2FD6H

Structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
212
Chain Sequence
GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human urokinase plasminogen activator in complex with its receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 41
structure length 212
sequence length 213
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fd6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fd6H02
4TUKL 1XF4A 4HJGA 5T1MB 3H3PH 4C56D 3HZMA 4XVTH 1ZA3B 4Q6IA 5KW9H 3NCBB 1NMBL 4YIQA 1LO2L 2V9RA 3D69B 1F90L 3BSZH 4PS4H 5F7KC 1U6AH 4HF5H 4KKCC 2Z91B 1QA9A 3VI3E 5DD6B 3I2CH 4PJ7F 2HN7B 3D39A 4R4NC 5FUCE 5DJXB 1SBSH 1T0PB 3U0WL 5MHSE 4XXCC 4G6KL 1S7VB 4PJ5B 4X7DC 1OT1A 5EBWB 1H3WM 1KGCD 4HWBL 4PJGA 5DRWA 1MFNA 2F5AL 3HZMB 3PDOB 4OLZL 2AXHA 2X6MA 3VXUA 2VAAA 1D7FA 1EFQA 1RUQH 1OGAB 3Q1SH 4OCSH 4Z7WE 4EDWL 5I1JL 3TT1L 4MB5A 1FYHB 2EIZB 1YA5A 3FO0H 4XC3H 3MLWH 5HHOE 3DYPA 2ARJB 2H41A 3FQWB 1OW0C 5LGJA 5GS1B 4WFFE 4WJ5B 4GUPB 5HGDB 3DO7B 5BW7C 2R1YA 5EBWA 4XAKE 4YPGA 1FJ1B 4CRPA 3HPJA 1A6ZB 2EDOA 2EZ0C 2ADIB 5I1GH 5IHBA 1AY1L 2I60L 1LO4H 3F58H 4P99A 5IR1B 1U8IA 3OWEA 4U1GB 1QEWB 1R6VA 5K59E 2OBGA 4IIQC 4HC1H 1YJDH 3RGVA 4OLYH 4MJID 1U41A 4JRYB 2OCFD 5FA3A 4NKOA 4YBQC 5HTSA 5GS1A 3O4OB 3AROA 3BAEL 3LQMA 1CE6A 4KGJA 3HZVB 2XNAB 5INCB 5C7XH 1Q94A 4JKKA 2ADIA 4FQJH 4OZGA 4Y2DD 4KRPB 4HH9B 3O6KH 2ADJA 4G9FD 5HHME 5C0CE 2NY4C 5LQBH 4OLXL 1ZT1B 1T4KA 1NFIB 1Z0MA 2DWDB 1NGZA 4JQIH 1IEBB 3BW9B 3H9ZA 3ULUH 4JRYA 5CFHA 4WU5B 5CP7B 2QQKL 3WHXB 4DWHA 3DSFL 4M8QB 5D7KD 3GI8L 2F54E 1EXUA 1TPXB 4RBPK 3SKJL 3BHBB 3HI6H 3FQRB 2ICWI 2R69H 1FSKB 5DD3L 5E4EC 2AKRB 4M1DL 4UV7L 1JHLL 1KJ2H 4YUEH 2VE6A 2XN9D 1RSFA 2ERJB 1NGZB 1XCTA 2CH8A 1YEEH 3D3VA 1L0YA 3PWPB 4QF1A 2Y36L 4JZJA 3MLXH 1H9VA 4S0TD 4L3EA 4NN5C 2BOBA 3VG0H 3ZL4H 5MEPA 2IPKB 3L3GA 5IEKB 4XHJC 3FT4B 3QEHA 2KPNA 3IGAA 4QTIL 2AW2A 3WMSA 1D6VL 1AC0A 4UMGA 1OM3L 2DKMA 3AFLA 4X6BB 1N7ML 2HRPL 1SBSL 1CZ8H 5DJ2A 5I9QB 3FQRA 1NGWB 1HWGB 1MHHA 2UZIL 2PO6B 3SJVA 3QHZL 3DURB 3UJJH 4KZDH 1H3VA 4U1JA 4D2NA 5C3TA 4F58L 2VE6B 4OGAC 2WUBL 4X5XA 1WCQA 4OLZH 1F42A 1NAKL 1WBYB 4DKFH 5E8DL 4D0CA 3AMLA 4LQFL 1ZLWK 4ETQA 2YUXA 2VXTL 4ZOEA 2C7UA 3MJ9H 4OCSL 3EAKA 3MMEB 2HLFC 5D96C 3P4LA 2CSPA 1TTGA 5E2VH 4IOFD 1MPAL 4RFEA 3FO0L 4NKIH 4N0UA 4KZEH 4Y2DC 5E9DE 3K4ZA 3DUSA 5DLMH 2IAND 5L6YL 3N1PC 1DN2A 3PWNB 3RU8H 5DD5L 1T7ZA 5GGSA 2BSRB 5JHDA 2P7TA 3L5WA 4PGEA 2OJZH 1CF8L 4CN4A 3ILQC 2EDLA 4OZIE 1HE7A 4Q9QL 3J7HA 3VXSB 1RIHL 4TNWF 1KPUA 4OIBA 1DQJB 2ZSWB 2NY1C 4KK6C 2R8SL 3CLFL 1TZGL 2IWGA 3NN8B 4ZOCA 3ORJA 4GKZB 3D2UA 1G7MA 3T4AA 2F8XC 1H3PL 4N0UB 1TJIH 2GT9B 3VA6A 4H8WH 1X7QA 4NN6B 4OFYA 1LDPH 3DI2B 1LO3L 3WIIH 5IBUG 2BSRA 1DBKL 4WNQB 2FATH 4ZAKB 4MAYC 5SV4A 3ZHKA 3LKPB 4MXQD 1TIUA 1KPUB 2BCKA 1UXSA 4K55A 4QNPE 3PP3K 3WYRA 2XXMB 4OLXH 5J6GA 2CO7B 1W72H 1KTLA 2GUOA 3E3QE 2X4UA 4PJAA 3D5OF 2AJZA 5CSGA 4P57B 3EJZD 4AH2A 5DMGC 2AJSH 2WINB 1DQDL 1M7DB 3RWJB 3QCTH 4WFED 5CEZE 4P3CL 1PYWA 3P9MA 2HMID 4LP5A 3L7EB 3PL6A 1U8OB 4YDLC 4PD4K 2B7DT 3WUWA 1ZEAH 4PRHE 1IBGL 4Y4HA 1JWMB 3FTGB 1A4JA 5LGHL 4XRCA 4JFFB 5LAXB 5MEND 4ODXA 3A67H 5KSAA 1TENA 3SHSA 2C1PA 4HFWA 4NQDE 3RWHB 1MCOL 3QA3A 3CX2A 3KPSA 3GSUA 5DJ6B 3CU7A 3DVNB 4NZDA 5IVZA 1P84K 4DZ8B 5HD8C 1J0IA 1A7QH 3JWDC 4KUZL 1F6FB 4JQVA 4X6DF 3RWCA 4DVBB 1PYWB 3P9MB 5A1AA 4Z6AT 1MFEH 2IEPA 2GJZA 4I4WB 2Z8RA 3BH8B 2ADGB 4U7KA 4OD1H 4J7RA 1I7RB 4LQ1A 5IFJB 2J2ZA 3G6JB 4OFDA 3KYMB 1JFQH 3WS6A 5JW3L 2I9TA 4GW5A 4YGVB 2IH3B 4E0RA 3CSYB 4OB5H 1VFBA 5KSAB 2C1PB 4LNVA 2K1MA 4OKVB 5A2IH 1WEJL 2R1WA 1TJHL 4WO4C 5JNYB 1I8KA 1TFHA 2OSLA 3CFBB 3DVGB 3REVA 4LMQE 3W5MA 1S7UA 3B9AA 4JO2H 4KQ3L 5IVZB 3A6CH 1CLYL 3RZCD 4MXQC 3T65A 3MLZL 5CHNB 2D7QA 4J6RL 4DFHA 2R0WH 3MA7A 4O2EB 1FBIH 4CVXB 1QFHA 2ZNWA 4ELMF 1H0DA 3R0MA 2APWA 3NFSH 1CDIA 1JHKH 4O4YL 4D0BB 3AUVA 4CJ1A 4A2MA 3TLRA 4R26L 3ZKND 5GS3A 4G6KH 3T0WA 2DM4A 1FG2B 5E2WH 4JANB 1E4WH 3NTCH 1V7ML 1ZHLA 4OFVA 1IGYB 1CL7I 3CXHJ 4NJAL 2A6KB 4HV8B 3EKCA 1B9ZA 5IESH 5AYUH 2NY1D 3HC0B 3TNNA 3RWGB 5GGTH 1BFVL 4HUKB 1CCZA 3MBED 4HULB 2Q86A 5A43C 4Q58C 1XGTB 3W9EB 5DVMA 1YY8B 4XMKH 1NL0L 4P5TD 3CAFA 1H0DB 5BVJA 3V0VA 3O6LH 4JPIA 4BSWA 5IK3B 3MGTA 2VOTA 4M4PA 3D9AL 3OG6B 2YD8A 4W6XB 5K9KB 5KVFL 5DFVC 1S7WB 1U3ZA 4KI5E 1SVCP 3ROLA 4JFHE 3RVVC 1CG9A 2DIBA 3HC3H 4GLRH 3DV4B 3P4OB 4LPXA 5D72L 3UBXI 4DQOH 1L0XA 4HV8A 4PV9B 2EDFA 3E1F1 2DQCL 3KYOB 5EC2B 4X5LA 2NY5L 2ZCKH 1N8ZA 4AEHH 3JV0A 4ALAH 5ANMB 1R3HA 4H25B 3ZTJG 1KLUB 4OV5B 5EOCH 4MDIA 5GGVL 3E6HA 2DQUH 2EH8H 1C5BL 4Y16A 3SDCC 2VLJA 1DQDH 4JKMA 12E8H 3MJ6A 4M7JH 3SDXA 3SKMB 1BMGA 4U0RC 1KB5L 1YMMB 3BJ91 2E9JA 2XG5A 4L29A 3ARPA 4HG4K 4Q9CA 4L9LA 3M8OH 1EHNA 3I84A 4K7PY 3EOAA 1S7RA 2HFEA 1PW3A 2MSPA 4ZPVA 1OAZH 5EU5A 3MRHB 5K33A 2J8HA 2HT4D 4JFHD 4YNYA 4Z7WA 4YIQB 3QXTA 2IQ9H 1HINL 2AJVH 4QTHA 1JF5A 1FL6A 2LVEA 3GB7B 1LO5A 4OGZA 4YHKL 4WTZG 1KFAL 5SWZB 4FQCL 3LS4H 1CXEA 5LGKA 5D7SL 1NGPH 2QQNL 5HVHB 3EYSH 4PGCA 3NCCB 2CQVA 1BQLL 1T1XB 1BGXH 5DQ9B 1J1PL 5JW3H 4NQCA 5TJWK 2R15A 