1FGNL

Monoclonal murine antibody 5g9-anti-human tissue factor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYASLGERVTITCKASQDIRKYLNWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPYTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN FAB 5G9
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnL01
3BPNB 4XRCA 2VR9A 3WNNA 4LSSL 1MVFA 1A1OB 4PJFB 3WEXA 1D5MB 4WW1B 1N64L 4YUEL 4Z77B 3N1FC 4PRAB 5GJTH 3SDXE 2FWOA 3O9WB 3NFSL 2F5AL 1XCQB 2E27L 4H8WL 5CJOH 1YEDB 2HRPH 1ORQA 4JKPL 4ZUSB 3X11A 1MHCA 1JYVA 4UQ3A 4WU7A 1YMMA 3DVGB 2XXMB 2OMBA 2PYEE 4NKMA 1A4JA 2EC9T 4X4YB 3TN0A 1DLFH 4XBGA 3WS6C 2DM2A 1YQVL 1IAOA 5D7JB 5EU4A 4WCYL 3G5XB 4JG0L 2NZ9D 1QNZL 1WIUA 1IM9B 3DO3A 1FO0B 2H2SD 4P23C 2Z91B 3BSZL 1T2JA 3NAAH 4JANA 5IKCB 1UJ3B 5F9OL 3TBTA 1PKQA 5D5MB 4HKZB 1T83A 4OQTA 5EORL 3F7YB 3VXNB 1DVFA 5I1JL 4HUKB 4HIXH 3I6LD 1D5ZA 5E5RB 3VXQB 1FRGL 3ZKXC 3BP7B 5DD5H 2C5DC 4K7PL 1UKSA 4YO0B 4RAVA 5JOPE 1LP9E 1I3UA 4OFYA 1J1PH 4U6YA 4DGVH 4NC2B 5KS9E 2ZUQB 3QEQD 2BFVH 4QWWD 3UTQA 4M8QB 1MFCL 1X4XA 2WANA 5BRZE 2R8SL 2BNRE 2DOCA 3RNQA 1HXYB 1RHHB 4WEBH 2JJTC 4N0UB 4TQEL 1MEXH 1A6UH 1IGIH 5JUEH 1MI5D 4PRIA 5ID0A 3O3BB 1ZANL 3OPZL 4DGIH 5ABDE 4NQUA 2JCCB 3GMRB 3L3DB 1E27A 4PRBA 2YWYA 3HAEG 2DQGH 3QEHA 4NWUH 4G6KL 2IG2L 4MA7H 3WE6B 3FKUS 1U8QA 4NJAH 4OF8A 3X3FH 4PGEB 2GY5A 1MY7A 4I0KA 3T4YA 3T0VA 4ZUUA 5DTFB 2ORBL 4OZGF 5C0BD 3MLRH 5L2KA 2BVQB 5EOCL 5FIEA 1NJ9B 1T04B 2W1NA 2CR6A 3UJTH 1YNKL 5EO1A 3VFGL 4X4XA 1KTLA 5HGGS 3ARGC 4N0FB 2FDBP 1G7HB 2XN9D 1FPTH 3LIZL 4PB0H 3CFJB 3LN5A 3QEQB 3RWJB 1X44A 2XTJE 4FG6D 4JQXC 4M1GL 4PJHF 3H3PH 2CMRL 4ZFZB 3PJSB 4HXBL 4ZSOA 1G7LA 5F3HA 1D6VH 1RUQL 5IHLB 5I74B 4EDWL 1QACA 1MI5B 4YXKH 43C9B 3IJHA 4HK3N 1S9KC 1IT9H 3MFFA 4ETQB 2RHEA 3UJJH 2G60L 1AC0A 5T3XE 1HHKA 1F45A 1ZLVK 4LF3A 1P9MA 1T80A 4KHTL 3IKKA 5F9WC 3VRJA 3D39E 4NM4H 2W9LA 4JGMA 3IDGA 5IFAH 4YHNB 1JF5A 3M45A 3IJSB 1DCLA 1BJ1J 5C0BB 3HFMH 3ES6A 1IJ9A 3V52H 3C9NB 3W9DA 2OS7A 4CW1B 2I27N 1FNSL 4ZS7L 2VXVL 1Y0LB 3Q6FB 1S7UB 1V05A 3CDFA 4PRDA 4NNYA 2G2RB 1U58B 1AD9A 4NOBA 3W11C 3OWEA 4LSSH 4O51A 3T1WA 5JW4N 3K8MA 2XN9B 3I6GA 1N64H 3JZ7A 4YUEH 5C0FA 4WU5B 1S78C 3OKMB 4XAKE 4DUXA 1UWXH 3NFSH 2F5AH 5AZ2L 5GZNC 2E27H 4H8WH 4Z7NF 4JKPH 5JPNB 3EZ8A 1QBBA 3U9PL 3H42L 4PD4J 3E6FA 2ADIA 3VGFA 1GC1L 1DZBA 3MOAL 4YGVB 3KS0J 4MDJA 4ONOA 4XCNA 1J0JA 4UNUA 1B0WA 1YQVH 2EDOA 4S1RL 3SDDC 1BFVL 4WCYH 4JG0H 1QNZH 2H8PB 3FZUD 3DVFA 4AEIL 1IAII 3BSZH 4OGAC 4I0CC 3WIFA 1SY6L 2Y72A 3UJIL 5F9OH 3ZO0A 3W81A 5I1CL 5EORH 5I1JH 4F57L 5DHVH 5E9DD 3R8BB 1HILB 3OB0H 3H9ZA 3LRSA 1LK2B 1P1ZA 1CDBA 2YD4A 3RKDC 4N90E 4KRLB 1FRGH 3VXSA 3OXSA 3ZDYE 2VDKL 4X8JA 3G5YB 3TT3L 4K7PH 5EFIA 1QFWI 4HWUA 2DBLL 3GIVB 4N0YL 5HYJA 1KIQA 3CX5K 2A6JB 5FYJE 4PRNB 1I4FA 4QOKE 3GJFA 1MFCH 4KTDL 2R8SH 2ZSWA 2QEJA 3CC5A 2EDQA 3AAZB 2DMKA 4UNTA 3RVVC 3VXPB 1DBBL 1A47A 3F7VB 3S5LG 4X80L 3E1F1 4TQEH 4CJ1A 3CVHA 4NQDE 5D93C 3K3QA 2A1WL 5LAXA 5TE4L 4TVPL 2GTWA 3ARBC 2NY4D 5DRZA 4JPKL 4OI8A 1ZANH 3OPZH 4XP6H 2ZOLA 3O3EB 1A7NL 2XKNA 3I9GL 2OXGA 1M7DA 3ORJA 1WF5A 4KVNL 5D2LB 5C3TA 5D9SA 1Q94A 1HXMB 2ZG3A 3BIKA 3VWJC 2IG2H 3QIUC 5JXEA 5CCKL 4NDMA 4X6DB 2E6JA 3V6OA 4HUXA 1CVSC 2ORBH 4D0CB 4X6CE 5EOCH 1I7UB 5E9DB 1NCDL 4TNVK 5EU5A 4KC3B 3ZHKA 1U8NB 2GT9A 1T7WA 1YNKH 2J5LB 4LOUC 3QHZL 5HDBF 4JN2A 3VFGH 3F6LA 1Q9OA 4X0KB 3IDXL 5KSBA 5F7YC 3LIZH 4LKCB 5GS2H 5F7DB 4C58B 1CXIA 3STLA 4M1GH 3L5WB 2CMRH 4ACPA 3GMMB 1TVBB 2O5ZL 2XZCL 4PP2B 1O5DT 1KLGA 4HXBH 4M61B 2KQNA 4R90L 1UM5L 43CAB 1YC8A 1RUQH 4LARL 4LCYB 4EDWH 5A2JH 5E8NB 3JUYA 2A73B 5E70A 2ATPB 3EFFA 1YMMD 3P11L 1YJDL 3O2DL 4X6FB 3KHOA 5J0BA 2NY4B 3VFSB 3WUWB 2G60H 5E8PA 4O2EA 4Y1AA 1H3VA 1X3DA 2ZKHL 1OOAA 1CLOL 5A43C 1EZVX 1NC2D 2Y5TB 4M9OA 4EN3A 3PWPD 2PXYC 4KHTH 1KN2L 2HFEB 2D7MA 3WLWC 3E6HA 4G6JL 4ZNEE 4YDVB 2X1XR 3OG4B 4JZJA 1YEJL 2ERJC 4HIJB 2VZTA 4HXAL 5HHOE 1Z2KA 2DRUA 1WWWX 1FNSH 4H5SB 4ZS7H 2VXVH 4PGDB 3G5ZA 3F7PC 3QUMA 4YHKL 3DV6A 3NFNA 1YUHB 3MLPA 1A02N 3BH9B 3ARPA 5IK3A 1XT5A 4LLDB 5FAAA 4OFYD 1NGWB 1CF8L 3IFPA 1AFVL 2NY3C 4XRCB 5FKAA 2HA1A 1PJ9A 4R2GD 4G42A 5AZ2H 4QRUA 2B5IB 3PXHA 1JNHA 1GXEA 2D7OA 3U9PH 3ZHDA 1B9ZA 3P4LA 1GC1H 5JIPA 1RUKL 3MOAH 1ORQB 5DJ8B 4OQ1A 3HMXL 1MHCB 3LB6C 1YMMB 2VLLA 3VGAC 1QFPA 1NBZB 4NKMB 4S1RH 1BFVH 1A4JB 2FGZA 2PR4L 2YUWA 3GMLA 3TBYB 1IAOB 1NC2B 2P5WD 3UAJD 2B0SL 4AEIH 4IIQA 1I9JL 1SY6H 3PWPB 5I6XC 3SO3C 3GSRA 3MJGX 2R0KL 4MCYB 3UJIH 4OD2A 1IAIM 4PG9A 3U7AA 5I1CH 1X5IA 3SHSA 4F57H 3CXHJ 2Z93A 4R0LA 2VDKH 1MPAH 3TT3H 5IWLC 3TJHC 4LLUA 5HGHA 5TDNA 1SVCP 5BV7C 2ZCKL 1D5ZB 5E7BA 5MHSD 2DBLH 3D3VA 4N0YH 4ZXBC 4UI2A 3U82B 4LSUL 5JHDD 1G9NC 3MOBL 1KN4L 2APVA 1I1AD 3CSYB 4RAVB 3LDBB 3U1SL 4KTDH 3RY6C 1ZHNA 3L1OL 1TLKA 3WO3B 4R2GB 1CYGA 1DBBH 3EYSL 3T1FA 3MFGB 4X80H 4UT6L 1A0QL 3BW9A 1RZJL 2A1WH 4PYHA 5TE4H 4TVPH 3V8CA 4JPKH 4U1NA 5EN2A 5DVLA 1LO3L 2MJWA 3AM8A 3KPPA 3K7UA 1A7NH 1EHLL 5CP7A 3I9GH 3QUYC 4Q9BA 4U6HB 5ID0B 3IJYA 1RAMA 5FOBA 4KVNH 4M62L 2MOVA 2XWBA 4NSKB 1G84A 1E27B 2DKMA 2P5WB 1I1FA 