4NUGH

Crystal structure of hiv-1 broadly neutralizing antibody pgt151
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
236
Chain Sequence
b'RVQLVESGGGVVQPGKSVRLSCVVSDFPFSKYPMYWVRQAPGKGLEWVAAISGDAWHVVYSNSVQGRFLVSRDNVKNTLYLEMNSLKIEDTAVYRCARMFQESGPPRLDRWSGRNYYYYSGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGT151 light chain
publication title Structural Delineation of a Quaternary, Cleavage-Dependent Epitope at the gp41-gp120 Interface on Intact HIV-1 Env Trimers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH02
5IB1B 3ZLQC 3C08L 5CD3A 3MRIB 3RUGA 4NFBA 4O2FA 5ICXB 2YPLB 1ZANH 1OGAB 4J6RH 5F7KC 2PTVA 4YXHH 2KL6A 2ENSA 4XC1L 1EJ6A 5SX5H 2I60H 3RGVA 5DUBA 5F9WB 2DJ4A 3RUGE 2DWDB 3ULUL 1NGXA 1MUJB 5ESQB 4FQJH 3T8XB 5IEHA 3FQXB 4YO0A 5L8KB 15C8L 4JQIH 4L9LC 3G5VA 5DJZA 1NCTA 5TPWL 5D2LF 4FS0A 3UTSA 1RUQL 2CMRL 5ANMB 4ZXBD 2VL5B 3GMQA 3RBGA 4ODSL 3AS3A 4HJGB 4KJYB 5FV2A 2CJUL 4MD5B 2FRGP 5L0QB 2FYYB 1FQ9C 1DBAL 1A47A 2FDBP 4PJIF 2JIXD 3UTSE 4NRXA 2YZ8A 3T1FA 3L95B 2VE6A 1CGUA 4LEXH 2XQBL 3DBXB 3FB8A 1OLZA 1NMCC 2R23B 1HE7A 5CSBA 1MI5D 2D9QB 5J11C 2NY0C 4EN3D 3PE9A 1IAIM 3EYFB 2OZ4A 1X9QA 2AI0H 1GGBH 2BNQB 3BEVB 3JTSA 3WO4C 5EUKA 1VPOL 3ZKXC 4R96A 3WFHB 3P4LA 2XZQL 2XN9D 1I3UA 1JFQL 3NCCB 1MLCB 2Y5TB 3I02B 5TF1L 3GIVA 1EHLL 2A83A 5HVWA 1E28B 4R4ND 1QD0A 5IFHL 3OZ9L 4RFEA 5TE4L 2XNAA 4P2RB 1SVCP 3MV9A 5CCKH 1KIQB 3CXDH 4YNYA 2IEPA 3IDUA 5BV7B 4M93B 4DN4L 4CN1A 1T21B 2ESVD 1LE9B 4OUUB 5BQ7B 3KYOA 5DRNB 5TDNA 4D3CL 4JEGB 1I9RH 4Y2DB 1F3JB 2WP3T 1KTLB 5E8NB 3MV9E 1E4JA 4UQ3B 4DVRH 3MCLH 3PXHA 3NBNA 5IIEB 3KYMA 5IR1A 4OLUH 1IAKA 5IJVB 3WFBH 5FYLD 2X05A 5DURB 4X80L 3AAZB 1KACB 2P5WB 2R56L 5FK9B 4WHTA 2BMKB 3CSGA 1LO3L 2YPVL 5GRVK 3TIDA 1T7ZA 2DBJA 1CFSB 1JF5A 3KLSA 1FH5H 4XMPL 1DANU 1WBYB 1CXIA 4K2UL 5DFTA 4P9HC 1ZS8A 1QLFA 1TDQA 5KSAC 4CNIA 4MB5A 3KAAA 5F7EH 1HQRA 1AXSB 3TESA 2J8OA 3NFPA 4FQXB 4O4YL 5GJTL 1P4BL 1Z5LA 4Q97A 1EO5A 3DVGB 2E9WA 4JCMA 4ZFGH 4XPAH 1ZT7A 3QPXL 5D70H 1T2XA 3EGSA 5I19L 4QHLB 4Q0XH 5GGVH 3MC0A 4M03A 3WS3A 2ZCHH 2B1AH 4MA7H 2MQCA 3N1PC 2DKUA 3GSQA 4H20H 5I8EA 2WUCL 1ONQA 1N2RB 5K9OB 1LD9A 5DRZA 5C7XL 4BZ2H 2VLRD 3LHPL 3PF2A 3O3DB 2WUBH 4DGYL 3FT4A 4JM4L 1YEIL 2NW3A 4LLMB 4NC1E 2GUOB 3SCMA 2C26A 1JYXA 1L0YA 4KI1A 1A5FL 4A6YH 1ROWA 3PL6C 5GSVB 4TSAL 3QI9D 3DXAA 2IAMD 1RVFH 2VDOL 4LLDA 4PJHB 4QTIL 5F9DC 5BZDB 1VKXB 2C1OA 2GJ6D 4G8GA 3G6JF 3WFDL 3E8UH 4JGUA 1GGTA 2BVEA 3BESR 1XR8A 3DXAE 3VFVB 2AKRA 1OD7A 3JZ7A 3T0VA 5E1AB 5JIIA 1CE6A 4X7CC 1OP9A 4G8GE 3RJDA 3BEWB 1SEBB 4LLWA 2NTSP 3BZ4A 2P8LB 1XIWD 5GXBB 2I9TA 2GT9A 3MXWH 2QSQA 2ZCKH 3OMZA 1INDL 1P5VA 5FUOL 4OI8A 1NCNA 4MJ2A 3BWAB 3FFDA 1LNUB 3JWDC 1U8IB 1BBJA 4GXUN 3WFEH 5T3ZE 3D6GA 1XGRA 2C3VB 1JGDA 1BZQK 1R3IH 3GSVB 4LL9A 3RWDA 5EB9A 1IAIH 3NFNA 1MOEA 3LKRA 3FHQA 5E8OA 1QFUH 3TBYA 4BQ6A 1DLFL 3FN9A 4GAYB 5T1KB 1ZSDA 1I9JL 3CFEB 1XCTA 1LO2L 4WU7B 2A77H 5KSBB 5B39B 3ULSB 3HI6L 3PWPA 4P2QB 4IMKC 1DDHA 4KRLB 3LQAH 4U1GC 4U6XB 2QADC 2FJHA 1P84J 4JDZA 2P42B 1WBZB 4AT6B 5J06A 4WTZG 5EU3B 4M1CD 3EO9L 4W4NA 4HK3J 4POZC 1B0RB 3ZDXE 4XNYH 4WTWA 3QCUL 1MCQA 3SDCB 1W72L 3PUCA 3TBSA 3IF1B 3SBWA 4G6MH 1FBIL 5D6DA 4O58H 1T03H 3CVHB 4EKXA 3V0AC 1ZHNA 1E4WH 5IOPB 4R9HA 1WFOA 5B38G 2APFA 4NFDA 2OMNA 2V7NA 2IBZX 4AIOA 3D39E 5B39G 3M45A 5IG7B 1IFHH 4XBPA 3VXRA 4GO6B 2Y36L 2H26B 3L3GA 3EOTH 3IDXL 1WWAX 3P9MA 5F1NB 1NFDA 3IFOA 3TWCH 5F70A 5F72S 2E8YA 3VXRE 2F53A 1WF5A 4G42A 4U3CA 4KRPB 2V17H 2IWGA 5KN5B 2JLLA 1DL7H 3RWIA 1INEL 4H0GA 3O8XA 1NFDE 4ZO7A 3AU1A 3WO3B 3UTPD 1PQZA 1GZQA 4S1DC 2H6PB 4YWGH 3WS6A 3K3QA 3QUYB 1HQ4A 2HH0H 5IBLD 1ZT4B 4P0DA 1Q0XH 2OL3B 4GRLC 4JQXC 5AD0A 1CK0L 5CUSL 3MJ9L 5HPOA 1JPFA 3O45B 4I3SH 4OT1L 4X6CB 5BRZA 1MCWW 1U41A 4LSTH 1WISA 4QO1A 1FVDB 3KJ6L 4S1QL 3MR9A 4KDTC 3DV4A 4ELMB 2FO1A 3EBAA 2A74B 2E7BA 2DQIL 3RAJL 1UB6A 1EXUB 5BRZE 3BKCL 2APTA 5J6HB 1OGAD 3P9WB 1BQSA 2EDQA 3Q1SL 4TUKH 4HG4J 2O61A 1DBJH 4M8VA 1O5DT 3QR2A 4XVTL 1H5BA 3P0VL 3U30C 2ZOLB 4WWKB 1CFQA 1A4KB 3MLSL 4JFXB 4XPTL 5EU4A 5GS3A 3VDBA 1R5IA 1P7QA 2Q3AA 4HFWA 2R0KH 4K3EH 2CUIA 2JCCB 2Y5EA 1OGTA 1CBVL 3MLXL 1PFCA 1K3ZA 3NMEA 3HZKB 2YEZB 2B0SH 1A2YB 5DD1L 4KVCL 4PGJA 4L29A 5KS9F 4ODBD 2JK5B 1ORQB 3WUWB 4JFQA 2ZKHH 2D31A 1T6WA 4GSDH 4YHKL 2GJZA 3S34L 3TJHC 4UT7L 4RWYL 4YFLF 5E8PB 1U9KA 3C5ZC 5GRWA 2H32H 2GHWB 3KLDA 1LEGA 3ZDYF 1ZV5A 1LO5A 3EDDA 1H3WM 1CLZH 1NAMH 3DRQA 3KPRB 3T2NH 5TQ2H 1KB5L 3SDYH 2MJWA 5D2LA 1TJIL 1YEJH 3B5TA 3ULVF 4CBPA 1EV2E 3HNVH 1OY3B 3LPFA 3VRIB 1MCPH 1UACH 5E2VL 3L3HA 4FQCH 3ZKSD 4DTGH 3LZFH 3I2CH 4Y5XC 3WJJC 5D2LE 4DKAA 4PJIA 3SY0A 2YS4A 3MRNA 4K94L 3BN9D 1ZA3B 4JANA 3VJ6B 4QGYA 1I7RB 4Z7QF 4DVBA 5D2NA 1UCTA 3QIWC 4ODTL 5IEKA 1F8TH 4H8WC 4P2YA 4PJIE 5DTFA 3QEUA 4KJPC 5DC4B 3NCYS 5ID1A 5EZOL 1E27A 4J3WA 3GSWA 1H15B 5DRXA 4F7EA 2CIKB 1NBYB 1I4FA 1FE8H 5F9OL 4QXGL 4KUCD 1LDSA 3CU7A 1MQKH 3ZDZF 1RHHA 2W1NA 5EIIB 3BKML 4ZXBA 3LVEA 4DUWA 3MA7B 1YEKH 5I1GL 3H9YA 2HRPL 2V5SA 2P5WD 1YY8A 5GGRA 4D8PB 1NPUA 1QEWA 1DFBL 3L9RA 4X6BA 4S1RL 2FR4B 2HTLC 1A21A 2JIXA 3FQNB 