5FHBH 3NZHH 4U1SB 2A38A 5HGBB 2GKIA 2WWKT 4KVCH 4IBLT 5T1KA 3MUZ1 3D85A 3PP4L 1CLYH 3GB7A 2E3VA 3RVXD 4OAWA 4YDVB 1TNMA 1IARB 4LSTL 3FO1B 4N0FA 1BD2E 4MX7A 5GSRB 4E5XB 2EIZA 2MTPA 3QPQD 1MAML 2DDQL 4UINH 2F54B 4MB3A 2EDYA 1ZKAA 3ZYOA 4DUXA 4RGMC 5CKAA 3MUY1 8CGTA 1G1YA 4F58H 4QHNA 4XPAH 1VA9A 5CIPH 5D5MF 3SGEI 4AL8H 4CMHC 1WWCA 3O6MH 1QRNB 5C0EA 3CVIL 3ARBA 3HE7D 3OZ9H 4BZ1H 1R5WB 1RZGB 2DQEH 3S37X 5CSZA 5AAMA 2NMSA 4JLRB 3W2DH 4WHCA 3MLUL 3WFEL 4HIHA 5FCUH 3RHWK 4PJEB 5A16B 3VXUE 4E41D 2WNGA 2VLJD 2WWMD 2O5XH 3ARED 3OKEB 3C6SB 1FFQA 5ADOL 3M17B 1LEGA 3INUH 3EYUH 4LLWB 4ACPA 3DVFA 5DVNA 3QNZA 5K9JL 1F4HA 2PCPA 3SBWC 4AJ0A 5DJ8B 4LDLB 4WUUD 3H3BC 4AIZA 1TZGH 3VE0A 1YNLH 4NZUH 2R2HB 4WWKC 3L3JB 4AIOA 2WUCL 2PTVA 3MRDA 2HJKB 3IETA 2XN9B 1AGFB 1F6AB 2H6PB 4Z8FH 3LQZA 5M94B 3IDNB 1LEGB 1OCWH 3PQYD 1P4BL 3PUCA 3PNWB 3RWDA 2IAMD 5J1AA 3MUGA 2V2TB 5GS0L 3QUXC 5GGRA 4LKXA 1N5YH 5FOBA 2G2RA 4DGIL 1WC7B 2BK8A 1XCTB 3N1QC 5IB5A 1NANI 1CTNA 3WIFB 3GBMH 1FNAA 5CKGA 1RFDL 2BFVH 1VEPA 3QEUA 4F80A 4RAUA 2ED7A 2I26N 2J8UE 1ACYL 3RDTA 4YC2C 1FFPA 5D7SH 4UV4H 5CAYB 4X6BA 1XGQA 2VDKL 1WFTA 4PJ8D 1J18A 3UJTL 1XF3B 3PABA 1BVLA 1J1PH 5EG6C 1WVZA 5IMOA 1FFOB 2BXYA 2GHWB 1CD0A 4ORZC 3WNMA 2DTSA 3QG6A 4U1NA 5E6IC 3WFZA 3IDGA 3DSFH 5E1AA 3PHOB 5DMYA 1MRFH 4NPYA 2KZWA 3Q2CA 4KQ4L 4Y5YB 1QFOA 3V6FB 2I5YH 4MLIA 3QAZB 2IMMA 3FL7A 5IQ7L 2AJ3B 2ZCLL 1YPZF 5EA0L 5KTEL 4KFZC 5EZOH 1M6OA 4HDIA 5FKAA 4BH8B 3RDTB 2M1KA 1B0RB 5B38G 1MIEL 2XZAL 4L3EE 1IQDA 4OF5A 1NGQL 2JCCF 5JDSB 4MA1B 5BRZB 5F7DA 2DJ4A 5EO9A 4HFUH 1QFWH 4LDOB 3B8SA 4ZFGL 4DCQB 3UZVB 3QRGL 2H26B 4NGHL 4U1NB 2JJTA 2YA1A 4JFEE 1OM3H 1DQJA 3DPBA 5D7JA 3S37L 4ZTPL 1F2XK 1KENH 4XWOD 5J11B 1BD2D 3MV8A 3ALXA 1DEEB 2VDML 1A7NL 2QSVA 5E8NA 4PJEF 3C5ZC 4XTRD 5TDPB 2MCPL 1AQDA 2FHBA 1QD0A 4OZFH 1HNFA 1K2DA 4XPFH 1P6FA 3BESR 3LN4B 1WBZB 3OR7B 3SDDB 4KK8C 1P5VA 4XP5L 1I9IL 3QO0A 25C8H 2XY2A 3EW3B 3DX9B 1UFUA 3UYRH 4K7PX 5D7JB 5HHPA 5JHLH 4U1MB 4WUKL 2W0FB 2VZUA 4NJAH 3B5TA 3ZDXF 3WN5A 2X4PA 5F96H 1XGUB 4LCCB 5GHWH 1RJZA 4YHPA 4IRJC 4G5ZH 2X4SB 1IT9H 2R0KL 2MQ0A 3UPCA 3ILQD 1AQDB 1IGIL 3NAAH 5L2JB 2D9QB 3RGVC 2GCYB 4XNZB 4KXZH 4XP9H 2X7LB 4C56E 1U8NA 3GJFK 2PTTA 3JWNC 3S3JA 1OSPH 4XMLH 1L7TL 5I76B 3T0AA 1A02N 3K4DA 3HI5L 4R2GC 1MRDH 3P77A 2GSIA 4W70A 1AC6A 4IS6A 4ZFOL 5HHPB 5I15L 3IXAA 1MVUA 3QUXD 4QXGL 1DSFL 3OKNA 5I1AA 4ISVB 1TXKA 4JRXE 4NO0B 4RGND 3X3GL 4P2RE 4NP4H 4R7DA 4P4KA 5E56A 4CJ0A 3ULVE 4XWGL 4NO2A 4F33A 3IDJB 3NACL 5KSVA 4Z7VA 3TZVC 2HFGL 2LQRA 5JQ6L 3NA4A 4Y1AE 5CEXB 2P5WA 2YWZA 5JUEL 5I16B 5FGSA 3GSQB 1BLNA 4HUNB 5DZLA 4D0DB 5D70H 5ID1A 5IKCB 5I76A 3ZKMD 5ENWA 4ZMAT 3MXVH 3STLA 3TPKA 1NC2D 4LK4A 1JNNL 4YGVA 4NC1C 1NCNA 4WFGE 3KWWB 2HT2D 3H9YA 3B9KB 1D5XB 4R96B 3IDJA 2YK1H 3QAZC 3VXNA 3TESA 2YSSB 4BK5A 1AHWA 2HTKC 5IB2A 1A1NB 4I0CC 4MNGE 3B3IB 3T65B 4O02H 3F7RA 1FDLH 4EJ1C 1UCBH 2X4NA 3FOMB 3VXMA 5E5UB 1T1YB 5MENA 3HPLB 4L9DA 2ESVA 2IGFL 1KBGL 2B1AH 5BS0A 3ELAT 3QEGL 4ZSOE 1WLHA 3FHAA 1T1ZA 1UACH 4YPJA 1FG2A 4QRQB 1YUHB 2QQKH 3WFBH 3GUTA 1A0QH 2Z31C 2J6EA 5FM5M 5HYJB 3HC4H 3L3KA 3TNNB 2FX7L 3IFNL 2BVTA 1JYVA 1KLFA 4UDUB 1JFQL 4R2GD 5F1OB 5CSBA 3QPQC 4S10A 5DD3H 4EVNB 3MV9D 1W72B 3DETC 1E6JL 1NBZA 1GL4B 4YO0A 1D3CA 1PAMA 3E2HC 4ZFFB 4ZTOL 1H15A 5DD0H 5KOMC 2Q87A 5F7HA 4QRUB 1SHMA 4F7EA 3EFDH 4IIQA 1RU9L 4LF3B 3ET9F 1RIVH 1EO8H 3CVIH 3OZ9L 1TQBC 3PE9A 4LVEA 4RFNB 5ANMA 3S8WA 4XMPL 3TO4D 5BVPL 5C6WH 2BC4A 3HG1D 4XVSL 3RIAK 1R3IL 4KDTA 4BZ2L 3W2DL 1QNZH 3BP7A 1AE6L 3MREA 4MJ6A 4U6HB 5EH1A 4TPRH 4HLZG 5E8DH 4XNYL 4WRLA 4MCZA 1JPFB 1L6XA 1RULH 4XPGH 2COQA 5BW7A 3VI4F 5E7FA 3FMGH 4U1LA 2Z93B 2P5WE 4P5MB 2HFEB 1FAIL 4KKBD 3LHPH 4XWGH 3NIGF 3P73B 4CN6A 4Z7WB 4KHTL 4LAQL 5C1MB 3GHBH 4N8CH 5JQ6H 4H1LA 5ICYB 2BJML 3DXAB 3N0PB 3EDEA 4NRXB 5E08L 4Q9QH 3QQ3A 3ZDZE 5SWZA 1ORSA 4LVOC 4N5EC 4GRWE 1GGBL 4UT6H 3IFLL 2R2CA 1HH9A 1U9KA 2FR4B 3OBAA 3QG7H 5I6XB 4JG0L 2VLRD 4U1HB 4R9HA 3TZVB 4M1CD 3B9EA 1ZSDB 2V6HA 4U3XA 1H3PH 1QSEA 5D7IF 3D39D 4IM8A 3QCVL 3Q3GA 1YMHA 2BDNL 2A6JB 3RVWC 3ZKQD 1NCTA 1YYML 1UVQA 4I3GA 5C2BH 1QBMH 1CGSH 1Z9OA 5ICYA 3NIDE 3TNMB 3PWLB 4JZNB 4PJ7B 4PJ8C 2IPUK 2R39A 5DJDA 1KBGH 1EBPA 1S5HB 2B1AL 4GKNA 5KG9B 1QOKA 2FJFA 4TULL 5E94B 1EFXA 2EYSA 4UTBL 5FV1L 2IFGA 4CMMA 1QO3A 1MWAL 5KN5B 4LCYA 1CU4H 2VR4A 1LQSR 4P3CH 5FO8B 1UVQB 4YHZH 2OR7A 3VGAB 1B88A 3S4SA 1VENA 1PG7H 2E9IA 3NCMA 1A2YA 3UO1L 3QBTB 3O6FD 4ELKB 3PWLA 3BKCH 1IC4L 2OR9L 4MD5B 2CKBH 2E27L 3WLWC 4YX2L 4ZTOH 1C12A 3EZJB 2NQCA 1X4YA 4J8RB 1MCIA 3VH8A 4K71C 4LLWA 2ZG2A 4LHUG 4L4JA 5KN5A 3K8MA 3LKOB 3IRPX 2GFBA 1MCPH 2A77L 4FA8A 1KCLA 3ULSB 1VFOA 1F4WH 3NIFE 5ACLA 5T1LB 2NY6C 1T7VA 4QOKD 1JMXA 3IJYB 3D0LB 5BVPH 3BP6A 2VDMH 1P84J 5ESVB 5IROA 2N1KA 2NY2D 1ONQA 2JIXD 3OAYH 3K8KA 4GJTB 2NY4B 1MNUL 1T80A 3BEWB 5T3XE 2ICEA 5EZJB 4X5WA 2WV3A 2OZ4L 5DI8A 4HX1B 4XNYH 2Q8BL 2IQAB 4KQ3H 4P2RA 3TT1H 1IC5L 3MV7E 3QUZB 5FK9B 3ZKNC 4PRPA 3LKOA 1A8JH 1AR2A 2N7BA 3MLZH 1EIBA 4AT6B 1D9KB 5IB1B 1FL5B 2ITCA 3TCLA 4YGAB 1DVFA 3ULVL 4MA7L 4PLNC 