1MRCL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL01
2R39A 4KJWC 4Y4FD 5EPMA 2V2WB 4HMCA 5HYQA 1MJJB 4KY1L 2LQRA 4Y19E 1OARL 1P69B 3L6FB 1FAIL 5EO9A 1IGIH 2NNAB 1WCQA 5JDSA 3UTPD 1F3DH 1OT1A 1A6AA 4NP4H 4ORZC 3WUWB 1G9ML 2IH3B 4G8EB 4AG4H 5K9QG 1OM3L 2QBWA 3ZKNC 3HC3L 4PRAB 4I2XA 1C8PA 4X6FA 1QSFD 3JV5A 3VI4F 3DETC 3VD4A 4LSRL 4OZGE 4QRPE 2FYYA 3I9GL 4K71B 4BQ8A 5DJ0A 2FIKA 4ZUSA 3HPLB 3STZA 2QQKH 2FLRT 3SE9L 5BVPL 3VD3A 2JK5B 3EYOA 1F11A 3BX7C 1GIGL 4IBLT 5IIEB 1N0LA 4WO4A 3HZVA 4Z8FL 4NO3B 5HYSA 1KPVA 2E27H 3LEVL 3NTCL 5TF1L 4OZIB 3H0TA 1AGCB 1NC4B 4YXLH 1ADQH 4NWUH 1C12A 3QDME 3MRJA 1JF1A 4XVTH 1OHQA 3BZ4B 2YWYA 3LSOA 3OSKA 2X9YA 3E8UL 4YUEH 5IBUG 1N5YL 4NO5B 1T80A 4D2NA 4YDIH 4I77H 4Z7VE 1FG2B 3I84A 2VXVH 2A73A 1IGYB 4K94C 3BYYA 4OFKA 4RAUA 4KK5D 4P9ML 1BREA 2VDRH 5AZEH 4LQFL 4TSAL 1HXMA 4HV8A 1ZGLA 2DTSA 3EYVB 4M6NL 3D1MC 4CVZB 2VE6A 4HS3A 4R7NA 4G3YL 3ARPA 3MCKB 3BO8B 3CLFH 2ZG3A 4K8RC 3GSWA 3QNXB 4OLZH 1NDMA 4PJ9D 1MHPH 3SDXE 2MHAB 3PDDA 1QHPA 4TUJB 4P59H 3X11A 5C8JA 2AJSH 4OGAD 3T0WA 3TA3B 1JP5A 5JLZA 4NC0B 3SKNB 2I60H 3DVNB 1KN2H 1YMHB 5EH1A 1U8KA 1CGWA 2YMXH 3T65A 1CLZL 2X70A 2WWKT 3H6JA 1I3UA 1FFPB 2H1PL 4RFNB 1KTKE 4AJ0A 1BBJB 4C57C 1AR2A 3GB7B 3AU1A 3CDCA 3BAEH 1RIHH 3GSVA 3FRUA 12E8H 3T08A 2VDQL 3TF7C 2AXGA 2F53D 4IRSA 1ZAGA 4XBGA 4Z5RA 4KKCC 4WENB 5EOCH 4R2GC 4X4XB 2B1HH 2C1OB 5ILTL 1ZVSA 3DPBA 4PIRF 3PUCA 4YHML 3VFGL 3GBML 1IEAA 4ALAL 1FBIH 2ED9A 5C0CE 5GGTA 1NLDH 1JPSH 1U0QA 5JXEA 4KI1A 1IILE 1NCCL 4FXLA 2VL5A 1OTUC 2AGJH 2XYCA 3L9RB 3MV7E 4GG6A 1ZT1B 1H5BB 5HY9A 1MREH 2Y23A 2GTZB 4G8IA 2MCPH 3MLRL 4YNYA 3Q5TA 3FT3B 2R2EB 3JZ7A 5F9OL 3X14B 2HKHH 1FNFA 1H0DA 5C0IB 1FPTH 2CKBA 2W9EL 3NIGF 3QR2A 1EBAA 4BQBA 3GMRB 4MLSA 1XGRB 4NDMB 3HNSL 3G9AB 1NC2A 3TIEB 5E08L 2CLVA 3WFHB 2NYYD 5CBAB 1RJYA 5J6HB 2VDKH 2NLJA 4GW4B 1T0MB 5BXFB 1NMAL 5T1KA 5DQJA 5TE6L 1Q9OB 5HHNB 2VITA 3C08H 1KELH 3VXSB 1S7WB 1BPVA 5MEQA 5CILH 1DQQB 4KMTH 4TRPH 4KTEH 1AC0A 1AO7A 4LBEA 4NZRH 4AMKL 2X41A 3LMJH 1G1YA 1X6LA 4P3CH 3CDYA 1BZ7A 3S9DB 5AWNH 4ZUWA 2C3VA 2AXFB 3OL2A 4M8QB 3L3OA 4OT1H 1J8HB 3CFCL 2A9ML 3VRIA 5E8PB 4LLWB 1CXLA 3WLWD 3BH8A 1T20B 3I3BA 3G9VA 3VMNA 2EICA 1Y0LA 1U2CA 5E9DD 2A83A 1PD6A 4Q2ZA 1M7IB 1RMFL 1JI1A 1MAKA 4LCUB 2VTFA 4M9PA 4Z7WE 5JO5B 1KB5L 3WD5L 2ENSA 5L2JB 5D2LF 1CFBA 1BZ9B 3KWWB 4L8CA 4MNQA 1RZGA 3ARFC 2X4UB 3BP7A 3P4NB 5IB2A 2QTEA 5DO2C 5IB5A 1UB5B 5C7XL 1A1OB 4R0LA 1ZA3B 3GSOA 4MDIB 4QCIA 3LAFA 5EU6E 1GXEA 1VFAA 3P4MA 4MYWB 1TVBB 4ZUUA 1D9KB 1X5YA 2B2XH 2DI9A 4XXDB 5BOZG 2PYED 5CSGA 5BMFL 3AGVA 1G7QA 3BQUC 4PRHA 5ADOH 4RRPG 1I8MA 1G6RL 1JRHI 2DI8A 1YQ2A 2R0WH 2XTJB 4Z78B 1VFMA 3JWDC 1QFWH 3GSXA 3GJFH 3I75B 2R4RH 2FBOJ 3H3BC 4PRBB 3PWLA 5FM5M 1RJZA 1BVKA 1QP1A 4FTVB 4L4TA 3WNOA 2Z0BA 4JZOB 5HBBA 1XGUB 4OQ1A 1KLUA 1OAZH 1KULA 3Q3GA 4JKKA 4F7MB 1OM3H 4MXWL 1QLEH 1R3HB 1SMAA 4GAGL 1OL0A 2EO1A 3D9AH 4LSRH 3LN5B 3I9GH 3VFOA 4R7DB 5E2TL 2Z31D 1S7SB 4YFDB 3W9EA 2WBJB 1XCQB 1VPOH 3BPLB 3FO0L 3G5YB 3MLXH 4W6YB 5BVPH 4M1DL 1BQHA 2VLRA 1X5XA 4OM0L 3Q0HA 5FECB 4Z8FH 5AZ2L 2UV3A 5DD5L 3LEVH 3NTCH 3O2VL 3HZKA 4Q0XH 5I8EA 4HZLA 4K3HA 1GZPB 3OGOE 2N56A 2OSLB 3O4LB 2CH8A 1WC7B 1A6TB 2AK4B 5JXAH 3HUJF 3VRLE 1BX2A 5TE4H 4MD4A 3BE1H 4LKXA 3TH4T 3MJGX 2DIAA 4PGBB 3V7AE 4N8VA 3QUMB 5ERWB 2RQ8A 5IHUH 1HWHB 1EFXA 3SGKA 2H32A 4HWZA 3QUXA 5KOMC 4QY8B 2VLKB 4TSAH 3W11C 5CEZE 4N5UA 1HYRC 1I9IL 5CSZA 4PJBB 3FFCE 4PRPA 4YDVA 1BFVL 3DVFA 4HFUH 4OLYH 4DGYH 5C92A 2YBRA 4Y4HD 3VD5A 3V7MA 5MEPA 2ITCA 3BZFA 4GS7B 2OL3A 2CDGB 3BRDA 4XRCA 5GRXG 1XF4A 2UVEA 2R1WA 3BGMA 2BK8A 3EHBD 3QEQD 3BIAX 1U8HA 2B5IB 4Q6IA 1ZLSL 1CG9B 4XC3H 2P5EE 1AFVL 1PBYA 3DV4A 5F89B 5FKPA 4M4RA 4LU5L 1FC1A 2QR0A 1X7QB 2ZSVA 2YD4A 1XIWA 2LVEA 3DJ9A 2Y7QB 4MA3B 3KLSA 5C0AA 1I3GL 1WAAA 3IVKB 1QFPA 3MBEB 2X10A 1KV3A 4I0PB 5CHNA 3S6CA 5GGUB 1CLZH 4FNLL 4OSUL 4MX7A 3BDYH 1INDL 1KN4L 1UWEH 2PW2B 2H1PH 5I0ZA 5D2NC 3VXPA 4RGMB 4D0CB 1R3JB 1FNHA 4PJGF 5D2NE 2ED8A 1PW3A 3BSZH 2NY2D 4UQ2A 4X0KB 4LVOC 3FB8A 3MV8E 4HUKB 1VENA 3FHQA 4Y0GA 2AABL 5KSAD 1MF2L 3ZHDA 3P4OA 1IL1B 4OZ4A 4OLVL 4YHMH 3MRKA 3VFGH 5DURB 5AYQA 4UTAL 1JN6A 4HJGB 3T3MF 1NPUA 1FZKB 3LRGA 5BVJA 1S7UB 1NCCH 5L0QB 1QSZA 5SWZD 2DQHH 3BIKA 3RU8L 3DUUB 4O58H 1IEHA 4AIOA 5IQ9A 2VR9A 3QXDB 4QWWD 4JREC 2RFXA 3MLRH 3GGWB 3CFEA 3LRSB 5F9OH 4YXHL 3CFKB 2OJZL 5ENWB 2BXYA 3PL6D 1HXYB 3OXSB 1QLRA 4G43B 1BQLL 4L29B 4PJ8C 1RZJL 2B0SL 4LSTL 1HH9B 1D5IH 2C5DC 3GMMB 4JPVH 4LCWD 5IV2B 5KS9F 1A4JB 4M43L 1MJ8L 4MB5A 3KYOA 4IEFB 1KT2B 2JELH 2VH5H 4WW2F 1LEGB 1CWVA 5IW6B 2Z93A 1DN0B 1N2RA 4AQOA 1BVZA 1KEMH 2NQCA 3D18B 4P5TA 4X6CA 3RNQB 1MCCA 2Q7YA 4U7KA 3EOBB 1MCEA 3HHRB 4M7LT 5AUMB 2E7MA 4G6KL 1NGZA 2VABB 5FGSA 3HAEA 4TTGA 3BUTA 2EXWD 3JV0A 5DJCA 4RCAA 2ZCHH 1X5FA 4CMHB 5F6IC 3HZYA 3RZCC 3BD4A 2F74A 2X7LB 2WQRA 3AREA 5C9JA 5IF0B 4YEFA 1BHGA 1ADQA 5DEGB 3WNKA 3O9WB 1FLRL 4L3EB 4NJ9H 2PXYB 3IETA 3LH2H 3O8XB 4U1KB 4DN3H 3GSUB 9CGTA 1MUJB 5ISZD 1UWGL 4LAQL 2GSIA 1Q94A 3QJHB 4JGJA 4DK3A 