1K4DA 2VITB 3RX8A 4DCQB 2HAZA 2P8PB 1XF2A 4JHWH 1LO4H 1JGUL 4M6NL 4OB5L 1GOFA 3CD4A 3BZEA 4EN3A 5FA3B 3V0VB 4D0DA 2BXZA 4OGAD 1UXWB 1PDKA 3U36B 1HIML 4YHOL 3B9KC 2HKFH 4MDIA 1CL7L 3V6ZA 1OAXH 4XI5C 1QRNB 2XN9A 3ZTJH 5FFLA 1MI5E 2ZG1A 1UVQA 5IB4A 2V7HB 3B8YA 5HPMB 5E2WH 3G6DL 1AFVH 3PQYB 1MVUB 2NY3C 2WW8A 3IU4L 4JFOB 1EPFA 5I73B 1CFTA 1ZA6B 4TNVF 2HVJB 1D9KB 2X42A 1WZ1H 4HGMA 2DICA 4WFGD 4HK0A 2XN9E 2XPGB 5L88H 1MJUL 2HJFA 3V0WL 4OM1H 4NJAH 1S3KH 2ESVA 2N7BA 4PRNB 2FO4B 3K2UH 2C1PA 3TNMA 2BX5A 4BQ8A 1G6RB 2LE9A 3OKYA 5C0JB 4IIQA 2ESVE 1KEMH 1OAQH 1G7LB 5JLZB 5DT1H 1KXVC 2B20A 2BJMH 1OB1A 2BNRB 3WN5B 1OSZB 1F5WA 1K9TA 1L0XA 3DI2B 5ACZB 4H1LA 3BGFB 4OCXL 5CWSA 3KDMA 4PP1C 3UZQA 1FAIH 2OJEA 4MNHB 4XH2B 3VGAC 1EBPA 3T65B 4J1UB 5FYLE 2XY2A 4KTDL 4EI5B 4P57B 3MLZH 5F1IA 5FECB 4XRCB 1NCAH 3TIEB 3K46A 2P8MA 3NZHH 1Z6JT 2AJVL 4TSCH 4NN5C 1G1YA 1F6FB 3HNTL 4XNQA 4HG4K 3TO4D 3CZFB 1S9YB 4QCIA 3BZFB 4I3RL 3QB7C 1RULH 3V95A 4PJHF 1TVDA 4P9HH 1DUYB 3HC0A 5HVHB 3WE6B 1Q9WB 3ZYOA 4JAMA 1U58A 3G6JE 5DD3L 5T1KD 1UCBH 5IFJB 3VFSA 1KT2B 5HDQL 2L0DA 3TBWA 3E3QC 3D25A 5ALCH 1NBVL 3FCTB 4BFBD 2VLRA 4YQXL 5IMOB 1AGEB 4CJ0A 4POUB 5C0EB 3B5HA 5DQ9A 4P2QD 2X09A 4PS4H 3THMH 3ME0A 3W2DH 4HKXA 4F7PA 1AP2B 1KCKA 5I1EH 5C07B 1U92A 4YHLL 5I6XB 4EQ2A 4RCAA 1HXMA 5JIPA 2V9RA 3QI9A 5EU7C 4PJXA 2VLRE 5F6IB 4L8CA 4YHYB 2EIBA 4FQ1H 5HI5C 2XV6B 4G6JL 5AAWA 2IAMA 5JUEL 1U93A 2DIBA 3S9DB 4M6ML 3OKLB 3VH8B 3L5XH 5FYJD 3UC0H 3SDCD 2C3XA 2GJ6A 4HUXA 4QRPA 3MRHB 3SGDI 3KHOA 2A9MH 4PJXE 2A9NL 3C09C 1G6VK 1JGLL 4UT6H 1GJIA 2Z35B 25C8H 3O2VL 2GJ6E 3SJVD 2NW2B 1AGBB 3GSNH 4GS7C 1BIIA 1KTDB 1XIWA 4LVHB 4NZTH 3ARXA 1JV5B 4MS8D 5CGMA 3VE0A 1HH9B 4ZAKB 5KSBF 3AM8A 5CP3A 4M7LT 1YEFL 3SKOB 3ARFB 2VDNH 3WXWL 2J7LA 4DWHA 5KAQF 1OP3K 3C6SA 2DIAA 3QWOB 3CSPA 1I1AC 1LHZA 1QFHA 3HE7C 1WZKA 3PJSA 4I0KA 3LPGA 4KAQL 2R2HB 3QEHA 1I3GH 3NCEB 4ISVA 3IFNL 1BX2A 2DMKA 5A1AA 5JA9A 3U4BH 4IRJD 3NH7L 3UPCA 1UWGH 1QBAA 5HGAA 3QEQB 4UOW1 1MCJA 4JREC 4Y5VB 3ARSA 5AZ2L 4F7MA 4OM0H 1RIHL 4RAUA 1C08A 2J88H 5TDOB 3LEXA 2DQUH 4XVSH 1TJHH 3I9GL 3CFKB 1U6AL 3D0LA 5CJQH 1MFAL 4JFFB 3T3PF 5LQBL 2GQHA 2RR3A 3L6FA 4HWEL 2AXFA 4IHOA 3S37L 3DRTB 4MZ2A 5K93A 1AR2A 1JHTA 4X7TB 5HHQB 5J6GA 3CCHA 2M2DA 3MFGB 4NQXA 4U1HB 1A9BB 4MJ6B 2VQ1A 1NMBL 1NMAL 3B2VH 4XP6H 1EEZB 1IE5A 2A38A 3CMOL 1G7QB 4PRAA 1A64A 3UZVB 3AVEA 5GGRY 5LBSH 2AAVA 4ONOA 2OTUB 3BGMA 4AH2B 3I3DA 1KLFA 4JHAH 1KPVA 1NGQH 1U3YA 4G6KL 4X6CF 1Q0YL 1AD0A 1UXSA 4PG9A 5CJBA 1KPUA 2FJGB 4ELMF 3MRRB 3ZHKA 3TYGL 3IDGB 1RURH 3H42H 4KY1H 3I3EA 1KUMA 2R4SL 1TTFA 5CKGA 4N8VB 3STLA 3K4AA 1CXFA 5ADPH 2FBJH 2H1PL 1FLRL 2YZ1A 2HN7B 1WT5C 3SGEH 4G5ZH 4XBEL 4HV8A 4CMHB 5D9SB 2H41A 1ZEAL 3U7YL 4NM8H 2KQMA 5J0BA 3HC4L 5KANI 3UTPE 2E7LC 3VD5A 5HYSG 1KG0A 2FJFB 3CFBA 4NNXB 3ARZA 3QIBD 4UMGA 3AREA 1Z0MA 1RV6X 2D03L 5EC1B 3BPCA 3BD4A 5K9QI 1BVKB 5KS9A 2JCCF 3JV6B 5FM8A 4NZRH 4LPCA 2OXGA 5F8RC 1Q9OB 4X0KB 1M1SA 5ICXA 4M7ZC 3KWWB 1QLRA 3HCVA 1OGAA 1DEDA 2EH8H 3KVQA 1CU4L 3P0YH 5C0FB 1KULA 5KS9E 1Z0NA 2O93L 3D18A 2EDLA 1MWAA 4YXKH 4HGKC 4HS6B 1N8ZB 1U2HA 2DWDA 1SM3H 4ZUSB 3CVHH 1MUJA 1FC2D 5IW1B 2Y6SC 3RWCB 2I26N 1OGAE 1JHLL 1UA6L 3T8XA 5IBUB 3FQXA 1BM3H 5T1LA 3RP1A 5ILTH 1OWWA 3HRPA 1GHFH 5JZ7C 3ZDYE 5HBBA 3QYCA 2VDRH 3G5ZB 1S7VB 1Y6NR 5ANMA 2VL5A 4XVJL 1M7XA 4XXCA 1RU9L 4KJYA 3VXSB 5HGHA 4RGND 4AM0B 1J0HA 4V2BA 2Q86A 1CE1H 5JORA 4YEEA 5EOTA 5ANME 3IKKA 2IG2L 4WUUD 4FQQB 4Z7QE 5J9PB 4LAQH 4QXWA 2DQHL 4Y16B 5IBUG 2BRRH 4U7MA 5K9KB 3CAFA 3MBXL 2D9CA 4O2EB 2OL3H 4PY7B 2HP4A 5EUOA 3SKMB 1KN4H 1RUML 3ZT5A 1CLCA 1MLCA 2Y5TA 2MHAB 2ATKA 1QFOA 3PQYD 4HULB 5T3ZL 1A6ZB 4L4VB 4KKAC 2DL2A 1F90H 2IQ9H 2WM0A 1Z9SA 4M48L 4BSVB 3TN0D 2E6QA 4RGMC 1FV1A 3LN5B 1ZTXH 2PXYA 5EUOE 3ZDZE 5E2UH 5IMMB 3VMNA 2OQJB 1YDPA 3ARDB 3DETC 3MREA 3U0TA 2DTML 5IMLA 3LKNA 1T21A 3VWJD 2LVEA 4OUUA 1DQQB 1N64H 1MELA 4GRMB 5GSRB 1F3JA 4JZOB 1KTLA 1MIMH 5C2BL 4P2RE 4MNQB 2EDKA 5JXAL 5H94A 1NLDH 2P5EB 4KKNA 2HLFD 4UQ3A 4ZS7L 2AV1B 5ESAB 4PLJC 5IIEA 2E27L 1UB5A 5IJVA 2BNRD 1JWUA 4NRZA 1NAKL 1GC1C 4URTB 5IKCA 4U6YB 4YUEH 3FT2A 3BXNA 4LHJB 4NWTL 4FZ8L 2Y23A 4OGXL 2P5WA 4YR6A 2BMKA 4CVUA 3EDJA 1CFSA 5MP6H 3ZL4H 3LPWA 1I8IA 5JNYB 2AJUH 4EI5D 5DJCB 1LP9B 4QY8A 4U49A 2CKBH 4K9EC 2P5WE 3CC5B 1ZVHA 3L3DB 5I15H 4NGHH 2QTEA 5DMKB 5I1KH 1U91B 1FNHA 1BQHG 5A2FA 1P1ZB 3H3PL 5IVXB 3GMPB 3DVGA 5LWYL 5GS0C 2IF7A 3AMLA 1AO7B 3Q5OA 1DQML 1OCWL 4QKXB 3U9UB 3B43A 4M02A 2OR7A 2NMSA 2BFVL 2Z92A 2DKSA 1OP5H 1YYMH 1N2RA 1XR9A 3GFUA 2H45A 5K9OA 4NQVB 4YBQC 3SEPA 3O3DA 1QHPA 4W81A 1OF2B 5L6YH 2GUOA 4MXWL 5JOFB 3MGTB 4Z7UB 1JJUA 1YEGL 2YD3A 5GSVA 4LEXL 5TFSL 4EVNB 5HGBB 5KVFL 1R3KB 4WFGE 4MJ5B 3OQ3B 1TQBC 4PJHA 1P4IH 3QWQB 3TVMC 3ISWA 2IPTL 5FYKH 4FXGA 2BHYA 4DN3H 4NP4H 5D6CA 1MCOL 2Y1VA 4S1SL 1MJ8H 1WFUA 1TPXC 1J11A 4YH6A 5E1AA 4PJHE 1N6VA 4L9LB 2RCSH 3UBXI 3BEWA 1SEBA 3C8DA 1JTTA 4XCCH 2P8LA 4HIXH 1VACA 4LKCB 1FPTH 3AUVA 5IB3A 3AS0A 4DFIA 4PGCB 4PJDA 3R8BB 5EOCL 5C92A 3QUZB 1U8IA 2YD5A 4HWZA 1M4KA 3K80A 2C3VA 3TO4A 5F7UA 1JPGB 3O4LB 3O6MH 2X1QA 1HYSC 