2ZUWA 3NFSL 4NUJB 1WFOA 1HDMB 4WEUD 2QADB 4S1QL 1IT9L 3BEWA 4YHLL 2ITDB 1DDHA 3OPZL 5T1LD 3WXWL 1NFKA 2DLTA 5ITFB 3MRQB 4GAGH 1UQSA 4Y16C 1A1OA 2VZ3A 1NLDH 3SCMB 1ZVYA 3RVXC 1ZA3A 2EXYD 1PZ5A 4NCDA 3QCVH 5JPNB 2YUVA 3KYAA 4W4OA 3BRGC 3G5VA 3A6OA 2CUMA 4XMKL 4PJDE 2Y6SD 4PJBE 3MRRB 5FXCH 4U05A 3MV8E 4RWHA 2FHFA 4EXKA 3UPRB 4YE4L 3TYFB 1DFBH 4U0RB 1OVZA 4LRNL 3HUJB 3VXPB 5D1ZD 2E8ZA 1DLHA 5GSVB 3R1GH 5DUPL 4IMKC 4L8DA 4K94H 1N5AA 1MY7A 2NZ9C 3O6FA 3AAZB 3VD4A 4JQIL 4C56B 4I9WD 4PP2A 1OTTC 3V5KA 4OCYL 1VFMA 1OGAD 4O2FA 4U3CA 2HVJA 3RTQC 2AS5M 1TVDA 1CXHA 1RQ5A 4OI8A 1WJ3A 2H26A 2X44D 2E6JA 3ARFC 4X0KA 4HKZA 1NUDA 1KIPA 1QLRB 1UXWB 3BXNB 4JRXB 2XZZA 3VFUB 2HKHL 3UPRA 3AREB 5I19H 1T5XA 3BVNA 5F7YC 4MGXA 2YXFA 1D5BA 5BZDA 4JG1H 1FAKT 3QUMH 5CINH 5I30L 5CWSA 2V9QA 4L8DB 1EHLH 1IKNC 4EUPG 1Q0YL 4MD4B 5DA0B 1ZOXA 1E4KC 3FQNA 1ZHKB 1MRFL 3DROB 5D1QD 4FQPA 1ZHBA 2V5YA 4TVPD 4YXLL 5BMFL 3TVMC 1JWSB 1VB9A 2H32A 1KIPB 1QLRA 2RQ8A 3F8UB 2GK2A 4JRXA 2FYYA 3TVMD 4RMWA 4OZHB 1EO5A 5CP3A 1NFDF 2D03L 1D6EA 1NMAL 3FJTA 1GGIH 2V9TA 3GMNA 4NKOB 3EBAA 3BQUA 3FAXA 3Q6FB 5F9WB 2JF1A 5KS9F 2WBJA 1ZHKA 2AXJA 3FB8B 4NNXB 5KVMC 2VLKD 4ZAKC 1OT2A 2HP4A 3O2WL 2X7LA 5FB8A 3PWVB 1BOYA 2PTTB 3VMOA 5GGSY 2A6DA 4DW2L 1ZT1A 3T77A 4QXUL 2FYYB 2FBJH 2WLYA 4LVOB 3LVEA 2P45B 1Z5LA 1U95A 1KLGA 1WBXB 1MOEA 5IQ9A 3VDBA 2YEZB 4XBGB 4I2XE 3P4MB 4G6JH 5FOJA 5JLZB 5EU7E 4YHLH 2UWEB 1OAXH 4JPWL 3B83A 4R4ND 4GG8A 4GMTL 4KHXH 3SE4C 3SE4A 3HTLX 4G9FB 5F96L 4ZSOA 4D0DA 3BZDA 4PBXA 3T77B 3I6LE 5D4QA 2R0KH 1ZMYA 4GRMA 2AEPL 5DHYA 2C4XA 3O2VH 3MBEC 1EEZA 3MLWL 3OKKA 1RIUH 4LIQE 5J4MA 1J9CT 1FAIH 1YEGL 4V1DD 5B4MC 4HIJA 2JLLA 4XNMA 3U6RA 3WIHH 2R9HC 3HS0B 4WHDA 4QKXB 3BIKA 1A1NA 1R5IB 3B3IA 3QT2A 2FEDC 2DM7A 1CICA 4RIRB 2DQIL 2R56H 3H7BA 4G9FA 3SO3C 4TSAH 5K9OB 1RAMA 3CMOL 3F58L 1IQWL 1SY6A 3FKUS 1FVDB 5I1EL 5A3ID 3MFGB 3EO9H 3FO9B 4JQXA 3MV01 4GRMB 5D1QA 5DHYB 4D0CB 5C0GB 3NZ8A 2WUCH 1IAOA 3RZWA 2MOVA 4L8SB 5HHVH 5ADPH 4JB9L 3DX7B 4NFCA 3S36X 2NY0D 3L3KB 3SE8L 1TQBB 5D1ZC 3HS0A 3BPNC 5F7UA 2X4OB 3BE1H 2NY3B 3S3SA 3QRFM 4I9WE 1FZOB 2V7NB 5HGHA 1GVIA 3CVHL 3WFCL 1IL1B 5LG1A 4CAGA 3H7BB 2P24A 1W72A 3GSVA 3DLQR 1AGDA 1T0MA 2Y7QB 1F8TL 1NBZB 4BFEA 4YO0B 1W8NA 4LVNB 5TQ0H 1KOAA 3MRJA 3NZ8B 1A3LL 4A6YL 1ORQA 4HPYL 5C09D 3KPMB 1JGEA 5J1SC 2YC1A 1KULA 2W59A 2Z8WC 2HTLC 3DGGA 3HZKB 2NXYD 1CWVA 1TZIA 4P23D 5BS0E 1MJ7L 1R24B 1N4XH 2E7LA 3BPNB 4HWZA 4NNYA 2CUHA 3UTZB 1K8IA 3DNKA 3LIZL 3TJEH 2CIKA 1JN6A 1T2QL 4P46B 4OJFH 1D5IL 4X8JA 4UV7H 4JCMA 4LEOA 4PY8J 4YUEL 3T1FB 5GJTL 1MFAH 2EICA 3OXRA 4NO0D 4GG6F 1PD6A 2APTA 4HUWB 1HHHA 4L4TA 1FO0A 3MLXL 1M7XA 1I1CA 5F7LB 3MLYH 4DTGL 4GRLB 5T3ZD 3DXAD 1EAPA 2YC1B 2X4UB 1MF2L 3TO4B 3E3QC 1T6VN 2XICA 3C5SA 3G08A 2DTML 4JCLA 4Z7NE 1N7MH 2P49B 2IANA 5B39B 3WIHA 3EDJA 3EJYC 4GRWH 2NY2C 3P73A 3RNQB 3ARQA 3V8OA 4U49A 1U8OA 3W0WE 1GZPB 4HZLB 3I2CL 1AO7D 3WUWB 1HHKA 3B6SA 4MXVF 4BUHA 2H9GA 2R4SL 4FTVD 4HIIA 5EPMA 3QUZD 4PJBA 5LAXA 2FHCA 3C8DA 4XMPH 5JXAH 5IFHH 1JRHI 3MSPA 4JAMB 4CVWA 3IXTB 4CU8A 4JDZA 1YYLL 1NBVH 4QCIA 1MPAH 1UJ3C 5TPWL 1AE6H 3DVNA 3MRGB 1EGJH 1PLGL 4ZUSA 4PTTA 1J8HD 3KPRA 4BJLA 2FJGA 3VD7A 4DVBA 1QLFB 3S3PA 1MLCB 2F15A 3SGKC 3HRPA 5MI0C 4ODHH 4IRSA 3PGFH 1DBJH 3GHEL 2G5BA 1S8DA 2NCMA 1KTKE 3DYMA 2IH3A 4E0RB 4JHAH 1QR1B 1JL8A 2DJSA 3GSNH 3T4YB 4KV5F 4X80L 1INEL 5HVGB 3WFHB 5E9DD 3FQXB 5KS9B 4G5ZL 2AK4D 4M7JL 1F6LL 2IAMB 1T03H 3HCVB 2XIDA 4BK4A 1IGIH 3MRBA 3FQUB 2AJYL 1VACA 4O2EA 4PJHA 4I18B 3O9WA 4JHZA 1A2YB 1QR4A 4ODVL 3QPXL 3ECBB 5D7JC 3WE6B 2F5BH 1G7IB 1F8TH 5ID0B 1U8MB 1LO0H 5FGBC 3VFWA 1HINH 3CFKA 3G6JF 1HZHH 3GNML 2ARWA 1FRGL 3SGJC 4WHYH 1A3LH 4HPYH 3T0EA 3VH8B 5J0BA 5FYKU 5HDBF 5B21A 3RWGA 2YKLH 3LPFA 5GIRB 3MTRA 2P5EA 4Z7UB 2FCBA 2ORBL 1M71B 2JJTC 3EYSL 4HKJA 4I18C 1FVEB 3H8NA 4I18A 1KT2B 4XBEH 5LJYH 4KJYB 3RVTC 1E27A 1T7WA 4JKPH 3KLAB 1FN4B 3R8BB 4L3CA 1WZKA 3WE6A 4IOIA 5M95B 3CFIC 5I18H 3SY0B 3DRTA 5EZJA 1TCRA 3CFKB 4HBQA 3IVKA 3UAJD 5DF0A 3VFSA 5FUZL 4PV9A 1RJLB 3KYOA 4F9PA 1EZVY 4ZYKA 4XPHH 1YMMD 5IMMA 5D8JL 5T1MA 3T2NH 3QUZA 5KSUB 2CDGB 4OV5A 1RVFH 1RD6A 1MFBH 2XYCA 5BV7B 3T2PA 5HYEA 1OF2A 5H37G 3MRCA 3WO4C 1P7KA 2AXFA 2F8OA 2UVEA 1GGIL 1MI5B 3QEGH 1INQA 1HDMA 2Z8VC 4NFBA 4ZUUB 1CFQB 5ETUA 4KKLC 3W11D 5KSBA 3R0NA 2V2WB 3O6ML 5DRNA 1BVKA 4U6VH 1BJ8A 3C60B 4JY4B 1HILA 5E2UH 1N64H 4R90L 5GRUL 2AEQH 4AG4H 3VXTB 2CDEB 2LABA 3SOBL 4G8GD 1G6RH 1S9XB 2GTWB 1B6DA 5IT2L 4YC2B 1ZT7A 2OTWA 5I8KH 4YEEA 1T6WA 1FL6B 1PLGH 3IRZA 3P0VH 4TUKH 2A6IB 2WAHA 5I8OL 5D2LF 3T8XA 2AXFB 5IVXB 4LSQL 2YBRA 1IC5H 1QRKA 4LU5H 1W0VB 2X70B 3VXPA 3UTQB 1CFQA 5ETUB 5KSBB 3O8XA 5GSVA 2NZIA 3GHEH 4RA3A 1EBAA 1HH6B 4Y5XC 4FZ8H 1RZJL 2DMBA 4JFOB 4IDLA 5AYUL 2V2XB 2VQUA 5T3XD 1CBVL 3M1BA 1Q38A 5F93C 3WNLA 5HGBA 2YA0A 3MRFB 5L7XH 1H8NA 2HVJB 4LOUD 4WI5A 4U2YA 3MA9L 5TFSH 2Z35A 1V7NL 3HAEH 2FH8A 5IW6A 1LE9A 2BY1A 2F54D 3BXNA 1OY3B 1I1YB 2Z91A 4Y4FD 3ULUF 2PNDA 4EI5D 3BIBX 4O58L 3MLVH 3HLAB 1G7JB 3MCG1 3PIQA 1V5JA 3QDGE 3AM8C 4K7PH 2GW5A 4JFXB 1T2XA 1A1MB 