4NUGH

Crystal structure of hiv-1 broadly neutralizing antibody pgt151
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
236
Chain Sequence
RVQLVESGGGVVQPGKSVRLSCVVSDFPFSKYPMYWVRQAPGKGLEWVAAISGDAWHVVYSNSVQGRFLVSRDNVKNTLYLEMNSLKIEDTAVYRCARMFQESGPPRLDRWSGRNYYYYSGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Delineation of a Quaternary, Cleavage-Dependent Epitope at the gp41-gp120 Interface on Intact HIV-1 Env Trimers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PGT151 light chain
total genus 45
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH02
5DJ2B 6CGTA 4YBQD 4X6FB 1F2XK 1N0XL 1IEAA 2AI0H 3MRJA 4U1MB 1XIWB 2VDNH 5DEFA 2CLVB 5C07B 4JN2B 5IB2B 5JORB 4AEIH 4OD3L 1CK0L 3GI9L 2FBJL 5DXWA 4YE4L 2M2DA 4KWUA 4O2CA 5F7MC 1LO2L 4LGPB 4X6EA 1MAMH 1Z3GL 5JOFA 4L4VB 2Z91A 5CGYD 4LCCB 2XN9D 4I3SH 4WU5A 4HWZB 3KWWB 1BX2B 2J7LA 3MOBL 2J3SA 3U0TB 5KS9A 4AJ0A 4JKPL 2OZ4A 1JGVL 4OLZL 4LAJH 3T2OA 1QOKA 5E8NA 4DCQA 3RAJL 3OJ2C 3B4NA 3UDWC 5KJRH 2VABA 2CDEB 4JHWH 5IB4B 1AC0A 1OW0A 3U0WL 4U6HB 1CVRA 1D5MA 3QT2A 2R4SL 1NCWH 1PQZA 2ZSWA 4J3XA 4HXAL 4YDJB 2OR7A 3GSNH 3VFNA 3F12B 4G6AD 3CH8A 3MA7A 1UJ3C 3SKMA 1UJTA 3KXFA 2LU3A 5KSBE 4GRLB 4F9PC 2E7BA 1LO4H 3HHRB 5I1EH 5FOJA 3JWOH 2BNUA 1ZMYA 1PDKA 2O5XH 2OL3L 5GSRB 15C8L 4UV4L 1D9KC 4NSKB 4QXTA 4BH7A 3MA9H 5BZDA 4JZJC 4XNMA 2DM2A 4U6YA 3MCLL 4JEGB 5TE6H 5DC9B 2GITA 5J6GA 1KB9J 3MV8D 2DI8A 4ESKA 3ARFC 4JPKH 2UV3A 3RY5A 2ESVD 2A0LC 1YEJH 1D6VL 4NRYA 1HQRA 4Q9RH 2P24A 2PN5A 3BJ91 4IJ3C 4LHUG 1RJLB 1FVEB 2CR3A 3X13A 1CQYA 4P2RD 5IFJA 1MFEL 3FQNB 2WM0A 2Y23A 3CCHA 5LGHH 4OJFL 4LLMA 3MBED 1GYAA 5CLWA 2NY4B 2WSKA 3DVGA 4M48H 4HLZG 1ROWA 5D8JH 2NMSA 2FNBA 4FRWA 1TVBA 5C0AD 3B9EA 5SWSB 3GSXA 2Z31A 3T09A 2BVPA 4RGNB 2AXJA 1IAIH 2DIAA 3MLRL 4LARL 5IHUL 1A4KB 1MPAH 3KJ4C 4HC1A 2L7JA 4JDVA 1KYOJ 3QO0B 5CBEB 2VDKL 1KB5L 4IOIB 4X4XB 3EZJB 1S7QA 2VDML 2BX5A 4HC1H 5T1LD 2A6JA 4JN1L 1ZT7A 5CIPA 2B4CL 3B5HA 5ERWA 2ENYA 3S88H 3O11A 3VGAC 2DWEA 5D1XC 3M1BA 3FB5B 4FOMA 1KTKE 4G3YL 4X4ZA 3SGJC 2YD8A 1ZLUH 3DVFA 2GK2A 1UH2A 2AXFB 5F44A 3C2AH 1P4IH 5IW1A 5J8OA 1F6AA 3VGHA 2Y06H 5ISZB 3L1OH 4GQPH 1UB6A 4PJBB 3QCVL 1UWXK 1AD0A 1XR8A 4R2GB 5DD5L 1I75A 1X4XA 4MAYB 4KJQC 1CK0H 5MERA 5KTEL 3ULVF 1XGPA 5DLML 1RZKC 5HVHC 5I16A 2QQQA 1ZT4A 1FFNB 1R3LB 3FB7A 4ZODA 1DEDA 3MNWA 1F4HA 2LE9A 5I6XC 5IIEA 3UZQA 5JW3L 5FUOL 3K7UA 3CH1B 3SKJL 4ZFOL 1DLFL 2AJUL 5K9QI 4Y88A 2HFFB 2OK0H 3KR3L 4L9DA 4NKDB 4OLXH 5EIQA 4FQ1L 4RA3A 2ZG2A 4K8RD 3BUTA 4HS3B 5C09A 1ND0B 5DMJB 5BW7C 5C6PB 35C8H 4L8DB 1A1MB 1OTSC 1I8IB 1D3CA 5IHZB 3QUXC 5I8KH 2E27L 1BQHG 3CNKA 5K9JL 3MFFB 1HXYA 5DDHA 2FZ3B 3W81A 3KYAA 4L4JA 4CVZA 5DRXA 4I2XB 2XOTA 3OX8A 2VLJB 3MCG1 3P9WB 2EDJA 3S34H 3H42L 3AREA 4QNPF 1CGTA 5F6HJ 4U1IB 5C6TL 5GRJH 1P9MA 1CLCA 4NQEB 2CGRH 5J6GB 5JW3H 4MMZC 1DSFL 4MA3A 1TETH 2DIBA 3DX6A 4G43B 5DK0B 2DMCA 1BZ9A 1D6EB 2EEBA 2ICES 3DV4A 4J4PD 1YY8B 5A2KH 1GZQA 5FB8B 2GW5A 5D2LB 4K9EL 4LRNL 5F6HI 3BH8A 1K8DB 1GGCL 2I26N 4PJGA 1HHHB 3CFIC 4OF8A 3A67L 4WJ5B 4OCRH 3HAEG 2F8XC 1BQLL 1FZKB 5CEZH 5D6DC 4P5MB 1A6WL 4WUUD 4IRJB 5HVWA 1YEJL 3ARYA 3MLVL 3MYZA 43C9A 3IXAB 3V0AC 3KPRE 1BECA 2LAGB 3QQ4A 3QRFM 3QULB 1P7KB 4U6XB 3JV4B 3WS3A 3GHBH 4JZJB 2OTPA 1JWUB 1JNNL 3MSPA 5KANG 2IADA 3ARRA 5F88A 3D0LA 4LFHD 3P3YA 5ISZE 2G5BA 2AK1H 1E4WL 1ZLWK 1A1OB 3ULVH 3RFZC 2AJ3A 2OQJB 4WW2B 3ES6B 1R24B 5I76A 2BNRE 4RAVB 1U41A 2FWOB 4PFEA 1IC7H 5D71H 2DBLH 4MAYD 5B4MD 3HUJA 4JPVH 1IRAY 2R4SH 3VMPA 5LVEA 5ILTH 1NAMB 1ETZA 5DD0L 5TE4L 5DRWA 4DOHB 4Y19B 3B8SA 4M7LT 5D7SL 1FYHB 4EI6B 3IU3A 3PV7A 3AB0B 3H3KA 1S3KL 3O6KH 4F37F 3MRCA 4ETQA 1CR9H 1TZGH 2H2SC 2CMRL 3MR9B 4ZOEA 3VXUB 3LN4A 3HZYA 5IW6B 2EDBA 5CMAB 4XRCB 4GO6B 3MV7D 4H8WC 5D7IA 4G80B 3SE8H 1GVIA 3D3VD 1EO7A 2GK0A 4AM0B 4N5EC 1C5BH 2IALA 4DN3H 4JJ5A 3LKOB 1J5OL 1L4IA 1V5JA 3V52H 3CFCH 3O45A 2PYEB 2OMNA 1JNHB 5EOTB 1RD6A 2XA8L 5I74C 3V9FA 3R06A 1WCQA 5E6YA 5EOQL 3IKCB 5C09D 1QSFE 1G7QB 1LP9B 3ARVA 3AM8A 3KPMB 3ZKNC 4NQCD 1G7MB 3UTSA 2V17L 1EFXD 3BXNA 4FQXC 2F54D 2GFBB 3WO3B 2DQCL 3EYOA 4OAWB 5F3HA 5GRVL 1DR9A 3P0YL 1CQKA 4OM1H 5EBLA 1S7UB 5CJBA 4JB9L 4WHDA 4K7FA 3T77B 1QBAA 4YQXH 1G7HA 2HRPH 5IB4A 2R1XB 1RUQH 4K2UH 1JWMA 5ALCH 2XWTB 3MV8A 4M8VA 2FGWL 3NFPB 3RZCC 3QEGH 2DQJL 4QGTA 3QDGB 3DV4B 4B7LA 1RU9L 5D2LA 5DJXB 4BZ1L 2MCG1 4N0UA 4HLJA 1T21A 5FYJE 2NX5A 1A6UL 2CGRL 4WFHE 2OZ4H 3A67H 3MBEA 2W9EH 2ZCHL 1DZBA 1MJJB 3NACH 1YJDL 5D9SB 1PW3A 2CDGB 3IU3B 1CICA 4TN9A 3WFBL 5TQ0H 1V7NH 1JHTA 3MRCB 4HUXB 3F65A 4ETQB 2WUCL 1I8KB 1NGWB 1ZANH 5ADOH 4MQTB 2NW2A 3NOIA 1UH3A 3RKDC 3DXAD 1NC2B 5GS1B 3ET9F 4ZFOB 2BVOB 2R39A 2G5RA 2ZG3A 3IDGB 1NFKA 3HE6D 3CSYA 3S3SA 1WTGT 2CSPA 2GCYB 4DKFH 3RTQC 3QUMB 2FO4B 4JO2L 3QI9A 4P4KB 1FHGA 1IGIL 2ZSVB 5C07E 4DAGH 3L3KB 5KSBF 2GTWB 3I9GL 1NGZA 2OP4L 3D87B 4XH2A 5ITFA 3C9NB 2IJ0C 3D1MC 2OJZH 4IS6B 4WY7L 5E8DH 5MEQB 2Z31B 4PY8I 3BP5B 3RWGB 5IUSA 2ID5A 4PLOB 4ODWB 3SDCC 1CGWA 3CFEA 2H1PL 1DQLH 1OGTB 3IJHB 1JIBA 1RZFL 1U3HC 3WFBH 3LB6C 2XPGB 1XGRB 1LWRA 4YAQA 2XXCB 4MQ7A 4J3OC 2X42A 4LLWB 3ILQD 