1K8DB 1NMCB 1O0VA 3IS0X 4KJQC 3K8LA 4P49A 4CGTA 2XI9A 5DC0A 3U0WH 4M1GH 1OLLA 4UOJA 1B4JL 5C0ND 1NANH 4KTEL 5J11B 1XF1A 2EDTA 4JM2C 3WO4B 3PGFH 3CUPA 5T1KA 3ZKXB 1KJ2L 5CHNB 2VDLH 3CFEA 4CADA 4OLWH 1IGCL 2DQTH 4B53A 4U6VH 3WDHA 1MRFH 5B39A 3B6SB 4P2QA 4FFWC 5FO8B 5DS8B 3G9AB 3L7EB 4UBDD 3U4EB 3LS5H 3O4OB 2K9UA 4GQPH 5LG1A 3ZTJG 3JXAA 3JWOC 5HHXL 3LEYH 2GSIB 5EU3A 4P2OC 4JFFD 5KSBE 1DN0A 1VADB 4KV5F 4LHQB 4P2QE 4YE4H 2IBZY 3SDCA 3BH9B 3V7AE 3CXHJ 3IF1A 4GW1A 4ZDHB 1HHGB 3RTQC 4MGXA 4JO1H 4AMKH 3MLWL 4NCC1 4HCRA 2NY2C 1VFBA 3S5LG 5IOPA 1N7ML 4OCYH 5E6ID 1HHIA 4PRIB 2R2EB 3D3VD 1N4XH 5FYJE 3ARPA 2DQFB 4WW2B 4H20L 3SJVA 4ZOAA 4B7IA 5IG7A 4BSJA 4PRPB 4UTAL 3EJZD 1DBBH 1KEGH 3BQUC 4ZPVB 2DN7A 1KCRH 5D7JD 5FDWA 4Q7DA 4HZAA 4RWHA 3C9NA 4I0PD 2AJYH 3VXPB 35C8L 2CSPA 4A6YL 4Y89A 1CXLA 3KPQB 1XZ0B 1PW3A 3HZMB 2BY3A 2EYSA 2O5ZL 2Q8AL 3E6HB 5KN5A 3V5DA 4FMKA 2H6PA 3X17A 3LKPB 4GW4A 3A6CL 4XTRC 5F89B 1PKQB 2VR9A 1BMGA 1J0IA 4YDKH 1F2XK 4U1KA 5DJXB 4CN6A 3B9EA 4IRJA 2EE3A 1KBGL 4LSVH 1T2QH 1UM4H 2XTLA 4R0LA 4LIQE 2AK4B 3DSFL 4Y5YC 5D93C 1FVDA 5IW3A 3S96A 1YUHB 4UU9B 3VXQB 1QKZL 1HKLL 1CICC 2LFGA 1EXUA 4AEFA 3NCJH 3TT1L 1FRGL 2DF3A 4DK3A 1V05A 3CX5J 4NBZB 5D4QA 1C5BL 4M9OA 3ZT7A 4ELME 2EO1A 4XCFH 1CL7I 2DLTA 4MQSB 2Q6WA 2BY1A 3MROA 3WFCH 2FX7H 2O5XL 4NOFA 2ZOLA 4NKMB 1ZXQA 4O02H 4NKDB 5BOPA 1JTOA 5DHXB 3WHXA 2DAVA 4EDWH 3EJYC 4WUKH 3O2DA 4OKVB 4KK8D 4N0YL 3V8OA 2JCCA 1BVZA 4U6HB 4TTDD 5CD5D 3PABB 2D7QA 3MRQB 2CUMA 1I1YA 3DSNA 4OJFH 3B9DA 3HZKA 2YEZA 3FB5A 4X4XB 3CLFH 4TVPH 3VDCA 3N85L 4PB0H 1IGIL 4QRSA 2ATPB 3P30L 2JCCE 1LEIB 5FF6B 3HMWL 2B4CL 1F4YH 3RIFK 3T3ME 3EYOB 3ALWA 5EWIL 5A2KH 1XCQA 5E8PA 3DUSB 4NO5B 1A7BA 3C2AL 4Y16D 1A1MA 5GS1B 3FB6B 2FATL 4ODXB 1ED3A 1D7FA 3QZWG 4I48B 5DLMH 5FYLL 5F9AC 4PGBA 4Z7OF 5E08H 3VRIA 3WKMH 2CO6B 3QIBA 2YN5A 5F6HI 1WVZA 4O5LL 4MD4B 5HHOB 4LKXB 2MPAH 4L4VD 2NXZC 1CD1B 1U3JA 4BQCA 4PLKD 4M4RA 1I85C 3EKCA 1JI1A 1I7RA 4XPHH 4U1GB 4K8RD 4NC0B 3ZYZA 2QADB 5HI4D 1BWMA 1SMAA 1JUFB 1U95B 4G9DA 3CGTA 4LVEA 3TEUA 5C6TH 2QR0A 2AW2A 4E0RB 1AKJB 2HH0L 1N0XH 4LK4A 1FNLA 3IAQA 2P5ED 5IF0B 4JB9H 1I7TA 1DUZA 1H15A 3EO0A 2AQ1A 1NBYA 3W0WD 5KVEH 4ORGA 5EU5B 2FX8L 5EO9A 1ZKAA 3MA7A 1P5UA 2CGRH 3OJMB 3DTXB 2YMXL 4L5FH 3MBEB 2FHBA 5MENB 2W0LA 1CDIA 1HEZB 3P11H 1NC2B 3ULUC 4U0RB 5ICZB 3KHQA 2BP3A 4XNMA 4PJEB 4DCQA 3QQ9C 5C0RL 5DD5H 2Y4SA 1RIUH 5CJ5A 4WUUA 4D0CB 4H5SB 5T1MB 2DQEH 5E94B 3CXHK 4RGNE 5FA3A 2ZUYA 1ORSA 3MPCA 3U36A 1FGVL 4P46C 1ACYH 1AO7D 4YFEA 3QAZC 5D1QC 3QG6A 3DUUA 4HH8A 4GRLB 4Y1AD 1G9EA 5ESVA 4L8BB 3HUJA 5K9JL 1S78C 3LS4L 3PQYA 5JXED 1T4KA 1YQVL 1MVUA 4YHNA 4JFOA 2GY5A 2HVJA 4KKLD 4NNPL 2XICA 3TN0A 5GISL 3K1KC 2BSRA 1KYOK 1QRNE 1TZHB 1T20B 3MLYH 3LSOB 3HUJE 1L4IA 3PQYE 3QBTB 3IJYB 3VWJA 4PRNA 5GGSA 1NCCH 4R97C 5KSVB 2FO4A 1CLYH 5FUCC 1LP9F 5FEBA 2GITB 1HSBB 5HI3C 2JF1A 2PO6B 2DDQL 1G6RA 2NY5C 5C0JA 3CDGB 1NAML 4BKLA 1G7LA 3AC0A 3SDYL 1YEJL 1TITA 5IVXF 2BNRA 3JTTB 3WN5A 3WFZA 3HNVL 5ACZA 3BZDA 2YD1A 5BW7A 4GAGL 3WIHH 2CLVB 5IWLA 4TRPL 4LBEA 4LRNL 4XCYB 4PJCB 3WHE1 5I66A 3CVIH 4XH2A 3GSOA 1T0PB 4F7CB 4AG4H 5SX4I 4LCIL 4KZEL 4EXPX 2BNRE 2IFFL 2VZUA 1BHGA 1IGFL 3HMXA 4WGVB 4J1UA 4EI5A 1SJHB 4P57A 3LKQB 4XRCA 5IW6B 2CIIB 3TIEA 2B2XH 3VMPA 1G7PA 4PUBH 4Z7UF 3RDTA 4MQTB 1IT9H 2VMFA 1O7SA 3BUYB 3CZFA 4JCLA 3D5OF 1JCKA 3BZFA 3BD3A 1FL6B 4IMLB 3HAEB 1IC4L 1PKOA 3C5ZB 3U1SH 3WEXA 3INUH 2NY0D 1DUYA 4GXVH 4LF3B 3WE6A 1Q9WA 2PTUA 5IFJA 1MEXH 5GGTH 1KT2A 4LVOC 1MQKL 3EW3B 1IAOB 4KDWA 3UTQB 4S0SD 2NR6C 3FCTA 3S4SG 4QXTB 5IMOA 4JE4B 4AEHH 5C0EA 5GS0H 4NM4H 4Y5XB 1AP2A 2RQ8A 3RI5K 4HS3B 3GDBA 4M7JH 4RBPH 1P2CB 1JZ6A 12E8H 3WJLA 5H37H 3QIWB 3MLVL 3OKLA 1X7QA 1NFKA 1G9MC 5E5MB 3EYUL 3B4NA 2C3WA 1FCCA 4U1NA 1LEKB 2Q1EA 3AY4A 1S5IH 3QNYB 3RY4A 4LDEB 3VXMB 5GJSL 4ODVL 4KMTL 1OVZA 5FCUL 4K3JL 3RU8H 4APQC 2QQKL 1AFVL 4XX1G 1JF6A 2Y07H 2HWZL 3OR6B 4GBXC 4QWWC 2ZCLH 4PRPD 3KPOA 4LRIA 1KTDA 4X5WB 1KNOA 4LVNC 4EBQL 4UUJA 4FNLL 5L2KB 3BP6A 1ZVSB 1IEHA 4Q9QH 1NGYB 1F4XL 3MRLB 4OM1L 2G2RB 3H7BA 5GGQL 3MLUH 1D5BB 1I1FA 3KPSD 2E7MA 2VQUA 5KSAD 2ARJQ 4N0CC 3BDYH 4CAGA 4JFHD 4AZ8A 1FNEB 1G7IB 4Z6AT 3QG7L 4OLVL 2WBJC 3ULVL 4KV5E 3VI3F 1KEML 3O41B 1OARL 1F3DJ 4G8EB 2V2WA 3B9KB 2O5YL 3MUY1 3CK0H 1HZHL 4HF5L 4WY7H 1NUDA 1MIEH 2NY3B 1X5XA 2AK4D 4HDIB 4P5MB 4WW2F 4CKVX 2C4XA 3H0TA 3MODL 3F6LA 2X1XR 3RKPA 3X11A 1P4LB 2JE8A 1FZMA 3CFKA 1BD2D 5KVDH 4JFFA 4L8SC 2I24N 4KKBC 2Z8VC 1A22B 1NCDH 4OD1H 2VLMD 3DRTA 4HXBH 3PL6D 4X7TA 5HHQA 4QT5A 4YZFF 2UYLB 2F54B 1A9BA 3SN6N 3UXFA 4MJ6A 1IL1A 2UWEB 4OLXL 4R2GC 1WIUA 5L7XH 4JFFE 5DJYB 2AP2A 3KPMB 5E6IA 3D3VA 3VU2A 1QFWM 4QHNB 5FUZL 4Q9RL 4KVNL 1UCBL 4KHXH 1CFVH 3HZVB 1DBKL 1T89C 4MYWB 3GI9H 5D7KD 4AH2A 4MCYB 5T5FL 4DW2L 4LNRB 4UIKL 1XT5A 3DECA 5D7JA 5DFWH 1FSKB 5HYSA 2DMBA 3D3VE 4I0PA 3PGCB 5ELIA 1DQJA 3SE8H 3VGAB 3SO5A 2FJGA 3RJQB 4QYOB 5FAAA 5C0GA 3MRRA 1KSRA 5BV7L 3OR7B 3OL2A 4OFDA 4NN5B 3QDGB 3SDAC 1A6AB 3BISA 3O0RH 4G7YH 4DGIH 3M8OH 5C6WH 4X4YB 4PBXA 4RA0C 2A9ML 1MY7A 3O9WC 4U6TA 1IQWL 5DZNA 3MLRL 2H9GA 3ARBC 