4NUGH

Crystal structure of hiv-1 broadly neutralizing antibody pgt151
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
236
Chain Sequence
RVQLVESGGGVVQPGKSVRLSCVVSDFPFSKYPMYWVRQAPGKGLEWVAAISGDAWHVVYSNSVQGRFLVSRDNVKNTLYLEMNSLKIEDTAVYRCARMFQESGPPRLDRWSGRNYYYYSGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PGT151 light chain
publication title Structural Delineation of a Quaternary, Cleavage-Dependent Epitope at the gp41-gp120 Interface on Intact HIV-1 Env Trimers.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nugH02
4B50A 3FN0L 1I1AB 3VGFA 3H3BC 4X7SL 4UT9L 4X6BB 3VMPA 3ILPA 4HJGA 3MNZA 2AABH 4MA8L 4WTZA 1JF1B 4X6CA 1RURL 4IRZH 4NQXB 4FQXA 4NRZA 3UO1H 4UDUB 4Z95H 1ZOXA 4E42A 2F9BT 3QIUA 4ZS7H 1CGSH 4HCRH 5JO5B 4NQED 3O9WA 2YKLL 4K94C 3ZSTA 1T4KB 5BRZD 3VXRB 1I9JH 3ZDXE 5JA9A 2X4PA 3SE9L 1CLCA 1XIWC 1BEYL 3HUJB 4FFYL 3PWJA 2VR4A 4Z76A 4X83A 5HYIA 1I75A 5L2KA 2CDGA 3HZVA 1YQVH 5CSBA 3DMMA 3ABZA 1EERB 1QFWL 1OAUL 2Z91A 1QLEH 2WINA 3NAAL 1RD6A 3C6LD 5E5UB 3B9VA 1A2YB 5SWSE 2BRRH 4MAYB 1LK2A 1IM9A 3FQTB 4ZUSA 1R3JA 1BX2A 3SO3B 1DUZA 3LZFH 2AK1H 3QUMA 3BUTA 1GGCH 3LKRA 5DJYA 1L9NA 2ADGA 3A67H 2AV7B 4RMVA 3DSFH 1KIUA 2HWZH 1ZS8A 2AKRA 4KK5D 4R26H 5D2LE 1KIRB 5KG9A 5D1ZB 3IXAA 3O4LA 5I18H 5JHDA 3FQWB 1Q9WA 3S4SG 1SBSL 1AR2A 3IETB 4LCWD 1O0VA 4X6EB 3GSXA 3AB0C 1G9MC 1CZ8L 5DD5L 4I0CC 4HMDA 4P2OA 1RZFH 4HX1A 4MJ5A 4GJTB 5FYLD 4R2GC 2PW1B 4YLQT 2DBJA 4RMSA 4YBQD 5L6YL 1BIHA 3ZSSA 4XAKE 2YK1L 5F44A 2ZCHH 2MCPL 3SGEI 1T66C 3O8XD 4WEMB 3K3QA 1SMOA 3QHFL 3W82A 1JPTL 3U7YL 1V5JA 1I1AA 4X6BA 5F3BB 5D1ZC 2RIKA 3FRUB 4PR5B 1EH9A 4NKIL 3TVMC 3VI4F 2V7NB 3PDGA 4MXWL 1JF1A 4NYLB 4NQXA 3MNVB 3OL2A 4UDUA 3H42L 4AH2B 2Q7YB 1E27B 4OSUH 4LSRH 1T4KA 3VXRA 4Q6IA 1YEIL 1WT5C 4PJAF 5F7UA 2FEDD 3P77B 5D1XD 3S3JA 3HUJA 4MYWB 4XPBH 3UEZA 5DUMH 5C6WH 3E3QC 3VCLB 4NFCA 3MCG1 1T7WA 3QDGD 1AGCB 3EFDH 4I0PD 2VLMD 4QY8B 5KSAB 1MIML 4IDJH 1A2YA 4MAYA 3C08H 2HT2D 4NNYB 3HPJB 2B0SL 3CLEL 3NH7L 3OX8B 4GRWE 5JW5A 1LO2H 3FQTA 43C9A 3WFEL 1I9EA 2FLBT 4P59L 3PHSA 2WQ8A 3CSBA 2AV7A 1T6WA 1MRFL 2PYEE 2HTLD 1CD0A 3ARGD 2OCFD 3QDJE 4GRMB 2UWEA 3W11C 1UXSB 1E6OL 4H0HB 1G7JA 1KIRA 2Q8BH 5D1ZA 3QT2A 1MFAL 3X3FH 1KB5L 3FQWA 5DA0B 3AMKA 3BP6B 1JZ2A 4U4BA 3LSOB 4X6EA 5JIPA 4APQC 2X42A 3CLFH 1HWGB 5ADOL 3MA7B 3DYMA 3PE9A 5HHQB 2PW1A 2MQ0A 3IDIB 1B0GB 5EBGA 4S0TD 5BCAA 1NUNB 4R8WL 2Q86B 4M1CD 2WM0A 4OZGF 3BXNB 3LEXB 4MQTB 4KWUA 3ARVA 1QNZL 1U8MA 5F3BA 5F89B 5I1CH 2V6HA 4XNZC 4ZTPL 3FRUA 4PR5A 3DETD 4U1IB 2V7NA 2Z31D 2EDWA 2OLDA 1TJHL 4NYLA 1QRNE 2AV1B 4RGNE 1NFIB 3MNVA 4GSDL 2O5ZH 3FL7A 1P84K 2DQHL 2CDEB 5A1AA 1E27A 3X3GL 2Y1VA 1I4FB 3UTQB 4U1JB 3LRSB 5DFWH 1MY5A 43CAB 1RAMA 1WLHA 2Y5EA 3TH4T 2FB4H 3P77A 2WWKT 1VERA 3UTZB 2BY1A 3QI9D 4UV4L 2VXSL 4OZFH 5I19H 1LDSA 1S7SB 1NKOA 1N7ML 2Y07L 3VCLA 3RI5F 1XR9B 1RIUH 3VD5A 4JPWL 3FOMB 4U33A 1CLOH 1AGCA 5ELIA 4QY8A 5KSAA 3KPSD 1JNLH 4WI7A 4NNYA 3HPJA 5IVXE 3OX8A 3GM8A 3N1GC 4MSWB 4HH8A 4YK4C 2NY0D 4WTXA 5DLML 4URTB 5GS1C 4MNGB 2AEPL 4GRMA 5DSCB 2BZDA 4N8PA 1WSST 4G7VL 1G7LB 4Y2DC 3VU2A 4RFOH 3X14B 1UH4A 2L7JA 3TBSB 2FX7L 2KH2B 3LSOA 2VN4A 2B1HL 4ZDHB 1NUGA 1OGTB 5ECJE 1FIEA 2GYSA 3Q6FA 1MCDA 3MA7A 3RPKA 4Z9KB 1EHLH 1J1PL 1NKRA 5HHQA 4WTWA 5JIHA 4HJ0D 4PBVC 4WFGE 4XBEH 3IDIA 3RI5K 1B0GA 1M7XA 3IJYB 2ZUXA 2AK4D 4F7TB 1R6VA 5CIPH 2EDTA 4GO6B 2Q86A 1XF1A 2D03L 3WJLA 3BXNA 3LEXA 1I8LC 3RVVD 4FNLH 3U4EA 1KG0B 5F89A 3GSVB 3I50L 2PW2B 4U1IA 4NIKB 5EZLB 1VB9A 1VESA 3KPRE 3BO8B 2HTKD 4JFDE 4P2RB 3UJTL 1INDH 3PF2A 5AWNH 1FIGH 3QH3A 1NFIA 1ZKAA 3OKYA 4K9EH 5E8PB 2DQJL 4F8QA 4HUUA 1J5OL 2CDEA 4L1HA 3UTQA 1I4FA 2YR3A 2Y5TB 3LRSA 2G75B 4KROC 1HIMH 4O4YL 43CAA 4OCLC 5IROA 4KXZI 1P1ZB 5DVOA 4I4WB 5L88H 4ZD3L 1TPXB 1MFEH 3AM8A 3TBTB 3UTZA 5IHLB 1UA6H 2NY7L 4NO0B 1F8TH 2E9JA 3EOTL 4IOFC 3U2SB 3TCLB 5IM7B 1S7SA 3NA9H 5E6IB 1SVZA 1FVCA 2P7TB 1B2WH 1XR9A 2A9NL 2OSLB 2Q1EA 3NFPB 4HH9A 5T3ZD 1NQBA 2VDRL 4XCCH 1LILA 4XMPH 4NOBA 4Y8DC 2YPVH 3FHAA 1HK6A 4MSWA 4NO5B 1AXSB 4RFNB 3MGAA 4TVPH 2ZCKL 1BAFL 5TE6H 4MNGA 5DSCA 2IC2A 1I3GH 4M1DL 1TPXC 4AENA 1G7LA 1IAKA 3X14A 3QCUL 2ITCB 2IBBA 1LEGB 1OAKL 2H6PB 1I3RB 3NCFB 1CL7I 3TBSA 3V52L 2VH5L 1D5BB 4ZDHA 5DK0B 1OGTA 3T2QA 3MUZ1 5D7JD 1QFUH 3B4NA 1N4XH 3O2VH 3ULVH 3IJYA 4D9LH 2NX5B 1T5XB 3QQ9D 4F7TA 4Q7DA 3QA3B 3MOAL 4CMHB 5C9KA 4Z7VF 4JREB 5D72L 4K23H 1IKFH 1KG0A 3ZZ1A 3PGDB 3GSVA 3JVGA 2PW2A 1JHKL 4Y88A 3MRKB 4Z7WE 3BO8A 4P2RA 1AJ7H 1VFOA 5D5ME 5CJ8A 4OI7A 1IGIH 4U3CA 4Z7UF 5E8PA 5H37H 2R8SL 1FBIH 4U2ZA 2Y5TA 4JM2D 3RKPA 2G75A 2NW3B 3S36H 3MLVH 1CYGA 5DJ0B 5M7QA 1EVTC 1P1ZA 2Y9RT 3EJJX 5DHVB 1G7MB 2YS4A 5D70L 4LPUA 4NQDB 3H9SE 2CKBH 3TCLA 5IM7A 5E6IA 2P7TA 3RUGE 1NLDL 2OSLA 3NFPA 4DKEL 4FN0A 4QXWA 1QLFB 3OBAA 4KU1A 4NQVB 1RUAL 4NO5A 2H41A 4UV7H 1AXSA 3BZFA 4GRLD 4KJQC 1V3MA 3GO1L 4X5WB 3KPQB 1HNGA 5HYJD 5FHBL 4P2CG 2X4QB 4PJCB 3RWDB 2ITCA 3VDAA 1LEGA 2H6PA 4DK3A 1ZV5A 4WO4C 4M7LH 1NL0L 2NY1D 2NY2C 1BZQK 1TNNA 1D5BA 2FH6A 5DK0A 4S2SA 2G60H 5C0AE 3G6JB 4KKCD 5TJWK 1F6LL 5CJ5A 4WEBL 1F00I 2NX5A 4PJXF 1T5XA 5DURD 