1F42A 5IK3A 5D93B 5JW5B 3S3JA 1CZ8H 4QKXB 4WFED 1J1OL 5IW1B 3Q6FA 4JHAL 4OFIA 2CDEA 4ONHB 4S2SA 3ZDYF 1SEQH 1R3IL 3MOAL 2P5EA 1B0RA 4NNXA 2ZUQB 3ULSB 3QZWB 3K0WA 1CGUA 1A0QL 3IXTA 3SGKA 5AG9A 3CVHB 4PY8J 5FO8B 2HT4C 5EWIH 3TJEH 4M5ZL 4KK8C 5FOBA 4JAMA 5B38B 1EFQA 1TNNA 3GJFB 4ZMAT 5F9JB 1G9NC 4LCUA 1F8TH 4OLYL 2X4SA 2XYCA 3WXWH 1SJVA 5CZVH 3QA3A 1RZGA 2OTWA 1KUMA 4LQFL 4X80L 4X7SL 5DSCB 5J57B 1PX3A 4NJ9H 2V17H 4LCYB 5EU3A 2R69L 1ZVSA 4N8VA 3EOBB 3MRFB 4D94A 2NQCA 4PJCA 3PHQA 3VFTA 4MYWB 4DUXA 5IQ7H 4JFOA 3RZWA 2Y25A 1G9MH 1N6QH 3CFDA 1KLFA 1IC5L 4UB0H 1MAML 1HEZA 1T7XA 1Z3GH 1WZ1H 3MGTA 3ABZA 1FYTE 5HDBE 3I9GH 4N90D 1NGXA 1TVDA 2NTFB 3SE9L 3ELAT 4TUKL 3L3HB 3BRDA 1TTFA 3SDCB 4Y1AB 1YEDA 4Y4FB 4XCYB 2IF7A 1BZ7B 3PGDA 4F8TA 2MSPA 3AMLA 3HC4L 4DGVL 4MDJB 5IMKA 4JZOB 4OF6A 2VJXA 4OFKA 5FO7B 3FB7B 5I8OL 1TZHB 4OCLC 4PUBL 1CIDA 5JW5A 3U79A 5M95B 2C4FT 4C4KT 3HG1D 1DUZB 4XVTH 1BFOB 4X80H 4X7SH 5HVGB 3KPRB 2G9HB 2RHEA 1B0WA 1IAKA 1KENL 4MX7A 2DRUA 3AS0A 1HILA 5EIIB 1DVFD 3I6LE 4J12A 1Q9LA 1IFHH 1MREL 3GBNH 5D1QA 4ZS7H 1C5DA 1YNTA 5CFHA 3WIIL 4UIMB 3U0PA 3VFVB 1Y0LA 4QF1B 3FN0L 2EDWA 4PRBA 5B38A 1K2DB 1QLRA 3PGCA 25C8L 3VWKD 2F74B 3MC0A 1JI1A 3FOLA 1AO7A 5D2LE 1P84K 2UWEA 3AU1B 5DJAA 2VC2H 5ADPH 5HHQA 5T5FL 5C9KA 1J8HB 2D0HA 3MNZB 1I7UA 3O3DA 1QLFA 4GKSB 4IMKA 4APQB 4FFYL 4LPYA 1JTPA 3O9WA 5DJ6B 5E6IC 2CPCA 4LSVL 5DD1L 3VXPA 3OB8A 1FBIL 4LHQB 3RAJH 5IIEB 1RUAL 1EPFA 2MTPA 4BQBA 3C2SA 5J4MA 3RWHB 3FO9B 4JCMA 5F7NC 2IEPA 3ZSSA 1PZ5A 2VLJE 4MSWA 3G5ZA 1OP9A 4TNVK 2A38A 2VDLH 1EHNA 4DKEH 5IBLC 4FQJH 1UKTA 3HFML 5HHXH 2CIKB 2V5YA 4V2BA 1F3JA 2J8UF 1ND0A 2A1WL 3I3BA 3FTGA 3B3IB 1ZAGA 4HMCA 3L5XL 5SX5H 1ZLVK 3BAEH 3K1DA 3T0EE 4EN3C 4Y4HA 3BD3A 5MI0C 2B1AH 5IBLD 4TUOA 4KMQA 4FABH 5IFHL 1A9EA 4XHJD 2APXA 4Y4KB 2I27N 3AAZA 3IETA 4HPOH 3TYFA 4OLUH 1HK6A 4RA0C 3VE0B 5BVPH 5KVDL 1KIPB 1QSVA 2P4AB 1EEUA 2IH1A 1IAII 3A0OA 1YC7A 4L8SB 1LEKA 2CJUL 2XQYG 3KPLB 3WFHB 3JUZA 3I6KA 3CUPA 4MQSB 3MO1A 4UQ2B 4E9LA 2HJKA 3VRLF 3RWJA 3KPMA 1CFNA 4OLXL 1C5BL 2J5LB 5I1CH 3BW9A 4HIHB 2GKIA 1LGVA 2CKNA 1T22A 5DD6B 1WBXB 1LDSA 4UUJA 4MLIA 4I0PA 4YO0A 1K4DB 3EDDA 3FZUC 4ODBD 1CR9L 1TZGL 3PABA 3RJDA 2NYYC 3VD4A 2RB8A 2ED7A 5GS0L 1QPXA 2LTQB 3KWWA 1N2RA 4ZOCA 4UOW1 3X11A 3IDNA 1ZSDB 4NBZB 4CNIB 4ZUWB 4NZTH 2R1YB 5H94B 1OAZH 1IM3B 3BI9X 2CIKA 4P2OD 4E41B 2H8PA 3EFFA 4YGVA 3T4YB 3QG6A 5I15H 1HWGB 1U2HA 1RZIB 4TNWF 1KLUB 4OCYL 4ORGB 2YWZA 5HYJB 4ZSOA 2C7UA 4FA8A 1LEIA 1FFRA 2OSLA 1NL0L 5TDNB 1IEBB 2I60H 3ES6A 3BMVA 5DEGB 2YPLB 4RAVA 3WIHL 5T3ZD 5FAAA 5MEPB 1U8KA 5ENWA 3VD9A 1IL1B 4EDXA 4PJ9B 5HI3D 2F19L 5JMRA 2V7NA 1JN6A 5T5FH 3VCLA 5EWIL 4YXLL 1T7ZA 3FT3A 2ZCHH 4XVSH 2DQUH 3WS6A 5DVOA 5BV7B 4WWKC 5DMKA 1MFAL 3F7VB 4NKIH 1EHLH 3MLVH 1EVUA 4KJQD 1OLLA 3FHAA 3UBXA 3O2DL 3MV8B 3VRIB 4HV8B 1XF4B 2DJUA 5GJTH 4MA8H 4YLQT 1VADA 4IIQC 4P0DA 3CDGA 3ZKMC 4QHMB 2J88H 5CZXC 3MUJA 4HLZH 1BZQK 1J8KA 3EOAB 2ENSA 3VD5A 3C2AL 3KPPB 4M1CC 5CINL 5GGRA 1X5FA 4I1NB 3ZDXF 4LSSL 2C9AA 3BH9B 3U7YL 1JGDB 4UT7H 4FP8H 5DVNA 1S7SB 4LFHG 3SKUD 2O93L 5E8DL 1A9EB 3PHSA 4QEGA 4WU7B 5GRUH 3DUSB 1CI5A 5I1DB 1ZS8A 5ANME 3HE7D 3MPCA 5HHME 3D85A 4QXWA 3MRRA 3LPFA 1LK3H 2DQTH 4HCRL 4LU5H 1R3JB 1SYSA 3H9SB 1B3JA 4ONHA 2LU4A 5FHAH 4OF3A 4EN3A 1BLNB 2HVJB 3GBLA 1NEZA 1HSBA 1S9KC 4A6YB 3BKCH 3PQYA 5H8DA 3O8XA 1HH6A 3GRWL 4M6MH 5GRWA 4POZC 3OKMA 3TN0D 1T20B 1SM3L 4P2CG 4U6VH 5BZWB 1N3NB 1OCWL 4OD2B 2CKBH 3ZL4L 5D93C 4D0BB 4MXWH 5C7XL 3NCFB 1IGJB 3BP5A 3RWGA 5K93A 4ODWA 4QRSA 4U1GC 1HN1A 4PJDA 3KPSD 5F9DC 4NQED 1A7BA 5T1KA 4IBLT 5JXED 3BPNC 4LARH 3RL2A 1SVCP 1KPVB 3VI4F 1I1YA 2X4TA 2ADGB 4WI5A 5JW4N 3BQUA 2IBZX 1CXIA 1FNGB 4RRPG 1XFPA 3R0NA 4R0LC 4EIZC 4WWKB 2DB8A 2DLIA 3P4MA 4P2QB 2X4NA 5BS0B 2D31A 4PRHE 4H1LH 3BN9C 3MACH 2EKSA 3P9LB 4YNYB 3LV3B 1CTNA 3MTRA 1TZIB 5DUML 1P4IL 5E1AB 1EBPA 3H7LA 2MPAH 2JK5B 1QFOA 5TFSL 5DVMA 4B50A 5HDOA 4F7TB 2NY6D 1UWGL 2GJJA 3VWJC 3BO8B 5D2NC 3KPTA 4ZDHB 5IW3A 1YA5A 4E5XA 1UEYA 3CFKB 1V7MH 3GSOB 4X7TB 2GUOA 3U30C 3ZKSD 1N59B 1F13A 4HFUH 4G9FB 1NCCL 4GH7B 4M61A 1M71A 4KAQH 4Q2ZA 4UV7L 4LOUC 4NPYB 4MCZA 1JWUA 3G08A 2EIZA 2FLBT 3K8KA 5T3XE 1BWMA 3QFJB 3OQ3B 5E7BA 3WXVH 1KNOA 1FVDB 4X5XB 4F3FA 3HRZA 2CH8A 4WI2A 1IT9L 3DARA 1OD9A 4NT6B 5TE7L 3MYJA 2A9MH 5E9DD 3W9DB 1DBKL 2VRAA 1NAKL 1QUNA 4JREB 4BSVA 4PG9B 4XBEH 3OMZA 4CDHA 1J12A 3AXLA 4M9OA 1YEHH 1J11A 4CVWA 2IQ9H 3FT4B 2HTKD 1FG2B 1YEFL 4P5MA 3JTSB 3P0YH 4PV8B 1I7ZB 5IJKA 4WTZG 2V9TA 2J88L 4G5ZH 4MQXD 1U8NB 4I0KA 4KFZC 4PJBF 3PWJA 4WWKA 2AERT 3V0VA 3QFJD 3L3DA 1MCDA 3MV7E 3S37H 2B2XH 3RVXD 3ESUF 5INCB 3OXRB 1XAUA 4LCCC 1RURL 4M1DH 4CADB 1FRGH 2GK0B 4OCWL 3T0EA 1INEL 1LK3L 2DQTL 3M45A 3OR7A 2CLZB 3VRJB 2YXMA 1MQKH 3B3IA 2AK4A 1ZGLB 3REVB 2IBZY 4PJFF 1C5DB 1YNTB 4RGMB 5LXGH 3IJSA 4DN4L 3MGTB 3HUJE 4G6MH 3FT2A 1T2JA 3EBAA 2KPNA 5D1ZC 5CEYA 3F7YA 2DQIH 4GRLA 1QA9B 1KTLA 3C8KA 2EICA 1F58L 5GSVB 5LCVH 4QXUL 4X5LA 1MCPL 1OCWH 2W0FA 3MRHB 4HH9B 4TVSa 3NGBC 2FX7H 1MCCA 3M17B 1YEHL 4FNLH 4OFYD 5HYQB 3KDMA 1AGFB 4YXHH 4OCNC 5BVJA 3WN5C 4L3AA 1KCRL 