QSCH 4Y4FC 4AJ0A 1D6EB 4O9HH 1MHPL 4JKPH 5K9OB 2DQCL 2JB6B 2LVEA 1BWMA 2A6IA 1H15B 4JCMA 4EN3D 2APVA 2BHYA 4BZYA 3RBSA 4KRPC 1JHLL 4ZUWB 4L3EA 3SKNA 5E70A 2I25N 5IK3B 1DSFH 1T6VN 4LLAA 2J8HA 1WQVT 4LSUL 4LFHG 1FBIH 4WI5A 5HPOA 1MJUH 1QLEH 3OXSA 1DBML 4P9MH 2RAMA 2NY2B 3ZE2F 5T3XE 4TOYH 3ZLQC 2Q6WB 3C2SA 1UM5H 4GMTL 5J06A 3FRUB 1CLYL 2CUMA 4QF1A 4JHWL 1F4XL 2BOCB 3JWDC 4M6NH 3P0YH 1N7ML 3ARSA 2QBWA 4ZOEA 1IEAA 4MXWL 5DEFA 4L8CB 3EJYC 3QHZH 3MBEA 4G3YH 3E2HC 1EEYB 4CW1B 5EO0B 4DGYL 3PIQB 3V95A 1JPTL 1VHPA 3VFSA 1N59A 2ADJA 2HFGL 2W9LA 5HYQA 4NQXA 3H6JA 2DLTA 1V3JA 4PG2C 3RQ3A 1UB5B 3QUYC 3B8SA 3VG0H 2WZPD 3EJJX 4V1DB 1GYAA 1FAKT 3F6IA 3FONB 4E9LA 4P23B 5BVPL 4OZ4B 2OCFD 1AO7B 3DVNB 1ONQB 4PJIA 2E7MA 4P3CH 5E9DE 1IGFH 3PV6A 2H1PL 3BH8B 5E08L 4N0FB 3SDXF 4EVNA 4WWID 4GRLC 1EGJL 2I60H 1D9KC 3ZKNC 3F7VB 1XF5A 2KDGA 4ZPTB 4XVJH 2ZKHL 3OR6B 3D69B 2HP4A 4JEGB 5C9KA 3F7YB 1LDPL 3F65A 3QP3A 3W9EA 5E8OA 3WLWD 1F5WA 4XNUL 2ARWA 2GT9A 4IHOA 3R06A 3B2VH 4IRJA 4JRYE 4BFIA 1WZLA 4HS6B 3KPRD 4X6DF 1R6VA 3TT3H 3HAEB 4ZYKB 1MJ8H 5HHNB 1P9MA 3SGJA 2XWJA 4ODHL 3RWGA 4P9HL 5DA4A 1RPQA 2FJFB 2NY0B 3THMH 2HVJA 1AY1H 4WU5A 3FOLA 3BMWA 1IC4L 3MOAH 5F7EH 5CILL 3OWEA 3QUZC 3CLEL 4YK4B 4Y4HD 1J12A 1AQKH 1AXTH 2EYTB 5E8EA 5E8PA 5C0RH 2W38A 4FNLL 2P1YA 5I66A 4X9FA 2P47B 4G9FD 2J4WL 1CIUA 4GRWE 5GJSL 1PDKA 4G6KH 3ROOB 4D3CH 4N5ED 2OR9L 4OLVL 4E41E 2B4CH 1G1YA 3RA7H 4K9EH 4MNQB 4R7NA 2IBZX 2EIZA 2JLLA 2Z31D 5K9JL 3PP3K 5EZIL 3HZYA 1DQDL 3WXVH 5EUOB 1PKQE 1TVBA 5F7KC 5KVDL 5J11C 1EXUB 3EO0B 3OKKA 3CFKA 2WBJD 5M7QA 3MREA 5FYKE 4P2RD 3QSKB 3MRMA 4LCWD 5CGYC 4HUUA 4X80H 3WXWL 3L5HA 5JMOC 1WAAA 5E1AB 2BERA 1A7OL 3QIWC 4WI8A 1Q1JL 5F7YC 4U1NB 2OJEA 2LTQC 1JE6A 3G6JE 3ZSSA 4LEOA 4D9QE 1KPVA 4P5KB 3MO1A 4UTBL 1XIWC 2W60B 4PGCA 2RGSA 2BFVH 1PG7H 5IVZB 4LSPH 4NPYA 3AM8C 3MV8E 3QO0B 3S5LG 3RHWF 1WVZA 3WL9B 2VDOH 4Y2DA 5I1AA 2ZZUT 2KPNA 3MCKA 1RUKH 4KROD 3TZVD 5D70H 3UYRL 3AREB 1NFKA 4PYHA 1BLNA 4TSCL 1RZ7L 3QIUC 2VR4A 2RJMA 2YRLA 5IESH 4BFBD 2C3WA 5EWIL 2RQ8A 