4CVZB 1BJ1H 1KXTB 1B4JH 5D1XD 4QY8B 3VFPA 3ZKXB 4XC3L 5CEYB 1CGXA 5D6CA 1DBKH 3HNTL 5JW4Q 3RWIA 3HAEB 5EIQA 4X7TA 1U3HC 1UZ6E 2VAAB 3SE3A 1LE9B 4Z78B 4OGXL 4ERSL 5KVEH 2BVEA 3BMVA 4GBXA 3C9NA 4JLRA 5FYKL 1IM9D 1T22B 4PLOB 3ARGA 1PY9A 3B9KD 5JOFA 3K0WA 2N7AA 1OGTB 1UYWH 3I6GA 5EFIB 2D7PA 1FZKB 3CFDA 5IFAL 3I75B 2PCPB 4ONGH 4WO4A 2NY3C 2WP3O 1AFVH 5JW5B 2AKRA 1I1FB 3W81A 2GAZA 2YOCA 5EZOL 2XFXB 4K7FA 5LGHH 4HGMA 3P11H 4K07A 4GBXB 5HD8D 2OTPA 3E2HB 1AR1D 4H0HB 4WFHE 1MCOH 1BX2A 2NTSP 3DMMD 1T1WA 1OAYH 1IGML 1TITA 1WBXA 4UB0L 5ALBL 3QUZC 4NO3B 2R0ZH 3ES6A 1BGXL 4TN9A 2SEBB 4JFYA 4QRSB 3RL1A 5FM5O 1HEZA 3FFCB 5FHBL 4JPKL 3B2VL 3IDUA 4I3RL 5IG7A 2ATPB 2QSCL 4N5ED 4S2SB 1P2CB 3U79A 2XFXA 2CRYA 4CW1A 4JFEB 3JXAA 4UQ2B 3GMRA 2F74B 4XP6H 3ARDA 3KDMB 1IKFL 2NY6B 4PJ8B 3VA2C 5L8LB 1U58B 4XPFL 4RAUB 2IALA 3QDHA 1GCFA 2Y36H 5HYSA 1X5IA 1C08A 1I9IH 4K8RH 3BKYH 5FF6A 1ODAA 4QXUH 3SDAD 4MA8H 3BIKB 1F11A 3H9SE 1R5IA 2DMCA 3LEYL 5FCSH 5IGXL 2DQTH 2AI0H 3IKKA 1FORH 1HN1A 3L5HA 3QZWG 4CW1B 1FVDA 1X4ZA 4RGNB 5EU6D 1I4FA 2R2BB 2EC9U 1FO0L 1N0XH 2X42A 3QDGA 3ARDB 2OQJA 4KI5D 3V6FA 4YXHH 4I0PD 1UG9A 4R8WH 3VXMD 4MAYD 3G6AB 3M45A 3RX8A 1QUNA 1IAOB 2EC8A 3L3GB 4F7CA 1EGJL 3DYOA 4APQC 1TTFA 5FKAB 3DX7A 2CK0L 4HW6A 3LMJL 5EO0B 5T1DL 1JYWA 4XP1L 5LXGL 2J12B 3CFEB 5FFLA 4M1GL 4OM1L 5E99H 3MCLH 4YHNA 2BSTB 2V7NA 4MYWB 4ODHL 2E8YA 4Y5VA 4U1JB 2QQLH 4WNQA 5ECJE 4ZS6C 2XZQL 4OF7A 3L1OH 4MA7H 1JK8B 5TGBB 1WBYA 3NACH 5DTFA 1BIHA 4R7NA 1YNLL 4NZUL 1G7QB 4S1QH 4BUGA 3ROOB 4QT5A 4WIQA 1BIIA 3RDTD 3KVQA 4KXZI 1GHFH 1NUFA 1X5AA 2AJZB 2VLRB 4JVWA 4L8BB 3F7YA 3O45A 1M7DA 3RWJA 4YHNB 3EYQD 4MA1C 1RUPH 5FM8A 1YNTA 3CX5J 5GS0H 3D2UD 5FDYA 4P9ML 4F15C 1F3JB 4X8JB 2UZYB 2XWBA 2E5EA 3V79C 3WIIL 2QQQA 4LCWB 2ZSWA 1W0WB 4FS0A 3RJQB 3GJEB 2KDGA 4OI7A 1CL7L 1XGUA 1JV5B 4PLKD 3HMXL 3FN0L 2BSSB 4PG9A 3O3EB 3GSOA 3BFOA 3L3OB 4MNGB 3X11B 3RWCB 1YNTB 1U8NB 2XQYK 1SYVB 3JWOH 1VSCA 4FFVD 1HHKB 5L8JB 4OQ1A 1QFPA 5C0ND 4AMKL 1I7RA 1S7TA 2W9DL 4KQ4H 1MVUB 3ZE0E 1HXYA 3A0OA 5HHXH 2J88L 5JXEC 5FO7B 5J6GB 2OI9B 4Q9RH 4XNXL 4BQ6A 4X7SH 4X6CF 3VWKC 1RZ8A 4N90D 1N2RB 5GISH 3V0WL 1Q9LA 3RA7L 4UOW0 4LNRA 5D7LB 2DBJA 4LSDA 1LO2H 3BPCB 1AO7B 5I8CA 3CFCH 2BVUA 3K1KC 5T3ZE 1QFWL 1LMKA 1D9KC 4JN1H 5ID1B 4HHAA 1CFTA 1U93B 1JWMA 4ZNEA 1PG7X 4YFLF 4WGVB 3WD5H 1U0QA 1QR1A 3JTTB 1XF1A 1M4KA 1RZ8B 1R3IH 5FYLD 1IGYA 5KS9A 3T0DA 2A6KA 1YEFL 1KELL 1XZ0A 5JHDE 4C54A 3CC5B 1AO7A 2F9BT 3V6BR 2Q86B 3KYKL 5M7QA 4XPGL 3DHJA 2Y07L 1GIGH 1CQYA 1R3JA 4JFED 3QISA 4X6DB 3TV3H 2ADGA 5FUOL 3UBXG 3D25B 5CCKH 1KNOB 4PJCA 2OTUA 2VXVL 1F4YL 2EYTA 4R6UA 1A6AA 2AXGA 5L88H 3UYRL 3U7AA 1LVEA 1H5BC 2I9TB 2AJUL 1YECL 2YUZA 3TEUA 3JTTA 3LEXB 3ZE1F 6FABH 1JHKL 1YPZA 5HHOB 3H42L 3OJVC 2DD8L 1GC1C 2GJ6A 3T0EB 5JNYA 3REVB 2QJDA 3TYGL 2JJSC 5ANME 5TFSL 1MH5B 5AWNH 3DECA 5HHNA 2OLDA 3VXSE 3TF7C 1K5NA 4X6DA 3T08A 3ARYA 3U7WL 1E27B 3IDIB 1L7TH 3KLAA 5FHAL 4P23C 2AEPH 4Z8FL 1A7RH 1RJYA 3TBYA 4N8VB 1VGEH 4OCMC 4JANA 3O6LL 3T3PE 2EIBA 3LEXA 3AY4A 4YBLC 4WV1B 4P5TA 4LSPH 4XCYB 2JTDA 1J0HA 1S7QA 3QDME 1RJLA 3MLTB 2HH0H 4JJ5A 4WCYH 4FQLL 1RUML 4C57C 4APQB 4OZFG 2F5BL 4ERSH 5KVEL 1GGCH 4U0QB 1LO5B 1FRGH 4X9FA 5I1EH 4XAKD 4Z7QE 2ZG3A 4UTBH 5IW1B 1MI5A 2NW3B 3JWOL 3MXVL 2DQUL 2EH8L 1C5BH 4PRPE 3HR5A 3QNXB 4X6FA 1JPFA 3V6ZA 3FB7B 4MA3B 2DLFL 1HHJA 5DRNB 4TUJB 1MJUH 1QSVA 1RZFL 2NXZD 4HUVA 3ARUA 4OCRL 4I77H 3MUJA 2B5IC 3EFFB 5EORL 4MXVE 1U8QB 1FNSH 1OB1B 3G04A 3C60C 3P0YL 4PRNA 5DMJB 1HQ4A 5T3ZH 1G9NH 3SDXB 4TQEL 3TJHC 2IGFH 1WZ1L 3V7AE 3VI4E 5L2KD 4UB0H 3ZLQC 1QA9B 2HFTA 5ALBH 4I5BA 4X9HA 5DD6A 1P9MA 3D39B 4WI4A 1FC2D 5ERWB 4NQXB 1CD9B 1ZSDA 4J23A 4F3FB 4OD2A 4QWWC 1QSEB 1S7VA 3NCYP 5GJSL 5F9JB 4MCYB 4OLVL 1IAIM 2NY6D 2JKXA 1BM3L 4QHNB 2X40A 1YMHB 3RL2B 2VQTA 2WUBH 2W9EH 2R4RH 3GSNA 3WDHA 1QRNA 2HFFB 4RRPG 5DRXB 4DAGH 1FGVL 1L7IL 5A40E 5J3HD 4M7KL 1S78C 1MCJA 5KW9L 4LSRL 4P2OC 3NOIA 5E2JA 1IGFL 3WBDA 3TV3L 3RTQB 4EDXB 1RK1A 3VWJA 3QO1A 2ARJA 3FQWA 1G7LA 4H5SA 4JFXA 2ED8A 1CXIA 1U8PA 5T5FH 3UTTA 1T1XA 2G5RA 2VLKE 1EFXB 3OKDB 3M17A 3FN3A 3FAWA 4HPOH 4U1SA 3TPUB 2L7JA 3A6BL 4XP5H 4OLEA 4R3SB 5T1KB 2JJSA 1CFNA 4YXHL 1J05B 1CIUA 4LRIC 1JCKA 2WWMC 3O0RL 1H5BB 4DOHE 5FKPB 4LSVL 3BZFA 5J9PB 2R4SH 4WWKB 4E5XA 3MRDB 1CDUA 1PJ9A 3EYVB 5D1XC 4UBDD 4H5SB 4BZ1L 4XP4H 2B5IB 3LCYA 4OZFB 1VGEL 3IDNA 5DS8B 4Z0BL 1MVFA 3IU3A 3LB6D 2X1WL 4YDKL 2VLJE 1FG9C 3D87B 3L1OL 2DM2A 1UH4A 1JRHH 2JK5B 5I8EB 5DQJA 4N8VG 4MAUH 1JZ3A 5I71C 4QEGA 4KMTH 4LAJH 2DQGH 4FG6D 3BZFB 5J9PA 2VDLH 1XCQB 5ESVA 1XGYH 1ULVA 1X6LA 1T1WB 1K4CA 1BPVA 5FO9B 3RI5K 3H9SA 5C0CD 7FABL 4HGKC 4LCWD 1CD1B 1HSAB 2KQNA 4Z7WF 3WXVH 4ZUWB 4G7YH 4S1DD 1Q72H 4PJXF 4GBXD 4NQED 1HKLL 1J8HE 3CNKA 3TN0A 4D9QD 2X05A 5KVGL 1J1OL 4ZD3H 1P5UA 1FNSL 1A5FH 3CUPA 3GMRB 3ARGD 4M6MH 2CDFB 4IRZH 3QPXH 4UIKL 5ESQA 3O6KL 5F97E 3TBVA 2Z31A 4TQEH 4LCUB 1EJOH 4WI3A 4XB7A 3VJ6A 2D0GA 3FT4A 1F6AA 5FO9A 4OF6A 1M6OB 4X98B 1S7XB 3ARXA 3FT3A 2VH5H 4Y19B 1HSAA 5DXWA 3UTSE 2YD4A 1CFSB 5JPNA 3DURA 4FXKA 1T2JA 3UTPD 4PJ7E 1TVBA 