4F3FB 2JIXB 3O11B 2EH8L 4MJ5A 2EDRA 4CN1A 2ICWA 2A83B 2DQHL 1JMXA 2ESVB 5DD3H 4NQCE 1WIOA 3HNTH 2J8UE 3T1WA 4OGXH 4JM4H 1FNAA 2HH0L 4ZYKB 1QYGL 4PGCB 2Q6WB 4YFLF 3MQIA 2UY6A 4PG2A 3MV9A 4X98B 1O7SA 1RJYA 3TA3B 2IAMD 5SWZE 2IBBA 3BZFB 3S36X 5JDJA 5FA4A 2Z92A 3G04B 3UCRA 3MROB 4KRPB 2A6KA 1N7MH 2K3TA 1OW0C 2A73A 3VWJB 1HXMA 2IFFL 1J18A 4FTVA 3NCEB 4X9GA 2X89D 2VSDA 3JV6B 3VGDA 1V3MA 2F53A 4YDLC 4LHUB 2X4RA 2CLZA 1MHEA 1CZ8L 2X1QA 2A6JB 5CIPB 1I3GH 3L5WA 2ZNXA 4XAWL 4EJ1C 5JHLH 3TBYA 5B8CA 3ARDB 4EQ2A 2WBJC 4YHML 3S36L 3KLAA 5JOPD 3VG0L 1P5VA 3LS5H 1BAFL 2IAND 3RY4A 4P9HL 1D5BB 1OD7A 4HS8L 3FRUB 4HK0B 3V0WL 4KGLA 4HUVB 5IQ9A 4CVZB 4MAYA 5MERB 4M4RA 3DO3A 4M1GL 1QYGH 4HWBH 3VGGA 1X9QA 1LO2H 2DQCH 2XZQL 3NABH 4HXBH 5CJOL 5E2WH 2X4UA 3EFDL 4G7YH 4LSQH 2F9BT 1A4JA 3RY6A 3GUTB 1XGQA 1CE6B 1OB1B 1JYWA 4TQEL 2CRYA 5FKPB 3T2NH 1G9MC 1JRHL 1QSFB 1JHLL 3QWQB 4JE4B 5FGBA 1MCWW 1RV6X 2PW2A 1LE9A 3CVHH 3HE7C 2P7TB 1DANU 5K33A 3I75B 2XKSA 4MJIA 4S1RL 1T5WB 3CVHA 3VW3L 4NC1C 2Y5TB 1CXFA 5E5UB 3T0EC 4QCIA 2HG5A 4LIQH 4OV5B 3HC0A 5F89A 5IROC 3SE4C 1N6VA 3G6JF 1RIHL 2YEZA 2APWA 3S5LG 3QPQC 5EPMB 5F3BA 3S4SA 3UTSD 1N5AA 3BUYA 3SJVD 4X6DB 3BP7A 3RWCA 4RMRA 3WDIA 5HHPB 4UDUA 1E6OL 4JZNA 3EGSA 4HDIA 5J6HB 5FA3A 1Y6NR 1XGUB 3GSNB 4TYUA 5I1IL 3I2CH 3O41B 4MNQA 2BRQA 2BHYA 4R2GC 5GIRB 4OFYA 5A2FA 4WTZA 1ZSDA 3B6SA 4U1HA 4MD0A 4G6AC 1GZQB 3W5MA 4YFEA 1JPST 2BMKB 1UA6L 2IQAB 1I1AD 2YUXA 3BPNB 4K8RH 4LPWA 4DOHE 4Q9QH 3TH2T 2ICEA 1BD2B 5EU6B 3B2VL 4KC3B 3V4VH 4NNPL 1KCSH 4NQCA 3WIHA 1YN6B 1NEZG 2H32A 5JHDE 5MENA 2W65B 4Z7WF 4LQFH 3SCMC 5I75B 4G6FB 4QRTB 2X10A 1A4JB 3UAJC 3D48R 4LEXL 2V5MA 4U1NA 4BK5A 2A73B 3OGCB 1Y6MR 3RX8A 5BOPA 2FBJH 3MLSL 1IC5H 4UB0L 1UB5B 4WCYL 1MCSA 1RJLA 1Z0NA 2VABB 3J7HA 3ZDZF 2EKJA 1UWEH 2ICCA 2K9UA 2P1YA 1QZ1A 5GGVL 5C0JA 5E00A 4U1LA 4L5FH 3LS4L 3IT8D 5SV3A 1YYLH 5A2LH 4WW1A 1SY6L 4UQ3B 5DK2A 5LWYH 2W0KA 5F71A 2WNGA 4JPVL 3RL1A 4HS8H 1NMAL 1I4FB 4GW5B 4P2OC 2VDRL 2FEDC 2VZTA 3VFOA 3AUVA 3F6IA 5F96H 4HDIB 5J6HA 4JDZA 5L6YL 4HWNA 4XXCA 1REIA 4HIXH 2XKNB 1G6RH 2VXQL 1DL7H 4PRNA 3SJVB 4XP9H 2J5LC 3QISA 1RU9H 3PP4H 5BOZG 1HI6B 2XZAL 4LLVA 1U8PA 4NC0B 3QHZH 3IDIB 2Q86B 3PWLB 1R3JA 1SYSB 3GRWA 4K94L 2DD8H 4XBPB 2HVJA 4QRPA 4HBCH 1YQVL 3GMOA 3MJ9L 4MB4A 5IWLC 4P5TC 1BIIB 3EYQC 3GFUA 5T5NG 4MHHG 1YMHB 3TNMB 3CXDL 2H2PC 5EZIL 3O45B 3RPIA 4Y4HB 5AG8A 3UZEA 3FHQA 3ZKQD 5EC2A 1QLRB 3PGCB 2IANB 4NYLB 5C3LD 5FM5M 1K85A 3IVKB 4D0BA 3GSXB 4F2MA 1IGJA 2GJ6D 4H25A 3L3JB 5L2JB 4ZFOA 3F8UB 1Z5LB 5JQHC 4G8IB 1NBQA 5IKCA 2Z31D 4U2YA 4X9FA 3P73B 2DWDB 4JGUA 4ODTH 5HHXL 1DUYB 1NCBL 1NGPL 4L8SA 3RWHA 5L7XH 4OFDA 4ZOBA 1QQDB 1IC1A 1PZ5B 5IHZA 4O4YL 2VDPL 4NBYB 1YNKL 1D5ZA 3AS1A 1S9WB 5ACMA 4NT6A 2VXVL 1Z9SA 4IRZL 2AAVA 5EUOE 1J05A 2XG4A 4MAUL 4K9EH 5C08B 1AO7D 4G6JL 3B2VH 2Y5EA 2HFGL 1QRNE 3TYGL 4JFXB 5H37H 1YUHA 3L6FA 4WO4A 1A21A 4Y5XA 3WIIH 4HG4K 5A16B 2AEQL 3MV8E 2I9LA 3BP4B 3MRKA 5L2KD 1OPGH 4D9RD 4GKOA 5E8OA 1GHFH 4OGAC 1MCKA 1KB5A 4P48A 3RVWC 3RWDA 3VU2A 5I1AB 3BO8A 5KAQF 4EOWH 2F5BL 5IM7B 4J4PC 1HI6A 4OD3H 1CU4L 2YHGA 4N8VG 4FHBD 5DEFB 3DURB 1NC2A 1YY9D 3VFSA 2C3VB 3SCMB 5LBSL 4DKFL 1AIFB 2BNQD 2X9XA 1FFPB 1EFXB 4K7PY 5JO5B 3MV9B 2G60L 4LSPL 5DT1L 1F90L 4NN7C 4GAGL 3SQOH 1YEIL 2IANA 1G0YR 3HS0A 4JRYA 3IAGC 5MI0B 1ZVYA 4TSBL 3GJFA 4N8PA 4AIXA 1X5GA 5D2NE 4D9LH 4YDKH 5J13B 3WKML 4XH2B 3TIEB 5FUCC 1ADQL 1P9MC 4UILL 4EUPG 1T22B 2DMBA 2XTJB 3C6LD 3T04D 1MFBH 4WIQA 2EIDA 4PV8A 1GC1L 4HCRH 5AZEL 2OXGA 5DR5L 3SDYL 5IK3B 1R5IB 1OY3B 1XMWA 4YWGH 1MRDH 4DVRH 4CRPA 3KYMB 4X9IA 2YA1A 4H0GA 3RUGA 1VADB 2CLVA 1WUNT 1A3RL 4YHPA 4WFGE 1TCRA 2O5YH 4DW2H 4B0MM 2YRZA 3HUJB 3UZVB 1PJ9A 4KHTL 1HHHA 1KEML 5AEAA 3IJYB 1NLBL 1R5WB 2BVUA 2HFGH 3BDXA 4K9EC 1QSEB 1DDHB 4ZYKA 1KIQB 5KSBB 2MCPH 4LBEA 2B39A 4KROC 1EMTH 4MDJA 1GIGL 1L0QA 3FN0H 4F57L 4F80A 2I25N 3BPOB 4YR6A 4MCYB 5I1DA 1OSZB 3QQ9C 3OAZH 3GBML 4OCRL 4G80A 1TIUA 2W38A 4I48A 3ZE2E 3UTTD 2BRRL 1L7IL 1SYVB 1AGFA 3UJTH 2RJMA 3QPQD 3AMKA 2H2PD 4RWHA 2V5SA 3VXMB 1XR9A 5ALCL 4LPXA 1G9NH 4LLMB 4FQ2L 4PLKC 5B22A 1PKQB 5ETUA 3UPAA 5CJQH 1AHWB 5L2KE 3GSQB 1RULL 3GO1H 1X5IA 1B4JH 4WUUB 3BKCL 3T3MF 1A3RH 4C54A 4Z77A 3S34L 5DRZA 3H6JA 5EZOH 5GGVH 4NCDA 4C56A 5JOEA 5EUOA 3O3DB 3L6FB 3E3QC 3MUZ1 3QSKB 5HHOA 4JDVB 1CGSL 5EU4A 3QHTC 1GZPA 2K1MA 1CGYA 1KPVA 4X4XA 3IFNH 3D2UD 4Z7NE 1BQHB 3HZKA 4CBPA 2ADGA 2YD7A 5KVGH 1BX2A 5J13C 5C0AE 3U46B 2D9QB 3VXUA 2ICWJ 2YUZA 4RGOL 5F93C 3REWA 3U4AA 4LVHB 5C0NC 4N8CL 1M05A 1SJXA 4GSDH 2R9HC 4OZGB 4QTHB 2XFXA 2BSED 3L3GA 4F8QA 1OAUH 5IVOA 5EIIA 1UVQB 3QH3A 2EXYC 4FZEL 2QBWA 2R0ZH 1NQBA 4PJFB 2JK5A 5DJCB 4MGXA 5F8RC 1CICB 3PQYB 5IROA 4FQ2H 5GJTL 2ZCLH 3BIKA 4N0FA 1P4BH 1NFDA 2BVTA 2CK0L 4P2QE 3VGBA 4LEOA 1RZJL 2PXYB 1Q0YL 4YEFA 3BSZL 4JFFD 4EI5C 1PKOA 3OB0K 3QUMH 3DX8A 1YDPB 4PJAF 1J8HA 5CWSA 2IG2L 4IHOB 3I3EA 3S37L 2D03L 5T1KB 5BZDB 4JANB 2X05A 1DTUA 2VITB 1TENA 2ZOKB 4ELKA 4YHIA 5JXEA 1AQKH 1CE6A 3NFPA 3MBXH 5GXBB 3T0XA 3S88L 1UJ3A 4O02H 1HDMA 3GO1L 1N4XL 4YHPB 4KY1L 4MD4A 4PYGA 2Y1VA 2MMXA 1WGOA 1GGTA 