1DEEA 1U8IB 5IM7A 2WP3T 4YFDB 4F15C 4LSRL 4F9PA 1H3WM 2XKNA 3W0WA 1N6QL 1NGPH 5AG9A 1LO2L 3C5ZB 4GKZB 4MAYB 3QT2A 3VJ6A 5HI4D 3UROR 3DIFB 1OGAB 3ZKQD 1ADQL 1E4XL 1MFDL 3MYJA 1NAML 5EPMA 5J13B 5I1GH 4LDEB 1Q9OB 3MUZ1 4PJ8D 1CDYA 2VQUA 3BPLB 4NZRL 4HPOH 4LHUG 1T83C 5FYLE 3L5WA 4NO0D 5C92A 3VGBA 3HMWH 4DFHA 1CFNB 4LSTH 3FHAA 2R2EB 1IAOA 3B5HA 3SDCB 3GEWB 4JFDA 3MR9A 5EOCL 1W0YT 2CLVB 2HLAA 2X4SB 2BNQA 4PREA 3QWOB 2OL3B 1I8LA 2GJZA 5A16B 1T5WB 3SO5A 1QD0A 1EAPA 3VI3F 1ZTXL 4I3GA 3P40A 4TRPL 3MRBA 4LNVA 4L8DB 3V4UH 4KDTA 2C1PA 4PGEB 2ZCLL 4GSDH 1UCTA 1YEJH 2E9BA 5JR1L 1KEML 2FSEB 4DVRL 4Y1AE 4YUEL 1M7DB 1HEZA 1FFOB 1IM9D 2JJWA 3MXVH 1J88A 4HUXA 4LARL 4CRPA 5CEZL 1J7VR 1TMCB 2E6PA 3HZVA 5D7LB 2M8XA 4MGXA 2Q1EA 5IV2A 5HVHC 4K94L 3NN8B 1BEYH 1JPSH 4HJ0C 2OZ4A 5I1HL 3GMPA 4J4PA 3ALXA 1MIEL 4KY1H 3P77A 3OL2A 1ZLWK 1JGLH 3SE9L 1R5IA 3CDGB 1RHFA 3U9UB 2V9RA 1AQDA 2HKHH 1J0YA 1FZOB 3VXPA 1IFHH 4O2FB 4ELKB 1UWGH 3QDMA 2CJUH 35C8L 3HRZA 2FLRT 3QFJB 3G6AB 1E4JA 4OAWA 3RVTC 3ULUH 3MA7A 4ZO7A 3Q5TA 2OP4H 4KK9C 1D5BA 3G5YB 3KPTA 1CI5A 3RX7A 2X4RB 2C1OB 3FO2B 2WUBH 3KYOA 1I3GL 1MHEB 4FFZH 1UM4L 5CBEA 3QCUL 1EO8H 5FB8B 1JUFA 1A22B 2YEZB 4LQFL 2YD8A 1U9KA 3FFDB 4F80A 4YBHA 4BH8B 3JTTA 2W0PA 5L7XL 1I7RB 3G5XB 1C5DB 1YN7B 2KZWA 2JJSC 2GCYA 3B6SB 4XCNA 1NGXB 5KSAD 1KJMB 2ZCKL 5D1XB 4JR9H 1OP9A 4ZPVB 5DA0B 3V6FB 1FG2A 4NM4L 2ATKB 3UJJH 4JM2F 3IFPB 1EPFA 3QQNA 1DQTA 1LD9B 5C6TL 2NY2C 4YDJA 4K3GA 2X9YA 3ARBB 1IGJB 4GG8A 5TDNA 1SYVB 2FEDD 4WV1A 5T33L 1UKSA 5GGVY 2PO6B 2ZJSH 4MS8C 5FV2A 5J3HC 4NDMA 3H9ZA 4FFWC 1T0MB 3BMVA 5CIPB 3SDAA 1U41A 5C09A 4R90H 5D72L 4EXKA 4GAYA 5J9PB 1IGMH 1KNOA 2GJ6D 4FRWA 5ITFB 5HYFA 1IC5H 5KVMC 3O3BB 3FB6A 5EN2A 1B0WA 1DVFA 1ZEAH 4GRMA 1S7TA 2XRAH 1BFVL 3JTSB 4XZUA 3TYFA 1H8NA 4FG6C 1CE1H 1W0WA 1YMHA 2C3GA 2YWZA 4MJ6A 5BOPA 1MNUH 2GJJA 1KXVC 3MBXH 5IBUB 4M93B 1AIFB 4APQB 5A40E 5DQJB 3WSQL 4P23C 4I9WE 3MFFB 5FA3B 4O4YL 4PRHD 1DLFL 2H32A 4BQBA 4GLRH 2NY5H 1Y0LA 4MJIE 5ESAB 1P5VA 1F11B 4U3XA 4L5FH 1OAKL 4HKBB 5DJ6A 3TV3L 