2FD6H

Structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
212
Chain Sequence
GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Structure of human urokinase plasminogen activator in complex with its receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 212
sequence length 213
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fd6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fd6H02
4ZAKD 5E8OB 1PKOA 4L3EE 3WIFA 3HCVA 5KW9L 4X5LA 1FZMA 3M45A 3EOYG 2XFXB 4HEPG 4WO4C 2YK1H 1T0PB 4MHHI 1YPZE 5GGRB 5TJWK 2VDKL 1OTTC 2NZ9C 4WEUD 5IG7A 5C6TH 1P4IH 4PV9B 1A5FL 3VG9B 1OPGH 2A6JA 4MGXA 4NKOA 5T1LA 3GJFH 4WFHE 1HEZB 2DWEB 2XRAH 1NGXB 2C1PA 4XMPH 4JKLA 2Y1VA 2R23A 3DGGA 1MF2H 2FSEA 1CDBA 3LMJL 1VKXA 4M6OL 1A6WL 5DRWB 4FRWA 2YRLA 3OB8A 1B0GB 1U42A 1S7UB 4ESKA 5ELIA 4CNIB 1IMHC 4RAVA 1N64L 2D03L 1NLBH 5GS1B 4LKCA 1QSEB 4KK9C 5FO9B 5DD1L 3KPQB 2FR4B 2RIKA 2IG2L 3IFPB 4ODHH 1Q9LA 1YEJH 3CC5A 3HC3L 5D70L 5JORB 1SJHB 2M1KA 4IIQC 3F6IA 3NZ8A 3K2UL 1GOGA 3LB6C 5JO5B 4DW2H 1T2QL 1G7MB 3MLTB 1EO5A 1AY1L 2DLGA 2OL3A 2NY4C 1J1OH 3OKKB 4YHMH 1F4HA 3IETB 2NZIA 4MA1C 2PTVA 5ETUB 1UGNA 3OKDB 4K8RD 4NJ9H 1VPOH 1NL0L 4ORGA 3JV4A 2W9DL 3LH2H 5C08A 2CJUL 4K7PL 4P46B 4AT6B 4OZHB 4G9FD 4LDOB 3UJJH 3AFLA 2ZOKB 4M62H 4JPKL 4WFFD 2VITB 3UYOD 2DLFL 3QP3A 5F7EL 1J7VR 1GVIA 3O11B 3ULUC 4DTGL 1P69B 3LIZH 4Y5VC 5H35A 4HUWB 5D1QD 4PJEA 4L4VB 5JW4Q 4Y1AE 5EU5A 2HN7A 4KUZH 5DXWA 5D7IF 1MFCH 4X6EA 2DM3A 1G1CA 1IARB 4IRZH 3ETBF 1Q9KA 4PJIB 5T5NF 4PRIE 4DK6A 3AY4A 3HS0B 1I7UA 1EXUB 1PDKA 3NAAL 4X5XB 5FO7B 1EEZA 3ZTJH 3OKEA 5FGRA 1UB6A 2X1WL 4OBSA 4ERSH 1QSFD 4EQ2A 2Q76B 2Q87A 4YK4C 2C5DC 5JPMB 3OKLB 3LEVL 1PGRB 4MXQD 4MA8H 1JIBA 4MXVE 4J8RA 4KRPC 2BC4B 1YEIL 2EDXA 4U6HB 1YEHL 2NY2C 4NQED 4Y4KC 4GG8A 3QNZB 1CGXA 4GBXB 3QHZH 5HVWA 1KEGL 5J56B 3UJIL 35C8H 1R5WA 4AIZA 2F5BL 1F90L 4HUXB 1JRHI 4UV7H 4ZS6D 4GAYA 4LHUB 1OSPH 4WI2A 1T3FB 1U95A 1MJJB 3SDDB 5IR1B 3MROA 1G7PA 2IH3A 4ZUWB 4QHLA 4UTAL 3BESR 4XPFL 5CCKL 1NMAH 2BK8A 2BSRB 5TFSL 5GIRB 1FFOB 1AJ7L 4U6XB 2R0KL 4FFZL 2DQCL 3HMXA 4WIQA 3TNNB 3FRPA 5F9AC 5M7QA 3O3BA 4IMLA 3O9WD 4JFFA 2VDKH 3HI6L 5DHVA 2EDBA 2GIYA 4S1RL 1A5FH 4IRJD 1C16B 1MCHA 5IHLB 4AM0A 3LQAC 1CFTA 1U8IB 2EC9T 5JOFB 4XCEA 3UBXI 4F7EA 5T3ZH 4M6OH 1A6WH 1B4RA 1BLNA 3PWNA 1M71B 5DJ8A 1T1YA 2J88L 2YOCA 1N64H 2D03H 2DLIA 4IRSB 3GSUB 3VXTA 2BSTB 5KN5B 3SDAB 4V2BA 2XKNB 2FHFA 3FFCE 3QXDA 4WWKD 3TBSB 1XF2B 5DD1H 5ICXA 1NAKL 3FOLA 3DO7B 2IG2H 4WU7B 4AMKL 2XZQL 3HC3H 5D70H 1PQZB 1KJVB 1YY8B 1ZLVH 4PYGA 3M17A 3RY6A 1PKQA 5C0IB 4LLVA 3K2UH 3QIUB 3FQUA 1T2QH 3QI9D 3CXHK 4WEBH 5FDWA 3IJHB 5D2LA 4Y89A 2X4QA 1BF8A 3LHPL 5HI4D 2QADD 1S5IH 2LFGA 2WANA 4JM4L 3I84A 5HYQB 2YD2A 2XT1B 1DBAL 4JVPA 3ARFD 3KLAB 2W65B 1NL0H 2CJUH 3D3VB 4K7PH 4Y2DA 5EPMA 5GSVB 4D9QE 3ARGA 5KOVC 3LQZB 1MI5E 4P59H 3B9DA 3PWVA 3BN9C 1KJMA 4X7EC 4NFDA 4XBGB 4A2LA 4MD4A 2DLFH 4CW1B 5F7EH 2R0WL 4OIBA 3QWOB 1OY3B 1S9KC 5E2VH 3MX0A 4EI5A 5JW5B 3QJHB 1YJDC 1DBBH 5EO0B 1TJIH 4TVPD 3CJJA 1HWHB 5CLTA 3NMEA 4M02A 4YDJB 5KSBB 4P23C 3IDGA 4ZNCD 2YXFA 4TTDC 2E27L 5CGMA 4PJAE 1T22B 4MCYB 1KXQE 2GAZA 3NAAH 3KXFB 5GGVL 4WV1B 1FFNB 2Y5TB 4UT7L 1ZWIB 2D3VA 3TYGL 5JZ7C 2DB8A 4G6FB 5BW7C 2ESVD 1UCTA 4G6MH 2DQDH 4TSAL 1CE1L 4HS3A 2P46B 2ZOLA 5EZJA 5KVFL 4PG2A 2PXYA 4PJ9B 1HHGB 4J1UB 5MI0C 5LBSH 1YEIH 3TGXA 3KPSE 1YEHH 4G3YL 4ZD3L 1INQA 5J06A 1YY9C 5FKPB 4CMHC 1MLBA 3ARBC 3MNVA 4IJ3B 1FRGL 2RBLA 1KEGH 4N0YL 1I8IB 3MNWB 2R1XA 2WINB 1YEEL 5F21B 3TFKC 5MHSE 2F9BT 2F5BH 4JRYE 3ZYIA 2HFGL 4WFEE 2CXGA 4HMEA 2CO6B 5HI5D 4ELKA 4NDMB 4XVUD 3M07A 3MRMA 1BEYL 4O2EA 3SDXF 5K9JL 2VZUA 2AQ2A 5CJOL 2V7NA 5F3HB 1P2CB 4UTAH 2E5EA 3SJVA 3KGRA 3OKNA 3ZKXB 5A2FA 2R0KH 4FFZH 1WFTA 2DQCH 1EZVX 3X14B 1U91A 3ROLA 5D9SA 2X42A 1HDMA 4MAYC 4FOMA 2VLRE 4TOYL 4JVWA 3NN8B 3VFMB 2FEEL 4S1RH 2GJ6E 1F4YL 2AV7A 5AYUL 3V5KB 2AEWA 1SMOA 4DVBB 3RVTC 1LMKA 3QIBC 3O2DA 4JB9L 2YWZA 1II4E 1UM4L 5CJXC 1U8OB 1HI6A 3SCMC 5FO8A 2J88H 1HHJB 4FQQA 5D1ZC 4E41D 1P7KA 4TPRH 1X7QB 2VDML 4GJTB 3RBGA 5GZND 4X7SL 1MHHB 1NANI 1NAKH 4YFLI 3CVHB 4U1IB 1ZGLP 4AMKH 2XZQH 3VFTB 1DE4B 1XGUA 4JDTH 4MMZC 3IDNA 4M00A 5IW3A 3WS6A 4PD4K 1QFOA 4M5ZL 4KDTC 5T3XL 3QUMA 1BIIA 4UTBH 4PJ8D 4FZEL 1NUGA 4HZAA 4QRQA 5C0EB 1BIHA 2HAZA 3INUL 4X8JB 4PJGB 3LHPH 3CLEL 4UUJB 3JWOL 1Q38A 1O5DT 5BVPL 2H6PA 1DBAH 4HGWB 4BYHA 3BP7A 2HLAB 3WFDL 3C6LD 1LVEA 1KCUH 1AP2A 2IQAA 1YN7B 1OGAE 2FIRT 2ID5A 2JCCF 4FTVB 2OX5A 5HYJD 1NQBA 3KYKL 5E2UH 5T1DL 4LCYB 4JO1L 3RU8L 3JZ7A 