1HHKA 1MHPH 5C0BA 3FFCE 1S5HB 3TVMA 1FYTB 3MLYL 2R29H 2YN5A 1EX0A 4QOKD 2A74B 3O3BA 1ZHLB 2GHWB 3IYLW 3NTCH 3NN8A 1URLA 1BFTA 4KVCL 1H5BB 4TTGA 4YR6B 4MB3A 5ANMB 4EVNB 1UM4L 4Q0XH 2VDRH 4KI5E 2X4OA 3C5ZA 2PXYD 4PJIA 1N0XH 1LO0L 2NY3B 3IS1X 1U8LA 4XBPA 2BY0A 2P5EB 3SE3C 4KDTA 1XGUA 3DSNA 3GSNA 4LF3A 5DD1H 3SY0B 4NC1E 4RGND 1C5CL 2MQ3A 4FFVC 3QEQA 3RNQB 3RKPA 4O9HL 4K3GA 1DBBL 1DN0B 2PYFB 1PKQA 2R0WH 4Y5YC 1KEGH 3CMGA 1KTRL 3MFFA 3I6KB 5E99H 3A6OA 2MPAL 3BHBB 4ZQKB 3HUJF 3DWTA 1PYWB 3CXHK 1NC4A 3CC5B 4G6ML 4R8WH 4M00A 5EU3B 5D2LF 1HHJA 5D7JD 3RL1B 4ZXBC 3BE1H 1IM9D 4DAGL 5B3JE 5FHBL 3WLWD 4JANA 2NY1B 2R29L 4NKIL 3SEPA 5DMKB 2NTSP 3Q5TA 1Z2KA 3DMMD 4HMDA 4IMKC 5KBNC 3QO1A 3QHFL 2QL1A 1FGNL 2IPKB 4GOSA 3QFDA 3QXVA 3QR2A 1A7PH 1C08B 3WN5A 5M7QA 1CXHA 3WLWC 1LILA 3L3HA 3MJ9H 5LAXB 3WEXB 5T3XH 1RUPH 4RFOL 5AYUH 1UXWA 3VXUD 2XZCL 4X6CE 1JGEB 4R7NB 2JJTC 2FR4A 3LEVL 1DANT 4MS8D 4J3TA 1FYTA 5HYJA 1ZGLP 2C7UB 5BJTB 3WFCH 4FFZH 5DS8A 1KLUA 2AK4D 2SEBB 1PKQE 4Y19A 4DUVA 5C0CB 3KNBA 5EUKB 3LZFH 5B3NA 4ZNEA 2W1NA 1WWAX 2BSTA 4PRPB 4FQHB 5FXCH 5FV1L 1DUZA 4KZEH 3G5XB 3CFBA 1H3WM 2VXUL 1NSNH 4DN3L 1UYWH 2PO6A 4UIKH 4HXAH 1G7JA 4BQ8A 5EA0L 4XWGH 4FFYH 2LAAA 2UZIH 1OLZA 1PEZA 5HHNA 2IADB 1KTDA 3VXQA 1JMZA 1CBVH 3SO5A 4XMPH 3NMEA 5DI8A 5E08L 5CS7A 3VWJD 4S1SH 2JIXA 1FAIH 1NANI 4N9OB 3FQXA 4L4VD 3MCLH 1D5IH 1XEDA 4XPAL 4GXVL 3EOAA 1W0WB 2OXHA 4IDJH 2FO1A 1N3NA 1CFBA 4JREC 4KUZH 4PRPD 1W72A 2DM3A 4HUMB 2Q3ZA 4OKVB 4Z7UF 1MRDL 1JVKA 4XWOD 1VGKB 3OPZL 2FD6L 4JR9L 2J2ZA 1RJYB 5CHNB 3ULUE 4Z95H 1X5KA 4QRQB 4R9HA 5FUZL 1MFEH 5L88H 3WNLA 4QOKA 3SE8L 5LAXA 1WEJH 3PUCA 3MRRB 1BM3L 3DRQB 4NQDA 1ZS8B 4TTDD 4FQCH 4BSWA 2ORBL 4NKOA 1UM6H 4AM0A 3UC0H 3LRGA 1LP9E 2WUCH 1IQDA 2HFEA 3DLQR 5FGBC 4QRUB 1WFUA 3E2HC 4TSCH 5ACLA 3LPGA 2BOBB 5I9QB 3CVHL 2QLVB 2H2SD 2EO1A 1INQB 1TCMA 3MV9E 2IAMA 2LFGA 1X5JA 1WBYB 2ICWI 4LVNB 1MWAH 4NRXB 1NJ9B 4ZXBD 3KXFB 1IBGL 3VXRD 3HC3H 1NSNL 3N0PB 1N8ZA 1RK0A 3BUYB 1GOHA 1NAMA 1GGYA 5IQ9B 4R8WL 3ZMRA 3TT1H 1EMTL 2X89A 1SYVA 3VXUE 4M93B 3VXPB 3MNVB 3PWNA 5E1HB 3RDTD 4LGRB 3CXHJ 1NKRA 4RGNC 1KNOB 2JELH 1UENA 4WRLA 4JHWL 2HT2D 1C1EL 4W6WB 3LPWA 1A02N 5I75C 4RMSA 5IOPB 5C2BH 1FDLH 1EBAA 5ESQA 3W5NA 5FYJH 4X8JB 3NACL 4U6TA 1ZOXA 4HUUB 2GAZB 1R5WA 3UTSE 4LVNC 4OGYH 5JIIA 3G5VA 4GRLD 5CHNA 3QEHB 4UINH 3KNBB 2AQ3A 3MLUL 5HGBB 2XPGA 1AGBA 1QFUH 4MQ7B 4NKMB 2PKDA 3VGAB 3TFKD 1KPUB 4PB9L 2NXZD 4JPWL 4M93C 4KKCD 1QACA 3ZE2F 4JJHA 1SEQL 3MOAH 4JFFA 1T7WA 1CTOA 4EBQH 5C0RL 4YZFF 4ODUA 3WHE0 1S7XB 5HDQL 3VE0A 3GMQA 4FQLH 5HJ3A 3TO4C 5D5ME 1ONQA 2F53D 2ITDA 2WQ8A 5FYLL 1CT8A 5I66A 5I1GL 3CFJA 3FFCB 3LVEA 2FYYB 4Z5RA 3TH3T 4KKNA 1N26A 1F3DH 4U3CA 2WBKA 1IT9H 4NWTL 3V5HB 5J0BA 3FCTA 1JJUA 5FYKL 2H3NB 2MWCA 1K8IA 5FUCE 2J4WH 1BF2A 1BREA 4KQ3L 4OZHF 3LN9A 1ZLSL 4I2XA 2OJZL 5HHOE 3VXTA 3MRHA 3FT4A 2B5IB 4NZDA 5TQ2L 1E4KA 3QWRD 4LSUH 4OKVA 4NGHH 4ZFGH 4IMLB 4PGDB 1ZLWH 2MQCA 4LASL 4QHKJ 3VXRB 2ARJA 2NY7H 2UYLA 4YDLB 4KQ4L 4JR9H 4X6FA 2EDXA 4OD1L 3RI5K 5FGRA 4HC1L 2PO6D 1QFHA 2VDMH 4I48B 1TTGA 4JKPH 3U36B 1EO5A 4I2XE 4GRWH 5IHUH 4X8JA 2GY5A 2JJSC 3KJ4B 3GSWB 1BJ1J 1A14L 3V5KB 4GAJH 4I77L 5IG7A 3LQAH 4L4VA 4PB0H 1FL3A 1EEYA 3BIKB 3GRWH 4GW4A 4M6ML 5SV4A 1IC4L 1OQXA 4RZCA 5J1AA 5IJKC 4M8QB 1AQDB 1RK0B 4P23A 1QFPA 3LKQA 5GSVA 5SWQB 4G8IA 1IAKB 3BGMB 1ZVSB 4N8VB 3LEYL 3FRPG 3DMMA 1RVFH 4JDZB 1T4KA 3HAEH 3UTQA 5GZNC 1F6LL 3S98A 3PGFL 1YQVH 2X4QA 3OAZK 1P7QD 4K3JL 1U3HD 1FE8H 2OL3B 1AGCA 2HA1A 3EO1B 2H3NA 1I9JH 4WV1A 2YSSB 1D6EA 5D7SH 2BHUA 3SDAC 2A83A 3ZTJG 5IOPA 5FB8A 1AKJA 3AU1A 4HH8A 3C87A 4I0PC 4OFVA 1BD2E 3MLZH 2AP2A 4NSKA 4QHLA 4PJDB 3E3QE 4O58H 4P9ML 3MXVL 3LRSB 3FQWA 3TA3D 3RDTC 3DJ9A 4JFHD 5E99L 3MRLB 3LRHA 2NXZB 2E6QA 3HE6B 4L8SC 4NQUA 1S78D 2JLLA 3Q0HA 3U30B 3KJ6H 1E4XH 1N7ML 3QIWC 4PUBH 1CICC 3DURA 4N0RA 4OFPA 1QP1A 4QXUH 1LE5A 4NRYB 3TZVD 2EYSA 3GHEL 3K4AA 1J86A 1BLNA 2EYTA 5HGAA 4ODHL 1YN7A 3SPVA 5EC1A 1KEGL 5T3ZL 4P59H 5IB5A 2OBGA 2BVQB 1BMGA 1AP2B 3TCLA 5IEHA 4MD5A 2BZDA 1M6OA 2YPKB 1F6FB 1NBVL 4N8CH 4UT6H 4NZUL 1QVOA 4ODVH 3RZCA 1MVFA 2Y36H 4Y1AA 2YC1A 1H3PH 3MJGX 2Y06L 2B20A 4PREB 5L0QC 3OKLA 3B83A 4LOUD 2BNQB 5JR1H 4O58L 3BIAX 1DQQB 1U8QB 2NY5L 5DMIL 2C1OA 5C3TA 2MFNA 2AXGB 2A77L 1DQJB 4JZNB 1FJ1B 5D70L 1OTUC 1S5IL 1IGYB 3C08H 4MWFA 1IMHC 2IGFL 3KPLA 4YDVA 1RUPL 2X1OA 1SJHB 4M6OH 4JDTL 1X5LA 5IFAL 1Q9KB 1E4KC 2KQNA 4Y4FC 1KJ2H 2CO6B 5J3HC 1MEXH 3RP1A 1L7TH 1U8OB 2ZUQC 3D25B 5I19H 1SQ2N 1Q0XH 3BSZH 2Y5TA 2VQTA 3F7RA 5BV7H 4LVHC 2VE6B 3BPOC 1HQ4B 2XN9E 2APFA 4JFPB 1TDQA 2O5ZL 4X7TA 4KI5C 1NCNA 2FGZA 2RFXA 1KC5H 3PJSA 1I85C 1YEEL 2EYSB 4YHLH 3U6RA 4XCNA 4PGEA 5KN5B 4TSAH 2X1WL 4PY7A 3TIDB 1XR9B 1RIVH 4N1EA 1I8IA 1ZK9A 5GRJL 3FT2B 2A9NL 3BVNB 4L8DA 5CEYB 3SHSA 1EHXA 1UKSA 4FQLL 5BO1H 3T2NL 4Y5XC 4QY8B 1I3RA 2W65A 3OPZH 1T3FA 4H26A 3T3ME 1MCJA 2X70A 4FG6D 3NA9H 4G8GE 3OXSB 1RHFA 1WIPA 1U3HB 3T65B 4Z7NF 1Y18A 3EKCA 4LVOC 2HRPL 4NZRH 3H0TB 4ZNCD 5HYFA 3SDXF 1A2YA 1KC5L 4YIQA 3MRGB 3WE6A 3FO0L 3QCVH 3PL6D 4DKAA 1KIUA 1NGYB 1UQSA 3EDKA 3ARPA 4EIGB 1DQMH 