4JDTH 5DJ2B 3ZYOA 2WLYA 2DQDH 4B7LA 3KXFE 4MQ7B 1A1MB 5C7XH 5CLWA 1U3HC 3FRPG 3ZE0E 1A3LL 3C8KB 2VL4A 2WUBH 5E1AA 2DMBA 3FOMA 1MFEL 3NA9L 1OAQL 1MY7A 3KPRA 3JWDL 4K3EL 3ARDC 4HIEB 4HUVA 1RI8A 4OZFG 2Z35A 2VAAB 5FYKE 4MWFA 4HK0A 1U92A 5D93C 2OTWA 3WIHL 4UT7H 1KGCD 2R23A 4GBXB 3VWJC 3AXLB 4N0RA 3U2SA 3HB3C 1T03H 1AGFA 3WXVL 1BIIA 1IAOA 1U8MB 4P57A 2DTMH 1KB9J 5T1DL 3FAWA 4IMKC 4ISVA 2GUOB 3OF6D 3N50A 2ARJA 2I27N 4WFFD 5ICXA 5CKGA 3O2DA 3DBXB 4O02L 2E7HA 2APXA 1R0AH 4JM2A 5TE7L 2JCCF 4BJLA 1KCVL 4MXWH 4PB9L 4IRJA 2GJZA 4GAGH 1XEDA 3DVGB 4GW1B 1L7TL 2YC1A 1L9NA 2EZ0D 3RNKB 1ITCA 4NQVB 4ZMAT 3SGDI 5E2TH 1UT9A 4KU1A 2D03L 4CDGC 3U0TA 1DUYB 2YEZB 3TT3H 1IQWH 2X5PA 4MCYB 4NFBA 5DRNA 4PJFB 4L8DA 4MAYB 1EAJA 4Y16C 4EUPB 4HJ0D 3H9HA 4XT1C 2HN7A 1ZHBB 3K8MA 4OM0H 2Q86B 4RWYL 1ZHNB 2BRRL 1FYHB 3NFSH 4GOSA 5E5MA 3O2VH 2XKUA 2LE9A 1JNJA 3QHFL 1Q9WB 1I8IA 1T2QL 3VXMD 1A1NB 3SKOA 1KG0A 4N8CH 1A6VL 3BPNC 4HIHB 4UDTA 4U1MA 1B88A 2GY7B 1NFKA 1HIML 1CXKA 5GS1A 2XACC 4BUHA 3V5DB 4WEBL 4J3XA 2AJUH 3EO0B 1KTDB 4IOIB 5SWQA 1PX3A 1KXTB 1K2DB 3O6MH 1ORQA 2ZUXA 4HIJA 2OS7A 1MCWM 2R56H 5CJXA 4ZFOA 1P9MA 2HG5A 2VLJD 4XBPB 3QUMH 4X5WB 5F44A 3FOLA 3RDTA 1LP9E 1MCIA 1M6OA 1CIUA 1YEHL 5GGQH 1DL7L 4D94A 4ZUTB 4LSPH 1HKLL 3MRRB 3RWCB 1ONQB 5MENA 2FRGP 4JFOA 1BFVH 5D1ZD 5HYIA 5F96L 4PRDA 1D6EA 1YC8A 3GHBL 3QA3A 5I1EH 1QPXA 4KPHL 4GRWE 1S9XA 3QDGE 3UTSE 1W72L 1U8IB 2VR5A 5IR1B 3S36X 2XFXA 1T5XA 5D1XB 3TNNA 1KBGH 4KV5E 4LASL 5D7LE 4CU7A 2HFFA 1AKJB 4JRXA 3TWCH 5F8QC 3SBWA 3DRTA 4LPUA 5TPWL 3B9KC 1I3GH 1OW0A 3LKRA 4C83A 5JW3L 4JFHD 2CR6A 4RA0C 3LN9A 3G6JF 3HI1A 1CR9H 4FNLH 4MQSB 4OSUH 3ECBA 4FZEL 3RX7A 1HQRA 5JHDB 2ADJA 3KPPA 4JRWA 3FCTB 3NCFB 4XP4H 2J1KA 4JR9L 4ZFGL 4EDXB 3RHWK 5DJDB 3O3BB 5DC0A 3EYUL 4MAUL 3FTGB 4JN2A 3U4EB 3TN0B 1FFOA 2DWDB 3QXTA 4UINL 2ZG1A 3L3JA 2UWEE 5ICYA 1EXUB 1Q72H 4FQXA 1TZGL 3FO9B 4XB8A 3QWRD 3BKML 4OLVH 4D0DA 1J5OH 3KPSD 1WK0A 2DB8A 1BQUA 3C5JB 3QZWB 4RQQB 5D7JC 3C2AH 3U30C 3CVHB 4FQLL 3O6FB 1MQ8A 2ESVE 4JFEA 3SJVD 2AJ3B 4UQ3B 1HINL 2XN9A 1D5ZA 5FCSH 3STLB 1DEEB 4ZOCA 5L2KA 4H1LB 3RL1A 2YPVL 4JLRA 4H88L 1FORL 1YMMB 2NXYD 4B5EA 2EE9A 2OJZH 4M1CC 5JMOC 5K9KA 4Q9CA 5BV7C 3ULVH 4MA7L 2EH8H 43C9A 5IVOA 4U1IB 4OTXH 3WO3B 3GMLB 4MJIE 1ZEAL 3DMMD 1BQLH 4JRYB 2B0SH 4RMRA 3MRNB 2YN3A 3SDAD 4L9DA 1KF9B 3VCLA 5C0JA 5DTFA 3FQTB 4PJ7B 5DEFB 2Q1EA 1AGDB 2X9XA 3WFCL 1H3GA 3L3IB 4PJAA 4WW1A 1YNTB 1X5ZA 2DBLH 3KPTA 3ULUH 2OK0L 4NZUH 3VXRE 1ZWIB 5IROA 4OUUB 2F8XC 1G6VK 3S4SA 5F3BA 1RIVL 4JFDD 4F37F 3QG7L 3RGHA 2FNBA 2H3NA 2JK5A 5ICZB 3UCRA 5IIEA 5E6IB 4J7RA 4UV4L 4NO3A 2Z92B 2H26B 4MNHB 4WFGE 4C56A 5FUZL 4HC1H 2FR4B 2VUOA 1BQSA 4LIQH 1BM3L 4P2OA 3WLWC 5DRWB 5EU5A 4JQIL 3SCMB 3SDCA 2ZZUT 1WCBA 5EBLB 1M7DA 1UVQB 5SWSB 1QBML 1GAFH 1E6OL 5GGRY 5C6PB 3TBSB 3EGSB 1ZLUK 5DS8B 5FUCC 2G5BA 2EC9T 2R69H 5FUCE 4AT6B 1P2CB 5C6WH 1MAJA 1XZ0A 1UZ8B 1IEBA 1MFEH 1KTRL 1OAQH 4JFQB 4R97C 3BKCH 1YN7B 3D5OF 2WSKA 2WIIB 2ZPKL 3MRHA 4EQ3A 1RVFL 3BO8A 3D2UB 4WU5B 1BAFL 1YEIL 3QNXA 4POZD 1YEFH 4L5FL 4NRXA 5EO0A 5H37H 3WIHH 3QHZH 3RY4A 4I18A 2DM7A 1B0RB 1S8DB 3NZ8B 2V2TA 3U7WH 2Q3AA 2X09A 5C0EB 2XRAH 2HJLB 3JUYA 3TA3A 3HE6B 5DI8B 4ONHB 4L4VE 4OIAA 4RGND 4E41A 5I1IH 3O45B 1R24B 5F7EL 2H8PA 2JF1A 1T4KB 1G9NL 1SBSL 2EIZB 2J8UA 4M7ZB 5T3XH 1ND0A 3A6CL 4QRRB 3T2NL 1XGYH 2X4SB 5DWUL 1EHXA 2C4XA 3THMH 5C70A 4JHWH 2Z31C 5ESAB 3S8WA 1CLYL 5CJ8A 2IBBA 4PUBH 3FAXA 5DDHB 4BH7A 3B83A 4JFYA 3S5LG 5FEBA 5FYJD 1TJGH 2DQIL 5L8LB 2WWKO 3NAAL 1WZKA 1MHCA 3ZDYE 3MTRA 4LRIA 4HHAA 2YA1A 5FO9B 1TLKA 2X4TA 4PG9B 4JY6B 4EI6A 3DSNA 3TBVA 5GS3A 3CFJA 2CGRH 1J1PH 5FGBC 1NLBH 5J12B 1ACYL 4WEBH 2BXZA 4WFEE 3RVWC 1RHHB 3HC4H 2ZUTA 3EJYC 4GW5A 3QWOA 1FFNA 1EHNA 3UAJD 3FT3A 4N9GA 4I5BA 4CN1A 5C0IA 3C9NB 3GMNB 4F9PA 3LEYH 4RNRA 2DL9A 3QXAB 4QOKD 5CZXC 3IT8D 5EC1A 3IJSB 1HKLH 5E4EC 2NR6C 3RIFF 3OPZH 2FX7L 4GMSL 4XXCA 4HXAL 4HPOH 5B39G 1N5AA 4Y4HC 3TIEA 1JFQL 4JFFB 4OZHE 4O2CA 1LO0L 1T83A 5HTSA 1W72H 4BZ2L 4F8QA 3EHBC 3L5IA 5GPRA 2P5WD 1A5FL 2VNCA 3TJEL 4BSWB 1V7MH 4C59B 4NKIL 1G7LB 5HHNA 3NOIA 5HHPB 2VSDA 2OZ4H 3NABL 2P8PB 3IDMB 3CSYA 4O00A 2YSSB 3MRMB 3EJZD 4JEGB 2BNRB 2FBJL 3N9GH 4KJYA 5LXGL 4BSVA 3QIWB 4C4KT 4NNXA 5ACZB 2EH7H 5DZNA 4WUUA 1ZKAA 1MHEA 1NGWB 4YPJA 3HG1A 3G5XB 1ULVA 4G6AD 1EIBA 3VE0B 3HRZA 2BHUA 5CCKH 4BKLA 1NBZB 5C07B 2FO4B 1S7VA 5C3TA 1QFOA 1K4CB 5MHSD 3GFUA 4Z7OE 7FABH 2X6MA 4RDQF 1J05B 1I7RB 4EDWL 4J8RB 5B3JF 5HHVL 3JVGA 3EYUH 5CJQH 4GKNA 4WV1B 1KB5A 3EYSL 1KPUA 2XKNA 1CGTA 3CFDB 4MJ6B 2AS5M 2EDJA 5IFJB 3G5ZB 5JR1L 3MA7B 5KSAC 43CAA 5ID0A 1NCAL 4KDVA 3BKMH 2PN5A 3P4NA 1UB5A 1WBZA 2OXGA 5GGRA 3KLDA 5LCVL 2NMSA 4JQXC 2LV4A 3B6SB 4G9DB 4PJ5D 3NFNB 2FZ3A 3CVHH 3WS6C 2I9LA 3C09C 3GZKA 2P45B 4NN6B 4KHTL 1MIML 4QWWC 4ZFZB 5HHOA 4H1LH 4RMTA 4F9LC 5BZWA 1T89A 4F2MA 1GGIL 4MA7H 2NX5E 3I75A 4R3SB 3RTQB 3PHQA 1T1XA 4D9QD 1ROWA 3B8SA 4P46C 2EEDA 3QIBA 3ROOB 3V4UH 5DC9B 1PZUB 1DLHB 1T1WB 3VWKA 3ILPB 3QI9B 4TQEL 4V1DD 4Z7UB 1IARB 5F9JA 3M17A 1XGUA 