1QSZA 1WBXB 1OLLA 1CDIA 2QHRL 3ZT6A 4KKBC 5DLMH 4DAGH 1JZ7A 4DKDC 1WEJL 5J1AA 1CLOL 4KJPC 1TZIA 2YD9A 1XH3A 3BZ4B 5FDWB 2OZ4H 1UH4A 2AXGB 1JI2A 3OKDB 2VH5H 3D9AH 2DL2A 3NIDE 43CAB 5B38B 5JXEA 4L4TB 1DLHA 4F8QA 3O3AA 3E3QC 5ISZA 3ECBA 1CFVL 4Z7WE 1TCMA 3GB7A 3QYCA 5DR5H 1OP3H 4Y4KD 4L9LB 1CXHA 4NBZB 1MQ8A 4OF6A 4UBDD 5GSVB 5ETUA 4ZOAA 1EVTC 5IW6B 1TVHB 3IU3A 2KBGA 2R0KH 3Q3GB 3QDJD 4YK4C 4DCQB 3WBDA 4XNXH 1OAYL 4PS4H 3O6LH 4UQ3A 3MUGA 4WDIA 3VFOB 5C2BH 2AQ3A 1JYWA 5HY9B 4YXHL 2NTFB 1RJZA 5DQDH 3RKDD 5LXGL 1NC4B 5L8JB 4QNPF 3TNNA 5C8JB 4Z0BL 2R1WA 2EDWA 2GFBB 1T2XA 4M4RA 3AS1A 3F62A 4HUWB 3BESR 3PGCB 2G2RB 4WENB 1KG0B 1RK1B 5I8OL 3BP7B 5EUKA 15C8L 3SY0A 3BDBA 3MRGA 5A2KH 4ZFFB 4UT7H 2CLRA 5GS2H 3I3BA 3BRDA 4I4WA 1YMMB 3MFGB 4JDZB 3INUH 3OKEA 3K4ZA 2EKSB 2E9WA 1IAKB 2VC2H 1H3TA 4D9RE 2C7UA 3BXNA 4S1DC 2DWEA 4PJBA 1FNEA 1MI5A 4X6BA 2NYYD 3REWB 5I1KH 1X5AA 4YXLH 3NIFE 5KANG 5AEAA 1B0RA 3BKCL 5EUOE 4NUGH 1XGYL 4BH7B 4FQ1H 4NQSB 1X7QA 3MV11 2CDEB 1L9MA 4XGZA 3T04D 1MFEH 2XA8H 3LS5H 3CFBA 2ATPA 1WWCA 4OLYL 3AREC 1OSPH 1F4HA 4ZUVA 2AKRA 4NGHH 4KRLB 4MYWB 3T77A 3BEWB 5C71A 1L4IA 3H42L 4KTEL 3VWKD 5IBTH 5DEZA 1MF2H 3KXFB 4OGXL 3W11D 1WBZA 3GMOB 3ZDYE 3LN5B 3MLXL 5CEZD 1BD2D 5I0DA 4URTB 3U7YL 3C5ZC 1Z9SA 5DEGA 1LO5B 3ARDB 4K7PH 4MAYC 2XWBB 1KT2B 3JSSA 1RU9L 1U8MB 1YEFL 3O8XA 3X14A 3RTQA 4NCDA 4JVPA 3QIBD 4QOKB 5J13C 2B0SL 2J12B 3HTLX 2DQIL 5C70A 5EO9A 3UTZA 1RK0A 3MGTA 3BPLC 3LKRA 4Y16B 5ID1B 1HCFX 2LU3A 4N8VA 3TO4A 4D0CB 3KPNB 2BY0A 4UUJA 4ENEC 3WFCH 1QSFA 1CBVH 2UY6A 1T7ZA 5DD0L 1OHQA 3SDCC 2VZTA 4OT1H 2GK0B 4NC1C 4HT1L 3OGCB 4NNYB 1RD6A 4F37F 1OGAE 3D85A 5JW3L 2G9HA 2AP2A 3REVA 1BFOA 3V52L 1IGYA 4FZ8H 2AGJL 1J1OL 4C54A 3MOQA 2ADIB 3MRRB 3SE8H 3T0BA 1EZVX 4PJCB 1OD9A 4Q0XH 4YFEA 1SJVA 5HHVH 3HNVH 4RWYH 3ARQA 2GKIA 2FIKB 2FX7L 3K80A 4IJ3B 4FQHA 5CJXA 1ZHKA 4PRNB 3UMTA 2Z35A 4Z7OE 2F9BT 1EVUA 2UWEE 3GM8A 3BH9A 4PRIB 5LQBL 4GG6F 1U8NA 2DWDA 4ZG1A 3S36L 2V7NB 3VD5A 4Y5YB 3VXTA 4QTIH 3ZYZA 4MX7B 2HKFL 2AVGA 1KCRH 1U93A 4QRPA 5AUMB 