1IFHL 3RJDA 2QHRH 2XQBL 2QR0A 3UTTE 3LH2L 4CU6A 1WEJH 3KLDA 3ZZ1A 1HXMB 3VFGL 3OGCA 2VMFA 1IGFH 1A6WH 4H88L 1ZVHA 3QJHA 3U9UB 2WANA 3SDCD 4KUCD 3ARFD 2ZCLH 2EE3A 3THML 5D8JH 3V5KB 3BO8B 2BSTA 3T2NL 4X8XA 2D7OA 4PJCF 4FNLH 3ULUE 1B2WH 3HG1E 4Y5VB 4GMSL 2E6PA 4RWYL 4OZGF 1IJ9A 1JTOA 3BGFC 1MUJA 5SWQB 1CT8B 1JK8A 2FZ3B 3BKYL 4HFUL 5E2WL 2FD6H 2MJWA 1OAXL 4JPWH 1J0JA 1FGNH 5CLWA 1SY6L 3S97C 2VKWA 3LS5H 5K9QG 3RAJH 1JNHA 2DQTL 3QDJB 3U36A 4GKZA 1OARL 2OL3H 5HYFA 1MCHA 4NNPH 4XBPA 5AYQA 4MD4A 1NCBH 2L4OA 4EUPH 3BYTA 1UZ6F 2AEQL 4PJHF 5D7JD 1IQDB 2Y9RT 5I17A 2HLAB 1DQML 2VXVH 3KPOA 1CXFA 1KCRH 4Z95L 5JA9A 4KY1L 2D4FA 2HTKD 4JPVH 1EHXA 2AJUH 3BRFA 1ETZA 5JPMB 1KIQB 1KB5B 1NLBL 4LCWA 5CUSH 5CJXA 1NGXA 5LXGH 4P46C 3L5IA 5FGBA 3C5JA 1JNHB 4MJ4A 1I8IA 1WF5A 3FONA 1X5YA 2GUOB 1JV5A 4EI6A 3C6LD 4F33B 4M6OL 2BNQE 2WBJB 2FGWL 5GGVH 1C1EH 2AERT 2P5WB 1MIMH 3QEQB 4WDIA 4K3EH 3PWVA 4ZO9A 5HI3C 3U4BH 3U82B 2BNRA 4PJXB 1HKLH 4QWWD 1JI1A 2PETA 2XN9E 3KAAA 3FTGA 3STLB 4MDJB 5GS2H 1A4JB 3BE1L 4JFFA 5KS9E 2X4PB 3GFUA 5IHZB 2DJUA 2BNUA 5LWYL 3W39B 2ZG1A 1JNJA 2X4SA 4NQVB 2EDNA 5DFTA 4RGNE 5FYJD 3F5WA 4ORGB 2X9YA 5GZOC 2VLLA 1OTTD 1NFDB 3QQ4B 4X9GA 5IB4B 1F4AA 1IM9B 4RQQA 1HHIA 2NXZC 1G9NC 4OGXH 5IJVB 3WNOA 2GSIB 1RUKH 4M8VA 4OBSA 2RCSL 4OT1H 1BQLH 1R0AH 1JPTL 1FL3B 1RUAL 4NRYA 4E41E 5L0QB 3HFML 3SN6N 1VFBB 4M5YH 2X1QA 4LVHB 2RR3A 1YEHL 3JBG7 1NDGA 2Z4QA 2GQHA 3HHRB 1S7UB 3MODL 2R2EA 5B8CC 1JVKA 1NJ9B 1AP2A 2IG2L 5KSAC 3LOWA 4K94C 1CGWA 1KJMA 5D6DA 1MWAB 4WEMB 3MA7B 4QNPF 2X4QB 1R3JB 4Y7MA 2OXHA 4WUUA 1MF2H 3U4AA 2AABL 1WT5C 2OR9H 1NCAH 3D25A 3EO1A 1A6VH 3ULVC 4O02L 2AXGB 4JN2B 5EO1B 43CAA 3O9WD 1HKFA 2MQ3A 3N06B 2FIKA 1MCWM 5IV2A 4P4RA 2IPUG 2P46B 3JTSB 1OAYL 1C5DB 1ZHLB 3GMLA 3BD3A 1QBLH 2GJ6B 2HA1A 4Y19D 1CE1H 1LNUA 1KN2L 2YRPA 2EDEA 1XH3B 5HYSG 5HHNB 2BC4B 1IGTA 3C87A 3L6FA 4ZDHA 4IMKA 1SJXA 1C5CL 3C6LA 3LKSB 2PW1A 4LLQB 1JE6A 1L9NA 3HPLA 1CICC 3D39E 3BI9X 2R29H 3HB3C 3U2SB 2O93L 4I48A 1KYOJ 1WZLA 1ORQB 3EZ8A 4M5ZH 3V4PH 2YZ8A 4QRQA 3BD4A 1KB9J 1H3XA 4BM7A 4V2CB 5DJYB 1TZIB 2ZKHL 1MJ8L 4JJ5B 1LNUB 5E8EA 5DLML 3I50L 3PGDA 5J12B 5E5MA 5MEQB 2NXZB 43C9B 1D5MB 2ZUXA 3LKSA 4NUGL 2DN7A 5E8OB 1FPTH 1MIML 2VIRA 1EMTL 3UJIH 1WAAF 1RIHH 2OXGA 4YDLB 1XMWA 5B22A 1EGJA 1QNZL 5AWNL 3IF1B 1IILE 4NBYB 4G6FD 1NLDL 3RQ3A 1JZ2A 4PJFA 2YD6A 3G08B 2IJ0C 4PGZA 2IANB 1UC6A 4JFDD 5SWSB 2J8UA 4OCXH 4N0UE 1A7RL 4DGIH 1MCRA 3Q6GH 2JJWA 3BP7B 3MREB 2BFVL 2JE8A 1G0YR 3BZEA 2H9GB 1JF1B 4X6CE 3OB8A 1ZTXL 3DX8B 3GSWA 4JZNA 4PJ7A 1J7VR 4PJBB 2BRRL 1DZBA 1P1ZA 3O3UN 4M61A 5I1KH 5KG9A 3MR9A 1JHTB 5AG8A 1Z3GL 1BWWA 3QI9C 4N90E 4U1LB 4QRPD 4PJFB 1YY9D 3WS3B 2ZJSH 3MZGB 1BVZA 4MSWB 2EDKA 3RL2A 4DVRH 4RISL 5C0NC 3GMQA 4NSKB 3BEVA 2DAVA 3S96B 4OAWB 4YDVA 4N0CC 1ORSB 1ZEAL 3BGFB 5E24E 3JV4B 2AJVL 3T0XA 1A6VL 1TQCC 2CKBB 4U1HA 2QTEA 1U8PB 1RVFL 4OGAD 3BUYB 3V52L 1ZLWH 1A3QA 1T21A 4MQXC 1G9NL 3U0PA 3WS3A 2J5LC 5E03A 3ABZA 2EXYC 1MEXL 2QADD 3WNPA 2IH1B 1KPVA 1U8HA 3BT2H 3CGTA 4GRWF 4JY6A 5L2KA 4R3SA 1BQSA 2BVPA 1J05A 4M00A 5CGTA 1MWAH 1MRCH 4P2OB 4KKBC 1T0NB 1CK0L 1I3UA 4ZOBA 5CSZB 5AZEL 2V17H 5J6HB 4WWKA 3JV4A 4YHZL 4RGOL 5CEZH 5ILTH 1DUZA 5GRXG 2R69L 1UWXK 4YHYC 2FB4H 1MAJA 5E94A 3LEVL 5I75B 1X5HA 5D71H 4XAWL 1C7SA 3RDTC 2VDNL 1HHGA 1J8HA 2Y72A 4LCYB 3BMWA 3MJ9A 1VFAA 3LN9A 5DGQA 4QHMA 4JY6B 4AYFA 5H35B 1DQLL 4J6RH 1P4IH 3RKDD 2H45A 5LBSH 4X4MA 1EERB 4L4VD 4MNQD 2DMKA 5F6HJ 2B2XH 3QFDA 1U36A 2R2HA 4FFYH 4KRPC 1CFVH 2O26U 4QO1A 1ZGLM 1B0WA 5C0IA 5HDBE 5E0QA 4HWEH 2VWEC 3H9SB 1YYLH 1QSFD 2E6QA 4FFVC 2NY7L 3KPPA 3VH8G 1XIWD 4JRYE 4XX1G 4BQBA 4YHMH 3KHOA 4G80B 3QI9A 1G7PB 3W0WD 3G5VB 1KCSL 2G2RB 5CJQH 1SJHA 1OF2B 5IB5B 3CUPB 3KXFB 3PGFL 1V3KA 1KF9B 4LBEB 5DHXB 5C9JA 4LHUD 5GGQH 2XWTB 3IDXH 5L6YH 4NN7B 2G60H 3EDFA 3GSNL 2ZUQB 4X5WB 3VXRA 5ISZB 2HFGH 4ENEC 3X14B 4JZOB 1BBDL 5JZ7C 4P2RB 3MO1B 2DQCH 2EEBA 4QLRA 1S9XA 1LE5B 1MREL 3CH1B 4R97C 1D9KA 1EAJA 5EOCL 2J4WL 1A6UH 3QWOB 1E0OB 2BOCB 4RISH 1PDKA 5IJKC 5I1CH 3T8XB 4NPYB 4Y5YA 3L5JA 4AEIH 5IFAH 1LDPL 5MENE 1OAQH 4M02A 2AV1A 3DTXA 2XXCB 4Q97A 3F7VB 5BJTB 1DDHB 4O5LL 1E4XH 4HDIB 2EECA 3RIAF 5ITFA 3QJHB 3QIUC 2HKFH 3V9FA 2HH0L 3G5ZB 3BO8A 5D2LE 1RI8A 1PZ5B 4UTAL 1W8OA 1M1SA 2DICA 1W72L 1CVSC 1YEIL 1P9MC 4LCWE 4UT7L 1RUAH 2YD3A 3P3YA 5E70A 3WDIA 1IZJA 4JHWL 2VLME 5FGCE 1A0QL 5EULV 2XKSA 2BNQD 1UM6H 3BKMH 1I7TA 3U36B 3QCTL 3F7VA 2V17L 3KG5A 3BQUB 3KPQB 1AKJB 1RZFH 4PGBA 4QY8A 1F3DJ 5E8NB 3VFPB 2BSED 5B39G 4C56A 4JG1L 4PJDF 1RHHB 5F44A 1C7TA 1U8LA 1ZANL 1N59B 4W81A 1K2DB 2FSEB 5GJTH 2DYPD 3H3PL 1EK3A 3SO5A 1NAML 1QVOA 4LLMA 4KJQC 3QO0B 4EN3C 4J2XA 1UB6B 1RMFL 3DBXB 5K93A 3JUYA 3IJHB 4YWGH 2VL5A 4JM4L 1NGXB 3IAGC 5EOCJ 2FH6A 4MWFA 3WN5B 1Z5LB 1S5IH 5F3BB 1H3GA 2AQ1A 1CE1L 3KGRA 3SDDD 1MFEL 2PKDA 3DVIA 5DVLA 3TH2T 4ZFZB 4HXAH 4P48A 1FO0H 3DROA 5F7NC 5EWIH 1N59A 3SKOA 2NTFB 2FSEA 3AY4C 4MJ2A 2IADB 4ZUVB 4P5KA 4OB5L 1PFCA 3BQUD 5IB3B 1D5ZA 2ZUTA 4OIIH 3KPLA 3FN9A 4M7KH 1IGCH 5IP4A 4E41A 3LMJH 3QXAB 1B4RA 4IS6B 2VUYA 1HK6A 1BQHA 3JV6A 