3DX9B 4LCWE 1RFDL 4WFHD 1CU4H 3OKOB 2OK0H 1KUMA 2A0LD 2AJYH 4PYHA 3V6OA 1DANT 1F58H 3CC5B 2YD7A 4NQCE 2CJUL 1NL0L 3FQWB 4P0DA 1XCQA 2PW1A 3G5YA 1UWXK 2EXWC 3G08B 2P8MB 5KW9L 2AERT 2P24A 2QADB 5LGKA 1U8NB 4F57L 3IDNB 1BOGB 4ELKA 3CXDL 4HPYL 1BD2D 2NY1C 3IXTB 2HWZL 2VDML 1GZPA 3LDBC 5HI3D 5CFHA 1GRWA 1F90H 3O4LA 2YD9A 4JQIH 1UENA 5TJWK 4ODXB 5BCAA 1OSPH 2NXZB 3CH1A 2EYTB 5JNYA 3QO0B 1JUFA 4LSVL 5I1LA 4Y2DC 3ES6B 3C8DA 1AD9A 1PKQA 2V17L 3O0RH 4P3DB 2X44D 1ACZA 5A16B 4XI5D 4F7PA 3NPSC 2ZP0T 5TH2A 1KJ2L 3MOQA 5ESQB 3D6GA 3CDFA 2OJEA 2VLKA 3NGBC 2NY6B 3TBYB 2CDEA 5CEXA 2HMID 5IVXA 3C5SA 3P0GB 2COQA 1BOYA 3H9SA 3QBTB 1A4KB 4NM8L 3SO3B 1EGJL 2YPLB 4JO1L 1G7HA 1L6XA 2ZJSL 4L5FH 5HDQL 2L7UA 4XVUD 3NPZB 4MXQD 3BW9A 1XGQB 1QRNA 1YN6B 4UUJB 3O3EA 3MRBA 3P40A 3DUSA 1KLGB 4L9LC 2UVFA 2VDNL 15C8H 5F89A 1IC7L 1DBAL 4PJHB 5HDBE 2MQ0A 1X7QA 1CL7L 4YJZL 4KKLD 5B4MC 2YZ1A 4WHTA 3TT1H 4E0RB 3FZUD 5CSBA 1OGAA 4LLQA 3KPNB 3JV6B 4WO4D 4J12A 3BWUC 4I0PA 5ALCH 5F7EH 1T21A 2R8SL 1SBSH 3U0WH 3KNBB 3QPQD 3U7AA 2EXYD 3KVQA 3A6CH 3BGFB 4H5SA 1CGYA 4DZBA 4XPFL 1P53A 2EZ0C 2OP4L 1EV2E 1IGCH 3QAZC 1MVUB 1JGVH 4MB4A 4P5MB 4UT6L 4YHLH 1I1RA 1CDJA 1FZOA 3OKMB 4Q6YA 4QRQB 4X0KA 3VFTB 5TDPA 4HJ0C 1I7UA 4XNYL 3H7LA 3TJHC 4XWGH 1UG9A 3WJJC 5IBUB 1DBJL 4IJ3B 4OF7A 2R1XA 3UJTH 2MQCA 1PSKH 1HEZB 1WBXB 1W0YT 1I3RB 2BSSA 4KUCD 3RVUC 1MFCH 5FO8B 1C5BL 5FDWA 4P9HL 1JNHB 3TVMC 1CFTA 2GEEA 1F6FB 1F6AB 2X05A 3RWJB 4U0RC 2EDHA 2E7BA 4P2RA 2IANE 4M62H 4YFLI 1NCBH 2VXUH 4UIMA 1GH7A 4U7MA 1EEYA 3P3YA 4PJDA 3MV9E 4X4ZA 4PJEF 2P48B 5CIPA 4QTHB 2EDYA 3QCUL 4U1LB 2RJMA 3X13A 3FO2B 1YEKH 5KVGH 4NCC1 3CSGA 4X4ME 5I16A 2X9WA 3VXUA 1HH9A 4OCSL 4GMSH 5D1ZC 5F7NC 3HN3A 4TVPL 1J10A 1JGDB 1JFQH 1YQVL 2E6QA 4P2YA 4BFEA 3P73A 5KG9A 2X4NA 2OXHA 3D3VB 2D0FA 4BZ2H 1TETH 1CICB 5E5RB 1D5XB 4NKIH 2DD8L 4PRIB 5DD1L 4LF3A 4XNMA 3PIQB 5D8JH 4Y5YB 5I9QC 2DN7A 5IB4A 4XPAH 1GC1L 3QIUA 5ANMB 3K7UA 2FJHB 4PJXE 5FHBL 4D9LL 3SPVB 2HVKA 4NHUB 1UB6A 4NBXB 4P2QA 3LRHA 1JGEA 4IRSD 4MJ5B 1YDPB 5FYKU 1QEWA 3L5WB 2ADIB 2ZSWA 3IS1X 4HC1A 3MNZA 4NIKB 5EO1B 4YHPA 2CXGA 4LNVA 4ZQKA 5DHVB 1A6UH 1U8QA 1KJ3L 2FB4L 3OX8B 3IJHA 3IFOB 1R5IB 4LEOB 2PO6B 1XFPA 4YZFE 1D3CA 1F4XL 1ZXQA 5JXED 2BCKB 4ZTOL 4LFHD 4MDJB 4O2FB 1CTNA 3VD9A 1F13A 3HC0B 2G5RA 3FN3A 5CUSL 4WI5A 3S34H 2IF7A 3BP6B 3CDGB 2FJFB 1AJ7H 3MYJB 3KYKL 5FA4B 1DP0A 5I71C 2M1KA 1FC2D 4JFZH 3KPSE 5LCVH 5HD8D 4HUNB 4IOSD 1QA9A 5T3ZE 1JF6A 5KJRL 4Q58C 4X7TB 4DKEL 3HI6H 2VAAA 1NC2D 5FO7B 2A6DA 5FYLE 3WIHA 1TNNA 5IHZB 1VEMA 3BP4B 4NQUA 4L3CA 2AXJA 3AXLA 4HMDA 4Y7MA 3GMQA 4DOHB 4X8JA 5T1KD 2GJ6B 5IVZA 4WIQA 2Z4QB 1E27A 1KIUA 2V7HB 5DFTA 3RL2A 4ZXBA 1YNKL 4PGZA 3DMMC 4IOFC 1N6UA 3L3KA 2H2SD 4HKXA 3SDAC 4TSCH 3PWPA 4JKMA 3A6BH 1G6RB 1RFDH 1HSAB 2CLZB 4I3RL 1CGXA 4EN3D 5F88B 3ZDXE 5DK2B 5KTEL 1G7JA 3KR3H 4FS0A 1NGQH 3HCVB 3G5VB 1H15B 1DCLA 2CJUH 3GMPA 3FRPA 4I4WB 4KKNA 1NMBH 1CLOH 4OZGB 3DXAA 4MJ4A 4DGVH 1JHLH 3C87A 4JFDE 4HBCH 1U8LB 2Q86A 1ZHNA 1Q9LB 2VOTA 4DGIL 5IWLC 4GXVL 4WTXA 3P0VL 5DR5L 4MNQD 3TV3L 2N7AA 2HWZH 3FQNB 4LDLB 1Q9WA 2WMPA 1N0XH 2A1WH 3F62A 3AMLA 4U6YA 2P7TB 2FEEI 1RUML 3IXAB 5EIIA 3ZL4H 2WANA 3K74B 5DVNA 4FQQB 5ETUA 2QHLA 2CMRL 3LQAL 1WFOA 1KXVC 2GCYA 3GK8L 1PQZB 2YD6A 4PRHD 4UTBL 5IGXL 1PYWA 4MNGA 1JZ3A 2XOTA 4Z7VB 4F33B 2R29L 2PTUA 3UTTA 1FE8L 4RDQG 2EIEA 1SYSA 4WGVB 4ZUTA 1KENH 2VDOH 1CDBA 4L4TD 4F7CA 4G8GA 3T0EC 5EFIB 2W0LA 1JJUA 5TDOB 5I8OH 3IRZA 3T0EE 4A6YB 1OAXH 1QOKA 4JO1H 1W72A 1T1YA 2ZJSH 4KKBC 4POZC 4RISL 5JA8B 4ZO7A 1ZT7A 5IR1A 4JJ5A 1QFWI 5F21B 1MCJA 2SEBA 2VDLL 4O5LL 4R90L 5JZ7D 2OI9C 4H25B 3SDXB 4OV6F 4AH2B 4CRPA 2QEJA 2VDNH 3RWDB 4OZIE 3MLZL 1DTUA 1GGBH 4YGVB 1NMCC 4F58H 3QUYB 4JO2L 2OZ4A 5DQDL 4GH7B 1CVRA 1VEOA 2XWJB 3KPQA 1S5IL 3UTZB 4FMKA 3S36L 2VLRD 1X5GA 3QDJA 1P84J 2QKIB 3PWNA 5C08A 1F8TH 2DQGL 4Y1AB 4XPFH 1DVFA 1U6AH 3VMOA 3FB6A 3QNYB 2NY3C 4LVHC 5DMYA 2BSTB 3MRDA 2VQ1A 3PABA 3S88L 4YHKL 3ISWA 3L3GA 5D5MF 3GSQA 2RGSA 4QRTA 5DRZB 1IJ9A 1RV6X 4CNIA 1EFXD 3C5JA 1KFAL 1MLBB 2FL5A 4S2SB 3QUXD 3A6OA 4KQ4L 3PGDB 1C5BH 5DA0B 4R2GB 4UB0H 3P11H 5HYJB 1TENA 4LCIH 4MQXD 1MCKA 5C0CB 1UM4H 4PRPD 4WWKC 4B50A 2AQ2A 5ID1B 4QEGA 3MLWH 1J1OL 1KCUL 3UAJC 2QL1A 2VERN 4FP8H 2D9QB 1F4WL 3C5ZC 5D9SA 1CFSB 3VMPA 1S5HB 4G7YH 4U1HB 5B21A 1LE5A 5SX5K 5JQ6L 4NRYB 3GMLA 4YX2L 5FOBA 4U6HB 1LP9F 1XIWD 5CGYC 5C0AD 5L7XL 4N0FB 3P9LB 3QJFB 5I1AA 1YQVH 4QXGL 2CIKB 1MRFH 4KKAD 2FD6L 2ICWB 3IJYA 4WY7L 1HHIB 2FGWH 5IB1B 4RMWA 4LCCC 4M9OA 3VFNA 5FCUL 5GSRB 4LGPB 4D0BB 1CE1H 2DKMA 3WL9B 4DAGH 4KV5F 1E4JA 4AEIH 1H5BC 5E7FA 3EJZC 3UP1A 1LO4H 2KDGA 3NN8A 1YYLH 1UWXH 2H26A 4ZD3H 3GO1L 4LL9A 4RWHA 1K5NA 4F7EA 5EUKA 2FB4H 2VLMD 4RBPH 4RGOL 4NM4H 5E8DL 4K3DL 4KK8D 2XV6B 4Z77A 3MJ6A 4OCWL 3C6LC 2V6HA 2WUCL 5GHWL 3HUJA 1XT5A 4LSQL 2DJSA 4NUGL 4HH9B 5IG7B 3DUHA 4O51B 3EDEA 4Z7WB 5D7IE 3D25A 4YAQB 1IC4L 1BLNA 1A14L 2YPKA 3K1KC 5IOPA 1JVKA 3QO1B 4XMKL 2UWEF 3OKNB 4WI3A 5E99H 3BVNA 2VXQH 4JKPL 1MAMH 1YECH 3O2WH 2BDNH 5JPMA 3ARFB 3VXSE 