1NBQA 4OQTA 2JIXD 3QA3A 4AM0B 2NY6C 3CC5B 4P0DA 1A6WL 2DM7A 2VXQL 1G1CA 2LU7A 4Z8FH 1E4XI 4TVPD 3PGDA 1GH7A 3L3KB 2C7UB 3DXAE 5JW4N 5JQ6H 1V7NH 3MRKA 3B2VH 3RL2B 1N6QH 4J7RA 4QRPD 4ZXBB 3SQBA 1YY9D 4EVNB 3H2WA 1ZLUH 1C5BL 1N64H 4D0BB 4CBPA 2A9MH 5C7XL 4TTDD 1AP2B 2EEDA 4YDJB 3LD8B 3ZKMD 2MCG1 2RB8A 2NW3A 5DJ0A 2AQ3A 5DHVA 1G7MA 5KS9E 4OFYD 4Q97A 4ZUTB 4XCFH 4NQDA 4EI5D 1IC7L 1Z0MA 4PG2A 1G7IB 2BMKA 4F80A 4R9HA 2QLVB 1RZ7L 1J1XH 4X7CC 3MYJB 4NM8H 2HFEB 5CILL 3KS0H 3MTRA 3H7LA 2EC8A 4ZXBC 5C09E 1QLFA 4OCXL 5CEZL 5IGXL 3IRPX 1NMCB 4IOSD 3HZYB 3U7WH 3KDMB 4HWUA 1MFCL 1LP9F 3MRLB 3OKKB 1IGYB 5I73B 4FQLL 4HJJH 3TPUB 3RY4A 4LSDA 4R0LA 3VD9A 4X5WA 2VZ3A 3KPQA 3VRJB 2X4QA 4PJCA 4ZOCA 1J11A 3RWDA 4TNVK 5FO9B 1EGJL 1PG7X 1BJMA 4PB0L 4N8VB 2AGJL 2E7MA 5TQ0H 1R5WA 2KL6A 4NQEE 4F7MB 5BRZE 3L95B 4WFEE 3G6JA 4KKBC 2DMKA 1QBMH 4DUVA 3J7HA 1SY6A 4P49A 1TIUA 1KBGL 2NXYB 3LEYL 2Q3ZA 4HF5H 4WUUB 2A6DB 2HRPL 4XNQB 4AM0A 3CC5A 4AEIH 1WFTA 4HBCL 1N0XH 1ND0B 4XVUD 2FO1A 1L0YA 4XXDB 1IAOB 2RHEA 1RIVH 2PETA 5JOFB 3JWOC 3L3KA 2C7UA 3EO0B 5C07D 4G6KH 3AUVA 1RU9L 4DKDC 1WBYB 3RL2A 1NC2B 2R0LH 3FN3A 4ZXBA 3SCMD 4EVNA 4ENEC 5E2UL 2EDFA 4GH7B 4D0BA 3MRJB 3P0VH 1Q8MA 1AP2A 3V4VH 1JNHB 4YDJA 5HDLA 3DRTB 5E1AB 3EO1B 5C86A 4KTEL 1F4XH 4O2CB 3HG1B 4LCWE 3VFWB 5C0GB 4ZUTA 1YEKH 1KFAL 2X9XA 5I8OL 5FM5O 1KN2L 1G7IA 1DBMH 4M02A 5LWYL 1ROWA 4YHMH 3LHPH 3MYJA 2HFEA 5FYLE 1SY6L 5JXED 3T2PA 1BMGA 4LASL 4WDIB 4WW1B 2HA1A 3ECBB 1BFVL 3FFCD 4EQ2A 2I24N 1Y6KR 4HQQL 4NBZB 3N9GL 3LH2H 3HZYA 4QHUB 4HKJA 5EZIH 3KDMA 3OKKA 3MRLA 1PX3A 1FAIH 1IGYA 2IJ0C 4FABL 1RY7B 2QADB 2X2YA 3TPUA 3ZHKA 2YEZB 4JZOB 5E00B 3VRJA 5GS0L 1JN6A 3RWFB 4PJEF 5FO9A 1HE7A 4UTBH 4N8VA 2OR9L 4ISVB 1FFPB 3FZUD 1UENA 3RJDA 4PRPB 2NY4D 3L95A 6CGTA 4JKMA 5SWZE 3SBWC 4EBQL 2NW2B 2O5YL 2XN9B 2J6EA 5J4MA 2OR8A 4WUUA 2A6DA 2QADC 2X10A 3WDIA 4KZDL 1ND0A 1LMKA 4PJIE 1KGCD 4XXDA 4C56D 2VLME 2ENYA 2VMFA 5JOFA 3QEGH 3DUSB 2QSCL 4OIIH 3KJ4B 3EO0A 1KYOJ 1A3LL 4YHOL 4WI3A 2FBOJ 1WBYA 3EDJA 1LO3H 5FYKU 5C6PB 3IDXL 5DQ9B 2XRAH 3VG9B 4A2LA 3SE4C 4WHYH 3ARXA 4XPTL 3MRJA 2MSPA 3ARFB 3DRTA 2HVJB 3EO1A 1KTDB 2XZQH 5E1AA 5L9DL 3T0ED 4J6RL 3HG1A 4CJ0A 2ZOLB 3VFWA 5C0GA 5HDQH 1H3XA 4D3CL 3U9PL 1HN1A 3PP4H 3NGBC 4V1DD 3UZEA 1I9IH 1J8HD 4K7PY 3UX9B 2J6EL 2KBGA 3AC0A 4WDIA 4WW1A 2F5AL 3ECBA 3WKML 3H6JA 3SBWA 3SDCD 3EUUA 4OLXH 1ITBB 4QHUA 1MPAH 5IHUL 1WC7B 2X89D 4PJ9D 2CK2A 1FLRL 3ARFC 4JO4L 4IOIB 1HYRC 1XEDA 4MA7L 2YEZA 4JZOA 1TZGL 2D7TL 5E00A 1P9MC 1GAFH 4MLIA 3RWFA 4UTAH 4KMQA 5KSVB 5EOCJ 1IE5A 1FZOB 4F9PA 4ISVA 1QSVA 1FFPA 4PRPA 3MRHA 1PLGL 4WWKC 5I1IH 3BD3A 4U6VH 4LSUL 2F8VA 2NW2A 2XN9A 5EO0B 3VE0B 5CJBA 1RPQA 3O2WL 3C8KB 3NIDE 1K3IA 1WCBB 5I30L 1AGEA 4JHAL 1YEGH 1LO5B 4OCRH 1T0PB 3DUSA 3KPSE 4K3EL 4MA3B 2JJTA 2ENSA 4JFFB 3MYZA 1D3CA 1MIEL 3WHXB 2PNDA 5D71L 1A7PL 5DQ9A 4HPYL 5EORL 5IVOA 3T8XB 5T1LB 2VL5B 5LXGL 2AXFB 1R0AH 2DLGA 3ARFA 4RISL 2HVJA 3PG2A 4LVEA 5IWLC 1BZ9B 3RA7L 1RZJL 1CIUA 3O81A 2MPAL 2ZOLA 3UYPA 5K33A 1KENH 4LSPL 4ZYKB 3ALPA 4HG4J 1KC5L 5ESQB 4PJBE 2A73B 2MOVA 1CVSC 5T1DH 5DGQA 5IBLC 1FGVH 3V4PL 4PLNC 3EW3B 1F42A 1LO4H 4WI6A 4KMTH 5ITFB 4HDIB 5JHLL 1UH2A 3UZVB 1VACB 1UM4L 1UACL 3AU1B 1JNJA 1WC7A 1Z3GL 5AAWA 1RJYB 3KPMB 1HKFA 1L6XA 4IOIA 4PBWD 4LQFH 5E08L 1JGVL 4OGYH 4S1RH 3PHQB 1U8OB 2QHRL 5EUOF 3G08B 1REIA 3VDCA 1AC0A 2P45B 4FP8L 3U4AA 2BNUA 1X3DA 4I3RL 4Z7OE 2OL3H 1DQTA 1C7TA 4G9FE 5KSVA 1DQDL 4LFHG 1FZOA 1L6ZA 1RQ5A 4R2GD 1IQDB 2VQUA 3CPLB 2NNAB 4JQXC 3K8LA 4UT7H 2GITB 1QSFD 5J1AB 3C9NB 3S96B 3JBG7 1AD9B 3VE0A 3LB6C 3UTSD 3OAUH 1IL1B 3C8KA 4HXBH 3K7UA 1OGAB 5GRYA 1MQKL 1WCBA 3FB7B 2WBJC 3MREB 1IBGH 3FT3B 3TVMD 5T3ZE 4BQ8A 5GS2H 3S88H 1ZHKB 4OM0L 3HA0A 2AJUH 5E4EB 4J4PD 3BD5A 1JWSB 4OLVH 4MA3A 3GSQB 4JFFA 5EU4B 1ACZA 3WHXA 4R97B 2V5TA 3DPBA 1A02N 4W4OC 3T8XA 4FFVC 5T1LA 4UOJA 4X8JA 2VL5A 1WFUA 4PUBL 2AXFA 4OZHF 2J8UE 3DJ9A 1X9QA 1BZ9A 2DI7A 3UTTD 2APTA 1J0HA 1J1OL 2W9EH 3JTTB 4D2NA 5TQ2L 5AZ2L 1X5FA 4N0FB 4ZYKA 5ESQA 2A73A 1GYAA 1DBKL 3KLHC 1VHPA 5C92A 5B39G 1U8JB 3PGFL 2NQCA 1YPZF 3RNKA 1N3NB 1UH3A 3UPAA 2QKIB 4R97C 4M5ZH 5ITFA 4HDIA 2Z93B 2KQNA 3MQIA 1VACA 3AU1A 3W11D 1SQ2N 4X7DC 4UB0H 2B1AH 4JPVH 1S9YB 2IQ9L 1RJYA 3BDYL 3KPMA 1UT9A 3TYGL 1VEMA 2E9IA 3PHQA 2CXGA 1U8OA 3MNWB 3G08A 3HHRB 4YIQB 2WP3O 5K93A 4I2XB 5DK3A 3AGVA 1H9VA 5IMMB 4XH2B 5H2BB 5IT2L 2PO6D 5EBLB 1OT1A 1N0LA 1IQDA 3O45B 3ULUL 5KZCB 3BZDA 3CPLA 4YDLB 1ZXQA 3WSQH 1FNSH 1I1YB 4W4OA 2NNAA 2GITA 2PCPB 4MJIB 4AG4L 5J1AA 4RSVA 4AEEA 3C9NA 1LGVA 3S96A 2N56A 1AD9A 4IRJD 2E6PA 5GJTL 4UUJB 3T2OA 2C4FT 2DDQL 3O3AB 3W9EB 1CE1H 1OGAA 1WZ1H 3TV3H 3FB7A 3MREA 3QXDB 3FT3A 4LMQI 4QF1B 4X7TB 1ZHKA 2APVA 3KR3L 2FRGP 1MCPH 2R4RL 4JDVB 4TULL 3VFGH 4YDVB 3BQUB 1RZKL 2DI8A 4M62H 1JWSA 4PBXA 3GSQA 5MP6H 3DX6B 4DQOH 5EU4A 4K2UH 3FAWA 5DRWB 3GIZL 1QHPA 1FYHB 5E2JA 1JRHH 1JHTB 1Q38A 4K7FB 2BOCB 4X6DF 5HYJE 4Q0XL 1WJ3A 5H94B 2HJFA 1IEBB 2VDQH 2PR4H 3JTTA 1DEEB 2KPNA 3RDTC 3MXVH 5TFSL 1FH5L 4N0FA 2WZPD 2RAMA 4M6NH 1F90H 1WK0A 4R90H 4P23C 5I1KH 1EUUA 3CK0H 4DGYL 5JTWA 1U8JA 