1MRCL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrcL01
3CZJA 1JPTL 2ARJA 1KIPB 3ULUD 3L5WB 5ANMA 1S7WA 3WHXB 4M6NH 4L9LC 1SY6A 4R7DB 1WGOA 1A1OA 4WTZA 4XAKE 5EWIL 3UJTH 4KKBD 5E9DE 2Z9TA 3SQOL 2Z4QB 1NBQA 3G6JF 3C8HA 4QRQB 4G8EB 2P5EA 3GMPA 3CSPA 2Y06H 3KYNB 3QUYA 4OQTH 2MQ3A 4TUOB 3GNMH 4X6CB 5DHVH 3EBAA 1D5ZB 4I77H 3KPOA 5F6HI 4ZQKB 4OLUL 3RTQB 3Q6GH 1IGYA 4RRPG 5J8OA 3RY6A 1EFXD 4D9LH 1MREH 3BWUC 4KROB 4JFEB 1OW0A 5E1HB 3O6LL 5F9AC 4XGZB 3WO4B 3WN5C 1JK8A 3OKOA 5DMGD 3K74B 1A14H 3QQ4B 4POZC 5D5MA 2KL6A 4KMLB 1J05A 4MNQA 3FKUS 4NUJA 1KIUA 5T3ZH 4UOJA 2AEQL 1OB1B 4U1LA 1CGUA 4J8RB 1WLHA 4MNGB 3QPXL 3RY4A 3VFNA 3L9RB 1GGBL 1TJHH 32C2B 1W0YT 1BJ8A 4Y4FA 3QQNA 4X83A 4NUGL 4BK5A 3QCVL 1JPSL 2B8OT 4EUPH 4NO3A 1QYGH 1CFBA 1I8MB 3FMGL 2CLZB 4BUGA 2R1XA 4ZG1A 4U1MA 5IBUB 5JMOC 4NOFA 1QA9A 1IGTA 4QHUB 3RBSA 3T4YA 3NFNA 5F7LB 2BRQA 1E6OL 1QLRA 3SDAA 1YPZA 2Y9RT 3C08H 3F12A 2RFXB 1UG9A 5FM5M 5LQBL 5GISL 1IM9B 1A7QH 2APXA 4L9LB 2VE6B 2GUOB 1KB5H 2VDKH 4MHHI 1BFSA 3EYOA 2ZSVA 2ZCLH 5JNYB 4OZIB 3Q2CA 4WFGE 5HD8C 1CL7L 5DK2A 3WLBA 1PLGH 3LMJH 1NBZB 1YNKH 4QRRA 4LHUD 1OWWA 2FJFB 5TPWH 3HUJA 3M07A 5F3HA 1T1XA 3RIFF 5L2JB 4I5BB 2IAMA 2VABA 4HEPG 4I0PA 1Q1JH 2FZ3B 1MCNA 3H9HA 3FQUB 1JNJA 3BKJL 5A16B 3CMOH 5DVKA 1LO4H 3GMQA 3O4LE 3HI1A 3T0EA 3T3PE 3ULUF 5JUEH 2IQ9H 3MRIA 3K80A 2BZDA 5F7DB 3WSQL 5EO9A 2WWMC 1FV1A 4YPJA 4XNXL 3E1F1 2Q7YB 4UINH 3UDWA 4R9HA 3L3KA 3KYOB 2FR4A 5D1QB 3AXLB 1RJYA 1S7VB 3V0WL 2Y36H 4NC1E 1AE6L 5CEZH 5IMMA 1NLDL 3P77B 1ZV5A 1CFNB 4LASH 5T5FH 4PJBB 1XEDA 4JQIH 3UTZA 2UWEE 2ERJC 1OF2B 3RIFK 3NCFB 1U8PA 3K7UA 3MJ8A 3LKSB 5HHPA 1ZSDA 3MRNA 2ZPKL 2HWZH 1F4WH 3GBNH 4ONGL 2QADB 3JBG7 1RVFH 1DQJA 3L3JB 2Q3ZA 2VOTA 5BOZG 5FO7B 2Z91A 5DK0A 1UA6H 3QG7L 4Y4KC 3VMPA 5IR1B 5T1MA 4HQQL 5D7LE 4L1DA 1KFAL 3T77A 1DL7L 2F54E 4D8PA 4MXQD 4L4VB 5INDB 4N0YL 2VLRB 5D4QA 1IT9L 2Y25A 1WBYA 5EU7C 2E7MA 3BP4B 4XNMB 1UC6A 5M94B 3KLHD 3VXRE 1E6JL 5F9JA 1ODAA 1R5IA 2EDDA 2GJZB 4FZEL 1W0VA 5E7BA 3UJJH 3KPRB 4JKKA 5ALCL 3DVGA 4WEBL 1GGYA 1WFNA 5I6XC 3FO9B 4R0LA 1KULA 2V6HA 4CVUA 4DK6A 1WSST 5ACZA 1QSED 4ZUSA 4GBXA 5ITBH 4OF6A 1CLYH 4UIKH 3A6CH 3GKZA 4LPUA 2IFGA 1YDPA 4GW5B 4GW1A 2IBBA 3QPQD 3NPSC 1LP9E 2OK0L 2VLJB 3GI8L 4HKJB 5TE6H 4WJ5B 4OLVH 3DX9B 2G60H 4YXKH 4KXZH 2X4TA 1EHAA 1UB5B 4O4YH 4M1DH 5KSUA 4NWUL 5I1JH 3U9UB 1Q8MA 4F7MA 5BRZE 1QVOB 1FAIL 5I1EH 3R1GH 4R4ND 3INUH 5DJXB 4FQIL 5EU6B 4QNPF 1MAML 1YEDA 3TA3D 5F7EH 4XRCA 1NUDA 1MFBL 1KNOA 1KT2A 5HYJE 1KLFA 2A73B 3KPSB 5ESVB 4YGVA 3BZDA 2ED7A 1C5BH 4KHXL 2BSRA 5SWSD 1PEWA 1NC4D 1JHTB 1P4IH 2A0LD 3VFRA 3L3HA 4LPCA 4MMXC 4M1CD 4HK3J 1S9XB 3VGBA 5FEBA 1IARB 3MQIA 4NQUA 3QISA 1JZ8A 3NCJH 3WIHL 4GKOA 2DLEA 4Y4KB 1ZHLA 1VACB 3RIAF 4QCIB 1AGDA 4V1DB 1MWAL 1KJVB 1H15B 1T22B 2CQVA 4JLRA 4GAJL 1YMME 3MRPB 5GGRY 2BVOB 2VISA 3E3QE 2FHCA 4UI2A 2BNQD 4WV1B 1OGAB 2YUVA 2Q3AA 5IVXF 2DM7A 2Z8SA 1QEWA 5AUMA 3NIGE 4NM8L 1CDBA 3VJ6B 1B6DA 1OQXA 2J8UA 1T5XB 2KH2B 2EH7H 3VG9B 3NTCL 1ZE3C 3MUY1 1I3GL 3WKML 3GI9H 2EO9A 5L0QC 3VXNA 2CSPA 2W0KA 4Z0XA 3T2PA 3EFFA 1U8JA 2I27N 1ZA6A 3L3GB 3LPGA 4M03A 4K94H 4O51B 1JF5A 4ZUVB 5EU7E 4AZ8A 1FZMB 4OLXL 2F19H 4ZODA 1NC2D 1G7QA 4OZ4A 4JB9L 5T1KD 1MIMH 4KRMB 4JRWA 4MX7B 4EN3D 3PWPA 4GG8A 4TPRL 5C0FA 2NY5L 3S37X 3LN5A 2HN7B 4MSWB 3EYSL 4OLWL 5AZEL 2BVQB 4U1SA 3KLDA 4P5MB 4EDXA 2CLVA 2F74A 2B2XH 4G6FB 2E7BA 1SM3L 1KGCD 3W11C 1MHCB 4HS6B 1FYTA 1UCBH 4LCYB 3HRPA 3ZDXE 4CW1A 2WV3A 3G08B 3GMLB 1QKZH 3MODH 5C09D 1FIGL 1U93B 1UM6L 3UEZA 4M48L 4H5SB 3Q1SL 3ZYZA 3MXWH 3E6HA 5JPMA 4HMCA 5KS9F 3TBWB 2ENYA 3V9FA 1KN4L 1H0DB 3HAEA 3QEGH 4JRXE 4XPGH 1WFOA 5C9JA 2AAVA 1F4AA 2R2BB 3IAPA 4K2UL 3NN8B 4A6YA 3MO1B 3TT3L 3KPQB 5IT2H 1N0XH 3LKPA 3BUYA 2R8SL 3QHZL 3PGCB 1JGUL 4HIXL 1BD2A 3QEQD 1PVHA 5CHNB 1C16A 3GUTB 5GJSH 1UWXH 1FRGL 2K3TA 3DETC 1GOGA 4WDIA 2H26A 3VDCA 2YD7A 4ZSOB 1ZT4B 2VDOH 3MR9A 3H7BB 5GQBA 3P30L 2ATKB 4N9GA 4GAGL 2ZOKB 1F4HA 4MA3B 5HGAB 5CGTA 1WZKA 2CUMA 4KZEL 1NDGB 2JJWA 1IGJB 1MHHA 3GSQA 3UXFA 5J7CC 3QJHA 4DWHA 1I1FB 3FN0L 4HKBB 3D6GA 5E6IC 4DEPB 2MPAL 3G9VA 5L0QB 1F02I 3B9KC 5ECJE 5CJQH 5EN2B 4KK6C 5C07B 1BOYA 3UTTA 3RHWF 1PX4A 4HJGB 2AK4B 3SJVE 5CILL 1KPRA 5EG6C 2B1HH 2W38A 3BD3A 1I75A 1N5YL 3D0LA 4Z5RB 3QI9B 4WWKD 2IG2H 4NNPH 4QRSB 4KUZL 1SMOA 4DN4L 3I6LE 4G8FA 3K81A 4HIJB 4LLYB 2PYEB 4P59L 2XQBH 4PJGF 3BESR 5IHLB 3RUGE 1CFQA 2NPLX 4LFHG 2ENSA 5L2KA 4M9OA 5A2JH 2HLFC 3JVGC 2VO5A 4P48A 4G6JH 3K8KA 1VA9A 5DSCA 4JAMB 3T8XA 3K8LA 5MEQB 1TZHB 4H1LB 4KMTL 4F58L 1GH7A 2NY2B 2F5AL 1FGVL 1S7XB 4JO1H 4NRYA 1DQLH 4RMVA 3HC3L 1OP3H 3CFEB 5CKAA 5LAXA 4Y5VC 3UTOA 4LOUC 3DRQA 3DRTA 4PRID 3RKPA 3S7GA 5DVOA 5EUOF 2DQTH 1YJDC 1KJ2A 1G7HB 1RIHL 5TQ2H 3TEUA 3S35L 1NCCH 5E2UH 3VE0B 1DBBL 3B2VL 1NDMB 3ZTJG 5ACMA 3CPLA 2WW8A 5C6PB 1LO5A 1VB9A 4E0RB 1KIRB 2VZ3A 1DLHA 4P49A 4I48A 2A6IA 2JK5A 1NEZB 4GRWB 3HE6B 3I6GB 3GSOB 4U6XA 3TO4A 5C0NC 1JNLL 2DMBA 4NHUB 4J3UA 5DJAA 5J3HC 5IMOB 4CADB 2VL4A 5EUKA 2NY1D 4U6HA 1DBJH 1MH5B 2OXGA 4HKXB 4NQEA 