2D0GA 2GAZA 3QUYC 3NIDE 2X4PA 4R4ND 2E8YA 1BBDH 1DN2A 5ACZA 1P2CA 3LS5L 4LCUB 1BOYA 1NUDA 4UQ3A 5DK2B 1K3ZA 3ETBF 3NPSC 4FQIL 4ELME 2V7NB 3X3FH 5J56B 1HH9A 1KN4L 3BT2H 1A1NB 5J9PB 3MJ6A 1EERB 4XP4L 1K4DA 1HHIA 3IDUA 1J1PH 4JZJA 4ENED 4Q9RL 4KZDH 3QDME 3NAAL 4FXGB 3Q5YA 4P46B 2VZUA 1NMCC 3CLFH 5DYOA 5HGHB 2Z8VC 4LLWA 1JPTH 1XCTA 4PRNB 2AEIT 3MA7B 1FG9C 3N9GL 2O26U 1KN2L 1D7FA 2A0LD 2AJVH 1PSKH 2Q1EA 4RX4A 1B6UA 5EO9A 4R4FH 4WEBL 3TZVB 3P9MB 4L3ED 4QHNB 4I18A 2FH8A 4HIJA 2BNRB 1JF1B 2ZCKH 4JZOA 3ULUC 1H15A 4NQDE 5I18L 2FEEI 3UROR 1ZHKA 1OAYH 1LHZA 2ZUVA 1ADQA 3I3DA 3U0TA 5MEPA 5FYJU 3ARTA 4Y4HC 1KCVL 1AE6H 1KXTB 1X4YA 3ZSTA 1ADQH 1UZ6E 1VEMA 3JV6A 1CDYA 3WHE1 4OLEA 1CD1A 3NZ8B 4S1QL 1XF2B 4JFDB 5D96B 1AIFA 4L3EE 1E4XL 1Q9LB 4C58B 1QQDA 1GXEA 2KBGA 5D2NA 5M94B 4JCLA 1HH6B 3LEXB 4LKXB 2EECA 4NUGL 3V6OA 2FJGB 2CRIA 1A6VH 2Y07H 3BKJL 4M7KL 1U58A 4YDJA 5E9DA 3ILPB 5ISZD 3UTSB 4R97B 1LO5B 3WSQH 3X3FL 3FRUA 1H3TA 4HWUA 1P7HL 3W39A 5DJ6A 3G6AB 2OTUB 4M5YH 2NY1C 4ODVL 3RA7L 2FATL 4WO4B 2M26A 1JGUL 2ZCLL 4APQC 2IH3B 4KJPC 5TGBB 4WU7A 1L6ZA 3B6SB 2PF6A 4RGNE 1J0ZA 1U36A 1C5CH 3B5TA 4XRCA 1H3UA 3OKEB 1QPPA 4F9LC 5EO9B 2N7BA 4R4BB 3HB3D 4OZGF 5HY9A 1CLOH 5JIHA 3TZVA 4X7CC 3PL6C 1FFPA 1L7IH 4Z78B 1KACB 7FABL 1L0YA 3SE9H 3T1FA 5DURD 4WW2C 2R2EB 3KJ6L 1Z6JT 2E27H 4XGZB 4JLRA 4POUB 2EH7H 4O2FA 1X7QA 4HCRA 3HC0B 5F89B 1SEBA 4N9GB 1S7WA 4GW4B 4KDVA 4QRPE 2BOCA 2VOTA 5C1MB 1TETL 1ORSB 1ZT1B 3I50H 4AEIL 4NO0A 2CR6A 1U0QA 2PNDA 4X8XA 5J9PA 3TIEA 1DEEA 1YEGL 1LNUB 2GSGB 4M7ZB 2ADJA 1M71B 1HIMH 4MXVF 1FLRL 4WHYH 5E6IB 4D0CA 2ZSVA 5BQ7A 3U4EA 2BVQA 1A64A 1ZA3A 2LVEA 2X4QB 3N85L 1RZJC 2YPVH 4Y2OA 3PV6A 1LO4L 4R96B 1IFHL 4PJXF 5DJ8B 3FQUB 3BP6B 32C2B 4ZAKA 3TNNA 4XI5D 3MRQB 4L29A 2VR4A 1LO3H 2A9NH 1KCRH 1CD0A 1K4CA 1QR1B 5C0DB 3M07A 4RX4D 4UOW0 3KPOA 2W60A 3LRSA 4K71B 3P4OA 4M62L 3DHMA 1GIGH 5E2JA 4UU9B 5IP4A 3C6SB 1EJOH 4XPTH 3P77B 5TDPB 3O4LD 3ULUF 3OXRA 1OAYL 1UWEL 3DRQA 1GOFA 3T0EB 4CADA 3ARSA 4CMHC 5I8CA 1G7JB 3ORJA 4L4VE 4JGJA 4QRPB 3Q6FB 3STLA 4ZUSA 4AH2B 4X6CB 2EEAA 4PRPE 4ZFZA 2X6MA 5FHAL 3HFMH 3P4NA 4O2FB 5L9DH 5DR5H 5IV2A 5D71L 3RHWF 3ILPA 4LASH 2VZVA 2Z92B 4LVOB 5HYJE 3ZE1F 4M7LH 1FSKB 2FDBP 4XP1H 4ZPVB 3V8OA 4H25B 4POZD 4QWWD 3LEVH 1Z5LA 1L6XA 3GNMH 2EXYD 4PRHA 4E41E 4LNRA 4C83B 1X4ZA 2Y7QB 2YD2A 1YZZA 4LL9A 1Q38A 4R0LA 4XC3H 3F7VA 1CGXA 1J8HE 1YNLL 3PABB 3DO7A 1GZPB 2AJZA 1JGUH 1F90H 3G6JE 3HZKB 3SBWA 4AK1A 3BZEB 1SBSL 3KLAB 4P46C 1N4XH 3VFMA 5IMLA 1J1XL 4MJ5B 2E8ZA 2QQKL 3QXWA 3SDDD 2F8OA 2BP3A 1ZXQA 4BELD 1A7QH 1UM5H 2P45B 1LVEA 1YN7B 1EVTC 5C0BB 1T03H 1WFTA 5I9QC 4YGAB 2RGSA 1A5FH 4JO1L 3RRQA 2AQ2A 2NY0B 3L9RA 5D1ZA 1OP5K 4RDQF 1AGBB 3C60A 4QXGH 2WIIA 2R8SH 1Y18B 2XT1B 5C0AA 3CPLA 3UBXG 3CDYA 4YK4B 3Q6GH 4PJIE 4JFPA 4GKNA 2VN4A 2ZUSA 1KYOK 3V95A 1ZLUK 1JNNH 5FF6B 3HB3C 2HLAA 3OKLB 4DCQB 2ERJB 4PJHA 4JKMA 4W68A 5C70A 4FFWD 2ZPKL 3MUY1 1WEJL 2EDNA 4Z18A 2P7TA 4YZFE 4IHOA 5EU6D 2FYYA 4MJIB 5DO2D 1YNLH 4KJWD 3L5WB 1IKFL 4NKQB 5F88B 2IPUG 2ADIA 3SDYH 3PNWA 5I1JL 1WCBB 1N64L 1K2DA 4KVNH 5IWLA 5EU5B 4YJZL 5CZKA 1WAAA 4RMUA 4KMTH 1PYWA 4JN2A 3RVUC 1NC4B 1Q9WB 3CC5A 1IC4H 1OGAD 3JWDH 1N5AB 2P43B 5EBLB 1Q94A 3F6LA 4N0YH 3GKWH 3JSSA 1H0DB 1D9KD 5E6ID 1QBMH 4HF5H 4HHAB 4XBGA 4MSWB 5E24E 4YUEH 1TZHA 1KB5B 2CKBA 4DWHA 3T0BA 4ACPA 3LDBC 1RULH 4MQXC 1BBJB 1PEWA 1JBJA 5BS0A 3ARFD 5BMFH 5E8NB 2ED9A 5FCUL 4YXKH 2DM7A 5I8CB 2GSIA 5D7LB 1T21B 2X4OB 4JKLA 2CLRA 5JZ7C 5TE7H 4UZGA 4NN7B 4H0IA 1BGXL 1K6QL 3GMLB 1A6TB 1ZWIA 3HI6L 3V4PH 3ARGA 5INDB 3CFJB 4EOWL 1W2KT 4G8EA 4R26L 1JF1A 3EJYD 2JB5H 1ZT4B 4EKXA 3ECBA 4Y16A 3S35L 5GGQH 2CO7B 1MLCA 3JZ7A 3AY4A 1KLGA 4IJ3B 4PGJA 4RRPA 5HI5C 3BP7B 1S9VA 1AD9B 3HRPA 3RTQB 1IM9B 3RNKB 2BVEA 5D7LD 1OGAB 2MHAA 1YYML 3C5SB 3DETD 3GKWL 4HUNB 3TV3H 3ARFB 4J4PA 1H3XA 5T1DL 2CQVA 1LE9B 2QHLA 1BEYH 4L9LA 2P5WD 3PNWB 3O6ML 4JG1L 3RDTA 3RJQB 4I13B 1C08A 3WN5B 1OSPH 1NGZB 1IC7L 4DZBB 1CG9B 2IWGA 2ICEB 4BKLB 1ZHNB 1JK8A 3BEWA 3MCKA 3L3IB 1NBVH 1HZHL 3BDYH 4I3SL 4LRIC 4UT6L 4HGMA 1Q1JH 4I0PB 4YO0B 1M7DB 4TRPL 5CEZE 3TC9A 2DICA 1DDHA 2Y4SA 4OB5L 4I18B 3L1OL 5E03A 5I16B 4HWEL 2XWJA 1VGKA 3GDBA 2YK1L 3PDDA 1QFWI 5IMMA 3CVIH 1U3ZA 3CX2A 4FMFA 4YPGA 4W70A 2XKUA 4YAQB 3O81A 5A43C 1UXSB 4QRRD 1HE7A 3PGFH 5JNYA 1P1ZA 3LKSB 4Z7WB 2YEZB 4E41A 2R8SL 4OGAD 5EPMA 3ZL4H 2EE3A 2XACC 4OQTH 2H8PB 1AQDA 3AS3A 3EFFB 1YEKL 4ZG1A 3HCVA 3THML 4N68A 4JY4B 5H94A 1UG9A 3QXAB 3TF7C 2EDLA 2EH7L 3DIFA 3DSFL 3U9PL 3PWPE 1T1YA 4CGTA 3TBTB 3VXQB 3QFJA 3NBNA 3T08A 5E00B 2JJTA 2CXKA 2NXZC 3DPBA 5C0JB 1QVOB 3DI2B 2QSCH 1T04A 2ZP0T 2YSSA 4XAKD 4P5TA 2YPLA 2JJSA 3BW9B 1AXTH 3NCYS 3RUGF 3P9MA 4PTTA 1KT2A 2QHRL 1W8OA 5FYKU 4K3DL 1SY6H 3OKDB 5TPWL 1H0DA 4BSJA 1FN4A 2VL5B 4XMKL 2DMKA 4WUKH 4CVUA 1JTOA 3QB7C 1WIUA 3HE6A 1H3GA 1T7YA 2DLEA 4XXCC 3S37X 2BSSB 2X9WA 3TP4A 2X09A 4XX1G 4XNUL 4OJFH 7CGTA 1B2WH 3DRTB 4EI5B 2XQBH 3BH8B 1WLHA 4LDEB 5AUMB 3IFLL 2IC2A 3D69A 3LQAL 3MV01 2PYEE 3O3UN 5CSGA 4LLDA 4RQQA 5CAYB 5FECB 2VLRE 3LHPL 5F7LB 1CDJA 4OGYL 5E8PB 2CK0H 1U8HB 4C57C 1ULVA 4X6CF 