5K9QG 3RHWF 3P40A 2R0WH 4YEFA 1D6EB 4Z0XB 3MUY1 4UBDC 1T1XB 2HJLA 3HNTH 3VW3L 1PG7L 1B90A 5T1KD 2P49B 5FF6A 4XCYA 2PO6B 1WWAX 4EN3A 4N9GA 2IQ9H 5FV1L 5HHMD 1OLZA 1RJCA 1MWAB 4FP8L 4OCXL 2NYYC 2F8XC 1WWWX 3U2SA 4L3EA 5GGVH 1NCNA 3VG9C 4XXCC 2OQJA 3MRPB 4LSDA 4QRSB 3V5DB 1U8QA 3TYGH 2EO9A 1UQSB 3VXSE 1UEMA 4RNRA 4QOKA 1X5FA 5AAMA 4Z77A 4TSAH 1CE1H 2IPUG 1I7ZA 5KVFH 4XVJH 5IEKA 4UIMB 2XTJE 2NLJB 5SWSD 3MOBH 4WW2B 1Z9LA 4GKZA 5LCVL 5GS1C 5EBLB 2DI7A 1MCRA 3L3HB 5H94B 4N5ED 3C60A 1CDGA 3WNNA 4G3YH 4W4OA 4AENA 1LO2H 2A74B 3K80A 3BUTA 1FL3B 2J4WL 4RMRA 4D8PB 1F3DH 3TN0D 3SDYL 3BO8B 1FRGH 3SDCB 3L6FB 3MV9E 5CEZL 3BRDA 4UU9A 4RWHA 3DX7A 1YEEH 2DYPB 4L4TE 5C0BB 3ORJA 1RZJH 5DHYB 1KENH 2HFGH 5DEFA 3ZDZF 4U1HB 3MCLH 3V8CA 5D8JL 1F11B 3I3BA 2D4FA 4DKFL 2YRPA 4LKXA 2AK4B 2R1YA 4GKNA 1IFHL 3LQMA 5DFVC 5AG8A 2V5TA 5K9JH 1MRFL 5CJOH 5SWQA 1FNGB 4BELD 3OJMB 3HC4L 3D0VA 4U3HA 4DN3L 2K7PA 2OS7A 2FHCA 1QPXA 2YHGA 1UXSB 1LP9E 4XRCB 4P46C 2BRRL 3FO0L 5INDA 3VRIB 3CVHL 3MLWL 1QOKA 3RAJL 5IB5B 5DQDL 4JN2A 3WUWB 3MRGA 4CADA 4TOYH 2IANB 1IC4L 4H1LB 1CGWA 5EUKA 4G8GD 1GGCH 1F4YH 1S7XA 4XNUL 1BJ1H 2DS4A 4N8VG 3EIFA 4KAQL 1KTKE 3AAZB 4K94L 2DQGL 2EYTB 4JB9H 1UM4H 1FH5H 1NSNL 1AKJD 1R3IL 1YNTB 2VDMH 3J8F7 1U41A 4LPTA 4X7SH 4WU5A 4Y1AA 2DKUA 3HG1E 4G42A 5JMRA 4JFDE 5EO9B 2HT4C 4G8IB 4MMXC 1FP5A 4LVOB 2X89A 4LCWE 1KN4H 1QRKA 1S8DA 4CGTA 3LRSB 4M5ZH 5DTFB 4C83B 4NFCA 4MA3A 4PJ5E 5T3XH 3GSXA 2DJ4A 1CFSA 4FZEH 2GK0B 3BD3A 4XNXL 2ZCKL 5E2WL 4P48A 5KVEL 5IIEB 2BVQA 5E5RB 2EXWD 3INUH 3DOSA 4GRLA 5D7LB 3NFSL 4NM8L 3QA3A 2LU7A 4N0UE 4TNVK 3JWOH 1LILA 3NCJL 5BVPH 1ORQB 4K7PY 4NUJA 3T4AA 4GG6F 1ZT7A 4J6RL 5DMKA 2Q8AL 3WFDH 1KTLB 1YEDB 1IKNC 1RIVL 4U3CA 5E7FA 3FQXA 5I15L 3RWCA 5E2JA 4F7TB 3O6KL 4ZUSA 3VJ6A 3B6SA 4FNLH 2QV2A 4HQQL 3KYKH 1DDHB 3KHOA 4JO1H 3MREA 4I9WE 2VO5A 1HIML 4NBYB 3S98A 4U1MB 3TM6A 4JG0L 3VW3H 5JOPE 3VXMB 5EIIA 1AXSB 3ARDA 4UNTA 2J6EL 5HXMA 1QRND 4WTZG 1U92B 4LDLB 3SE8H 3AGVA 2UY7A 3DPBA 1U3JA 2G75B 4D0CB 4EUPB 5KS9A 4FP8H 1PY9A 4NHCL 2R1WA 1AGFB 3QQ9D 3L95A 2GSGA 3HNVL 1QO3A 4V1DE 2CDEB 5J3HD 1T83C 2YWYA 3FRUB 5EFIB 3CDGA 3FO1B 2LU3A 1DN0A 3TLRA 4GOSA 2E7BA 5DMJB 1JJUA 4LNRA 4P5TD 1J18A 5J1SC 4Z7WA 3CPLB 5F93C 2MMXA 2CDGA 4QCIA 4CN6A 1EMTL 2HFEB 1HXMB 4LLDA 4UDUB 5I2IB 1E4XH 5I66A 2OLDA 5I1KL 3SDAC 1ZGLA 1KT2A 4ONHB 3C5SB 1HILA 2J4WH 3Q48A 3FZUC 4OUUB 3SE3A 4GRWE 2W9EL 1SVZA 3BP5A 4L8BB 4JFOB 4FABL 4R2GD 3SKNB 3OKOB 1T66C 1WUNT 3QIUC 3FFCA 2EH7L 4G80A 1FHGA 4CMMA 1I8KB 1X5HA 3K1DA 4J3UA 3RY5A 4W68A 1REIA 4PRPA 4MNQE 4LPYA 2NW3A 2YSSB 3PGCB 4RIRA 4U0RB 3DIFB 1MRFH 3C8KB 2VLJE 5E1AA 4EDWH 4G6AC 3KVQA 1JN6A 1KB5B 3N50A 2FBJL 2RCSL 1HH6B 1OTSD 1JPTL 4JPVL 2KPNA 3E3QE 3Q3GB 1K4CB 2BRRH 3O6LL 4P4KD 1T5XA 4PY7B 3MLWH 2PW2A 5DSCA 4PJ7A 1BQSA 5DQDH 4QY8A 4MJ6B 1IC4H 4J23A 4PJBB 2AXGA 4WI5A 1K5NA 5F1NA 4C54A 2P8PB 2VABB 5IHZA 2X4UA 5GZOC 2XA8H 4KHTH 2EECA 3VXOB 5HGDB 4KU1A 3G9VA 3DBXB 3R4DA 4AY0A 3V5HB 2DI9A 4K94H 1GL4B 2DQGH 3WL9A 2AXJA 5TE7H 2N7AA 1CQKA 4A2MA 2H8PB 5ANMB 1X5LA 5C6PB 2UVEA 1IBGL 2DMBA 1R3IH 4C56B 4DGVL 4JHWL 3QZWB 1UM6L 2WNGA 1QLFA 1XIWC 1NEZG 1OGTA 3GK8L 3KJ6H 3B83A 3DURA 4WV1C 1ULVA 3S8WA 4YHPA 3LKNB 3MLSH 5IROA 3T0ED 2MKWA 2Q3ZA 4K7FA 3JWDC 2DLTA 1GRWA 1MVUB 2YPLB 1MCOH 3HMWL 4HJ0C 2Y7QA 5HYEA 1X5YA 4PJ9C 3F6LA 3S96A 4XNXH 2ZCKH 4YDKL 1KYOK 5E2WH 4Z7OF 4Q97A 5SX4H 5KVEH 3VWKB 5DURD 1UZ8B 2BOBB 1BOYA 1VA9A 3NFSH 4NM8H 1JNLL 2VL5A 5BO1H 4QRPD 2A73B 3NCJH 2R56L 3WNMA 2I9TB 4CVWA 4YXLH 4J6RH 2Q8AH 3DX8B 1KGCD 3GO1H 1KN2L 5LGJA 1RIVH 2DBJA 5I15H 3KPSA 4G9DA 3EYQD 4KVNH 4NO3A 3UROR 3KNBA 4UILH 2B7DT 3UO1H 5BS0E 3BMVA 3BKCH 4OZIE 5TH2A 5I8CB 3MRFA 1HXYA 4DKEL 1GC1C 4X83A 3H9SD 4KFZC 3VG0L 1HIMH 2ADJB 4JRYA 5BVJA 2Y36L 4FQJL 2VNCA 3OAZK 3ZKXC 3PDOA 4UV4L 2NY3B 4UDTA 4APQD 1KIRA 3GSWA 3G6DL 5TF1L 1MUJA 4NP4H 1N0XL 3I6GB 2X10A 3T04D 5JPNA 1FQ9C 2H32H 3IU3A 4NHCH 3QUYA 1IM9A 1ZK9A 3ZE0E 3HE7A 4NN5B 3C08L 1K8IA 3HNVH 5EULV 1IGTA 1WVZA 5EWIH 3L3JB 1G0DA 1QNZL 3VXUE 2L7JA 1Z3GL 3O0RL 3GMOB 5GRUL 2X4RA 3FO2A 4Y5YC 3RNQB 4GXUN 5TDNB 3GMNB 2Q7YB 4KKCC 4CJ0A 1MAJA 1ADQL 1A4JA 1L7TL 2CLZA 3U82B 5MEQA 3NBNA 4P2OA 1IGIL 2C7UB 5IF0B 1EMTH 5IUSA 1T03L 2PW1B 1F4XH 1KB5L 5I1KH 1N6VA 4U6TA 5EZLB 1CLZH 1XF4A 4UOJA 1NFIA 4MS8C 2EZ0C 2R4RH 4G7VL 4I0PD 4Z5RA 3L9RA 4XAKE 3AS3A 3ZLQC 4FABH 1W0YT 3PHQB 3KYMA 4WFGD 2EIZA 5D7IB 1IEAB 2V7HB 2V9RA 5ISZB 3T2PA 3LEYL 2EH7H 1ZE3C 2E7LC 4M1CD 4PPTA 5IB4A 4JRXD 2NY1B 4KPHL 1MAMH 2AGJH 5AEAA 3CVIL 1J0HA 4E0RB 