2HMID 4PRBB 5CCKH 3QFJA 2EDNA 3DHJA 4G9DA 2AV1A 4L8SB 4Y4HA 3VJ6B 3RX7A 4I1NB 4ZYKA 2W60B 1OAUL 5IVZB 2CLRA 1NCDH 5I16A 4MNQA 4QYOB 4LLYA 1RK1A 1ZTXL 3QHZH 2EYSA 3WS6A 3QUKB 3IDXH 1ZA6B 4PLKC 2AK4A 4HPYL 2XTJC 5C86A 4ODTL 5JHDB 4XZUA 5DURD 3WMSA 3JTSB 1I1AB 1JK8B 4HS3B 4X4XB 3EYQC 3QZWG 1KCVL 1AGEB 4J3OC 5J12C 5DUPL 3X13B 5E2VL 2O5ZH 2XZCH 3LN5B 1RULL 4R90H 1FZKB 1UM5H 4LARH 5CD5C 3GMQB 3HG1A 5B4MC 2B7DT 3BPCA 4GFTB 4U2YA 5DA0B 1UB6A 35C8L 3SE9L 1YJDH 3P11H 3O2DH 5I1AA 4GG6F 5F3HB 2FJFA 1OP5K 2LAGB 2QR0A 3WCYA 4NCC2 2ZKHH 1VGEL 3TWCL 4CN6A 1CLOH 3MFFB 1HHIA 4MA1C 1J05B 1KN2H 4C56D 1KYOK 2F58L 4LKXA 1HHKB 3CPLB 5GZOD 4G6JH 4LF3B 3PDOA 2FX7L 1U8MB 1J1XL 5E8OA 3VRJB 1YEJH 2AXGB 2MHAB 4EVNA 2JJTA 4P9ML 2EDFA 5IMKA 2EXYD 1KXVC 4HXAH 5KOVC 4OLYL 2XQYG 4BH7A 5E2TL 1EFXA 5IHBA 3MRLA 1X5KA 4YHKH 2NCMA 3ES6B 1OTTD 4FTVD 2FATL 4NRZB 3W0WA 4N1HB 1WCQA 1CF8H 4PRDB 5M7QA 3BRGC 5HYJD 4BQ8A 1AFVH 1AD9B 2EC9U 5DURB 4EI5C 1IEBA 1TTGA 2OXHA 3EW3B 3HAEA 5TFSL 3E2HC 5B38B 5C0FB 3ZDXE 1J10A 5DLML 3MRKA 1UYWL 3TF7C 4F9PC 1I1RA 4IOIA 1WC7A 3CK0L 1EXUA 5HTSA 1VB9A 1RUKH 5GSRB 1AE6L 4P46C 3HMXH 4Z0XA 1ZVYA 4AYFA 2E7HA 4KK5C 4N0CD 4EQ3A 1YDPB 4YK4C 5CD3A 3B4NA 5HHXH 3UPAA 1KELL 2PR4H 2FH8A 5HHNA 3ARGA 1I3RB 3MRDA 4XCNB 2BC4A 2ZP0T 3U0TB 4ZFOL 3T3ME 2B0SH 3RJDA 1I9JH 4PJAF 2R0KH 3NPSB 1ZV5A 3O45B 4C56B 4KPHL 2MQCA 1ITCA 4JQXA 3NH7L 4Z7VF 4GRMA 3DX7A 4LVOB 3SE3C 5CGMA 4FFWD 5F96L 1T1XA 3E3QE 1U93B 2ZCKH 1P1ZB 5C9JB 3NA9L 3SKNB 3VFUB 4FTVB 4X9HA 4LSUH 3MOBH 1KN4H 2C3XA 2FO4B 2NY0D 4E41E 3U1SH 3FN9A 2AEIT 2ICCA 5HYJB 3TBWA 4EIZC 3L1OH 1M7XA 1I4FB 5ESQA 4F33A 1I9RL 2ZG1A 3EYSH 3STBA 3ET9F 4LLWA 4UT6H 1SMOA 1UWGL 1A0QH 1RZJH 4JQIL 3WHE0 4GRWB 4WFHE 2P5EA 3QXDA 3IDNA 4GT7A 3T04D 1LO3H 1T1ZA 3D2UA 1YPZB 3GZKA 4PJIA 1XAUA 1JNLL 3ARTA 5D96B 1EHLH 5DRZB 4YQXL 2DJ4A 2B1HL 4FMFA 2ZOLB 4M62H 5FM4A 1DQLL 3MZTA 3IF1A 1M7DB 4HLJA 1MUJB 1OD9A 4EN3D 4ZPVB 1UQSB 4XGZA 4IOSD 1Q94B 1YEIL 4YFEA 3CZJA 4TUKL 1AGBA 5C1MB 1OAUH 2X41A 3S4SA 1YNLL 4HGWA 5GGSY 3ESUF 3PWLA 2BXZA 5D7LE 1ZTXH 3TO4C 1F90L 2ADJA 1A1MA 2WW8A 1N3NB 3O6ML 1KB5L 1XF3A 1IFHL 2Q3AA 3ZKSD 2PTTA 2XWTA 4I3SL 4N9GA 3SDDA 4HPYH 3UYRL 2W91A 4KJWD 3HPJB 4ODTH 2F9BT 3P4OB 3EO0B 2NY0B 1KCVH 4MJIE 4P2RA 5EOCJ 3IDYC 3IXAA 2YS4A 4HK0A 4OI7A 5B39A 5DUPH 5J9PB 4XP1L 5E2VH 1RULH 3FB6B 1RZ8A 5HDOA 1WAAA 4U1IB 3V7MA 4RSVA 5I8OL 4Z7UE 1K4DA 1CFNA 1S7RA 3SE9H 35C8H 1NBVL 1PGRB 3JVGC 1R5IA 1QRNA 4HCRA 4YDLC 2GCYA 2DYPD 5H35A 1LNUA 2D7PA 4X6BA 4UINL 1VGEH 3TWCH 2BDNL 2O61B 4XNZC 1OWRM 3JV0A 4Q6YA 3UTSA 5J11B 2EDRA 4O2EB 1QBLL 4K2UL 3OKNA 2F58H 5EH1A 4HBQA 2V9RA 4EN3B 2FX7H 4NO0D 4XNQA 4K8RC 1J1XH 3NCYP 4PJGF 5E4EB 4P9MH 2CH8A 1XZ0B 4MJ5A 3VXTB 2AEPL 3BHBA 4OLYH 2IANA 5E2TH 2P24A 1FYTD 3ARBA 1MNUL 4XVSL 4XBPA 3BE1L 1FG2A 4GAGL 1QA9B 1KIUA 4M7ZB 2FATH 4NO2A 5IOPB 3ZE1E 4MVBD 4M6AA 1P84J 3D3VD 4PLJC 2XOTA 1BFTA 3QFDA 4JJ5B 3ZE2F 1KLFA 3WV0A 1CDHA 4G8IA 5IK3B 3QIUA 5TFSH 1RVFL 5J1TC 1WQVT 2G75B 3DURA 3LD8B 3HC3L 5DLMH 4KK9C 2I9LA 5IB5B 1OL0A 3G6JA 4YJZL 1UYWH 5SWSD 3HTLX 5L8JB 4G42B 3CK0H 5HYSA 2XV6B 1AE6H 3MRRA 1KT2B 4WW2B 5EPMB 5GGTA 1YY8B 5DEGB 2MFNA 2DYPB 3BZEB 1KELH 4KKAD 4JKWA 4JO3L 2VZ3A 4ZTPL 3FN3A 1L6ZA 5LCVL 3LH2L 3OJMB 5D2NB 4JHWL 4LVHB 4TN9A 4FXKA 3FQTA 4KPHH 1WTGT 5T1MB 1JWMB 1PYWB 3DBXA 2BVEA 4L3EA 1CBVL 3NH7H 4IIQB 4F15C 4NO0B 1RZKH 1HKLL 4JFEA 4CN1A 5F96H 5ACLA 1E4KC 1V7NL 5I17A 5DGRA 3KYOA 1YN6B 5LVEA 5F7LB 2VQTA 5I1GL 1FYTB 4NQCA 1F6LL 1ZE3C 4FXLA 3NA9H 4KQ4L 3VG0L 3VFPA 2IH1A 4LLUB 1C12A 4LBEB 3VD3A 3X12B 2VDRL 4TVSa 4GAYA 5HGHB 3WFDL 4ZO9A 3G04B 3SE8L 4TOYL 3D3VB 1VDGA 1NFDE 2PXYA 4C54A 4WTXA 3KPLA 1I9RH 5M94B 4U7KA 4P23D 3MA7A 2VC2L 1UWGH 3FFCA 3MUHL 3RY4A 4JQIH 4XWOD 1HYRC 5SWSB 4TUJA 1QEWB 5CHNA 3ALPA 3GM8A 4OGYL 1CLYL 4S1DC 5FM5M 3ISWA 4AQ1B 4GO6B 1EV2E 1JGEA 3OTTA 1JNLH 3Q48A 3MRCA 3ZKND 1PG7W 1DJSA 4YQXH 4U1NB 1LEIB 4PPTA 2CJUL 2HLFC 1FL6A 2B1HH 3SDXA 1NH6A 3VFOA 1DQLH 1IAMA 2OI9C 5DQJA 3UCRA 5CP7B 2HRLA 1F4XL 4I5BA 5FOBB 2GJ6D 1FV1B 3EGSB 2PYEA 4AG4L 1YEIH 4HWEL 4TUKH 1I1FB 2CD0A 1YNLH 3CFKB 4JFFD 2AV1B 1S9WA 4LPVA 3ILPB 3RGHA 1T1YB 3TA3A 1GH7A 4LK4A 1F90H 2FSEB 5HI3C 3O6MH 3HE7C 1KB5H 3IRPX 1IFHH 4I3SH 1RK1B 3UYRH 3GBML 4JFXA 4PFEA 4H25A 3MRBB 3T77A 1TVHA 2EYSB 1JN6A 1HNFA 4FMKA 2VLME 3CGTA 4XP1H 2M2DA 5BCAA 1CIUA 2EDJA 4P23B 4U1GC 5I8OH 1FNEA 1LP9A 2VXTL 1NBVH 5F7WC 2LAAA 4B7IA 5IWLA 2NY6D 2AJXL 5FYJU 3UX9B 3P4MB 5KS9A 2VZSA 5DK2B 1UB6B 4UINH 3VD7A 4ZXBA 2BDNH 3ZKXB 5DI8B 5BRZA 2FJFB 2APXA 3QHTC 4Y5YC 2BNRA 5GIRB 5KJRL 4UV7L 5ICYB 1QBLH 2BK8A 3KLAB 4K2UH 5DYOB 3RY6A 1NMBL 2X4UA 3S36L 2XRAL 4BFBD 3SDAC 2P48B 2GJ6B 5CZXC 3STZA 2CK2A 2BNQE 3QI9C 4WGWB 4Y88A 1A7BA 1GGUA 4JFOA 5L8LB 3MV7D 4QLRA 3F7QA 3B5HA 3CSBA 2AEPH 1ZXQA 4JFFB 5H37H 2NY1C 2I07B 1YY9C 2HFTA 4C59B 4F58L 4XVSH 3LKNA 3BE1H 5TE6L 4D9QD 5IMKB 3KPSE 4GAGH 4HIIB 3TPUA 2DKSA 1I7ZB 1RD6A 3QUYA 4AM0B 1D6EA 3HS0B 5E5MA 4MDIA 2APTA 3H3BC 1YEGL 3C8DA 1QPXA 4QXTB 1RVFH 1FFNA 1KOAA 3HC3H 4FQ2L 3TO2B 1VADA 2R1YA 1H15B 2EDHA 