3AVEA 3WXVL 1AP2A 3GI8H 3G9VA 1XT5A 2R2HB 5GS0H 5E2TL 5J12C 3H3BC 3NN8B 3D5OF 3LQZA 2WWMC 4OUUA 4XCCL 4N0FB 1JGDA 1CXEA 2P5WE 4H88H 1U91A 2HKHH 5BCAA 3HR5B 5EB9A 2D9CA 4JQXC 1EXUA 5AAMA 4A2MA 3D9AH 4M6AA 3RNKA 4NZJA 3JXAA 1U95B 3LSOA 4ZFGL 1AXSB 1MFCL 2NY0C 1NEZB 3TPKA 3K74B 1D5MB 3QHFH 5KVFH 2GY7B 3WNOA 3QUXD 4PJDE 4ZO9A 1IGFH 3PHOA 1I3GL 1R24A 2KQMA 3IKKA 4XAWH 4AG4L 3R1GH 2H32H 5I76B 1YY8A 3ZYZA 3MCKB 3RWEB 2XQBL 1QRNB 2R2BB 3RZCD 1A0QH 1CCZA 2C5DC 4RMVA 4KRLB 2HJFA 2AJSH 1DLFH 3W2DL 4R0LB 1NFIA 3D85D 3QDGE 3UC0L 1DLHA 2M8XA 3PXJA 4PBVC 2FB4H 4URTB 3UP1A 1SVZA 5IEKB 3UAJD 4EN3D 4TVPH 4EXPX 1SEBB 3NPZB 4DW2L 4MJ6B 5FO9A 5DTFA 5JNYB 3ULUL 4Q6YA 3EYVA 5DJZA 4MS8C 1MJ8H 4RMTA 5ICYB 4U49A 3C08L 5FM4A 1BFOA 1R3HB 2NY5C 4Z0BL 4XPHL 2HRLA 3C09C 2WZPD 3GIZL 4Z7QF 3FZUD 3PJSB 2H6PA 5GGSY 1HQRB 3EO9L 3V79C 3LV3A 4ONFL 3WD5L 5HVHB 5LGHL 5BQ7B 3SY0A 1EGJL 3WMSA 5DQ9A 1A1OA 3KPSA 3QAZB 3G9AB 1X44A 1EUUA 1VCAA 4TUOB 2J8UA 5GHWH 5FYKH 5GRZA 2VZOA 2GI7A 4LSVH 5C08A 4JFQA 1YC8A 1DCLA 1E27A 2BJML 3QDMD 1G7PA 1OQOA 3GSOA 3C6LB 4PJHB 4I8DA 3TPUA 3V7AG 4OCSH 2C3XA 2VSCA 4NWUL 3DMMB 2VZ1A 4HGWA 4C4KO 3K81A 3UTQB 2ATPB 4EI6A 4KQ4H 3VXMA 4PJGF 3Q6GL 5I30L 5IVNA 5DLMH 3FQRA 1WWCA 3H0TA 5D7IF 4AG4H 4JPWH 5HI4C 2X9YA 1C12B 3P9LA 1F6AB 4YNYA 5IT2H 4HULB 4Y2DA 2RAMA 5JTWA 4AH2A 1T0MA 2JJVA 4AEFA 1FGVL 1JGLL 1DLHB 3EYQD 2BC4B 3NTCL 5IG7B 4A2LA 4G6KL 3D0VB 3D2UA 1EZVX 3Q3GA 4ZPTB 2FIRT 1CFVL 3EO0B 4HKXB 2FSEA 4PTUA 4HPOL 4YHLL 5KS9E 3GHBL 4M7ZC 2DQIL 4U1JB 1BOGB 2XN9A 2DQUL 3CFKA 3KPRD 4L3EB 2DQGH 4Y19D 1TVBB 5JMOC 2NZ9D 5D6CA 1PY4A 4GKNB 3IDGA 3IDXH 5J06A 3K8MA 4I4WA 3BJLA 3GSVB 1X5HA 1LE5B 1C7TA 2NLJB 3TM6A 4GLRH 1GGBL 1NCUA 4ORGA 1N64H 4KVNL 4YFLI 1R5IA 2DI7A 5CP7B 1DFBL 1K5NA 4YHNA 4KI5D 3VXSB 1KENH 1MUJA 4JGMA 1CE1L 4U7MA 3NCCB 1G0DA 4FMKA 1NCCH 3K3QA 1WBZA 5LCVL 3BFOA 4TPRH 5LJYH 4N5UA 3FT3B 2HJFB 4IRZH 1EDQA 5JXAH 1AQKL 4L4TB 4XNXH 5GS2H 3PP3H 3KLHC 1IQWL 2FRGP 3OKKB 4NQEE 3U48A 3X14B 4P2QD 3PWJB 3QIBB 4UNVA 1MI5B 1GPOH 5I1KH 3QPXH 5DGQA 4M5YL 3CFDB 3RA7H 1RFDH 5E7FA 2XA8H 1U92A 3EYUL 1L0XA 1R3HA 3VDBA 4CAGA 4XC1H 2YD4A 1BBDL 4XP9L 5F9OH 3QH3B 3ZKND 2Y9RT 4UI2A 4YGVB 3RU8L 1FZJB 4FQXD 1PX4A 2BVYA 2R23B 3AM8C 4X98A 4JFDA 4LKCB 3WUWA 5F7EL 2PR4L 4ALAH 4GRLC 5DWUL 2XWJB 1MVUA 4QRUA 1EK3A 4KKLC 3TN0B 5JLZA 2VNCA 2F19H 3THMH 3AGVA 1RHHA 4UBDD 3H3PL 1P4LA 1CXKA 3SE3A 5TDOA 5EG6C 1AI1L 4IS6A 2RR3A 1NC4D 1ZEAH 4XPFL 3CX5K 4MJ4A 1FNLA 4KTYA 4PJ9A 1JN6B 3RVTD 4OI9A 1MCQA 4L3CB 3G6AA 4LHUA 5KVEL 5DUMH 5E8EB 4H88L 3QDMA 1MHEB 5F6IC 5F1IB 3MGOA 3QNYB 2K7QA 3QEQD 3AREB 5I18H 5ITBL 4DGYH 7FABH 4M3JA 4MJID 6FABH 3DXAB 3HAEA 5TF0A 2MKLC 4QTIL 2O61B 1IAOA 3WIFB 4NUJA 1KIRB 4GBXB 1WJ3A 4AQOA 2BDNH 3S4SG 1AGDB 3VXSD 1VA9A 4IIQA 5T1MB 1U8IB 2D7TH 3FJTA 3BPCB 2WWKT 2Z8RA 3WFEL 2HTLC 3OXSA 4I77H 4EXKA 2GTZB 3GM8A 2JTDA 3VRLE 5D96C 5T3XD 3ARBC 2IPKA 2OYPA 1H5BA 4Q9QL 3H8NA 5D7IB 4JRXE 5I15L 5TH2A 1I1RA 1VFAB 2X4RB 4E42B 4DZ8A 3ZT5A 4Z7VB 5SWSE 4U31A 4JQVC 1OHQA 5H37G 1NGYA 1UQSB 5EBWB 5SWZA 3BMWA 1U42A 5DS8B 3P30L 4G7VH 1C8PA 4W81A 5DURB 2PYFA 1M7XA 3OAUL 4R96A 3RUGE 3VGFA 5C0IB 4L8BB 1VKXA 4XVSL 5DHXB 3BPLB 1E6JL 4XPTL 2X5PA 5E6ZA 3P11L 4P4RB 3TYFB 4FQ1H 3RWFA 3C8DA 3ZE0E 1S7QB 1JZ8A 3LDBB 1ZT7B 4U1GB 2QV2A 1XGYL 5E4EC 5IF0A 3BZEA 3VH8B 3QUZB 3MR9A 4KMLB 2BSSA 1CFTB 4MDIA 3U36A 5IW6A 2V7HB 4ONGL 3QXAA 4F57H 3QIUD 2H41A 1CFNB 4ONOA 1YYMH 3M8OL 2FD6H 3O6FD 5DZLA 1FZJA 2B0SH 2C3VA 3UYOD 5FKAA 1F5WA 4KPHL 1W72B 5C0FA 4HWBL 2F54E 1D5XB 2DQFA 4NQSB 3CLEH 4XNYL 4JFDD 2AK4E 4QRTA 1RUKL 4GQ9H 5L8KB 3RQ3A 2FL5B 5MEOB 1FORL 4OUUB 2P5EE 3R8BB 1UCTA 3VD7A 3RIAF 4FQIH 5LGJA 5CD3A 1OM3H 2AJSL 4MVBD 3MNZA 5FK9B 3CU7A 2DD8L 4RISH 2ERJC 1EGJH 4DK3A 1EUTA 1L9NA 5E5RB 4JFYA 5CBEA 2W92A 4FZ8H 4KK9C 3GBMH 4WFFE 4XWGL 1B88A 1F4WH 4M6NL 2X7LB 4M7KH 2VXQH 3ULVE 3VMNA 3WL9B 1A7RL 1VHPA 3UTTA 5TDNA 4K55A 3QYCA 4WUUA 1JPSH 3F5WA 5C08D 2V5TA 3E6HB 1NGQL 4IRJD 3QCTH 2DYPA 1AFVL 1AD0B 2ZZUT 4HIEA 4KK5C 4O51B 5AD0B 1NMBL 2VISA 3BWUC 3CFEB 2PETA 3H42H 3DUHA 1DBML 4NHUA 5L88L 3LQMA 3LQZB 5D1XA 5D9SA 3ARDC 5IEKA 1N2RB 5J11B 2VAJA 1B6DA 4J1UB 4U6VL 3WCYA 4PV9A 1UFUA 3ULVD 3QNXB 4Z7QE 2V6HA 3LOWA 1IAMA 5I74B 2EZ0D 4HMEA 4RISL 3GMOB 1P6FA 1MY5A 2Z31C 4WWKD 3KLSA 3B5GA 1FO0H 1LD9B 4OLUL 1LEIB 8FABA 3EYUH 1OAKH 2ZNWA 4JLRB 3PP3K 4OBRA 3CUPB 1T5XA 1AY1H 4XNYH 5E2WL 43C9B 1VERA 3NIDF 3WBDA 4Y5VA 4NKMA 3UJIL 3O2WL 3GHEH 1W0WA 3C8KB 5D7LE 4FXKA 5FYLH 4NM4L 2FX9H 1G1CA 5LBSH 1ZLVH 2QSVA 4G7VL 5DQJB 4XVJH 3TT1L 2CK2A 2VITA 1J7VR 4QHUA 4WNQA 5E6IA 2G5BB 4D0CB 1JHLH 1WZ1L 2VLJD 3TLRA 1VDGA 5TGBA 2J4WL 1J8HD 1J05B 5L0QB 3SKNA 4LLQA 2AJXL 3SDAB 4UT9H 1TJGH 1IEHA 1HYSD 1KV3A 4GMTH 1NMBH 1DQLL 4Y1AD 2ZUWA 4ZSOB 5DJCA 1CDCA 1KJMA 5HGBA 2X4UB 2EC8A 2R2EA 4TULL 3BEVB 3PIQA 3B9KB 4H20L 3CLEL 4LMQE 1EJOL 3QXTA 3QDHA 4NRXA 2AV7A 2UUDH 2ADFH 3O3EA 5IM7A 5C9JA 2X4SB 4UV4H 1RZKH 5D5MB 1NCAL 3QA3B 1NFDE 2JKXA 2X4NB 3WSQL 4S0TD 1X5XA 3A6BH 4PJIB 4BQ6A 2GJZB 5K59E 1NPUA 3GIVB 3ZTJH 1GL4B 3DYOA 3I75A 4LCWD 4PG2C 2NX5D 3TBTA 1GPOL 4GUPB 