1WZLA 4NQDB 2BHUA 5IB1A 2FBJH 2ZNXA 2RCSH 5DYOA 3LKOB 3E8UL 4Z7VA 4P2QD 1M05B 2EDNA 4JPVH 4X5WB 1SYSB 3V6FA 4U1KA 1AGCB 1F45A 3O6LH 4C58B 4ZQKB 2B4CL 3PGDA 1KXVC 2HVJB 3MRRA 2CR6A 1BFSA 5ESVB 5AZ2H 3MBEA 1KNOB 3DECA 4MB5A 1Q9WA 5GRYA 3QNYA 3S3JA 1G9NC 1OGAA 3GMQA 4NQVB 1EHXA 4YO0B 3DV6A 4KQ4H 4X6BB 3GNMH 3PL6B 3MRJA 4PR5A 1WLHA 1DBKL 2PO6C 2JB6B 2VB5A 3LEXB 4TNWK 2W1NA 3V0VA 4G8EB 1NJ9B 3PXJA 3QDMD 3W9EB 1QLRB 2MSPA 3FN9A 3O45B 1IGFL 4NKIH 4JHWH 4DGVH 1UM6H 1G0YR 3GK8H 3UTQB 4S1DD 3FQNB 1AD0B 4QRRD 3NFNB 1RJYA 4NRZB 1EERB 3HFML 4L4VE 4NCC1 1OW0A 3SKMB 3QPQD 4WW2C 4MQ7A 4YAQA 1PBYA 4YDKH 4PJIE 1QR4A 2HFFB 1LEKB 5I6XC 3DUHA 2B39A 4OQTA 3EYOA 4XP9L 1SJEB 5BZWA 4HBQA 1FDLH 1JNLH 3SDCC 2DLEA 3IYLW 4J4PA 5H2BB 4QHUB 2X2YA 4HIXL 2A9NL 1KN2H 1S5HA 3S5LG 5C07D 1IQDB 3O4LB 5HDBF 4OFDA 1A0QL 5JHDD 3BI9X 4F7MB 3HE6B 3MV9A 4N0CD 4H25B 3GSQB 5IQ7L 2OJZL 4DKEH 4OZGA 4MJ5B 3VG0H 2K3TA 3SY0A 1U8PA 4RGMB 2PTTB 4NUGL 2EYSB 2Y36H 3LCYA 5TDOB 4HJGA 1P6FA 3EW3B 1C08A 4UV4H 4XZUA 1MPAL 2ED8A 3L3KA 5JXAH 2UZIL 3OXSB 5TF1H 1N0XH 3FQRA 5CP7B 3L5WB 2NY6B 3HZVB 3QG6A 1MHEA 1CIDA 1U2HA 2B1HL 1G7JB 5LXGH 4QTHA 3C08H 1NC2A 5I1DA 1LP9A 1AGDB 1QNZH 5IM7A 4OF6A 3REWB 3IB4A 1FZKA 3UTSE 2AKRB 4ZFFB 3O0RH 5GRUH 2E6QA 3GJFA 2A1WL 2A38A 4KH2A 4LASL 5EU7E 3IVKB 1N2RB 3H9YA 3ZKSD 3FB5A 5FDYA 1NGPL 5EOCL 2BZDA 1MAKA 3D69B 2IAMD 4U0QB 4G7YL 4ALAH 1FCGA 3P0VL 4ZMAT 2BNRB 2YC1A 3MUHL 3B9KC 4NN6B 5JHLL 4ZPTB 1KC5L 2NY0D 4XCNB 5DC9B 1GAFL 3ZE2F 4M6ML 5FKAA 5E24E 2ZUVA 3WLBB 4I3RL 4XGZB 3T77B 4EVNA 2NQCA 4KC3B 3A67L 3RWFB 4G7VH 1SEQL 5KSAB 3IT8D 5INCA 2R69L 2FWOB 1RD6A 2YBRB 4X80L 4YWGL 5ID1B 3ARXA 1JHTA 3LEYH 1TJHL 3VI4F 3HG1A 1KLFA 4JLRA 3AM8C 1R24A 3Q6FB 4W70A 5EU3B 5I9QB 4HULB 1AD9B 2CUIA 4DFIA 1FC2D 1UWXK 1NMBH 5F6HI 2OR9H 1KBGL 4PJ5A 4RX4A 4U1SB 3TPUB 1ONQB 3V6ZA 4U2YA 3VFNA 2J2ZA 3TVMD 1NCUA 3G5YB 1N4XL 3TH3T 3E8UH 3U7YL 2HMID 4ODWA 5HHOB 3BE1L 4B50A 1KIPA 4WO4D 2CH8A 2APWA 1HINL 3BZEB 2A6DA 3CFCH 4KZDH 2B4CH 3NIGE 1OTTD 3RKDC 2UWEF 4RGNC 4CN1A 4B7LA 4ZPVA 3DJ9A 1UZ6E 2CK2A 1FVEA 3QDAA 2OCFD 1IAKB 3OMZA 5GS3A 5KBNC 1INDL 3U9UA 4IDJL 1BQUA 3G6JF 3WE6B 6CGTA 2C3VB 2RFXB 4LPWA 4M7LL 2I9LA 3KYOA 3CX2A 3L3OB 4ZAKB 1DBKH 2BVPB 2DTSA 4Q74A 2CIKB 5HY9B 4R7NA 4HLZG 1L4IA 4S10A 4QTIL 2BRQA 5I74B 3D3VE 5D7JD 4PBXA 4AEIH 4MWFA 4KK9D 1CFVL 3SDXB 2FZ3A 1XMWA 1HZHL 1IGFH 4WVRA 2F54D 5CEYB 3IS0X 4ELMA 1T89A 3VH8G 5LVEA 5T3XE 3IGAA 3MJ9H 2X4NB 3QULB 3DRTB 2V2TA 1BVZA 1F6AA 3TO2A 4KK8C 3LB6D 4K3EL 5FYJD 2VZ3A 2WBWB 1WICA 5C9JA 1MEXL 2NY4D 5TE6L 5KSBE 1J86A 3IU4L 5SV4A 1RK1B 5C09A 1C1EL 3BEVB 4PP2A 4HFUH 5E4EB 2AJXL 5C0RL 1G7QA 1G7IB 3EOAB 4NCDA 4XP9H 3KXFE 4NKMB 2P8LA 5HGHA 3OF6A 4JDZB 1OAXL 2NMSA 2IFFL 1IAMA 1WBXA 5DR5H 1WT5C 5DQJB 1A6AB 5E9DD 5TGBB 2ADGB 2A9NH 4HIXH 1DANT 1CR9L 1OAZL 4A6YB 3VFVB 1I8LC 4K3HA 4FQXC 1FGNL 1S9XA 3DX6B 1A0QH 3TH4T 2CKBB 2OK0L 4AEHH 5J6GB 1XZ0B 3GZKA 4U0RC 3ULUD 4KV5F 4JN1H 2Z93A 4NNXB 5F9WB 3BP4A 1I7RB 2Z9TA 4PUBL 5CMAB 3WJJC 3P4MB 3WLWC 1A9BB 4JPWL 5FYLL 5KAQG 1JGDB 4QHMA 2IH1B 4Y16C 4MNQA 1MPAH 1CU4L 3VRLF 4G9FB 2VLJA 4LEOA 2FL5A 1X5AA 2Z4QA 1NGYA 2X7LB 3BN3B 2HRPL 3TBTA 2B1HH 2ATKB 5A40E 3H7LA 1PEWA 2QJDA 1LDSA 3MR9A 1TTFA 5D6DC 2YKLL 1PZ5A 4LSTL 5D1QB 1MNUL 1XFPA 2A1WH 2CRZA 1OARL 4LASH 4BSWA 4W6WB 5DF0A 1NGPH 2JCCB 2X9YA 5EOCH 5C7XL 3WIIL 5C0GB 1EDQA 1KIQA 3MRDA 3MRKA 4G7YH 4KRPD 4PB0L 5F7DA 3P0VH 1P84J 4XMLL 4HUUB 3WXWL 5JHLH 3QCUH 5CEZE 3OX8A 3ULVC 1GAFH 4M6MH 3QO1A 4BJLA 2AEIT 5E5UB 4EEEA 1C5BL 3BX7C 3QXAA 3JSSA 4OGAC 4FQHA 4I3RH 4X6CE 2DTML 2YD4A 4UMGA 3QPXL 3L3IB 1A6ZB 4RCAA 2R69H 1JGEB 4X7TA 4EBQH 3MA7A 4X80H 1FC1A 4POYA 1U58B 4LSSH 1F2XK 2CGRL 5IESH 5I1AA 1G84A 2NW2B 2Y07H 2NXYD 2K1MA 4LVHC 4OCYL 4NQEB 3KR3H 3VXQB 5CSBA 3QUZC 5DVLA 4MD0A 1KBGH 3WFZA 4ZXBB 1MCCA 1Y0LA 2DQJL 1S9WA 3LKQB 3S88L 5C0CA 1P9MC 3U7YH 5GS0D 3KG5A 3P4NB 3T8XB 1J1PH 1HINH 4PYHA 4PJDE 3EUUA 4TVSa 4OCNC 4JFXB 2EDDA 5T1LD 4GRMB 5K9OB 1CG9A 1A64A 3AU1B 3SKOB 2HWZL 2CMRL 1JHLH 3TPKA 1INDH 2WIIA 1XGPB 4PJGE 3BOVA 1R5IB 2HG5B 4YDIL 5BS0A 3H6JA 1FNSL 4PGDA 4Y4FA 3UC0L 3O2WL 5IK3A 3RWDA 1YQVL 1YUHB 1RFDL 3D85D 2ZKHL 3QDJD 3O9WB 7FABL 1UH3A 5I1EL 2ZCLL 4NN5C 1WZKA 3STLB 1ND0B 2Q1EA 4IRJB 3WUZA 5DJ0B 3V7AE 5GQBA 5DT1L 5ABDE 4FZ8H 3O6FC 2VMFA 3N06B 2M26A 1Z9MA 2QQNL 4CVXA 3DVNB 1CXFA 4L8CB 4QT5A 4F33A 1CGUA 4L3CA 3WCYA 3VXUA 1MOEA 4UT6H 4MJID 1MEXH 4PJCA 3LY6A 5E8DH 5ADOL 2AV1A 1YMME 3I75A 2ARJA 1C1EH 4K8RL 4WWKB 5C0RH 4N1EA 2HP4A 4AH2A 5C08D 3W9DB 5FIEA 4I3SL 