5CEXB 2FJFA 1ZHLB 1OAUH 4NNXA 5EC1A 1I7UB 3SO3C 4NQSB 4MA8L 1AY1H 5HHOD 1XAUA 2OXHA 3NCYP 5BS0B 3BKJL 2VDML 1BZ9A 1BEYL 4ZSOB 2F9BT 1Q9OA 3JBG7 3SKNB 5BVPL 4JKPH 4OLYL 3UDWC 3MMEB 1J1PL 3KWWA 1H3TA 4JR9L 2X9YA 4LFHD 3PWVB 5JDSA 3OKNA 2JJWA 3L5WB 2XQYG 2QADD 4GMTH 5C8JB 2JB5L 3CMGA 3H6JA 4POZD 4N8PA 1AKJD 4ZUSA 4RA3A 1I3GL 4JO3L 1TQCB 5IW1A 3RWCA 3GSXA 3LH2H 1DE4B 5D7LD 4GLRI 4AEIH 3EFFB 2YK1L 3TH3T 1A6WL 3SKJH 3C09B 1A4JB 1NCWL 1BAFH 3G5ZA 3BYYA 1NCBH 4GS7B 1ZLUK 4FQIH 4OZ4B 4YEFA 4Z7OE 4BFIB 5C0DB 3CX2A 5MEND 1NGPL 2VXSH 4OUOA 4X99A 1OW0A 3O6LH 7CGTA 3I50H 2HVKA 2WP3O 4PJAA 1CR9H 4UDUB 1FAKT 4KH2A 1FYTD 4FQQA 4FQLH 3VXOA 3ILPB 1PY9A 1ZLVH 2APVA 3UAJC 4Z5RB 1I1AB 3QQ4B 1FP5A 3HE7B 3QCTL 4S1DD 3OXRA 1KCUH 3MA9L 1SJXA 4PY7A 3EOBB 4PJAE 3IYLW 2L7UA 3FONB 3FL7A 5EORL 3LIZL 3SKMA 5LBSL 4E41B 2FX9L 4GRLD 4NKOB 4F15B 3AREC 2MHAA 2ADIB 2DI9A 2ITCB 4XZUB 5HHVH 4KKCC 4XC3L 4D9LL 1A6ZA 1QZ1A 4L4VA 4BSVA 2MWCA 4OD2B 4JREB 4KC3B 2VISB 2BC4B 3LN5A 5I30H 4Z18A 3OWEA 3QDMB 2XZCL 2VL4A 1FIEA 5FO7B 1MF2L 3HI1A 4X5XB 1DQQA 4L4VE 3MCKB 3U6RB 1VFAB 4GRMA 3OKKA 2QQLL 2ADFL 3PDDA 4PJEF 5GSRA 2W9EL 5ITBH 3GSUA 4JZOA 5FGBC 4XWGL 1YN7B 1G0DA 3ZKQD 4G5ZL 4XPBL 1W0WA 2P5EA 5SWQB 4JGMA 2QEJA 5BZWA 1UKQA 2EEDA 1FL5A 5EOCJ 1M7IB 3X12A 3W0WA 1J1XH 2APBA 1VSCA 1L7TH 2JJSA 3SGDH 1RAMA 1F13A 3P73A 3PHQB 2P5EE 4CN4A 1DR9A 3CFDB 3UCRA 4P3DB 3UPRA 4N0YH 3P40A 3W0WE 3H3KA 3C08H 4BH7A 2A0LC 1MLBA 5JNYA 5DJCA 3O6KL 1GGUA 2NTFB 3P4OA 4E42B 3CC5A 5FYJL 3WNPA 4CDGC 1S7XB 1U91A 2WWKO 5C0AB 1P1ZA 4P3WA 4LLYB 4F58L 5IVXA 3TJHD 3CVHL 3O3EB 1NKOA 1C12A 4OZFH 2OI9C 2XY1A 3C5ZD 1FC1A 1AO7A 4AEEA 1RQ5A 1BM3L 2BXYA 1MVFA 3QULB 4Y1AA 1QRKA 2FSEA 2KBGA 3MJGX 15C8H 4I5BB 3U9UA 1AQKH 5JXEA 2DL9A 2E6JA 5TPWH 3JVGC 4W4OA 1SMOA 4PJFB 5IVXE 1RUQH 2CMRH 4NQVA 5CEZD 2Q7YB 5EO1B 2PXYC 1AO7E 4ODSH 1PLGL 4PJCF 4Y1AE 4LPXA 2CJUH 1IGML 1RZFL 5JOFA 1DBAH 4Z7UA 1QQDB 4HWNA 2NYYC 4LP4A 2OTPA 1IILE 1G9NC 2NX5D 5HGBA 4RAHA 3N1MC 4NO3A 1R3KA 3FMGL 4X9BA 2EE6A 3RVWC 3QIWD 2AQ3A 4NKIL 5DVLA 3BRFA 4Z7UE 4LIQL 4ZO9A 4U2ZA 2OJZL 2OL3L 4KJPD 4IOIB 1VPOH 3FO2A 3ILQC 4KXZI 3D69B 2A73B 1IC5L 2ED9A 2XZQH 3L3JA 2QSVA 2BCKB 3QDAA 1JFQH 3T77B 4L9LA 1RJLA 4M5ZL 4PJGB 3IJSA 2BVYA 1ADQA 5TF1H 3SHSA 1EHLH 1AHWC 1YECL 4NO2B 4N1HB 4UNUA 1ZTXL 1PG7L 4ZPTA 3FAXA 4LKCA 3OZ9H 2YUXA 3WL9B 5TE4H 4GKSB 3ZE0F 1XGYH 5I1AB 1U8NB 4OLEA 2HTLD 1ZT1A 3KNBB 5JA8B 4RIRB 1KCSL 2F19L 4DN4H 3B8SA 3GUTB 1JPGA 4D3CH 1T7VA 4NYLB 1P7HL 2OR9L 1MIML 1K8DA 1NLDL 4ODUB 1BZ7B 3KYNB 4Y7MA 3QJHA 2PR4L 4L8DB 1UKTA 2ZG2A 3B9KD 4P9MH 3O4LE 5CHNA 3S5LA 3C6LB 3IXAB 3Q6FB 4XI5D 1Q1JL 1T0MB 4X80H 1F97A 2ADJB 1XFPA 5GS2H 5LGJA 4LPTA 3B6SA 2NY3D 1LO3H 2NLJB 2YPVH 1NGWB 3IRZA 5DS8A 4LLQB 3S36L 4Z0BL 4XBGA 4XMPH 3TM6A 4K2UH 2AJUL 3RUGB 2DBLL 4O2FB 3KLHC 4OQTA 3SE4C 4RSVA 3WMSA 1FLTX 1VADA 3PHOA 2WANA 3RGVB 4EOWL 4O4YH 5DUBB 5GJTH 1NGXB 1P4BH 4WHCA 4X83A 5C70A 2F54D 5GRVL 4OI7A 2PN5A 4NPYB 5MEOB 5IEHB 3QPXH 1VERA 4MJID 3RVUC 5I19H 3G5VB 3VI3E 5H35A 4OTXL 2DQFA 3O2WL 4PRPA 2WUCH 2XZZA 5C9JB 2NY1B 5C7XH 4PP1D 3LHPH 2OM5A 4OCRL 1V3MA 4DGYH 5CINL 4PRIE 1Y0LA 4JM4H 2BVOB 4HLJA 4MXQC 1YEIH 4PJ8C 3RIFF 5ADOL 1MFCL 4UAOB 3VXPA 1K3IA 4PRPE 4XNUL 1T1YB 4PJ9C 3KPSA 3T1FB 5KSAA 2J8UB 2VE6B 3KPQA 3HZMA 4TSAH 4NNYA 3FB8B 3E6HA 5DXWA 3GI8L 2VDOH 3GMLB 4QTIH 3QDGD 1JNLL 4YJZL 1PKQA 4UILL 5EUKB 3U48A 3WFDH 5EA0L 3CDFA 2R15A 3KPSE 4YZFE 5DJXA 4R96B 3I6KA 3EDEA 2UWEF 4JFHE 3UPAA 1MCCA 2RCSL 3T09A 2EDYA 1PKQE 3GIVB 2AK4A 5KG9A 3EAKA 3WDIA 4JKWA 2GK2A 4UU9A 4RRPG 3VXQA 3KYKH 4AJ0A 5GIRB 3LKOA 1BD2A 5FUOH 2DD8L 1M71A 3VFTA 3OPZL 2AK4E 2R0ZL 2PTTB 3PL6A 3O6FC 3DV6A 5FYJU 5DHVH 1EFQA 1OOAA 5HI5D 1TQBB 4HUNB 3OJDB 4JO2H 1CT8B 1FNGB 4JFYB 5F71A 3TVMB 4Z78B 3UJTL 3VFRA 1QSZA 2VLME 4NKDA 3KYMB 2VN4A 4ZS6C 2BSED 1DLFH 1W0YT 3LRHA 4OLWL 1I9JH 2VZOA 3RX7A 5H37G 4OKVA 1LO2H 3QZWA 5KTEL 3U79A 3UTZB 4U6HA 3AMKA 3MRQA 4WHTB 4X9HA 3TIDB 3VWKC 1WSST 3HI6H 4LGRB 1HHHB 1C7SA 3Q48A 4V1DB 2WLZA 5JQ6L 5D7KE 1ZS8B 1QLFB 2J3SA 2X4OA 3WSQL 4WDIB 2ATPA 1KLUB 5CKAA 5HDOA 1FL3A 3EO9H 2Z93A 3DX9B 3QCUH 3NFPB 1RFDL 1BIHA 4FP8L 1W72H 4WO4C 2UUDK 4B0MM 4NO5A 1G6RL 3KPPA 4XP9L 1UZ6E 3QRGL 1Z5LB 2RIKA 1I1AD 1FBIH 2D7OA 3WXVL 1ZT7B 3HE7D 3ARYA 4JM2B 2GY7B 4I48A 4JO4H 3WS3B 3O11B 2RBLA 2GJJA 2NY4B 1PG7W 1H3XA 3A6BL 4QLRA 1DBMH 3DX6A 4YXLL 2EDRA 1PBYA 1YEHH 2Y36H 3QPQC 4MD4A 5HHOA 3FT4B 1ES0A 3IDXH 1KFAH 4JZNB 5D5MA 3HMXL 2AJYL 2X41A 1MFNA 1KENL 4IMKA 5HHMB 5T3XD 3QDMD 1Q94A 1CXHA 3F58L 4YBHA 1EGJL 5HHOE 3V79C 1U95A 3MXVH 4P2OB 3RQ3A 1INEH 4LLDB 5D5ME 1X6NA 1AKJA 2C1OB 1VEMA 1CXKA 3LRGA 4FXKB 4B7LA 5IF0A 3VFWB 5D7LA 2FGZA 2EDEA 4ZTOL 2AKRB 5HHNB 1CK0H 1CE6B 3IFPA 4HQQL 5CUSH 2ITDB 3MJ9H 4PJBF 1XF3B 4P23C 4OT1H 4L3CB 3X3FL 3DTXA 5D7LE 3KJ6H 3N50A 4S1QH 3BX7C 2DQGL 5MENA 5DF0A 2GT9B 1HEZA 1NC4B 1KIUA 2DQIH 3RAJH 4Y8DC 3FFDB 1E6JH 4PJEA 4R6UA 4Y4FA 3BKCH 4TN9A 5B3NA 2MSPA 1K2DB 1FYTA 2Z0BA 5CFHA 4H5SA 2D2OA 5MENE 1JGDB 3Q1SH 3RWDB 2OK0L 5C0IA 4UTBH 5C0AD 4G8IA 1YEEL 4HUMB 3OKOB 4XVTH 2BY2A 4PJEE 3VW3L 3GMMA 3TBYB 