4HFWA 3BKML 5C0FB 3PL6B 3K74B 3GO1H 3IDGA 4Y4FD 6FABL 2E6QA 3SCMA 2CGRH 4OQTL 1N4XL 4RWHA 4IIQB 5DJ0B 1AGDB 5F88A 1INEH 1N64L 1C16B 4OJFL 4C57C 3WKMH 2E7LA 3V6OA 1Q94A 1KENH 4KRPD 5JIIA 1T03H 3CMOH 4LU5H 5T3ZE 3UPRB 2VLRB 2YZ1A 1F45A 3CU1A 2F19H 3VH8G 3WUWG 3VG9B 4NM8L 4UIKH 3QEQD 1NCUA 3LZFH 3OKYA 4LVOB 5L2JB 5BVJB 4HS8L 1QNZL 4PJEF 5IB3B 1NBVL 3A0OA 1JWUA 1JWMA 4CJ1A 1ZANH 4F7TB 3X13B 4WWKA 4ZD3H 3DO7A 3C5JA 3EOBA 3L5XH 1NCTA 4LNRA 3MRPA 4NKQB 3VXNB 3IFNL 2EC8A 4QTHA 3ARBC 4PB0L 3VXMA 1OCWL 1J11A 3EJYD 3FCTB 1QEWA 3BP5A 5E9DD 1RQ5A 2DQHL 1IAIM 3QUMA 2IQ9H 2PO6C 4NN6B 4Y8AA 1QACA 1GJIA 4KKNA 5ERWA 3U0WH 1DQML 5DC4B 2ITDA 3P0VH 4WUUA 5F7NC 2AV7B 1ZT4A 4ELMF 1S7UB 3PDDA 4DGVH 5T5FH 2YD4A 3OJ2C 3BYYA 1ZT7A 1X5JA 1I3RB 2P24A 3MLTA 1UENA 1JNLH 2J2ZA 4Q9RL 4NQDB 5TF0A 3FHQA 3GMMB 1FIGL 2FO4A 3LEXB 4WI3A 1S9YB 4WUKL 4YDIH 5E2WL 5BZDA 1Q9WA 1L7IL 1RUAL 1YEGL 1IAIH 1RFDL 4M93C 3CDYA 4JFPA 4APQC 3V5HA 3D2UA 3BE1L 5FOBA 1F3JA 1S7SA 2F74B 1KOAA 3MRQB 2HRPL 4GRLD 3RU8H 2F54D 4YGAB 5DSCB 1D9KD 1NCNA 3D6GA 3ZKND 32C2B 2A6JB 5IB4B 3P11H 2W9DL 3IAQA 3SDXE 5ESQA 5IT2L 3MA9L 3V7AG 5J6HB 5DVLA 3B2UC 5LBSH 1E27A 1FO0B 3QWRA 5JLZA 4RFOL 4OCWL 1JTTA 4NCC1 2FGZA 4UDUB 4BQ8A 3DUUB 1R3JB 4AIOA 4EBQH 3WIFA 2ESVA 1G7HB 3BEVB 3QHTC 4K3DH 4PJ9B 3HRPA 1HXYA 4XC3H 1S7VA 1TZGL 1LEKA 4X6DE 3HN3A 3N50A 1V5JA 1P7QA 3QUZD 1OAZL 3IKCA 1JZ2A 5FYKD 3UTSA 4CBPA 1QA9B 4TNWK 2GUOA 4MA7H 3JV4B 4L9LC 1EO5A 5SX5H 3UTTB 4R4FL 1M4KA 1JZ4A 3L6FB 2UYLA 3DXAA 3GSQB 2VQ1B 5I19L 4H20L 1Q9LA 1A6ZB 3SE4C 3JBG7 2YSSB 3KPQB 2QR0A 4PFEA 2H26A 4YNYB 4XPTL 2AJYH 4X7SL 2P5EE 5BV7H 2X4OB 1VGKB 1T2QL 4R3SB 2AJSL 1A9EA 2BSTA 1Q0YL 5B8CA 3QG6B 1HCVA 3VWJA 4Q9QL 4PJFB 5KTEH 4R97B 4GAGH 5CGYD 1BVKB 3MV9A 2VL5A 2ZWLT 1VFOA 2V5TA 4RX4D 4ZAKB 1LO0H 5C0JB 3AAZB 3U79A 2VIRB 1JGUH 1HWHB 3QIWD 3UJIH 4XHJD 2OQJA 3F7QA 1QBBA 4LAQH 4UT6H 4S0SD 5D7JB 3DURB 3QJHA 1KLGB 5F7MC 3B9EA 3WIHA 1A7BA 2R4SH 1XIWD 4HWEH 1S3KL 5DJ8A 3S35X 2FZ3B 1P7HL 1MFAL 4UNTA 4E42B 2C3XA 2QQLL 4PJ5D 4LKCA 4Z7UF 1MH5A 