1UXWB 1OAXH 4PTUB 4WNQA 1AO7D 1BZQK 4HFWB 5GGRA 3CX5K 2DQFB 2PR4H 5KANG 4GW1A 1GOFA 2AJZB 4PP1D 3QI9B 3BN9D 5DD6A 5CZKA 1FIGL 4M8VA 3N85L 2A6IA 5B3NA 5JW4M 2OK0H 5L7XL 1CLOH 3W39A 3GHEL 2QADB 4PUBH 2CLRB 3KLSA 4U31A 3PWJB 4HIJA 3X11B 5B4MD 2JE8A 1QYGL 4JPWH 2WLYA 2QLVB 1B0GA 5FYLH 3ARFB 1F5WA 5HDQL 3DTXB 4OKDA 1CU4H 4Y4HA 1JZ2A 4MQTB 1FAIH 3EKCA 4TTDD 2EDKA 4HZLB 5CHNB 5C0BE 1BGXL 4X99A 2A6KB 4AQOA 2AEPH 2FBOJ 4E5XB 1MIML 3L7FA 1VFAB 4JFPA 2HRPH 3O3EA 2XI9A 1C12B 5L8KB 5JORA 1SJHA 2RHEA 3RBSA 2YKLH 3AUVA 3IXTB 4QHNB 3PL6C 5BOZG 2ITCA 4GG6B 1A02N 2KZ1B 1EA9C 5JO5A 1OARH 4I48A 2A83B 2A0LD 4U7MA 3T3MF 2WZPD 2XNAA 4PJHF 3OJDA 5C7XH 2UUDK 2OXGA 3P9MB 1KJ3H 1QPPA 1RV6X 1S7QA 3TJHD 1WK0A 3IETA 1WBZB 5BV7B 4XMLH 4OF7A 3WXWH 2FX7L 2NY5C 4U1LA 1YY9D 2IANE 1C5BH 4HKBA 3X3FH 5B8CA 4ZG1A 1WAAF 3EJZC 2CRIA 3QPXH 1Q9OA 3SE4A 1M7IA 4JDVA 1T7YA 1TCMA 2D7MA 1CXIA 1CTNA 2QKIB 1JTPA 3IXAB 2CGRH 2NX5D 1K85A 4LLWA 2YUVA 1EIBA 3O11A 4HC1L 1U8JB 4KDWA 4OCYH 3MBXH 2FYYA 4L4VA 5IJKA 4QLRA 2ICEB 5GISL 5MP6H 2DQJH 1KJ2L 3S88H 3FRPG 4PJIA 4GAGH 4I2XA 2FX9H 3RVWC 2BY1A 6FABL 1ZANL 3MOAL 4LBEB 2LV4A 2MOVA 1ZA3B 4BQBA 5FO7A 3MA9L 3F7VB 5EN2A 4XB8A 3QCTL 3HE6C 1CFQB 4QYOB 4MCZB 2IADB 1IZKA 4M1DL 1GGIH 1SM3H 3OG6B 4ZO6A 5EU6E 1ZLSH 3PP4L 3QRFM 4U1NA 2HWZH 2CMRH 4DCQA 4JG1L 5JPMA 3OKLA 2GSIA 4P5KB 5D7LE 3U4BL 3RVTD 2XWJB 1IAOB 1FNSH 2E9BA 3UC0H 4FMKA 4ORZC 5D1ZD 5F7UA 5D7SL 5DZOA 4NO2B 5EUOF 4U6HA 5L88L 3FT4B 2ZKHH 1QEWB 2NY6C 3QNZA 3OXRA 2GFBA 4GBXA 7FABH 5I1EH 2ZCLH 3E1F1 1A6PA 3DVGB 4HJJL 2NTFA 4ZODA 3RWIB 4S2SB 2PYEA 5DGQA 4HUXA 1UADC 3U7WH 1I7TB 4NQCD 4XWGL 3SGDI 4RWYL 4YXKH 4F7PA 1T2XA 3VXME 3HAEH 1LNUB 1HYSC 3H7BB 2DOCA 4M7ZB 3SDDA 5CAYB 5ADOH 1NFDF 3UTSA 5IGXL 4NN6C 2EDJA 4JREB 4E41B 4IOIB 4JANB 1E27A 3DVFA 4K8RH 2P7TB 3U0WL 3PQYD 4U49A 4WJ5B 3IDXL 3WKML 5GIRA 1FFOA 1DQLL 3GI9H 4FFWC 1L0XA 1YDPA 4BQCA 4I3SH 4JY6B 2X4PB 2DM4A 3NA9L 5KAQF 5KSAC 1X3DA 1JWUB 2PETA 1QA9B 2V6HA 5TF0A 4MA7L 1DLHB 5CZVL 1MLCB 1A7PL 4OKVB 1NAML 1C16A 4PJ8B 1IE5A 1T0NA 3N85H 5I9QC 5I0DA 1ZSDB 1BOGA 4UBDD 1G7LB 4TVPL 5E03A 2FB4L 2GJZA 3GHEH 4CUCA 4R7DA 4D9LH 2VC2L 2GTWB 3QRGH 5CJQL 2AJUH 1FYTB 4YIQB 5HDQH 1KSRA 4IRSA 1QQDB 3P0GB 1DVFA 2P44B 5KN5A 2NYYD 5JXEC 1BGXH 3TBSA 1XF2A 1TFHA 3RVVD 4D2NA 3MLRL 2DD8H 3UTOA 2VUOA 5F1IA 4YGAB 1KJVA 1EJOH 1H3VA 3FTGB 5GXBB 4LLUB 5DD3L 2PN5A 1D7FA 4N5UA 5DJXA 5FHAL 4ZAKC 3FN0L 43C9B 1XGTB 2P48B 1HKLL 1RZGA 1FJ1A 1A3LH 2JTDA 1IGJB 5K93A 1VDGA 2IPKB 5HHMB 4GT7A 2R2CA 1FZJB 3CMOL 4NZRL 1P7QA 1AGEB 2B2XL 3S36X 3GI8L 2Q6WA 4PJBE 5F97E 2APBA 2EYRB 2YEZB 3D3VA 2FLRT 4NCC2 3JUYA 5GGSB 5SWZA 4F2MB 4KUCD 4EI6B 4NHUB 4P9MH 1MFDL 2DQIH 3MUZ1 5HPMB 2KL6A 1S7TB 4XBGA 5SWSB 4BFIB 4FS0A 3K74B 3EYFB 1FZOA 4O5LL 2JJTA 5ANME 1G6RB 3GJEA 3SJVD 5JW5A 1A8JH 4C56E 3T0BA 2HVKA 3ULVE 1IAII 3TN0B 2XQYG 4L29A 1KJ2H 4JGUA 4L8DB 2X1OA 2FO4A 1T0MA 1J8HB 6FABH 1I8MB 1ZANH 3MOAH 4RBPH 1T22A 3MLYL 3KXFA 5KVGL 1QBLL 2YPLE 4CU8A 1L0YA 3MA9H 1C5DB 3LKPA 4M1DH 1UWGH 1FFNA 4HEME 1P1ZA 4M8QA 1VEOA 5F9WC 2FATL 3DLQR 4OFPA 2IBZY 4JG1H 5DD5L 5IVOA 3U4BH 3B3IA 2WSKA 4P2RE 5EC2B 4EQ3A 3P30L 1ZS8B 1N59B 1CBVH 3M8OL 3CFIC 2Z8VC 1P6AB 3S37L 5D7SH 4O9HL 2XWBB 3WJLC 5L88H 1PFCA 4M7LT 4J3OC 1ZLWK 3IDIA 2BNUB 5FKPA 5F7KC 3FB7B 4FG6D 4G8GB 4HJJH 1J1XH 1RZ8A 2G60L 1EEYB 1NH6A 3TT3L 3BXNB 1H5BC 5F7WC 5D1QC 4XWGH 1N5YL 1WFNA 4NM4L 3GM0A 3U4AA 2Y06L 1YEKH 4GH7B 4OZFG 3ARYA 3MGTB 1TCRB 4RMWA 3I6LD 3RZCA 1F8TH 2X9XA 5IGXH 1P2CA 4YPGA 5ILTL 1AKJB 3QWRA 3MFFA 4PJFA 2EDHA 2J5LB 2BMKA 4PJEF 2C26A 3IDXH 3WKMH 1KELH 1DQLH 5CILL 3GMRB 3L5IA 1R3HB 3NA9H 3FB6B 4J3TA 3GDBA 5GJTL 3U36B 3BPCB 1JCKA 2RQ8A 4Y5XA 1RZKH 3BEWA 3EFFB 4XMKL 3RWHB 4CVZB 3BMWA 5ITFA 2CDFB 4YC2B 5CZVH 4OT1L 1A7PH 1NAMH 4X6CA 2XQYK 4U7SA 4Z7UF 3S6CA 4YHNB 1P4LA 2GJJA 3IDMB 3WFBL 3TV3L 2FB4H 4EN3D 4FQCH 2VXVL 1NUFA 4C4KT 1FNEB 4ZXBC 1R3JB 5CJQH 1B4JL 3X17A 4MDJB 3TP4A 1HHJA 3C9NA 4Z78B 1J0ZA 4R26L 5D5MA 3AXLB 4UI2A 5D7IE 4E42B 2V5RA 4UINH 3BZ4A 4H8WL 5ISZE 1RJLB 4F3FA 3MLRH 3MLVL 4RRPA 4O2FA 5ID0A 1UJ3B 4LRIC 4G5ZL 4QOKD 3KLHC 3CH8A 1MCPL 3RPKA 1Y6MR 4PJDA 5DD3H 4FQIH 4HUVB 5CKGA 5FHAH 3FN0H 4NQDE 4BQ8A 2YUXA 4U2ZA 1EAPA 4GAFB 3MLXL 1AXTL 1QRNB 3C60D 5I1LB 5DEGB 5F7NC 4PJGA 3DO3A 1LEIB 1P53A 3DX9B 4LSVL 4ODVH 4JE4B 1OCWL 2AABL 5EZOL 3SDAD 2V5YA 5E99L 4NZRH 3CMOH 4X4ME 5E8NB 5AWNL 5KJRH 4IRJC 2B2XH 4HGWA 2XXCB 3WN5C 3RGVA 4DUVA 4ZUUA 3X13A 3KPOB 1EV2E 1T66D 4OLWH 4QKXB 1CL7L 5K33A 3VDCA 4P5TB 4BQ6A 1KCSL 4MDIB 1OL0A 2MQ3A 