3MLSH 1ZSDB 2EE2A 4XPTH 2OR8A 4JQXA 4L8BA 1D5ZB 5F1KC 3CFJB 2ZUWA 3RI5F 5CBAB 4J4PC 3QXWA 5F7LB 4OJFL 2NXYC 3PWPB 4Y5YB 4YFLI 5DFVC 3HLAB 3MLXH 3PGDB 5D93B 1CBVH 3SDDC 1LK3H 1DDHB 4KDTA 1T20A 4U7SA 2FJHB 1J0JA 1A3QA 1CICB 3MTRA 5I17B 1J8HB 5KSVA 2OBGA 4YHKH 3S34H 1HSBA 2AV7B 1OM3H 3TBSB 5J13C 4FOMA 1KELL 4UT7H 3GGWA 4RWYH 1VB9A 3CDGA 4X9FA 4UV4L 4HKJA 3NA4A 4K07A 5IM7A 2HFFB 1KB5H 1TJIH 2Y6SD 2GFBA 3BVNA 5I2IB 2AEPL 2A6IB 3K2MC 4L3ED 4XBPB 5JZ7D 5FGCB 5E2VH 4XP1L 2MPAL 3L3GB 1S9XA 4F7CA 5LJYH 3P9MB 4PJFF 1NFDB 3RWEA 1BLNB 3LKQA 4K94H 4N90D 3HC3L 5IW6A 1XF5A 5E00B 1X4XA 2F53B 2DWEB 4PGEA 1WFTA 4NZJA 3O8XB 1FFOA 3AU1B 1RUAL 2YD4A 2CPCA 4RQQB 1HH6B 1HQ4B 3C5ZA 5EZOH 4DGVL 4HIHB 1UGNA 3BFOA 3FHAA 4I2XA 3RGHA 4OIAA 1MHCA 1EUUA 5KVEL 2XZAL 5I74B 4QXGH 1URLA 1JPFB 5BRZB 1IAOA 3UTQA 1CF8L 1F11B 3BKMH 5LVEA 4QXTA 2HRPH 4PJGF 2X5PA 3MR9B 3DV4B 2EH7L 4QGTA 4U3HA 4G7VL 4Y5XA 1DFBH 4KKAD 3WJJA 4S1RH 5CBEA 5JHDB 4HS3A 3PV7A 3G04B 5JDJA 2NX5A 3VD9A 5CEZE 1P2CA 3DETD 5BO1H 2ILLA 1JGUH 4M6NH 5C3TA 1R5VB 1GGCL 3V5HB 3ZE0E 4OB5H 5K59F 3MZGB 1WBXA 1VENA 4MB4A 3TH4T 2IPKA 2B1HL 1HIMH 2NX5E 1LEKA 1JPTL 3QNYA 1CL7H 1HN1A 3L5HA 4KROC 4B41A 1R5IB 4HFWB 3QFDB 2H8PA 4QHKI 4PLJD 4BQBA 2FZ3B 4U1JB 3BIAX 1YPZB 3IU4H 1T7YA 3MYJB 4HC1A 2DQJL 3DMMC 4R7DA 1NGYA 2DI8A 4DAGL 1MJUH 2G2RA 3V0WH 1QHOA 1EVUA 1D6EA 1KXTB 3EIFA 1MCSA 4NUJB 5CZXC 3RDTC 1D5BA 4YBLC 3RUGF 3DO7B 1Y6KR 1FNEA 1G7IA 3RRQA 5L2KE 4X8XA 1DANT 4TSBL 4QHKJ 3RKDC 2WQRA 5DK2B 1LEGB 5I18H 1U3HC 4G8EA 3DRQB 3KXFA 1ETZB 3B9KA 2J2ZA 4P46B 1MNUL 1M6OA 5GS0D 3QUKA 3QAZB 3PDOB 5D1QB 3TYFA 1OAYL 2SEBA 3CJJA 3WKNA 4OCXH 2V5RA 4DOHB 3RZWA 3VG0L 4HDIA 4AG4L 1H3GA 3BPNB 1N5AB 3H7LA 4YBQD 4HJ0C 3KS0J 5EZJB 3LD8C 1P4LA 3MACL 4KTDH 1J8KA 2B2XL 4IBLT 5D2NB 1AIFB 1M05A 4NQCB 3PP3H 2D0GA 4LARL 3UTOA 3HNTH 1ZLSL 1YY9C 4R97B 5DTFB 4K7PL 2J8UF 4I3RH 2UZIL 2UYLA 2F54A 5FHBL 4LCYA 3QFJB 1ZWIA 4P3CL 5DJYA 1YEDA 3DO3A 4MJIA 5DRXB 3TVMD 1MHPL 4OFVA 5IVOA 5GGTL 2QLVB 4PREB 5DD3H 3HZVA 2DQCL 1F4HA 1Q38A 4I3GA 5HDQH 1SJEA 4QOKB 4WV1C 2F54E 4IRSC 4LSDA 4LNRA 3VD4A 1NBVH 3PWNB 5CJOL 4AEHL 5GGRB 4NM4L 4ODWA 5EU6B 5HJ3A 3L9RB 2YKLL 1HCFX 3LY6A 5D8JL 3DARA 4V1DD 4YHLH 2JIXB 1K4DB 3GK8L 5D7IB 5DO2C 3F12A 1K6QL 1IZKA 1XF2B 3S88L 4UNVA 2Q76B 4G6JH 1CFNA 1G7MA 3U46B 5JUEH 1TCRB 4M6MH 4YLQT 5F7DB 4EN3B 3BZEB 4D0DB 2WBWB 1A6AA 5AYQA 1T83C 2ORBL 4POYA 5IJKC 1HYSD 1SHMA 1T3FB 4KJQD 4MDIB 3RWJA 2A9NH 2XN9B 4JM2D 2VERN 3QDGE 1QSFB 5DEGB 3O2VH 1WWBX 4M8QB 1R3HB 2MFNA 4LVOB 3VFPB 1I7UA 4K71C 1MAKA 1J9CT 5K33A 5C0CD 3I75A 4ZNEA 5DQJA 3SKNA 2P47B 4FFWD 5HHMD 4NJ9H 3NPSB 3MMEA 4LSRH 2KZ1B 4PV9B 2X9WA 1YEFH 2ESVB 3WXWH 1CD9B 1AH1A 3E3QE 3BDYL 3IS1X 5C8JA 3TNMB 1A6VL 4P2OD 5KANG 4ZNEE 2XRAL 3DYOA 5IV2A 4KQ3L 5E6ZA 4CVZA 3FQWA 4KAQH 1JZ4A 3RTQD 3DPBA 3BUTA 5IUSA 1DE4A 1OB1B 4OF6A 3IFNH 4HBQA 5K9QG 3CK0L 2NY2D 5EU7E 1MH5B 1A4JA 3NH7H 4JM2F 5AG8A 3KDMB 4DZ8B 2X4QB 4Z7WB 4GBXB 3VFOB 5DRWB 4OZ4A 5AZ2H 4BFIA 5C0DA 1QSED 1RIHH 3BQUD 4KK5C 1NC4D 5F1IB 3J8F7 5KVDL 3I9GH 1U6AH 2P8MB 1MFAH 5LQBH 5SX4H 3MRCA 4HXBL 4HWEH 3TT3L 4ODHL 4QCIB 3UEZA 4FRWA 2ERJC 1HKFA 4PPTA 4RMRA 4YIQB 5E99L 1I1AA 3OG4B 3QQ4A 3HE7A 1BF2A 4GG8B 4M6OL 1NMBH 4XTRD 1NMAH 3LQAC 3HC0B 3CMOH 4QTHA 5E2TL 4FQ2L 3ZO0A 2VKXA 2ADIA 3D25B 5JW5B 1ADQL 2B4CC 3ZTNL 4HKBB 3HI5L 5JHLL 4G6KH 3ZHLA 2VISA 2BC4A 1SEQL 3PWPD 4G43B 3SE8L 3T0EC 2Z91A 3R0NA 2BSSB 1Q0YH 1U8PB 5KVGL 3HTLX 3QDMA 1GH7A 1MCBA 1V7ML 1MFDH 3GRWA 3LV3A 2VDKL 3TYGH 1CICD 2E9JA 4PJXB 4JY4B 4L8CB 4X5XA 4F80A 2R4SH 3MCKA 3U6RA 4L8SB 2IAMB 1J8HD 1FDLL 1U93B 4HIJB 4GQ9L 4JN2B 5IQ7L 1LMKA 2GJ6B 2H1PH 4HUXB 1FLRH 3VD3A 3M8OL 4QRPB 5T3XE 3QDME 2CD0A 5SWQA 3T0AA 4XBEH 1QR1A 3MV01 4WHYG 3MX0A 4HUWA 3FT3B 4R2GB 3U7YH 5BVJB 3HC4H 1BFSA 1L9NA 2B7DT 3SKUD 4PFEA 2HFGL 2YR3A 3U83A 1BIIB 4HWBA 1J0ZA 3R4DA 1XIWB 3EJYD 4P3DA 2XKSA 4KQ4L 3GSRB 3E0GA 4OQTL 1WCQA 4DKEH 3RY6C 5FOBB 1X5KA 3C6SB 3C5SB 4E42A 4M00A 1CI5A 2XACC 2VXTH 1S7XA 2AK1L 2OX5A 5C0AA 1Q72L 5A3IC 4LLYA 3L3KA 4FQPA 1LVEA 4UV7L 3NABL 3VMOA 1BWWA 3SDAB 1YMMA 1WT5A 5I16B 4ISVB 4HJJL 4HSQA 1JHLH 1UA6H 4WI6A 3QULA 3SKJL 4I5BA 1I8MB 4X7SL 1J88A 1QR4A 4O00A 5C0AE 4OGZA 4HAGA 2W65A 4H25B 1NUFA 2E7LA 4MNGA 2GW5A 3ARBB 1QVOA 3ARGC 2Q7YA 1OAKL 5EO1A 4FQIL 4XVJH 1DSFL 4F7MB 1RU9H 3SO3B 4RAUB 3FN0L 3V4VL 3LEXB 1DLHA 2NXZD 3QHFL 3WYRA 2I5YL 5JHDD 1NFDF 2HT3C 3NCBB 2J5LC 4MA3B 3NGBC 4MNGE 1CR9L 2AXFB 4WTXA 4IHOB 2IG2H 5I9QC 2ZUVA 4WGWB 4Y4KC 3MLPA 1N59A 5DGQA 5J6GB 1DQDL 2ZUXA 4PV8A 1WICA 2DQHH 3N1GC 4NIKB 1W0VA 1T1XB 2CLRA 2W9DL 3MBXH 4IOIA 3V4UL 3LN9A 4X98A 1RUMH 2BCKA 3T77A 1HHJB 4L3EA 3BGMB 4HLZH 3WNLA 4O9HL 5T3ZH 3OGCA 2ZUQC 4OF7A 1CDBA 4NO2A 4M48H 3DIFB 2EKJA 1A02N 3PP4L 1AD0B 1UXSB 4RAVB 1KPUB 1RJYA 3WL9A 4L3EE 5EZLB 1MCLA 4PJGE 3ULUD 2ZJSL 2DTMH 4RIRA 2PF6A 3STLB 1U8QA 3QQ9D 2HTKC 5CMAA 5FGSA 1RUKL 4ODUA 4N90E 5C2BH 4XNXL 2Q7NA 1AXTL 5JXAH 3QO1A 3KYNA 3UBXG 4L8DA 4Y19D 4KUZL 3BPOC 5HDLA 4ZS7H 2E27H 3ZKNC 4P46D 1NAKH 5J1AA 3Q6FA 5D1QD 1T0MA 3CFBB 3HB3C 4ZUWB 3AREB 2HFEB 3SQBA 5I1IL 3BPCB 4NWTH 4FZ8H 