1P4BL 1NLBH 1N3NA 5E6ZA 2QKIA 4Q9BA 4G9DB 2C3VB 3MRFB 3RGHA 1INEH 1S9YA 3OGCB 3NACH 1S3KH 2E9WA 1IILE 1PG7H 3MNWA 1OAXL 5F7DB 2XTJB 3HN3A 3D3VB 1Q94B 2VITB 4JPIB 4NN5B 4I2XA 1MCNA 5IMMA 4XH2A 5H2BA 5EBLA 4K3DH 4QRSB 3U79A 3GNML 4KHXH 3S7GA 3O45A 4OLYH 1CDYA 1I1YA 4U6TA 2DQGH 1HDMB 2E7BA 2PCPA 4MJIA 3FMGL 4AK1A 2C9AA 2ADFL 3MOBH 1K6QH 1MLCB 4I18B 5E8EB 4UUJA 3P30L 3BH9B 3O3AA 3W9EA 3VD7A 5FUCC 2AJVL 3RVXD 1T5WA 2CGRH 4QF1A 5JXAL 4X4YB 3BPLB 4X7TA 3OF6D 4OUUB 1YQ2A 1C5DB 4ODUB 4Y4FB 1TETL 2R15A 4JDVA 2IPTH 4WCYH 4YDVA 3BQUA 3QO1B 2H9GB 4MB3A 1T7YA 4NNPL 2JJSC 2YN3A 2FIKB 5I74B 3MLZH 2NXZC 3DX6A 2QQNL 3VXQA 4Q74A 5C8JB 2J88L 3FTGB 5J8OA 5DRWA 1OD9A 5DYOB 4JPKH 1JHTA 4K7FA 5HDBE 2BOCA 5AAMA 2WMPA 3BGAA 1JGUH 3V7MA 3GRWA 4HCRA 3GZKA 1WUNT 3O3EA 4GG8B 4P4RB 5H94A 1IEBA 1H3TA 1OAQH 2ADIA 1MCBA 2W65B 5EIQA 1DEEA 4M03A 4RMTA 1DQML 3BPLC 3FRPG 3ARSA 4OF8A 1KCRH 4Y4FC 4OCWL 3ZTNL 4LFHD 3F5WA 2AW2A 2F58L 2Y06L 5I74C 5D8JH 4F2MB 4DK6A 4X6DB 4D9QD 4M5YH 1KT2B 2XY2A 4G9DA 2C3VA 4NHCH 3IAGC 1MRCL 4NC1C 3MRFA 4FOMA 4QRUA 4Q9RL 1OP9A 3K46A 3TP4A 3VH8B 3OGCA 3LY6A 4NBXB 3SE3C 5DD1H 4J8RB 4MXQC 3CCHB 3SGJA 3EYUL 5C07E 5KVDL 3SDAA 1XGTB 5DJCA 3D3VA 1Q94A 4JPIA 4Z7NF 4IMKC 2JB5L 5CMAB 5GQBA 2R2EB 1KCSH 1INQB 4MD4B 4ZODA 2YHGA 4QLRA 4QRSA 1JL8A 2WIMA 4R6UA 4Z95L 4C59B 5ID0B 3GHEH 1CGSL 4HCRL 3RVTC 1HDMA 1EJOH 1CFBA 4NQCA 5A2JH 1I9JL 1MWAB 1NEZG 4XGZB 1A6TB 1MLCA 4I18A 4P46D 5FECA 1MCWM 5FO8A 2XG4A 3BH9A 1ZT7B 2OJEB 1ZANH 1G9EA 1Z9MA 5B38B 4OUUA 5F6IB 4ODUA 1C5DA 3TBYB 1A1OB 4TSAH 3FFCE 4KRPC 1QLEL 2X4NB 3QO1A 2H9GA 3BESR 2FIKA 2XKUA 1ZLSH 3FTGA 1PKQB 4GKZA 5DYOA 3QNYB 3LZFL 2AK1L 3QRGL 5IB2B 3P4OB 4YNYB 1GGCL 2EE9A 3A67L 1DANU 4ALAL 3DSFL 2EH8H 2HWZL 4XP5H 1X5JA 1QP1A 4WEUD 4R26L 4MLSA 3K4ZA 4GG8A 1AGBB 2K7QA 5I18L 2F5BL 2W65A 5E8DH 3UZQA 3D1MC 3MBEB 4JRYB 2X1OA 4PJDF 5CD5C 3SDXE 1UJ3C 3BZ4A 5F6IC 3F65A 3WXVH 1CIDA 3AY4C 4HIEB 2YA1A 4H0IA 1RZFL 1I1RA 3IKKA 4ETQB 1KT2A 5E5MB 1L4IA 2YXMA 3GSNB 4HEME 4DAGH 3L9RB 3F7VB 4LGSB 1W72H 3VFSB 2ZCHL 2BY0A 2CK0L 2VISB 3VH8A 2B4CH 1PFCA 3QHZL 4C56E 3CVIL 4RA0C 1EHXA 3CCHA 2ZWLT 3U1SH 3V95A 4WO4D 3QZWG 4OF7A 2OYPA 4OM1L 1MI5B 3IFNH 2NY2D 1T04B 4MVBC 1IT9H 3NIGE 5EC2A 5CMAA 5EIIB 4PD4K 2R2EA 1INQA 4MD4A 4OCYL 3MRQB 3EYVB 3EO9H 5GZOC 5ID0A 4OCMC 4NFDA 1UM6H 5T3XH 4OFVA 3T0EE 3QPXL 4GOSA 3EJYD 3FT4A 4U1NB 3IKCB 1DP0A 3ALXA 4GG6B 3TO4D 1EO8L 3KNBB 3D85B 1MWAA 4XGZA 1A6TA 1ZEAH 1CICA 1TNMA 3QYCA 4LIQH 2I07B 4XNXH 4OD3L 1T7ZA 4DUWA 4XP9H 1ZT7A 2EC9T 4XPBL 2OJEA 3AVEA 4KUCF 1BLNB 3LKOB 1EAPB 1VPOH 5B38A 2XQBH 1KPRB 1QFWI 3RBGA 3TBYA 1A1OA 1YNTB 5DZLA 2X4NA 1AY1H 3EFDL 2VE6B 2CO6B 5MEOB 3STZA 4IDJL 5HYFA 3ZL4H 1NCWH 1PKQA 4NZRH 3QNYA 5IB2A 2NR6C 3P4OA 4YNYA 4IEFB 1OLZA 3MV7B 1MFDL 2CRYA 2XT1B 2I9LB 5HTSA 5D9SB 5EU6D 1J7VR 1AGBA 1TTFA 3E8UH 5CSGA 1HNFA 1M1SA 4YR6B 1MCLA 1AKJA 4NCC2 3MBEA 4JRYA 3I84A 1QSED 4GMSH 3ARDC 5K59F 3CLFL 5F7KC 1CK0H 4MZ3A 4HIEA 4AZ8A 1NFDF 1JYVA 2DJSA 4M6OL 4ETQA 1F4YH 3EYOA 1DBJH 3HC4L 4RGMB 3GSNA 3L9RA 2GSIB 4QTIL 4CW1B 3F7VA 5C0CD 3VFSA 5B4MD 2VISA 1FG2B 1D9KD 3A6OA 2ESVD 2VXUH 4L4VE 1X5LA 4POUB 3ZDYF 1I1FB 5I1CL 3IDGA 1MI5A 1T04A 5JPNB 4WUKH 5EIIA 2J3SA 1CGWA 1B90A 1CXKA 4YH6A 4KKBD 3EYVA 2CSPA 5C0EA 2O5ZL 1G84A 3BJ91 4NHUB 4U1NA 1V05A 3V2AR 3IKCA 4PB9H 2LQRA 4CVWA 4GG6A 4H1LB 2UVEA 2VN7A 3KNBA 3D85A 3Q0HA 5EA0H 3V8OA 2I07A 4PV8B 5J12B 2CUMA 5E9DD 3VXUD 2A77H 4FQHB 1G9NH 3BSZL 2VDOL 4KK6C 4P2QB 1ZMYA 5F7HA 3M8OH 1BLNA 5IB1B 3LKOA 1CD1B 1EAPA 5CJOH 1F02I 4JKWA 1A22B 1KPRA 4GLRH 1WAAA 3UTPE 1RIUL 1T2QL 1YNTA 1CLOL 3GSNL 1D5IL 4LARH 1Z9OA 2VDPH 1F4HA 2JLLA 1I85A 4ODXB 1RZ8B 2DM4A 4L29B 2EDJA 4XVTH 4FXKB 4HWBH 1BECA 5CHNA 1JYWA 3MV7A 4PJHF 4NUGH 4H88L 4OI9A 2I9LA 5D9SA 5KSBE 5T3XD 4KVCH 3U82B 5J12C 4RFOL 1NGQH 2E6QA 2IAMB 3PP3K 4M9PA 4YR6A 5HI4C 3NIFF 1HXYA 3HAEH 4L3AA 5DT1H 2WAHA 4KI1A 4EZMA 3KXFE 4LHUB 2UZIL 5DVMA 1QSFE 2DQCH 1MJJB 3LKPB 4YUEL 5EDXA 5IJKC 1QYGH 3CXHJ 4YPJA 3JWDC 1DFBL 3UTSE 4PP2B 4KDTA 5SWSB 3BP5A 2GSIA 5DGRA 5I1GH 4BH7B 4K71B 1F58L 1UZ6E 5FGCE 4FNLL 5FO7B 1I1FA 2W0KA 5D2LB 3OKOB 3MZTA 4CL7A 2APBA 2DD8H 2W0FB 4G8FB 5JPNA 5EZOL 2ZPKH 4L8BB 5C0ND 4GQ9H 1BVLB 1DR9A 5AWNL 5FV1L 3HMWH 2OK0L 3MLTA 4ERSH 4B53A 2UUDK 5J89A 4NHUA 1DQLH 4U0RB 1KJVB 2P43B 3UTTE 4H1LA 4Y19D 5I6XC 4PV9A 3E3QE 1U91B 5GGUB 4YC2B 4NWUH 5L88L 4PV8A 2IALA 1MFEL 3IXTB 5L0QB 2UZXB 4FQHA 3VD3A 4P2QA 1HCVA 1R3KB 3OHXB 5IB1A 1CD1A 5D6DC 1B2WL 3NCYP 4R7DB 2Y23A 4EUPG 4XCCL 2HLFD 4XMPL 2YPVL 4ODXA 5C0DB 1RZ8A 3K4AA 4HS6B 4WHDA 4L29A 4FXKA 1WVZA 3QUXD 5JR1L 4E5XA 4X9FA 5TE6L 4UBDD 4U1MB 5L0QC 5C3TA 1PSKH 2B20A 2IAMA 2LTQC 2V5RA 3F62A 3HS0A 4L4TD 4LHUA 1MJJA 3DYPA 4I48B 1U36A 1T1ZB 1BGXH 3BDBA 2J5LC 1N4XL 1E4JA 3O2VL 1R5IB 4PP2A 3ULVL 4L8SB 3OJVC 5JUEL 4D9LL 5SWSA 4YX2L 2R0WH 1U58B 3N1PC 4OT1H 4GRWB 4PRHD 2W92A 3WFCH 3TGXA 1Q1JL 4BH7A 1ORQB 4HUXB 3DARA 3X17A 4NBYB 4ODTL 2PYEB 2EDEA 3MGTB 4K23L 5DJ8B 3QDJB 5FO7A 4ZNCD 4K8RC 3BRFA 5D2LA 3OKOA 4LCUB 4H25B 4L5FH 2W0FA 4G8FA 1IFHH 4L8BA 1K8DA 4UU9B 1IGIL 5KVMC 3TNMB 1NBZA 1NJ9B 