3HNTH 2NNAB 4CUCA 4PG9A 4F8QA 3KWWA 4L8BA 5E6IB 1A02N 3TCXA 3PHQB 5HYSG 3HC4H 1G7LB 4JDZB 1UACL 3RVUD 2P5ED 3IF1A 3RGVC 2R69L 4F2MB 5IFHL 2G75A 4P46D 4EKXA 4D9QE 5HDOA 3VW3H 1EO5A 5ISZE 5HDQH 3HCVA 5CJXA 5HPMB 1T3FA 1EA9C 4OBRA 1QQDB 5DJ2A 3RKDD 3ARGA 4ZOAA 4JY4A 3DYOA 1HDMA 3SKOA 4BZ2H 4PJ8B 1ZLSL 4LPTA 4NQCB 5FA4A 2GSGB 3MRGB 3QIWA 4B5EA 5BS0D 1UVQB 1T0MA 4UOW1 3VI3F 5FM5O 4NQSB 3KHQA 3BZFA 3D39B 5F72S 4I0KA 4MS8C 3DBXB 1WWWX 4XPTL 5MEPA 1U8QB 5T1DH 4JKMA 1FL5B 1ZTXH 4MD0A 4X9HA 4G43B 4OV5A 2HLAB 2PR4H 4ZYKA 4PJEF 5D7JB 2BFVH 1IGMH 4XI5D 2ZKHL 3UTSB 5GS2H 1PZ5A 1NGWA 3FCTB 2R56H 4Y2OA 5HYSB 3IS1X 1S9WA 2OTWA 1HILB 2CXKA 4PG2A 5GRXG 4X6FB 3ZYJA 4I13B 3VXQA 4OLZH 1S8DB 4Z95L 5I18L 5FCUH 1QRNA 4FQ2L 3QB7C 3QUZB 3VI4F 1IM3A 1BBJA 1K3ZA 2VXSH 4S1SL 3QXDB 1HHJA 1Z0MA 1LE9A 1PW3A 1YEIH 5GRZA 3CXHJ 1CIUA 4MAYC 4WW1B 3QA3B 1IEAB 3PIQB 3U7AA 2HRPL 3WS6A 5HHOA 2JB6B 1OL0A 5F96L 2Y5EA 4QTIH 2VLME 3E2HC 4LPWA 4XMLH 3QEHB 2MSPA 4CDGC 3ARQA 1OAKL 2K7QA 5B4MD 4PRDA 3S4SA 3TJEH 2V17H 5EOCH 5EIIB 1FL6A 2AJYH 4PJ9B 4QRRD 5C0CA 5L88L 3OKEB 3M1BA 4HD9A 3QCUL 2GK2A 1F3DJ 5FGBC 4U49A 5ERWA 1UWGL 3VCLB 3GIVB 1LEKB 1NMCC 4JJ5B 4CDHA 4L4JA 4ODSL 2ZG1A 1OAQL 4OGYH 1S9KC 4GKZB 3H9ZA 4WFHE 1ZHNA 2CDEA 4YDJB 2J6EA 4OI8A 4OCWH 3T0ED 5BMFH 4PRHA 3AREC 1JHLH 3V6FA 1U2HA 4DVBA 1MRCL 4JM2A 1WICA 4XVJH 1QLEL 2OI9C 1DLFL 4Y4HA 4JFFB 4OCSH 4U1IB 3TBSA 4E9LA 1CE1L 3PWVA 1A6PA 2DQFB 5FYJL 4K3EL 3ALWA 5K9KB 1TCRB 4X6BB 3PJSA 2KZWA 5C9KA 3ES6A 3TPUB 3KG5A 3O3UN 4U6TA 4XNQB 4JY6B 1PDKA 3GJFK 2APTA 3PV7A 5EOQL 1XF2A 1U6AL 4F8TA 1ZVSB 4F3FB 3IJYA 3L5XH 4LEXL 4OIIL 3QWOB 4JO2H 1GOHA 3HRZB 1MQ8A 2CIKA 2EO1A 4XNZB 5D7SH 4ZAKC 4OV6F 1R6VA 4OZGB 4UBDD 1EMTL 3MXVL 3GSNB 3U0WL 4BQCA 5AZ2L 3H9SA 3UPRB 1B0RA 5FA3B 1IC1A 4QHKJ 3WFCH 5BO1L 5KSBA 3KPNB 2VQ1B 3CFJB 4TNWF 4Y0GA 5DZOA 1YNTA 4JANA 4RWYL 1NUNB 5EORL 1CE6A 4MCYA 3T0XA 3QDMA 4TYUA 2A2QT 1HSBB 4K8RL 1PYWB 1A47A 3ZLQC 2ED9A 3T65B 4APQC 4MVBC 3DI2B 3VRIB 4HC1H 1C12A 1MJUL 3VXPA 3BAEH 3O41B 1R24A 2W0FB 4HS3B 1MJJB 3VDAA 2DQDH 4OD2A 1IQDB 3FT3B 5ILTH 1ZLVH 4P2QB 1CGTA 1P1ZB 5HXMA 3VFUA 5DQJB 1I8LA 1Y18A 1DBMH 2ZWLT 3BXNB 4TNWK 4TRPH 3TWCL 4QTHA 1MNUH 3CXDH 4M1GL 3VWKC 4GJTB 5IVZB 4YNYA 1DEDA 4OJFH 1OP5K 1FVEB 3PGFH 5DEGA 1BJ1H 4L3EB 3HMXL 2VLKE 2W9DL 3KYMB 3TZVC 2OI9B 4PRAA 4JQVA 5E8DL 3I85A 2GI7A 4MQ7A 3U79A 2M8XA 1NCTA 1FDLL 5FYJD 3U7YH 5HI5D 1YUHB 2IPTH 4GRWH 2YMXH 4HZLB 3HUJF 2RBLA 2IGFL 5C6WH 5TE7L 1CICC 1UJ3B 4G80A 4WNQB 3MV7E 4S1QL 4MJID 4OGZA 1CR9H 1YEGL 1Q9OA 1UXWA 3WIIL 4RQQB 3MREB 5DJ8B 2RAMA 1L0XA 5TF0A 3JTSB 4R2GB 3PHOA 3P9LB 1X9QA 4O5LH 2EEAA 4Z6AT 1DQQB 3CU1A 5D2LA 1FORL 3TJHD 2J7LA 4RMRA 3GFUA 2LFGA 5F1IA 4QWWC 2PTUA 2R0ZH 2J5LC 4PJIA 2J88H 4I2XE 4NQDE 2DTSA 1INDH 2D7TL 3ZDZE 1OTTC 4LSPL 1FNEB 4NHCH 4OB5L 3RL2A 1JZ6A 2NY4C 1U91A 4MWFB 5ALBL 4ZPVA 3WE6A 3GSUA 2F53B 5JMRA 3NH7L 2FL5B 3MLYL 2AXFA 2YPLE 4K8RD 1M6OA 1FE8L 4PJHF 1MI5A 3P0VH 3QHFL 4OGAD 1RIVL 3VXME 4BSWB 4GW4A 3ZTJH 4UTBH 1CTOA 1ZWIB 2DQGH 1BFVH 3C6LD 2C1PB 1MFDL 2XN9B 3GKWH 4ZDHA 3R06A 5ID0B 4BKLB 1FSKC 4Z7NE 2A74A 3HI5H 4P4KA 4R96B 3CVIL 4ONFH 4FRWA 5LKNA 1OOAA 3WFHB 4XPAH 3O6FB 3FOLB 4RA0C 4NO0B 4ZS7L 4JPVL 2A1WH 3MRQA 4PLKC 3ZDYE 2EDRA 4PJDA 2BSED 3SE4A 5D7IB 2Q76A 3D3VB 1NCBH 3MLSL 3WYRA 3I02B 4N0CC 2FB4L 5C0EB 5ESQA 4YHPA 5JW4R 2YA0A 3RWIA 1WTGT 3TO2B 4QXGH 5D7KD 1D6VH 1M4KA 1BM3L 2EYRA 3BSZL 5AG9A 2UV3A 1B0WA 1U8NA 3ME0A 1QSFA 2PUQT 4FQHA 1FNSL 3RL1B 1P7QB 1T1YA 2BRRH 2GSIA 3LV3B 1F6FB 2VYRE 2XTJD 1E4XL 2W60B 1A7RL 3HTLX 4N0UE 3F58L 4PGCB 5GGRB 5HHVL 2VDLL 4S0SD 5T3ZE 1B6UA 1ZEAH 3GMOB 1KJ2L 3CLEH 3T0VA 1T4KA 4YDIH 5JOFB 5IJKC 4MNHB 1NBVH 5DJCB 4HPOH 3SY0B 4Z7UE 2FX8L 3V4VH 1R3KA 4M7KH 2NY4B 2YD8A 2CDGB 1FFOA 1GC1L 5H2BA 5IB4A 1HH9B 4D9RE 3OPZL 1NBYB 4O02L 5E2TH 4TUJB 4P2OC 5KZCD 1YY8A 3VFTB 4WU5B 4GKSA 2OL3A 4C56A 3RVVC 3T4AA 4XC1H 5B39G 2VITB 4KI5C 3ARZA 4UUJB 2HFFA 2DTMH 2NXYC 1I4FB 4JFDE 4LBEB 1U92B 4HFWB 1BF2A 2P24B 4HF5L 1FSKB 3SKMA 2AV7A 1S5IH 3UTTD 4RFOH 2EICA 5I16B 2ITDA 1FVDB 4G6KL 5DWUL 1VSCA 2Z31B 4JFYA 3D69B 1Q9LA 5MEOB 3QFDA 4L9DA 3KR3H 1LQSR 1ZT1B 4RBPH 4LHJB 1C08A 2V7NB 4EBQH 3CX5J 4R3SA 4Q2ZB 2OQJA 4Z0BH 3RWFB 3LD8C 5MENA 3DUSA 1N5AA 1V7ML 2FD6H 4JFZL 2J8UF 2Y6SD 1OVZA 4FA8A 3EZJB 3GSNH 4LVEA 5JOPD 3EJYD 1O7VA 4WGWB 4OFKA 3RWEA 3LKQA 1CGSH 1R3HA 3V95A 2VDRH 3OXRA 3KYKH 2HKHH 1IGCH 1RUPL 2ADFH 5IROC 3DX6A 5EO0B 1MCIA 2GJ6E 2NX5A 4OFIA 4ACPA 3CLFL 4BQ9A 4C55A 3CCHA 1HQ4B 1YYML 3S9DB 3K1DA 5B39B 5I66A 2EDYA 4AEHH 3FQTA 4HH9A 3RWDA 5TE4H 3VFSA 3RWJA 4BH8A 4M7JH 4L8SA 4X8JA 1S7QA 1X6NA 4LQFL 4XVSL 1ADQA 5DI8B 3MV9D 1Z3GL 3O81A 5MERA 1AO7A 4DKFH 1WWCA 4AIZB 3IDMB 1YEJL 1OAZH 1QRKA 5HI3D 1DUYB 1EUTA 1IAIL 2XRAH 5F9DC 1D5MA 3JWOC 2YWZA 5CMAB 1RZ7L 1ES0A 1CF8L 2B0SH 8FABA 3BE1H 1DJSA 5GRYA 1EFXB 1RK1B 1RZIA 2HA1A 4G7YL 5LXGH 1JYWA 1UZ8A 1UXSA 7FABL 3I50H 4KZDL 4LKXA 5INCB 2NXYB 3DIFA 4XP4H 4X80H 1PSKL 1UENA 1A9EB 3JWNC 4Z76B 4R4BA 5T33L 1TVBB 3GSRA 2VL5A 2FO4A 3VRJA 3F8UB 