4LLMB 1MFDH 1OAQL 4LCYA 3GBNL 1DUZB 1EHLL 4NT6B 1ORSB 4LHQB 3K8MA 5I75C 4G6AD 5FK9A 1TJGH 4GSDL 4EXKA 4TRPL 1UM5L 1X6LA 3CSYA 1DQJB 3GMMB 4NC1C 3HZYB 1YMMA 3AS2A 4Z95L 1GZPA 4R2GB 1RIUL 2N56A 4URTB 3VCLB 4Q6IA 4GUPB 3MLYH 5KVGH 1QBLH 4NGHL 4O2CB 1TZHB 4RZCB 1QKZL 3MC0A 1U3ZA 2XYCA 5CD3A 3MRPA 3GIZH 3AC0A 3V5DA 3F7RA 5DJZA 3AB0B 1H15B 5GZOD 4NWTL 4GS7B 2O93L 1UQSA 4XNQB 4P4RA 1Q72L 1O7VA 4JFYB 5DDHB 2P5ED 1JNNH 4JJ5B 3ARFC 3FQTB 2JIXB 2J6EA 3EO1B 4RDQG 2FGZA 1RUAH 2W59A 1LK3L 3S37H 4O9HH 4P4KB 5D2LF 1A6TB 1FIEA 1K3IA 4P5MB 3O4LE 2DIBA 5KVMC 2O5YH 2H32A 1XIWD 3D2UA 1QVOA 4HK0B 2X89D 3TT1L 32C2B 4YH6A 4LLYA 1KPUB 4XTRD 2G60H 3TT3H 1FO0B 3NABH 4NSKA 3ZHKA 2DYPA 5C0BA 1N5YH 3PJSA 4G8FA 4OF0A 4NM4H 2FCBA 1E4XI 4HJ0D 2Y06H 1F11A 4MLIA 4PGJA 1GPOL 4NZDA 1WCBA 4PJ9D 2UWEB 1J5OL 4JZOA 5BV7C 4OF8A 1QACA 4J12A 5ILTH 3EFDH 4KTYA 5TPWL 1NEZB 3LS4L 3G6JB 3RWEB 5D7KD 2LTQC 1BFTA 1SHMA 1UXSA 4UNVA 5CILH 4J3SA 4X9HA 5B3JF 3QUXA 3U79A 3VRIA 3T0EB 5IFAL 1JGVL 1CK0L 4DQOL 1LO3L 1O0VA 3QUKA 4XMKH 1S9YB 5D4QA 5A43C 1UB5A 1TZGH 2IANA 2JELL 3PNWA 2J8HA 4BZ1L 2VR5A 2FO1A 3U0PB 4KROD 4FMFA 2BNRE 2X09A 3ZL4L 3PABB 3ARDD 3QH3A 4X8XA 4OAWA 2VZ1A 3TV3H 5HDOA 2VXVH 1ODAA 1L6XA 4P0DA 1B4JH 3ARRA 4P57B 2WWKT 5IV2B 3OGOE 4Z7NF 3RRQA 4R26H 1WZ1L 3MJGX 5GRJL 2WBKA 3BVNB 1DUYB 3V6BR 3G08A 3TZVA 1Z5LB 4FXLA 4H8WH 5HI5C 4GKSA 3BRGC 4XVUC 4M48H 1ETZB 5ITBL 1TTUA 5C8JA 1YC7A 1T1ZA 4KY1L 5ESAA 5FYKH 4I18B 1MCPH 3DYMA 4NO5B 4WUKH 5DTFA 3CNKA 2ZG2A 3MSPA 3DROA 5B22A 1TETH 5LAXB 4ZFZA 5EU6A 4KUCF 2Q86A 3PWPA 3MLXH 4GW4A 3L5HA 2FJHB 5HHOE 4APQB 3RWGB 3NCYP 4WHCA 5IIEA 4ODTL 1ZHBA 2AABH 4ZUVB 1JZ4A 5E99H 3OBAA 1PSKH 4XH2A 4MS8D 3EYSH 3KJ4B 4R3SB 5C2BL 1KTLA 4M1GL 2H41A 5GS2H 4F7TA 1EVTC 2F58L 5I8EB 5IJVB 1W72B 4PRPD 1OAQH 1W0VB 4UQ2B 4M7ZC 1OP5K 1B2WL 1LO0L 3GBNH 1OTUC 1SEBA 3UTZB 1OF2A 5IVXE 2MPAL 4U1MA 3TO4A 2LU4A 4P9HC 4H5SA 1KCRL 3OTTA 3ALXA 3IRPX 3SDXE 5KSVB 3QYCA 2GCYB 4GSDH 4JM2A 4TRPH 4NKQB 4LSUL 3T1WA 3KPPA 1ZHLB 4X6FA 4I0PB 5GRVK 5CKAA 3RDTA 3H9HA 1EUUA 4FTVD 3DUSA 4Z95H 4D0CA 2FX8L 1EAJA 4KI5D 1RIUH 5IKCA 3T0DA 2AJYH 5I71B 4NGHH 4HWBL 4PJ8C 5C1MB 1YN6B 3K8LA 2IALB 2J12B 3TIDB 3FO1A 4JRXB 1FL5B 2AXHA 2AXFB 2DQTH 3FT2B 1A7NH 4KK6C 3CPLA 1Q72H 2V2XB 4BH8B 2PO6D 1F6LL 4UDUA 4Z6AT 4W4NA 4MNGB 3WIHL 4P2QB 3PF2A 3MRCA 1CDHA 1S9VA 5K9QI 2P8MA 4YHOL 3C5SA 4ZO8A 2CK0L 4PGBB 1W0WB 2DDQL 3TT1H 4IM8A 3KS0H 1KUMA 4MX7B 5ERWB 4L8BA 5EIQA 1NCDL 5D1XC 5DJ6A 4XC3L 2ERJB 4WUUB 5CP3H 1W2KT 3AROA 1GPOH 1XF5A 4HV8B 4NPYB 2R29H 2ICWA 3AREB 3QDMB 4G9FE 2WWMD 5BXFA 5I19L 4G43A 1XGRB 3LS4H 3BDBA 4LHJB 1LGVA 3Q1SH 3BZFB 3SDCD 1HH6A 4WFFE 4GQPH 4QRRB 3WKNA 4CN4A 3F7QA 4OZ4A 4PY7A 4DQOH 4I8DA 2BNQD 4CBPA 4F9LC 5FAAA 4YXHL 3RI5F 4JHAL 2DMCA 4PJBA 2JCCE 3V0WH 1UJTA 2AK4D 4JRYD 2ICES 4IOFC 1NCAH 4N5EC 1KB9J 3ZL4H 1XCTB 1L9MA 1RSFA 1JYNA 3TN0C 3M1BB 3PG2A 5BMFL 3BP6B 4ODXA 3S5LB 2FJFA 2BSSA 1QSFE 3QUYD 2QHRL 1WZ1H 4M5YL 5C07B 4C56A 3V8OA 3GMPB 4GXVL 2ZZUT 1J87A 2F53B 5JHDB 3BUYA 4YBLC 3ILPA 2ZWLT 3PP3K 5ITBH 3RQ3A 1IM3A 2A9ML 1W72L 1ZHKB 5HBBA 4NQEE 2GT9A 4P2OD 3RFZC 2YPLA 3OAUL 2X70B 5DMIL 5KSUB 4GMSH 1FNHA 1Q1JH 1N3NB 3O3DB 1JF5A 2P24A 3VWKA 3B9KD 3T2OA 5MEOA 4XHJD 4ODTH 4X98A 2BOBA 1D5BB 4P2RA 1EO8L 4F80A 2R2EB 3HZMA 4Q6YA 2I9TA 4LMQI 3O6MH 4OCMC 1EO7A 1SBSL 5C2BH 4Q9RH 4M1GH 3SGKA 1NMCB 3LOWA 3MJ9A 5ESQB 3D18B 1RJZB 2H2PD 1GZQB 1B2WH 4XNMB 5EBWA 5I8CA 3KPNA 2D7QA 2V2WB 1X5JA 2MPAH 3ZDZE 3SO5A 5A16A 2GUOB 4HKXB 1KXTB 3C6SA 2NY0B 4I5BA 1KCRH 2J5LC 3MUGB 4YDVA 4YX2H 4OGXL 3QXUA 1CF8H 3KYNB 1XF1A 1SYVB 3WNKA 4PJHB 4RDQF 3F12B 2FX8H 2O5ZH 3MBED 4RGND 4YC2C 3RKDD 5C0AA 4HWBH 3Q5OA 4ODUB 3CH1A 3VWJA 2BHYA 1C5CL 4D0DB 3GMOA 1PYWA 3KDMB 3L5JA 3HUJA 3IKCA 1PX3A 3CDFA 1JWMB 3UDWC 4QXTA 4WTWA 5EU4B 3P9LB 4HKJB 3BISA 2C7UA 5J6HA 4S1QL 5IB2A 3TVMB 5H37H 2VQ1B 4ISVA 5DD0L 3BIKB 3WIHH 4NC1E 4B53A 4WO4B 1V3JA 4HH9B 4XX1G 5FA3B 1DEEA 1FSKB 5TQ2H 2UV3A 3SOBL 4OD1L 1UJ3C 4BKLB 2JJSA 1WZMA 1I85C 2VDPL 1TVHA 3WS3B 3VI3F 3PHQA 5E5MB 1IEAA 1DP0A 4KK8D 5BCAA 3JTTB 3VGDA 1R3LB 3MRQA 3MRBB 4KXZI 5CJBA 5D7JB 1HH9B 5I19H 3MGOB 1BVLB 1PW3A 4JAMA 4NQDA 3VH8B 3I6KB 5DZLA 2F54B 4J3XA 1G9MC 5FM8A 1M05A 5ENWA 4B5EA 5FCUL 4RMUA 5F7YC 3A6CH 4GG6E 2FD6L 3CUPB 4P5TC 2AK1H 4CU7A 1U8KA 5KS9F 2Z31A 4X4MA 1I4FB 2HVJA 4FQXD 5F96L 2G2RA 5EUOB 1E0OB 5ESVA 4TVPE 3HI1A 3G5VB 4OV5A 3LN9A 3PGFH 4YHLL 4YO0A 2YD6A 2ADIA 4YE4L 3O8XA 5FGSA 2ZUWA 3TA3A 4JY5L 5EH1A 4JQXC 3NA4A 4Z7WF 5F9JB 5D6CB 3FCTB 4NQXB 3ELAT 4Y16D 4RGOL 