4I77L 4IMLA 4NHUA 3GGWA 1R5VA 1PSKL 1FYTB 1RZGB 1H8SA 3E6FB 4ZO8A 4Z78A 1MCPL 5DK3A 3QIUD 1F42A 5HYSB 1QYGH 1BOGB 2FH6A 4M1DL 4BQCA 3LRGA 5E6IA 5KZCD 4WHYG 2D7NA 2DIAA 4R7DA 1Q8MA 4HIEA 3T0EA 1SQ2N 1MAML 3C8KA 4JKKA 3I50L 1KFAH 5B21A 1WC7A 2OSLA 3DBXB 1QFWM 3M17A 4QHMA 2E3VA 1QZ1A 5TDOB 2KZ1B 2PXYB 2YXMA 3TN0A 2AXHA 5EA0L 4WEBL 1S5HB 4GLRI 4HEME 5IG7B 1OWWA 2DKSA 4NJAL 2OMNA 3QXVA 4LCUB 4NOFA 4OV6F 3T1FA 2JIXB 4OF3A 1TLKA 3GM0A 5SWSA 5HYEA 3PWJA 2MHAA 4HJJL 5C07B 1FGNL 5ALCH 4FXLA 5HDBE 4Y16C 1XGRA 4GFTB 1LEIB 2XYCA 2BP3A 3VA2C 3KXFE 3PWVA 4P2OA 2DQTH 3C6LD 2NQCA 3DETC 4L4VD 3TH4T 2NX5D 2VLJB 1L7TL 1I8KA 3QNYB 5T5NG 2V9QA 3QUXD 4H88H 2IPTH 3NIGF 1IE5A 4POYA 3VI3E 4H1LG 2WINB 2JB5H 2EE9A 3ROLA 5KVGH 5CWSA 4U6YA 1YQ2A 2PETA 3CU7A 4IBLT 2M1KA 4QOKE 3KWWB 2CR6A 3MRNA 5A43C 3I75A 2VDML 3ELAT 2CKNA 3RBGA 4HV8B 1PEWA 2EIEA 2VDNH 5C0BD 4WNQA 5LG1A 3JV6A 3LEVH 3RZCB 1HINH 2X4TB 4CVZA 4RA3A 4IJ3C 5I18L 1MIMH 4BZ2H 4EI5D 2PYEA 5IFAH 4JFQB 3CFCH 1FE8L 2AK1H 3TIDA 1OP3K 2IANA 1QVOA 4JKMA 3TBSB 2BNRD 2OX5A 2FNBA 4PRAB 1WT5C 1WF5A 2A74B 5IVXF 2K1MA 3WIHH 4GBXB 1YNKH 3PL6C 1N5YH 2H3NB 4M8QA 3D3VA 1KN2H 2VUOA 1M05A 2OL3L 4W70A 4WJ5A 5EBWB 2HWZH 4IIQC 5K9QG 3T8XB 4YWGL 2NZIA 2I24N 5D2NA 2WUCH 3P9MB 4XPAH 3MGOB 2AEQL 3BGFB 4QT5B 1WFOA 4G8GB 4QRTB 4JO4L 3IDUA 2CRZA 4HQQH 5GGSY 4KTDL 2W0FB 1R3HA 5JPMB 4W6WB 3DVGB 4G6MH 3U83A 2D4DA 5ID0B 2AK4D 4NN5B 1D5MB 2XY2A 4UDTA 3VG9C 1FFNA 4JRYA 2D9QB 4Z77A 5D8JL 1YN6B 1CDGA 1HQ4A 2X44D 4LVOC 2Y9RT 3FQWB 1YEHH 2F5AH 5JZ7C 3DPBA 4RA0C 1S78C 5B4MD 3T4AA 4F7MB 2YWYA 4GKSA 3X3GH 1A6PA 5IHLB 5C0NC 3PWPA 1D5XB 4XBEL 5CSZA 1FJ1A 3K2MC 4MS8D 1XF4A 3N0PB 5C0CE 2EDDA 4FFWD 3WDIA 1ACYH 4G7YL 1R24A 4XBGA 4X9GA 2F8VA 3S4SA 5CMAB 4NN6C 4HUMB 1JRHH 2AEPL 1A1OA 1P6AB 1D5IH 4UU9A 3HHRB 4XCEB 4FG6D 1NFDF 1KUMA 1JHKH 3Q5YA 4PG9A 3I02A 2MTPA 1UVQB 4G8FB 4V1DD 3C5SB 1PKQA 4N0YH 4PB9L 2BVQA 3U4BL 3BPCA 2FX9L 3L9RB 5DFWH 3LIZL 4P23D 1LP9E 4FQQB 3RWJB 4OCXH 3QHFL 4ZTOL 2AJVH 1AO7D 2R1YB 1K4DB 1HOCB 2OJZH 4JFYB 2BVOA 1BFTA 