5C71A 2R0LH 2Q6WB 3IT8D 4R7DB 2B39A 3EYOA 5D1XA 1F45A 4OTXL 2YPVH 5AUMB 3WJLC 1CDYA 2YRZA 2F8VA 1CDBA 2DF3A 4JGJA 2GTZB 3FFCA 2BXZA 5GRJL 1J1XH 3GIZH 4R26H 2BY2A 4IRSC 4NQDA 4RFOH 3TIEB 4S2SA 4P2QA 3HN3A 1HHIB 3IKCA 1MREH 4Y8AA 3QXAA 5D1QB 3OJDB 1BQHB 3JV6B 1Q0XL 2Y1VA 4UI2A 1U95B 3T0EC 2C1OA 3N50A 1TQCB 5EUKB 1UGNA 3NCYS 1ITBB 1D5XA 3VXNB 3HE7C 4Y8DC 2OM5A 2PN5A 2R2EB 2AJYH 3GMMA 1AD0B 4RA0C 1E4XL 4NZRL 1FZOA 5IBLC 1CL7H 2MQCA 1JMZA 3IFOB 4KPHL 2ENSA 2EKSB 3QDJD 2AVGA 5F7WC 5I66A 3QDGB 2X2YA 2X4TA 3GBNL 3CIQA 1AGCA 1DP0A 1I1AC 1XGPB 4F7MA 4F7CB 1XIWC 2BY3A 3GUTB 1JWUA 2HG5A 3S5LB 3WLBB 4PJCE 3HZKA 3W5NA 1JNNH 2VN7A 3GDBA 5D9SB 12E8L 5EO0A 2ORBH 1UKTA 3RVTD 3I6KA 3U83A 5C0AA 4UT9L 4A6YB 4LFHD 1DUYA 5C08E 5F72S 1VEOA 2VDPL 5JIIA 5CGYC 2PW1B 4PRBA 4I0KA 2E7MA 3MBEA 3OX8B 4YX2H 5DTFB 2AGJH 1HHHB 3RKDC 3VD3A 1FP5A 1OAZL 4HKXB 4AQ1B 3I3DA 1JI2A 4UILL 5GS1C 4H26A 3ZHDA 4F7EB 4IIQB 1UM5H 1DE4B 2PUQT 1ED3A 1NCAL 2WP3T 1QHOA 5HGAB 4FFZL 1IAIL 5B39A 1KFAH 2W91A 4G43B 4KDVA 1FHGA 4Z5RB 1CZ8L 4HC1A 1OLLA 3PGDB 5HGHB 4LGRB 3S6CA 3TM6A 4KZDL 4HT1L 5EUOE 5D1QC 1JGDB 2W60A 1T3FA 4JY5L 5KZCB 1FVCA 4HK0B 2GITA 1WISA 1KJ2A 2BY0A 4MAYA 3WV0A 2AEWA 4MCZB 4TRPH 3GJEA 4OM0L 1JGEB 1N64L 4R90H 2OL3A 4M7LH 4PJ9B 4DN4H 5HY9A 3LKRB 3TA3D 1CQKA 3NPZB 2IFFH 1DE4A 2Z93A 3SQBA 5EBMB 4ODSL 2BX5A 2DLIA 3UDWC 4F7TB 3UTZA 4NN6C 2ZOLA 3C5ZB 3GSRA 4BFIA 5HI4D 3FO2A 4RAHA 5L9DL 3FOLB 4NM4L 4LEOB 4RWYH 1NC4D 4GBXC 2A73A 2ZKHH 3SE9H 4L4TB 5BOPA 4WENB 2MCG1 3I50H 1RJCA 2B4CL 4G6ML 3T4YA 1OARH 2XTJB 4JKWA 3WFDH 4MMZC 1QFUL 2RJMA 3TO4A 2LE9A 5C0BB 4L8CA 4G9FE 2EO1A 5HHMD 3OAUL 3AS3A 3PHQA 4FTVB 4YQXL 1U3HA 3UCRA 4N1EA 5E99L 4BFIB 4F37F 2K3TA 3QUMA 2W07A 3MCKB 4XGZB 3S88H 3B43A 1V05A 4PRIE 3OJMB 3LB6C 5C9KA 2ZZUT 3DIFB 4Y4KA 3TVMA 3MRMA 3HE7A 1S5HA 2BJMH 4M6AA 1J87A 2PW2A 3GBNH 1LDSA 4IRJA 3FRPA 1AY1H 4X6DE 3MJ8B 3W9DA 2ZNXA 3MRGA 2FO4A 1ZTXH 3QWRA 4GW4A 3FB6A 4X4ME 2NNAB 5EBGA 3ALWA 3GRWA 2BVPB 4KJYA 3U4BL 4U6YB 1FLRH 5HHOD 3BN9D 3JUZA 3ARDC 2EH7H 1NCCL 3G9VA 2VN4A 2DQHL 5J6HA 3RPIB 3DIFA 3MNZA 3T0BA 2R23B 4M43L 4HZAA 3SDAC 2MPAL 3GJFH 4IRJB 3IVKB 3W9DB 2QEJA 1XF2A 2CKNA 1HI6B 2VXQL 1J8HB 1MY5A 3O4OC 5MERA 1INDH 4UNUA 4GW4B 3WKMH 1WIUA 3FB6B 3P30H 3ULUL 1A9EB 4PLJD 1SQ2N 2ZOKA 3P11L 3PQYA 3ULSA 3PWUB 4KTDH 3VFTB 4Y1AA 3V8CA 5DGRA 3ZE1E 1UM4L 3CLEL 3BP6B 5T5NG 4ZQKB 3HUJF 4LASH 2YR3A 1G7IA 2D4DA 3QFJE 3UO1H 3OKOA 1VADA 4F2MB 1BP3B 3MLSH 4N9GB 4P5TB 4M1DH 4HX1A 3S98A 4M48L 1XF2B 4LHUB 4PJGE 5AZEH 4HAGA 2VZTA 5DSCB 2C3VB 3GO1L 1AI1H 1P53A 4YAQA 4PRPB 2I5YL 4G80A 3O9WC 2ICCA 5FUZH 1FYTD 2LU7A 3O3DB 4JM4H 3SDDC 2FLRT 4OCWH 5EA0H 5DRZB 5KTEH 4GRLD 4BQCA 3OTTA 5BCAA 4N1HB 4XAWH 2BMKA 5IVXA 2XA3A 4ZQKA 4HPOL 1NKRA 4U7MA 5TDOB 1F90H 3BSZL 1ND0A 4M62L 1V3JA 4I8DA 4ZFGH 2P1YA 5LBSL 4NRZB 4Y89A 1RU9H 1PEWA 1FORL 4BFBD 5IMMB 2LFGA 3M1BB 3SKNB 4DGVH 5EOQH 3ZSTA 3RUGF 4HS8L 4U6VL 1ZLVK 1U8QA 1KJ3H 3UX9B 4JDTH 4KVNL 3ARFB 1J86A 4WW2C 3GIVB 4HWEL 1GPOH 5C0JB 2JELL 5CGMA 5I6XC 3F6LA 2CMRH 3DUUB 4PJFF 5KVDH 2YPLB 1JPSL 3V0AC 5TDOA 4IDJL 1BFOB 1ND0B 4P2RD 3ULVH 2O5YH 5F6IC 5I74B 1FV1A 2NY5C 1RUQL 2R1XB 3IDMB 3C2SA 4I13B 4NO5A 3WSQL 1AGBA 1YN6A 4X4YB 3VGGA 5F9JA 4U3HA 4OV6F 3G5ZA 4MJIB 5D5MB 5BQ7A 1OSZB 2GTWA 2B4CC 4EEEA 3O11A 2AAVA 4MLSA 5F71A 1P4LB 2A6IA 3REWA 3VGEA 1DBBL 2IBZY 5DDHA 2XTJD 1UB5A 4WTZA 4CU7A 5INDB 3QO1B 1T5XB 3BVNB 1FZJB 3UTQA 5FA3B 5DJCB 1I7TB 3ARGB 3IDMA 3MRLA 4Z7VE 5CWSB 3DRQB 5CBEA 2AJXH 2PXYA 4O51A 3VRIA 3MLVL 3LD8C 1MHCB 4PYGA 5A3IC 4F57H 3OL2A 3KR3L 3CFDB 4WEBH 1MFDH 3TPUA 4UDTB 4XXDB 1M05A 1UH2A 2Y4SA 3QIWD 1Z9SA 2ADJB 2GAZB 3MNWA 3T1WA 1GGCL 4Q9BA 4O5LH 4QHKJ 1JWSA 1IMHC 3DBXA 3GKZA 4JKLA 1UB5B 4ZO7A 1T7YA 4PP1D 3FQTA 1A9BA 3QQ9D 1CN4A 3NPSB 3MRLB 4GS7C 2CGRH 1NBQA 4CVZA 3HI1A 4QRSA 3K46A 1IFHH 1Q9OA 1P7QD 2H2PC 3RL1B 3TIDA 5GRVL 2CO6B 4MHHI 1IZKA 3BHBA 4QGYA 2UYLB 5DWUH 3DOSA 4LPYA 1DL7H 4UDTA 3NZHL 1KB9K 5FB8B 1QQDA 1UYWL 1ZS8A 3MOAL 1D5ZB 3DX6B 4H88H 2YD1A 4M7ZC 2ZWLT 4G42B 1NEZG 1XCQA 1TZHA 2CLVB 1Y18B 5HJ3B 3THMH 1U58A 1A9BB 1JHLH 1KJ2L 3L3HB 3UTSA 1NDMB 4KUZH 1IAIH 5IQ9B 1YQVL 1QG3A 4MJ5B 3RFZC 2BNRE 2GJJA 4HJJH 1OGTA 1C08B 1Q9OB 2D7NA 3TIDB 3NA9H 2Y6SC 2RBLA 1L4IA 1CD1A 1BM3H 4GG8B 2UUDH 3ZTNL 2PO6A 4PGJA 4JRXD 4N9OB 1QHPA 5HYIA 3CVHB 1LK3L 1MCLA 4ESKA 2DI8A 4P2QB 3O3AA 4K7FB 4TRPL 1KEGL 1IAKB 5ESQB 3ZT5A 2QSCH 2HT2C 3NFPA 4EQ2A 4MB4A 2DL9A 2IFFL 5CEZL 4DW2H 1CXKA 4PTUB 4RMSA 3OSKA 5IJKA 2R0WL 3TP4A 4HIJB 5F1IA 2IPTL 4GSDH 2QSTA 2JCCB 4LARH 3CFEA 4MNHA 1Q1JL 1EO7A 1S9YB 5FUOH 4PLKC 5CCKL 1CFSA 2NLJA 5JHDB 3LRSA 3OG4B 1P4IL 4MQTB 3O3AB 3O0RH 4S1SH 4JHAL 3B5HA 4PRDA 4HJ0C 2J8UF 1G7QA 5F7MC 2D3VA 1CF8H 4XI5C 3OGCB 4B41A 2DWEA 3OQ3B 1CLOL 1QKZL 3JWDH 2XTJC 3OR6B 4BA8A 4EXPX 4JO1L 1YMME 1UJ3B 5DFVD 5JTWA 2ZPKH 3T0EE 4PJ5A 3QEQE 4ZS6D 4GG6B 1IL1A 2XZCH 1K4DA 5FHAH 2P24B 3GSVB 3LKNA 3MV7A 2HVKB 4MVBD 5D72H 4ZAKA 4XNUL 3IU4H 5CJQL 3PDDA 5FYLH 5MI0B 4G8EA 2ZCKL 3G6AA 1RZIA 1WWAX 1EH9A 1U42A 4TNWK 4CADA 5JW4R 3JZ7A 4MS8D 1FNLA 4PLJC 3R1GL 2NZ9D 