5EOQH 3WD5H 1KOAA 4RIRB 4L8SC 1YJDC 1PZ5B 4LU5L 3CVHB 5GRWA 2I26N 3S36L 4FQCH 1U91A 5GGUA 2HFFB 1PEWA 3IXTA 2QSTA 4OF6A 1I7ZB 5DJXB 2BC4B 3AREC 1R3KA 3OHXA 1XCTB 3TA3B 3VWJC 1X7QB 4R7DA 2EYRB 3U0WL 1NC4D 1IGJB 2R2BB 3PDOB 4LPTA 4Z0BH 1QRNB 4RGNB 4BZYA 5C0DA 3MV11 3VI4E 1BFTA 1RJZB 4UV7L 5FCUL 3CDYA 4HS6A 3F6IA 4PYHA 1W0WB 1PG7W 1XMWA 4X7SH 4UT9H 1Z6JT 4LCIL 1MHPH 5KVFL 4U1MA 1IGCL 3OKLB 1UKQA 1OTSC 1RURH 4PJAE 3TA3C 5IBLD 2J4WL 4OKDA 4M7LL 1EEZB 1YEEH 3CDFA 1HINL 3T77B 1BWMA 4I48A 2BVYA 5CJXC 1T1ZA 5I8CB 3GK8L 2YKLH 4Y8AA 4CU7A 4PJ8D 1R5IA 5EFIB 4L8SA 1WFNA 4O9HH 2C26A 1U58A 5IVXB 1WITA 3C87A 1BEYH 1NAKH 2VDNH 1HI6B 2I60L 4YAQB 1ORQA 2VJXA 4Y16B 5CLTA 4HUXA 2PUQT 3RY6C 3BN9C 2PYEA 1G7PA 3MGTA 2A83A 5DJ8A 3QDJA 5AZEH 4PJ7E 1OAUH 4LBEB 4HW6A 4U05A 5HY9B 4LCUA 4H25A 1QR4A 3MJ8A 5JQ6L 3NAAH 5D1QD 3V4UL 1N6QL 4PGCA 4R4BB 4UU9A 2VUYA 2YMXH 4H5SB 4YZFF 5DI8B 3TNMA 1NJ9A 1N64L 2R56L 1UQSB 3LB6D 1SJVA 4RIRA 4Z7WF 5HVHB 5GGSA 1PZ5A 5C0RH 3BMWA 3CVHA 4LF3A 2HFTA 5FGBC 2WBJD 1DVFC 3BYYA 1IMHC 4XCFL 3WMSA 4GKOA 2ADJB 3LN4B 1I7ZA 1CZ8H 3QQ4B 5DD5H 5DJXA 2VLKD 2BC4A 1J1XL 1XCTA 3TA3A 3DNKA 4NM8L 1X7QA 1VENA 1WWCA 4LLVB 4D9QE 2EYRA 4OZGE 4LPXA 4RBPH 2Z92B 4NUJB 2R9HD 5CJXA 3KPRB 3V9FA 1BQSA 3ET9F 3PDOA 4JFDB 5F97E 3SGKA 1Z5LB 5L6YH 1QRNA 5I1HL 1S7UB 2WLZA 3VH8G 3F7PC 3U7WL 5FDYA 1RJZA 2MCPH 2GIYA 3U7YH 4NN6B 4HJJL 3L3GB 1W0WA 1ULVA 1BD2D 3LDBB 3OKLA 1F6FB 2APXA 3QUMH 1SVCP 3Q3GA 4EEEA 1T1YB 1EEZA 1U42A 2P5ED 4ZTOH 3T77A 3TBWB 4Z77B 5I8CA 1J12A 4PD4J 3TJHC 1F4AA 1GSMA 3C5ZD 1JIBA 5EFIA 4YHKH 2QL1A 1L9MA 2BRQA 4HF5L 3V5HB 4Y4HC 4O00A 5IVXA 1ZGLP 4KV5F 3KLDA 4AEIL 3MA9L 1HI6A 3L5WB 1N0XL 4GW4B 4YAQA 4Y16A 4U1LB 3LRGA 5IMKB 3TN0C 3B6SB 4MS8C 1RIVL 3VWKC 4K94H 9CGTA 4LBEA 2EDRA 1LDPL 4P3CL 4K7PH 1K4DB 5GS3A 3NH7H 4R4BA 2R0LL 5FA3B 1IGMH 4H5SA 1HEZB 3QFDA 5DI8A 4P59H 4CVUA 4UAOB 1UQSA 3QB7C 3V4VL 1J0ZA 1E6OH 1V3JA 4D0CB 1F4XL 1MFAH 3BKYL 3ULUF 4QKXB 1CXIA 1JF6A 3SY0B 1VDGA 2ADJA 3LN4A 1DBML 4NSKB 3QQ4A 4YHML 1EMTL 5ADOH 4KK8C 1RZJC 4LLVA 4ZUWB 2Z92A 2HJLB 4NUJA 3RQ3A 4Z7WB 5AYQA 3KPRA 4IHOB 4JFDA 3G5XA 1RFDL 5D5MB 1Z5LA 5HYQB 2BVTA 4R8WH 5J06A 4UAOC 5EZIL 1S7UA 2EDDA 4EDWL 1FAIL 3G6DH 4OF3A 3ZKQD 3L3GA 3NPSB 5GGRB 3DX7B 2Y72A 3RDTD 3DUUB 1NCCL 3F7YA 1OAZH 4UTBL 1F3DJ 1T1YA 3H9SB 3QIUD 3AFLA 1DLFH 3RUGB 4Z77A 4JRXA 2WP3T 1R3LB 5B21A 1PY4A 5J11C 1IZJA 5FYKE 1I8MB 1I1CA 3V5HA 2QQKH 3SN6N 1N8ZB 3NPSC 3C09B 3RIAF 4UV4H 3L5WA 4GW4A 1KXVC 2FHBA 3L5HA 4U1LA 2G9HB 2CR6A 4N5EC 3B6SA 1VKXB 1IKNC 2R0ZH 3QG6B 3NN8B 3QEGL 4POZD 4OIIL 1BP3B 5C0JB 3TZVB 1NCAL 4KRLB 2YXFA 1DLHB 1BVZA 3GKZA 1K4DA 1LO3L 4WU7B 1MVFA 5E99H 4FMKA 3DBXB 1HEZA 2XRAL 3QIWB 3SDYH 5KN5B 5C0AB 5EU6E 5DLMH 3BGMB 3BW9B 35C8L 3HZMB 5DMGC 2AEPH 5HGDB 4M4PA 2XZQL 5INCB 1XZ0B 1M71B 4D0CA 4M48H 1NEUA 2WV3A 3O4LD 5IFAL 5JHDD 3SY0A 3PDDA 1QSEE 5HDQL 2FX7H 3ES6B 4YFLF 3RX5A 4NSKA 3PP4L 4P4KB 5CGTA 3RVUC 1I9IL 1G6RB 4P2OD 2VDKH 2NXZD 5I8KL 3RIAK 3TZVC 4XVJL 5JZ7D 4ZUWA 2LABA 3DXAB 1TCRB 4Z7VE 3OAYK 2HJLA 2YD5A 4Z7WA 5F7NC 4IHOA 2DQDL 4O02H 5D5MA 4OLXL 5HYQA 1WIPA 1A14H 1MPAL 2ESVE 2B39A 2D03H 1JFQH 3E6HB 2ZNWA 5GGRA 1A7RH 3M1BB 2HH0L 2G5RA 4ZFOB 4Y5XC 3DX7A 4Z7UE 3OPZH 3PWUB 3WLWC 1GAFL 4ZO6A 3O6FC 3EYSH 4TQEH 3DUUA 1IKNA 5KS9B 5BW7A 1OPGL 2JJWA 4ONGH 1CDBA 5IEKB 1W2KT 3DO3A 3H9SA 3HCVB 1KNOB 4XP4L 1J5OH 1F6AB 3RUGA 4BQBA 4UILL 1R3LA 1A8JH 4AIZB 1QLRB 4PIRF 5EPMA 2IGFL 3B9DA 5T1KB 2KZ1B 4F58L 1KPUB 2RR3A 1I8MA 5E9DE 5C09B 2A0LC 3ULUC 3MV9D 5FKPB 1S7VA 1N8ZA 1PQZA 2NY7H 4L1DA 4U1GB 2NTSP 2RBLA 3EOTH 2F54E 4I3SL 1PBYA 3CX5K 1IQWL 1OSZB 1V3LA 5JMOC 1YEGL 5GXBB 1VKXA 3NN8A 4ZPVB 2ATKB 2B2XL 5C0JA 3TZVA 1DLHA 5CLWA 4MAYD 5I75B 4WU7A 1Q9LB 3UJIL 3DBXA 4AT6B 1RJLB 3U0PA 4NQEB 4CN1A 3QIWA 4BH8B 2ZCKH 5BRZB 5KN5A 3HE7D 2UYLB 5C0AA 3BGMA 1R0AL 3BW9A 3HZMA 5HGDA 4M1DH 3BPNB 3CJJA 1XZ0A 5DEZA 1M71A 3QCUH 4GBXD 1OAKH 4EJ1C 3ES6A 2VH5H 4PJXE 4H8WC 4KRPD 1QRKA 4P4KA 4XB8A 4J3WA 1G6RA 4TUOB 2DIJA 4WIQA 3C6LB 4PRNB 5IBTL 3DXAA 1QG3A 5I75C 4G42B 5LQBL 2XIDA 4KMTL 1AO7D 2XV6B 1RI8A 1A21A 2C5DC 4JQVC 1PKOA 2V5SA 5KVEL 1YN6B 3MOAH 1SJEA 1NCBH 4P9HC 3E6HA 4FA8A 4M8QB 2A38A 1TTUA 3BPNC 3M1BA 5D72H 5K9QI 4OGYL 2DLFH 4S1RL 4ZFOA 1BVKB 5GGVY 1JHKH 3PWUA 1TVHB 3GSRB 1S5HB 1UCBH 5KS9A 2EO9A 4LCWB 2OL3L 1W0VB 3WHE1 4L3CB 4MXVF 4NC2B 3ZHDA 4Z78B 4PRBB 3HCVA 3C6LC 1F6AA 3BWAB 3WO4B 1FZJA 4Y19E 4AIZA 1QLRA 1AQDB 5T1KA 4ZAKB 1KPUA 5C09A 4GUPB 3O8XB 5FKPA 5E4IA 1UGNA 3BP4B 4WFHD 3OAUL 4DTGL 1G6RL 3MCKA 3G6AB 4BFIB 2DYPD 1GOFA 1OSZA 1IBGL 3QUZC 4XPFH 4LMQE 1LP9E 3C5SB 2AJUL 3WJJC 2ATKA 3RJQB 2EDOA 4M43H 3HLAB 2QTEA 4Z7QF 4OLVL 5KSAD 3BUYB 3TNNB 1GC1L 4NO3B 2J7LA 3VGAB 4JY6B 1JPFB 1Q9LA 1RUAH 5F9AC 4AT6A 1RJLA 4NQEA 4BH8A 3L5XH 2UYLA 5SWZB 3GO1H 5IESL 4PLOB 1MAJA 5D1XB 4XWOC 5FHBH 5B22A 3DLQR 3EJZD 4L4TE 4QEGA 3IF1B 4AQ1B 2XZCH 5D93C 1A4JB 4PJIB 5IIEB 4I0PB 4TUOA 3C6LA 4PRNA 1CGYA 4G42A 4M61B 2NR6D 5ISZD 4PRHE 5F9OH 1K2DA 1CXHA 3D87B 1A6WH 3ARGB 4JPVL 2FEDC 4M8QA 1BVKA 1QHOA 5IMOB 3BJLA 1TVHA 4LDOB 4NC0B 1S5HA 1XR8A 3ARDD 1E6JH 4LCWA 