1RIVL 1TETH 4OCSL 4X6CB 4HS3A 1JK8B 5DVMA 5KS9F 4GXVL 4FQLL 4NKIH 1HHJA 3QRFM 4KKBD 1S9WB 1A3RH 1U8KB 1WFTA 1U3JA 4NRYB 5E4EB 2R0LL 1WBYA 5ILTL 1MRCH 3CDFA 4KJPD 1QRNA 2XPGA 3UPCA 1KEGL 3MRCA 1A2YB 3RUGF 3BZFB 4Z76A 3A67H 1GRWA 2YC1A 5F7UA 4IRZH 3I3EA 1FYHB 3L3GB 2R2HB 4YAQB 2XT1B 1CICA 1U3HD 4YHML 1F13A 1NEZA 3VXUB 4LCCA 1GPOH 4RMVA 4PJ9C 3BP6A 5IJKC 1A0QH 2XICA 3CSBA 3G5VA 4ZUUB 4F7PA 1MJJA 3STLA 4OV5A 2VERN 2EDHA 1JV5A 3BJLA 3NCBB 4Y19B 4NUJA 5DRWA 4RFEA 3HLAB 1DQJB 3NCJH 3WEXB 3MJ8B 1CGYA 4JFOB 3EO9L 1CT8B 4FS0A 3T4YB 1MCEA 2FJGB 4JG0H 4OF5A 1QHOA 2NNAA 4YHLH 2V2TB 1YY8B 4MDIB 2EYSB 4MNQD 3RPIB 4QNPE 1RSFA 2PKDA 1OAUH 1U92B 3KYKH 1CQKA 5F6HJ 3VFNB 3VFUA 3ULVL 4WGWB 4RMQA 4C56B 2JK5B 4FTVB 2IEPA 5J89A 5GS1A 4AH2A 4FXKA 1A7RH 4R97C 5DRNB 1QKZL 2DLFH 2WP3O 3TVMA 4ZAKC 4E5XB 1T1WB 3OAZH 3UTTE 3VH8A 3WUWA 2IFFH 3LKNA 4OF7A 3TPUA 4WO4A 1KGCE 1HYRC 2V5MA 1C08A 5D7JC 2VZ1A 1ZLUH 4HC1L 4S1DD 4AQOA 1OQOA 4LCYA 4MA8L 3FTGB 5DJ2B 1P2CB 4NO5A 1XMWA 3WUZA 4J8RA 1B90A 3RY6C 1TJHH 5IFJA 1S7XA 5TH2B 1MAKA 3C2AH 4FMFA 1INDL 4LSSH 2DQEH 4PJFE 1OSZA 5KG9A 5E56A 2Q86B 2B2XH 3W2DL 3CPLA 1NLDH 5GS0H 3E6HA 4P4KB 3ULVF 3ARED 4QXTA 4P2QB 3QDGD 5GRXG 2OK0L 3QEUB 1C8PA 1YYLH 1RUPL 4BYHA 1P7KA 3O6MH 3IXAB 3TA3B 3VFMB 3K2UL 2DJ4A 4PLJC 4LSVL 1XF3A 4ODWA 5DYOB 4XNQB 4G6JL 4GOSA 4HXAL 3OAYH 3SO3B 5HI5C 2BDNH 2BVPA 4P5TB 4OCLC 4G42B 4DOHB 3MJGX 3C5ZD 1IVLA 3DGGB 1KJ2B 1NQBA 4MAYD 4LMQI 2Z92B 4X7TB 4BZ1L 1IAII 2AI0H 5FGBA 2ZG3A 4KVCH 1BAFH 2H2SC 5ACZA 4NQCE 3C60B 3MODL 2PXYC 2XG4A 4XPFL 1WFNA 2K9UA 1YPZA 3ARGC 4AEFA 4OIAA 3B9KB 4KHXH 5I71B 4OZGF 4LDLB 4YEFA 1RY7B 2VXQL 2X1XR 3I2CL 5T1KD 4ENED 3X3FL 4JRWA 2FYYB 5FO7B 3IJSA 4N0UE 3J7HA 4OTXL 4YGVB 1UCBH 3TBWB 3WFBL 4KHTL 1CR9L 3SJVD 8CGTA 1BGXH 4X8XA 1KCSL 3PWUB 5FCUL 1JJUA 3D0LB 1A02N 3IU4L 3IJHB 2D0FA 4P2CG 2APWA 4I48A 4QRQA 3NAAL 1J8HB 1RVFH 1ED3A 2IQAB 3HI6L 5DHYB 5GGSB 5H37H 1ZT1A 2XN9A 5IGXL 4TVPH 4IRSA 3OKOB 2XZAH 5H94A 5CCKH 5C0AE 1I4FA 4C83B 4FQJL 4BM7A 2ADGA 2YBRA 3BP4B 4JM4H 4XVSL 5HGAA 