4XX1E 3QFJA 3D0VA 2GSGA 5I0ZA 1UJ3A 7FABH 4PG9B 3CDGA 3MRIB 4C58B 5I17B 1I75A 5HHVL 2WLZA 4M3KB 4RZCA 1ACZA 4P23B 3B9KC 4UU9A 5HDLA 1KCKA 1FJ1A 4X6CB 1UWXH 1A6ZA 3E6FA 2VQ1B 3OXRB 4PRID 3C5ZD 2WIMA 5I18L 2MPAH 3QHFH 3ZE2F 5IR1A 5T33L 3C5JB 4QT5B 5C07D 1WQVT 1SEBB 2ZUUA 1N2RA 1QBML 3UMTA 4YDIL 4S0SD 4UNTA 4J3WA 3C5SB 2PO6C 5F7EL 5FYJH 1WZMA 5D7LE 3O45B 2XZAH 5HVFB 4ODWA 3T2OA 1LWRA 4I3SH 3P9LA 3FOLA 5BRZE 2HJFB 5FGRA 1BFTA 4OZGB 1ZLVH 4CN1A 3LIZH 5JMOC 4HKBB 4EN3A 4HIIB 2NY2B 1R5VB 3G6DL 5TH2A 1NFIA 2DWDA 3QXDB 4EI5A 1MFAL 4NKMB 1IEBA 5IHZA 1KEGH 3WL9B 3IXTA 1AI1L 3GO1H 3SKJH 5CP7A 2BZDA 2VERN 5B38B 2AK1L 4Q9RL 3O3EA 2V5MA 5I8KL 4BH7B 4LLUB 4PTTB 3L3OA 4MNGA 4DAGL 3X11A 1A7BA 3RA7H 4Y0GA 4OZHF 5FECA 3O2WH 1GGTA 3ARTA 3VCLB 3WJJC 3QUMB 1ES0B 2ENYA 4OZ4B 1A6AB 2HLFD 5D7LD 4Y4HC 15C8H 1S8DB 1WFNA 1YEJL 3MRMB 1O7SA 3HE7B 4W4NA 1NBYB 4JZJB 3V4UL 2C26A 1OD9A 4RX4A 2A1WL 2BOBB 2E7LC 1MCPL 2A77H 3MV7D 3DMMB 5HI4C 1NDGB 3UC0H 3MJ8A 5E7BA 2Z4QB 4JDTL 5I1IL 2UZIH 4KVNH 2X4RA 2FO4B 2YN5A 5B38A 5BO1H 4BH7A 4PR5A 1AP2B 1V7MH 3ZMRA 1KJVB 5CLTA 1QLEL 1TNNA 5DMKB 4FFWC 4Y2DA 1LHZA 1WWBX 1KIRB 4Q74A 3DI3B 4LQFH 2RGSA 3PV6A 4OCLC 1F4XL 1GIGL 1S7WA 4X5XB 4N8VA 4TVPL 4QOKA 5ID0A 4NT6A 4P4RB 3RRQA 4BSVB 1FE8H 4M6NH 1OW0A 1S7QB 3QUYD 4YHOH 4PRIA 2CPCA 5FIEA 3V4VL 5EC1B 3FFDA 3U9PH 5DD5H 3WHE0 4PR5B 3VWJD 3UAJC 3W82A 35C8L 1R3HB 4H25A 2VXSL 4MAUL 3U30B 4DUWA 2YPLE 1U8KB 3PWUA 2VLJB 4J4PA 1XGYL 4Y1AB 4F9LC 2P7TB 3L5WB 5EU3B 4TTGA 1PEZA 2YZ1A 4OFIA 1JYXA 1CLZH 4QXTA 2VYRE 3TBTB 4QHUA 4YR6A 2CJUH 3Q0HA 1YPZB 3SCMC 3TFKC 1KB5H 1Z6JT 2Y06H 4FZEH 1UWEL 5ADPL 4JB9H 3D2UB 2IBZX 5EUOF 1U8JA 4KK9D 4YAQB 4B50A 1V3LA 1X7QB 1QSFA 1L9MA 1D5MA 2XTLA 3IDIA 3EO0B 3HA0A 4YH6A 3RNKB 3T0VA 1EJOL 5HHQA 2DQDH 5E6IA 5F3HA 1INQB 5D7KE 2OYPA 1KN4L 3L7FA 3WJJA 3G5XB 3OMZA 4NJ9H 1MCCA 2EDJA 4QHUB 1FCGA 2NX5E 2P8PA 1HILB 4OD2B 2Z92B 4XPTH 2PR4H 2ZUSA 5GS0D 3DJ9A 5HI5C 1AKJD 1YQ2A 4LEXL 5DJZA 4LPWA 3PGCB 4I3RH 4ETYA 2H2SC 1MJ7H 5IMKB 4RGOH 5E4IA 1CGYA 1T83A 4Z77A 3C08L 4HAFA 3D85B 1HYRC 4G8FB 2RB8A 4EI5C 5I30H 1JGLH 4ODTH 1DJSA 3T3PF 5J13B 3TN0C 1YEDA 5CJBA 3OKMA 4KKAC 2AGJL 5E6IB 5F3HB 5AZ2H 4MX7B 1RK1B 3KPNA 2RIKA 2EIEA 4NKDB 3PP4H 4K8RL 3RVUC 3MLYL 1FYTE 3O8XB 1FV1B 1A4KA 2F53B 5I73B 5IVNA 3CSGA 4W6YB 3UTOA 1E28B 4RGMB 5IGXH 1A7QL 5FA4B 2V2XA 3MC0A 1RIVL 3UC0L 3GEWB 4OFYD 5DJ6A 5TF0A 4ZTPH 3PDOA 4I0PC 4P9HL 5GRUH 2FGZA 1RZ7L 4KU1A 4DEPC 4PRNB 1C5CH 3ARBB 4HLZH 2QHLA 1GSMA 1OGAA 5FKPA 2F5AH 5B8CB 1KEML 5C0RL 4ZXBD 4HIHB 1BF2A 4P4KD 4NQEE 4M9OA 1RULL 2DQEL 1F4XH 3KYMA 1A1MA 3VRIB 3OKEA 1W2KT 4GXVL 1I7UB 1MHCA 4MCYA 3IU3B 4TTDD 5FCUL 5T5NF 5FA4A 4NC0B 1JPSH 2R1WB 2P5WD 4FQHB 3HPJB 4PUBH 1QZ1A 4JPVL 5DJ8A 2O5XL 1M05B 1N6VA 3GSNB 3N1MC 4JFPA 2JK5A 4NQTA 2V5RA 5DQJB 3OXSB 4Z78A 3VE0B 2HT4C 1NC2B 3QJFA 3NFNB 3VRLE 3OAZK 1CDCA 1NUGA 3ARGC 2P8LA 3IETB 3GSXB 3K81A 2H6PA 1FNGB 3UPAA 2EDWA 5EU6E 4G9DB 2FNBA 4QGTA 3I6GB 4FQXC 4K7PL 3RWDB 3PV7A 5J1AB 1NMCC 4ZUWA 2C4FT 4HWNA 4WO4B 1NL0H 4XNUH 3BAEH 2JB5L 5J13C 1I1FA 1BZ7B 1RIUL 3BRDA 1CFNB 1P4BH 5FOBB 4QRRB 2AJXL 2L7UA 1XAUA 1ZLUH 1T4KB 5KVFH 5GRVK 5BZWB 4J12A 4W4OC 3NFNA 5BVJB 2EDBA 3VFNB 5C0FA 4Y5XA 5IK3A 4GAJH 4LGSB 5CJOL 2FJHB 2XPGA 4NO3A 1EFXD 5ICXB 4N5UA 3MRPA 5H2BB 2BHYA 3WO3B 5DK0A 1EEUA 3EOYG 2VXUH 4KAQL 4QYOA 1WTLA 4FFWD 3CPLB 1HEZB 3PABB 4KKCD 3VGDA 4LEXH 4FXKB 1N8ZB 2EYRB 2C3WA 4Z7UE 5ISZE 1QP1A 1ERNA 5FUCC 3C08H 4MDIB 1DVFC 4NQDD 5JO5A 3FFCE 4MQSB 3KXFA 4PJ8A 2VZ1A 5ESAB 3EGSA 1IC4H 4O9HL 5GZND 1DL7L 2VC2L 5F7EH 1YMMA 5FYJL 3VXRB 3QEHB 3VD5A 1GRWA 3DARA 3IGAB 3MODH 1NEZA 3TBSA 3V52H 3JVGC 5JOPE 4KWUA 4QYOB 4D9LL 5JDSA 5F1KC 4YBLB 1MHHB 4P3DB 3K8LA 3MRHA 3TN0B 1AO7E 1IVLA 3N1FC 1N3NB 3EOBB 3QWOA 3UTSD 1ZWIB 2XOTA 2BOCA 4HXAL 5JZ7D 2FX8H 1RZ7H 4LOUC 2FX7H 4NWUL 5ESAA 3UEZA 2C7UB 3RUGA 3WNNA 2AV1B 3DTXB 3MMEA 4YHYB 4JE4B 3VJ6B 5J3HC 5C0RH 3IFPB 2D7TH 4PJ9D 3UDWA 4XBPB 1ZAGA 4C59B 3VFMB 5JW4M 3FT3B 2A83A 4DGYH 4K3GA 4AG4L 3PWNA 4Y4FB 4U1IA 3T09A 4HUXB 1CIDA 3LKNB 3MV7B 1WBZA 3OR7A 4MA8L 1X44A 4J4PC 3CFJB 3VXSA 1ETZB 5JPMA 4WI6A 2DDQH 4R7NB 4UINL 4YLQT 4JM2D 4ZFOA 1ZLSL 3KNBA 5F89B 4K9EH 3FONB 2W0LA 3HNVL 3SDAA 3WNKA 1BIIB 2HJLB 4HWBH 1P69B 4XPAL 1PSKL 4YEFA 5B3NA 4AY0A 1RHHA 5JIHA 2DB8A 4YHML 3RY6A 2NW2B 5EDXA 4Y4FA 4P23A 4UU9B 1KJ3L 2CK0H 5T1DH 1QVOB 3UJIL 3KLHD 5FYLE 3EJJX 1F3JA 4EDWH 2VQ1A 1URLA 1OWWA 3ILPA 1LP9F 1I9JH 2VDOH 5HI5D 1IE5A 5E6YA 4MDJA 2ZPKL 1W0WA 4JO3L 3MRKA 3DO3A 3AB0C 4ISVA 4NO0A 4XMLL 4RFNC 3W39A 5IBUB 4XCEA 2FEDD 3AVEA 3INUL 4XPBL 5SWZE 4P2QE 4QXGH 3RY4A 5KSVB 1MLBB 3C6SA 1G9MH 1FCCA 4LPUA 2VXUL 3P9LB 3PWPD 3KPOB 3GSQA 1NFDE 4KKLD 3KXFE 3QQ4A 1TTUA 1IM9A 2OMBA 3D18B 1INEH 3KPLB 2ESVE 3X13A 4WI9A 4E9LA 4EN3B 2WK2A 4WTWA 1FL3A 1OAQL 4ODXB 3RGVB 4XVJL 1DR9A 2IAMC 4EI6B 2ZJSL 3QR2A 3QUML 1FSKC 1K3IA 3GSUB 4O9HH 3ARVA 1BAFH 2ICES 1CTOA 5CZVH 1B3JA 1GZQA 5IB2B 4LLUA 1RZJC 4POZD 1I8LC 1KJMB 4J3VA 3D3VD 4R0LB 5C08B 5HVWA 4EOWL 5INCA 1HNGA 4YXLH 1FZMA 1YEIH 1T1YA 3ZDXE 5MENB 5TE4L 1NUNB 3JSSA 3WCYA 3SDYH 