3K80A 2LTQC 5CEZD 4MJ4A 4HG4K 3ZT6A 4GW1B 2G5RA 3QDME 3HUJB 1A21A 3G9VA 4L9DA 5HY9B 1KBGL 3MRKB 1CTNA 1BZ9A 2X5PA 4HUMB 5C3LD 4U0RC 3GSXA 4IOIB 2NY6B 4P49A 1UZ8A 3D2UD 4JO3H 2GEEA 2GJZA 1CIDA 4MXVF 4ZTPH 1INEL 5LCVH 1HH9A 3LH2H 3W11D 4JHWH 3WNKA 2OJZL 5HHNB 4HKJB 4X5WA 1CBVH 2BC4B 3P9LB 5L7XL 1JTOA 3E3QC 2JJUA 4IRSD 3MGTA 3RGVC 4QT5A 5DJ6A 3MJ9A 3MV7B 4NO3A 1V7NH 4AIOA 5IR1A 3ULUL 1X5AA 5GGQL 5I1GH 3DX7B 3QRFM 4X7DC 5MEOA 5HBBA 3O6FC 3VG0H 4KQ4H 5IB3A 3DOSA 2Z8SA 4A6YB 4KRPD 2VDRH 3WFDH 3I84A 3SE8H 1G6RA 1OTSC 4TOYH 5SWZD 3ZDZE 4DZ8A 2D31A 4WO4D 4HX1A 3R1GL 4LDLB 3QQ9D 2WSKA 4OGAD 2VC2H 3RPIA 2C3WA 5F9WB 1LO5A 3RVWC 4Z76B 2BSTA 3BDBA 5LGJA 4OGYH 1CLYH 4KH2A 4LLWB 3VDCA 1FC1A 4JCMA 2FEDC 5DMIH 3NIFF 4DGYL 4Z5RB 5FCUL 2BOBB 3RKDD 5IHUL 1JZ7A 4XVTL 3RP1A 3MYZA 5CJBA 4M8VA 4PJBF 1Q1JL 2CJUH 3CNKA 4PRHD 3D2UB 1T1ZB 1GIGL 4PJ7E 3BKCL 3MRQB 3SDYL 5F6HI 1CGYA 4POZC 4EI5A 4FQIL 1F4XH 3S3JA 1RIVL 3X14B 4UOJA 1D5IL 4AG4H 4HWEH 5HDQL 3IF1B 4JQVC 1N59A 4IRSB 3B2UC 3TBVB 2GAZB 3P0VL 2NTFB 4F9PA 3CX2A 3RVVD 4H0HB 3MRPA 1FFQA 5HI4C 1X6NA 1U3HA 3CJJA 4P46A 1K4CA 3S4SB 3U4EA 3UC0L 2Q8BL 2HYMA 5FDYA 4DTGL 2WUBL 3PWLB 2YA1A 3GBMH 1U91A 4JEGB 1QYGL 3RNKA 4KRPB 2VLJE 5FEBA 2FHFA 2HFGL 5IW1A 2BCKA 4N9GB 5SWZB 4WO4B 3T65A 1UCBL 1QLRB 4XPTL 2HJFA 3VWJD 5H2BA 1XIWD 5DJYB 3QIUD 4M93C 3PV7A 3SE3A 3MUGA 5CIPA 2VXTH 4XPAL 4ELMB 3C6LC 3NTCL 4M7LT 2EKJA 1KB9K 2AJXH 2EH8L 4OZHB 4QOKA 4KRMB 4I0PC 4LOUD 4Z6AT 5CGTA 2GCYB 4PRHB 5F1NB 5H35B 3EOTH 5KJRH 1LNUB 5TQ2L 1A6AA 4GLRI 4UV7H 2CRYA 3RTQD 1NMBH 3S36H 5EBWA 2XRAH 4GKSA 2H6PA 4OCYL 1F58L 1KJMA 3OKNB 4U1MB 2NXYC 4MLIA 4JHBA 1MCEA 1RJLA 4MX7B 1S5HB 4JFED 3U7YL 4F58H 1JIBA 5CJ8A 3HZKA 4XCEB 1QSFD 3KXFD 3WUZA 3MCG1 3IDJA 1R3KA 2BRRL 4MJ5B 5D93B 3BHBB 2P24B 5T1LD 4DAGL 3S35X 2C1PA 4CMHC 5HD8C 2YUZA 3A6OA 1F8TL 1YEGH 5JZ7D 2V5TA 4KDTC 2B1AL 3TVMD 2WWKO 3MRJA 2CQVA 2PTUA 4X6CA 4FQ2H 2PXYD 3QFDB 5CLTA 2G9HB 3VWJB 3LQZB 4G8IB 4OIBA 3QIUB 1BIIA 1HWHB 4XP5L 3DURB 1QVOB 1G9ML 3EKCA 1KBGH 3FOLA 3TO4A 4Z9KB 2JJSC 5HYSB 4X7SL 4PR5A 1DANT 3T0EE 2Y7QB 1DBAL 1INEH 3DTXA 4NC0B 1VFOA 5J1AA 4CAGA 4RA3A 3BT2L 4JFYB 4JLRA 2MNUA 2OJZH 3RTQB 2OL3A 5L7XH 3NPZB 1NUFA 4I13B 1AH1A 1CLZL 5AAMA 5TDPB 2W38A 2X4RB 1BD2D 4OZGE 5C0RL 1T2XA 2QL1A 4P9HC 3CH1A 4JPIB 3ULUH 3MRGB 5GGQH 1MVUA 3HMWL 3JVGA 4JFEB 2A6KB 5DA4A 4LSVL 1QSFB 2VDQL 3KXFB 5F7EL 5SV3A 1DQQB 1ZA3A 5I17B 3N1PC 1FNGB 1H8SA 3LB6D 5DQ9A 2P46B 5T1LB 3ARSA 3VFPB 4ZNEA 4HFUL 1C12B 5E56A 5FXCH 3TVMB 1WUNT 1F42A 4V1DE 1RV6X 1P4LA 3R1GH 4PJHE 5HPMA 5HHOA 2PXYB 4KI5D 3OJVC 4ERSL 4P2OC 5AAWA 3MA7B 1TENA 4L8BA 3EFDL 2X1PA 1HCFX 5ECJE 4DGYH 1KSRA 5IHUH 2ERJB 4JVUA 4KV5F 4U1HA 4XVTH 5CHNB 1XR8A 5EDXA 5J06A 4WI5A 1MCQA 3QG7L 1Q1JH 2QQKL 3TCXA 3B9VA 3O41B 3RWCA 1GIGH 1GPOL 3BKCH 3DMMC 3SDYH 3ULUF 1AKJA 4FQIH 1EEZB 5MEQA 3FO2B 1FL6B 1RIVH 3VFOB 5FK9A 2WWMC 1D5IH 1V3KA 1VFMA 3WKNA 5DD6B 5HDQH 3CFBB 1NPUA 1XGPA 3FB8B 1MHEA 3P0VH 1BD2B 3KVQA 4NKDA 1RURL 3O2VL 4KAQL 5IFHL 3UC0H 4PTUB 2Q8BH 1U8IA 2X4OA 3DRTB 4DTGH 4Y4FC 1KNOA 1S9WB 2N4IA 2WUBH 4S10A 1JYNA 1QYGH 2J6EL 4S1QL 1U6AL 4F7TA 4F7PA 3MLZL 2HFGH 5E24E 5IW3A 4ORZC 3MLWL 2ARJA 3PDDA 4UU9A 5I1LB 2UVFA 4ZUVB 3DUSB 1UCBH 1K5NB 3T8XB 3V5KB 3WIHA 4XPTH 4RX4D 4YBHA 1CXHA 4Z7NE 5I6XB 5L88L 4H1LA 3S37X 4XPAH 2EO1A 2WBKA 3NTCH 3L3JB 4K9EC 1KIPA 2EH8H 3P9MA 1JFQL 1B4JL 1DEEB 3O8XD 1AR1C 4NZTL 1NAMA 5KS9B 5TQ2H 3K4DA 3K1KC 1NCTA 5B21A 4JFPA 3QNYA 5IVXB 1T0MA 4HHAB 3ARDD 4OCYH 2OQJA 3EYQD 5B8CC 1F58H 5IB1B 3GMNB 2F54E 4N9OB 3L5XL 1WT5C 3LKRA 2YD6A 2R39A 1X5HA 3U7YH 5IF0B 1T4KA 4ZO7A 2BRRH 1AGFB 5HHQB 1PEWA 4I3GA 4DOHB 5SX5H 3H9SE 4X9IA 5K59F 4U3XA 4DAGH 4ZAKC 1GZQA 3J8F7 3QIWC 5D7KE 4MS8C 2A38A 1F8TH 1FL5A 1CDCA 2B1AH 3I3BA 4LFHG 3D39D 3AC0A 4GKZB 5KVMC 2VISA 4YPGB 4QRPE 5D5MF 4OF3A 4U0QB 5JW4M 4POYA 3RL1A 2DIBA 3D5OF 2BSSA 1EZVY 4XP5H 3TESA 1G9MH 2E6PA 3MLTA 3ZHLA 3GSVA 3C5JA 4X7SH 3DX9B 4YBLC 1C08A 3KJ6L 1ZT1A 1J0YA 3OKEA 1J87A 2EIDA 1OP3K 1DBAH 1KC5L 2WAHA 3O8XB 3MODL 4NRXA 3BT2H 2VYRE 4F9LC 1DUYA 4YHZL 4Q58C 2G5BB 1CLZH 4EI5D 3ARDB 3V7AE 2YEZA 1WAAF 3AUVA 4KDVA 5DRWB 5C0RH 5J12B 1OWWA 4WJ5A 5KAQG 4DKFL 3UDWC 1JHLL 3HMWH 3MGTB 1NEZB 2P49B 2ATKA 4KK8D 3RHWK 3PWJB 4LSVH 5E00A 2VDQH 5HDBE 5F7EH 2JCCF 4NO3B 4EUPB 4UDTA 4P46D 2R9HC 5MI0C 1C8PA 4X7TA 3U36A 1WISA 4DJMA 1KCRL 5I18L 5IQ9A 1ZHKA 3L6FA 4Y5YA 4HFUH 2UYLB 4W68A 3D39B 5F21B 1G6RB 1LGVA 4WTZG 3V0AC 2IPUG 3MCKA 5C7XL 4LLVB 2YRLA 4JPWL 3HR5A 3QI9A 4HS6A 4ERSH 4WFFE 4N90D 1E0OB 5TGBB 1FVCA 3WFEL 2VUYA 4LLAA 1MF2L 1LO5B 1NUGA 3HE6A 4FXGA 5LGJB 1UZ6F 2PCPA 2VWEE 3QG7H 3BN9C 5FYJD 5DHYB 4YXHL 1CFSB 5KVGL 4HFWB 2QQKH 1V3JA 2A2QT 2X9YA 4LLQB 2Z31D 4A2LA 1GPOH 3T3PF 4NQVB 4Z7OE 1YN7A 3FOMB 4NPYA 3ETBF 2WBJA 1OGTA 3TYGL 2HT4C 2XZQL 4EI5B 3G6JF 4JFHE 5CGYD 4UIMA 4NQDD 5DSCB 4MA3A 5HHME 2Q6WB 1RURH 1CGSL 1A64A 5HDLA 3O2VH 2E7BA 1DR9A 4KAQH 5IFHH 1P5VA 4D8PA 4M1CD 2QKIB 3ROLB 4TPRL 4MQSB 4Z78A 2AABL 2J6EH 4P46B 1U6AH 4S1QH 4BQ9A 3MYJB 4OD1L 3IETB 3MLZH 3WS3A 4FQJL 3MLWH 5HYQB 1CG9A 1OAXL 