4LHUG 5C0AE 4ERSL 4KKCC 1K2DA 4XP6L 1A3RL 4NKIH 2AI0H 5GS1A 3KPLA 3OTTA 4FTVD 1HHGA 5I8KL 4MDJA 1T7XA 2VKXA 4HAFA 5DT1H 1AR2A 3K3QA 4K23H 3ARGD 3UTQA 4KI5E 1JRHL 1NJ9A 3HLAB 5EZOH 4Y19A 1NFDA 3BZ4A 3QUXA 4HWEH 1TTUA 3U7WH 3CH1A 3N1GC 3MRCB 4M02A 1FZKA 1P84K 5ENWB 4P9ML 4YAQA 4M43L 1WQVT 3BDYH 4WI4A 2QL1A 4QGTA 1P4LB 2IBGA 4UOW0 2HT3C 4NGHH 4ZFOB 3KLHC 4AG4L 1VESA 1AR1D 2P5WA 3IETA 4H88H 3GHEL 5EU5A 3AVEA 4J1UB 2MCPL 2Q8BL 5SWZD 1NSNH 5CZKA 4RGNE 4JKPL 2FX9L 5CUSH 1QPPA 1X5LA 3IT8D 5DD6B 5CJ8A 4PUBH 1ITBB 4PB0H 2ESVA 5E6ZA 2VDPH 5BJTB 1NGXA 1WV7T 3VD9A 5E8NB 4LHUB 2ATPB 4U6YA 1J1OH 4KK9D 2IPKB 3KDMA 3D48R 1QRND 1FZOB 1MFCL 5CIPB 1AI1L 5I1CH 4MA7H 1YEEH 4EQ3A 5F6IB 1BOGA 4WEUD 1HXYB 5HHOD 3MRKB 4BFEA 3MRJB 3ARFD 1CD1B 1KTRL 3CC5B 1TCMA 2EH8L 4KKLD 4IDJH 1A3QA 5CJOH 4OGXL 4X7SH 5KVFL 5M7QA 3DO7B 4NN6C 4HX1B 4KPHL 1OSPH 1A3LH 1IILE 3MRFA 4HXBH 3VFMB 4X7FC 5C0CD 2YR3A 3QUML 2V2TB 1FGNL 5JA9A 4G9FE 4XCFH 2V2WB 5IVXB 5EC2B 3IB4A 4QY8B 1LE5A 4JHAH 1XGRA 5CFHA 5JQ6L 2X41A 3L1OL 4AQ1B 1R3IH 3EJJX 2BJML 5KVEH 4CNIA 2CUHA 4PRHD 2BDNH 4JM2D 1S9YB 2CJUL 3WNNA 5J12C 3TH2T 5GZNC 5HVFB 2XA3A 1QR1A 5EU3A 3BOVA 3AU1A 2H3NA 4JZJA 2VDML 4MA1B 4Z7WF 3FOMB 5E9DA 4WW2A 1CQKA 4HUVB 3IFOB 3TYFA 3TNMA 1KENH 1BQHA 3HC0A 3MLZL 3EO0A 3LKNB 1KN2L 1CGYA 2OLDA 1XZ0B 6CGTA 3VGAC 4XWOC 4XC3H 1RD6A 4XNYH 4YPGA 5E94B 1UZ6F 2PW1B 3V2AR 4LGPB 1QSEB 12E8L 4XXDB 4HG4K 2CKNA 1K8IB 5IHZB 1RIUL 3O8XA 5DZNA 3IDGB 4N8CH 2XKNB 3FB8A 1FO0L 4Y1AE 1XAUA 3IU3B 1S7SB 4MXWL 4PRPD 4Y89A 4ZTPL 3H9SD 3LKOB 3RNKB 2HRLA 2JELL 1T0NB 2PO6A 3QO1A 4PRBB 5DHYB 1HH6B 3KYAA 4NJAL 5ADPH 1ED3A 3FFDB 4PBVC 4XCYB 1S9VB 2Y72A 3VH8A 3WMSA 3HZVB 4YXLH 1HYRC 4HK0B 1PBYA 3FB5A 1QFWI 5FOBB 5E8PA 5FYKU 4FFVC 4HAGA 5C8JB 3QDMD 4U7SA 4ODUA 3BGFB 4L1HA 4DQOL 4RIRB 2NXZD 1HNGA 1VADA 1NCDH 4HUKB 1XF3B 1K6QH 1I8KB 1U58B 3SE9L 1FNLA 3O4OC 1WISA 3BO8B 3PQYD 1JI1A 4IRSA 1O5DT 3H9YA 1V3MA 3LRHA 3LS4L 1T03H 3STLA 5KBNC 4F7EB 5KAQF 3BFOA 2OM5A 4N8VA 2HFEB 4XBPB 3QDJE 3ZMRA 2R2EB 4M3KB 2EEDA 5C08D 3NCYP 1R5VB 1OAYL 1JJUA 4K3HA 1Z2KA 5JHLH 2MKLC 5CBEB 5SWSB 4LLUA 3ULUH 1NC4B 1GIGH 1RUKH 1I3UA 2VDNH 3V5KB 3JV0A 3IFLH 1H5BA 3T04D 1Y0LB 5D71H 3BZEA 4K55A 5FKPA 1ACYH 2A6KA 4U33A 2XPGB 5E00A 4XB8A 4M8QB 5I15L 1HXMB 2YKLH 4XNUL 3HNVL 2D31B 1G9NC 3STBA 3QIUC 2OJZL 2ICES 1TPXB 3WJJC 4YO0B 2JJTA 1BHGA 1V3LA 3SKNB 1JN6B 4PV9B 4PJGB 3VMOA 4RAVB 4OFYA 5FUZL 4GRLA 1W72A 4LLQB 3LQZB 2VXQH 5H8DA 3I75B 3MJ6A 3SDDA 2IH1B 1CGXA 5H35B 3P11H 2E6PA 3HZYB 1FG9C 4ODTH 1NGPL 4JM2F 5GGUA 3O4LA 4OFVA 2EDOA 1WZ1L 4OKVA 2IH3A 1UH3A 5DJ6A 3ZE0E 4FQQB 3D18B 1T66C 1EUUA 4X5LA 1VKXA 4P5TC 1A1NB 3HZMB 3TVMC 1KLGB 2FBJL 5K9OB 1INEL 1Q0YL 2Q8AL 3OX8A 3F65A 3OMZA 1NC2B 4NZUL 2OR9H 5T1KB 4JHWH 3WUWA 1AP2B 2OL3L 1PG7H 5EUOB 5CLTA 5IIEA 3VD3A 4LIQL 1K5NA 4PY8J 1EERB 4FP8L 3ARDC 1AKJB 3DECA 3FFCD 4GSDL 4L5FH 4U3XA 1IKFL 1ZA3B 4WI8A 1BIIB 4WENB 2ZUQC 1DQDL 5HGBA 1GZPB 2R29L 1E4JA 5D6DA 5AWNL 1WK0A 4H26B 4PJ7E 4Z7VF 3V52L 3AFLA 4Y2DC 4ZMAT 1U8IA 1F3JB 4R4FH 2B4CC 2PXYC 1EHNA 5BVJB 4J2XA 1JPTH 5HHNB 2F54A 3WN5A 1RZ8B 4YHYB 1JV5A 2JJUA 3GSWB 5DEFA 4RZCA 2ICWJ 2B1AL 3MUGA 3W9EB 4P2RD 5EWIH 3OKKA 2JTDA 1T1WB 4ORZC 5HHME 3SQOH 2W59A 4NZDA 5BZDB 1BREA 3FZUC 2W9EL 3MLVL 5F89A 2E3VA 3ZHDA 5CGYC 1MWAB 3NABL 4UQ3B 2MWCA 3RGHA 2GTZA 1GOFA 4BA8A 5CIPH 3O45B 2W07A 5KG9A 5I8CA 4Z8FL 4CVXA 4CBPA 3VFOB 1QFUL 5IEHB 1I7TA 4OLUH 3ULVL 1M7DA 4X6DE 1LP9A 1IL1A 1J5OL 1R5WB 3O6LH 4L4TE 3GBML 3C5ZA 4L3CB 5D9SA 2HMID 3LRSB 3VWJA 5JHDE 4YWGL 5D1XD 1CLOL 3MRBB 1HKFA 5CBAA 5CCKL 1TZIB 4P5TB 4ELMB 5BRZA 5TH2B 3QUYC 1XGQB 4L29A 3SDXE 1X4XA 5CZXD 3MLRL 4PJEB 4XPHL 2VZOA 3QPXH 1P2CA 3M17B 2FIKB 5KTEL 4WWKB 2O5ZL 1XCTB 2X70A 1GGBH 4G8GE 2EIEA 5MI0B 3O9WA 5FAAA 1T7YA 1CLZL 2BXYA 4NUGH 5HYJA 5IEKA 3MV11 3QCVH 4LF3B 4NBYB 5IWLC 1JPSH 1JZ3A 1P7KB 3RY6C 3A6OA 1OW0C 3JV5A 3FMGH 1SVCP 2CK0H 4ETYA 5I8EA 1OT1A 5D2LF 2H6PA 4Q6IB 5IQ9B 4C83A 2R0WL 4FXKB 1KJMA 2V7HB 4PJIF 3VXUE 1FN4B 1E6OH 5DJ0B 1X6LA 1MAKA 3RDTD 2BERA 5HY9A 1A2YA 5GISH 5LQBH 1GZQB 3K4DA 3X17A 1YMMA 2XG4A 5DRZA 3DURB 5IW6B 1JFQL 3Q6FB 1JBJA 5FDWA 4R8WL 2DQUL 1CG9A 4ZOBA 4ODBD 4PRIB 5IBLC 4Y4FC 4NT6B 4YX2L 4LSSL 1QLFA 5MEND 3GSXA 1FIEA 5IG7A 1EEZB 1HZHL 3SBWA 3QFJA 4K3DL 5BVPL 3BT2L 3O11B 3AMKA 4P2CG 1YQVL 4CMHB 3CSGA 1XR8A 3T0BA 2PTTA 5DO2C 1RJZA 3Q3GB 2DF3A 4UMGA 1TVHB 3IU4L 3GGWA 3JWDL 3GJFB 1AGEA 4PV8A 2CMRH 3SDAC 3BKJH 1LO2L 2NX5D 2A9ML 2V5SA 2ARJB 3TIEA 5F7YC 2C5DC 3ULVD 1XCQB 5ANMB 1S7WB 4PJDF 3WSQH 2KQNA 4XNXH 4LCWE 2EDTA 3V0WH 1AE6H 3NZ8B 4F9LA 1NLDH 3TBYA 2APFA 2DWEA 4BH7B 4DN3L 2P5EB 1JGLL 2A9NL 3OAUL 3T0DA 5I1GL 1UM4L 3HI6L 4P46B 4OKDA 3MA7A 5J1TC 5EZIL 2IAMC 3FT2A 3S3SA 2ZPKH 4I0PC 1S5HB 5CD5C 3QRFM 3KPOB 4ONGH 4GXUN 2WWKO 2R9HD 4KAQH 5IHUL 1DP0A 1MHEB 1ZLUK 2WANA 3HG1D 1U42A 3QG7H 4EZMA 1VEPA 4HQQH 3RPKA 2J8OA 1KFAH 3GRWL 3KLAA 4WI6A 4WUUD 1DL7H 1NCWL 3P9WB 3QAZC 1JK8B 4WTWA 4JRXA 4N0YH 1KCVL 3OKOB 4PJXF 3X3FL 4ZUTA 1IT9H 4EOWL 1U36A 5GRVL 1LO0L 1PKQE 1J05B 4MNQB 