3AREC 1FDLL 3OJDA 4LGPB 3X17A 5IV2B 3WIFA 3I3BA 1MJJB 1WFUA 2FX8L 1C5DA 5DC9B 3U46A 4HWUA 2JJVA 3HNSL 4OZIF 4HWBA 2ZUYA 5HHXL 3RBGA 3SJVD 5HYJA 4K2UH 3CC5A 5JXEA 2VLKA 4M8QA 3GMMB 3F5WB 2J8OA 1IGTB 4R0LC 4R0LA 5C08A 5KAQG 4P9HC 1SEQH 5TE6H 4EVNA 4LSRH 1FZMB 4JO2L 1BVLB 3R8QA 4RQQB 1BEYL 1KNOA 4PJCB 1VGKA 4JRWA 3PV6B 1TCMA 4WY7L 5SWSD 2OP4H 5BRZD 3MV9E 4QOKB 2PYFA 3QDMA 1E6OL 2Q76A 4QRUA 4NM4H 3ZT7A 2CLZB 3WLBA 5DJYA 2IPKA 3BDXA 5BS0D 4P9HH 3CJJA 4NHCL 4QHLB 2NY4D 5EOTA 1SYSA 3VFRA 2VLKB 4ZXBB 4BH8A 3QRGH 2ADFL 4NGHH 3P4NB 2B4CH 1KELH 3ZKMC 1G1CA 4WUUB 2Q8AL 3SO3B 2G75A 3RY6C 3N85L 3ULVF 1ZGLA 3CZJA 2A9MH 3S36H 1P6AB 3LV3A 1FYTB 1CFBA 5EO1A 1S9VA 1JIBA 3EJYD 3CXHK 3DV4A 2VDOL 1I1AB 4WV1A 3QCUL 2P8MA 2CUIA 1UEYA 3TWCL 3MV8B 1TPXC 3P0VL 1MHEB 2BERA 2JJUA 3KHQA 1JRHL 3QH3A 4Z5RA 1DANU 1Q1JH 5SV3A 3M07A 1JNLL 1MJ8H 2DQGL 3BH9B 3E6HB 2YUWA 5CBAB 4FQ2L 1ZHNA 2NXYB 3PL6C 4OFKA 4LLQA 3CMOH 1ZGLB 2VUOA 4WTXA 3F6IA 4LPCA 1HOCA 2YHGA 3L7FB 5HVHC 4G7VL 4LIQL 1GOGA 4WV1C 3G5XA 1BF8A 2WBJC 1I1AA 4U1MA 3OAYK 2W0FA 5JORA 3ESUF 4OLUH 4J3XA 2EEDA 1PGRB 4G7YL 3WXVL 4HUVB 1QACA 1MHEA 3TCXA 5DJZB 3HMWL 4ELME 5EU5B 3QH3B 2VLRE 2EDXA 3EFFA 4TUOB 4YE4H 5KVGH 1J1OH 3MJ7B 4ZD3L 5E5MB 4Y4HD 5MEQA 5DT1H 4M43H 3BH9A 1XR9B 2CLRA 2QADC 1ZHNB 4OCNC 4KC3B 4GAJL 5CJOH 2UUDK 1YEDB 5IVOA 1YEKH 3SCMD 5LCVH 1OOAA 1S78D 4NP4L 1A3RH 4G3YH 3RTQD 4Z7NF 1WK0A 2BCKB 3O41A 4N68A 3HB3D 4NQCB 1T21B 1KTLB 4L8CB 1F00I 5EZIH 4CMMB 4IEFB 4HCRL 5SWSA 2IH1A 4OI9A 4LASL 4AIXA 1FFRA 1MJUL 1B0GB 5FYKH 3BP5A 4NJ9L 5E6ID 2QHRL 1DBMH 1LP9B 4HIXH 2DKSA 2HFFA 4P49A 5D2LB 1QSED 4P2OA 4JO4H 2IBBA 3BD5A 4FMKA 1AHWC 3Q48A 3VFGH 2J6EL 5I9QC 4MD5A 3P0YH 5DC4B 2NY3D 1WSST 4L5FL 1P1ZB 4BELD 5ICZA 4JM2B 4RMVA 2F54A 2PW2B 3UTTB 1PQZB 1MCBA 5F8RC 5FGCB 4X9IA 3L95B 4X7CC 1JGLL 1AQKL 4K71B 4KRMB 4LLYB 3RWHA 2DKUA 1NAMH 4KI5F 2MNUA 1B0GA 5GJSH 3VG0L 1FH5H 1HIMH 3MYJB 4U2ZA 2AK4B 1A6PA 5IIEB 4QTIH 3OB0K 4KV5E 3CSPA 1S5IL 4PJIE 4WO4D 3CU1A 3VXMB 1BFSA 3U48A 1NCWL 4WW2B 3WFBL 3EYVA 4JPKH 2CKBA 4HS3A 5IWLC 4M7LL 5D2NE 4DN4L 1T1ZB 1J0YA 4UOJA 2WIIA 3ISWA 4L4VB 4OF0A 4GXUM 4ODUB 1K8DB 4NQSA 1KEMH 4HXBH 1N6UA 3OKYA 2BNQA 5GZNC 1KTRL 5L2KB 3QIUD 1T20B 3D48R 4H0IA 4JVPA 3BGMA 3TCLB 3GMPB 4FQXB 2V7HA 5F1SA 3WEXA 5F9WC 3L3JA 2XWTA 2Y23A 4GMTH 4F2MA 2XN9A 1EJ6A 3ZYZA 1YECH 4ZNEE 5J11C 1BJMA 4L4VA 5J7CC 3LQZB 4G7VH 3LZFH 3SBWA 2O5ZH 4IJ3B 2DD8H 5I1IH 4U1KB 3SCMA 1HYSC 4NDMB 1Y6KR 1T03L 1CXLA 4C4KO 4Q6YA 2BNQB 2DS4A 3LN5A 1RZKH 5I2IA 4DN3H 3CH1A 4XCNA 2R8SH 4GAGL 5E2TL 5IHUL 3MRRA 3GMPA 1YEGH 2PO6D 2EDDA 5MP6H 1LEKB 1TMCB 4HGWB 2BVQA 4XHJD 3V0VB 3TYFA 4XPBH 3S4SG 5BXFA 2XY1A 3C2AH 4TVPH 4X99A 1F5WA 1W0YT 3MV8D 3IJSA 5IOPB 2DQIH 2R56L 4N8PA 1J0ZA 1N5AB 4NZRH 3O8XC 5I73C 2OK0H 1OTSD 2P5ED 4U1KA 1X4XA 1ZK9A 4Y19A 4WCYL 1PKOA 4GKSA 3WJLA 3V7MA 3BJLA 3BN9C 1G7PA 4XCNB 5E08H 2FX9L 2HWZH 3GIVA 2VDQH 5TE7H 1T83C 4X83A 5C0JA 1ZWIA 1I8MA 1SJHB 5DEZA 4HMDA 3BX7C 3CD4A 3DXAA 4NRXA 3SKMA 4MJIE 4Q6IC 5D5ME 1D5BB 1Z0NA 2X5PA 5ISZA 4LLAA 4S1DC 1ROWA 4P2QD 2HKHH 2WW8A 3U9UA 2BDNH 1AJ7L 5TF1L 3MO1A 1DQTA 1S9KC 1INDL 5F7DB 4KMQA 1OSZA 2I9LB 5TQ0L 1EUUA 4EBQL 1UWGL 3KXFD 2Q7YA 2FWOB 2APXA 4KTDL 2A6JA 3IAQA 1I9EA 5DO2D 1I8MB 1CT8A 2FZ3A 1JGVL 1UCTA 1O7VA 1A14L 1NGPL 2APBA 3FN0H 4IOFC 1SM3H 5DO2C 1KCVL 4POYA 3SDXE 1D6EB 3HE6A 2ZCHL 1MI5E 1DANT 4J3UA 4XXCA 4D3CL 1KN2H 4HJ0D 4IOSD 4XPTL 2YXMA 4ZFZA 3I02B 1GAFL 5E2UL 2FJFB 4K9EC 3KPRD 4HMCA 5ELIA 4P59L 4OUOA 3QDJE 4PGDB 2EYSB 4JY5H 3LDBB 4DTGH 3P2TA 3MNVB 3K3QA 1UENA 2MCPH 5IW3A 3PJSB 5FO8A 3PP3H 3MGOA 2CKBL 5AZ2L 3FQTB 5CD5C 3O4LD 3MRKB 1PX4A 4R4FL 1KLGB 4NHCH 25C8L 5DR5H 5F7FA 3HR6A 3B5GA 2FBJL 4PGBB 1GOFA 5JLZA 5HPMA 4D9RD 1C12B 2WBKA 2UWEA 3JV5A 4PY7A 5A2JH 2GTZA 3GMOB 4DGVL 1X5KA 5L2JA 5J06A 1NCBL 4LLMB 4XC1L 5L7XL 1BECA 4ZSOB 3DX6A 5BOZG 2GI7A 3MV9B 2BNRB 4PJXA 1DQMH 5DZOA 3IJHA 4U7SA 1Z2KA 2VL5B 3KPRE 3IXAB 1CGVA 2RFXB 2PYEE 2C5DC 5HYJE 1KC5L 4ZG1A 5ADOH 2P47B 3MJ9L 3S34L 5DYOA 4C4KT 4NQVA 3CK0L 5DUBA 5K9JH 3OB0H 4OLWH 3GMOA 5DMIL 3WLWD 3L3DB 4WUUE 1T89C 5ACZB 2VLLB 4P5KB 3CVHA 2LTQB 4FTVE 5K9OA 4FP8H 5IB3A 3PXHA 3MBXH 2EKSA 3MV9A 5C2UB 3GIZL 3AU1B 4CVUA 5ENWB 4KMTL 3F12A 2JCCE 5MEOB 1VKXA 4TSAL 3ME0A 1G9ML 2FL5B 1DLFL 4LKCB 1XGPA 3C60D 2D7MA 2Y5TB 3FT2B 4K8RC 4GRLC 5AUMA 1EV2E 2X9WA 5DT1L 2ITDA 1AHWB 4JZJC 5GQBA 1NJ9A 2YS4A 4WEBL 4H8WL 4LCCC 3OAZH 5ACZA 3H6JA 1G9EA 4K3JL 5ALCH 4V1DA 3MUGB 3F65A 3U0TB 1ZT4B 4JJHA 2V2TA 1BQHG 1J5OH 1QTYT 1KIUA 1V3MA 3OX8A 3QXWA 4E42B 3FRPG 5CZVL 3K4AA 1MCQA 4NFDA 4RCAA 2PYFB 2C1OB 2KZ1B 4TSBH 1A14H 4PB9L 5IEHB 3MACL 3OR6A 3QEUB 1R0AL 1PZUB 4XWOC 3C8KA 1OAKH 4EIZC 5EOTB 2DIAA 4HWZB 4G43A 4UDUA 2YN3A 5DURD 1FFPB 5F9OL 5GPRA 3O4LA 1XIWA 1GAFH 4GG6A 3LQAH 1JN6B 4P46A 4V1DB 2Y5EA 1QYGL 1JGDA 2HVKA 3K74B 4UT9H 3QG6B 5TDNB 3V7AG 5I66B 3LV3B 2X4TB 1FO0B 3N1GC 4M03A 4X0KB 1IKFH 5HPOA 1RZIB 2UV3A 2P42B 4PJ9C 1E6JH 1CLCA 4MQ7A 3VU2A 5D2NC 4LF3A 4XH2A 5BZDB 3D0VB 5EBMA 1UA6H 1SJEB 4HCRA 5C0AB 5HHMB 2OP4L 1QFWI 5IBTL 3VXUD 5C0BD 4X6CA 1JF6A