4BYHA 3OBAA 2UUDK 4ONFL 2D3VA 5CZKA 4GKNA 5L88H 3RGVA 3S3PA 2CIIA 3I6KB 3WHE1 3P77A 1G7MA 5FO7A 1JFQH 3UXFA 3PL6C 1S9VA 5FCSH 4E41A 2L4OA 3O6FA 1B4JH 2MKWA 3NZ8B 1Z0MA 2AXFB 2BY2A 4NZTH 1MCNA 1MWAA 3RX8A 2Z31B 2C9AA 2J8UE 1DQJB 4QRRD 1IRAY 1OVZA 3BDXA 4M5ZL 3FFDB 4NRYA 1N6QL 1A6AB 4XT1C 3L5XH 2IF7A 3VFVA 2QHRL 4GKSB 2H6PB 2ICWJ 4QHKI 2EKSB 1VGKB 4CKVX 4JM2D 1QR1A 4NQDB 3V6FA 1A22B 5D7SL 4MAYC 1KYOJ 2QHLA 4L9LC 2X7LB 2A83B 4JVWA 2YD5A 3BEWA 1U3JA 1G9EA 3SDXF 1Q9LB 1JZ6A 5TH2B 2Z4QA 5KN5A 1BGXL 4QF1B 3NVQA 5C07E 1ZGLB 5C09E 4PY8I 2C3VA 5JO5B 1N0XL 4JRYD 1FVEB 2Z35A 4JQVA 5FV1L 1WZ1L 4GXUM 1U95A 4JFDE 3T0EC 4ODSL 2X09A 2XA3A 1ED3B 4H26A 1CDGA 2KDGA 4LSPL 3EDDA 3E0GA 3OF6A 3KJ6H 1G0XA 3VA6A 3FOLB 1KC5H 4MJIA 5IM7B 4BKLA 2IMMA 3MODH 1SEQL 4JZOA 2WIIB 4QRRB 4YHZH 5E0QA 4ISVA 3DTXB 4NN5C 4NUJB 4Z7UA 4LNVA 5DJAB 1VERA 2Z0BA 1FDLL 4HJ0C 1U42A 5DHXB 5AYUL 4FQXD 1BFOA 2OL3B 4C83A 3MRNA 3LAFA 4I4WA 4KK9D 4JM2B 3C6LA 1JHLH 2BY0A 2VKWA 3SGDH 3ZLQC 1HWGB 2V5SA 3CVIL 1KTDA 2SEBB 4M48L 2VXQL 1ZVHA 1OTUD 2HN7B 4F37F 3SN6N 4I0PA 3S96A 1KCRH 5I18H 3RAJL 1KTRL 1LD9B 1CQYA 3DJ9A 4JY4A 5FYKU 5C6PB 4I2XB 1OAQL 2RIKA 4ODUA 4XNZB 5D71L 5C7XH 2CO6B 5D1ZC 4JPWH 4Y2DD 2NQCA 3ECBA 1UM6L 1OSZA 2DLIA 1F11A 4JRYB 4LSQL 4TTDC 3WFEH 4XVUC 5BMFL 3DI2B 1BOGA 4GG6E 1JGUL 1HIML 4FS0A 3MBED 4YXHH 3TPKA 5KVGH 1AO7D 1I85C 5HHPA 3OKKA 1LEKA 1XGYL 4KDTA 4N8VB 1BREA 4KZDL 3HRZA 1CL7I 1PY4A 3AB0C 3D87B 3TYGH 3KJ4C 2XZQH 3OHXA 3QUXC 3BUYB 3BP5B 1T1WA 3DUUB 5C08E 4OCMC 3B83A 3OMZA 2X4PA 1P4BL 4FQXB 2CKBB 1CGSH 2BVUA 1XGPB 4NP4L 2R0LL 3S7GA 5E8EB 5KSUA 2JJSA 3B3IB 1C5CH 3BEVA 4TPRH 4S1DD 3QDJD 5J56B 2AABH 4LHQB 1A3QA 4QRSA 4OD1H 1M71A 1SBSL 1EDQA 2X4OB 1H3WM 1XF5A 1KNOB 4FQJH 1MH5A 1E4XL 2DL2A 1OAXH 4KRNA 4BZ1L 4ZG1A 4F7TB 1HHHA 4R3SA 4F7PB 4OF6A 4PJ8C 1S7WA 4LIQL 2DBJA 3QWRA 3HNVL 3VXMD 1ORSA 4ORGB 4Y2DB 3K8LA 2VLKD 2VLRE 3QXAA 1HZHL 1Q9KA 2GSGB 2CSPA 2H3NB 4F15B 2V9QA 2OZ4A 1JI2A 4H1LB 5HI5D 2ZUUA 1QD0A 4HUWB 4LCCB 3BH8A 1NFDA 5BJTA 5ISZD 1KIPB 3IGAA 2VL5A 4NFDA 3MBEB 4PV9B 5CJXC 5HI3D 2H2PD 3MO1A 3HE7D 1AO7B 2J3SA 4EBQL 4LDEB 1HE7A 3CFDA 1EGJA 2XWJA 1JYWA 4M5ZH 3I85A 4PJAE 2CK0L 1N6QH 2KUTA 4LNRA 2Q86B 4Z7VE 2QHRH 2IPKA 1T0MB 2DWEB 4OZFG 5ETUB 4H8WC 4P2OA 5D7SH 5MEPB 2YPLD 2IEPA 2FNBA 5GRJL 1YNTA 3C6SA 3QDJB 5FF6A 4KJQD 3N9GL 3WDHA 3V79C 1R5WA 3U9UA 2HVKA 1WK0A 1OY3B 3DMMA 3RIFF 1BGXH 5F1SA 2GYSA 2JK5B 4L29B 4Q7DA 1QSED 1FORL 1DANU 2J7LA 4JY6A 1ZHBA 3QA3B 2FGWL 1N0XH 5DF0A 5EUKB 5IB4A 1WFTA 1WZ1H 4GW5B 2VISB 2R1WA 3VXMB 3AS2A 3SDAD 3F8UB 2VLKB 4YR6B 1OAZL 4ODSH 3QI9D 3S88L 4LSPH 2BSSB 3OQ3B 2NY1D 1YY9D 1HSAA 4PJCF 4NKIL 4Y4FA 1JWSA 4J12A 3GSVB 3V7AG 3BX7C 2ZUVA 5ISZB 1UB5B 1SEQH 5AD0A 5I66B 1ZT1B 2M26A 2FECL 3HE7B 3OKEB 3UP1A 1K3ZA 1INDL 3D85D 1Y18A 3EOAB 4XAWL 3DROA 3VCLB 4NHCL 3P40A 1FDLH 1VKXA 5AYUH 3FCTB 4X83A 1HDMA 4XNUL 3PHQB 4BJLA 4L4VE 5MEND 3CVIH 3V2AR 2YPLB 4RFNC 5EBMA 4ODWA 4M48H 2VXQH 3T2OA 3CH8A 4MCZB 1MHHA 1MJUL 1NGPL 5E00B 1NC4A 3RAJH 5EU6E 5GS0L 4GMTL 5JIHA 2ED7A 1FFOA 2D7QA 2BNQA 4X7TB 4GBXD 3WDJA 4O02L 1KF9B 1OAQH 5D71H 5IQ9B 1ZHKB 4Y5YB 4IOFC 2W65A 1QSEB 5L0QC 1U8HB 1PKQE 1KJ2L 1UM6H 5B8CA 2H45A 1WZLA 4LSQH 4ZFFA 1MRFL 3MCKB 2Z8RA 3KPSA 3SDAB 1IC5L 2VWEC 5FM5O 5BMFH 3QI9B 3SDCD 3BRDA 3MNVA 1JGUH 1HIMH 1M05B 2F53E 2GI7A 1YECL 2NY1B 2VERN 5IMMA 4E41D 4ZAKA 2YA2A 2HKFL 5CFHA 5EBLA 3QIWA 1EO7A 1V3LA 1XGYH 2PCPB 3LPFA 4MSWA 3SBWC 1BPVA 3EJJX 4KZDH 4G8EA 4X6CF 3D85B 3FONB 2GW5A 3BZFA 3LRHA 3QDMA 3QQ4A 1YN7B 3U6RA 3GSUA 5IW6B 2ZSVA 1NDGA 4NPYB 1CGVA 1P4BH 1SJEB 4PJGE 3WXWL 5FB8B 4WFHD 1EIBA 4TUOA 2Q87A 1Q0YL 4NP4H 2P1YA 2R0LH 4FRWA 2BVOA 1WLHA 3RVWD 5MENB 1N6UA 1II4E 4MA3B 3V5HB 1E28B 1AP2A 2AJUL 2BVPB 1SBSH 4D8PB 5BOZG 2FL5B 2J88L 4J3XA 4U0RB 3PWVB 1E4XH 1IC7L 5JW3L 4Z78B 4BZ1H 1T6WA 1T7YA 3NGBC 3ZE2E 4GRLC 4F9LA 4GBXB 4LIQH 3CMGA 1A2YA 3GNML 2NNAA 3HNVH 1SJHB 3MNZB 2DD8L 3MA9L 5C0EB 1HZHH 3MV9E 3GHBL 4FFZL 5KOMC 5D7LD 4QNPF 3SO5A 3UDWA 5F7NC 1QOKA 3SDCB 5I0DA 2V5RA 3EYOB 2X1WL 4GXVL 4L3CA 2A6DA 4WHDA 5TDOA 1GL4B 5CWSB 4BSWA 3OF6D 4EBQH 3UEZA 4E41B 4KJPC 2E9WA 5IV2A 3OXRA 3H9HA 1D5BA 4P5TC 4Z0BL 2AKRB 3VFTB 4C4KT 1MWAB 2CK0H 4UOW0 1F3JA 3G6AB 4CVZB 5C0CD 4ZSOE 2HT3D 1T7XA 4Y5VB 1MLCA 5GRJH 4J2XA 5FO9A 3V6FB 1GC1C 4PJ7A 1HSBA 3MMEB 5A16A 3RY5A 4I9WD 3N9GH 4PY7A 1HYSC 2H9GB 3LKOB 3BD4A 5GQBA 6FABL 4TNWK 4GRWH 1LE9A 1NGZB 1FORH 5ICZB 3QEUA 1U8KB 5IQ7L 5C70A 1YYML 2FGWH 3IXTA 2Z4QB 5FA3A 2V7NB 1XF2A 3IAGC 3JTTA 4WI9A 5C0AE 3QIBC 2IFFL 5EUOA 3T2QA 1XGTB 4KDWA 1OAZH 1W72L 4R96B 3JUZA 3S88H 2ZPKL 5D7LB 1BBJB 3D25A 1S7SB 1X5XA 4LCWE 1T66D 1WWAX 4F7MA 2VLJA 4X7FC 3DYPA 4HJGA 5LKNA 4NKIH 2FJHB 3BQUD 5DUBA 4HUUA 3FT4B 5CS7A 5GRWA 1EUTA 2X42A 5DJ0B 3RQ3A 4HG4J 4XNYL 4HEME 2AXJA 3DECA 4UT7L 2W92A 4IJ3C 1INDH 3HA0A 3DIFA 5HD8D 4XAWH 2LABA 5JORB 5DDHA 4E5XB 4JZOB 4NHCH 5DRXB 2IBBA 3VGGA 1JNNL 1I8KA 5C0CB 2BHZA 4GRWF 4HC1L 4XNUH 4WUUD 4P59L 1YPZF 3PL6A 4I4WB 3RWIB 5HJ3A 1MJUH 1I3GL 1NGPH 3LN9A 5I76A 4AZ8A 3NCJL 1BJ8A 3QXUA 5E7FA 5GS0H 4GMTH 