1W0VA 4L3CA 1EEUA 3RWJB 5BOPA 4DN4H 1RZGB 1V8HA 4I0PC 1C5BH 4Z78A 3NFSH 4PRBA 5HYSB 1FNSL 2H2PD 3BWAA 4LSQH 2HT2C 7FABH 3GHBH 2EECA 4HLJA 1AQDA 4WV1B 2R39A 4ZAKA 1JYNA 2YA2A 2HTLC 3ARGC 3O8XA 2QSQA 1CDJA 3BP4A 1FG9C 2AJ3B 5DS8B 4ONOA 4BFIA 1WZ1L 1JPST 1JHLH 4HUMB 4S10A 1ZWIB 2WLYA 5CJQL 1JYXA 3DIFA 5CILH 1KJMB 1MCPL 1B4JL 1BWWA 3C5SA 4OQTH 5A2FA 3P0YL 3HLAA 4AL8L 3BUYA 3TNNA 4F7PB 5CEZH 4JGJA 4DQOL 5IB3B 4JY6A 5KAQF 1JPFA 4MJ6B 4K2UL 4EQ3A 2HKHH 4UOW1 1MFCH 4PJEE 4CDGC 5SWZA 1CS6A 3WLBB 5TF1H 1FRGL 4TYUA 5D1XA 4OI8A 3IDUA 2COQA 3QI9B 3IFPB 3RTQA 4WHCA 1PX4A 5FYLL 3IF1A 3MXVL 5MI0B 2OX5A 3DETC 4LGPB 3PABB 4JJ5B 2APFA 2Z31C 5J13B 1A4JA 4PJIA 1F90L 3SPVB 5IIEA 4R90L 1ZGLB 4I0PA 3CK0L 4NWTL 5DHVH 1YC8A 3KPSB 1NLBL 3MUJA 1BFOA 4M61A 2DQIH 3LEYH 2OBGA 1J9CT 3DGCR 2NY0B 4MNQA 1LE5B 2NY3D 4HBCH 1RUQL 3IJSB 4BYHA 1INEL 4YHYB 3ARGA 4PRDB 5JQHC 3NACL 1MCWW 1MELA 3FQUB 5HI4D 1S3KL 2GJ6A 3WNPA 4YHIB 1YNLL 5HHMD 5IMOA 3MSPA 4NPYB 2CLVB 1RU9H 3FB5B 1IGFH 4ZOBA 4K3DL 1UB5B 3RWJA 4UZGA 1RZGA 4ZUVB 4PJBB 5E2UH 2H45A 5HYSA 2P8PB 1OL0A 4OLYL 4JRWA 5JDSB 1PD6A 4WV1A 4CMMB 4KUCD 3MOBL 4MD5B 3ZT5A 4QHKI 4JM2F 1VADB 3C60D 2ZUVA 1UJTA 2VLKE 2AJ3A 5I8OH 5DS8A 5LWYH 2CGRL 5D2NE 5K9QG 4FQJL 4XAWL 1ZWIA 1ZTXH 1AE6L 4WI8A 1SY6H 3B83A 4RFEB 1KJMA 2GK2A 5I15L 4LASH 2IPTL 3KWWB 4WCYL 5IUSA 1OQOA 1BFVH 4I9WD 4IDLA 2X1QA 4G9FB 3MLZL 1QZ1A 4F7PA 1PGRB 4HQQH 4MJ6A 1FC1A 3N9GH 3OR7B 5H35B 3Q5TA 4B7LA 3OZ9L 4FABH 4JPKL 1BD2E 2RGSA 2OZ4A 4M6MH 4ELMA 4NFBA 4FQ1L 1OF2B 5F93C 3WLBA 1JGUL 1XF4B 3VGBA 1TJIH 3RVVC 3QI9A 2YZ1A 3IFPA 5SX5K 2P5EE 2OR9H 3S4SB 1UM5H 3PABA 1KCRL 3P9LB 4JJ5A 3SPVA 1D5XB 1F3JA 2FEEL 4HWNA 4EBQH 3KPSA 1NUFA 5FV2A 2Y6SD 5GSRB 1OARH 4CVXB 3INUL 4PREA 1DN0B 3SO5A 1LE5A 4QXGL 4PRDA 2FJFB 2J8UB 4PJFF 3FQUA 5TH2B 2OTUA 1FCCA 2QSCH 4YHIA 4NPYA 5C0IB 1A3LH 4YHOH 5GGSY 3FB5A 1JI2A 4LPVA 1KCSL 2OZ4L 2BNQD 4ZUVA 3VXSA 4PJBA 5D7JB 5IOPA 2P8PA 1M6OB 4NGHH 5K9JH 5JDSA 3GSUB 1EJOL 2OM5A 3JWOH 4CMMA 4OLEA 1CVRA 2NY5L 4MD5A 4J6RH 1H5BB 3FAXA 3WXWL 1VADA 1MCHA 3N06B 3VMNA 3IDNA 3OXSB 2DWEB 4RFEA 4LCYA 1BIIB 2CLRB 4TSAL 2GTZB 1KEML 3KWWA 5DZOA 3A0OA 2F5AH 2DTSA 1FSKC 1FE8L 4G9FA 3UP1A 3MX0A 1ZLSL 4MWFB 5EUOE 4RNRB 5D7JC 1GOGA 1RMFL 3OR7A 4KRMB 5H35A 2HT3D 4LPCA 1FLRH 5DHXB 1I3VA 4JM2B 3QQ9C 5E1HB 4K3HA 1MCFA 4MA7H 5D7IF 2EH8L 4XP5L 1XF4A 1Z9LA 4KH2A 4NKOA 4O5LL 3ARED 1PJ9A 1CLZH 5CEXB 3S4SA 5IW6B 3LS5L 3IU3B 3P9LA 5GRJH 3WXVL 1PLGH 1N5AB 3O6KL 4JG1H 2VQ1A 5LGHH 4NM4H 4LSUH 5AYUH 5ID1B 2HAZA 2HN7B 2VKXA 2DS4A 4CVXA 4DAGL 1DN0A 3W0WD 4JM2C 1TDQA 4GRLB 5TDNB 2B4CL 2ZUTA 4ZO9A 2FJFA 5F96L 5I30H 4JHAH 3BN3B 3OKMB 3QP3A 1NGYA 2J8UA 4WENB 5HYJB 3U1SL 5FK9B 5TH2A 1EEYB 1FV1B 1DBAL 3IFNL 4OZHE 5C0IA 2NY1B 3KAAA 1MIEH 5GS0D 5D71H 3DECA 1ERNA 1A7PH 4HPYH 4XNUH 5EORH 4F9LC 1M4KA 4HLZG 1YYMH 5D7JA 5HHNB 1Q0YL 3O4OC 4Y89A 1M6OA 3GSUA 3P4MB 4GS7C 5ALBL 4J23A 4RISH 3H7BB 5DURB 5C6TH 3TWCH 5JW3H 3O6LL 3RA7H 2JIXB 2MPAH 4GRLC 1ZEAL 1H5BA 1QA9B 4LIQL 4K9EC 4XNXL 1YPZE 1OP3K 4JM4L 5BXFB 1T89C 5T3ZL 5JLZB 4IMLB 4KKLC 1C5CL 1FNGB 1J0IA 1P5UA 2AJXH 5HHVL 3OXSA 1WWWX 2DWEA 2XQBL 4OAWB 5FXCH 1BIIA 4JJHA 3V4PH 2GTZA 3OQ3B 5M95B 4QCIB 4OLUL 5DFVD 2A6JB 3QDAA 4G6MH 4MWFA 3CD4A 4RNRA 3ZL4L 1NCWL 2Y36H 1UACH 5J0BA 5EBWB 1KUMA 3NCEB 5E08H 5CBEB 1MOEA 1JGVH 1DVFD 4BFEA 3FQRB 3QQNA 1IAIL 1JZ3A 4LHJB 3UBXG 4OZIA 4I3RH 2GJZB 3E8UL 4EI5B 3RGVC 4WI2A 3MZGB 4QHLB 4E0RA 3C6SB 5CEXA 2ID5A 5IW6A 1WZKA 1BHGA 4NC1E 1MCJA 4IJ3B 1N5AA 4LDEB 5KW9L 1CGTA 4UNUA 4A6YB 1F4YL 2VOTA 5ID1A 5FCSH 3MV9E 2HN7A 3D2UD 4LLAA 4TTDC 2XWTB 5GHWH 1A5FH 2VXTL 3Q2CA 5TDNA 1MQKH 4M8VA 3V6FB 3N85H 2JJVA 3OKMA 2FO4B 5FK9A 3MRGA 4OM0H 3P4LA 3WO3B 1EEYA 1VFAA 1YUHB 1HCFX 2D4FA 3U83A 3TJHD 3HTLX 4IJ3C 2ITDB 1A0QH 1CXFA 5HHNA 3RWGB 4PUBH 4Q2ZB 4NJ9H 3WFBL 2UWEE 4Y4HD 3P4MA 4G3YH 4JO1L 4PB9L 3H7BA 2JIXA 4MD0B 3R8QA 5IQ9B 2W1NA 1QA9A 1J1OH 3TN0D 4QNPF 5BXFA 4MS8D 3VWKD 3IVKB 5AZ2H 4IMLA 1FNGA 5DHYB 3M8OL 5CJOL 5C07B 4OAWA 4OQ1A 1UWXK 3PGFH 4PRIE 5EN2B 1P4IL 5GGRY 4QCIA 1AO7E 1CD9B 4LARL 1RHHB 2A6JA 5D7LD 1EEQA 4JANB 5B3JF 4FRWA 3RAJL 2X4UB 1KXQE 4NKMB 3IU4L 3MLWH 3SKMB 2JJUA 5JIIA 5EBWA 5A2IH 4KDVA 2VQTA 4HWBL 4NUGL 1FNEB 3FQRA 3BEWB 1XF5B 4OFYA 3R4DA 3VXTA 1Q0XH 4XVUC 2W60B 2GJZA 4EI5A 1NGQL 3MOQA 4KK8D 4NDMB 5IJVB 4QHLA 4RMUA 3C6SA 1E4WH 2E9BA 5MEPB 1IEAB 2HFGH 1A4KB 2IAND 1L7IL 4AG4H 1KN4H 1ACYH 1TVDA 3FFCB 5GPRA 3SCMC 4A6YA 5ICZB 1T03H 4QGTA 2GKIA 2MKLC 3DX8B 5GJTH 4C83B 4WFHE 3D69B 5I1GL 4KQ3L 2XWTA 5DQDL 1JJUA 3V6FA 3EAKA 4LPYA 3JWNC 3CAFA 5E94A 2X40A 4M7ZC 4TULH 4W6YB 1YUHA 4ODSL 5IHBA 2AVGA 3V0AC 1LEIB 5FOBB 1EPFA 2DD8L 2QHLA 1M7DB 1CXEA 5JXEC 4OV5B 4GQ9L 4F37F 3PWPE 4OGXH 1HHHB 3SDXB 2NY4B 3GIZH 3HMWL 3C2AL 1GHFH 3QIBD 4Q2ZA 1C7SA 1NBYB 3ZMRA 1OVZA 4MD0A 5F6HI 4NWUL 5IQ9A 4OFDA 4JFQB 5F9DC 1U3YA 3IVKA 2DKUA 1FH5H 3BH8A 4QRQB 4C56B 5DHYA 5GJSL 5DMIH 2PYFB 5C07A 1YECH 2CJUL 4DGYH 5EN2A 5ISZE 2CRZA 4OKVB 3DO7B 1RHHA 4JANA 3T04D 2V9QA 1XFPA 3BE1L 2X4UA 4NKMA 3SKMA 5DMGD 3NCJH 4Z7NE 2V5YA 4OB5H 4LVNB 4XCEB 4UMGA 4F37K 4E41E 3GMLB 3T0EB 