4PY8I 1E6JH 5HGHA 4NUJB 2XFXB 1DEEA 1FAKT 4FZEH 3QWQB 2IANE 5ALCH 3CU7A 4WEBH 3VFNB 2QHRL 4HWZA 2AEPL 3D2UA 4Y4FB 4XVTL 2Y23A 2B7DT 4HFUL 1FHGA 3SGEI 1M05A 4HUMB 1Q94A 4IHOA 4NO3B 5FO8A 3PWUA 4Y19D 1H3UA 4P5KA 1WZMA 1FLRL 2R1XB 5GSVA 2UUDK 3FQRA 2ICWI 2OK0H 1IGTB 5HVHC 3GI8H 5JA8B 2QBWA 1Q9KB 3NFNB 1KYOJ 5D5ME 4MMZC 1BJMA 3V6OC 1C5CL 4NO2A 4DUXA 2UZYB 3IXTA 2P5WD 3U1SL 3BQUC 3F12B 4B0MM 3SJVA 4NWUH 3PL6A 4X6EB 1WFTA 1FAIH 4PJFF 3EYOB 5CSZA 2ZSVB 1WAAA 4GBXC 4FQIH 3UPAA 1I3VA 1KXVC 5FGCE 3I3EA 3WLBB 1MAMH 2E7LA 4QRRB 4MQXD 3MV8D 4N1EA 2FEEI 4PP2A 5AD0B 1MFBH 5HVWA 4Z9KB 3RUGA 1PEZA 3DYMA 3CFBA 3HUJB 4KQ4L 5EBMB 5F3HB 1T1XB 3KXFE 1R0AL 4KHXH 2IAMB 2XG5A 2VABB 1CLCA 3H9HB 1YPZE 2OS7A 1UB6A 3MJ7B 1MFEL 4HGMA 3EYQC 3T0EB 4DK3A 3ULVF 3WIHH 1X5AA 4NSKA 5EO9B 4FMKA 4QO1A 1FV1B 1DBKL 1WBZA 3W5MA 1JPFA 3D85A 3L3KB 3MNZA 5DA4A 1MWAH 3EDFA 3QAZB 5C70A 4GAJH 3Q48A 5IMMB 4NQXA 2DM3A 3WFBL 3QJFB 4MLSA 5ELIA 3G5VA 2CD0A 1UQSA 4OIBA 2BC4B 3UTZB 3RWHB 4PJCE 4L8DA 1HYSC 5HHPB 3U2SA 1MLCB 3D39E 1ZSDB 3MRNB 4OTXL 4YC2B 4NM8H 5HDBE 3EGSA 2NMSA 1AHWA 3NTCH 3NA9L 2X1XR 1I3GH 3PWLA 3WKMH 2Z91B 5DK0B 3UBXA 1TVDA 1BECA 1WEJL 3I3DA 3DMMC 4RX4A 4MJ5A 4D8PB 3UYPA 4L8CA 2D7OA 3MJ9A 5HVHB 4XAKD 1JGVL 3PF2A 2NQCA 1FCGA 3U46B 1LK3L 4OLXH 5DRWA 2LVEA 1U3HA 1MCWW 5I1KL 4JB9H 1OHQA 4XHQA 4TPRH 3V8CA 5IB2A 2NY5H 4R7NA 2FGZA 4UILL 4R0LB 1W72L 5ICZA 4NCC2 3GSVA 1F13A 3EYSH 4OLWH 5AZEH 3I3BA 5ISZA 4AMKL 1KEGL 4ZUSB 3H42L 4H0IA 1NMBL 4IRJA 1SM3H 2GTWA 4NBZB 1NLBL 1TJGH 1YDPB 2PO6D 2AQ1A 3WLWC 1FIGH 2MNUA 1UM6H 3P4NA 3FT4A 4GW1B 3BH8A 4M48H 3BPCA 2AJSL 3Q1SH 3HE7C 2BNRE 3O2VH 4ODWA 3V6OE 3SDCC 3B9KA 2X4TB 3X13A 2PF6A 1KN4H 5HPOA 1N4XL 3V0VA 3ZKXC 2ZNXA 4LSVL 5EO1B 5KSUB 3CSYA 4QOKA 2WIMA 4K2UH 2I07B 4F7CB 1G7MA 3CFDB 3TT3H 2OXHA 2R0LL 3RVXD 2FJGA 1EZVY 2AGJL 4AIXA 2R8SH 3OXSA 3QHZH 3CK0L 1JGUH 4HIXH 1MVUB 5TF1L 3EYUL 4XRCB 5F21B 1KNOB 3D1MC 4JFED 1G0XA 1FRGH 1KT2B 1L7IL 3GJFH 3JVGA 1A6AA 1IQWH 1ORQB 3P30H 2BSRB 4LCCB 4MJIB 4OZHA 4WCYH 1BFOA 4GAGH 3IGAA 4QRUA 3VFRB 2R1YA 2Q6WA 3BUTA 3FN3A 5E5RB 1L0QA 4KZEH 3RI5K 3K8MA 4N9OB 3ESUF 1M7XA 1AJ7L 3FN0H 3V7AG 2E9WA 2MPAH 3AAZA 4Y5VA 1AGDB 1I3RA 3EHBC 4JLRB 4CJ0A 4IIQC 5CILH 4DZ8A 3WXVL 2VISB 4OZGE 4PJAA 4OI9A 4U6VL 4LVHC 1N5YH 1YYLL 3BP7A 4XZUA 3S37L 2N4IA 4KUZH 2LTQB 1Q0XL 4I3GA 5AUMB 4P59H 1F11A 2VZUA 4OFYD 4GRLD 2J8UB 3ZKMD 3EAKA 3ECBB 1QHOA 4NN5C 3HAEG 3BRDA 3ARUA 3C6LB 5KW9L 1J88A 1OSZA 3VXNB 4Z0XB 1JF1B 4KMTH 3EFFB 5GGSA 1YNLL 4HWBA 4F58H 5JLZA 3JV6A 3G9AB 4RCAA 3NCCB 2JCCE 2F5AH 2ZP0T 2PETA 1FGVH 3H3PL 4FQLL 1I1AA 3HC3H 3C6SB 5GRVK 1E4KC 2WAHA 1OP5H 1I1RA 1BWMA 1B9ZA 3TH3T 4KVCL 3DHJA 3QH3A 3TV3L 1QFPA 1XIWA 1G7QB 3ZKXB 4RAUB 3RWGA 4OZ4B 4JR9L 1DFBL 1FZJA 4GG8B 5C0FB 1ITCA 2VAAA 3HR5A 2Y6SC 1RIHH 2VUYA 3LVEA 4Z7QF 3S35H 3VXSA 4UV7L 2FJHA 1D7FA 1DBBH 3B2VH 3EJYC 4U1SB 4EDXB 2CLVB 3DV6B 3TBVA 1QBMH 4EIGB 2OTUB 1FYTB 2NTSP 4WI9A 4P23A 4CW1B 1J9CT 5E95B 1E4XI 1RULL 1JNLH 1ZHKB 3QHTC 3HS0B 5DFVC 4K7FB 5F7NC 5D7LD 2NY0C 3E6HB 2F54D 5JPMB 3LN4A 3PV6A 3OKMA 2XTJB 4X0KA 5I0DA 5KVGL 2VR4A 3HHRB 4WU7B 4Y8AA 3HAEB 4POZD 3EKCA 5D8JL 5C3TA 3V8OA 4S1RL 5C9JB 1NANI 3PWPE 5IW1A 3VXRD 1F90H 3VA6A 4P3DA 4UNVA 2H41A 4BZYA 1UACH 4QXTA 5C0GB 1IKNC 2YBRA 3LKRA 2R69H 5IFHH 5DUBA 1J8KA 3NFPA 2W65B 4X5XA 1J10A 4WDIB 1FJ1B 2CO6B 3TO4C 1SHMA 2VXTL 4Q9RL 2E6QA 2BVPA 1ZLSH 5KJRL 1J8HE 4NN5B 5KVDL 4ZXBA 4KTEL 3GSQB 1MHHB 3C5ZD 4C57C 5F1NB 2H2SC 5IB5B 3EDEA 2F8OA 3UTTB 1RMFH 3OKLA 2VLKA 3MRDA 4XP9L 1FG2B 4LAQL 1NGYA 4XPTH 5BRZD 3F6LA 3CFKA 2JF1A 1BD2E 1KPRB 1UEYA 1G7JA 5LBSL 3SGKA 3FTGA 1DUZA 5HD8D 3D0LB 5I1IL 1BZQK 3B3IA 5CJXC 5C0BE 1EX0A 2ZKHH 1ZXQA 2X9WA 3HPJA 3ARGC 5HYJD 3BP5A 4YZFE 5FGBA 1CFQB 5JW5B 3RZCC 3QXVA 4JHZA 3MV7A 3QIWC 4Z95H 4DUWA 5I18H 3MGOB 1V5JA 1Y6KR 4FQ2H 4DOHE 3DHMA 4JE4B 3AREA 3T3PF 4DFHA 3UYOD 4S1SH 2R23A 3G6JE 3MRRA 2WWMD 5DFWH 3HB3C 4S0TD 3G6AA 1EJ6A 2Y1VA 2HRPH 4NRYB 2NY0B 4OZIF 2YZ1A 4K9EL 3PP4L 5EU6D 3EO1A 4NQDA 5F96H 5LAXB 1HCFX 5FFLA 3DRQB 6FABL 5DD5L 4KVNL 2DLTA 4M5YL 5DJZA 1OAKH 2UWEF 1KJ2B 1IEBA 5L2KE 3DUHA 4YK4B 2V9RA 3MV9B 5I17A 2YPLA 1EPFA 3CPLB 5L88H 3QCUH 2VWEC 3TT1L 3VXMA 5DDHA 1MHPL 1DLHB 1UWGH 3N85L 4I48B 4ZAKA 2ZUUA 2A6IB 2JK5B 4ODSH 5J13C 2C1OA 4KDWA 4PTTA 2X89A 2JLLA 4Y4KD 1OAQH 4UTAL 4KKAC 3CUPA 4NFDA 4V1DD 5DJAB 5DJDA 3WS6C 2X09A 5EUKB 4F15C 3BPNC 1MRCH 2Z93A 4U6HB 4NQEB 1KELL 1QLEH 4PJBF 1DLFH 3DXAE 4PG9B 1OGAD 3EW3B 5KAQG 3BX7C 1CE1H 4Z7WB 4OQTA 5FYJH 4K3EH 2V2XA 4NKOA 2XV6B 2YUXA 2B39A 2BY0A 2DQHL 4LEOA 4MD5B 5DHVA 2YOCA 3U4EA 2G75B 4LLMB 1HIML 5I19H 2BY3A 3LSOA 5EOQH 4FTVB 1JRHI 1U6AH 4NWTL 1T3FB 4N90E 4LEXH 5DJ2B 4OIIH 2HVKB 3QEUA 3CVHA 1MCHA 3ARGB 4JY4B 5I1LA 4X9BA 1JNNH 2BOBB 3QIBC 1LP9F 2ZCKL 1HDMB 1EMTH 3VWKA 3MXVH 3SPVA 3U0WH 3M8OL 5AZ2H 4Y4HC 3FHAA 2IWGA 2DYPD 1T0MB 5BO1H 1GXEA 3BZFB 3NGBC 3LHPL 1JGDB 3H0TB 4Y16A 4YHOL 4RWYH 1M71A 2ED8A 5EORH 5E03A 5MEPB 3B5GA 4MD0B 4OV5B 3B83A 3MFFA 4ZYKB 1MUJB 4K8RH 1Y6MR 1AH1A 3NBNA 4Z7UA 2JIXA 