4OGXH 1S78D 3Q5YA 2BZDA 5IQ9B 2NLJA 3IDNB 1FNSL 1YPZF 4LLQA 4JQVC 4QNPE 3W9EB 1M7DB 2IAND 1QLRB 1C5CH 2X4NB 3HCVB 3BO8B 1ZLWH 3JWDL 4NQCD 4PYHA 3V6OC 3D18B 1MWAB 1OTSC 2NNAA 1FN4A 1QPXA 3BPLC 3V7MA 2EO9A 3H3PH 3HZYB 2X70A 5HI3D 1QNZH 3QWRA 5HY9B 2YD2A 4NPYA 5LWYH 3QFJD 3E2HB 5MEOA 1MCDA 4HGWB 2COQA 4OKDA 5T1LB 1AQKL 5HTSA 2R39A 1DQMH 1OCWH 4ZFOA 2BFVH 3QXDB 3T08A 4QOKD 4GLRH 5C9JA 4F37K 1KCVL 5HGHB 4U31A 5EU6D 2BVOA 4MXWH 2FB4L 3SE3C 1I1RA 2Q86B 1W8NA 5JORB 4XT1C 4RRPA 1T1YA 5EOTB 2EXWC 1YEGH 1Z9OA 2J8UA 5TFSH 4OFPA 5ISZB 5KVFH 3P3YA 4FG6C 4PB9L 2Z31C 3GMLA 4UIMB 5EZIL 2R4RL 1KF9B 4ZMAT 5F3BA 4HAFA 1MRCL 5GS2D 2IPTH 2P24B 2OI9B 2J8UE 3P0GB 3IDYB 1FJ1A 1MCOH 5EUOB 4S1SH 1EHNA 1UC6A 1ZMYA 1QSFD 2ATKB 3UJJL 3C5JB 4JKKA 3B3IA 2ZZUT 1RMFL 1ITBB 2YA0A 4D2NA 2NR6D 3FO0L 1FV1B 2VZ3A 2PXYB 3FOLB 1WGOA 3C8HA 4U2YA 3ULVC 5ITFB 1WIPA 1NL0L 1YDPB 3DHMA 5GIRA 1UH3A 5ICYB 3SOBH 1XGYL 3MREB 3U0TB 5IMLB 3OAYK 5EOCH 4LGSB 1RD6A 1Z3GL 3LKNB 4WU5B 2EKSB 2PTTA 5F7MC 2BSTB 5D7IF 2VR5A 2OMBA 3F5WB 1F2QA 3F8UB 5H94B 3OJDA 2PETA 5TJWK 1CT8A 1B4JH 1FNGA 3IDMA 4JFYA 4KTEH 3TVMA 4Z78A 2AXGB 4HUVA 4KFZC 1G0YR 4P9ML 1UB5B 2V9TA 1JWUB 4NRZB 1KJ2H 2GYSA 5IKCB 1J18A 3FT2B 1DVFA 3BXNB 3VDAA 2A1WL 4APQD 1IGCH 3UTZA 2GTZB 1AQDB 3IDJB 4GBXD 4PRBA 5DQDH 3UROR 4QWWD 4YR6B 4DKFL 5JW4Q 1NCUA 4LPYA 4XPFH 1AHWB 4HK3N 1HHHA 2R29L 2V5TA 1I8IB 2DYPD 1I75A 4V1DA 4LQFL 2QQQA 4WDIA 4QY8B 1KLUA 5HHXH 2NY6C 1DTUA 1Q9KB 1UJ3A 1TNMA 3DX9A 1B2WL 4N0CD 4V1DE 3REWA 3MLWH 4HUUB 4IOFC 2WBJD 5DR5L 4JM2A 1N7MH 2OSLA 4TYUA 3O11A 2E9IA 3LKSB 5T5NG 2Z92B 4F2MB 1RK1A 5DA0B 5E1HB 1XR9B 4WFHD 4UTAH 4PJ7A 4WI3A 4Y2DC 1HXYA 5C0CA 4Z7WF 4JZNA 2F5BL 1CWVA 2I9LA 3T4YB 1PD6A 4P5TC 35C8H 1UG9A 3ZYJA 5IROC 1KJ3L 1MHEB 4PJ7E 2AJSL 1F45A 2IJ0C 3VFGL 3ORJA 2O5ZH 4P2OA 2Q8AH 4KKBD 1RUPL 2QHRL 2HG5A 1OTTC 4BZ1L 5HHME 5IESL 4CUCA 2VAJA 3A6CH 4ELKB 4FXKA 4QRPD 3RTQA 3C87A 3SGKC 4FXGB 3VFWA 5D6CB 4R2GD 5HHNA 3VI4F 4N9OB 1KBGH 3GJFK 2ITDA 3U7AA 1XF3A 5CEZL 5AWNL 4L3CA 1FVCB 4KI5C 5I1HL 4LSUL 1D6VL 4FQXC 4KXZH 3DSFH 4Z95H 5DJDA 1UWEL 1QSEA 1VACB 3HE6C 1N5YL 3BQUA 3KYKL 1NC4A 1PYWA 5IB3B 1QKZH 1HKLH 3MSPA 4PJ8B 1O7VA 3VFMB 4PJDB 1IJ9A 4HWZB 3V4PL 3TT1H 1FRGH 1GL4B 1K2DA 1C5BH 4PJ9B 3TO4B 5I8CB 1S9WB 1QSEE 5SX5K 4QHUB 1KB9K 2EIDA 3F7PC 4PJXF 4JO2L 3MJ8B 3H9SD 3OKOA 2O5XH 3AXLA 2V2XA 5IK3A 4FZEL 3SDAD 1E4XL 3BI9X 4G8FA 3CUPB 3WBDA 3O9WD 4OCWH 4CADB 2ZSWB 1D5ZA 5B38B 2NZ9C 1FYHB 3CFJA 5EO0A 5CBAA 5FKAB 3ARBD 3U0PA 4Y5YA 3HLAA 3PGDA 2EDJA 4QF1B 3N85H 4GRWB 2R0LL 1IGIH 1CICA 3P30H 1T7XA 4XHQA 1DN0B 5I17A 1J8HA 3NACL 3HMWH 3PWPE 2B4CH 4Z9KB 4IDJL 2AV7A 2QSCL 2NCMA 4GW1B 5EWIH 4NSKA 1AJ7L 4JGJA 2QL1A 2BNUA 3C2AH 5JOEA 4LASL 2FATH 1VFBB 2G5BB 2YD6A 1I9IL 3Q6GL 1I7ZB 1J8HE 1TTGA 2HFFA 3FTGB 2VIRB 1HHIB 4JO4L 2BOBB 5FYLH 5I2IA 4H1LH 2A6IA 3SJVB 1S5HA 1DBML 3OHXA 1MHHA 3U4AA 4HBCH 1YEHL 4O5LH 2UVFA 2FHCA 1KFAL 5FDWB 5EBWB 1T7WA 1B0GA 1BLNA 3C9NB 3DGGB 5C0BD 5F3HA 4Y4FC 2RHEA 4WI2A 5E00A 4NN6C 5FGCE 2DWEA 2EYSB 3MXVL 4CJ1A 3I6GB 5MEQA 3TCLA 1T80A 3V5DB 4WNQA 4GW4B 4RQQA 1HH6A 4LLVB 2K7QA 4I8DA 4L1DA 1A7PH 4HIHA 3UAJD 2F53E 2CXKA 4U1KB 3VFNA 5JPNB 2EIZA 2W0FA 2BVTA 4IRJB 3NCFB 1EERB 2OCFD 4OSUL 3F7YA 4EUPB 4CVWA 1F6LL 2FX8H 4I13B 4OV5A 1F11A 4OIIL 4R0LB 4GKOA 5GRJL 4OZHA 3WDJA 3ARED 3WIIL 5DK0B 2YMXH 1BFTA 1TIUA 2VDQL 3QDHA 3S96B 2A6JB 4KKCD 1KIRA 3IXTA 5JHDA 1I85A 2EEBA 1E6JL 3G04A 4R8WH 2C7UA 3U82B 2E5EA 4Z76A 3MV7B 1LDPL 3BH8A 4OZHE 5C0RH 5L9DL 5ABDE 2DRUA 1R5VA 5F7NC 3V5HA 2R0WL 4UTBL 3CDYA 2Q6WB 3MROB 2FNBA 4JJ5A 4UI2A 1EIBA 5JHDE 1QBLL 3HS0B 1FGVH 4TULL 1GZPA 2FIKB 4EUPG 1G0XA 2XTJC 4F57L 3O3AA 5T1LD 3WHXB 2B5IC 3HR6A 3W5NA 3QFDA 4MZ3A 4R7NA 4M61B 5DVNA 4KRPC 5K9JH 2FZ3A 1S7QA 3LS4H 4U1JA 1YQVH 1YPZA 4OZGA 1A3RL 3QXTA 2H3NA 3MYJA 1YZZA 4P23B 3TCXA 1I1YB 4NNPH 2Z8SA 5GISH 1LK3L 2LQRA 3FB5B 3QUYC 5HYFA 5CP3H 5EIQA 4YHIB 4QRSB 3UYPA 3T4AA 4NUJA 2PKDA 2EDFA 1YPZE 2A0LD 2WAHA 3DO7A 2MQ0A 1KTKE 1GOHA 3QQ3A 3QCVL 5ISZD 3WNKA 3S6CA 1N6QL 1OM3L 3RWFA 3OAZH 1XCQB 4KWUA 2VZTA 4BUGA 5I1CL 1JHKH 2DDQH 4NQEB 1A1MB 1AI1L 3ULUE 5DK2A 2KUTA 4Y19A 2DIJA 1CGSL 1QUNA 4PIRF 3W39A 1ED3B 1ETZA 5HYJB 1A7QL 5I75B 4P46A 2P46B 5CIPB 4PGBB 3PDOA 2IH1A 5D1QA 2DTSA 5E5UB 4GAGH 3QIBB 4TRPH 4LRNH 3H2WA 4Y19E 4C4KO 1CDUA 2EDXA 4PTUA 2IMMA 4KZEH 1N5AA 4LCIH 2LU4A 1JBJA 4HD9A 2IFFH 1UYWH 2PXYD 3VA2C 4WWKC 3QA3A 5E7FA 1IGFH 5EZJA 2IANA 3SDDB 2WSKA 4X6EA 4DOHE 1AIFA 1WAAA 3AS2A 4NQCA 2QHLA 2NYYD 5ERWB 5IB5B 4G9DB 4WEMB 2QR0B 4L9DA 4ETYA 1X5HA 3RVWD 2IANE 5J13B 5JW4N 4HPOH 3QFJA 1IC4H 3W82A 2G75B 5D2NE 1I7TB 1DUZB 3QUMB 4NQCE 5I0ZA 3EO0B 3RNQB 4EIGB 1WEJL 2J6EA 4PREA 1QYGL 3ILQD 4ORGB 4P59L 5FUCE 4U0QB 4V2CB 1FHGA 5EUOF 4D0BA 4QOKA 4L3AA 5EO9B 1T5XA 3QFJE 1QFPA 2HJKB 3PWNA 9CGTA 5EU6A 4HZLA 4RGNB 4JHBA 3DX7A 4PG2C 3BJLA 5T3XL 3E6FB 3GRWL 1UZ8B 3T0DA 5JPMA 3MOAH 1VFOA 1P7KB 4QOKE 4XNMB 5D7IA 2H2PC 5CEYB 1IEAB 2WWMC 1FO0B 5BO1L 4HLZG 4WUUB 4YC2C 2Q76A 2EC8A 5EU6E 3U46A 7FABL 1TCRA 3MLVH 3GJFB 3R0MA 5F7DA 4OD3L 1S7SA 2ADGB 1ORSB 3EYUH 5BCAA 3ROOA 1F4WL 