3EOYG 5I2IA 4KGLA 1DUZA 4FFZL 3PWJA 3TNMA 1TJIL 1W0VA 2V5TA 3IFNL 4HKZB 1PDKA 4K2UL 2N1KA 2EEBA 2DQJL 3BQUB 4X6BA 3MXVL 4P5TD 3JWOL 1W8NA 1B2WH 1J8HE 1HKFA 5DK3A 3DV6A 1I7ZA 1YNKH 3BPOC 5JORA 3E2HC 3QEHB 2XPGA 5HGDB 2ZCLH 4ONHA 3RGVA 3KJ4C 2ORBH 4MS8D 2Q8AH 1P4BL 1T4KA 5ESVA 4N90D 3ARED 1GJIA 2D7NA 2A0LC 2CDFA 5KTEH 3GJEA 3QDHA 4LHJB 4G5ZL 2R2HA 2DKSA 4ODSH 5F7HA 4PJGA 4QYOB 1VADA 2Z8SA 2HA1A 2Q20A 4DCQA 5TQ2H 2F5BL 1VEPA 3EBAA 3MV11 5T5FL 3SGEI 5IUSA 4W70A 2A6JA 1FL3B 1CZ8H 5HI3C 4KMLB 1TZHA 3SN6N 3UPAA 4OCXL 3IKCA 3ZT5A 1HHGB 4I13B 2CMRH 2APTA 1LK3H 4JB9L 5EZJA 5IGXH 3OG6B 3C2SA 3WN5A 4IHOA 1I7TA 4OZFB 3TO4A 1FL5B 2OTPA 2R29H 1FE8H 4XP5L 1TFHA 5CGMA 4PJ9A 4CVXA 4OIIH 2XY1A 3QXAA 4OCYL 3MLUL 2HTKD 2EYSA 3QNZB 4K94H 2J8OA 5T1MB 2LAGB 2DM2A 4HH8A 5BW7C 5KS9A 1NCWH 3QUZA 2X4OA 2XA3A 3BJLA 4WVRA 5CEZL 3E6HA 5J6GB 4M93C 3N85H 3FFCB 4ZODA 2Y25A 5EU4B 1U91A 3U9PL 4WW2A 1WVZA 4HCRL 4JM2D 5GRVK 5LBSL 4IRJD 6CGTA 4M1GH 5C09A 3GNML 1ZVHA 5KANI 5L9DL 1O5DT 4K8RH 1IKNC 3UYPA 3V4PL 5HHPA 1AQDA 3FMGH 5DGRA 1Q1JH 4MCZA 2E8ZA 1R5VA 4KKLC 2BVPA 5JIIA 4NZTL 3IDMA 4GRLB 1LK2A 4JDVB 3IAGC 3DYMA 4V2CB 3RVVD 2AK4E 3FZUC 1IGJB 3VGAC 1G7IB 4WO4C 4NCDA 1T22B 5KSUB 4HWEL 1NKOA 4UT9H 3HS0B 2DQGH 3VE0A 3U4AA 5FYJL 3AVEA 1N59B 3EOTH 3CK0L 2YOCA 5EUOB 4KI5D 1OF2B 4G9FE 1JNLH 1AGBA 1FHGA 2B7DT 2BVOB 2P8LB 3KG5A 4DZ8A 3QG6A 3PDOB 4J8RA 4YH6A 4P4RA 1KSRA 5D2NB 3L3DB 1NEZA 2R1YA 4FXKA 4YHKH 4MJ6A 1NDGA 5E70A 4C4KO 1QSEA 1L4IA 3O3UN 5ECJE 1FYTA 5I17A 1JV5A 1UXWA 5HVFB 4GAYA 1KFAH 2HJKA 1MCDA 5D96C 1A0QH 1I75A 5DJ8B 4M7JL 5GRJL 5DMGC 3B6SA 1NUGA 2CLRA 3NFNA 1JL8A 3OGCB 4HT1L 5TDNB 3ZDYF 1FIGL 2ZOKB 4R4FL 1NGXA 5DJZB 1SM3H 3FONA 5MEND 4GKZA 3WFEL 1KIQA 4DEPB 1VGEL 4KK6D 1J1OH 5D2LB 2PTTA 2O5ZH 4U2YA 3J7HA 3MUZ1 5ACLA 3GSNH 4LSUH 1V8HA 3L5XL 4XAKD 5TFSL 1NCTA 3ARGC 4JREB 2LABA 3M07A 1DE4B 32C2B 5JQ6H 2V5MA 4JCLA 1VFBB 1XR9B 1PVHA 3SGJC 4JRXD 3LB6C 3QI9A 4H26A 5DK0A 5EOTA 1L6ZA 1S78D 4QXGH 1L7IH 4JG0H 4NRZB 3K4ZA 3DX9A 2JCCA 4LLDB 5E00B 2FD6H 1JGLL 2NTFB 5T1LA 3OKOA 3IF1B 5EBGA 4RA3A 3DOSA 1J1XL 4R96A 2BHYA 4OKVB 3G6DL 5IEHB 1W0WA 1QQDA 3GKWH 2A77L 1IGMH 2XZCH 5E8OB 3VFWA 5AYUL 3FQWA 3PJSB 3EZJB 3GI9L 4OLWL 1AP2B 4IRSC 3W2DH 1BF2A 2YRLA 5LGHH 3EIFA 1MWAL 3OJDA 3MO1B 4RSVA 5FA3A 4K9EL 3GO1H 5J8OA 2A9NL 5ALBL 1QFHA 5J06A 4A2MA 2IQ9L 2VZ3A 4PJIF 2EYRA 3QQ9D 3RZCB 5E8DH 2W91A 3FT4B 3HTLX 1FO0H 3V9FA 4LLMA 2AEPH 2XN9D 4LSQH 4NUGH 1MI5A 3X3GH 5L2KD 3IDJA 4GG6E 4HMEA 4G6JL 2IPTH 4X6DA 5DMKA 4U33A 4MD5A 2IG2H 5DRXB 4XBEL 1XF2B 4TOYH 5E8NB 1ZS8B 5A16A 2FWOA 1LO5B 2N7BA 3KXFB 3WNMA 1PLGL 5ESQA 5HD8C 4JKPH 3PV6B 1DQJB 5D7KE 1OAKH 4NQDE 4PGCB 1U3HB 1UM6L 1FRGH 1R5WA 3UJJL 3W82A 3MLVL 1KJVB 1TJIH 1A4KA 4CMHC 3MRIA 4LQ1A 5DUPH 3IFNH 5I1GL 3FO1B 5EU3B 2MKLC 4ZUVA 1N3NA 3WCYA 3ARDB 5C0ND 4U1NA 3U48A 5LWYH 3WE6B 3MXVH 4QGYA 1YN6A 4PTTA 5EOCJ 1OPGL 5D93B 3SE8L 4XMPH 4PJHA 4NQEA 4B53A 2AK1H 4AM0B 5MEOA 4BH8B 5J9PB 3MUY1 1NGPH 1WEJL 2AJXH 2YD3A 2AI0H 2H2SC 4OV5A 3QQ3B 6FABH 3LHPH 5BRZA 1NBYB 3WIFA 3RWHA 3SDDA 3ULSA 2XG4A 1AO7E 3JV6A 4P23A 1P4BH 5CWSB 1EEZB 4C56D 4OI8A 2DLTA 4FQ2L 4H8WL 1CFQA 1YPZF 1ES0B 2MOVA 4MGXA 4HKJA 4MJ2A 1NC4D 3SY0A 4G5ZH 4P2OD 1XCTA 1D5BB 5CJOL 2JIXA 4P5MA 3UZVB 3SDCD 4ERSL 5DSCB 5E94A 3OKMA 4MA8L 1RZFL 5IK3A 5B38A 4PJCA 1HDMA 1FGVH 4ETQA 3TFKC 3S35H 1U58A 3JXAA 2NY5L 5FM8A 2EKSA 2YKLH 2V7NA 5T5FH 4DW2H 2YUXA 5C0BE 2BMKB 3T3PE 3WBDA 2R2CA 4Y16B 3KLAB 2C7UA 5HYSG 5IMMA 3IGAB 5HGHB 1H9VA 5I75C 4R0LC 1TCMA 2VQUA 5IT2H 5GIRB 1TQBC 4QRSB 3QFJA 3UROR 4U6XA 5BZDB 1F6AA 2HT3D 3TYFA 1SEBA 3OJVC 3NBNA 2G60L 1B0GA 2XNAA 3QWQB 3KLHC 2EDDA 3VXTB 4JG1L 1ORSA 2BC4A 4KVCL 4L8SC 2Z91A 4CJ1A 5I1JH 2BVQB 5EZLB 1P7QA 3GMOA 4CVWA 2AJZB 1A9EB 3QEQA 3B9DA 3TA3D 3OR6B 1AQKL 4W4NA 1CK0L 2EC9U 3GSRB 5CEZH 5CZKA 4KAQH 3W81A 3N1FC 1T3FB 1JPFA 4L4TE 4E41D 3O6LL 4XNUH 1TTGA 5KVEL 1HHHA 1PGRB 1NAKL 5DVOA 5AAWA 1AI1H 2CRMA 5LBSH 4GRWB 1JYWA 3QDGB 4XGZA 2W0FA 3UTSB 3HRPA 5FB8B 5L9DH 3RIAF 5IKCB 1OWWA 2ZUVA 1UXSB 2HTLD 35C8L 5ANMA 3DX8B 3X17A 2CIIB 4PP1D 8CGTA 4KDTA 4Z18A 3TIDB 4FMFA 5HDBF 4NGHL 2VC2L 4PREB 5H94A 2I5YL 3ARWA 5D6DA 3NIFE 3U36A 2VLRE 3CVIL 4BFBD 2VZSA 3F12B 3LKQB 1F4YH 2M8XA 4ODVH 4YFLF 5IQ7L 5HI5D 2YA2A 2NW3B 1Q0XH 3TYGL 3GBNH 2WV3A 1P6FA 4LEOA 1UJ3A 4Q9QH 1K3ZA 4MDJA 1G7PA 4N8PA 1C08B 2YD1A 3WXWH 3HC0A 4NT6B 1BGXL 5SWZA 3HFMH 1NAML 3BP6A 3QCVH 2DQFA 1XGPB 2X4PB 3U9UA 1JBJA 4ZDHA 2AKRB 4W6XB 3QUXC 3LS5H 3MGTB 5D72H 4ZSOB 3W39A 4HT1H 4U6VH 3OKDA 4MQXC 1IGFL 5F93C 4R4FH 1PZ5A 2ZKHL 2KPNA 5I1CH 2ARWA 4X7TA 3U30B 4HDIB 4XPBH 3WFEH 2M2DA 4LFHG 4G6ML 5IHZA 2BNUB 1HZHH 5B39B 2H45A 5I8KH 3BH9B 3OHXB 3BP4A 3WHE0 4NPYA 1CF8L 4Q6IC 3CPLB 4NKMA 2VXSH 2FIRT 1M7XA 4DVRL 2Z4QA 5K9JH 4JM2F 1XF3B 2DWEB 3AS1A 1I1CA 2DDQH 1EEUA 5TGBA 4XNXL 4Y19A 5BV7B 1YEEL 3TN0C 4NJAH 5C0AE 1M71B 5E6YA 4ELMB 1WAAE 3O4OC 1WUNT 4KDWA 4I48B 4NKDB 4WUUD 4PTUB 1A7PL 3D69A 1QNZL 1I1FA 3HG1D 4LGRB 1AXSB 2D9CA 3TBWA 2F8VA 3DLQR 5I18L 2JB6A 3G6DH 1TCRB 5LAXA 