4AT6A 3INUL 2VDPL 4HMCA 3LN4A 1KLUB 1NANH 1NBYA 4O02H 3HN3A 2A77L 4XHJC 4JFQB 1KJ2H 3DV4A 4IMLB 3RKPA 1CU4L 4JY4B 3FQRB 4X98B 3MV11 4ODUB 1MRFH 4DVRL 2PYFB 3V6BR 1IC5H 2CUMA 3ECBB 2I25N 1F11B 4MAYA 4HDIB 2JJWA 4BK5A 1H8OA 2VABA 4L9LA 1YECH 4RNRB 3BQUB 4AIZA 3V6ZA 2HKFH 3BFOA 4QHUA 3JV4B 1M7IA 4AH2B 2DI7A 4QGYA 2K3TA 2X4SA 2Q20A 4N5EC 2OYPA 4DQOL 5DMKB 1OARL 3EOYG 3DNKA 5C9KA 5IUSA 5EOTA 5HHPB 4CMHB 1MRDL 1AGDA 2UY6A 3PWUA 1AD0A 1Y6NR 1T03L 3WXWH 3S34L 4CVXA 1ND0A 1CGTA 1YYLL 3L95A 1Q0YH 2FR4A 3T0EA 3G5VB 4XTRC 1HI6B 4LQFL 5DC4B 4WUUB 2JTDA 5DZLA 1IL1B 5FV2A 4G6AD 1TTUA 3PHOA 2AJUH 3PQYD 1JPGA 5KANG 2J88H 1WBYB 5C0DB 4ZS6D 3BKML 1UT9A 1IC7H 3BEVB 2CRZA 5JW3H 1L9MA 3GB7A 4YHIB 2EDXA 5FUZL 1GSMA 4RWHA 3DMMD 4OZGA 4G9FD 2VAAA 3ABZA 4LHUD 1A8JH 2DD8H 3MA9H 4MAUL 3DO7A 1DUZA 1LK3L 4JG1L 3VGDA 3GHBH 4FFZH 3GO1L 3P30L 5F3BA 1ORSB 3NMEA 5IESL 5CJ5A 4Y8DC 1FAKT 4BZ2L 5CP3H 3U46B 4GXVH 4DKAA 4Y7MA 3SGKC 5DEFA 4Y4FD 2GTZA 3ZSTA 2DQDL 2VLMD 4MXVE 4PJXB 2BSRB 4IRJC 4V1DA 5ENWA 4PJHA 1ZEAL 1VEMA 1X5GA 5DO2C 5E4IA 3IGAB 4Z0BH 4CN4A 5BJTB 4NN7C 5E2WL 4N0RA 1M1SA 4A6YL 4HMEA 2LU3A 2XY1A 1UCTA 2YD7A 1B6UA 4LNRB 4WW2F 2Q76B 3ALXA 4AEEA 5EZOL 1FSKB 1MSPA 3TNMB 1HINL 1P2CA 1CD8A 4P2OB 4QHMA 3ZMRA 1XR9B 3S9DB 3RWFB 2J4WL 2DQJL 3PQYB 6FABH 1I85A 5CEZL 3IS0X 3ZYJA 1JGLH 5FF6B 1ZWIB 4H0IA 1H0DB 5IQ7H 4KK6C 3U9UB 2HVKB 1YYMH 3V8OA 1QFUL 3DMMB 4G9FB 5FYKD 4LHUB 3QUXA 1W72H 4CADB 5CSGA 2ZPKH 1JTPA 1FIEA 1I8LC 2EYRB 3MROB 4OFKA 1TJIL 1AQKL 2R1WB 2XTLA 5C0GA 3NIFE 1H5BA 2P45B 3RZWA 4AY0A 4PJBE 3BP4A 4XNYH 4MHHI 1ADQL 3HKFA 4UT7H 4Y4FB 4RFEB 2CR3A 1R3LA 3SGEH 4PJ8A 4W70A 3UTTE 4Z7WF 1JNNH 1EUUA 3FT3A 4HC1H 5DVNA 4JHAL 3RUGB 3DROB 3O4LE 4P59H 1BZQK 1RZJC 3QR2A 4WHTB 2C7UA 1I3GH 4P2QE 3NCJH 4LEOA 4R97B 5CJXA 2VDPH 4ODWB 4GAJL 4GG8A 1WCBB 2IWGA 2AVGA 3D0LA 1U8PB 2OM5A 3L5HA 1T5WA 1TCRB 2F54A 1PFCA 2A77H 1PD6A 1A1NA 5C2BL 4JGUA 1VFAA 4K3DH 1LE5A 2DQEL 3BYYA 1CU4H 3DWTA 1B6DA 1WBXA 1P4IL 2HP4A 4KXZH 4U7MA 2YSSA 3HB3C 4DVRH 4CU7A 5J6HA 5JLZB 4QXGL 1GZPB 5B8CB 3FL7A 2BMKA 3BJLA 2CIKA 2VRAA 4OKVB 4OSUL 5LGHL 1JHTA 4D0BB 2DIAA 3KLDA 4NFBA 4IMKC 2HLAA 1I8MA 3HI1B 3LS4L 3GSWB 3SCMA 4EDXA 1YEFL 3MNVB 1CDIA 3LKPB 4QRPA 1Q9WA 2WINA 5CLWA 4DFIA 4DQOH 1U3ZA 1MFNA 5GGSB 1OARH 1TZIB 3BJ91 4Y4KD 4R7NA 1J5OL 5J13C 3E8UL 3CUPB 1R5VA 1U0QA 1TNNA 1T03H 4PJDA 3S34H 4CMMB 4G8EB 4GS7C 4PV8B 5CBEB 1YYLH 5JPMA 2HVJB 1S3KL 3ZZ1A 3LHPL 1WIOA 2VO5A 4LQFH 3SPVB 1ZLWK 1NDGB 3LQMA 5DHVA 3J7HA 4OCLC 4PGCB 4YFLI 2P8LB 3BKMH 3DX8A 1EBPA 1JPTL 2ZUWA 1BX2B 4XXDB 1FQ9C 2Y5EA 3H9YA 5FUZH 1ZSDB 4NQSA 5GGUA 3BZ4A 1TQCC 4K07A 2D0GA 1IGTB 4MAUH 1LK3H 3WKML 4JG1H 4UUJB 5GGVL 1PQZB 3QUZC 3GO1H 1A2YB 3KDMA 3P30H 1WICA 3Q6GL 4Z8FL 3ZL4L 3HPLA 5IESH 3C09C 2QTEA 3VXUE 4BZ2H 4R7DA 1FIGL 1BF8A 2PF6A 5DS8B 3LPGA 1N0LA 5J3HD 2DQDH 3VFNB 1ZEAH 5DJDA 2AJ3B 4QXUL 5MI0B 2A6DB 1VEOA 3EYFA 4LHUG 5TDOB 5E2WH 2VITA 4BSWB 3D6GA 2JJVA 5IV2B 2P8PA 4XPHL 3KPNB 1MCJA 4Y4KB 4A6YH 1PG7L 1QO3B 1JRHL 2X4TA 1RZGA 2VIRA 3HUJF 1L7IL 1F3JB 1A6VL 2YC1A 5EZOH 4D9RE 4PJ9D 5JQ6L 1HINH 4M6ML 5IFJB 5GGRA 3VRIA 3PL6D 5HGDA 5EZIL 2J4WH 4HV8B 2DQJH 3FJTA 3IYLW 5CEZH 1Z9MA 4Y19A 1CT8A 4PJ7B 3C60C 1CDUA 4ZUWB 4NUGL 4JRXE 3REWA 3L3KB 3SBWA 3LOWA 3QAZB 5C2UB 1QFUH 3TBSB 3CU7A 1NMAL 4ONHB 3WFCL 2R1XA 2OSLA 3QG6A 2R0ZL 3MR9A 4Y89A 4L8DA 3M17A 3BAEL 2ESVE 1RZKC 1TJIH 2DKUA 1AQKH 2V9TA 5E1AA 3B9KC 1YMHA 1G7PB 4KV5E 1C7SA 1B0GB 1U8LA 4F7MB 1F2QA 2YD2A 3FB5B 5B22A 1ADQH 4HJGB 5E95B 1HH6A 1MQ8A 3ULUE 4M6NL 3QJFA 2WM0A 4EEEA 2IQAB 4GRLA 2D4DA 3BGFC 2ZUYA 4MJ6A 2PO6A 3O3DA 4D94A 1S7VA 3QDGD 4HKXA 3MRFA 1N2RB 2AAVA 1XCTA 5LQBL 1RY7B 1I1YA 4JHAH 3REVA 4G80B 5HVHC 3IDIB 4PJ9B 2J8UA 1A6ZB 1EVTC 3PL6B 4GAJH 1BQUA 2MQ0A 4RFOL 5HJ3B 2D7TL 1S8DB 4P5TA 1KG0B 5FA4A 5JW5A 5C2BH 3BP6A 1DTUA 3B9DA 3SQOL 5DJCA 4FNLL 2DQEH 3OKOB 4Q2ZB 5SWQB 1CI5A 1NBYB 1P4IH 1EAPB 1VEPA 5F70A 5I75C 1VPOL 1MJ7L 4G7YL 3IAPA 4QXGH 2AP2A 3DV4B 3IRZA 3Q0HA 4PBWD 5FO8A 1MFEL 4JREC 4OSUH 1GOGA 5LGHH 2I5YL 2EDWA 3OV6A 4XB8A 3LS4H 5GS1C 1J8HD 4ODHL 1YEFH 5C07A 5C09A 4EOWL 2EDDA 1MFBL 3V6ZB 1UG9A 7CGTA 5CEYA 3RX5A 1J1OL 4WY7L 4JFDA 1J5OH 1MCHA 2X4SB 2WP3T 3E8UH 1SY6A 1KPUB 3QDGB 4G8GA 3QIBA 1KCLA 5D1ZD 3TZVC 5F7MC 1DP0A 4L3AA 1S3KH 1AGDB 1A6TB 2VDLL 3LHPH 3NACL 3AXLA 4PLNC 3MLXL 4Q9RL 2FR4B 4N1EA 4O2CB 3VG9C 4LRIC 5K59E 5ID1B 3OKDA 1Z0NA 5BVJA 5JXEC 1N8ZA 1JPTH 2J12B 1CL7L 5FDWB 3PHOB 4K55A 1JPGB 2VAJA 3RFZC 2A74B 4HWZA 2I9TA 4ZDHA 3HNSL 5D5ME 1AHWC 3WKMH 5GGVH 2AJYL 2ITCA 2VAAB 1JWUA 2ID5A 4NN5B 3Q6GH 4Z8FH 1DE4B 3ZL4H 5H37G 3U30C 1NLDL 1DUZB 4PJEF 3WFZA 1IEAA 4AENB 1AXIB 1DFBL 4NQXA 4V2BA 3SEPA 1DDHB 4OFDA 1WFNA 1FIGH 4P4RA 5F3BB 4MD0B 1J8HB 3AREC 3ARWA 3W9EB 1CFVL 4QXUH 4U3CA 3L9RA 1I8IA 5DEFB 1BQSA 3BD3A 3HZVA 2VZUA 4NKQB 2GTZB 2VQ1A 4XPHH 5ENWB 4PJHB 3QCUL 3QRGL 1WWCA 3GUTB 1PG7H 3MV01 1JRHH 1WAAE 4N0UE 1OW0C 4QKXB 1L7IH 1N5AB 1A6VH 3ARUA 5D1ZB 1DQML 3C8KB 3KLHC 1QRNE 1IE5A 1VACB 5JQ6H 4YNYA 3DRQA 4M6MH 1JJUA 4S2SB 5EC1B 2JCCE 5T33L 5BS0D 3DETC 5EZIH 3LQAL 3ESVF 