4TULH 5BMFH 5DUPH 1DBJL 3T3PF 4NBXB 4R2GC 4FXGA 5E9DB 2QHRH 1QLRA 3ZDYF 3I02A 1NC2D 3VFWA 2ESVE 3O45A 5CIPB 5C71A 1NFDB 4GXVH 3C8HA 1QFWI 1PJ9A 2QBWA 4HKZA 4NZUL 5KG9B 3IF1A 4JCLA 3ALWA 1AD0A 3AB0C 2XWTB 2DKMA 4YNYB 5IT2H 1DQQB 2A9MH 2XACC 5F1OB 3W0WB 4OD2B 3ZYJA 1CDCA 5DMIH 2LVEA 3VGHA 3CFDA 2MNUA 4HPOL 1J11A 1HN1A 2IJ0C 2D9CA 4LVNB 3VXNB 2J1KA 2W07A 1BPVA 4WDIB 1LDPL 1SJEA 2DAVA 2W60B 1A9EB 1BBJB 1EO8H 4NKDA 4F9PA 4OGAD 3RTQB 2BFVL 1S78C 3ROOA 3L3GB 4R8WH 5H2BA 3BT2L 1NC4B 1D9KA 4KTDL 4YK4B 2FIKB 4K3GA 5HJ3B 1FNFA 3CFKB 2R15A 3EGSA 2F74B 4PJ7F 4L1DA 4F7MA 3LSOB 4H25A 2WK2A 3GSQA 4K3JH 4KI5F 3GSVA 4KRPB 5HHPB 4MJ5A 3I85A 2G5RA 4RX4D 3SGEH 3GMLB 2DWDA 3QUZD 5CEXA 4JFHD 4RMQA 3CXDL 4OGXH 2X44D 4XBEL 3MNZB 5EBGA 3T0EC 2R4SL 3U6RB 3MODL 5AUMA 2VDLL 3WFEL 3HZVA 4M9PA 3QIWA 1AGBB 5BJTB 1YC8A 3BFOA 2H3NA 3REVA 2FECI 2NXYB 4L8SB 5AAWA 1TVBB 1C5CH 4ZFFA 4E41E 5B38G 2EKJA 5DVNA 1U6AL 3HCVB 1N2RA 1DBML 4XPHL 2DQEH 1H9VA 4S1QH 5J4MA 5DD0H 3VFPA 3G04A 1E6OH 1E4JA 3EYQC 2NY7L 1BD2A 4HHAA 4WI7A 4XCNA 2VR9A 2W0LA 4NKOB 5T1LB 3BQUA 1U93A 4GLRH 4POUB 3WLBA 2CSPA 3T77A 4NO0D 2CLVB 2R23B 3DGGB 3ZTJG 1N5AA 1K2DA 3AVEA 3PHOA 3O6FD 5HYIA 5HHXL 2H9GA 4I18C 5FYJL 2QSCH 3W2DL 3GBML 3HRZA 4XBPA 2NXZD 5C0FA 4EJ1C 5KZCD 4MAUL 4RAVB 3NIFF 1T21A 5C09D 2WIMA 3RJQB 1F3DJ 1AI1L 5EU3A 2NNAA 4YJZL 4LKCB 4APQC 1AD9A 2OTWA 4KQ3H 1NBQA 1WSST 3D39A 3D85B 2X4OA 3QDJB 1I9RH 4RFOL 3OF6D 2HT3C 5HYJE 3CC5B 1UWXH 2DKSA 5CUSL 4JFED 4OLXL 3KJ4C 2DRUA 4XPBH 3G5YA 4CJ1A 1BECA 3NZ8B 5J13C 5HDLA 3BZEA 5FCUH 1MJUH 2OTPA 2FD6H 4ONGL 5JR1L 3ARZA 2OL3B 1ED3B 5F96H 3V6OC 3ULUL 1CD1A 4DK3A 1IJ9A 2X1QA 4MJIB 1ZTXH 4JRWA 3HC0B 5HHME 3LPWA 1QBML 5CLWA 5GRZA 5C08B 5FUCC 5HY9A 3BIBX 1K4DB 3LS5L 4BFBD 5IVXA 4RGOH 2FJGA 2XZCL 4I3GA 1WGOA 1X4YA 5I71C 1LO5A 2QR0A 1JNHA 1UENA 1UACL 4NZUH 4ZSOB 5SWSE 5H35B 1KLGB 2X4TA 2X4NA 4PJEB 4LAJH 1TQBB 2VZSA 3FMGH 1EHNA 2HN7B 3TH2T 4X6EB 5T3ZD 1I1CA 1K8DA 1JI2A 3UCRA 1S3KL 1BM3H 3W11D 5HYFA 3ECBA 3TNMB 1I7UB 5IVZA 4KKNA 5E8EA 4JQIL 1CI5A 3BEVA 1UCBH 3OKEB 4Z7UB 3T2NL 1G7IA 5F7FA 4NQTA 2HJKB 1UB6B 2C4FT 2VLKA 3GSRA 5ADPL 1IEHA 3TIEA 4PRAB 1MVFA 2BFVH 3E6HA 4Z7VF 2LVCA 1PEZA 1YYLL 3F7PC 4KTDH 1Z0NA 2ERJC 3BHBA 4NZTH 1HCVA 1Z2KA 1I1FA 3OKMB 1KCVL 5D93B 3BYTA 1XZ0A 4K9EH 4M3JA 5HYSA 3AREC 4NNXA 5JOEA 1A9BA 5C0CD 5KTEL 3ZE1F 2BJML 1BAFL 3CXDH 1R5WB 1P5UA 4S1DC 4G8GE 4AIZB 3RY4A 3RWJA 2R4SH 3RVWD 3MODH 4LMQE 1U95B 3WFEH 5E6IC 3LQAL 4CDGC 3MROB 3CU7A 3BJ91 1MRCL 3QQ4A 4I0KA 4QHLB 1N6QL 2NX5B 1A1OA 1I9JL 2WUBH 3C2AL 1LEGB 3R1GL 4K7PX 1JGUL 4Y4FD 1D5IH 1U6AH 2JCCA 1DBMH 2M2DA 5C0GA 4XPHH 2P5WD 3BIAX 2BX5A 1A7RH 3O3BB 3P4OA 3VFRA 1MRDH 4LPUA 5DHVB 1U3YA 1F00I 5J0BA 2MCPL 2NY7H 2NY6D 4DJMA 1A4KA 4H26A 3ZSSA 1BFVL 4XCEB 1T1WB 2IF7A 5ICYB 5JDJA 2D2OA 3JWNC 4F7EB 1QSFA 3EYVA 3L3IA 1KEML 4OGYL 1BLNB 2F8OA 3PWNB 3W2DH 3GBMH 5DJ8B 5DLMH 1T1YB 4LP4A 1HYSD 4UNUA 3RVUD 3RIFF 3BGMB 2NW2A 4OFVA 5D1ZB 4ZOBA 3QXDB 5I18H 1ZT1A 3C5ZA 4OZGF 3SKUD 3VXQA 4RFOH 3S4SB 4ETYA 1JMXA 3FONA 5LWYH 3DXAA 1VFMA 5CUSH 5DK2A 4OLXH 3QEQD 1AIFA 3B8SA 1PKQB 4NOBA 3GM8A 1XH3A 4LLVB 1QSZA 2M8XA 1NMCC 4U6YA 4Q9QL 5L9DH 4NQCB 4HDIA 3WFCL 4PJXA 4ONGH 1LWRA 4KKLC 3PIQB 5K9OA 4RMVA 5IWLC 5D2LB 3G9AB 2I5YL 3ULUH 3SKOA 4OFYD 1QRNE 5HDBE 1OB1A 1YJDL 1XGYH 2NY0C 1LQSR 3TJEL 1T2JA 3PQYB 2ATPA 4ZFGL 2OZ4L 2VWEC 3BH8A 1QBMH 4Y4HD 2ORBH 4YHIA 2BVOA 3LS5H 5EPMB 3D1MC 3U7AA 2XZCH 1AHWA 1KJ2A 3O9WA 3PWVB 2OP4L 5JXED 1KJMB 3MV7A 5EOTA 3V4PH 4PRBA 2BDNL 4MD4B 5FGBA 5FOBA 1UACH 1NKOA 1CVRA 2ZUQC 1ES0A 3S7GA 4OB5L 3BDYH 3QDGD 3OB0K 3VD9A 3HPJA 3T1FA 3RP1A 5DS8B 4L8CA 3KPLB 1DFBL 1S3KH 3TVMC 3PXHA 1ZHNA 5FCSH 2HMIC 3R06A 1G1YA 4QRUA 2G9HB 1QTYT 4JQIH 1AFVL 1FSKC 4IMKA 4WWKA 3T2NH 1B0RA 2RGSA 5EB9A 1IGML 3W9DA 2XICA 2D7TL 2W0KA 5DQ9A 1CT8A 1JRHH 4HS3B 3FO9B 5EZJB 1YYLH 3R8QA 4U6VH 4DGIL 3QI9A 5I1HL 1S7RA 1EFXA 5TQ0H 2EEDA 4P3CH 4LCCA 8CGTA 4WY7L 1KCVH 3EOTH 1WC7A 3QB7C 3S35L 5D7JC 1XR8B 3RUGF 1INQB 1MLBB 1MFEH 3ZTNL 4QWWC 3SBWC 1NGZA 2BJMH 1BAFH 1VFBA 2R1XB 3LRHA 3LPFA 5D2NC 5DI8B 2FLBT 1AQDA 2JK5B 1XCQB 3EBAA 1H8NA 1MJ7H 4PGZA 2EKSB 4ELKB 4AL8L 4XP6H 5I8OL 3LQAH 4O2EB 4DAGL 1ZT4A 4UB0L 1MRCH 1C12A 2V7NB 1N6QH 2UWEE 1I9JH 4NQSB 4ELMF 1NAMA 3GB7A 3C2AH 3R1GH 3IXTA 1JGUH 3SJVB 5F44A 3OKNB 3G6JE 3NFPB 1U91B 3ROLB 3JVGA 3HLAB 5D9SB 1HDMB 2Z91A 3LAFA 3T0EE 4Q2ZA 2BOCB 4PGEB 2IFGA 5F9OL 1OAUH 2AV7B 3ZSTA 3AS0A 2PYED 3Q5YA 3ABZA 4BFEA 4WEMB 4M6NL 5JW3L 5JUEL 2ESVA 1SVCP 3ISWA 1HI6B 4ONFL 4FQQB 3UTSD 5JNYB 