3TBYB 5B8CB 5I1KL 3I6GA 4PJBE 2YBRB 4R2GD 4WGVB 3RDTB 2Y36L 5ACZB 4HJ0C 4PRBB 4YHZH 5JLZB 3SGKC 4X6DF 1RHHB 1HEZB 5ID0B 1SMOA 4YHNB 4GJTB 4ISVB 4D9LL 1NGXB 4KGJA 3O4OC 4Y2DB 1JHKL 1FIGH 2FX7L 1FAIL 3QIUB 3A6CH 3FB6B 3ARQA 3SGEI 3DTXB 4X6DA 4O51A 4ENEC 5HHPA 4FFWC 1CDBA 4G8FB 3BGMA 3QEHA 3D3VA 5DYOB 3BWAA 5TF1H 1FH5L 1WICA 4X4YB 1U3HA 3BE1L 5DD3L 5FO7A 4NIKB 3FB5A 3T65A 4XPGL 1FVDA 4X5XA 3P4MB 5IB1B 1LEGA 1SY6A 3AROA 1JV5B 4WVRA 4FQJL 2G2RB 2RIKA 3WHXB 1OF2B 5EU6A 2BFVH 1AJ7L 2Y72A 3GSWA 5IFHH 4EUPB 1Z0MA 4JJ5B 4F7EB 5I66B 4JO4L 2VMFA 2BNRA 1FQ9C 2YPLE 2YKLH 1KCLA 3PL6A 1R3LA 5IVXF 3DX9B 4OZFA 5F7DA 3FFDA 3KR3H 4BYHA 5EN2A 2VXSH 4P2RA 3OKMB 4HEPG 4NFCA 3MLTB 5H2BB 5EU7E 1H9VA 5D1XD 3HZMA 1JPGB 1T0NA 2GFBA 3VFUA 2WBWB 4XCCH 2J1KA 3I2CL 1XGTA 43CAB 4P23B 4JG0H 1J0YA 4O00A 4FTVE 4YPJA 1KJVB 1XF3A 2VQ1A 2VXUH 3CFCL 1INDL 4QWWC 5E8EA 3JVGC 4FXGA 3X14A 1BJ1H 4X5WB 4EDWH 4NOFA 3MGOB 1BJMA 1Q1JL 5LGKA 1OPGL 2JB6B 5MP6H 5HYIA 1G7LB 2C4FU 1AKJB 2YOCA 5KSUA 2ZUXA 2R2BA 2R0WL 4XVJL 5EUOB 4C55A 4NJ9L 2WBJA 3WFEH 3W39B 3RVVC 1F3JB 2J6EA 5KSBA 4JFEB 4OSUL 1DSFH 3FTGB 4K8RC 4PJCF 4X7FC 3BWAB 4YH6A 2J6EH 1CVSC 1NH6A 4OM0H 3QXDA 4LCWE 3B9KA 2WIIB 4O2EB 5KVGL 1U2CA 1CFQA 3SJVA 3V6BR 1NMCB 4MWFB 2PUQT 4YDVB 4MA1B 4U1NB 1FAKT 2FX8H 2NR6D 3OAYK 4M8QA 1FV1B 4QTHA 1RZJH 3N50A 1EXUB 2XWBB 5HY9B 1IM3A 2QQNL 1M05B 4JRYE 1FLTX 4YHKH 5TH2B 2XZQH 1CD1B 4DUWA 4HIXL 5HYSB 2VLKD 2R4RL 3HI5H 1AR1D 3RI5F 4KXZI 4DGVH 1TMCB 3ARGB 3SOBH 1BHGA 3RPIB 5C0BD 2VLRA 4P57B 4NM8L 2EC9U 1MCOH 4PJEB 3QQ3A 2R1WB 4LEOB 2AQ1A 2YPKA 5ADOL 1QD0A 4KJWC 5DRZB 5FM5O 4HIHA 2PYED 4PGBB 3O0RL 1MCRA 1E4JA 3VFPA 1XF3B 4KTEH 3VA2C 3OX8B 1WF5A 4OB5H 1FG2A 1W0YT 2DWDA 3D3VB 3TBSA 3RU8H 4GAYB 3QJHB 5CJXC 3CJJA 2Q76B 1UJ3B 1WVZA 5EZLB 3RVWD 3LKNA 3FAXA 4HV8A 3GJFK 5DJ8A 4NWUH 4MAYC 3X11B 2WLYA 5EBMA 1WC7B 4MNGE 3STBA 1QBBA 2WBJB 5ESQB 4K2UL 4PLJD 3GSUA 4OIAA 1QBLL 4F7EA 3PGDB 4NKOB 4MA7H 2CLRB 1YPZB 3QUYA 4ZFFA 4Y5XB 1RZ7H 3OAYH 1BIIA 3Q3GB 4MD5B 3QNZB 4OGZA 4S1SL 3P0VL 4LCCA 2Q8AL 1INEH 1OARL 2OR8A 4A6YL 3PWUA 1DJSA 3MV11 4AT6A 1VKXB 5DEGA 4RGOH 1AC6A 1K9TA 1F11B 2OZ4L 2BDNL 1VEOA 5T1LA 3SO3C 4MX7B 1NGPH 1YECL 43CAA 5CD5C 3MRGA 3WE6B 3EOBA 5IVXA 2DAVA 1MJ8L 1YMMB 1FL6B 2NW3B 5IKCB 4MMXC 3JWOC 1BFSA 2DTML 1FL5A 4BA8A 3NIFE 1I8LC 1SJEB 4K3EH 3QEQB 3RNQA 5FYLE 3C60C 1MCHA 3OKNB 3FCTB 1MFDH 2V2XB 1T04B 4JB9H 2DDQH 1HIML 4BKLA 3NA9L 2K7PA 1U6AL 1T3FB 3DYMA 1OAKL 3OWEA 4H26B 4X6EB 1OOAA 4X9HA 1OP3K 4X4MA 2A6DB 2AXHA 4JQXA 5F7KC 3GUTA 2XWTA 3DNKA 1PLGH 1FC2D 3MMEB 4MNQB 5TQ2H 3T8XB 1A6PA 5GGSA 3TWCL 4MA8L 1A6UH 3VWJA 5D72L 3SDDC 3ARED 2VXTL 3KPRA 2WIMA 4Q9CA 4G9DA 3BKYL 1RQ5A 4ZUUA 4BH8B 1T89C 3UTZB 4ODSH 3P2TA 4RNRB 4MLSA 5EZOL 1OTSD 5JQ6H 2UZXB 5C92A 4GT7A 1JGEA 4R7NA 4OLZH 3QUXA 2NYYD 1YNKH 2HG5B 1JNJA 1DQDH 5FDYA 4PJ8C 4UT7L 3PQYE 1RVFL 2R0LH 1KJ2B 3QDJA 4MCYA 4K7PX 5HHQB 4ZUVB 4RWYH 4AMKH 4PJXA 5JPNA 1WZLA 2QEJA 1MRFL 2PO6B 4OZIB 2GJZA 2W9EL 1MJUL 2DTSA 1H5BC 2UZIL 4PIRF 3OZ9L 4UTAL 3QUMA 4K7FB 3QRGH 4GG8A 3O6LH 2Q76A 3ULVC 5ETUB 1RZKL 2O61A 2FJGA 1J0IA 2N1KA 4NUJB 3KYMA 3ULUH 4JG0L 1YEFH 4K94C 5E5MB 4KKAC 4DGYL 1RK1B 1SM3H 4JVWA 4MXQD 5EO0A 1UKQA 4LSRL 2QADD 3NGBB 2EDKA 3VXSE 3KLDA 1EZVY 4MXVE 4KU1A 1T83C 5JDSA 5I1GH 5I73C 5EOQH 1QLEH 1H3PL 1KCSL 4K7PL 1A7RH 5DFTA 1AKJD 5J1TC 1RY7B 3VXME 2YZ8A 5EUOF 1F4WL 2A77H 3G5YA 2VKXA 4DGIL 3TWCH 3VXMD 1WQVT 3WJJA 1LEGB 4QOKB 2BVPB 2WLZA 3IFPB 5CILH 5D5MA 1MRFH 3MREB 4RNRA 5CD5D 4IRJC 3ZHLA 3NIGF 4H5SB 4X6BB 1YMMA 2XNAB 4KJYB 4PLKD 1J0KA 4PJFA 3LSOB 5C07D 5HHMD 5SWZB 4DVBA 5D4QA 5DK3A 4OZ4A 5JOPE 1SHMA 1XCTB 1DQDL 3ECBB 2VQUA 1NEUA 4MNGB 2X41A 1FZOA 3MYJB 3W9DA 1IZJA 3O6KL 4F7PA 2YC1B 1S9YB 1H8NA 4J3VA 4NQCB 3IF1B 5MENB 3QQ9D 2BSRB 1GC1H 1LNUA 4GRMB 2YA2A 4LMQI 5ABDE 4U1IA 3SBWC 2FJHB 3ZE1E 3O6LL 3GMPA 4NQEA 3ZE0F 5F96L 3DI3B 3D18B 4P23C 3PXHA 3ZYIA 3ULUD 1Q9KA 2OI9B 3PQYD 2R0KL 3FQRB 5EO0B 3SDXB 4XPAH 4JM2F 4CVXA 2EE9A 4XPHH 5C2BL 1XCQB 5K9KB 5K9QG 2VH5H 1JNLL 4NN5B 3RHWK 2AEWA 2AJUH 4PS4H 3G5VB 5D2NB 3O8XC 4Z0XA 1HYSC 4F58H 2FHFA 4RMWA 4QXGL 1UACH 2RCSL 5IMMB 3MLRH 1YY9C 4K3JH 2I07A 5SWZD 2VC2L 5ADPL 4KY1H 3MOBH 3PL6B 4NYLA 3G5YB 4PP2B 1NAML 1OTTD 4JFQB 1J0JA 2P49B 3BN9D 5JHDD 1RI8A 2VWEE 3JWOL 2FECL 1CT8B 3OHXA 5HVFB 5C0ND 3T0VA 1IGMH 4U0QB 5J7CC 3SDDA 1WWWX 1ONQB 1JCKA 1GSMA 2ITDB 3KDMB 2VQ1B 5D1QB 4X4YA 1EA9C 2VLKB 1KXVC 4MNGA 4PJIF 3VJ6B 1G9EA 3FO1A 5K9OA 4OBSA 2ZKHH 4XVUD 2KL6A 3NFSH 5BVPL 4F9PA 3WIHH 4ZQKA 4OTXH 3IGAA 5ID1A 5H35A 4GBXD 4HSQA 32C2A 5DUBB 5LG1A 2GT9A 1XIWA 4TPRL 3VXTB 1BM3H 3TNNB 4Z78A 3CVIL 3ARZA 3WDJA 1MRCL 1N6UA 4WJ5A 4HFWB 5DHVB 5HI4D 5HPOA 3MJ8A 1QKZH 4IOFC 3BP4A 2OS7A 3JTTB 3W11D 5E8OB 4XP4H 3GI8L 5IMKB 2VB5A 3QG7L 3ALPA 4JO2H 4HIIA 3P77A 5TDPA 4IEFB 1ITBB 2GITB 3D39D 4ZS6C 3QNXA 2OJEA 4IRSD 1DBMH 3PG2A 1M7IA 1GHFL 4EVNA 2MKWA 5CEXA 4BK4A 3OR6A 3UTOA 4GXVH 5CKAA 5C0GA 1NUFA 5F1SA 5A1AA 1JYVA 5A3IC 1HILB 5T5NF 2VAAA 4O02L 4RAUA 3WUWB 4LAQH 2SEBA 5D1ZD 4OZ4B 5AYQA 4CUCA 5KW9L 4KZDL 1Z9OA 2ITCB 2WP3O 3FQUA 4RZCB 1MH5B 1QBLH 2E7HA 3S6CA 