3RWEA 1IGJA 4KROC 4NUGH 3O4OC 4QHMB 4QGTA 3QXVA 5C08A 4Y5XC 4HEPG 1EHAA 2HG5B 3NFPA 2A6IA 3VXOB 3ZSSA 4YWGL 1NMAH 2NR6C 1CICC 3WFCH 4MWFA 2CKNA 2R0ZH 3Q2CA 3F58L 3BAEH 3KJ4B 4CNIB 5ITFA 5AUMA 5JIIA 3D0VA 3H9SD 3QULA 2XPGB 2YBRB 4AEHL 1UZ6E 5HHVL 3Q5OA 3VWKC 3O2DA 1E4JA 5C0GB 2RR3A 4GQPH 4YFDB 5ACZB 4M6NH 3T3PE 3OAUL 4LL9A 4G6ML 3BP4B 2VLRA 4QRPD 1CXFA 3WNOA 2DF3A 5DJXA 5LQBH 4RIRA 1CD1A 2GFBB 2YD9A 1G0DA 3FT3B 5EWIL 5KAQF 4O00A 1S7XB 3SGKA 5BS0B 4PJAA 4RFOH 3MRIB 2D7TH 2XFXA 1K8IA 4EKXA 4IRJA 1MQKL 1OGAD 4Z7VA 1X6LA 5DFTA 3Q1SL 4GG8B 4I3RL 3SQOH 4FNLH 5DJ2A 1S7QB 1ZT7B 3X3GL 1A1NB 1MJ7H 1VPOH 4G7YH 5FYJL 5C0BE 1LE5B 3B6SA 5F89B 2ICES 5DJZB 3KAAA 2UZIL 1MFEH 1WBXB 3ULVD 2YSSB 2I5YH 2YPKB 4ONGL 5K9OA 5C71A 3H8NA 3C5SB 3H9SB 4OF7A 1C16A 2V2WB 3HMXA 4ODHH 1CCZA 5EU3B 2P8MA 3GSQA 2XN9E 4EOWH 4OCWL 1BLNA 3SJVD 1JV5B 1MFBH 4YAQB 4FQHA 3FB7B 4EDXB 3PG2A 3PV6A 4OZIF 1J1OH 4WY7H 5ESAB 4QRPB 1Q9WB 5D6CA 1NDMB 4KI5F 5EUOF 1C5DB 2MQ3A 1JF6A 2VDLH 4NO5A 3NACH 4B50A 1R5VB 1I8LA 3GDBA 4U1KB 3MLXH 4Q9RH 5JPMB 2IADB 4KVCL 3AY4C 3WFHA 5C0IA 4BQCA 2HTKC 4Y4HC 3NN8A 5MP6L 5IVXF 3DX6B 4GH7B 1XGRA 3PWNB 5FHAL 1OGAB 2Q7YA 3HNSH 9CGTA 4NT6A 2AJYH 5GGUB 3NIGF 4L4VA 3BZ4B 5I8EA 1KEML 1ULVA 2AV7A 1ETZB 1CFBA 1NLDH 4XX1G 5AEAA 2YN3A 1DFBH 1GGTA 5EU6A 3FO0L 3O0RL 1KXQE 1UENA 5ELIA 4I48A 2CDFB 2MCG1 1M4KA 1AXSA 2QADC 4RFNB 1CFVH 3IFOA 1L0YA 4R4BA 5F6IB 3OR6A 3HZMA 4IEFB 2W9EL 1MJ8L 4MLSA 3SJVB 2DQFA 5F1OB 2LFGA 5E8DL 3B43A 2UZYB 5D70L 4EUPH 3QCUH 4PLOB 3QRGH 3GSNB 5DJDB 1NSNL 3ZT5A 1VFBA 4RA0C 4MYWB 3CZFA 4G6FD 2F53A 1M6OA 1DQMH 4MB4A 4XVJL 4WWKC 1JZ5A 1IILE 5A2KH 5IBTL 2ENYA 2VIRB 3R0NA 4HUVB 4POUB 2YC1B 3ARVA 4Q0XL 5T33H 1SYVB 2RB8A 4IMKA 3LQAH 4XH2A 4D0DB 5CMAA 1T89C 5KSAC 3EBAA 3VRIB 4XC3L 4ZUTA 3U83A 4F80A 1ZHLA 1FGVL 1EK3A 1AQDB 2RGSA 4PJGA 1ZMYA 3DYMA 3L7FB 3VD5A 4YWGH 3FAWA 2GHWB 4KI1A 3BXNA 2FLRT 2BY1A 1BZ7B 1JF1A 3EJZC 3F58H 1OF2A 4HIEA 4MA8L 2IQ9L 1NKRA 4LP5A 4WIQA 4HW6A 1MELA 5L9DH 1U36A 3LEXB 3NIDF 2QV2A 3H7BB 2E7CA 5CZVL 1INQB 4AEHH 5HHVH 3ULUC 4LASL 3FO1A 2PTVA 1YMHB 1MCWW 5E6IC 3HCVA 4R26L 5T1DL 3VFWB 5EU7E 2CKBL 3OAUH 4ZOCA 5INDA 4JKMA 1LILA 4G6MH 1U8LB 5JXAL 3MV9A 4UOW1 4UQ2A 4PREB 2Y4SA 3QJFB 3TNNA 3QUZA 4MJ6B 3D18A 4HKBA 1K2DA 4G6FB 4HH9A 4XCYB 2EEBA 2LU7A 4L8CA 5EWIH 1I1YB 4YEFA 1A7QL 2DTML 4KKCC 3HLAB 3RZCC 4N1CA 4F2MA 2O5XL 3D9AL 4DEPC 1MQKH 3Q1SH 4I3RH 5EZLA 4MZ3A 5J57B 3NOIA 3MRMA 1T20B 3X3GH 3I02A 5FYJH 2DM4A 3BP6B 3VH8A 4E42A 4CBPA 4F3FA 4APQD 2UZIH 3IDMA 2OBGA 3MLUL 4YIQB 4ONGH 1BM3L 2OTWA 5FO8B 2CDEA 2WQRA 4EXPX 2HJLB 3L3GB 5ICXA 5DD1L 4OCWH 3OL2A 2EDEA 3C60A 3W39A 5C0AA 1P7QA 1U8JA 2YD3A 1CE1L 2NW3A 4ZFOA 4NCC1 4LCWA 4U1LA 5I1KL 1G7JA 3QO1A 2DQTL 3KPMA 2HJKA 5D7JC 5E6YA 5I2IA 3KYMB 3B9KA 4KVCH 2DWDA 4ELKA 4BFIB 4ENED 3AXLB 1UJ3C 4Y16D 4J1UA 3NCFB 3CLEL 2E6QA 3HC0A 5INCA 2EIBA 5MP6H 1ZAGA 4FFVD 4WTWA 2AQ1A 1H8NA 1L0QA 5BVJB 5FHAH 1N8ZB 4OZFH 1U2CA 4UTBL 4U6XA 1RJZB 3WDIA 4N5ED 4IJ3B 2NX5D 2A0LC 4HWZB 4YHPA 3LV3A 1KEMH 2F74A 1EJOL 2WUCL 1BQHA 2EYTA 4BSVA 4APQB 2C26A 3P4NA 1A3LL 3L5JA 3LCYA 2R0WL 1BECA 2ITCB 5ESVA 3TYFB 5I73C 3FO0H 3MRHB 4XP4L 3O0RH 4LMQE 2D9QB 2JIXA 4MQXD 4YC2B 4PJCE 2VZVA 1IEAB 3C87A 2R2BB 2W0PA 1W0WB 3VFMA 3L3IA 4ESKA 4P4RB 1AR2A 2W9EH 1MJ8H 5JOFA 5E8DH 2JB6A 5D70H 1REIA 5CBAA 1NSNH 1YEKL 1V8HA 1MREL 3CDGA 4XVJH 2OJEA 1K8DA 5IBTH 2QSQA 3SKMA 1G9MC 4GG6B 1NAKL 3RVXC 4Q0XH 3FQNB 4JAMB 4BH8A 3KPQA 4RISL 4KMQA 3TIDB 4YDKL 5GS1A 1Z5LB 1MFDL 3HI6L 2VXUL 1KB5A 4XC3H 4ZQKA 4Y16B 5F9JA 5F7FA 5BXFB 2GK0A 1FGVH 2QQQA 3AU1A 1IGJB 3SQBA 3M1BA 1VCAA 4H0GA 3MPCA 3N1GC 4W81A 2ITDA 5KVDL 4JDVA 4PJDF 4QHNB 3KLSA 2ZWLT 4MA8H 2NX5B 1Q72L 3BWAA 2IQ9H 3TZVA 5IEHB 4JM2F 1GGYA 4MWFB 5CZVH 1RIHL 3CCHA 2AJZA 1MCDA 4LASH 1MCOL 5D8JL 5DFWH 4LRIA 5ITFB 5AUMB 4G6KH 4QWWC 3DVNA 4R26H 3BIAX 5JHDE 2VTFA 5T1DH 3RIAK 2CKBH 2JELL 4RBPK 4F7EB 4YHLL 3QO0A 5JXAH 5DD3L 3MZGB 1TETL 5I74C 1AHWA 3MV8A 4NHUA 1KCKA 4KK6D 4NOFA 2H26A 5F88B 1FVDB 2R2EB 5L2JB 5K9KA 3WO4C 1EX0A 4L5FL 1A7QH 1HQ4A 4OLUL 2DTMH 3JV5A 4WI8A 2QJDA 3QQ3B 1FFPB 3MXVL 3C08L 3QWOB 2O5XH 3D9AH 3AREA 1C5BL 4WHCA 3KYNA 5HYFA 2FZ3B 4PJAB 5SV4A 1XF4A 3K81A 1HEZA 4HD9A 4Z7VB 4NN7B 3KPRE 3ARQA 1OW0A 4M9PA 4FQQA 4L4VD 2EIZA 1T0NA 2C1OA 3MLUH 3VI3F 4QNPE 3TN0D 2K1MA 5D1QC 1EEYA 1BM3H 2R69L 2UY7A 3B6SB 1BVLB 1RK0A 3KPOA 1R0AL 4Z7OF 5EU6D 1CE6A 3MLSL 2CLVB 1W0VB 5K9OB 5DD1H 3PGDB 3P73A 3EO1A 2GSIB 5J6GB 4G8FB 4YXLL 2P8MB 1CE1H 4Y5XA 1ZVSB 3GSQB 5HGAA 1TQBC 1DVFD 1CICA 5I1KH 4FQHB 5IB2A 2R2HA 3UBXA 2ILLA 5EZJA 2DQTH 2H32H 3MGOB 2BVYA 2BOCA 3BVNB 4PJBA 1JI1A 3R8QA 4LIQE 3MNWB 1LMKA 2FJGB 3OG6B 1FZMA 3VWKA 4DVBA 1LO0L 2XG4A 4GXUN 2X70A 3WEXB 2FHCA 3CLEH 5BZDA 1EEUA 3WFHB 3UTTA 5DK3A 4C56E 3H42H 4UTBH 1JMXA 2FWOB 1GGCL 5KSVA 3O4LA 5TPWL 3TA3C 4KY1L 4KTYA 3X11B 4HZLA 1FJ1A 4DCQA 4UQ3B 4WU7B 1EJOH 5ERWA 1HK6A 2WUCH 4P2QA 4QY8A 4PRID 1A3LH 5ALCL 4L4VB 2R0WH 4XP4H 3TN0B 2AV7B 4XBGB 3ARYA 2J8UF 1OAKL 2CXKA 1GHFL 4FTVE 3BOVA 3OJDA 1UVQA 1O0VA 1VHPA 5EU4B 1RSFA 2KBGA 3GRWL 