3VXNB 2G5BB 1UCTA 3BEWA 1OAXH 1XF5A 5DJZB 4N0UE 4DEPB 2DKSA 5KJRH 3RVUD 1PSKL 1QR1B 2DTMH 3R8BB 4NDMA 5IJVA 2PTVA 2LVCA 3QCTH 4PYGA 5MEPA 1IEAA 1VFUA 1A4KA 1CGUA 4HWEH 3VFNB 1BGXL 4L3ED 1UG9A 3FFCA 3SDCB 5ICZA 5FIEA 1MNUL 1I3UA 3DX8A 2BOBB 3ARUA 4WW2F 4C83A 4PJ9B 1YMMD 4LVNC 3D69A 3EYQD 3WFCL 3S36X 5F6HJ 2UY7A 2ZSVB 4QGYA 3QFJD 1S7TB 5TGBB 4AEFA 1TETH 4L4JA 4L5FL 1LEIA 1A6VL 5FOBA 5ADPH 1M7DA 4JFFD 4OV5A 2EIDA 1UZ6F 3BWUC 1HHHA 3SDXA 1RZIB 3I9GL 1MQ8A 5T1LD 2FYYA 3SDCC 3WD5L 3V0VB 1JPSL 4XBGB 4PJDE 3ULUD 4LSVL 4QOKE 3IB4A 3SEPA 2ED8A 5E24E 4XTRD 4PY8I 1KF9B 4XHQA 1N6UA 1DUYB 4JFQA 2X7LB 3OG6B 4C56A 4XMKH 5IKCB 2PYFA 3B3IB 4OCWH 4L4VB 3ZTNH 2ZUWA 2ZNXA 5FAAA 1BFSA 2Y06H 2F58H 4LOUD 4BM7A 4OKVA 3NA4A 4L9LC 5EOTA 3JV0A 2LV4A 1BQUA 2DIAA 4XCEA 1XIWB 2OTPA 1S78C 3GMLA 3VXNA 4LEXH 1MHPL 2G5BA 5HHME 4EN3C 3EYUH 3T0EA 5KVDH 4LAQL 2BVOB 2N1KA 5DJZA 3JXAA 2NCMA 3U9UB 3VGGA 3AS1A 2JB5H 1QR1A 1S9VB 2GQHA 4Y5VC 1OTTD 3CUPB 4EIGB 3QEUA 1HZHH 1YEEL 2DJ4A 2Z9TA 3GRWH 5ACZB 5IFHL 3D0VB 3VRIB 5I1AB 3VFNA 3WIHA 1EHNA 4UQ3B 2H3NB 2IG2H 4YHPB 2BOBA 1LE9B 2BNRD 1NANH 4O9HL 4W68A 2E8ZA 4PJ9A 2VSCA 4F33B 1AGFB 1NAKL 2BVPB 2VDNL 3C5JA 5JNYB 2OTWA 4PY8J 5BJTB 4LRIC 3AB0B 2ZSVA 5AZEL 1BF2A 1FN4B 5TGBA 1AI1H 5KSBB 4I9WE 3MACL 3DI3B 4U6XB 1MY7A 4PJ5D 4R2GB 3UDWA 4KRNA 2ZSWB 1UXWB 1GJIA 2YMXL 1RZIA 2YC1B 3KXFB 2R69L 3QRGH 1QSFB 1FO0B 3V0VA 4ALAH 3KYOB 4G6FD 5C0RL 4MQSB 5K59E 3UTSB 3UYOD 2IH1B 1BBJB 3ELAT 3QUZD 1NFDE 2F5BH 1DUYA 3T08A 3CU1A 3TVMB 3HI5L 2X7LA 3LQAC 5KAQG 3VFRB 3CFBB 5BS0D 5IKCA 3B3IA 4L4VA 3W39B 5FGCB 5ITBL 2YPKB 3G9AB 1HHKB 2JELH 4N90D 3OR6B 3BRDA 1QFHA 1CGVA 5BV7B 1MUJB 4WW2C 3ZDYE 3VFTB 3HPLB 3DGGB 4XCNB 1PDKA 4XWOD 2CK0H 1KIPB 4X9GA 3QHZH 2GT9B 1XIWA 5GGTA 3CVIH 3QHTC 2Y4SA 4IRSD 3C8DA 5DMJB 4BSJA 3UTTB 1BM3H 2ZUSA 2BVOA 4OM1H 4LRIA 2CMRL 1S9VA 3QUML 2BNQE 2VSDA 3CUPA 4OCYH 1OTUD 4OZFG 2HT4C 4J4PC 2H32B 1UADC 4ZTOL 2QSVA 4HUNB 5ACZA 1CCZA 3D0VA 5I1AA 5JO5A 1NCUA 3QPXH 5BV7C 3PWVB 1U8QB 4ZQKB 2ZUQB 3CFCL 1EO8H 4UQ3A 2H3NA 2YRZA 1J10A 2IWGA 4YHKL 1LE9A 3KPTA 4WWID 4F33A 4OD3H 1AGFA 3BEVB 5JNYA 3RWCB 4LSSH 4X4ME 2XPGB 3ARYA 15C8H 4J3SA 5BJTA 4APQB 1FN4A 4K94L 5KSBA 5KANI 4U6XA 1CQKA 2PO6B 4PJHE 4K7PL 3OV6A 2ZSWA 5CP7B 3PQYD 5GGTL 1UXWA 1IGML 5D7SH 2YC1A 2B5IC 3KXFA 4PJ7F 1NMBH 1QSFA 3NIFE 3LKNB 1FO0A 4R7NB 3RPIB 1MFDH 2ZUQC 3FOLB 1Q72H 1X5AA 3KYOA 3UTSA 2GY7B 4JVWA 4X9BA 2IH1A 2H8PB 1BBJA 5FGRA 4XNZB 2V2XB 1B6DA 3TVMA 4HS8L 3IETA 4NRXB 3CFBA 3QWRD 3W39A 2FH8A 3B43A 1T0NB 5L8KB 2YPKA 1QPXA 2GK0B 1MWAH 2PO6C 3UC0H 1FNLA 4M6OH 3OR6A 3I75B 4OIBA 3W0WE 3DSNA 3HC4H 1IEHA 1KJ2B 3JZ7A 1MUJA 3ZTJH 3VFTA 5ERWB 4QTIH 2CRIA 1WT5A 3HPLA 1QEWB 4RZCB 3DGGA 2X70B 4XCNA 4IRJC 1G9ML 2GT9A 4HZAA 3G6DL 5DWUH 3D18B 3SDAD 4WGVB 3UTTA 1CFVH 2XTJD 5SX4H 3U36B 3H9HB 4JN1H 5ESAB 4LPWA 3FONB 4XZUB 3DVFA 4S1DD 1OAZL 4OBRA 3I02B 5DO2D 2H32A 3D48R 1DLFL 1KSRA 4AH2A 2Q7YA 1CDGA 1DE4B 3GB7B 4YK4B 4NQCD 3PWVA 4FG6D 5LG1A 1U8QA 4ZQKA 4V2BA 4OLZL 1S5IL 5GS1B 2E7HA 1LNUB 2QQKL 4PRAB 4Y2DB 3BEVA 3ZE2F 2VDOH 3BSZH 3BYTA 4PLKC 3RWCA 1DDHB 1KYOK 1T2XA 2VDML 2XPGA 5D4QA 2J8OA 4YFEA 4JEGB 4APQA 4EOWH 1T2QH 2R0ZL 3GSNH 2CD0A 1D5IH 5IG7B 2PO6A 5DC0A 5CP7A 4PJAB 1AFVL 1J05B 4V2CB 5E99L 3KS0J 4KAQL 4OF5A 2FX9L 3LKNA 3SDYL 4FQIL 4DCQB 5CZVH 4LCCC 3FOLA 3WE6B 4H88H 1CBVH 2AXGB 1UXSA 4JFHD 4GAYB 2H8PA 1ZVYA 4M48L 2YPLD 1TFHA 2V2XA 1C1EH 2VR5A 3HMXA 3BP6A 4UIMB 1XGPB 5GGVH 2YRLA 4NRXA 1L0XA 2UZIH 3K4DA 1KCUH 2PXYC 4YUEH 3NZHH 1T0NA 2VDKL 4UI2A 1U8PB 4PJ7B 5C08E 3I75A 1DFBH 1TXKA 5IW3A 4P5TC 4KROB 4O02L 2VLRD 4YBLB 5ERWA 1QEWA 4RZCA 1A14L 2X70A 3CGTA 3LVEA 4DJMA 2D3VA 5H37G 3GKWH 1JFQL 3WCYA 1F58H 3CFIC 4KI5F 5IEHB 1DL7H 3D18A 1A7RL 2XKSA 3B8YA 4ZG1A 2DKMA 3OPZL 1UEMA 1FPTL 4DKAA 3H9HA 3RVXC 3EYSL 4TQEL 5ESAA 5EZOH 3FONA 4ONGL 4XZUA 2BFVH 2AV1A 3I02A 4JFEE 2OK0H 4IBLT 3D25B 4N8CH 4XC3L 1DE4A 3GB7A 1T22B 4U1JA 4OZGB 4DGIH 5F7LB 4YBLC 4MDJB 5GS1A 3HMXL 2X1PA 1LNUA 1CICD 4Q6YA 4PRAA 4Y2DA 4YHZH 3TFKD 1DDHA 1A3RL 1T83C 2D7PA 8CGTA 1E4XL 4LP5A 5D7LE 3FOMA 4CN6A 2YD7A 3B9KC 5IG7A 2C3XA 3KPLB 4HIIB 3S5LB 1MAML 4FQ2H 1ITCA 4PJAA 1J05A 4J3VA 1NGPH 4B7IA 3LMJH 1WTGT 3HE6C 3VXPB 4DCQA 5JR1H 3S34L 5IBUG 3WE6A 5JW4R 4P46B 1I8LA 4KMLB 2AXGA 4HG4K 3BPOC 4GAYA 2EE3A 1C16B 3AS2A 5FYJH 3ETBF 4G43B 3CSYB 2MQ3A 1EIBA 1AKJD 4LQ1A 1FL3B 4JRYD 2MKWA 4UIMA 1XGPA 3OF6A 5MENE 2IANE 3GIVB 4H1LH 3MRRB 5ETUB 5KANG 1EFXD 5B39B 5JUEH 3UYRL 5CGMA 4O2FB 4YX2H 4LK4A 1Q1JH 2FD6H 4P9MH 1NCBL 1WISA 3DI2B 4P46C 3T2NH 4ODTH 2DLFL 4YZFE 1I7TB 5E2TL 5EZLA 3U0TB 4JFXB 1UCBL 1MEXH 2R1YB 4HSQA 2Z8SA 3MR9B 1ZT4B 3D25A 4WRLA 4NZUL 1T22A 5ICXB 2OXHA 4OZGA 5KTEL 4LU5H 2MJWA 4MDJA 1FGNL 4I4WA 2W38A 4RDQF 3TBTA 1F11B 1GPOL 4NO0A 5D7KD 3U2SA 4WO4B 5GSVB 2E6JA 3BT2H 4XPFL 2NY2B 1KLGB 2DN7A 3ESVF 3N50A 2QR0B 3LKQB 3U0WH 4M43L 3KPLA 4HIIA 1X6LA 3QUYD 3S5LA 3MLXL 5ICYB 4CNIB 1MHEB 5FCUH 5FM5M 2YWZA 4D9RD 2NY6B 4XI5D 3TO4B 3L5XL 2VZOA 3MV7D 4LCIH 3QEQD 3VXPA 3DUHA 3NBNA 4P46A 5KVFH 4NKQB 2A6KB 4KKLD 4N0YH 1IGCH 1VEOA 4PTTB 2OQJB 3QJFB 1C16A 