5FDYA 2I60L 3ZKSD 4EUPA 4RGMC 2XWJA 2ZCHL 4GMSL 3BEVA 1PZ5B 1IGFL 1MJUH 1NGWB 2QR0A 5DC4B 1BZ9A 1S9WB 2OTWB 3B9VA 5D72L 3BVNA 3QXWA 4PYHA 4Q0XL 1IAKA 2BCKB 1QRNB 4JVUA 4JFDA 3TWCH 1IM3B 1BBJB 3VGFA 5J13B 4M1GH 1HHJB 2SEBA 1N3NA 3U4AA 1LE9B 3QQ3B 4U3CA 4LU5L 1LDPL 5HHOB 1KB5A 1TJIL 1T7WA 3ARFB 3W0WA 4AENA 4F15B 1XGUA 2NXZC 3BPLB 3BPNB 2GIYA 3F5WA 3SJVD 3HMXH 1U95B 2W9DH 4NZJA 3VGHA 1L6ZA 5E8DH 2F8VA 4PRDB 3S4SB 3X3GL 4QHNA 1MF2L 1FL6B 4ONHA 2AJXL 3I6LD 1FDLH 3I6KA 5C0CB 3NIGF 4TOYL 4UT9L 2DOCA 2WLZA 3U0PB 2DLHA 2VWEE 3M1BB 2AKRB 2IGFH 5F7WC 5TE7H 4HLJA 5ERWB 3WCYA 4S1QH 1AFVL 1YEGH 3WIIH 3KHOA 3QCTL 3ULSA 1G9EA 1TQCC 1ZHNB 2CDEB 3HAEH 1I9RL 2F58L 1ZHBA 4PRHB 4LLVA 2GJ6A 4KRLB 4DVBB 3BWAA 2WNGA 1FORH 4JM2B 3ILQD 4GXUM 1KTDA 1I85A 4DCQA 3UTPE 2EC8A 4TTDD 2XACC 1P5VA 4YIQA 2D7TH 3I9GL 3MLUL 3PWVB 5GHWL 4ZFFA 4LSPH 2V5RA 3NVQA 4OB5H 3VD4A 4I9WE 3PJSB 5GSRA 3O3EB 5D2NA 2HJFA 5ALBH 1REIA 1J0JA 3UX9B 1RU9L 3LDBC 5F9WC 1HWGB 3VG0L 3NH7H 3MLYH 1N2RB 1FFQA 4NDMA 4ETQA 1XF2B 4QF1A 3W11D 1FE8H 3G5YB 1NFIA 3QHFH 3QDGA 3ZDXF 1X7QA 3RWCB 4AH2B 2CIKB 4C54A 3ISWA 1YEHL 1X5ZA 5A40E 1KBGH 1B90A 1IC4L 25C8L 1MFDH 5E5UB 4UV4H 4PRPB 5I73C 3H9SB 4RX4D 5CEXA 3WNKA 5KSBB 1VFBA 1YJDL 3N1FC 1NGZA 4JANB 4YHLL 1OP9A 3R8QA 4ZS7H 4QNPE 4JPVH 1T1ZA 2IFFL 1CE6B 3OR7A 4KFZC 4MCYB 1U3HD 5IJKA 2VJXA 1F5WA 2P42B 35C8L 5C0AA 3QDMB 2DBLL 4D0DA 4LNRB 2NXZB 1A7NL 3MLSH 2ORBL 2XT1B 2H8PA 4G6AC 2FB4H 4WWID 4EIZC 5E8EA 3IFPB 4ISVB 3BD5A 2YEZA 1C12B 3DETD 3VXPB 5ISZD 3LEYL 2WINA 5E24E 1JPGA 1I7UA 4P2OA 2LE9A 1WWAX 1RI8A 5DD0L 4P4KC 3QUMB 3SQBA 2DLFL 4ZPTA 3RPIA 3AS3A 3VFUB 4NPYB 3BSZH 3OHXA 2JJVA 3L5IA 1DN2A 4QTHB 1FNSH 3RNQA 3R4DA 3FB7A 2X4OB 4O2EA 3B9KD 4YNYB 4KK6D 5CD3B 1E4XH 1DQML 3SE4C 1A7RH 4I8DA 3F58H 2VDLH 3W5NA 1MPAL 1BVZA 1SYVA 3BMVA 1E4WL 2Q86A 4PYGA 2NLJB 4IMLA 4Z7OE 3T08A 4POUB 5JTWA 1NANH 4MQ7B 5D1ZA 4LLDA 2AVGA 2FX8H 1TFHA 3S88L 1SJVA 3B5HA 5EDXA 3RUGF 4MCZA 1MIEL 4JZOB 1KIPA 5IF0A 2HLFD 2EIDA 1GC1H 2LAAA 4XPFL 2VKWA 3LDBB 4HV8A 5F9WB 3WHXA 1CDCA 3OPZH 4O02H 4G80B 1DVFC 4Y5XA 1Q9OB 1UXWB 3MUJA 4UT6L 4HULB 3K2UL 1CCZA 2Z4QA 2HVJB 2Z35A 5IROA 3PHOB 4K7PY 2YD1A 4G8EA 2N56A 1OLLA 2HMIC 3UZVB 4LVNB 2DI8A 4IOFC 4NNXA 5D2LB 1FO0B 2GJJA 4HF5H 1D6EB 2DQEH 5GS0C 4LOUD 1DQTA 5EZJA 3B6SA 4PJIB 4TUOA 1EDQA 4G6KH 3UTSD 4X6CA 2VLMD 5DWUH 2Z0BA 3RL2B 2BVEA 1IBGL 2QQLL 1U91B 4OM1L 3WE6B 5HYQB 1WIUA 4P0DA 2CRMA 4NIKB 2AXFB 5HSFA 5ICYB 1A4KB 1M6OB 2EC9T 4G9FA 1LK2A 5DURD 3RZWA 1V7MH 3OG6B 5HTSA 4JFZH 1MI5B 4HGWA 5JQHC 2D0HA 3FFCB 5KS9E 1J0HA 4GW4B 2PYFA 5C0ND 4JDVA 3K0WA 1L7TL 2YK1L 5J3HD 1C5DA 3L5HA 3AS2A 4EVNB 2NR6C 1I1AD 3CLFH 5KSVA 1DANT 1YYMH 3O6ML 32C2A 3LIZH 2RIKA 3MRQB 5LWYH 3V5HA 4PJDB 2CRIA 3C9NA 4MB5A 1W0WA 4P2RB 4GQPH 3RGVD 4UQ2B 5TQ0L 2Q76B 1CDUA 5T3XE 2BOCB 1II4E 4M7LT 4LQFH 4XVSH 3RJQB 4O58L 1MCPL 5ESQB 5GPRA 4F33A 3SE8L 1Z3GH 3PXJA 1Z9SA 3X12B 1F97A 4QHUA 4YHPB 4YR6B 5BCAA 3RWIB 1RZKH 4GS7B 3NAAL 3NCEB 1JZ4A 4RRPA 1SMAA 4Y1AA 2EYRB 1YEJH 1IAIH 1CQYA 1A22B 4FQXA 1GHFL 1CF8H 2GSIB 3ZKNC 4OQ1A 2P8MA 3ULVC 1A21A 4G7YH 2OJEB 4X7CC 2BNQE 7FABH 4MS8D 3OB0H 4WVRA 4KZDH 3ELAT 1OTUC 1CN4A 1PSKH 4PGZA 2FDBP 5T33H 3P4OB 4PJXB 1Q72L 1T4KB 1T04A 1TMCB 5L2JA 3K4ZA 4I5BA 4ERSH 5DRXA 2O5YL 3WNOA 2AABL 1OTSC 5DA0B 1R3KB 4NZTH 3JSSA 5A16A 1A3RH 3LPWA 2MCG1 4QXWA 3MRLA 1YN6A 5I8KH 5H2BB 5IB4B 1QSFE 4FS0A 1F6AA 3D0VB 1IAMA 43CAB 2OL3B 1MCKA 2BSTA 4C56B 3EOAA 3T4AB 2QSQA 5D1QA 1JRHH 3KNBA 1K4CA 2HFFB 1MCSA 4KC3B 4JREB 3UO1L 3P77A 4MAYD 4ORGA 2UVEA 1JNHA 4OD3L 2FSEB 5JXEA 1OF2A 1EEYA 2J8HA 4HDIA 4M43H 4P9MH 3SKMB 2AV7B 5E2JA 1FFNA 3SDYL 4N68A 2HT4C 4I1NB 5GGVY 4HIIA 2ITDB 4AG4H 5HHQA 4JFYB 3MYZA 1Q9LB 3QFDB 3QZWG 3FL7A 3GHEH 1TNMA 4MA8L 5GS1C 3EUUA 3LAFA 2Q8BH 5FO7A 1BVKA 2VSDA 3J7HA 4P2QD 4JKPH 4QHMA 4R3SB 5BXFB 5C09E 2FX9H 2OQJB 3CVHL 5IR1A 4PJFB 4D94A 5MENB 3DUSB 5D96C 1I9JL 1N5AB 5C0IB 1U8LA 4MQTB 4QT5A 2VLRA 3QUXC 3RWEB 2ID5A 3RVWC 1R3HB 3UP1A 5JO5A 4GT7A 1MFCH 3ARED 3CJJA 5T1LA 1AI1H 3W81A 4L3ED 4N5UA 1Z9OA 3KPRA 3DX6B 2NX5B 4IS6B 3QEQE 3T2NL 3L7FA 5I66B 1X5JA 3U30B 2L4OA 2CGRL 2EH8H 1K4DA 5DFTA 3BEWB 3OJ2C 5EIVA 4OGXH 3EOYG 4HPYL 4HH9B 7CGTA 3RWDB 1WVZA 1S7UB 3VFSB 5F7HA 4KPHH 4BH8B 4L8SB 1HHIA 4GW5A 4XMKL 3SKJL 2VLJA 3DX9A 3QUMH 3BMWA 5MERB 1BQLL 1FGNH 5I74C 3VXMD 3QZWB 3VI3E 4ZAKD 1B4JL 2ITCA 5K9JH 5F6HJ 2O5XL 1VENA 5JQ6H 1JF6A 3L1OH 1CXIA 1HKLL 3U9UA 1T0PB 2QQQA 5BQ7B 1D5MB 2BJMH 1IAIM 1ES0B 8FABB 2ZCLL 1RZIB 3HG1B 4JRYE 3IDYC 1M7IB 4LKXB 1ZLWK 3DIFB 3LMJL 1OAXL 3SGJA 1P53A 5GRUL 4R4BB 2A73A 3KPSA 2VDMH 3GSRB 2FO4B 3SEPA 1AD9A 2I9LA 2D0GA 5M95B 3MLZH 3KLSA 1KN2H 1AO7E 4MVBD 5E70A 4APQD 3IVKB 4MB4A 1LO4L 1WTLA 3KPLB 1AIFA 1HHGB 3LPFA 5DUML 4Y5YC 1AXSA 12E8H 4PTUA 4QCIA 1H3PL 1RIUH 2N7BA 4UIMA 1KJVA 3WDJA 1NJ9B 4U0RC 3SOBL 1FO0H 4Y19B 3VWKD 4DW2L 2BVOA 3BZ4B 3QUXB 4NO0D 4MXWH 4ZTPH 5GGTA 1RUAL 2WM0A 2JELH 2X9XA 2C4FU 4L4TA 3VRLE 4LCUA 4NJAH 5F8RC 4JZJC 4U7KA 4ZFGL 4WW2C 1QO3B 5L8KB 3TZVD 4PGJA 1VCAA 2DI9A 2P5WB 3IETB 