4RDQF 5EU6B 4MMXC 2LV4A 4JANB 4ZOAA 1IM3A 4R4BB 1YEKH 2F8OA 4F8QA 4R6UA 3TBTB 1PKQB 3HZMB 1IGML 2NY2C 5CINL 1MREH 1DVFB 5L2KD 3MREA 4GRWE 1IZJA 3EHBC 4XP9L 3QUZD 1H3TA 4K3GA 4PGZA 2NLJA 1YPZE 3RI5K 1HOCA 1J12A 2DLHA 4RISH 4U6YB 4YDKH 3FZUC 3SOBL 1MFDH 1S9XA 3HI6H 2VXUH 1A14L 2UWEF 5IGXL 2IALA 2D9CA 4G43A 3UTQB 5JQHC 4PS4L 2PW2A 3IU3A 1NGXA 4WFGE 3RNQB 5CJQL 5KVDH 2J5LC 3T0BA 3OR7A 1Q72H 3BO8A 3HI5L 1JF1B 2R23A 4PRIB 2Z92A 4GS7B 2DJSA 1RIHH 3ILQC 5EU7C 3RL2A 3AY4A 1MCOH 1K3IA 2E3VA 5D8JH 3VFRA 2LVEA 3CXHK 3SGJC 5T3ZD 3FQWA 1OAYL 2JELH 4YHLH 2ICWA 1IQDA 3QEHB 5DD3H 4RAUA 1G7QA 2HFFA 3BISA 3VU2A 1TETH 1JUFA 1U8QB 3QBTB 5JDJA 5C0AD 1P7QD 3GSOA 3WUWG 4J8RA 3T4YB 4ZUUB 2NY4C 4KUCD 1TQCB 3VXUA 5L2KB 4UQ2B 3ZKMD 4L5FH 1JGDA 1KJVA 3V5DA 2YPVL 1A4KA 3QUZB 4OLUH 5EO1B 5DK0A 3GJEA 2Y25A 1KPVA 5CKAA 1KTLB 3B9KD 3MXVH 3C08H 1T2QL 2CGRL 1C5BH 1MJJA 1L7TL 4P9HL 4UT9L 4ZO6A 4ZSOB 2K7QA 1G7LB 3T2PA 5BZWA 1SEBA 4IS6A 4WRLA 3MJ7A 4WWKA 2WBWB 3LSOA 2R69H 3IJHB 3WL9A 3MJ6A 2X1OA 1R0AH 3MJ8A 3DXAE 1KTKE 4NYLA 4NFCA 4JRXA 5IMOA 3MLSH 2EEDA 1UXWA 1T89A 5KSAA 2B5IC 2DI8A 1QSVA 4YXLH 2NY5L 1MY5A 4HWBL 2R56L 1UXSA 3QNXA 3O3AA 5C0AB 1P7QB 1IBGL 1U8JB 2ESVA 3IDGB 3B9AA 4ZOEA 3VXSD 5GSVA 3KNBA 3W9DB 1B0RA 1CVRA 3QO1B 1RIUL 4NNYB 4QTHA 1LO0H 5I2IB 2IAMA 4WVRA 3B9KB 4U2ZA 4O51B 5E6IA 4LCUA 3I6GB 1A9BA 5D2NE 1SYSA 1GGCH 5TPWH 2NY7L 5IBLD 1Y6KR 3LKQA 5INCB 1PX3A 4KY1H 1U3HC 4U1SA 3E6FB 2ADIB 4U6XB 3AFLA 5ALCH 1DN2A 1FH5L 4YDIL 4GUPA 3LV3B 4MDJB 1I7RA 1FYTE 1J0KA 1IQWL 5HVHB 1OAKH 3WN5A 3WHXA 4OCRL 1GHFH 4O2FA 5M95B 1NFIA 4RMQA 5ESVB 3GRWH 5HPOA 3RZCA 2UV3A 4R2GC 4CDHA 2VL4A 5JXED 2FIKA 3UPRA 3OX8A 3WIFB 3K2UL 4DKEL 3FRUA 2EC8A 3QP3A 4QHLA 1IGMH 4Z7WE 3MSPA 4OGXL 5CINH 1WITA 4J3VA 4DZBA 2L7UA 5SWSE 3LRSB 1BWWA 2Y9RT 4XP9H 2K7PA 3OXSB 3VXSB 4K71B 2P7TA 4X8JB 3A0OA 1MAKA 5TF0A 3CDGB 3KPTA 5EFIB 3UTPD 2QBWA 4WW1A 2OJEB 1NCCL 3O6KL 4Z77A 2GITA 4PRAA 3SOBH 5FYKL 1KIQB 1A14H 2P44B 2BNUA 3LS5L 4L8SC 5IGXH 3GJFB 4PS4H 2ZSWB 5IBUB 4OBSA 3DVGA 3CC5B 1KB5B 1TZGL 3WIIL 3QHFL 5CJQH 4KKLD 5IJKC 1UWXK 4M00A 3AU1B 3P0GB 5C0NC 3CVHB 3C2SA 1ROWA 3HI5H 5LAXB 2AI0L 5J1SC 5D7JA 2GTWB 4M6OL 1I1AC 3VA2C 2ARWA 1IM9A 25C8L 4Y1AD 2EH7L 3OB8A 3LVEA 2YXMA 2XKNB 2Z91A 1OAYH 1UJ3A 4NCDA 4LAQL 5D5MA 5D9SB 3VG9B 3BIKB 3KG5A 3F7YA 3VXNA 4MQTB 1OD7A 4XCCL 5GGVY 1F4AA 4NDMB 4HUXB 4MNGE 4BQBA 4YO0A 5EU5B 4FQPA 4P3DA 2GT9B 2YPVH 4WGVB 1I3VA 4JN2B 2PUQT 2Q7NA 5DMYA 4OLZL 4M7LL 1Q9OB 4GQ9L 3W5MA 4EI6A 4M8QA 1IC4L 1T2QH 5KSBB 2CGRH 3VWKD 1JPFA 3JV6A 1HXYA 1MCSA 1RHHA 2VOTA 5JDSA 2ZUTA 3STLB 4N0UA 1L7TH 3VE0A 5D7IF 4P9HH 1QLFA 4WUKL 4UT9H 1MCFA 1KLGB 2YHGA 3O4LD 1VFUA 4JFFE 2JCCA 3L3DA 3EFFB 2AK1L 3BPOB 1ZLVH 4P2QD 5JW4R 3EOBA 1IZKA 5B38G 1MHPL 2EIZB 5E8PB 1CGXA 4Y1AB 3WE6A 1EEYB 4HPOL 2Y1VA 2Y06L 3RDTC 5GS3A 4KHXL 2NY5H 1Z9SA 4HWBH 2R56H 1KPRA 3UZEA 2EEAA 4LPCA 2BVQA 3TT1L 2HTLC 1NJ9A 1T04A 3E6HB 3NCMA 1IBGH 3S5LA 1UJTA 1JMZA 3AROA 2CRMA 1F3RB 4Y5XB 4JZJB 5ADPL 1O7VA 3HUJE 5IEKA 5F1IA 1CICB 5IB2B 3UBXB 1G7HA 3G5ZB 1RIUH 3QUMB 5EZJB 3WNMA 4YHYC 3DV6B 3NFNB 4TSAL 3I2CL 3NPSC 4PJBB 1OCWL 4HSQA 3BUTA 1PY9A 5GZOC 5CSBA 3IFPB 4NNXA 1MCKA 3VWKB 5FKAB 4ZFZA 3V4UL 3PJSA 1X5YA 4CL7A 5I19L 5DVMA 2NY7H 2EXYC 4QRUB 4JO1L 4ETYA 1JNHB 4C57C 1MI5A 43C9A 3MV7E 3O4LB 4ETQA 1OTTC 1FH5H 1XFPA 1YA5A 4YDIH 4FQLL 4OAWA 4DCQB 1IQWH 2VLLB 4P2QB 4OCRH 4B7LA 3GMLB 2YRZA 3AMKA 5E2UL 4FZ8L 4ALAL 4R4FL 3QFJD 4P4KC 3GSRB 3K2UH 5C0BA 2E9BA 4DKEH 4OD2B 2DL9A 4Y4HD 5SX4H 4PG9B 4OGXH 1GAFL 4CW1A 1JZ3A 1P84K 1Y0LA 3Q6FA 1S7UA 5CEZE 2Z93B 2EDYA 4R0LB 4MNQD 4N0CC 4ZO8A 2G2RA 3RWDA 1U58A 4AEFA 4QTIL 3GIZL 5TDNB 5D1QA 1AGCA 3TC9A 2XN9A 1NCCH 3O6KH 5BOPA 1SJVA 4WU5A 2AK4D 1Z9OA 5FYKH 3D69A 3OKMA 5J89A 4KQ3L 5FGSA 3LS5H 4UMGA 3DHMA 2F5BL 2J6EA 1QFHA 1ZHNB 1F2XK 3N1QC 1TZGH 3WIIH 3QHFH 4NZUL 2IALB 3T1FB 4G43B 4YGVA 4MQ7A 3U4BL 3HG1D 3MOQA 5E99L 3RUGF 1BP3B 2D0HA 1NGXB 5I8KL 3BW9B 2AI0H 4M7JL 2XA8L 8FABA 3OR7B 5EN2B 4M6OH 1FLRL 1CFQA 1JTTA 3KPPB 4WWKD 25C8H 2EH7H 2FHBA 2H8PA 3QYCA 2WIMA 1RUML 2Z92B 3IJYB 4RBPH 3CU1A 4LPUA 2B4CL 4LAQH 4JRXD 5SWZE 1P7KA 5A40E 2XWBB 3BMVA 3C5ZC 5GS0C 4AL8L 1OLZA 4XCCH 3ZYIA 3OGCA 3QFJB 1LK2A 4G9DB 1JHKL 4WDIA 4Y4HB 2HFFB 3G5YA 1CXKA 4ZYKB 1T3FA 1TCMA 2CLRB 1LO4L 5I16B 4MNQB 3GIVA 4LLYB 1EFXD 2A6JA 5J11C 2Z9TA 4OLZH 2ZUSA 4M7LH 4GQ9H 1JGDB 3NCEB 2XACC 1KJVB 5A2LH 3W0WD 1IC4H 5C0JA 2AK4B 4PRHE 1GCFA 3ULUD 4J23A 4XZUB 5AWNL 3VXPA 1KPVB 2D0FA 3F7VA 4Q9CA 5FGRA 5GJSL 3CAFA 2E7LC 4LAJH 3CDCA 1BAFL 4WUKH 4XWGL 5FYLD 3VRLF 1A7RL 1PW3A 3HG1B 4M7ZC 3BPCB 4NQEE 4P2YA 4TNVF 3UTOA 2AK1H 4PJEE 1JCKA 5I1AB 4KJWC 5BZWB 1MIML 1MHPH 2QR0B 4AMKL 4HAFA 1HXMA 3MJ7B 4WWKB 3ARGD 3F7RA 3QJHA 1N7ML 4HPOH 2Y06H 4N8PA 3N50A 1HHIB 2QSTA 2CRIA 4KHXH 4JRXB 3BI9X 2X40A 4D0CA 4LKXB 4EXKA 2RAMA 1I7UA 3TT1H 3H3KA 3PDOB 1UEYA 1U8NA 4WW2C 5E8OB 1UGNA 5ADPH 1MNUH 3HE6C 4EVNB 3QNXB 4X0KA 4Z7QF 2YUXA 4BH7B 3CD4A 1EFXB 5F72S 3MRLB 2BSED 4IHOA 4LKCA 4PP1C 5IP4A 5F7DA 5D2NC 4TSAH 3I2CH 4LVHC 3KNBB 1OCWH 3DARA 4OIIL 3SGJA 