4G43A 3CSYA 1I3RA 4OFIA 1FL3A 2J4WH 1QFOA 3TT3L 1HINH 2XZCL 3GIVA 2Z8VC 4KV5E 5C1MB 4L3EE 1RULH 3GK8H 3MRRA 1A7QL 4DKFH 5ETUA 2F74B 3VMOA 3WFDH 5B39A 2R0KL 1YMME 3T65B 1WBXB 2FGZA 1XGRB 3RZWA 4O2FA 2F53D 5F9OL 3PIQB 4LKCB 4NQSB 3DVIA 3EJYC 3L6FB 2C3HA 1O7VA 2I60H 3TO4C 5IP4A 4TRPH 1QFPA 3ARBC 4HUVB 3QFJE 5EU6B 3RGVD 4P99A 4D0DB 2JCCF 1I7TA 1RSFA 4NZDA 2EXWC 3MV8D 5B8CB 4JB9L 4JFXA 1JMXA 1E6JL 3S6CA 2R1YA 3V4UH 1QSEB 1WFOA 3LCYA 5DD0H 1ZLVK 5TE7H 3V0WL 1VA9A 3UCRA 4DN4L 3IDYC 2EIBA 1C08B 3MR9A 3ULUE 3NFSL 4X80L 2R56H 4X8XA 1ZT4A 1QKZH 3T3PF 4CRPA 4LSQL 7FABL 3GHBL 3FB6B 5ICXA 1C8PA 3NMEA 4Z7VB 4K8RH 4YDKL 2O61B 1DBBL 3FB8B 1JMZA 5IMLB 2XTLA 2KZWA 4JN2B 1SBBA 3ULVD 1D9KB 4EIZC 1F11A 2ESVB 1HILB 4GKSB 1J88A 2LFGA 1JHLL 4WO4A 5F7WC 5GSVA 1KLGA 4RMWA 4Z7UB 5B8CC 2BY2A 3LKQA 2QR0A 4D8PB 1X5GA 4OQTL 3RWEB 4GRWH 4G6AD 3ZKXB 4NQVA 1MCEA 5ICYA 4CNIA 1MHEA 5I1HH 1FNHA 3BAEH 2HKHL 2UUDH 3BKCH 3RIFF 5EU5B 1G1YA 2BX5A 5DJ2B 4BSWB 5FF6B 3TO4A 1NBVH 3KHOA 5CINL 2BY3A 2FBJL 5TF1L 3RBSA 5B4MC 4QYOB 2A6KA 25C8L 1D9KC 3W9DB 5E9DB 2XACC 2OQJA 4KUZH 2IAMD 2B7DT 4ZFGH 3MC0A 2QV2A 3BIAX 1P2CB 2F54B 3EOBB 2FWOB 4HFWB 1ZAGA 2DQTH 4KKAD 5GISL 3OJDB 3CVHH 3T0WA 1P7HL 1WWAX 1OY3B 4HGMA 4YWGH 2VO5A 2F74A 2BNRE 1HHJB 1IGTB 3ZKXC 1TENA 1VSCA 4JQIH 3T65A 1EFQA 1WBXA 2DQIL 5SWSD 1XGRA 3DHJA 3PIQA 4LKCA 4NQSA 4PPTA 3L6FA 4WHYG 3MA9H 3GDBA 2BSSB 4S1SL 4HUVA 4FQQB 3R0NA 4TSCH 4D0DA 3ESUF 4XP6H 5FEBA 4PJ5E 1FDLL 3LEVL 1LDPH 5B8CA 4LNRB 1MCIA 4P3CH 4KPHH 1IGFL 1TQBC 3ZKNC 1EO5A 2AEQL 4NCC1 4PJXB 2GI7A 1C08A 5ALCL 2GTWB 5FYKL 2YUWA 1S7XB 4M9OA 3FB6A 2XOTA 1B0RB 4XPAL 4YXHH 4Z7VA 5KBNC 2O61A 5AD0B 3FB8A 3BKYH 4OD1L 5IMLA 1NEZB 4JN2A 3N1FC 1D9KA 5BS0E 4EXKA 4XAKD 2ESVA 1HILA 4GKSA 4QO1A 4M3JA 1EMTH 1ZTXL 5FUZH 3ZYZA 4Z7UA 3AXLB 4D8PA 3RWEA 3VFVB 1BJ1H 2XQYG 1Q9OB 5E03A 1RFDH 3QXAB 4BFBD 1JRHI 4M7KL 4EDWH 4LLDB 5EU5A 3ROLB 5DJ2A 4BSWA 1U6AL 5FF6A 4Y19B 4M6ML 4ACPA 3I2CH 4QYOA 1D6EB 3KPOB 1KJ3L 1TJIL 4MQ7B 3W9DA 5E9DA 4ZNEE 1NCCH 1P2CA 4CGTA 4LAJH 1Q9KB 2F54A 1UM5L 3EOBA 4GAGH 2FWOA 4HFWA 4Y5YC 3FRPA 3HC3H 4F7MA 3DV4B 5C0NC 1LP9B 4HK0B 4EI6B 1YMHB 4JE4B 1HHJA 1IGTA 1S9XB 4YPGB 1T21B 1OARL 5TF0A 4Z6AT 1U41A 3TT1H 2WNGA 4XNQA 4PY7B 3QUXB 2BSSA 5HI5D 5TE4H 1IARB 2ICWI 1IC4H 2GSGB 1JTOA 4FQQA 3QDGE 1IAOA 2DLEA 2PYED 3QDJD 3NGBB 2DB8A 4FHBD 4JFZH 4Y0GA 3GMOB 3QZWB 2P47B 3ZE0E 1NCAH 3PQYE 3S35L 3WFZA 4YO0B 4L4TB 1B0WA 1NC2A 4Y7MA 2HJKB 4PJXA 2HLFC 1FFRA 2GTWA 1K85A 4NGHL 5K9JL 1S7XA 2R2HB 5CFHA 3QQ3B 35C8H 3BGFC 1ZGLM 2CQVA 1JNHA 1MAKA 1MCOL 3JWOL 3R06B 5AD0A 2XA3A 4PRHB 2B8OT 4O2CA 5IFAH 3QUXC 1NEZA 4LLUB 2X41A 1W8OA 3BIBX 4UBDC 2WUCL 5LAXB 1C12B 2GY5A 1U0QA 3OKNB 1RUPL 5A3ID 5L7XL 5I8KH 4XVJH 3REVB 5F9WB 1F5WA 1P5VA 3AXLA 1MF2L 2FJGB 4U31A 4WWKB 3CFJB 3VFVA 1Q9OA 2DQDH 1G9NC 3QXAA 1QRND 4HKBB 1YZZA 3ROLA 2ERJC 1E4KC 3KLAB 5HHOD 4MXVE 4Y19A 2HH0H 3SGDH 5A16B 1X4ZA 1D6EA 2NZIA 3KPOA 2H2SC 4MQ7A 3K1KC 4YDIL 4XNMB 2ORBL 3HKFA 1OPGH 2ICWJ 1VFBB 1CLZL 3CNKA 2SEBB 5SV3A 3D6GA 1Q9KA 1CR9H 4XP4H 4NQCE 4PJGF 5F9WC 4KK9C 5GRJL 4JG0H 4C57C 3DV4A 1NC4B 1LP9A 4HK0A 4UILH 5TDPB 4EI6A 3SE4A 2DIBA 4JG1L 1YMHA 1ZT1B 4RRPG 2IGFH 5LGHL 1R3IL 4NM4L 4F58H 4YPGA 5AYUL 1T21A 2R2CA 5I1EH 3EBAA 2MNUA 1I8IB 1S78D 4EN3D 3N1MC 3PV7A 4Z7QE 4I3SH 4PJEB 2XXCB 1IQWH 2GSGA 3EFFB 3OJMB 1KCVH 4HZLB 5DXWA 1CDCA 4M93B 5IK3B 2D31B 1UVQB 4XP1L 5HVGB 5C71A 2B2XH 3N1QC 3OTTA 3QZWA 2C4XA 4YO0A 4L4TA 1A7OL 4N1HB 4XWGH 3BZEB 3UJIH 4XNUL 1YYML 4K55A 4OFKA 4PJ8B 3RU8H 2R2HA 3O6MH 5EO1B 2KKQA 3QQ3A 4JO3L 5ABDE 1E4KA 1HQ4B 1KTDA 5C6TL 3TWCL 2YPLE 5JW3L 4G8GD 3R06A 1IC5L 3K8MA 1P9MA 4LLUA 4M93C 5LAXA 3T1FB 2AJXL 4M1GH 3OKNA 2BDNH 1ETZB 3REVA 2AK4E 5IBTH 3EZ8A 1FL5B 2FJGA 4X98B 2VLRE 4WWKA 5D1QB 3CFJA 5LQBH 1X6NA 3KPRD 4JFDD 4HS3B 1IAIM 4G6ML 2Y36L 4PJ8C 2XICA 4HKBA 5KVEH 4JFOB 3KLAA 3F7QA 2P48B 1T80A 2J8HA 1EXUB 2WBJB 5A16A 4CAGA 4TSBH 4B41A 3GBNL 4ZSOE 1MFNA 1VFBA 2VLKB 4QRTB 4GAJH 2SEBA 2PN5A 2Z4QB 3ZE1F 1B88A 2ARJB 1U3HD 5D2NB 2ZUUA 4X6CF 1L0QA 4JRXD 5D1QC 1NC4A 5TDPA 2EYSB 1ZT1A 3RZCC 3QEHB 1T1XB 2UY6A 1MJ7H 2VRAA 1CFTB 3CFEB 5EO0A 2AJZB 1I8IA 1LO0L 4NRYB 4W4NA 5IWLA 2DQEL 4FFWD 1MREL 5GHWL 4DTGH 1A5FL 1G6RH 1NCDL 4PJEA 1BD2B 3EFFA 3N85L 4JVUA 5D6CB 4HZLA 3MJ7B 5IK3A 1LO5A 2D31A 1UVQA 5CKAA 4ZOEA 3S5LG 2WUBL 1MCKA 2HT4D 1FP5A 3Q5OA 4WNQB 3T09A 2YUXA 1S9WB 1GC1H 3BIKB 1DQQB 5D2NC 2P5EB 2R9HC 1A0QL 5I66B 4M7JL 4NJ9L 4PJ8A 5EO1A 5KOMC 5IESH 1HQ4A 4G3YL 1CN4A 2ZJSL 3S37L 4AY0A 3FO1B 3K8KA 5FM8A 3T1FA 2V17H 2R29H 4XHJC 3S8WA 3F6LA 4R4ND 2DICA 4OIAA 1ETZA 4RBPK 1FL5A 4JQXA 4X98A 4KZEH 4EUPB 3HZKB 1P7KB 4HS3A 4N0RA 4ZFFB 2RCSH 1T7VA 3MLWL 3C5ZC 4OFPA 4H8WH 4JFOA 2GJJA 1WWBX 2X4SB 1MLBB 5DD3L 5F70A 3B5GA 3G5YB 2WBJA 3P4NB 3GMPB 3RVWD 1Q0XL 4OD2B 1ADQA 3PL6D 4QRTA 4YXKL 2VLKA 2FNBA 3CXHK 3K80A 2Z4QA 2DOCA 1E4WL 2VIRB 4J3UA 2ARJA 2X5PA 2D2OA 4P9HH 3MJ6A 2HFGL 3N0PB 1K9TA 2EYSA 1KN4L 1ACYL 3WL9B 1T03L 3V5KB 1T1XA 1CFTA 3CFEA 4ONHB 2D7QA 4Y1AD 2AJZA 3NCMA 5EUOB 3OG4B 3VXMD 2H26B 2GEEA 2Y7QB 1V7MH 1IL1A 1RUKH 5ANME 1HHGB 3MJGX 