3CZFA 5C07E 3FB5B 5D7LD 5I30L 2VISA 5E2TH 2V7HB 3QCTH 2PW1B 4WHTA 1BWWA 1NGWA 3RZCC 4MZ3A 3EOAA 3BSZL 3GBML 3TT1H 1AD9B 2VLJE 1I9JH 4I5BB 1G0YR 1JNHB 5E99H 5EU4B 5DMJB 5SX5K 5I9QB 5FIEA 4M43H 4RZCA 3BWAB 4PJAF 1EJOH 4HIHB 2MCG1 1T4KB 1UXSA 2VJXA 1RZKC 3QFJD 1U6AL 4TSAL 4MJIA 2X89D 4IS6B 3HFML 3VFTB 1F6AA 2FX8L 3FOMA 3TBTA 4DTGL 2QSTA 4IOIA 3H0TA 4R0LB 1JIBA 3WO3B 1BP3B 5IMOA 3LQZA 4WFHE 2AJZB 3TO2B 4XAWH 1BHGA 1RI8A 3FT2A 4G9DA 3LRSA 5HHOB 4WTZG 1NBZB 1S9VA 2OXGA 2DBJA 3GSNA 1FDLH 3BGFC 1CQYA 4EN3A 4JFZL 1F2XK 2X40A 2A83A 3O9WA 1IBGH 3DROB 4U6VH 4DW2H 1ZXQA 2ED8A 3U0PA 5MENB 3CK0H 4NN5C 5AAMA 4JFXA 1NSNL 5D5MF 2CXGA 3K4DA 1UQSA 4IMKA 3S37H 3AS0A 4Z7WA 5FYJL 2WIIB 3ARBD 3BQUD 3VW3L 5GS3A 4DUVA 5L0QB 2DYPD 2C3VB 4S1QH 5IMMB 5MEQA 3PQYB 1HIMH 2PO6D 1G7LA 1QSEB 2CIIB 5F7DB 1U8JA 3NFPA 5TGBB 3FO1B 3U1SH 3IDMA 1BIIB 1AKJB 5D6CB 3X12A 1UA6H 2J1KA 1CF8L 3ZL4L 5BRZB 1T04A 2V5YA 5CJQL 3EO1B 5MP6L 1KC5L 4E0RA 5JDJA 1VACB 2DL9A 2P46B 3VI4F 4CN6A 1HHHA 4ELME 3I6KB 1HI6B 2P43B 1G6RA 2YPVH 3SE3C 3CIQA 1IQWH 3TYGL 4LKXA 1T1XA 4APQD 2HJLA 2MFNA 4AM0B 5F9JB 3DV6A 4LLMA 2ARJA 3AXLA 4JO2H 1DBAL 5C6WH 5DK0B 1S8DA 4K55A 3L3KB 4NWTL 1NL0L 1D6VH 3ALPA 1FL6B 5IMLA 1DFBH 4FZEH 1KCUH 3TNMB 1H3GA 2APTA 4YHZH 4KZDH 1B6UA 1UZ6F 4EOWH 2D03L 1NGYA 4X99A 1YNLH 2QADB 4KI5C 4RRPG 3B2UD 2DB8A 2A6IB 1NKOA 5ADOH 2W92A 4WW2A 5E4EC 3FQTA 3DECA 1CXIA 3N1QC 1EFXA 4OZIF 4YE4L 3WHXA 5EU7E 2JF1A 3CNKA 1JL8A 4X5WA 4L3EB 4TNVK 3SKNB 4AEEA 1EHLL 5SWZD 4NHCH 1YYMH 3NABH 1ES0A 5I1IH 1KPRA 4L4TD 4M7KL 4YIQA 3OXSB 3AB0B 3WHE1 3CDCA 3CSYA 1SHMA 3SGKC 1GGYA 2VZUA 2XACC 3KPRA 1C5CH 3CXDL 4NBXB 1AGEA 3H3PL 4PY8I 1N26A 1ZA6A 3KJ6H 4QF1B 1SEBA 2YMXH 5E7BA 4IDJH 1I7UA 5D7KE 3L3OA 2AEWA 1RZ8A 3O6KL 1IEAB 1JF1A 5DEFB 3BOVA 3BW9A 4Y4HA 5C08B 3RPKA 1NC4D 4G43A 4K3HA 5FUOH 3MBEB 4PRPE 4QRRE 3OKNB 1I7TA 3VFSB 1N59B 2ADJB 2D7PA 3EYSH 3OZ9L 5HYQB 4JLRA 4NQXB 1FQ9C 2QSVA 4LIQL 1OAXL 2DF3A 4WY7H 1NAKH 5CHNA 4D9LL 4Y19E 2EXWC 5AWNL 5CJ8A 5FGSA 5DS8A 2PCPA 4K2UL 3QRGH 2O5XL 5T1DH 4MXQC 