4QRPE 2DBLL 1A7QL 1P7KB 4OCWL 4LVNC 5DEZA 3UAJD 1KGCE 2YN3A 1A14L 1PVHA 4GXUM 3I3DA 1U8JA 5DJYA 43CAB 2YD5A 3SHSA 1DQDH 3I3EA 3QEHB 1ZVSA 2ICEA 3MLZL 1XGUB 3RTQC 5J57B 3H9SE 3QUMB 1BIIB 1LO4H 4Q9QH 1A1NA 3WFCH 5DUML 1FVDA 4ZYKA 1JZ7A 2OMBA 3F7VA 4OZFB 1U3HA 2VISA 4QRQB 4QYOA 4MCZA 1BX2B 2IADA 4KKBC 4OIIH 2I25N 1PLGH 1VFUA 2Y23A 2P42B 2I5YH 2P45B 4KDVA 5F72S 1YJDH 4M7KH 3VGAB 5I16B 3LKSB 2H6PB 1E4KC 3QFDA 4ZFGH 3D25A 4ZXBD 2OZ4H 5DRZB 4NRXA 4KV5E 3STBA 2IQAB 1AHWC 2YD9A 1DVFD 4HSQA 1ZMYA 3CMGA 1MCFA 1XEDA 1QEWA 4N90D 1LE5A 3VU2A 5FGBC 1OWRM 4GRWH 3VRLE 5JIIA 2BDNH 4EOWH 7CGTA 4MD5A 2NXYC 1QSVA 2EEBA 4L8SC 5TE4L 2HRLA 1QFUL 3U46A 3KLHD 1Z9OA 5FF6B 1I7TA 2OTUB 4XCYB 5E1HB 3EOBA 4EN3B 2WQ8A 4N9GB 5KW9H 1DFBH 3P77A 3FQWB 1OP3K 5GS0C 3VFOB 3U2SB 2Y6SC 3SE9L 2R2BA 1P7QD 2R2HB 2VQTA 3G5ZA 4WFGE 3MV8D 1X5KA 2GHWB 1NGQL 2OQJB 4POZD 4WJ5A 4ZO7A 3CFBA 4R0LA 1X5XA 3I50L 1U8QB 3LKRB 5SWZD 1CYGA 5AD0B 1BFOB 4JRXE 1QA9A 4PBVC 4QOKB 1I7ZB 3LMJH 5IEKB 4X9GA 1MLCA 2RB8A 5F8QC 5A2LH 3IFOA 5T3XD 1BQLL 1EVUA 4DGIH 4GKZB 3RHWK 1T04A 1MFBL 4HWZA 2ARJQ 4C57C 4MNGE 1I9EA 4P2QE 3MRIA 4R96A 3C60B 5C3LD 3S35H 2HKHL 4AENB 5A2KH 2N7BA 2ED7A 2PCPA 4XVSL 2GTWA 2OM5A 4V2CB 4M93B 4UU9B 3DX7B 4JY4A 4LFHD 1D5XA 3C6LA 3B5TA 1FN4A 4U7KA 1QQDA 1RZKC 4LFHG 5DEFB 3NCBB 5HYJA 1WISA 4B7IA 4O4YL 1NLDL 1UVQB 4LKXB 2R1YB 1S7VB 4UB0H 1AY1H 5SWQB 4HAFA 2JJWA 3CK0L 4HIHA 3FTGA 3QDME 3D0VB 3MJ6A 3ESUF 2IBGA 5T1KA 3ALPA 3EO0B 3X3GL 1JVKA 5INDB 2W9DH 5DFTA 5C0DB 4QRRE 1IGJA 5KANI 4PJCF 2IPKA 4JN2B 3MRGB 4AQ1B 5EUKB 2W0FB 1NANH 4PP1C 5MEND 4JPKH 1NUDA 4QNPF 2EYRA 4L4JA 4Y19A 5E94A 3OAYK 1TQBC 2ICWJ 4F2MA 4DTGH 4EI6A 4NHUA 4ZUTA 1XR9B 2P5EB 5B4MC 5HPMA 5HHVL 3AY4C 3EYFA 4OCWH 1ZVYA 5C07E 4TUKL 5DK0B 1JYWA 1XIWB 1S7SB 4WI6A 5JHDE 1KPVA 3NCCB 3IJSA 4L8DA 3VXRA 2B0SL 3UTPD 4LSRL 4RAHA 4KMQA 1U3HC 3KPTA 4J7RA 5CSZA 3CZFA 3GSXB 3PV7A 1CFSB 5DUMH 2A0LC 3MLPA 3MCKB 3LEVH 1DSFL 3BWAB 2BVQB 5D93C 4O02L 3TJHC 4JZJA 4QHKJ 3QA3B 3U30B 3HTLX 2BP3A 4NUJB 4K07A 5ALBL 1ZT7B 1M7DA 3H3KA 1ZS8A 4RISL 1U8NB 3MGAA 4AZ8A 3UJIH 4WGVB 4XCFL 3ZKMC 1CXEA 3B6SB 2EXYC 1F90H 1HSAB 5CWSA 3MREB 4G8GA 1ZLWH 4RRPG 4KROB 5ACZA 5TE4H 2NR6C 5EIIB 2CQVA 3ARDB 4XPFH 5CCKH 4F7CB 4RQQA 5TFSH 1VACA 3HB3C 4KJPD 4XCCL 1AJ7H 3MGTA 5KS9B 3T3ME 2R1WB 3DMMA 3SE9H 4PJHE 5DO2C 3L95B 2GSGB 4ODSL 1QO3B 3TBWA 3HI6H 3RGVD 2B1AL 5DJAA 2VXQL 3CDGB 4KJYA 4OI8A 4L9LA 2UZYB 4ZFOB 4LNRB 2H45A 4Q58C 4Z7WB 5F3BA 2VE6A 4CVZA 1TVDA 4Y5YB 3BH9A 4MSWA 1WAAE 5I66B 1U9KA 1BQLH 4DZ8A 1OTUD 4P49A 4TQEL 1MFBH 4I77L 5CBEA 5CP3A 4PRHA 1YMHA 1B3JA 1KT2B 4JFZL 5IMOA 2XV6B 1VADA 3IJYA 1HILB 3IDMA 5IBLC 3T0AA 1XAUA 4XVSH 1IVLA 4HAGA 3C5JB 3I2CL 3BP5B 5HVHB 1H3GA 1NFKA 3RY6C 1MIEL 1P5VA 4CKVX 2VLLA 4Z78A 5LJYH 4CVUA 3B4NA 4G80B 1FBIL 4CMMB 2DL9A 2VAJA 3JV6A 4PRPB 4LQFL 4O4YH 1A6UL 3UJTL 2EH8L 4JHZA 1OLLA 1JN6B 2IPTL 2W91A 2C1OA 5F1KC 3UZVB 5JMOC 5JLZB 4HUVA 4KK6D 5B39A 4JM4H 4XP4L 3X3GH 2Q8BL 4Y2DC 2F54E 1FYTD 1QRNA 5I1LA 1T5XB 5DEGA 3ARGC 2PW2B 5BRZD 4OLZL 2EO1A 2H1PL 4PJ7B 2MTPA 3D2UD 4QY8B 1R6VA 4LVEA 2BVYA 2AXGB 5E8NA 1K5NB 4S1SL 5EUOE 4BSVA 5FYJE 3T08A 2VH5L 2X4UB 4LIQL 4NYLA 4XP1L 5EOCJ 5IEHA 4EI5C 3P2TA 3JWDL 4YBQC 5D1XD 3RPIA 4MDIA 2AEQL 4LLMA 1URLA 5K9KB 1QR1A 3NVQA 5HHVH 2YZ8A 4FXKB 3VRJA 1JF1B 1T5WA 3IS1X 4YUEL 4RFEA 5E9DE 2E27H 5GPRA 1QLFB 1JPGA 1OGTB 1MHCA 3DURB 3RVVC 1NFDE 4LAQL 4TUKH 3GKZA 3QO0A 3QUXD 5JW4N 4GAJL 4Z9KB 1DQJA 3GMMA 2VXSL 4HCRL 4K7FB 2B0SH 4IHOA 4UT7H 4WW1A 4AEEA 4LSRH 1YPZA 3ULUE 2DJSA 3VCLA 4PG2C 2Y7QB 5GRVL 4XP5L 2PXYC 3S96B 4RZCA 4H20L 1GC1L 4IDLA 5DJ2A 1A21A 4IOFD 1K6QL 2OSLA 5I6XB 2FGWL 4ZD3H 3BKJL 4PFEA 1CWVA 3ME0A 4RISH 3WD5L 3FQTA 5J1TC 1P4BL 1UZ6F 4EDXA 4G9DB 4NO3B 4N0YH 3EO1A 1RHFA 3KNBB 4XCFH 3H2WA 5DFWH 1FVCA 3TZVD 1J8HD 5DMGC 5TH2B 1A6TA 2BNQB 4ZFOL 3MRFB 1HXYB 4HK0A 5IP4A 2KBGA 32C2A 4OLEA 1KPUA 1BEYH 3JV5A 3LZFL 4HWBA 4JRYB 5F8RC 5BVJB 5EBMA 1YEFL 1SJVA 5T33L 1VGKB 2E7CA 3MO1B 4MXWL 3THML 1VHPA 3PWPD 1J0KA 4KZEL 2R0LL 1KIRB 4XCCH 1MUJB 2E8YA 3IFNL 4LCIL 1BWWA 5JPNB 3QUYB 3WIHA 1KIUA 4ODSH 1K8IB 1IGTB 1RVFL 3G6JA 4M43L 3O2VL 4PLNC 4U1JA 5F89A 2XY2A 5IMKA 3JBG7 5FHBL 2X4RB 3FO2B 4JPIA 4OFKA 5HPOA 4E9LA 5FB8B 1MCKA 5AYUH 4JO4L 1A4JB 5MEQB 4P2OB 3D9AL 2AJSL 1J0JA 3TO4D 5DJCA 1JTTA 4HXBL 3P4LA 5IOPB 3B9KB 4JFZH 1XF4B 2XY1A 1U8LA 4N8PA 2OXHA 1EGJL 2IPUK 2YXMA 4HPYL 3GSNB 4Z5RB 4QRPA 4FG6C 2EDTA 4WHYH 2R0ZL 4MJ4A 3WS6C 3KYMB 5IV2A 2EIZB 3NACL 4PRIA 3A6BL 1FV1A 4QF1B 1FBIH 4FQPA 1Q94A 1G9NL 4LQFH 5IB4B 