1KF9B 5EU5B 3NOIA 1EVTC 3ZT6A 4DQOH 3PGDA 4Z77A 2JIXD 1Z9MA 1ZGLA 2APBA 1HHKB 3SDXA 3SE9H 2F15A 3LS4H 3NIFF 3L3GA 1RURH 3O8XC 2YSSA 1CICD 4G8GA 1NFDE 3MV8B 3MRHA 3LEVL 3MFGB 4WI5A 2I9TA 2AXGB 4U6YB 4X98B 2R2CA 2ZUYA 3UAJC 5HVGB 3KDMB 5I74B 1OAYH 4JFDD 1HI6B 1EEUA 5GZOC 4M7LL 5J1AA 5C0JB 1U3JA 4WEMB 4HZAA 2DWDB 2HN7A 1ZLUH 3TVMA 4RISL 3VXUA 4P5MA 4S2SA 4PGBA 1OTTD 4R97C 1O0VA 4JKWA 3A6CL 3WL9A 2NY4D 4IRSC 3MGTB 3ZL4L 3OB8A 4LCYA 4HXAL 2CR3A 4H0HB 2ESVE 5I15H 3G08A 1QR4A 1NMAL 3GMLA 3MRFB 1U93A 3THMH 4XNUH 3HNVH 4EI6B 3F7VA 4H25A 2OJZH 5BS0E 1RFDL 2VNCA 4AT6A 1HSAA 4C58B 1H0DA 3VH8G 3BN3B 4O4YL 4YDKL 1LE5B 1XGRB 3EIFA 4QKXB 5FUZH 4LRIC 4Z7NF 1H5BC 4CNIB 4HHAA 3X14A 3KPQA 2JJSC 1NGPH 1KB9J 5C0RL 4OF3A 3PGCA 1WZ1H 1RZJC 2UUDH 5CHNA 4PLKD 2O93L 3MYJB 4NM4L 3D9AL 1QR1B 1QZ1A 1OD7A 2EE2A 4LCWA 3AU1B 2H3NB 4NZRL 4TSAH 2RR3A 5E9DB 2FBJH 4N8VG 1INEH 1Q0YH 3H7BA 4YHMH 1BQHB 4N0CD 2Q8AH 2YD4A 4XP1L 5I9QC 2DLIA 2HJLA 5HGAA 4NZUH 2YUWA 1JYXA 2P49B 1P6FA 3VFWA 2JJTC 3EYVA 5L6YL 2OL3H 1I1FA 4YPGB 3ZKMC 4FP8H 1MY7A 3RBGA 5A2KH 5BV7L 4GSDH 3WIFA 3SDDC 1IKFH 5C07A 5FO9A 2B5IB 3FB8B 3SKUD 5CGMA 3RX5A 2R29H 5AWNH 1QD0A 4LKCA 2PO6B 3V52H 5D7IF 3LH2L 1A8JH 2ZG3A 2W9LA 5TDOB 1ED3B 3QI9A 3VH8B 1F2QA 4YUEL 3FB6A 3WFZA 4LLYA 4HIJA 2WBJC 2DQJL 4NC1C 5GGSY 4X9GA 3UC0L 2B1AH 1CFTA 3HNSL 5E8PB 2EH7L 5EOCJ 4ODUB 5JZ7C 3E8UL 1PKQA 1VADB 5IBUG 1MOEA 5C92A 2IANA 5MEQA 2W9EH 3MLVH 1TZHA 4Q6YA 3STLB 2XKSA 2NTFA 3NABH 3JWOL 4PD4J 4Y88A 3LN9A 4P2OD 4N8VB 3MTRA 5IWLA 5D6DC 4JZNA 3RVVD 4Z8FH 4KI5D 3CZFB 4M62L 2NXYD 1QFUH 5DF0A 3HZKA 2X9YA 3WKNA 1I7RA 3ULVH 1H5BB 4G3YH 4UNUA 2XWTB 3GBMH 2J4WL 3BZEB 3S36X 3VE0A 3NA4A 1HOCA 2YC1A 1P4BL 5FKPB 2ZUXA 4YWGH 1CLOH 4PJHE 2ZSWA 5LGJA 1JZ7A 5CCKH 5E00B 3HE6A 3QXAB 4RGND 3I6GA 3GSOA 5HYIA 4FABL 2ZZUT 1D9KC 1FC1A 3MLRH 5IMOA 1IRAY 4E5XA 1TLKA 4XPHH 3G5ZB 5I9QB 5KTEH 2O5ZH 1MCWM 4HKXA 1CLZH 2NNAA 1T20A 5J11C 3WXWL 4OZFG 2OCFD 3KXFA 4GRLB 1W72B 1OD9A 3OGCA 1RPQA 4JDZA 2P8PA 3SDDB 3C5ZC 3JV4B 2DDQL 2FWOA 1EGJA 3VWJC 1U8KA 5GGUB 3S35X 3O4LB 4OKVB 2IH3B 3E6FB 2R0WH 5DJ6B 1B88A 1S7RA 5F9OL 1RZFL 2MQCA 2HG5A 1QTYT 5FK9A 2BMKA 2I5YL 3JUYA 3QO0A 5FECA 1PX3A 3FHQA 2X44D 3OX8B 2X4SA 1JFQH 4R8WH 2DQUH 4NQCA 3UZEA 3O9WC 4YX2H 4LSSH 2UWEB 5IIEB 1EJOL 1HZHH 4PJCA 1UKQA 2D7QA 1VPOL 4K3DH 4NQSA 5BVPH 3BT2H 3D39A 4NN7C 2IJ0C 1YQVH 3DBXA 5A2FA 2YPKB 5HGBB 1BEYL 2D9QB 4FFZL 2HLAA 3IU4H 4N1HB 4NC0B 5EIQA 3JWDH 3TN0A 1U8IB 4JPKL 4E42A 1BJ1J 1LO2H 5D7LB 2A9MH 5E99L 3LEXB 1I1CA 3VU2A 4LHQB 1MCRA 2F54B 2OR7A 3WN5B 3VDBA 3KPPA 4OZFB 4YFLF 3IS0X 3MJGX 1SJEA 1JV5B 5DEFB 2G5BA 1HILA 3MUGB 4PBWD 1UM5L 4X6FA 1TETL 3E3QC 4B50A 4G6JL 4KKCD 3VXRB 2BNUA 4MJIE 2Z8VC 1QP1A 3TIDB 4NKDA 3MACL 3SBWC 1CXEA 3MBEC 3NFSL 2ZUTA 5F89B 3QUZA 4DVRL 4DN3H 2A9NH 3OAUH 5I1GH 1UM4H 1IEAA 3HI6H 4JG0L 2OSLA 3DWTA 2BVTA 3DVFA 4KI5F 5I8CB 2NZ9C 4CVXB 5EZIH 4Y1AD 2V5MA 1SJHA 4WUKL 3QEHA 5L8JB 3EDJA 3H2WA 1LP9B 4ZUWB 2GK0A 1IL1B 1CFSA 4KJWC 2BNRA 4AEIL 5EIIA 1G7PA 5E2UL 1BLNA 3FN9A 3C5ZB 5HI4C 2HT3D 3V6OA 1OWRM 3GRWH 2WUBL 5D9SB 4XT1C 1NCWH 2DIJA 3VWJB 3BQUA 1KCVH 4X9IA 4F9LC 3X3FH 3VCLA 4EOWH 5CBAB 4DJMA 5KSAC 1LO0H 5BRZB 2GW5A 4N0RA 4KK8C 4YDJA 1XF5B 5I0ZA 1P2CB 1OAUL 2QHRH 3P40A 2AEPH 2X70B 2L0DA 3O9WB 3QDJD 4XVTH 5HYJB 2VDQL 4HFUH 4QHLB 4PB9L 1FBIL 4U1IA 4JM4L 4NN7B 2DQFA 3ARYA 5K9KA 1FLRH 3ARBA 4X6BA 4YBLC 4G9DA 1CT8B 4C83B 3PNWA 1GVIA 2IC2A 2AJUL 1KJMB 2I25N 1C5CH 4YHKL 1JGEB 3W9DA 1ZVSA 4Q7DA 1EBAA 3U1SH 3QWOA 5HY9B 1A2YB 4TN9A 4K9EC 1YMMB 2ARJQ 2C3HA 5DRZB 2C3GA 4OZGA 1CG9B 2ERJB 5C71A 1QLFB 4E41D 2D7PA 5IG7B 3OKDA 4W6YB 4BQBA 3UPRA 1HQRA 2DIBA 4W81A 3ZT7A 1IEHA 1RJLA 3KPNA 2EDKA 5GGTL 3CFJA 3MROB 3CAFA 1G7IA 1ERNA 2QEJA 3WS3A 1N64L 4KQ4H 2NY3C 3A67L 1UH2A 2D7MA 2PTTB 3GO1L 1RJZB 4BYHA 4KRPC 1R0AH 5T1LD 2BSSB 3GGWB 5FUCC 3MUZ1 1PYWA 3DMMA 4FZ8L 4HLZG 5GZND 3T65A 1LO3L 5F93C 1XF4B 2JCCA 1PQZB 2R56L 3PL6C 4XCNA 5DJYA 4HS3A 1G9NL 1DBKH 1MJJA 3FT3A 5CP3H 2E6JA 4OLZL 4O2CA 3V79C 1N59B 2RGSA 3QFJE 4XWOD 3OV6A 2E7LC 3WFBH 3TBYB 5J6GA 4OUUA 5I6XB 2DWEB 2ADJB 3RU8L 2J1KA 3FAXA 4HWNA 3MA7B 4NCC1 3FT2B 2E27L 1FVEA 4OTXH 2BHYA 4QYOA 2C3WA 3KYMA 5CEYA 1S7TB 3BP6A 3AROA 3NA9H 3NPSB 1A4JA 2VMFA 3HE7A 2V17L 3ILQC 1WEJH 3SDCA 3KLAB 2G2RB 2DYPB 4TTDC 1YUHA 4YBLB 4HZLA 2WBWB 4FFVD 5JORB 1HINL 4ZUTB 1JGVH 3PP3K 4K7PX 5HHMD 5SV4A 1LK3H 4CL7A 1L0YA 1ORSB 1AKJD 2EXWC 1CD9B 4RQQA 3MREA 1DEEB 5I1KH 2A83B 1V05A 3JTSA 3GMMA 5TDNA 4PRNB 4UILH 5BZWB 1CD0A 1DQQA 1W72H 2FLRT 4HWZB 4C59B 5IKCB 4R26L 3D2UB 4AMKH 2YHGA 1KEGH 1AHWC 1AY1L 3H42H 1MELA 2B4CL 1NCNA 1NMBH 3BN9C 1Q94B 3QNYA 4P9HC 2NZIA 4U31A 5FO8B 5DYOB 1BVLA 3MOAL 5IGXH 1NLBH 1FNEA 3NZHL 5GSVB 2CXGA 1ZS8A 2NY3B 3ARPA 3W82A 1J8HA 1T83C 1E28B 2CO7B 2F53A 1WCBA 2AXHA 2AJSH 4DKEL 3I2CH 3N1PC 4LMQI 1PG7W 4LDEB 3GK8L 2X4PA 5JHDD 4NO2B 1I1YA 1ZVHA 1U3HC 3Q5OA 3IXTB 5E2WL 1N4XH 2QHLA 4BSWA 4LSVH 4IIQA 3SJVB 4U2ZA 1FC2D 1ZWIA 2R2HA 4PS4L 3NACL 4H1LG 3QIUD 1A0QL 2R0LH 5ID0A 5CSZB 2AGJH 4P4RA 2WP3T 