4ZO9A 3VXRB 4PG2A 3GUTB 1C16A 4QRPA 4KK9C 4CBPA 4UDUB 3QUKB 3KPMB 4PJXF 3FT2A 5GGTL 2QQLL 1IZKA 4MXVE 3LKOA 4NFDA 1MWAH 5GJTH 4K9EH 2A9NH 1TXKA 2EE3A 5ISZA 4HGWA 1YMME 2XZZA 2NY4C 3DO7B 2XY2A 3TZVC 2DQEH 5IEKB 4KK8C 5HPMB 3PXJA 1D9KD 2OQJB 3QDMA 5CINL 3UDWA 2CKBL 4JRYE 1FZMA 5HDLA 4YZFF 3MCLL 5E9DB 5HHOD 4PJ7E 5D1QA 1KC5H 4G42B 2Y72A 5E8EA 1F97A 1HI6A 3WDIA 4F33A 4Z7VA 3T1FB 3K8LA 1QLFB 3QIBD 2FX9H 1CXHA 3VWKD 1O0VA 4WDIB 1J88A 3MOAH 1QKZH 2D3VA 3UJJH 3MLVH 1Y18B 2NY0D 1LWRA 5I1GH 3BT2L 4MLIA 2AJVH 4M6OL 3FB7B 4R97B 1NFIB 1GOGA 5LGJB 5SV4A 2KKQA 5FYKH 1EO5A 1SJHB 2ED7A 3PP4H 1QTYT 3SDXA 5EC2B 4LRNH 3RWDA 4P5TC 3RVXD 4FXGA 3OWEA 3V5HA 5BJTB 3GI8H 4YGVA 1WBYA 2D4FA 4H0HB 4I9WE 2E9WA 1I1YB 1HHKB 4E5XA 2OR7A 4BQ9A 4WNQB 4GAJH 1YUHB 4Z6AT 4JJHA 4CMMA 1A7QL 4L4VB 1ZHLB 8FABA 4E42B 3DSFL 3CMOH 4ZNEE 4OF3A 4JHAL 1MNUL 4WUKH 2PUQT 4FQ2H 1CD8A 3BRFA 5JUEH 2VLLA 3BDBA 4J6RL 4JDZB 5JQHC 1N64L 4YWGL 3QNYA 3O4LD 4FA8A 4WTZA 1CE6B 2O61B 4JFPB 2HLAA 3DWTA 1RZFH 5TF0A 2QSQA 2H9GB 5L8JB 5I74C 5DXWA 3G6JB 4C58B 2NY5H 3ZE1E 5DJAB 5HGAA 2Z31B 1BQHG 1FFRA 2GW5A 4QHNB 1XF1A 1VSCA 2W07A 4JPWL 5F7UA 1JGUL 3BI9X 4GKSA 4OCMC 4KROD 1JPTL 3T4YA 2VLKD 3VFVA 5I8CB 2VLJA 4PLOB 3F6LA 4WRLA 3OXRB 3OKYA 3L3HB 1T04A 4DUXA 1I9EA 3H9SD 1BEYL 2BHZA 4MMXC 2Y5TA 2AEIT 3KPRE 4X98B 3OKKA 4UNUA 3WNLA 5ID1A 5IJKC 5JIKA 3V0VB 4QXWA 3MV7A 5IW3A 3ZSSA 3GSNA 1DLFL 2CPCA 1HILB 1QRND 4N8VG 4JFXA 5KSBE 1PX4A 2I9TA 3PWUB 3EFFA 3W0WA 4KZEH 3CU1A 4O9HL 4NRYA 3UMTA 2HTKC 4XMLL 4K07A 2MMXA 2GI7A 3B5HA 1OVZA 1CK0H 1GPOL 4AZ8A 5F7KC 1OOAA 4FQHB 3MLSL 3AFLA 1OGAD 5KVEH 1TVDA 4HUXB 5E4EB 4AEHL 5AEAA 4I0PD 1ZGLM 3S96B 5INDA 1P4IH 1E6JL 1WIUA 4ZAKA 1S9WA 1X4YA 4OZHB 4Y4HB 3IDGB 4GRWH 1U3ZA 1YY9D 3M1BB 1SEQH 2ICEA 3EYFB 2GAZB 3DX6B 3RIFK 4D9RE 5IB3B 5D7SH 4HLZG 5J12C 3HNVL 2AW2A 4OZIF 1FP5A 3AAZB 3LCYA 4X4YB 1VACA 3CVIH 1G84A 4K3GA 4HS8L 3CFBA 2DLFH 5C0RL 1K8DB 1FVDB 5IQ7H 3E0GA 4OLEA 1NCUA 5DURD 1NGYA 3BWAB 4KI5C 2IGFL 3I85A 1FO0A 1WTLA 1WICA 5GS1C 5LQBH 4P2RD 5GZND 4M61A 5IESL 4D3CH 4AL8H 3SJVA 4JFFE 4Z7WA 1NAMH 1P9MC 5IBTL 3ULVD 1F3RB 1E4WH 1BJ8A 1JHKH 2ATPA 5DHYA 3RDTC 4NNPH 3KYNA 1IBGL 4OLUL 1T0PB 3ARQA 1A21A 5KSAB 2OL3L 2HFGL 4HWNA 4HX1A 2A6KB 3IFLH 5DD6B 5EU6A 4PLNC 3VXUD 4YR6A 4HQQL 5JW5A 1WGOA 2GK0B 3BUYA 3C09B 3QIWC 4KK6C 5I1DA 2UYLA 3U46B 3ULUD 4OUOA 1AHWC 4ORGB 2B4CC 1U8PA 3P77B 4HUWB 4PBXA 4YPGB 2V5SA 4DVRH 5HXMA 2IPKB 4ONGH 1N6QL 4XAKE 3B5GA 2NX5B 3QIUD 1KIPB 3LEXB 5C07E 1RK0A 3UO1H 1RUQL 1YEEH 4ODTL 4U0QB 3SBWC 5BV7H 4P2QD 3QEGL 1OW0C 2QQNH 3UC0H 4ENED 2MPAH 3MROA 1MY5A 2CRYA 4LCWB 4S1QL 4EBQH 2V5YA 4Z0XA 3I3DA 4XVSL 4FFVD 3QPXL 2E9IA 3FQXB 3O9WD 1KXQE 3L1OL 4QYOA 3UJIH 4DK6A 3O8XD 3UYOD 3V0WH 2F5AL 4NN6C 1AD0A 2DYPB 4POYA 3MFFB 2P46B 3MNWA 1MQKH 1MJ7H 4OD2A 3WYRA 1T0NB 4FQXC 4XWOD 3TEUA 1D5MB 4WI9A 4FQCH 4JY4A 4TUKH 1F6LL 3RTQC 5JTWA 4Q9RH 3TO2A 2UZIL 3LIZL 1UCBL 3H3KA 4ZS7H 1UH4A 2MCG1 1MCFA 2DICA 5CINH 2EDLA 3LDBB 5LJYH 4JFEE 4Z7UE 2BY3A 1CFNB 3D0LB 2VIRA 5L2KE 4PJEA 2W65A 1J87A 2FATH 4Y2DB 4JY5H 3WFBH 4KH2A 4JPIB 1FVCA 2NZ9C 3IRPX 4AG4L 4ZXBD 5EWIL 2I26N 1RK1B 3NPSB 4U1GB 3NA4A 3TBTA 3HMXL 1FGNH 1V7NH 2F54E 3RWIB 1ZSDA 3NGBB 4LARH 4K7FB 4P4KC 1JK8B 1G9MC 3ARXA 3RWFA 4ZFFB 1CFVH 2QQKL 3BP5A 5T3XD 1INQB 4YHOH 5C0NC 2IALB 1KCKA 4PJAE 1M05B 4QHMB 4NUJB 4ONOA 3ZYJA 2P5EA 3BKJL 3ESVF 3MRPA 2NXZC 1C5CH 3DXAD 2A74A 1TQCC 5HHME 4YXLL 1MLCA 1KJMA 4L9LB 2VUYA 1U93A 3KDMB 4NWUL 5FKAB 3WHE1 1A7QH 4NN7B 1HSBA 2KZ1B 1K85A 3B3IA 5KSUA 2MJWA 4QT5A 4UU9A 4DVBA 1MNUH 4YUEL 1FZJB 4MD0B 4YDIL 2BY2A 4I77L 3SQBA 4P2OC 1N64H 2VXVL 4QHUB 2NY6C 3O3AA 1S7XB 5D6CA 5DA4A 3SDCC 1NSNH 4OLXH 3D0VB 4XHJD 3ZE2E 2EDFA 5I15L 2VDRL 3BIBX 5EOQH 5AZEL 1JWSA 1BFSA 1EUUA 3QAZB 2OLDA 4KRLB 2BNQA 4TN9A 3MV8A 2HLFD 1ZLWK 3MNVA 1JIBA 5CMAB 1RUAH 4JPWH 3RBGA 2ITDB 4BFIB 1DR9A 3CLFL 3I50H 1N8ZA 4U3XA 3UTTD 1D6VH 5C0DB 2VRAA 1QACA 4N1HB 4OLZL 1MHPL 3KPOB 5AD0A 1K8IB 2GITA 3PP3H 4QRUB 1OP3K 2HT3C 4TUOA 3T04D 2NW2B 4G8GD 1OQXA 3VXMB 4P59L 4QOKA 1B4RA 2AJSL 3MR9B 3R0MA 5IMLB 3TVMB 4XCEA 1U9KA 2I60L 3OAZH 1ZK9A 1KN2L 4U0RB 4I18C 1T1ZA 1RULH 3HLAB 3ZKXB 1QFUH 4UBDD 2YMXL 4XAWH 5E2WH 4O9HH 1T5WB 3OQ3B 2P5WA 5B22A 4DKFH 3VFPB 1AIFB 4WCYH 4LMQE 2BOCB 2HVJB 5CZVH 2YUVA 3GRWH 4UZGA 1HH6B 1RIHL 3MLSH 4GT7A 3TH3T 3QDJD 4QNPE 4AEHH 5C08D 4IJ3C 4XH2A 3D48R 12E8L 3FN0L 4PJ8A 4Y4KA 2G2RA 4HUUB 1E6JH 2A6IB 5D1ZB 4XZUA 5JHDD 2YS4A 5H35A 4AIZB 1DVFD 4M7LH 5EOCL 1A2YB 2B1HL 3CD4A 1E28A 2ZUWA 4PP1C 3BOVA 3PJSA 1LE9B 3MA9H 1J0HA 3SQOH 4JM4H 1CGUA 5I9QB 1R3KA 2K9UA 5HJ3B 1JPSL 3H42L 1EAPB 3I2CH 1MWAA 4Y5XC 1FVEB 2AGJL 4HIIB 1IC5L 2JE8A 5DYOB 1MREL 3RJQB 2X4RB 2DS4A 5J13C 2Y4SA 1CD1B 4J4PC 2MCPL 1S9VA 2G9HA 4PRNB 5KSVB 3FT4A 5JIHA 5F7DA 2HKHL 4NO2B 2BZDA 1FPTL 3VG9C 4FOMA 5EBMA 4YDJA 3TCLB 2XG5A 4NZJA 5IESH 3P9MB 5DRXA 3D3VE 2C1PA 4PJBF 3GM8A 4G80B 5DJXA 3I6KA 3V79C 4OLUH 5T33H 3BEVA 4FQJH 1NBVL 2VDKL 3MJ9H 4PRIE 1QVOA 2HFGH 1KCSH 5F1NB 5GGVH 1QBBA 1DQJA 4NBZB 5IMOA 3FJTA 3KPSB 4XPHH 