1T3FA 5D7IE 3DYMA 3BP7B 2VDPL 1OT2A 5EC2A 3SPVB 1F58L 4HPYL 3BSZL 3MNVB 1BREA 3QG6B 3DUUB 5GJSH 4ODVH 4KMTH 5GRZA 5ESVB 5FCUH 4K3JH 2QQKH 3HUJB 4O51B 1PZ5B 1QSFA 5DEGA 2GAZB 1A14H 1MCIA 2HWZH 4M8QA 1T4KB 4EI6A 1R3HA 4HMEA 3QHTC 4YHNB 4HWBL 4OCMC 4KUCF 3VFPA 2C5DC 3TN0B 2BSRB 1R0AL 1IMHC 4EBQH 4FNLH 2BRQA 1QSFE 1F4XH 2ZPKL 4PV9A 2EDNA 2VZSA 3H3BC 5D7SL 5GGQH 3VWJB 2DLFL 5GGSB 1VGKB 4MD0B 5DZLA 3KLHD 2YD9A 1J05A 2CDEA 1JL8A 3QG7H 4JFDB 4OLVH 3X14A 5I18L 3ULVH 1D5MA 4BKLB 1VFMA 1OARH 3V5KB 3QNZA 1BGXL 5FM5M 1BECA 2O5YH 1TVBB 5IB2B 1MH5A 1EDQA 3K8KA 4KROB 1HZHH 3IKCA 3RVUD 4LBEB 4HF5H 4APQA 3PXJA 4DZ8A 5E24E 2X4QA 4Z7WA 1EAPB 3FN3A 4GBXA 3VFOA 5I66B 5DRWA 1OHQA 3GSOB 1R3JA 4LSQL 2DYPA 3DMMB 3MODH 3U2SA 4JDVB 3RWGA 3S37X 3MNZA 3QNXA 5A40E 5D1ZC 1S8DA 5GRUL 4PJ8D 4MXQD 4Z7WE 1G7PB 3MUZ1 4LPVA 3KJ4B 3RDTB 4J12A 5T33L 1JI2A 4YBLB 4PJ9D 4F33A 2FIRT 4YIQA 3PWLB 1D9KC 4ZTPL 1Q9LA 3RPIA 2HMIC 3A6OA 1EHAA 3RIAK 3WEXB 4GG8A 4OLXH 2WBJA 4HW6A 3WV0A 2C9AA 2Y9RT 4Q9RH 2GSGB 5FUZH 1ZGLM 4KVNH 3CZJA 3WHE0 4Z7NE 1DBKH 3QHZL 2X7LA 5JW5A 1SY6A 5T5FH 1NH6A 3VI4E 4DW2H 4HKBA 4UIKH 3ESUF 3MRDA 5DHVA 5GPRA 4G43A 2BSSA 5LCVL 1NDMA 1MCKA 1U8PA 4O2CA 4P48A 4FN0A 3LD8B 4WFHE 3MRFA 5BV7H 4JY4A 3LMJL 4WW1A 4AIZA 4L8SA 3BGFC 4PJDF 4JY6B 3A67H 2CK0L 3TLRA 1X7QB 4HIJA 4FHBD 1VEPA 4JN2A 3O6FD 1S9VA 2AABL 2MOVA 3G5XB 3O3UN 4U1NB 2VXUL 3EZJB 3FT3A 5BVJA 3VFUB 1IQWH 5CGYC 2VZ1A 3O81A 3MLRH 4ZS6D 4FABL 4CRPA 1WCBB 4K3DL 4QRPE 4WENB 1T89A 3KPOB 2YD7A 4WV1B 4GH7B 1KNOB 2QJDA 1ND0A 4F9LC 4MA8H 4UUJB 1W72A 3BP6B 3BKJH 2VDMH 4JPWH 5INCB 1BEYH 3VWKD 4NJ9L 5BVPH 4MJ4A 3GSRA 4LSRL 5JIHA 4OLYH 3H7BB 4MXVF 1J1PH 4JR9H 5FOBA 5HHPA 1JF1A 1I1FB 4HIEA 3C5SA 2N4IA 3C8KB 4GRWF 2RJMA 3MRGB 5ETUB 2DMCA 2PCPA 2JB5H 3TPUA 4YHPA 1CTOA 1T6VN 1CQKA 4NDMB 3H9SA 5TE7L 4ONGH 4WVRA 3MZTA 4XHJC 3SDAA 4WO4D 3PV6A 5DD0L 3W9DA 4JO3H 5I16A 2GCYB 4ZNCD 5DMYA 4NRYB 2FLRT 2V2WB 3KS0H 3KPNB 5I6XC 1CZ8L 2YK1H 4BK5A 3O9WA 1I8MA 1A6WH 1V3LA 4NZDA 1KC5L 1GC1L 1NCWH 4H25A 3H9SE 3ARBA 2BHZA 2VC2L 2XG5A 3GKWL 2X2YA 5E03A 3U7WL 3H0TB 1NJ9B 4K71B 3QPQD 3PWUA 1NGPH 3X11B 1OTUC 4PD4K 1BBDL 1FZMB 4MA3A 1VGEL 3UDWA 5AUMA 5LAXA 3ALPA 3LEVL 3MV7D 4HX1B 4K9EL 3UTTD 4NN7B 2P1YA 4W6XB 4QT5B 4GAJL 1EBAA 2OZ4L 1IL1B 4K23L 1T1XA 5EDXA 1BQLL 3QCTH 4ZAKC 2WV3A 5E6IB 3MA9H 3D3VB 1MRDL 4JY5L 2X4SB 3ARFC 5EORH 3LIZH 2J8HA 3EDFA 3OKDB 3P77B 1A7NL 5ALBL 4OF8A 4F37F 2FX9H 1X4YA 1HHJA 4N8CL 3GO1L 3UO1L 3RNKB 5D7JB 3MNWA 5HYSB 4XC3H 4D9LH 4P23D 4S0TD 3R8QA 2APWA 1EFXD 2UZXB 3DIFA 4CU8A 2KPNA 4I0PB 5C0BA 1XGUB 1DQJB 4RAVA 3LOWA 1EH9A 3AS1A 2YOCA 1MFDL 5C0GB 5EZLA 2XZCH 5FA4B 4ZUUA 3GBMH 2KDGA 1MF2H 2D7NA 3V6FA 4P4KC 2Q87A 2QQLH 2ADFH 5C0BE 4Z8FH 2W9EH 4Y5VC 4XWGH 2AEQL 4XPBH 4NQED 2AXHA 3UYOD 5GRYA 4TNWK 5HYJD 2VXVL 4Z0XB 3MRBA 2H9GB 4N0UA 2YC1B 5DJ6B 4MQXC 4ZUWA 2HFEA 1UM6L 2BVUA 1AE6L 3VXTB 3WNNA 1WQVT 4CMMB 5IQ9A 3IDNA 4J4PD 1D5XA 2E9BA 1BZ9B 3W9EA 5LXGL 2NXYD 3P4NB 1BFVL 3T3MF 1M7DA 5DFVD 4DKEL 3B2UC 4N0UE 1X44A 5M7QA 3EOAB 3SDDD 2X4NA 5DUPL 5E4EB 3OKNB 5JDSB 3O6KH 3BO8A 4HUKB 4XPGL 4N1EA 3ZT6A 2AGJL 2VXTL 5FYJH 1JWMB 3BMWA 2DB8A 5DI8A 5DMGC 4OLZL 4R4BA 4XXDB 2YWZA 5FGBA 3HZYA 3RHWK 4F58H 1J0KA 5HY9A 5CLTA 3GSXB 4BQ9A 1HI6A 4HGWA 3RZCC 4LU5L 1YNTA 3ARUA 3QXDA 1OPGL 1GPOH 1GVIA 4KHTL 2DLGA 4XNZB 5MERA 1UWXK 3KR3H 5IHUL 1A6PA 1PLGH 3VGDA 1QLEL 4X99B 1IGMH 1RZFH 2IFGA 5DJAB 3STZA 1B4RA 4WEBL 3T1WA 2HVKB 4H1LG 4RFOL 3JWOL 4PJAB 3OB8A 5ISZA 1N3NA 3TA3C 5B4MC 3FMGH 4MAYC 5JMRA 3VXOB 1JWSA 2JJVA 4UIMA 2YSSB 3EZ8A 1MAML 3G9VA 4NKIH 4MA1C 3RVTC 2PW2B 3HNSL 5SWZB 4KDVA 4ESKA 4LIQH 3MRJB 3OXRB 2OJZH 5F88A 5IFAL 2P24A 5ISZE 1IRAY 1JN6A 1R5WA 2CUHA 4W68A 3EFDL 1IC5H 4YDJB 3LB6C 3BN3B 3GMNB 5C9KA 4P99A 3ECBB 2L7JA 4M5ZH 3C5JA 4YX2L 2FGWL 4YFDB 3JVGA 1CDCA 2JJTC 3ARGB 1YECH 3GHEL 1PG7H 3FOLA 3NA9L 5ITFA 1FFPB 2GIYA 4QRTB 1FIGL 5ICYA 2Z8WC 2WIIB 4C58B 2VABB 2VZVA 5I1LB 4PP2A 4WU5A 1GGIL 3HI1B 2EKSA 1G84A 1KCSH 1G7HB 4KZDL 2F19H 1F02I 3S35L 3GJEA 2A6KA 2BSTA 3OKKB 1E4XI 1EEYB 4XP5L 5I9QB 3GSUB 2OR9H 3EYSL 3F5WA 4JPKL 2VLKB 1SYSB 1W0WB 5CP7A 1CDHA 1WZLA 4JFDD 2PR4H 5BZWB 1BQHB 2AXGA 1FL5B 3X12B 3W0WB 2Y72A 1S9KC 4TQEL 2QBWA 5C71A 5F21B 3QO0B 3O2DH 2ZNXA 1WUNT 4KROD 3P73B 1Q1JH 4W70A 1SYVA 5BXFB 2GTZA 3HUJF 1AQDA 1ZK9A 3IDJA 4TUJA 3IAPA 2CXGA 3UPRB 1AHWA 3S36H 4TOYL 3DMMD 4Z0BH 4BH7B 2H32B 1MLBB 2ICES 1GCFA 2FCBA 1Q8MA 2DBLH 2VUOA 1C5CL 1FORL 3MJ7A 3RVXC 1Q9KA 3P4OB 3T2OA 1ZHKA 1INQA 5CZXD 3RDTD 3MUJA 1TZGL 3VRJB 4EOWH 1J86A 4JPIA 4CDHA 2D7TL 5EH1A 1QNZL 4NWUL 1C12B 4HUUA 3RKDD 1K8IB 3ARDC 3TF7C 1AGCB 1E6OL 4Y1AB 2FSEB 3BPOB 4GW5B 1U3HD 4ZQKB 3ALXA 1MPAH 4XAWL 3LKSA 4ZFZA 4OTXH 4MMXC 1A6TA 4F2MA 3BW9A 4NQUA 5GZOC 3O2WH 5HGDB 4U1MB 1RIVL 43C9B 1QO3B 1PSKL 4OCRH 1ZHBB 2YPKA 5CINH 3T4YA 5ADOH 3QRFM 1MFCH 2C4FU 4GKNA 1MHEA 4HJ0D 2VLLA 4XNUH 2EZ0C 2HFTA 4S2SB 1CXEA 4NO3B 3SE4A 3EO1B 5E5RB 3GI8H 1IKFL 2A2QT 1A0QL 1JNLH 1YY9D 4ELKA 4UILH 3BPLB 5D1XC 5EA0H 1A7OL 3FO2B 4OFYD 1TMCB 4EQ3A 3MUGA 3D9AL 1DVFC 4PLOB 4RFNC 3L3JB 1V3KA 4EDXA 1YJDH 1RJLB 4KK6C 