4IRJC 5C0BA 3CK0H 1NUFA 3PUCA 4G8GD 2X4NA 5TF1H 3EYUH 4CGTA 5I76B 3WFHA 3RUGB 3CFBB 1L7IH 2MKWA 1SY6L 4KTDL 3TCLA 3WFEL 5FUCE 1A7PL 4OZFH 1X44A 4CN4A 3D3VA 4IJ3C 1X4YA 5IFJA 3CNKA 1UB6B 1T66D 3G6JA 5C0EA 4P5TD 3TVMD 4NSKB 1NCUA 1E4KA 4ZUUA 1J1XL 1JPFB 3D85B 1NEZG 3OZ9L 1G1CA 1WAAE 1KPVB 1T5WB 3QYCA 5ESAA 1ROWA 4OIAA 4NQXB 1DBML 3WXVH 4U6VH 2X4UA 4BZ1L 2EIBA 3RL1A 1UQSB 4TSBL 1YYLH 3ARDD 1QSZA 5J1SC 4HUUB 4IDLA 3S37H 1VGEL 1OP3K 4BSJA 2W60A 4MXVE 5DZLA 2NW2B 4L8DB 4H8WC 1Q0XH 1IAOA 2DQCH 3WO3B 3EGSB 4PJ7F 4Z78A 1AHWB 1SYSA 4Y2DD 5JOFA 5KW9H 4N1CA 2DMKA 2GT9A 2PXYD 5DJCA 3PWLB 1GAFL 5E0QA 4H0GA 3AC0A 5SWZE 3U9PH 4ZOCA 2GY5A 4MJ5B 2A6DA 4KGLA 3H3PH 4FQLH 4LCWD 4CVWA 3DXAA 1NBYA 5DRWB 2HP4A 4KVCH 3FZUD 3TV3H 1U3HB 5CGYD 1IKNA 2VITA 4IEFB 1BWWA 4UUJA 3G5XA 4LGRB 4JR9H 1DFBH 1I4FA 2DI7A 4J4PA 3RX7A 5IB2B 4R7NB 3SO5A 2UYLA 3A6BL 4HFWA 5ICZB 4ALAL 3GSVB 4UV7H 2CLRA 4F57L 4ONOA 1CBVL 5ISZB 4QRPE 4IRJB 3BDXA 4TQEL 1EGJL 1FVDA 3S98A 2GTWB 3D87B 3ZTNH 5HJ3A 4X6DF 4JFHE 2E9IA 3UMTA 3P4NB 2ZNWA 2V7NA 3BH8B 1I1AC 5AG8A 4AL8L 4FQCL 3V7MA 1U8MA 4ODWB 4PLJC 4IJ3B 3B9KB 5KVGH 1XIWC 4ZD3L 1TENA 5D8JH 3REWA 4S1RH 2F9BT 4O9HH 3CSYB 3QUYD 4I3RH 3DVNA 4F7PA 1AC6A 1Q38A 3OXSB 1Z9LA 3KPTA 1ZGLP 3RZCA 4P23C 1HQ4A 4I18A 4EI5C 4EXPX 4Q58C 2FEDD 2VXTH 4FFYL 2X05A 3DUUB 4KRNA 2OMBA 1I9IL 4Q9RH 1IVLA 1D5BB 3IGAB 3TBTB 4QRUB 2R1YB 2Q6WB 2PNDA 5KJRH 5KVDH 4KTEH 5DI8A 3O2DA 4ELMF 5ID1A 3PDGA 4QOKE 4MNQD 9CGTA 4HUWB 4LPVA 2B20A 3AAZB 3RA7L 4Y5VB 4QXGL 1I3RB 1OPGL 4LAQH 5C0DB 1FQ9C 3R0NA 3CH8A 5LBSH 5IBLD 4DZ8B 4Y4FD 5CMAA 1YC8A 1AQDA 1TITA 1V7NL 5I1IH 3DJ9A 1ONQA 3LS5L 4Z7VE 1UYWL 4XP5L 1DTUA 2I26N 4OZHE 3IAGC 4JPIB 5DURB 5DO2D 1A9EA 5B8CA 5DMKA 5DC0A 3BH9B 4ZXBC 4PY7B 2NW3A 3B9EA 2EKSB 3SDAD 5J89A 1MFNA 1AGCA 5FKAB 4UAOC 1CS6A 4U1HA 1XGYL 5JLZB 2Q7NA 3JV6B 4M7KL 4MJ6B 3PQYE 2AK1L 4HLZH 1I1AB 3SGKC 4ENEC 4PJAE 2A38A 3PP4H 5IB3A 1LEGA 4RNRA 3QH3B 4XC1L 2GEEA 3HLAA 6FABH 3RWGB 5DD5H 4KVNH 4YHZL 5C08E 3RGVB 5BOPA 4M5YH 4BQ6A 5CP7B 4WO4A 1FZJB 4YDVB 2RCSL 3HR5B 3MRCA 3N9GL 2IMMA 5CKGA 1D5XA 2IAMD 2X4QA 4I0PD 5FYKE 4LL9A 5CD5D 3ZKQD 4MZ2A 1P4LA 5EA0L 2HH0L 4MYWB 3TT1H 4ZFOA 4QLRA 2VZ1A 3MNVA 1MHPH 3N85H 3QIBA 5A2LH 3OJVC 1QOKA 1I9EA 4UTAH 2HAZA 4Z18A 1AXTL 1FH5L 4EDWL 3IXAB 5IJVB 3MCLL 3N1MC 3PV6B 1EIBA 3P9MA 2HTKC 1AD0A 1EXUA 1KELH 2EDLA 3H6JA 5C1MB 2D3VA 1MRDL 2HKFH 5IW1B 4P3DB 2IPKA 1H8NA 3VXSE 3HPLB 3OKNB 5CIPA 4LDLB 4QXTB 1VEOA 4S1DC 2BP3A 1KC5L 2YBRB 1VFOA 3LKRB 4NKMB 1CYGA 2DQHH 5DUBB 1HIMH 4S10A 4NWTH 3CC5A 4B53A 1CU4L 5FB8A 4AEHL 3ZT5A 2CKBA 4XCCL 2BVPB 4HX1A 5MHSE 4ZXBB 5D5MF 3M8OH 3VFMA 4MAYB 4JCMA 2Q87A 5IOPA 3BQUD 2V2TA 3ALPA 3DTXA 4KV5E 3LHPH 4OLYL 3ROOA 2ZOLB 5IVXA 4YHOH 3AB0C 2VLKB 3MRDB 4KKNA 3E2HB 1NGYB 3CFKB 3SCMA 1G7JB 4K07A 4AQOA 4GBXD 2QKIA 3OR6A 1RK0A 3CFCL 1CD8A 1VFAA 1U8HA 3B3IB 4NYLA 2I60H 4H1LH 3VFGH 5FYJU 2ZCHH 4OT1L 4GMSH 1S9YA 4N5EC 3HPJB 1IGFH 3BP5B 2WQRA 1NMCB 5D72H 3GMNA 4PLOB 3D25A 3FOMA 4Q0XH 5LJYH 3IFOA 4P2RE 1YPZF 2EZ0C 2YZ8A 4HS8L 2QQKL 2GITA 3AUVA 3EYQD 3LKNA 5D6CA 5IP4A 3AREB 1EK3A 3DGCR 4Y16C 4D0BA 2R23B 4PLNC 4LU5H 5E94A 1LDPH 4I2XB 4NQDB 3L3IA 4XX1G 5F3BA 3IDGA 1BQUA 4GG6E 2HJKA 5C7XL 5DR5L 1HHHA 2P7TA 2C3VB 5SX4I 1IEBB 1NQBA 1P5UA 3X3GH 1KSRA 4PJCF 4U1NA 1MF2H 1BX2B 2AJXH 1HYSD 5I17B 3FONA 4XCYA 1S9VA 4GLRI 4UT9H 4TOYH 3HZVA 3S3JA 3GM0A 3VXMB 4HK0A 5KS9A 1P6AB 5DDHB 4ZAKB 2OBGA 2OX5A 5FOBA 2FECL 4PJ5E 1NEUA 2QJDA 4PTTB 2P8LB 1AFVH 5FYLL 4A6YL 3BJLA 3ILPA 3DMMD 3QCTH 4WFED 4WI2A 3CUPB 4X99A 1I8KA 5DJDB 5CUSL 3BO8A 1I9RH 2F58H 4NOBA 2Z92A 4G42B 4YHNA 2ICEA 4PUBL 2Z93B 3CDYA 1FFPA 5I71C 3EFDL 3TA3A 2XZAL 2LVCA 4YHIB 5C6TL 4M3JA 1BBDL 3I9GH 3MLUH 5B38A 3AB0B 2YUZA 4UT7L 5CBEA 2V2XB 4NKOB 5SWSA 2XY1A 1B4RA 4MA7L 4J3OC 1Z0NA 2EIZB 4APQB 4LEOB 3U4EB 1QBLL 1RU9H 3V5KA 1CVRA 3AY4C 1E27A 4KMQA 1LNUA 2DMCA 3WBDA 4YFEA 5I1AA 2XOTA 2WSKA 3CVHB 3QEUB 3EOTL 5CJOL 3WLWD 1G6VK 1YEHH 2XPGA 1IC4H 25C8H 2YN5A 3HE7D 4M8QA 3VWKB 2M26A 1HXMA 3STZA 1FNHA 1YMHA 3Q5TA 3SDCD 1I85C 1G6RA 2BNQA 4N0UB 4Y16B 1MCDA 2BK8A 1YJDH 3PWPD 4YHLH 1JZ5A 3MZTA 3TZVB 5D2NC 4PV9A 4PJGA 35C8H 4C4KT 1MJ8L 3LQZA 5KVEL 2DBLH 5H35A 1A7NH 4Z7UB 2JIXB 2ORBH 1FYTD 3W2DL 2EE9A 2XWJB 3QULA 1BZ7B 3BEVB 2QR0B 3Q0HA 1BZ9B 3LEYH 1R3LA 1CICB 1DVFA 2FBOJ 3BVNB 5DD0H 1KLGA 3H7LA 4NRXA 1MRFL 1JMXA 3C09C 1IAKB 1OGTA 1G9ML 2WIIA 4MD4B 2X40A 1J8HD 4JFDB 2SEBB 1N3NB 4OCYL 5FYLD 4EN3A 3ARXA 5EUOA 5HYFA 2J3SA 3VD5A 1IC7L 1IC5L 3EHBD 3VGEA 2J5LB 2RHEA 1ZLWH 4KY1L 1MPAH 3F5WB 1BD2D 2YD3A 3MLWL 1E4WH 1JZ2A 3GDBA 1KTLA 2AW2A 3C5SA 2XNAA 5C09A 1MCOL 4QHNB 1F3JA 1A6WL 2HFGL 1UT9A 3I6KB 3S88H 3P3YA 3MRMA 1MIEH 5GJTL 4WUUE 3SO3C 2MFNA 4XPFH 3OGOE 4YFDB 3L7EB 4RBPK 1T1WA 3L3DA 4XH2A 4UT6H 3K2UH 5JW3L 3OAZK 3CMGA 5IMKA 1ZHBB 1T2QL 3W0WE 2GJ6B 1NAMA 5I1DA 3BWAB 2OYPA 4HWUA 5B3NA 4I4WA 3QEQA 5CINL 4JCLA 3V6BR 1KTDB 2HTLC 4DCQB 1RZGA 4YIQB 2PCPA 4RGNC 5DRNB 5D1ZC 3OSKA 4WRLA 2CRZA 1EAPA 1TTFA 5LCVL 2JKXA 4O2FA 5GSRB 1IBGH 2QQLH 3TGXA 5L2KD 