5I71B 1GGUA 4XCCH 3C08L 1KELL 2BOBA 3D85A 4XXCC 1HQ4B 1ZHKB 5JOPE 5T3ZL 4X99B 5EZIH 5EBWB 5CILL 4KMTL 5H2BB 2G75B 4KTEL 1T83C 3KYMA 1S7RB 2FH6A 3MUGA 5BQ7B 1JI2A 4U49A 5F9AC 4NZRL 5DJ6B 2D31B 3LMJL 4P3CL 1JMXA 1N6QH 2CK0H 5F1IB 4WJ5B 5AWNL 5HVHC 3VWJA 1B6DA 4BYHA 1IE5A 3RQ3A 1H3XA 4OT1L 3VFMA 5M95B 3IU3B 1T66D 3QEGH 3QQ3A 2FEEL 5KVDH 2DM4A 2E7LA 1FV1B 5DMJB 4HG4K 3DMMB 4ZPVA 3WS3A 5EORH 1X44A 3SDAB 1TZIB 3VA2C 3ZKMD 1ZT4A 5GS0L 1ETZA 5ITFA 1DFBH 2VXTH 1FG9C 4PP2A 3HG1E 5E7BA 4EIZC 3MRQA 3OTTA 5CP7A 3SCMD 4HFWB 1GZQA 4EI5C 3U6RB 4Q97A 4ZYKB 3VFRB 2ICES 3JVGC 4WTWA 4PGEB 3MLTB 3RKDC 1URLA 3S4SG 5D5MA 1X9QA 5BOPA 4JFDB 3HI5H 2DOCA 4Y16A 1RJCA 2D0GA 5ADOL 3CCHB 2YXMA 3NMEA 3MSPA 3RUGB 3LIZH 1OLZA 4DOHE 1UCBH 3VDBA 2R0WL 2GJ6E 1QFWL 3OZ9L 4PJDF 3HNTH 4PV8A 3ULVF 2QQQA 4W81A 5BZDA 2VAJA 2R4RL 3V4VH 2WBWB 2BRQA 1WFTA 3UPRB 3O41A 4EIGB 1C5DA 1F3JA 3D2UD 4EVNB 4JGMA 2O5XL 1CDUA 1ED3B 1T89C 5F8RC 4YHIB 3RI5K 3AB0C 1RZ8B 1MELA 1BFOA 1OAZL 3BPCB 4POUB 5JOFA 2FJGB 1IGTA 3QIBC 1LP9A 3ULUF 1QLEL 2R9HD 5EWIH 3PHOA 1M4KA 4PB0L 3VWKC 2JLLA 3OR6A 4X6EA 3D9AL 3HMXH 4NKQB 3RGVD 3PGCB 2PCPB 4MSWA 4PGDB 1YC7A 2NY0C 2F9BT 4X7FC 1VPOL 3W9DB 4Z95L 3U1SH 2E5EA 3RWGB 3LQZA 1HNFA 3MLXL 3T0EB 3VXNA 3WMSA 3UTQA 2D4DA 4URTB 3QDGA 1I9JH 5M94B 1GGTA 4NWTH 3V6OC 2QLVB 5FGCE 4NQXB 3RVXC 2VO5A 3VFSB 3BKJH 1LEIB 4Q0XL 4YDKH 4ZNCD 2OI9B 2WK2A 5D7LA 1CGSH 2AV7B 3OAYK 1Z5LB 1NMCB 4Z7QE 1HHJB 3CMGA 2R4SH 5JXAL 4CADA 5IHLB 3B9KA 3LKQA 5TE4L 3O11A 4QXUH 3BE1L 4RGNB 5IJVA 2NW3A 2FEDD 3BXNB 1MHHB 1UH2A 5IHUL 2D7TL 2ID5A 5I15H 5JOEA 2XWTB 1X4ZA 2LVCA 1JNNH 2NY3B 4LVHB 4YEEA 1NAMA 3TO4D 2HH0L 4HFUL 4OLYL 4DGYL 3GBLA 1XGPA 2UWEA 3PNWA 5DVMA 3RFZC 1G7MA 4FG6D 4PY7A 4KROC 3MGTA 1BJ1J 4U4BA 3T3PF 3V52H 3QUYC 4UNVA 3LOWA 4HKBA 4XC3L 1PAMA 5D7JA 4QHLA 2Y07H 3QUZD 4PLKD 1NFDE 2IBZY 3QT2A 5FM5O 3NH7H 5IVXE 2ESVA 4NOFA 3H9SE 3LN4A 4OD1H 4XCYB 2GJJA 4ZPTB 3VJ6A 3OHXA 3OR7B 3DURB 1EJOH 4GAFB 4HWUA 4TNVK 4WWKB 5I1KL 1DQMH 3DIFB 5C09D 1JWUB 4Y1AE 4YIQA 3PXHA 4XCNB 3R1GH 4Y5VA 1OAUH 1QR1B 1MFDL 3BDYL 3HE7A 1UWEL 3C5ZB 3VRJB 4U1SA 4XHQA 4MJIA 3IFPB 2C3WA 2ZOLA 1QYGL 2BNRD 3PWVA 3BSZL 3B9AA 3FN0H 3O3DA 1TVHB 4I48A 4PJFF 3OJMB 5I66A 2Q87A 1WZMA 1P7HL 1AXSA 2RIKA 3B2UC 3H3PH 1G0YR 2XZQH 4WI6A 3MMEB 3GUTA 5HYJE 4LCCB 3ROLB 3H42H 3NFPB 4LOUD 3BHBA 4U1JA 4X9GA 4FQ1L 1QSED 4NHCH 4WU7B 5IMKA 2DQHL 3BZEB 1BWMA 1IC5H 1FYTD 4O58L 5ELIA 4NSKA 3DX7A 3VDAA 1LNUA 1RZKL 4XNZC 3LKSA 5LKNA 4UIKH 2Q6WA 4LHQB 1QZ1A 3ARBA 1I8KA 2OQJA 3S98A 1YEDA 4M6MH 4BQ6A 3MRGB 3G04B 2WINB 4LAJH 3C6LB 1RZIB 1D5IL 4OJFH 4JPVL 1BBDH 5I73B 5HGBA 1AGEB 2H41A 5D7IB 1HYSD 1NBVH 1UH3A 2JELL 3H9ZA 4R4BB 1UACH 1FN4A 2VH5L 1LEKA 5I19H 1WIOA 3VGHA 1S7TB 1OP9A 2FX8H 1IAKB 1RZJC 4GUPA 1KEML 4GXUM 3QI9D 5DUBB 5CKAA 3EOAA 3G6AB 5MERB 4PJ5B 3V6ZA 5T3ZH 1YY8A 3EDDA 5DZLA 3FFDA 4P5KB 1SMOA 5T1LD 2ZCHL 5FYLH 2ENYA 3F5WA 3MJ8A 3V8CA 3DGGA 5GSVB 3VI4E 4EN3A 4ODWB 1CT8B 1FNEA 5KANG 4DUVA 3QIUC 1IFHL 1SJEA 1QFWM 1EEQA 3QH3B 4IDJH 4WNQA 4O2EB 4M5YH 5LG1A 3ARUA 4QXTA 2I07B 4NJ9L 5EZOH 4Q9BA 1DN2A 3M8OL 4L4VA 3BPOB 3LH2L 4P2QE 3E2HB 2RCSH 4DN3L 2A38A 1KPRB 5GS0H 4FFVC 1UM5H 4JDTL 3KJ4B 2DQDL 3WDHA 4FQPA 3KPLB 4NKOA 2WUBL 4IMLB 1MI5D 4NCC2 1SVZA 4YHNA 5DJAA 1IKFH 5IP4A 1ZVYA 5J4MA 4XWOC 5L8KB 3M45A 3WHXA 3LS4H 1P7KB 4UOJA 4MXVF 3K2UL 4JANA 2VYRE 5F9WC 5A2FA 4LHUA 1VGKA 4UT7L 2YRPA 3OZ9H 1CYGA 1T03L 1BD2B 1GYAA 4KJQD 2DTML 4KVNH 4LVEA 3LZFL 5A2LH 3RX8A 2O5XH 1ZV5A 1JWMA 4WI2A 1Z0MA 2CUMA 3NCJL 2H6PB 4ZOEA 4IS6B 1R0AL 1LD9B 5SV3A 3I02A 4TULH 4NQED 1CXIA 4PB0H 5HHQA 2IH1A 1S9YB 4GJTB 4KJPC 5EPMB 5IM7A 3E6FA 1FJ1A 5HYQB 5BRZD 3SDDD 3TT3L 5GGSY 1JTPA 4KWUA 1HOCA 1IQWL 4Z95H 4P23D 3PWPE 3VXOB 4LSSH 1KYOK 5EO9B 4AK1A 1F4AA 3TPUB 2PF6A 4OZHA 5JDSB 4M93B 2CQVA 3V2AR 4N5ED 3LKPA 1A6AB 3NFSL 2JIXD 1A9BA 3VI3E 3T09A 3MLPA 4I2XB 2WQ8A 4X6FB 5J89A 2NPLX 3PQYA 1NH6A 4UOW0 4N8CL 1T2JA 1MH5A 2FYYB 3EO1A 2HJFA 3CUPA 5DJ0B 2FIKB 4ZUSB 4X80H 3STZB 3V0AC 2AJUL 4D8PA 4AENA 4RZCA 4PJIA 3EYOB 1F11B 3O6ML 3VGAB 1NCNA 4WO4B 2R56L 5HYSB 1KPVB 1SYVB 2D7TH 3QUML 3QFJD 3X3FH 4XHJC 3T1WA 4G9FB 3H0TB 1K4DA 5GGQL 4KC3B 1NJ9A 5EULV 1JF1B 4LSPL 4CGTA 3LSOB 1FSKC 5CD3A 2HH0H 1T6WA 1DZBA 4JZNA 1E4KA 4MVBC 3ZE1F 5I1EL 4N0UA 1P7QD 3MJ9A 4LVNC 3NIGE 2AEWA 3QFDA 2A73B 4RAUB 1A7OH 2IQAA 4NZDA 2AV1A 5D96B 1KBGL 1ZA6A 4GRLC 4TVPD 1XR8A 1A6ZA 2ERJC 1HXMB 4HV8B 1ZGLB 3TWCL 3ILQD 3FB5A 2WP3T 4KRNA 1CS6A 3VGDA 2CR3A 3QULA 4M6AA 1CICD 4R7NB 4HS3B 3HR5A 1G0XA 5I1KH 4UBDC 5B8CA 4YPGA 4DN4H 1Z9OA 1YNLH 1CR9L 4F9LA 1NDMB 5EUOE 3RA7H 1MFDH 4R8WL 4FRWA 1IQDA 2UZYB 2XWBA 4XP4L 3ARGB 3LPWA 4ZS6D 4ZTPL 1H3TA 4P46A 5CBEA 4WI4A 3X11B 5C8JB 4RMQA 1QYGH 2GT9A 5DT1H 5C3LD 3B43A 2W1NA 2XZAH 1J11A 5JLZB 4DUWA 1YPZA 4YHZH 1HE7A 3SE4A 4GLRH 1Q72L 3FQXA 3MREA 1U8JA 4X8XA 1J5OL 2X70B 4OAWA 1Z2KA 4N0CD 4NQCA 3LV3A 1XF5A 3C2AL 3C6SA 4UV7L 1ZTXH 2IJ0C 4DEPC 3AU1B 5AG9A 2DYPA 5E24E 1YJDL 3FRUB 4FQ1H 5J1SC 1RSFA 4HIXH 2R2BA 1MIEH 5D2LE 1K3IA 4V2BA 4YO0A 2AXGB 