1BD2A 3OB8A 5D6CA 3RDTB 5IR1B 3PGCB 3MJ7A 5CJQH 2ZOKB 4RAVB 3HUJF 5DF0A 1B4JH 2N7BA 2BSRB 4P23B 3P0YH 4WNQA 4HGWB 1ZHLB 4WHTB 1G0DA 1S9WA 4AL8H 1A7NH 3BIKA 2AQ1A 4E42B 3QIUB 1DQQA 4D9RE 4OGXL 2C3WA 1YYLL 3QEQE 4FTVD 1GHFL 5I66A 2P5WD 3WBDA 3ZKSD 1EV2E 2P8MB 1ADQL 1FRGH 4PLKD 3PWJB 4YEEA 3SKUD 2EDYA 3VA2C 2UWEF 3FO1A 3I85A 5FYLH 2P42B 3O3BB 1YEHH 4U7SA 2OI9C 4HC1A 1K8IB 4P4KD 5DMIL 4GLRI 1CDHA 2R4SL 1YECL 5E2VL 4NWTH 4BUGA 4NCDA 5IV2B 1QTYT 3DXAD 5GS2D 2F53E 1LK2B 4OZHB 3DROB 2VLLB 3OXRB 3QIUC 4PJFE 4J3XA 1U92B 4EUPA 3EDEA 3HZKA 1P7KA 4DVBB 4ZFFA 2Z93A 3O9WC 3B5HA 1CFQB 4N0CC 1BZ7B 4DVRL 4G6JL 3NCJL 3ARRA 1RUQH 4OB5L 2WSKA 1AGDB 1R3HB 1K3ZA 2AKRB 1J86A 2IEPA 4TVPE 2X4SA 3TM6A 1MLBA 3MV8E 3G5YA 1GCFA 3P4NA 3GMPA 1YNLH 4YIQA 5KJRL 4OD2A 4QRPE 3DMMC 4NJAL 2PXYD 1QUNA 1YPZB 2E8YA 2DTML 3ILQD 4OLWL 4U1KB 4WFFD 4POZC 4HMEA 4YHLH 2NXZB 2VIRA 3LQMA 1YNKL 3QCTL 4JR9H 4HWEL 4K3JL 4KKNA 4P5TD 2FR4B 2EZ0D 5HI3C 3WL9A 5KOVC 3V5KA 1JVKA 3RKDD 4HULB 3ULVE 2V2WB 3SHSA 5EUOA 2IPUG 3HB3D 4HC1L 2H26A 2Y7QA 2ILLA 4LNVA 4LP4A 1HHGA 2D7NA 3QXDA 3RDTA 5IR1A 4FQJH 4KJWC 1N6VA 3PGCA 4XAWH 1AE6H 3SE8H 1OCWL 2ZOKA 4RAVA 1SEQH 4LVHC 3L5IA 4EKXA 5I15H 2BSRA 3C2SA 4P23A 3LN5B 4HGWA 1ZHLA 4WHTA 4HAGA 5ADPL 5D7IE 1KB5B 4P2OC 2EDNA 4RDQG 5JZ7C 3THMH 3OZ9H 1P69B 3J8F7 3H9YA 3OGOE 4Q6IB 4FQ1H 4WFED 2P8MA 4BQCA 2PKDA 3MRDB 3MV9B 5J3HC 2OJZL 4YJZL 1I1AC 1MRDL 2BHZA 3PWLB 3O3BA 5TPWL 4XMKL 2FECI 3B9KD 3O2DA 1K8IA 3QR2A 3BMVA 5CS7A 4AIOA 5IV2A 2VLJD 3AS0A 4NQUA 1FLTX 3L3OB 4U7KA 3MRBB 3DROA 2P49B 2VLLA 3OXRA 4OZHA 5JW5B 43C9B 3ZHLA 1JGDB 1U92A 2FGWL 3INUH 4DVBA 4CUCA 3CZFB 3HE6D 1CFQA 1BZ7A 3HE7B 4Q6IC 3A6CH 4PLJC 4QXGH 4YXLH 1S8DB 4QXUH 2UWEB 4QRRD 1AGDA 1R3HA 1G7JB 4LEXL 5DRZB 5F7DA 3DVNB 4GBXB 1MCSA 1PEZA 2A2QT 2VITA 2MWCA 5AUMB 4P5KB 1YPZA 4KRPB 3KVQA 2JJSA 3EOYG 4U1KA 2OZ4H 3ZYJA 1HZHL 3MLUL 5E7BA 1GXEA 5EU7C 3GRWL 4MAYC 3QNZB 2FR4A 3O3UN 4PRIB 3SO3C 1AO7B 4ZAKD 4G8EB 5C0BD 2NY5H 2IG2L 2V2WA 5E8EA 3HE7C 2X9WA 3WXWH 4RAHA 2XY1A 3O2DL 4P57B 3CFDB 3IAPA 4OTXH 5LBSH 1U8MB 3NPZB 1F97A 5FKAB 3EIFA 4GBXC 4X4YA 2K1MA 1UJ3B 1X4YA 4Y4FA 1AI1L 4ODVH 1JTPA 1KEMH 5T33H 4N68A 1WEJH 3LN5A 4Z0XB 1FE8H 1KB5A 3TJEL 1U8HB 1RMFH 3NFNB 5C8JA 3CIQA 1JZ6A 3H0TB 4KQ4H 2A1WH 4NOFA 5J1SC 5AEAA 5SWZD 4J3TA 3WDJA 1FFNB 3MRDA 3SE3A 2EE6A 3MV9A 4P4RA 1UWGH 1P7QB 4O5LH 2W0LA 3BVNB 1HHIB 3RTQD 4X5LA 5DVLA 1ONQB 2DYPB 1KACB 4IMKA 3PWLA 2AQ2A 2Q8AH 2AJSH 3LS5H 3LQZB 1ZLWK 5DUPL 1NMAH 1MJUH 3O6KH 2FLRT 2JELL 3VFMB 3WNOA 3PUCA 2VZTA 3CH1B 3WUWG 2HKFH 3L3OA 4F2MA 3MRBA 4X6DA 3NCYS 1JGDA 4KI5D 3CZFA 3PWPB 4MNQD 1DEDA 2MFNA 3HE7A 3JTSB 1E28B 1KGCE 1NGZB 5F96H 1S8DA 1G7QB 4J8RA 3VD4A 5F7EH 1M05B 2GJ6D 5DRZA 3WIIL 1XGTA 1BM3L 2NZ9C 3DRQB 3DVNA 4GBXA 1DBAH 5AUMA 4TVSa 5DRNB 1AD0B 4S1QH 4P5KA 5HGGS 5BMFH 1CXLA 4XPHH 4I5BB 4W81A 1IVLA 1N26A 1IAMA 3Q6FB 1Q0YH 5KSAC 4QNPE 4K7PX 3QNZA 1EX0A 3F58H 4PRIA 5ALBH 5ISZB 1AO7A 3O6LH 4JKPL 4G8EA 3ARBD 1KIQB 2V2TB 3HNTH 4P57A 4JM4H 4V1DE 3CFDA 5T3ZH 1J8HE 1C5CH 3U4EB 3GSOB 2EXWD 4JDTL 4LSSL 4I1NB 5CZKA 5FKAA 5HHVH 2Q87A 3OSKA 4E41B 4OF0A 5HGBB 15C8L 5E6YA 4FZ8H 3EJZC 2BXZA 1UJ3A 1GGBH 3ARDB 4N0UB 4DW2H 4OLUH 3AY4A 2QQLH 2H1PH 5SWQB 4Z0XA 3QH3B 4MJ2A 3HAEG 4BELD 4HUUB 1U8HA 3NFNA 4FQPA 5D7SL 4GT7A 5HHOE 4I8DA 3H0TA 4GXVH 4CU6A 1NMBL 1F3RB 1FNAA 4R4FH 1WV7T 1Q72L 1FFNA 1IAIH 2BSTB 3WJLC 2FHFA 1II4E 1P7QA 2EDHA 3CDCA 1MH5B 3BVNA 1HHIA 1ONQA 2DYPA 4RWYH 1FVCB 3LOWA 3LQZA 4HH9B 4MNHB 4OUOA 1MWAL 3OB0K 3VFMA 3UC0L 5KW9H 3CH1A 2GHWB 3Q6GH 5E5MA 2H2PC 5JDJA 4OV6F 3EDDA 3PWPA 1AR1D 2EH7H 2Q76B 3HI1B 2VXTH 3JTSA 3MLRH 5I17B 1E28A 5IROC 1WZMA 1NGZA 4JY5L 5DWUL 2XNAB 1G7QA 4B0MM 1X5HA 4PJDB 3UROR 4AENB 3AM8C 1IAKB 4QOKB 1M05A 3DRQA 1CFVL 5SX5H 4JN1L 5DRNA 1AD0A 1QACA 4TOYH 4WGWB 1BQHG 4I5BA 3MRQA 3VXSD 3WFBH 1MVUB 4G8GE 5ISZA 4JO1H 3GI9H 4X7EC 2AXJA 3GI8H 3UAJC 4OGAD 5IVZB 1KIQA 2V2TA 2NY3B 1HH9B 5DUBB 5EBMB 4M6AA 3V6OE 3GFUA 1PY9A 3GSOA 5LGJB 2YRPA 4E41A 5HGBA 4P2YA 1D5MB 5HHMB 4KGJA 5GZND 2HMID 4EOWL 3ZKND 3ARDA 2FATH 1P4IH 4HKXB 4N0UA 2VE6A 5SWQA 3STBA 5MEOA 4G9FD 4OBSA 3RAJH 1S7QB 2OS7A 3IU4H 1DZBA 4NT6B 1L7TH 4MMZC 4GXUM 5CZVL 5HHXH 5I1JL 2NY3C 1QBLL 4BK5A 1AXTL 2BSTA 1CBVL 3C60B 1FFOB 1MH5A 3DURB 3OMZA 1C1EL 4HPOH 1OW0C 3QG7L 3JVGC 5GGVL 3S3SA 4PJCF 4JRXE 4YE4L 4MNHA 4AMKH 2BVQB 3K74B 1KCUL 3V6ZB 3NZHL 1L7IH 1OHQA 4HT1L 1P6FA 1KB9J 5A2KH 1OP5K 3MLSH 4NNXB 1NH6A 2ZCLH 4KDWA 5I6XB 3G6JF 4CW1A 3BZFB 4KQ3H 2E5EA 3GJFK 2Q76A 3HI1A 5DQDH 5I17A 3GKWL 1WQVT 3IDJB 1FG2A 2XNAA 5CZXD 4PJDA 1PAMA 1DL7L 4QOKA 3C60C 1QSZA 2X44D 1U95B 4ODSH 1X4XA 3QBTB 3JUZA 4TTGA 1NFDB 1D7FA 5E6IC 2VAAB 4YQXH 2BFVL 3CMGA 1JWUB 4S2SB 1ZA3B 3C2AH 4N8CL 1KLFA 1MVUA 3QWOB 4XPGH 4DGIL 3KYKH 4RFNC 5IVZA 1HH9A 5DUBA 4X99B 5EBMA 4YHZL 8FABB 2LTQB 3PJSB 5GJSH 1K4CB 5LGJA 1OW0A 2I27N 4Q58C 1G0XA 2DWDB 4A6YH 1D5MA 5CWSB 1FFQA 2CJUH 3FT2B 1U2HA 3EHBD 4HKXA 1RIHL 3ME0A 5IJKA 1UEYA 2P8LB 2J5LB 1EJ6A 4FQ2L 2BNQB 3BE1H 1S7QA 4F57L 4NT6A 5C2BL 2Y6SC 1NGPL 3LMJL 3V5DB 1TZHB 3QISA 4G80B 3VG0H 4CMHC 1TITA 1OP3H 2IBZY 3C60A