1G7MA 5EU7C 2WWKO 5A3ID 1I1CA 3CDCA 3W0WE 3DUUB 4PP1D 5DMGC 5DMYA 1MWAA 4JFEA 3V6FB 1HHIB 5B39B 2HWZH 3VXOB 3VWKB 3GI9H 3O9WB 5DD5H 2Q8AH 1AR2A 3WFZA 2ZUTA 2FCBA 3KYNA 1C16A 2NY1D 4UINL 3QO1B 1NCWL 1I8MB 1AGCB 3EO1A 4J1UA 5GISH 4APQD 3QDGA 1R6VA 2P5ED 2WINB 4NO2B 2OL3A 1FPTL 5F7FA 5CMAA 2DQGL 1WC7A 1OAXH 5SX4H 2IMNA 2ATKA 3CIQA 3LKRB 3BISA 2FJFB 3H9ZA 3QDJE 3S5LA 3V5DA 4WFFD 4XB8A 4X7DC 1AXIB 3FQNA 5ILTL 1I1AA 2AKRA 3C09B 3QWOB 4I9WE 2X40A 4I0CC 1FYTD 1OAZL 3DVNB 1IGCL 3MMEA 1LP9A 4FS0A 4AQ1B 4CNIA 3DOSA 4LCIH 5CEXB 2VR9A 3UPRB 4L3CA 4NKDA 4CL7A 1AR1C 5D7LA 1TTUA 2ADFL 1A4KA 5KVEH 4ODHH 3O6FA 5HHNB 3IU4L 1KCVH 5LWYL 4W4NA 3MA9L 4G9FD 4WNQB 5IB5B 2W07A 2N4IA 5E94B 1CFVH 4NQVB 2OSLB 3NZHL 1I1AC 1IEBA 2X1XR 4ZO7A 1DBJL 4M02A 4GRWB 4JPKL 1TQCC 4N0CD 1MHCA 3W2DH 1E0OB 1V7NL 5H35B 4PB9H 1OAXL 2FZ3A 1F58H 1KLGB 1KIRA 4LQ1A 2DLHA 3GJEA 3U4BL 5KOMC 5C6WH 1DQJA 5CUSL 5GZOC 3EHBC 4DEPC 4U1SB 5DMIH 1TPXC 4HGWB 1X5AA 2W9DH 1ED3B 2C1OB 1DL7L 5BV7L 1OGAE 2Y6SC 1HINH 1VSCA 1JWSA 4YHIB 2W0PA 3O9WD 5EIVA 1QO3A 4HUWA 2ESVA 1I9JL 2EZ0C 2WP3T 5DK0A 4YEEA 2GSIB 4ZD3L 3WHXA 4B5EA 1KJ2L 4XBEL 4S2SB 4PR5B 1PFCA 3DROA 1JHKH 1FIGL 3O2WH 4Y4KC 3MJ7B 1GAFL 3OKOB 2VDQL 1S5HA 3RGVB 5JUEH 3GJFH 2QKIA 3L7EB 5MHSD 3QUKB 2A6KB 2C4XA 1W8NA 5DMGD 4DKEL 3Q5OA 3QQNA 4OF0A 1PAMA 3IXAA 1UXSA 1AH1A 4I4WB 4WCYH 3DTXA 4DKDC 1LDPL 1QHPA 2E6PA 5L2JA 2V2WB 1S7TB 2EYRB 3IAQA 1U8QA 5KW9H 4OZFH 3H9SA 4HK3J 3CU1A 3OF6D 1ACYL 2P47B 2DQEH 4FNLL 4N1CA 2ZOKA 3TH4T 4ELKB 2EEDA 3HNVH 4YDIH 4P4KD 1FCCA 3KYNB 4GS7B 1E4WH 1I8MA 4BM7A 1CG9A 4TVPD 4WWID 4AZ8A 4W6YB 3ILQC 2DJSA 2CMRH 2ICWB 4OZFG 1UC6A 2APBA 4P9HH 2J12B 1MIMH 2V9QA 4PRDA 3WLBB 4PRAB 4LPUA 3QUXB 4U1SA 1K4CB 1HHJB 3LCYA 4G42A 2HTKC 2VISB 3UEZA 4NQSA 5DRNB 3VXRA 4RFNC 2V2TA 1YMME 4PJ5D 4ZTPH 4PJCE 1LK2B 1BIHA 2KH2B 1KCKA 4D9QD 3GMNB 1T2QH 2RFXB 5DSCA 4F33A 4FQPA 4D9QE 4D0DA 1P53A 1U8LB 1ZVHA 4TSBH 3QDGD 4QRRE 2DDQL 5HI5D 2QQKH 1Q0XL 1FZMA 1T1XB 2IMMA 2ADJB 1OP5H 1KB5H 5E8PA 1QFWL 5F70A 3NAAH 5C0BE 1JUFA 3FB8A 2JB6A 5T3ZE 3WJLC 3GMRB 1IGTB 3BAEL 2E9WA 4FQQA 4NFBA 2NTFA 4V1DA 1JNLH 2L0DA 4D9RE 3K8LA 5SWSA 3BOVA 5E2UH 3QP3A 4YWGL 2YD5A 1JE6A 1HHKB 3VFWB 3GJEB 3MRQA 3O2VH 4M7LL 4XAKE 3WUZA 1FN4B 4S1DD 1O5DT 3E1F1 4CN6A 3MRIA 5CJOH 4HGKC 3QIBA 3HTLX 1MI5D 4XMLL 4WENB 2YZ1A 3MX0A 4OIBA 3C5ZB 4P2QA 3QUZD 4KK6D 1A7PL 4KTDL 1FVCB 1E6JH 4N0UB 5LXGL 1U8HA 2APTA 5EOCL 1FNSH 1Q0YH 4UIMA 3MRNA 3U0PB 4JO3L 2BRRH 2M1KA 3GGWA 4Z7UB 5D7IE 1I7ZA 5D7JB 4XC1L 3D39A 1ZE3C 2YR3A 5I8KL 3GMNA 4PJ7A 2AV7B 4PJ5B 5F3BB 5HPMA 3TO4A 1HSAB 2QSTA 4WW2F 3BKMH 1MFCH 4IOFD 4XVTL 4PJ7F 3WO4B 2IH1B 2DJ4A 1JZ5A 1VESA 2HMID 2H1PH 1RJZA 2VIRA 4X4ME 1WT5A 5F1IA 4S1RH 4PRIB 2GJ6E 5EZIH 1TJHH 3NFSL 1AI1H 4XT1C 3RBGA 1KBGH 5CINH 2BNRD 2CIIB 3WUWG 4D8PA 2YBRA 2B4CH 1Q72H 2KZWA 3SKNB 4XMPL 1VFBA 3NIFF 4I0PD 1I9RL 2D3VA 1P7QB 5ESAA 3RZCB 5BRZA 3SDAD 1BD2A 3ZLQC 5IMOB 5DJXA 1QRNA 3HNVL 4YDIL 1KPRA 3M8OH 4P4RA 1S7RB 3MLXH 2OTUA 1HHGB 3HZVA 2HLFC 3RWFB 3C8HA 5GGUB 3RX7A 1U8IA 3HMWL 4LP5A 1J5OH 1MFBL 4WHTB 4NN6B 4LU5L 5GZND 3UTTE 3L3OB 3MRIB 1RFDL 5EUKA 3GZKA 5I17A 3S35X 2FGWH 3C60B 4FFVD 1Q9OA 3QFJE 3WYRA 3EYVB 3V7MA 5T1DH 4PJ8D 3HMXL 3EOYG 3MV7A 2PW1B 3WO4C 5DTFB 1NANH 4Y16C 2NW2B 4FXLA 3X12B 1OM3L 4P3DA 4XNQA 4NJAH 2XFXB 4KKBD 3V4VL 4NOBA 4PJGB 4E42A 2PTTA 5C0GB 2AW2A 1FO0A 3O8XD 5GS1C 1NLBH 1DE4A 4Z7VA 1IQDB 2CKBL 3BD5A 3TEUA 1A6TA 1ZWIB 4AYFA 2Z93B 5GISL 3H3PH 1JUFB 2AEPL 1PVHA 1RAMA 4ERSH 5BS0D 2VDOL 4OT1L 5EC2B 2IAMC 1A6ZA 1F45A 4WO4D 3I6GB 1JPFB 2FSEB 1M6OB 3OGOE 1JF5A 3KPSB 4QNPE 3IFOB 4NO0B 1G6VK 5LGJB 2F54A 5ENWB 3E6FA 4KV5E 1MI5E 4Q97A 1RIUH 5F8QC 1A7QL 1UM5L 1GGBH 4PBXA 4Z77B 5KG9A 2VWEC 4Q6IC 3T2QA 2R0LL 5D72H 5DHVA 5CJXA 2RCSH 1LO3L 1OGAA 2MHAB 2WV3A 1F3RB 1Q94B 3MXWL 2DKUA 1T6VN 4G8FA 4M6OL 4G3YH 1FE8L 3TIDA 2XKNA 4KUZL 5EORH 4D3CH 3MJ9A 1IGYA 4MJ6A 2IFFH 4IRSB 3T8XA 1PQZB 2NY2B 3PV6B 1ACYH 2R1YA 5JXAL 2FWOA 5F1KC 8CGTA 4J6RL 4ORZC 1U93B 1AE6L 1F4YH 3UTPD 1PD6A 1M7DA 2GEEA 3GMMB 1YUHB 3HI5L 3TCXA 3E2HB 1W0VB 3IFLH 4Q0XL 3D2UB 1YMHA 1BZ7A 2P44B 2XIDA 3EYFA 3TNMA 1CGSH 3EO0A 4HKXA 4PTUB 1WSST 4AENB 4BH7B 1T0PB 3IXTB 5EA0H 1MFNA 5HDBF 4CMHB 1OAQL 5L9DL 4ONGH 2HVKB 5KVDH 5EBGA 4XX1E 2FX8L 5MEOA 4LHUD 1OB1A 1NFDB 4XMKH 4BFBD 1CLYH 1JYXA 3QQ4B 2XY2A 3H9SE 1XGTB 3HCVB 4EEEA 4HKBA 1I9IL 4YBQC 3VFUB 4KXZH 2YD9A 1CS6A 1NFDF 4M1CD 5GJSH 5C0RH 3X13B 4EQ3A 5KN5A 2JE8A 4ELMA 2ATPA 4YUEL 1B9ZA 1RUAH 4U1KA 2AABH 4P3CH 4NM8H 4TUJB 3IKCA 5GRXG 3VRIA 1YPZF 4QCIB 2WINA 4NO2A 5TPWH 3BZ4B 1MNUL 4NQVA 2OQJA 4WW2A 3TBWA 4O4YH 5C86A 4MB5A 5DZOA 4P5TB 4PP1C 1D5BA 5ICXA 4C56D 2UY7A 5CUSH 4FZ8L 3VG9C 4PJ9D 2ARWA 4L4TA 3K4DA 5I1IH 3NCJH 4GRMA 2BC4A 1MCWM 2QSCL 3N1PC 5DQJA 3B9VA 3KYOA 2XXMB 1IKFH 4NHUB 3QPXL 5CJ5A 1EH9A 4KROD 2DKSA 3IRZA 3W0WB 2F5AL 1KPUA 5IBTH 2PW1A 4H1LG 2B5IC 5I71B 1KGCD 1TJIL 4JFFB 3V4UH 5I0ZA 1XCQA 5K9KA 3GB7A 3QEUA 4P2OB 4E41D 1NL0H 3GSVA 4YIQB 2NLJA 4PJEF 1A6WH 4DFIA 4H5SA 5E1AA 4IDLA 3UX9B 3S36H 2P24B 3MBEB 4KK9D 4LF3B 2XG5A 3MJ7A 2R2HA 5IESL 4FG6C 2Z0BA 4GMSL 3VA6A