4IRSB 3F7YA 3BYTA 1RZKH 3C60C 3W5MA 4Z5RB 1I8LC 1N4XL 4LLYA 4PY8I 4HF5H 3REVA 1ZVSB 3EYQD 4LCYA 3ULVL 1UZ6F 2EH8L 4YHYC 1OGTA 4HAFA 4OTXL 1AH1A 4RFEA 2BJMH 2OTUB 3ARTA 1DBBH 4Y2DA 4GG6B 2W0KA 3DTXA 3QP3A 5HHXL 5HY9B 2W60A 4G8IB 4LPVA 4YNYB 4P48A 3DROA 2DBLL 3ULUL 4XX1G 4NZUL 3HMXA 4Y19D 2CKBB 4NQDB 4YDLC 3S3JA 3MODL 5J3HC 2J6EH 5C86A 2GQHA 1OTSD 3AY4A 4F3FA 3WIIH 3L7FA 5A43C 1INQA 5H37G 2LU3A 1NC2B 2C3GA 1VESA 3SGEH 2EIBA 1M05A 4OD3H 1RJYB 1BECA 5GGSA 3U79A 4KRPC 4HC1L 2NLJB 1J0KA 1IFHH 4KUZH 4YK4C 3ZO0A 5GS2H 3ZKND 4QRPD 4LIQL 5DQJB 3DETD 3CSPA 2JB5H 1T66C 3KDMA 1KTLA 3U0PA 1Z9MA 2K7QA 3CXHK 3M8OH 5MEQB 3OAYH 1Q0YH 1ZLVK 1DBMH 1GAFL 1AO7B 4LBEB 4IIQC 3ZKMC 2VJXA 2YN5A 4N1EA 1XH3A 4APQA 3VFUA 1RQ5A 4QHUA 1BZ7B 3NCYP 2R69L 3MXWH 4OI9A 2C3VB 4ZUWB 3ORJA 3QDMD 3QEUA 3L3OB 3D39A 3VRIB 1WT5C 2BY0A 1Q8MA 2IAMA 3CZFA 1Y0LB 2YHGA 3SKJH 2A83B 4Y88A 3BKCL 5D1QD 4Q2ZB 1JHTA 3AROA 4LLUA 3ZTJH 2ITDA 2VISA 5C0BB 3K2UH 1IMHC 3TCXA 5C2BL 3JTTA 4RAVA 1YEFL 3QHZL 4X5LA 4L8CB 4MNQB 2J88L 3BP7B 5IB2B 1TDQA 1CQYA 4Y4FC 5A2JH 5IB5B 2XICA 2NW2A 5I75B 4R0LB 1DQLH 2OMNA 2Z8RA 3LZFH 3U7WL 1TQBB 2DQCH 2XRAL 3P4MB 4HJJH 5IMLA 3UBXA 3TVMA 4ZUUB 4UI2A 2IANA 4LLVB 3NCJH 4I1NB 4LNRA 4PV9A 3HLAA 4Z7UF 5I1IL 3NACL 1G7QB 1EHLH 4PRHB 3T4AA 1I8MB 3MV9A 4K8RD 3HPJA 4G8FB 1P4LA 3FQRA 4OBRA 3UTPE 5C0GB 4BZYA 3MRFB 5T3XL 1CDIA 4L8SB 3VFPA 1XGYL 3GSXB 1OB1A 4L8BA 3NZHH 3RGVC 1QSFE 4Y2OA 1HH6A 4X4MA 3P30H 3THML 1JTOA 3PWLB 1EZVY 1RJZB 4J1UA 4JHWL 1G9NC 1BVKB 4QF1A 2P42B 1DDHA 4L4TB 4PUBL 4HUUA 4NC2B 4JVUA 1TJGL 4YBQD 1KLUB 4RFOH 1IM3B 4HGKC 1IM9A 3GIVA 3MUJA 4HWBL 4PJGE 5HVGB 2X1XR 4PJXA 4JO4L 2E6JA 3VFOB 4M4PA 2HFEA 1CDHA 5K59E 5CGTA 2CGRL 1J1PL 1NLBL 1X3DA 4PR5A 1NUNB 5TQ0L 3W9EB 3UEZA 3HZMA 2YUWA 3HC4L 3RIAK 1BQHB 2VLRB 3MGOA 2X4RA 1RU9H 5L6YL 1CDYA 4ODUA 4R2GD 1LQSR 4X6DF 3T3ME 4KK5C 5I1HH 4NO2A 3HZKB 5I8EB 4HZLB 3K80A 3LEYL 2FGZA 2EDXA 1JPGA 2EDNA 4AQ1B 4EOWH 3WN5C 4BUGA 3OB0K 3MV7D 3OPZL 1UKQA 5IW1A 1MPAH 3TO4C 1OTUD 4J3UA 4HPOL 1BX2B 2PNDA 4MD4B 1I1AA 2Y1VA 4LKXB 4HS6A 4FG6C 4NO0A 4PJ9C 4CDHA 4X7SL 3W0WD 1T7VA 3ARZA 4N8VB 3HA0A 4FQIH 3EFDH 5BS0A 1RIUH 1V7ML 4WHDA 1EFXB 1MFBH 1RZ7H 4HWZB 3QUXB 2K7PA 1BIHA 3QUZC 4PLKC 4OGAC 4PJHF 3MCG1 3R06A 4X99A 1DSFH 4OM1H 3MPCA 3GKZA 5A40E 2OZ4L 5CSZB 1QO3A 4WW2C 3V5KA 4NNYA 3K1DA 4H1LG 1J8KA 1U95A 4PRPB 4YDVB 4ZAKD 3V6BR 3REWA 1PFCA 3N9GL 5DJ6A 2ITCB 3BZFB 1KLFA 3MJ7A 2OL3B 4OF5A 1RJLB 2EH7L 4XRCB 4YC2C 1LGVA 1XF4B 4JCMA 4OGXH 2R1WB 4R8WH 4WJ5A 5ABDE 1U8HB 1T7ZA 4Q6IB 4S10A 3JSSA 2EEAA 5CCKL 5CP3H 3DV4B 4ZTPH 1MOEA 2QR0B 2Y36H 5F3HA 7FABL 2ZSVB 1FV1A 1XIWB 4MHHG 5CJQL 4Z76A 2B39A 5C0AB 4PJCF 2OX5A 3ZTNH 1X5LA 2F53E 3O4OB 5CHNB 1VB9A 1V3JA 4MX7B 4ZSOE 4NQSA 2RBLA 1FQ9C 4UV7H 1N6VA 3WEXA 3VXPB 3CVHL 2W9DH 1YJDH 3S37H 2D7PA 2VQTA 4UILH 5F1SA 1X4XA 5I76A 1KNOA 4UQ2B 5E2VL 3FB8B 2AEQH 4J3SA 3OKEA 3T8XA 1N4XH 5KZCD 4UOW1 3I6GA 2MQ3A 3P4OB 5IWLA 3GJFA 4XC1H 4OZ4B 3TH2T 2NY4B 3MRKB 5EU6D 2V2WA 1JN6B 4LSDA 1MJJA 3TZVB 3V4UL 1AE6L 3L6FA 4FN0A 3RPKA 5BVJB 1NUDA 2NNAA 1H3PH 3BIKB 4ELME 1V05A 2B20A 2Q8BH 4N0YH 5IQ9B 3BQUD 5HHXH 2NYYC 1HYSC 2RFXB 3WUWA 2IFFH 3BPCA 2IH3A 4G8EA 1J0IA 1CU4L 3CFEB 4PRAA 3F58H 4LP5A 2AJYL 2JJWA 1F58L 4X7DC 3MODH 4I0CC 4GSDH 1FCCA 1QLRB 2X2YA 3HPLA 5F1KC 4ONFH 1RUKL 5DLMH 2JCCE 2APWA 1EO7A 2GFBB 5JW4M 3WO4C 2QHRH 4WGWB 4KXZH 2EO9A 4OZIA 3HR6A 1BMGA 2Z93B 1AGCA 1N2RB 1NC4A 3EKCA 4P5TB 4X6CB 2Q7YB 1F90L 3BZ4A 1OSPL 3HMWL 3HAEB 4FABH 5E9DE 5JIPA 3MGAA 5DJCB 4NO5A 4KHXL 5ADPH 3T2PA 1FG2A 3HZYB 3O0RL 3BXNA 4RIRB 2YUZA 1IGYA 1MHHA 1REIA 3AREB 2Y6SD 1AXIB 3FL7A 1GVIA 1YEJH 4DKAA 4OGYH 4Z9KB 2P1YA 3EYVA 4KZDH 3IETB 4L1HA 1MI5E 3B2VL 4CVZA 3K46A 4OFVA 1QR4A 5I74B 3MCKA 4S0TD 2PYEE 4OCRH 2GSIB 5C2BH 1A7RL 2YA0A 2MHAA 2IMMA 2ICWJ 2J88H 4I3GA 5CEZD 4RX4D 15C8L 4KJQC 4TUJA 2X89A 5E1AB 3FOMB 3KPRB 3SKNA 4FFYL 1G1CA 3DVNA 4XPGH 3TT1L 3DURA 4HUVB 2DQUH 3NACH 2Z35B 1YMHA 4XB7A 4JZJC 3DIFA 5ALCL 4MWFB 4HK0B 1U92B 3U0WL 5J11C 2OTWB 2P5ED 2Y06H 2R23B 3P9WB 5KSBB 4XP9L 1FFPA 1OTTD 3C5ZA 3U2SB 1AGFB 1BBJA 1IGCL 1BIIB 2IC2A 3GB7A 1IAOB 4P57B 1JGVL 4YHLL 3G6JE 4ISVB 4OZGF 5FIEA 5BRZE 4P23C 1JYVA 2PTVA 3L5HA 2FECI 5ICXB 4EUPH 3Q48A 4XWGL 4N5EC 4X4XA 2KZWA 3UJTL 1PSKL 2C1OA 1FNLA 4W4OA 3MMEA 4IRJB 2GJZB 5DD3H 2MSPA 4HWBH 2YC1B 1MFCL 4JO4H 3ROLA 3FQUB 2O5YL 3U0TB 2BNQD 5TQ0H 3MV8D 1IAIH 3BZEA 3L9RA 5DRNB 5DUMH 4L8DB 1ZT1A 4M62L 1H5BA 3H9HB 2HN7B 1NCBL 4P3WA 2GTZA 4XTRD 5L6YH 2VXUL 2APFA 4P9HC 3ZMRA 2R2EA 3X14A 5E5MB 3MZTA 2W0PA 4Z7VF 4NOBA 1RHFA 1I8IB 3GMRA 1YEKL 2OBGA 3SKOB 5KVGL 1KG0B 3G04A 4UDTB 4U1MB 3C6LA 4TSBH 3N06B 1NEZG 5GS1B 1XGRA 4NDMA 2WAHA 2R0ZH 3CJJA 2YD8A 5SWQB 3WFHA 5CBAA 5JA9A 2FO1A 5J6HA 1ORQB 4HIJB 4X7SH 4GW4A 1TETL 1S7TA 4ZFOB 1T0MA 2R0LH 5BXFA 2HG5B 3A67H 1Q9OA 3FOLB 3QEQE 5DUBA 3RDTB 5D8JL 3SDXF 1M6OB 3JV4B 3VXSA 1S7WA 2J6EA 5MERA 4XPAL 3TM6A 4TVPE 1DQQA 3ILQC 4Y4KD 4PJ8D 4P5KA 4EXPX 5MENB 4JFOB 3PF2A 4PRDB 1D6EB 2JJTC 5JW4R 3QA3B 5GISL 1GC1C 1S9XB 3OJ2C 