1U3YA 3W0WB 1BEYL 2ZZUT 3L5WA 2WBJC 1TVBA 4PP2A 4TRPL 1IEBB 3V4UH 1FAIL 4M61A 3HAEB 5I19H 3CFEA 3WJLC 5E8NA 4JO1H 2A73A 3S36X 1B90A 4J6RL 3VFSA 1ZS8A 1WC7B 2EE3A 2P5ED 4P48A 1EXUB 3WUWA 3LKQB 4FQLH 2E9IA 1SVZA 4Z0XB 4M03A 4MVBC 1QSFE 4HMDA 1KXTB 2Y5TA 4E0RA 5CD3B 5E03A 5FFLA 3ARGB 3MRDB 5E2UH 5C6WH 3WHXB 1S78D 4FZ8H 4ALAH 3QZWA 1AY1L 3BPLC 1NFIB 4R4FH 4YDVA 1HKLH 3L5IA 4EIGB 4HIJA 1OQOA 2EO9A 3TFKC 5GZND 4RGNE 4DEPB 5FGCE 3ARFC 1GAFH 4H5SA 4U6VL 2ZCHL 4GRMB 4PGDA 2VXSL 4UBDC 2P47B 1T1XB 1YUHA 5JMOC 2E8YA 4XMKL 4QTIH 4DZBB 3GIZH 3BH9A 1UEMA 4KGLA 1IAIL 4M4PA 3SDDD 2P7TB 4L4TE 4KQ3H 3BYTA 2W07A 4R8WL 4BUHA 4P2RD 2F5BH 2GITB 2IPTL 1KULA 3TBWB 2BNUB 5ESQB 4NZUH 4F33B 1QFWL 1IKNC 3AMLA 5DJ8A 3U4BH 3UBXI 2PKDA 5E99H 5I8KH 2EDBA 1BD2E 1NBZA 4M7JH 2XA8H 1QRND 2FB4L 2P5EB 3QXDB 3IDNB 1FLRH 1FFRA 3TBYA 4PJIB 1NC2A 2DMCA 1DBKL 5AYQA 1RUMH 3PWPA 3UTSD 4MCYA 3RVXD 2B4CH 3CMOL 1DEDA 3GM0A 3RI5F 1C7TA 4AL8H 3QNZA 1E6JL 4OZIE 5F7KC 4XWOC 4WV1C 1JHKH 4XGZB 2O26U 1AGBB 1GVIA 4KI5E 5EUOE 4W4OC 4HGWB 1LO4H 2DLTA 3TV3L 2IAND 4NC1E 3GMOA 2IMNA 4I77L 4PJCA 3ARBD 3ZKNC 1L9NA 3CSYA 1J88A 1W8OA 2ADJB 1A1MB 3VD4A 4P3DB 1XF3B 2PTTB 3JWOL 2XWTB 3SDDB 1G7IA 5I73B 2CPCA 5AWNH 1FLTX 4B41A 5GJSH 4EI6B 3C8HA 1RHFA 4P2RB 5IT2L 5IVXE 3IXAB 1BAFH 2QLVB 4HK0B 5DRNA 5B39B 5K9JL 3ULVL 4XWGH 4K7PY 1JPFB 3JV6B 1OP5H 1FO0L 1RZ8B 1A7RH 5JDSB 3B9EA 3NIGE 3VE0B 1EEQA 2KQMA 1K4DB 1CFNB 1QLFB 2Y36L 1S7RB 1R5IB 1QRNB 4U6HA 1ACYL 2FYYA 5BO1L 1MIMH 4RMWA 3GHEL 4YZFF 4XP6L 4AMKH 4DOHE 3GSNL 4X6BB 4NSKA 2P5WA 2X4NA 1N7MH 1UH2A 2EE2A 1BMGA 3EOBB 3UTSB 4L8SA 3FN0L 3BDYL 3VJ6A 4F7CA 4O9HL 2W60A 4L3ED 5IVZA 3P0YL 1F5WA 3VXRE 4QYOA 4XNQB 5IJKA 4P0DA 1KPRB 2NY6C 5TE6H 5B3NA 3OSKA 3QUKA 4LSDA 2OR9L 4RCAA 1ZA6A 3S5LB 2IANB 1W2KT 3ARBB 1F3DH 4NQCD 4Q9QL 4XBPB 4GJTB 5JHDA 1FG2B 4WI7A 3JTSA 1I1AA 1JK8A 4HS3A 5IEKB 2YA0A 5F1IB 4OIIH 5D1QD 1AGEA 3MQIA 4NO2B 1RZIA 4P57A 1BEYH 1X5ZA 3X13A 2ICWI 4TRPH 5ADOL 1FGNL 1FAIH 3BZDA 1FZKA 1XGUA 2YKLL 3WLWD 5GGRY 3GMQA 1QR4A 4NNXB 5I8CA 3FFCD 5K9QG 1S9YA 2I9LB 3G6JB 1FNAA 4J6RH 1LVEA 1RJYA 3WFBL 1DLHA 1J0HA 4OFIA 5B3JF 3MRRB 1ZLSL 1H3UA 4LLMA 3WNPA 3NIDE 3FT2A 4JDZA 4XPFL 2XKSA 2FRGP 4W6WB 3CIQA 4KGJA 3F65A 3WO4B 1J05A 2DQUL 2FCBA 4OAWB 3CPLA 1U8MA 1AY1H 2NY3D 5GRZA 2AXGA 3KPRA 2MHAA 2WWKT 4FXKB 3FQTB 3DBXB 4NBZB 2PYED 4L3EB 4KMTL 1RQ5A 5GISL 4U6VH 4NIKB 2ZCHH 4XB7A 2VXSH 3P9WB 1ZOXA 5F7UA 3FO9A 3TA3D 4XMKH 3KYOB 4NRZA 1IAIH 1MRCL 4NQCB 3RWDB 2COQA 2IH1B 4OV6F 4GAYB 4R8WH 5D1QB 1AGCB 5B38A 2RJMA 3RDTA 5TJWK 4HUNB 2IPTH 3D69B 4IRSC 1BVZA 1LDSA 3CX5J 4NJ9L 3S4SG 3KPLB 1OP9A 1QFWH 5GSRA 1MCLA 2Y6SC 3FFCB 5JOPD 5FCUH 3GFUA 4TUJB 1E6OL 2FB4H 1YDPA 1TQBB 2NY2D 3TJHD 4MQ7B 1FP5A 1I3RA 4KRPC 4NN6C 3ZTNL 3BKJL 2NXZC 3U0TA 1JGEB 3PNWA 2EDKA 1DBKH 3EHBD 4ZXBD 2M1KA 3MRCB 3BGMA 5BRZD 1TIUA 8FABB 4WO4C 5A2IH 3O45A 2BNRD 1PLGL 4C56A 5HVWA 1CFQB 5B39G 3SDXB 3C2AL 4OD3L 3CMOH 4XPGL 5DQJB 1LHZA 3GBNL 3QQ9C 2NY3B 1E6JH 3B8YA 4I5BB 2PYEB 1P7KB 1U93A 3OGCB 4NNPL 5C9JA 3TV3H 4WDIB 4I77H 3SKNA 3VFUA 1MPAL 2DJUA 4FTVA 3TA3B 2FO4A 1T3FB 5I30L 3VGAB 3HHRB 3JWOH 3QUYD 1CK0L 3ARZA 4JGJA 4JFXB 4H25B 3T77B 3ILQD 1TVHB 1JN6B 5ANME 5C0JB 5IT2H 1X5FA 4P4KA 1CDJA 4PIRF 3SO3B 5K9JH 3ULVH 5ILTL 1FO0H 3QH3A 1GRWA 1YPZA 1FNEB 1LP9B 2Y36H 3LMJL 1ACYH 1FZJA 2NY2B 5BO1H 2AEWA 3MTRA 4EJ1C 4PJFF 3GHEH 5BV7B 1JNJA 3GSNH 2N56A 4PLKD 3TH2T 4ZXBB 1MUJA 2XTJD 5BRZB 1XGQA 1P5UA 4ZPVA 1UQSA 2BNRB 3FN0H 3BDYH 5EG6C 4O9HH 3HRPA 4PBXA 4CVWA 1XIWC 3QJHB 2X4UB 3P0YH 2MKLC 5HYSG 1TMCB 1QPPA 3IT8D 3STZB 4OLVL 4JFOB 5CD5D 5I15L 3S6CA 5B4MD 3RJQB 1N3NA 2OR9H 4OV5A 3SE4C 1Z9LA 4FFYL 3BWUC 1EPFA 3HPJA 4Q9QH 5T3XD 3ULVF 3LKNB 3P4OA 1FL3A 1CGUA 3EO0A 3GJFK 4URTB 5F9AC 4FABL 2UZXB 3TPUB 5D6DC 3RTQC 3QUYB 1D6EB 5E5MB 5EO0A 2DI9A 4IHOB 4MDIB 5J9PA 1GGIL 3CLFL 5ADOH 1FGNH 3FB6A 4QRRE 1IVLA 3C5ZA 5KW9L 2YKLH 2AERT 4U1IA 2AEQL 2PETA 1FFNB 1VADB 2R1YB 4TYUA 5IG7A 4JN1L 4PJDE 3WFBH 3CFEB 1KJ2A 2DICA 2KZWA 1JPSL 1ZLSH 2CXGA 1BZ9B 4XPFH 1QLEL 2O61A 1R3IL 3GSXB 1ZS8B 1DN0A 4X7CC 2DQUH 5JZ7C 1UZ8B 3TVMC 4G7VL 3VI4F 4XAKD 2GJZB 2KPNA 2XTJB 4JRWA 5BQ7A 4RGNC 5D72L 4E0RB 1HH9B 3UZQA 3K4ZA 2BP3A 3TLRA 5IVOA 4I2XE 4X5WB 2E7LA 1XZ0A 2V2XA 4NZDA 4KMTH 3VXTA 5GISH 3QZWB 5CILL 1DBJL 4JRYE 2X1QA 4QT5B 1BWMA 5DJ6B 1QA9A 3VMPA 1U3HD 5IR1B 3DXAA 2DLEA 5IOPA 5F71A 1MRCH 2XT1B 4KK5D 5MEOB 2VMFA 5IB3B 1P53A 4OLWL 4JJ5A 2XQBL 1HN1A 3CFCL 4O5LL 2G75A 1J18A 4DZ8B 2D31B 5IB5A 4MA1B 2QSVA 4HX1B 4NJ9H 1YQ2A 5AG9A 2ED9A 1KT2A 3EFDH 1CS6A 2I60L 4WW2A 5EPMA 3RPIB 3ZYZA 3S8WA 1HCVA 1YY8A 5DEGA 1TTFA 2BSTB 1E6OH 2DYPA 3BZEA 1CGWA 3DVIA 5E08L 4HLZH 3VI3E 3ZTNH 3BKJH 4QOKD 1HHJA 2ZCLL 5D2NA 5HHXL 4W4NA 4IDJL 1PLGH 4YLQT 5T1MA 1JWMA 1PYWA 3C2AH 4OD3H 4XPGH 4Y19E 5CP3A 2JE8A 4PYGA 5FKPA 3GBNH 4NO0A 4KI5C 4MZ2A 4G5ZL 5I1HL 4JFZL 3E2HB 4NC1C 3WJLA 1YN6A 1ZT4A 3QNZB 4AK1A 1N59B 3BMWA 3R06A 1FYTA 4NNPH 2KKQA 3MRPB 5C0ND 4XNXL 4J7RA 4LBEA 1U3HB 3X12A 1K4CB 3OAZK 3U4EB 5I30H 3G04A 3GMOB 4PJCB 1CK0H 4YK4B 1QFWM 4FZEL 1U91B 3RNKB 1AO7E