4OM1H 1SEBA 4R90L 4HIHA 3S34L 2DKUA 3QNXA 2DJ4A 2EYSA 5D71L 1Y6NR 4Y5XC 4QF1B 3JZ7A 4F7TA 3V6ZB 1NFIB 3LRSA 1X7QB 3O2DL 5BV7C 5EBWB 5EZLA 5DFVD 1L7TH 2YK1H 1XMWA 4TVPL 2NY0D 5CEZE 4IMKA 4ZFZB 4JGJA 3PWJA 5I75C 4JRYA 5FIEA 4PJEA 3M17A 4FXLA 5GIRA 3F7PC 4WWKA 1HEZA 2P47B 1NGZB 3WV0A 3O6MH 1FNGA 5D2NE 1T89C 3RTQC 4LF3A 4PIRF 2YS4A 3D5OF 4KQ3H 2FH8A 1WITA 4KROC 4KGJA 4HBCL 5C0AB 4UB0L 5E8OA 4D0DB 4YJZL 5TQ0H 3WHE1 2F5BL 3LB6C 3QDGE 2OZ4A 2H8PB 3IJSA 4O58H 1MCPH 4Q6IA 5E8EB 3SE8H 2KPNA 1RHHB 3TO4D 5AAMA 3DROA 5E7FA 1JPGB 1I7UB 5GXBB 4P2OB 5J9PA 3RRQA 1FN4A 2OR8A 4K94C 3NAAH 4ZPTB 4NQED 3HFML 1JHKL 3RNQB 2X7LA 1GHFH 2H2SD 1KCSH 3FB7B 4O2EB 2GY7B 1LD9B 4JY5L 1OY3B 5IBTL 3O11A 4NP4L 1A6VL 4D0CA 1SYVB 4XBEL 3KJ6L 4P99A 3F7QA 1CIDA 2Q86B 1Q72H 4N8PA 5F1KC 1QUNA 5IV2B 4F37F 1T6VN 2O5YH 2AABH 4RGNB 3GJFA 3O3AB 5D1ZB 2J6EL 3LD8B 4LLDB 4YEEA 1GSMA 3FRPA 4YZFF 5JDSB 4MCZB 5IM7B 3C60A 3RZCD 5IF0B 1XCQA 1FPTL 3QIWD 2P43B 2Y4SA 4HV8B 1YEKH 3T1FB 4FQXC 4Y5XB 4ELKA 3NZ8A 1QACA 1ZOXA 2Z35B 3UO1H 5BV7B 1UWEL 3HB3D 1B0GB 2VIRB 4BH7A 4NNXB 4OD3H 2MOVA 4TVPD 1B2WL 3OJDA 3N06B 5DS8A 4P46A 5LGKA 2X10A 4F37K 4Z7QE 3SDYH 5I75B 1CL7I 3TYGL 5EZJB 3B6SB 3FO1B 2JB5L 4H20L 1I8IA 1S5HA 5FHAL 4G8IA 4U7MA 4MA8H 3U82B 1MHEA 2IALB 2PW2A 3FO2B 3CVHH 4PREB 1ETZA 1KCLA 2CKBL 4WY7L 5BS0A 5K93A 2Y7QB 4G9FB 1I9JH 1LK2B 4CRPA 5D1QC 4HGWB 3WDHA 3V0AC 3F7RA 1XH3B 2PYFB 4JDVB 4KKAD 4RA3A 1NUGA 3BGAA 4LARL 5F70A 4OAWA 5DD3L 5A3IC 5JXEC 1C5DB 2XFXA 3DSFL 1JL8A 5J56B 5DTFA 4X6CE 3ROLA 4QXUL 1KLUB 3UTPD 2QADC 5KSVB 3T2NH 1EFQA 1D5IL 3V5HB 3C9NB 4JFEE 2VLLB 2CGRH 3LY6A 1INQA 1JUFB 1W0WB 2FHBA 3IDXL 4I9WD 4HPYH 5EBLA 4XXCA 1GCFA 2CK0L 4HUXA 4WO4D 1JIBA 3C2AH 5E08L 4XMKH 3SKJH 4F33B 4NRZB 1Q9KA 2GAZA 4Y5YA 1FLTX 2FYYB 1XGTA 2ADGA 5SX4H 1BQLH 1AGFA 2BY2A 3QSKB 1NFKA 3QIBD 1B4JH 1XGPB 1X5KA 3GMRA 4GLRH 4MNGE 4Y1AB 2QQNL 1DDHB 2O5XH 1HKLH 4X6EA 1CXHA 3NCBB 4KHTL 4Y4HD 4FQXB 2X4RA 4V2CB 2P8MB 4XWGL 5F7FA 1S78C 2UY6A 1NPUA 3HA0A 1OAXH 5AD0A 3RVTC 3DV4A 5GRUH 3TLRA 1RUQL 5EBMA 1T04B 1YY9C 3S6CA 1KG0A 2VQTA 5DRXB 4KUCD 4W4OA 2X2YA 3R0MA 3CXHK 2CMRL 2VAJA 3MJ7A 1JWSA 3MRLB 1YN6B 5CAYB 2ICCA 5DUMH 1QNZL 5H37G 3QDJB 1F6AB 1FYHB 4U1JA 1H3PH 2BSTB 3EOAB 4OZIE 3KNBB 3SOBH 1K4CB 4DW2H 5B3JE 1OLZA 3EJZC 1RUAH 3QJFA 4ORGB 2HT2C 3SGJC 1LEIA 1K8DB 5E1AA 1JNHB 1W2KT 1ZAGA 4MHHG 2BC4A 2KBGA 3QUKA 1EEYB 4HDIB 4ZFGH 3RWHA 2GYSA 5T3XL 1FFNB 1AC0A 4HIIB 1MLCA 4CMMB 3SCMD 5HHQB 4PJHA 1NH6A 2OP4L 4KAQL 4NN6B 5TFSL 3WJLA 3B9DA 2CIIA 4JVPA 1BVKB 1JTPA 4QHMB 1CZ8L 1L6XA 1J1PL 2GFBA 4E41B 1KPUA 2NY7L 4GXVH 2CH8A 3NMEA 1U8LB 5ITFA 1H3VA 4QT5B 3LEVH 2XZQL 3P4MA 4LRIA 3U46A 1GGCL 5JO5B 4G6ML 4PJBE 1G6RL 3S3PA 4J6RH 4WV1C 4P3CL 1J12A 3W39A 2JJSA 2VQUA 1CGVA 3EO9L 43C9B 4X5WA 2ICWA 5T1LB 2QSTA 3VXOA 3U6RB 3MUHL 4AM0A 2COQA 5ICXB 4M7LH 2EE6A 3KVQA 5J12B 3BHBA 4W6XB 2IADA 4RISH 3VG9C 3L7FB 4FQPA 1NGQL 1K4DB 3P73B 3ZL4H 2NY6C 4HXAH 1DE4B 3VGAB 1HHIB 1NMAH 4L4VE 2VLRE 4ZO8A 5KN5A 2YRPA 1ACZA 5IFAL 1PAMA 5IW3A 1RFDH 3FRUA 1Z6JT 5H94B 2ITCB 4YDKH 3KPRE 5EO1A 3IKKA 3WD5L 4DKAA 1FL3B 3HMWL 1LILA 2I07A 4F7CA 5GS0L 3CFDA 3OF6A 3ARWA 4D3CL 4PJ7B 1QFWL 4OFDA 3FQWB 1R3JA 4M6AA 5C0RH 4JFOB 1MVUA 2WBJA 2QTEA 2DJSA 4HMEA 4NM4H 3D9AH 4NZRH 4KTYA 4HJJL 2VLJE 1AD9B 2DLGA 3G6DL 2I9LB 5T3XD 5HHMB 1ORQA 1J0ZA 4KUCF 4G6AD 4LCCA 1MI5D 4MJIA 4XP1H 3O4OB 3L3OA 3MMEA 15C8L 5IK3A 1KCRH 4KJYA 5B22A 5L6YH 1HK6A 1AIFB 3ZYIA 2VN4A 3REVA 4ZS6C 1AXSB 1W8OA 4P4KD 4ODXA 5BV7H 4PTUB 4W6WB 1WBXA 3KS0H 4UIMB 5KSBF 1NAML 1H3XA 1JYVA 5EU6E 3O3DA 4GRMB 4X6DB 3HKFA 3IDJA 1H3WM 3LH2H 2C4XA 5IUSA 1XT5A 4L4TB 3KPSE 2H32B 2YA1A 4LCUB 4X4XA 4YUEH 4J3SA 5JHDB 2DQJH 3ZE1E 3UC0H 2XWBA 1TTGA 3OL2A 4IOIB 3HNSH 3WUZA 2MHAA 3BGMA 3WNPA 4NFBA 4Z7OF 5F1SA 3ECBA 4DTGL 3E8UH 1SBSL 1A6UL 2C7UB 3C6LA 3PGDB 3U0TB 1XR9A 4Z77B 4FQJL 5JDJA 1ZGLB 4W68A 1D9KA 3SDXB 3QIUB 4DEPC 2APVA 1KCKA 2WUCL 3RIAK 1JF1A 1QG3A 2NY6B 4M6OL 2WLYA 1KOAA 1KIQA 4V1DE 1QSFD 3JWOH 2YSSB 4G8GB 4RFEB 1VDGA 3ARRA 1DVFD 3MRHB 1T21A 2I9TB 3C6SA 5E2VL 4M62H 3IDIB 1N6UA 4CN6A 1OGAE 3QI9C 4RAUA 4IOFD 5J1AB 1KUMA 4HSQA 4JN2A 1ADQL 3HMXA 3TNNA 5GS0D 2YN3A 2J4WH 5CWSA 1QPXA 2FRGP 3TVMB 3VXUB 3LZFL 2RB8A 4JDTL 4S2SB 4PGBB 2VZVA 3VXTA 3DV6A 2OZ4L 1P4BH 3VGDA 2AEQH 2PN5A 3WL9B 2OTUA 4TUKL 3CX2A 3PP3H 2NY2C 3PG2A 1TJGL 2W92A 1ZHKA 3HS0A 4K7FA 4FABH 2EDWA 1L9MA 4XHJC 2BHZA 3F7VB 4C56D 4H25B 3O2VL 3ARDB 4AT6B 5EOTA 4X7EC 1HSAB 3MBXL 4WTZG 1GGTA 2FEDC 4WU7A 5J06A 2YPVL 2ZUQB 4ZNEE 3WXWH 4HMDA 2C26A 5I2IA 1P69B 3L95B 4KK5C 3NCMA 4HHAB 3BKCL 3AM8A 4W70A 4Y2DB 3X14B 5JXAL 2NR6D 2PXYB 4HJ0C 5C0GA 2DDQH 2DKSA 3N1QC 3UZQA 3QNZA 1DBAL 4P57A 3MLTA 2WQ8A 5GRJL 5F9OH 1RZFH 2W65A 1UH4A 2EKJA 3HE6C 4HK3N 4LCWB 1FJ1A 2I5YH 2NYYC 5EC1B 1IQWL 2W0PA 2WMPA 4WCYL 1CL7H 3MBEA 2HJLB 3VFWB 3UROR 4WHTB 4FFWC 3EYVB 1EJOH 5F1NA 5IB5A 4XMPL 4FXGA 1VPOH 2ZUVA 5JW4N 3WIFB 5FO9B 1FG2A 1TZGL 3VFVA 1ZKAA 1BEYH 4B7IA 3DPBA 4K3JL 3ZKND 4FFZH 5E5MA 3QG6A 1GYAA 4LKCB 1OCWL 4ZO9A 1A1MA 4JRYD 4JPKH