3ZKSD 3ARYA 1A6UL 1AHWB 2AXFA 1OCWH 4KDTC 4M8QA 1S3KL 2XFXB 1J8HA 5E8PA 4LLWA 3TNNB 2WBKA 1T20A 4XCFH 3S3SA 1SBBA 3IAPA 4HLZH 2HFFB 3EDFA 5D6DC 3B8YA 2NY2C 4G6FB 4JRXB 1M7IA 4JQVA 1KPRA 3DRTB 4LCUA 1CBVL 3LKRB 5JO5A 4C83B 1G9EA 1AXTL 3S34L 5L2JA 1BZ9A 3KWWA 3HI1B 1AJ7L 2X4UA 3ECBB 1K6QH 3V95A 1HQRB 1A1OA 2ADJB 3KPPB 1ZA3A 4JFZL 1EMTH 4MDIA 4IMLA 1TIUA 4NFCA 1Z3GH 2ADGB 1TVBA 1NUFA 1D9KA 4XXDA 2YRZA 5F7MC 1MJUH 4JN2B 3HI6L 5E2VH 5SWZE 1FFOB 1MEXH 3L3JB 5ICYB 4Z78A 4FQXB 1BWWA 3VH8B 1DQDL 2YD2A 5E0QA 2JKXA 1YYMH 5IFHH 3PL6C 4PRBA 3D85D 2HRLA 5D71H 4JO3L 1AE6H 4FTVA 1CI5A 3U83A 4JFEB 2LAAA 4RAHA 5FYKD 3UX9B 2XN9B 4JZOA 1D5ZB 4TSCL 2H6PA 3A6BL 3Q6GH 4PLJD 5L2KB 3RL1B 4F7MA 1BJ1H 4JLRB 1BVLB 2FDBP 2IWGA 1XMWA 1R3HA 5K9KB 3VWJD 1S9YA 3KR3L 3HB3D 3JWNC 1NGQL 3LN5A 4PY8J 4TNWK 5I30L 43C9B 2ZG2A 2ILLA 4R7DA 1NMBL 1S7SA 1CLOL 2F54B 2WBJA 1OTSC 2BVYA 1RUKH 2QJDA 3VXOA 4DGVL 5BW7A 1JHLL 1DBKH 3TPUA 3VCLB 5C0JB 4HBCL 5DTFB 4LEXH 2VSCA 5FECA 4P4KB 3KHOA 4PJAB 4WW1B 4PG2C 4GMTL 3MACL 3C8HA 1N0XL 2A1WL 4M5ZL 2OSLA 3JTSB 1IKNA 2J3SA 5HHMB 1WC7A 1GHFH 1A6TA 3ZL4L 4CW1B 1J12A 3S4SB 5F3BB 1TQCB 3HMWH 2AK4A 3CX5K 5K93A 4QHKI 3HAEH 4Y16D 2H3NB 4KHXH 3ARSA 1L0QA 5ISZE 3GHEH 4PGBA 4Z7WF 3QUMA 5ERWA 1SYVA 4LDEB 2VZTA 3OB8A 4C56B 4U1GC 5E2JA 4G9FA 4QY8A 3UDWC 1J18A 3LQAC 4P2OB 5EU5B 1KENL 2VDOL 3SDCB 5B38G 3DNKA 1WCBB 3B2VH 5D1QC 4CKVX 4PJBA 1H3VA 1M7DB 3BFOA 2CK2A 5I8OL 1OAXL 2PKDA 2J12B 3OB0H 1A7RH 2CDGA 3KAAA 4QTIH 5JHLH 2G5BB 4FZ8L 1CG9A 1GL4B 1KGCE 3BKYH 5FF6B 1CN4A 3SDYH 1D7FA 1XZ0B 1IEBB 1W2KT 1GGBL 3IB4A 4NN7C 4F58L 5J57B 2Y7QA 4MA3A 1WWWX 1UJTA 4L3AA 3R8BB 4FFYH 1A7NH 3IVKA 3MBEA 3MRHB 3QDGD 1KEGL 4NYLB 3UTSD 4WFFE 3OAUL 5GGUA 1F8TL 5CAYB 4NRXB 5EO0B 2PW2A 4I18B 4XP9H 3TC9A 2A2QT 3AM8C 5CP3A 1B6UA 5D7LD 4WHYH 3ARGA 1U6AL 2V2TB 3VG0H 4K23H 4D0CA 1R3JA 5C1MB 2WP3O 3SGJA 1FNGB 3RY6A 3B9KD 2HT2D 4E41B 4YBQC 3O2DH 4M02A 1IL1A 2H8PB 2J8UB 1I85A 2UUDK 2B1AL 1EH9A 1ND0B 2J7LA 5KBNC 5DEZA 5B3JE 4HJGA 3B9EA 4UB0L 3P11L 1FZKA 3VI3F 3VXME 2O5YH 4LCIL 1S7UA 1H3WM 3BZDA 3NCYS 1UM4L 3DUUA 1NANH 4BH7B 3ZKXC 4JFYB 3QXDA 1MCLA 1SHMA 1MRCH 3WFDH 3MLWL 4Y5XB 3GGWA 5EA0H 3LRSA 4FP8L 3VRLF 3CFKA 5ENWA 1MHCB 4W68A 5F6HJ 4G7YL 4JPKH 4HHAB 5D7JD 2VLJE 4JVWA 5J13B 2X4TB 4EI6B 1HXYA 3OXSA 3IAQA 3WKMH 1RUPH 2ESVD 3TBVB 3FKUS 4G43A 3CFJB 4L29A 1PEZA 3VG9B 3GMMA 3LPFA 1NQBA 5IV2A 2OTUA 1A4JA 4MQTB 1UADC 4GW5B 3QWOB 1B4JH 1N26A 1MRFL 1VKXB 1FFNB 3ETBF 1KT2A 3MLYH 3AS2A 1RURH 1LEGA 2JTDA 4N9GB 3U7YH 4I5BB 5GJSL 3HE7D 5IW6A 4M1CD 1DN0A 3W0WE 2FGWL 3D18A 3RNQA 4RNRB 4MJID 3EOBA 4NQDA 5AUMA 4PD4K 4OIBA 2GTWB 1QBAA 5EC1B 1CE1L 2VABA 3UBXI 4DAGL 3IDUA 5FV2A 2YZ8A 4AEIL 1EO8H 4ZAKC 2DIBA 4S0SD 5SX4H 1FAKT 1N5AB 1E4XH 5GISH 1LO4L 4JFHE 1YYLL 5CLTA 2X7LA 4O2CB 2L7JA 4HLJA 4ZD3L 3VXRD 5IF0A 1IRAY 1S3KH 5EU7C 5DEGA 5F7WC 2N4IA 2B4CH 3O9WA 4NM4L 4L3EA 5EUOF 5FK9B 5EU7E 4F7TB 2PXYA 1SY6L 5HVHB 4Y8AA 3O8XA 2IEPA 4U1KA 4YQXH 3GSUA 1CBVH 4YBLC 3CZJA 1MUJA 3EDKA 3CSYB 5DMIH 3QJHA 1AXTH 4KJYB 5DFVD 2ZUUA 5DJ2A 4WFGD 5E2UL 4BSVB 3IDIB 4NNXB 2EDBA 4MQ7A 4WUUB 3TP4A 1JMZA 1MHEB 1ZLUH 1A1MA 1R6VA 3ARBD 3HG1B 3HRZB 5E99L 3C8KA 1MFNA 2VXQL 4BKLB 5MI0C 1MAML 1YECL 4F80A 1S7VB 3O2WL 4AEEA 2BDNL 3LPGA 4F15C 3B5TA 4EI5B 2XQBH 2LU4A 4HIEA 4HUMB 3EO9H 4GKNB 1KB5B 1KPUB 3SJVE 2XKNB 4XVJH 5C0BA 1OP5K 2J4WL 4XP1L 43CAB 5ID0B 2NXYC 1M1SA 4GBXA 1DQDH 2VWEC 1WBZB 3IYLW 1U8MA 1FL6B 5GGRB 3DARA 1B2WL 2VWEE 1GOFA 2FZ3B 2HKFL 4K7PH 4JO3H 2I9LB 2OR9H 3LKNB 2GUOA 4X9IA 4CL7A 1MCPH 5GRUH 2ZCLL 4LLVA 1UA6H 2O93L 3DBXA 5I6XB 3JWOC 2ORBL 5DF0A 5HHOB 2Q8AL 5EIVA 4G8FA 5C0GA 5BZWB 4U05A 3ET9F 3MRFA 1C1EH 3AB0B 4L8SA 4F2MB 3DVGA 4GW1A 5GRZA 2DF3A 3RNKA 4NQVA 3PHQB 5I30H 1T1XB 4ODSL 4KY1H 2QV2A 1OARH 3QIBB 1DUYA 2DQTL 2YEZA 3UZQA 3VXQB 4L4VD 4MCYA 3VWKB 4PJFA 1FAIH 4MAYA 4BA8A 4EUPA 5EB9A 5TQ2L 1ZHBA 5F9JB 2NY0B 3M17B 2EE6A 4RMSA 3RUGE 1G9MH 4GMTH 3HC3H 3MACH 1IM3A 4HWBA 4LKCB 5HYEA 5FGCB 5K9OB 4PBVC 4M5ZH 1CZ8L 1A1NA 3J8F7 5C0FB 1LDPL 4HIHA 1A64A 4UAOC 3QCTL 5DGQA 3V5DA 3SE9H 4OKDA 2PW1B 3EO0A 1KTDA 4IOIA 1LK3L 1GIGH 1K2DA 2P24B 2PETA 2X1PA 4LHUD 1SVCP 4ELKB 4XBPA 4X5WA 5TF1H 2Y6SC 3QQNA 3SKUD 4WTZG 4OIIL 4E9LA 4WFED 2EDTA 2VDPL 3ZE0F 3MRRA 4K94L 1ONQA 3RWCA 3CH1B 3E8UH 1NCWL 1XAUA 1J9CT 4GRMB 5JNYB 3RVWD 1JUFB 1WV7T 1RPQA 5I1LB 3EJYD 1N5YH 3N85L 4BELD 4PJEE 3H8NA 4A6YL 2YD5A 3ZLQC 1AD9B 1PKQB 1TPXC 1U8IA 1OQOA 4FZ8H 4F7PB 4P9MH 5TH2B 4M1GL 5D1XA 4KROB 2VZVA 2MKWA 4M7KL 2Y5EA 4X9BA 5FXCH 4K8RL 2OJEB 4LQFH 3FMGL 1KIRB 3ZYZA 1AKJA 1Q1JL 3NCMA 5CZXD 1NFDB 2NR6D 2CDEB 5CEXB 3F7VB 3C5SB 4M6NH 5IVXB 3H9SB 4RGNC 4G3YH 1KEGH 5J56B 3OAUH 5DC4B 4RGNE 1G7HB 3ZT6A 3PGFL 1RJLA 4UT9L 5JHDA 3BW9B 1OTTC 3FCTA 1QRNB 2ADFL 3EOTL 3O3EB 3PQYD 3MRBB 3DUSB 4DTGL 4EDXA 1JNLL 5DJDA 2ARJQ 1LO2L 1CTOA 3O3BA 3AUVA 3FTGA 3RZWA 3K4DA 3TN0A 3U4EA 4WHTB 2DWDA 4OCLC 5F7LB 1OGAB 4LLQB 5FYJE 1EXUA 3FO9A 1T21B 2B1AH 1P1ZB 3QZWA 4RQQA 4H5SB 2X1OA 4DZBB 1A0QL 4CAGA 3CVHA 2FLBT 4IM8A 3O6FA 1SM3L 2AJ3A