4AEIH 4QGTA 4WHYH 3RIFK 1LK3H 1YMMD 2ITCA 4P2RA 2UVFA 4PJIB 3GMLA 3PV6B 2EYRA 2DTML 3QEGH 1XF2A 4MD0A 2XXMB 4UINL 1M7IA 3SKJL 3TJEL 4JO3H 2DLEA 3BO8B 4OLUL 4EVNB 5B3JF 1NMAH 4KH2A 3MLWL 3MJ6A 1R3IL 1N3NA 1MFCH 2CH8A 1HHGA 2G5RA 4RISL 3UTQA 3AGVA 2A73A 3HG1E 1K6QH 4GMSL 3CX2A 4FTVE 4KPHH 5GGTL 5KJRH 3CLFL 3IXTA 4KAQL 4O2EB 2UWEA 3LH2H 5E8OB 1G6RH 1QFOA 4P4KC 2GT9B 4IHOB 4IRJB 5FM5M 3OXRA 1JRHI 3BKJH 4BFIB 3B4NA 2XKUA 5DD1L 1MWAA 1I1CA 2XWJB 2C4FU 5D96B 1T89C 3RWGB 1P4BH 2HVJB 4WU5B 3FOLB 3FL7A 1O0VA 1KELL 1WZ1L 5D93C 3VXRE 1YEEH 3SO3C 4KJYA 5E2UH 4P5TC 5D1QC 4NBYB 1F58L 5E8EB 3VGDA 5E8PB 3MYZA 2DN7A 5I66B 4HG4J 1NCWH 2J8UF 3WKNA 5GHWH 3T08A 5EOTA 5L8KB 5DQ9A 3C60C 4P2QE 2W9EL 1RZFH 2H8PA 4MSWA 1NLBH 4NFBA 4Y16D 1Z5LA 2OBGA 3LHPL 3B9KC 4NWUL 2H45A 5I71C 4AL8L 2EIZB 4I2XA 4PJ8A 3HZYB 3EUUA 3DETD 4FQXA 1TVBB 3VD7A 4OD2A 3K8LA 3OKKB 3CFKB 5D1ZA 5C0DA 4NO0A 4X4ZA 5D7IF 3MREB 4DOHE 4I1NB 1FVDA 4QEGA 1X5XA 3MRMB 3EW3B 4NIKB 4HUUB 2JE8A 5E8DH 3FN0H 3WN5B 4EIZC 5T1MA 1SEQH 3NIGE 3WNLA 3KLSA 1YA5A 4L1HA 2OJEB 3QB7C 1KPVB 1RUMH 3H9SE 3CAFA 3MO1B 4PGCB 4CAGA 3V4PL 4N68A 3OJDA 3KLHD 1U36A 3KR3H 5JW4N 4NPYB 1QR1A 4U3HA 2FRGP 5AYUH 4PRID 4Y2DB 4YHKL 4OCRL 3MCKB 1IM9A 5JQ6L 2CK2A 5L6YL 2LE9A 2MCPL 2M26A 1BLNB 5ALBH 1MCOL 4ALAL 3GNML 1J8HE 3PL6D 2LQRA 5I9QC 3MMEA 3S88H 4HXBH 1DEEB 5IM7B 5KANI 1A7PH 1J8KA 5I8KH 4U1IA 2XKNB 5D6DC 4XCCL 1LDSA 2CD0A 3W0WB 1G9MH 4PV8A 4G5ZH 3H9HB 3SDXA 4R0LC 3VJ6B 3TCXA 1FC2D 1H3XA 1NEUA 3BYTA 2QHLA 3MYJB 5EPMB 3MLUH 3PHSA 5L88L 2CR3A 2VLRD 3HE7A 3T2QA 1AJ7H 3IETA 3OAZK 1SJHA 3L5WB 4JPWH 2Y07H 3GRWL 4R9HA 1DR9A 4HJGA 5JZ7D 5GPRA 2UVEA 1S78D 1ZV5A 1IAOB 3UTPE 4X6DA 1MWAH 5C0ND 4JFDB 2HLAB 2BNQB 5AAWA 4PREB 2GJZB 1EAPB 2NCMA 1SBBA 2NLJA 5HHOE 1RZKL 3MRBB 3BKYH 1H3PH 3SOBH 4RNRA 4F33A 2C1PB 1EGJA 2PR4L 4IM8A 1SMOA 1U8HA 3Q5OA 4ODTH 1A4KA 2VXTL 2P5EA 1BPVA 5EO1A 5T3ZH 4J3OC 1HHKA 1F6FB 1HEZB 1TTUA 4HUXB 5HHXH 3HZVB 2DI8A 3OR7A 5IV2B 5B39G 3U6RA 3WIIL 1NFDE 5DO2C 4HIXL 1B4JH 4NQDD 3GMPB 3OAYK 3U48A 2SEBA 1AE6H