2DM3A 1JGVL 3IJSB 1FVCA 4YHZL 5JW3L 3NIGE 3TP4A 4C56B 2XYCA 1PVHA 4IRSD 2C3GA 4ZPTB 4WI8A 4HH9B 4RZCA 3MOQA 3SOBL 4PJ8A 3VFMA 2DD8H 1UJ3C 1QFWL 4NBXB 3K7UA 1ZT1B 2IADA 3LQZA 1RZ7H 3OPZH 1CG9A 4MLSA 1B3JA 2R0ZH 3OTTA 4PJ9A 5DO2D 1S9WA 5I8CA 1NFIA 3ZSSA 1JZ5A 4QHUA 4WTZA 4ZOBA 1WWCA 4DUVA 2Z31B 3MJ8A 1HCVA 2NY0B 3KLAB 3QJHB 4PJDE 2X4PB 4MDJB 3UJTH 1AGDB 4GMSH 3S5LB 2ZSWA 5B38A 5JOPD 1TVHB 2XA3A 5IMKB 5DQDL 4EIZC 5FKAA 5KTEH 5LGJB 1UEYA 4WFFD 4XPFL 4ZO8A 3RA7L 4YPGB 4OCSL 4XBGB 4QF1A 5JQ6H 3WSQH 2XXMB 2H2SC 3OXSA 3K1DA 3DI3B 2PW1A 2K7PA 1RK0B 4MWFA 2E3VA 3PHOB 2LAAA 4M7LH 1MCRA 4MXVE 1RFDH 4X6FA 2FD6L 3O6FA 2EIEA 4FP8H 1JNNL 2WK2A 5LGHL 1G6RH 4XP9H 3BRGC 4GRWE 3QRGH 4ETQA 2WMPA 4U1LA 4X5LA 2G5BA 3WXVH 2X4TA 1I7ZA 3FTGA 4JPVL 2VIRA 3VXNA 3MOBL 5MHSD 3BDXA 2BOBA 4XGZA 1J5OH 1OSPL 5H35B 3G6AB 3QUZC 1AGFB 4D9QD 1NDGB 4ALAL 5HVFB 4R90L 3A6BH 4XP4H 1ZVYA 4G6FB 1CLOL 3K81A 1I1CA 4YXLH 3D85D 2LVCA 2J1KA 2HT4C 5EBWA 3HR5B 1Y0LB 1KYOJ 3VWKA 3DGGA 3HMXH 3GBNL 2IALA 4UZGA 5C09B 1KENH 4M43H 2DS4A 3SJVE 1F4AA 1V7NH 5AZEH 3KPSB 4KK5D 5KSAB 3F58H 4NNYB 1EGJH 2NY6B 4IEFB 3I6GA 1IGYB 1KTRL 2EC9T 2KQNA 4WO4A 4LLVA 2NY5L 1IBGL 5JPNA 5E70A 3O4OC 3I6KB 4UT9L 4ZTOH 2J6EL 2WINA 2YXFA 1J87A 3KG5A 2ZUSA 3ELAT 3GBLA 4HQQH 1U8JB 1EHXA 4EUPA 3DROA 4FFVC 4XMLL 3VG9C 1U8LA 3VRLE 2NY7L 5KG9B 4Z95L 3X3FH 1EA9C 5DK0A 2FLBT 2XKNB 1R3LA 4OBSA 4MVBC 2DQGH 2A6JA 3LKOB 1BD2B 1UM5L 2OS7A 3T0ED 1M71B 3VFTB 4P5TB 3MV7A 3HRZA 3PL6B 3UTTA 4WW2C 3DV6B 3D2UD 3TPKA 4F8QA 1Z9MA 1TXKA 3RFZC 2OK0H 3GSNB 4ONHB 2R1YA 1YEEH 3HS0A 2OP4L 2GTWB 3VW3H 3VFRB 4E5XB 3MV7E 2FIKA 3UTTE 4HMCA 4OCWL 4H26A 4M61A 4RGOL 4DK6A 1DZBA 3QZWB 4PYGA 1OP5K 4JLRA 5DYOB 1FZKB 5F7YC 5C3LD 1T04B 4P23A 3OJ2C 5EBMA 2WZPD 1EFXA 3QEGH 3D87B 5CGTA 1X5AA 4I77L 3HE6B 4YHIA 2MKWA 2X4OB 1KGCD 4LEOB 4LCUB 4PJ5D 4I9WD 1FL3B 4KTYA 2Z93B 1YA5A 3M1BA 2VOTA 2FEDC 1S7TA 4DFHA 2AJ3A 1KELH 1G9ML 3KPPB 4NQEA 4LDOB 5SWZD 2IQAA 5CZKA 4G9FB 5A3ID 4UV4H 5HYJA 1RZKH 6FABL 3V8CA 4JHZA 4ACPA 2DM4A 5CIPA 3FKUS 3BIBX 4ZUVB 3MRPA 1JVKA 4JG1H 2AEPH 3OJVC 4NQEE 4HBCL 3DX6B 4XP1H 3IVKB 1KN2L 3ROLB 5AYUL 4J4PA 1YC7A 5HYJE 1ES0B 1T1WB 3ARGD 4W6WB 5D5MB 3IGAA 4GXUM 3SDDA 4IJ3C 1JIBA 2F74B 1UH2A 2WWKT 1Q94B 3HC3H 5KW9L 1LWRA 2RGSA 5DJ8A 1G7JB 2HT3D 5ERWA 2ED7A 1IVLA 5IB5A 5FKPA 2CRZA 1A7RH 3KPTA 4PJAF 4PRDB 4P2CG 1RUAH 4XWOC 4Y4KD 2VLKD 4YGVB 1A7PL 2G75A 4DGVH 3PWJB 5D7LB 2PUQT 3QUMA 3ZE1E 5A16B 1A9EA 4OBRA 3RNQA 4KPHL 4ONFL 2DM7A 3C2SA 3IFPB 2XZAH 3BKYL 2XQYK 1I8KA 1SY6L 2R2BB 1CF8H 2HJKA 3H9HA 1SBSL 1RZIB 4JN1H 3U9PL 5HYQB 2EH7H 5GS1C 4G7VH 1JRHL 4BFEA 3E6FA 4DUXA 1A1NA 1I8LC 4R8WL 1UZ8A 4X4ZA 1P7KA 2VH5L 4Y4FB 5CEYA 1IEAA 1ZGLB 5IP4A 1FO0A 1X6LA 3SGJC 3RIAF 3D0VB 3KGRA 1JYNA 1FYTB 1QPPA 2FWOA 3DX8A 4NN6B 5B8CC 3T2QA 1DQLL 3GJFA 1KLGB 1GGCH 4U1IB 4NT6B 2ADGA 5C0IB 2GK0B 4G8IB 2HTKD 3DVFA 3BP7A 3OBAA 2VTFA 2B1HH 3FZUC 3GMMB 1JPTH 3SPVA 3MNVA 3NTCH 4WUUE 1JZ8A 2G60L 4O51A 1PZ5A 4UDTB 2GAZA 3ZKND 1JTPA 3C60C 3TJEL 2E8ZA 3N9GL 3HB3D 2DQJH 2XFXB 4WCYL 3D39A 3OKMB 1JPSL 4DAGH 4XB7A 2AEIT 1LQSR 3X13A 1C1EL 3Q3GA 4GAFB 1VGKA 4MD0A 4QHMA 2VRAA 5EIVA 2W60B 1JHKL 3GGWB 1U2CA 4TSBH 3V7AG 4JFDA 1FFRA 1AD9A 3MBEC 5KAQG 1OTSD 3V5KA 4HKJB 4U0RC 3U30B 5IM7B 2CDFB 1HILB 1A8JH 1MNUH 1TVBA 5IB2A 2GFBB 3BVNB 2XTJB 4ZUTA 3S97C 4ENEC 1L9MA 1EZVY 1OAYH 2B5IB 3QT2A 4AY0A 2ZUUA 3RPKA 2QQNL 3NFSL 4JFDE 1EAPA 4MAUL 1CGXA 4FTVB 3W81A 3VG0H 1S9XB 2EYTB 4K3GA 4LCCC 4C56D 3IETB 4X7FC 1PEWA 2I07A 3CSYB 4G80B 1DQTA 2D0FA 3DMMA 1UYWL 3RWEB 4JDVA 3S4SB 2R8SL 4NCDA 5ENWA 2XA8L 3MACH 1XF5B 3MFFB 3B9AA 1H3PL 4PGEB 4LARH 1RJZA 1VFUA 1WK0A 2EXWD 1UADC 1FFOB 3F7VB 1ZLSH 1J12A 3RL1A 1IC7L 4K7PH 4NQTA 3PWLA 4RMVA 2IGFL 2Z4QB 4HPOL 2UZIH 5FHBH 5MI0C 4FG6D 3SE9L 2Z31D 3S3PA 1JZ7A 4P3CH 3RWHB 5KSUB 1F00I 1U3HA 4I2XB 4YAQB 1HK6A 1CFBA 2GSGA 1MHCB 1B0WA 4DKDC 1MHPH 3GMRA 3CNKA 3DVIA 2DQCH 2JELL 3TZVC 2Q3ZA 2YPLD 3ES6A 4MHHG 3S3SA 2PO6C 1F3RB 1XF4A 2LTQC 5CJOH 4EXKA 4LOUC 3T0XA 1D5IH 2YKLH 5IHBA 5CBEB 3HHRB 5D8JH 5TDPB 3MOAL 4K8RH 1MCFA 3ULVD 2NX5B 1CIUA 3GK8H 3T2PA 4PLNC 1K6QH 2EE9A 4U1SB 3S88H 4JY6A 3N1QC 1KJ2A 6CGTA 5INDB 2GEEA 5A2IH 1WBXB 2A6DB 3G5XA 2IPKB 2ORBH 2YBRA 5CJ8A 5F1OB 4OFYA 2WIMA 5FGRA 1MREH 1CDYA 3VFUA 3FO9B 5J57B 3NOIA 3TBTA 2H8PB 1A14L 1KJMB 2HLAB 1WCBA 5CLWA 2CKBB 1HOCA 3NIDF 1IAMA 4WV1A 4G6FD 4IRSA 1YYLL 3SQOL 4J3TA 4R7DB 5EFIB 1A1OB 5INCA 5E2JA 5I1JL 1YN6B 3NZ8B 5C09D 1D6EB 5DEZA 2BNQD 4P5KA 3BP4A 5DVMA 1BP3B 3V6BR 3C8KA 2ICWA 3MRGA 5ETUA 1MWAL 2NY6D 3EOYG 4TNWF 5JW4M 1A6VH 4YC2B 5CZVL 4NDMA 4DZBA 2XRAH 4KQ3H 1XGTA 4MX7B 2ZUTA 1T83A 4NHCL 2GCYA 3KXFB 4OQ1A 5IJKA 4NRYA 4HT1L 3KPNA 1M6OB 3QUKB 4K7FB 3WUWG 4HXAL 4IOFD 2D7MA 4P2RD 3TYFB 2UY6A 2P7TB 2SEBB 3IDIA 1TZIB 4OAWB 1OP3H 4A6YA 4XCEB 4L4TB 5D71L 1FGNL 4PGZA 3R1GL 4WI9A 4ERSL 3IU3B 2UZYB 1NJ9A 2BDNL 4Y2DD 5C08B 1HDMA 3WUZA 5JOPE 3T04D 3V52L 2DLIA 1M05B 3RHWF 4WFFE 2PYFB 3JSSA 3L7FB 4P5TD 1EO7A 4HX1A 1P9MA 1T5WB 3BHBA 5E8EA 3TT3H 4ODHH 3BP5B 4CL7A 1PZUB 4WI4A 5DURD 4A2LA 1HINL 2CRIA 5E99H 4HEME 4LCYB 4EZMA 3F6IA 1ZWIB