1ZVHA 1A6UH 3OZ9L 3KYAA 3ZT6A 3H9SA 2EEAA 1D5ZA 3VGAC 5I1IL 3QDJE 2IPTH 2ILLA 3CLEH 3K3QA 4AG4L 5E00A 4C59B 4Z7VB 1GCFA 3L3DA 5LAXA 2Q8BH 2EDRA 3V6FB 4U1KB 2R8SL 4QO1A 1MWAL 3PE9A 1LD9B 2ICCA 3PGDB 4PG9A 1YQ2A 3T0VA 3UYRL 3WHXA 3ZYOA 4YR6B 3VGGA 1JUFB 4LLAA 4OLZH 5I1JL 2H1PH 1RQ5A 5CBAB 3MBEB 4RGNB 5F88B 1Q9WB 1V3MA 2D0GA 4PJFF 4MJ2A 1WCQA 3K81A 1BZ9A 5T1DH 3GBLA 1OGAB 3RU8H 3GMQB 4LIQH 4XP1H 1GHFL 4MJIE 2BVEA 1GIGL 1BP3B 3MRJB 4Y7MA 4ONOA 4PR5B 5IBTL 5LGKA 3QNXB 5C0ND 4EN3C 1PG7H 5IJVA 2AEQH 5D96C 1TQCB 5FM5O 25C8L 5C08E 4ACPA 4Y2OA 4X6CF 1TTGA 1J0IA 4YUEH 1AO7E 1ZOXA 3PWLA 2FH8A 1OP5H 2O61B 4OCXH 1I1AA 2GCYA 4ZSOE 3RIAF 4GAJH 4YQXL 1RJYB 1ZHLA 1F3JB 4I0PA 2VXSH 1IEBA 4HCRH 3H42L 4JFQA 2GY5A 1FE8L 4PJEE 5JIKA 4AIOA 5D5MF 1UWEL 5EO1A 1JPFA 3OGCB 4MQ7B 4YAQB 4MQXD 4H20H 1GC1H 1YN6A 4NN7B 3OR6A 3C60C 4JRXA 1FL5A 4W4OC 5LCVH 5BZWB 4WGWB 3EHBC 2F5AL 3Q5TA 1KLUB 1DEDA 2XTJB 4Z7UE 5C3TA 2FGWH 2V2XA 1U8HA 5GGRY 4M93C 5HHQA 2GTZA 4F58L 3WD5H 3SDYH 1WTLA 1S5HB 3PUCA 2XZAL 4MNGA 4P2QA 5CEZH 1BZ7A 1T6WA 1RUQL 5CGTA 2EDOA 2VUYA 3EYUL 5MERA 5HI3C 4MVBD 4FQXB 3G6AA 4X9IA 3D5OF 4KKAC 1C7SA 4OZGB 5D8JH 1YECL 3OJVC 1U8PB 4DKFH 3LZFH 1IFHH 4JGMA 2ZSWB 3QISA 2X41A 1YEFH 4MXWH 3HC4H 4XZUB 3THMH 3L3KB 4DN3H 4KZEH 2JIXD 2R0LH 5DRNA 5CD5C 4Y16B 4LCIH 3FQRB 4HV8A 4NPYA 3FO0H 2EE3A 3QG6B 3QDMA 4P2RD 1S7WA 1YNKL 3GSNL 3GRWL 4NRYB 3CVHH 2QEJA 4QTHB 3RAJH 1NC2B 5HTSA 1XGRA 3IDYC 3UPCA 1RVFH 4M43H 3O2VH 1FZKB 4G6JL 3VFUA 4HG4J 2NX5E 1S78D 3GJFB 4QRRA 5FHBH 2EIEA 4HF5L 3MXVL 4XNUH 3FB5B 2LAGB 3D9AH 2AJSH 1MI5A 1KTDA 1OT2A 4KAQH 5BQ7A 3U0TA 5C0JA 3RL1B 3S34L 2BXZA 2YC1B 5T5FL 4HXBH 5EA0L 5EDXA 1NSNH 3DSNA 1XCTA 3TWCL 3MRHB 4EVNB 3QEUA 1EGJH 4HPYH 4M61B 4NQUA 1EPFA 3IAGC 4U1GC 5INCB 1B88A 3SKJL 3BP6A 4XTRC 4K71B 1WFUA 1R3KB 3T65A 4NJAL 2ZUUA 3NACH 2UVFA 3A6BH 2JB5L 4PJAA 1AQKL 1JHTB 5C0AD 5C07A 4KHXL 4EIZC 3HG1B 4JLRB 4YHYB 3MCG1 3VWJD 2WUCL 1R24B 1G9NH 4GRLC 2UYLA 3GGWA 3MQIA 4LVHB 3U30C 4FQ1L 1YYML 1CICA 3SPVA 3PP3H 2XN9E 3V6ZB 5IW6A 3VFNB 3QUZB 1D5MB 4X6DE 2X70A 4AG4H 1Z0MA 4ODWB 1KIPB 2CIIA 1JMZA 2R8SH 1F42A 1MWAH 1CGSL 2A6DB 1PKQE 1RI8A 1GGBL 1HSBA 2C4XA 3UYRH 5I1JH 4NQCE 1FFQA 1FVEB 3O6KH 1D5BA 4HQQH 4G6KL 3RUGB 3U9UB 3BJLA 5D2LE 2VZOA 4KROC 5B38B 1GHFH 2I9LB 2UZXB 2LABA 1GIGH 5IBTH 2MHAB 3ARDC 3E6FA 4JG0H 4JO3L 1ZGLM 3BD5A 3PQYE 4NC2B 4R7NB 5E8PA 5HGBA 4BQ9A 2FDBP 3V95A 25C8H 2J6EH 3RVXC 2IAMA 3V4VL 3NCMA 1VENA 1X5ZA 4MWFB 5GSRA 1NBYA 4BZYA 1GJIA 2FZ3B 4LF3A 4HKXA 5GGVY 1PD6A 2HT3D 4HGMA 1MQKL 4ELMB 3IGAB 2KQNA 3KYNA 4KJQD 4NO0B 2V2TB 1F6AB 2AJ3B 1SYVA 2Y72A 4YQXH 3TO2B 3AMLA 3QR2A 1F97A 2Z31D 3O6FB 2WBJA 1FE8H 4LLQA 1OAKL 2VLRA 3F12A 3LV3B 1H0DA 2P47B 1UWEH 5B3JE 3C2SA 2NXZB 1Y6KR 5KZCB 1U8MB 2GJ6A 1FNAA 1CIUA 5C09B 4YHZL 4PP2B 3CSPA 4HS8L 4KJWD 3TA3D 5TDPA 2I60L 2P8LB 2VSDA 2ZSVA 3SE3C 5EU4A 5BZDA 1WBXB 3P9LA 1F13A 4UOW0 5HVHC 4JFEB 2YK1L 1JV5A 4LK4A 2XZAH 2J3SA 2W9EH 3BIKA 4JKWA 5FA3A 1RUQH 4H1LH 1S9XB 1OPGL 5J12B 4YHKL 3Q0HA 4MZ2A 2Z35B 2XQBL 1Q0YL 3JUZA 4Z7NE 3NIDF 5DRXA 1I3GL 4XMPL 4BKLA 3BP4B 3MRLB 2WP3T 4Q7DA 3WS3A 5E5MA 3MJ8A 5FA4B 1QSEE 4D9RD 3JTTA 4MNHA 4NBZB 4LDEB 4W6XB 4MNQB 4X9FA 1R3LA 1JPTH 2VLJB 4LEOB 2FL5B 3P0YL 3ULVL 1NGYB 3TBTB 5IMLA 4KI5C 1BVLA 3QXVA 2EC9U 5DC4B 5J9PB 3MR9B 1N8ZA 2IBZX 1W8NA 2F54A 2BCKB 1PZ5B 4G6JH 3S3PA 4JM2F 1D9KD 4IIQA 3LVEA 1CFNB 1GXEA 1LE9A 4HF5H 3MXVH 3HPLA 1VESA 2G5BB 1MCWW 3IDJB 4N8CL 1CDUA 5FOJA 3SJVE 1FL6A 3BGFC 1QHOA 1KIQB 3MRDB 3UPRA 3L7EA 3MRKB 4WUUD 1J1OL 3UEZA 5F7DB 4YHML 3S34H 3B2UC 2APFA 5EZIL 3QFJD 3BPNB 3OX8B 3CFEA 3ARED 4OZHE 5T5FH 3QO1B 2X5PA 4HMDA 5IBUG 1IBGH 3QXAB 3LH2L 1GGYA 5F9JA 4DFHA 4OD3L 5IROC 4NFBA 4KGJA 1CXKA 4NQXA 1CDIA 4OTXL 3SKJH 4X7TB 4NJAH 5E9DA 4IOSD 3QIWD 2BY2A 3VD7A 4KHXH 5E6ID 3TBYA 5JDSA 9CGTA 5I1AB 1NFDA 2WUCH 3HMWH 4ZOEA 5KG9A 1P7HL 3IAPA 2IGFL 1MH5A 2J7LA 1DQQA 1EJ6A 4Y5VA 3KLDA 4KUZL 2WWMC 3VXSA 1YYMH 2OBGA 1MFCL 5I76A 1Y0LB 2KKQA 1S9WB 4R4FL 5C0CB 1WQVT 5FYLD 2R56H 1BD2D 5B21A 2EIBA 4OLVL 4EUPH 1CGSH 3VXNA 1GGBH 2Z92A 5KOMC 1IGCL 3O41A 1G7HB 3B9EA 1CG9B 1X5GA 4GW5A 2F53D 1OAYL 4PY8I 5CJ5A 2CO7B 2WIIB 4NC0B 2X1XR 4WHTA 3EJYC 3I6LE 4PB9L 5BS0B 4L4TA 3TCXA 4Y4FB 3DVIA 5HJ3A 2D31A 4MA8L 5IK3B 4FQJH 4LARL 3RWDB 1JK8A 3LSOA 2P5WB 3D39D 3EZ8A 1IGYA 4HLJA 3G6DH 3QUYC 2X4SB 5FGCB 4LPCA 3HE7C 4Y4KA 4PTTA 1MQKH 4UQ3A 3NTCL 2DN7A 3OPZL 4UV7L 15C8L 1OSPL 1RK0A 1Z3GH 1IL1B 4CVXB 4F33B 2GITA 3GIVA 4P2OC 8FABB 3G5XA 4S11A 4KKLD 3VXUB 5DUBB 5JW4R 1ADQH 4PJCB 1L7TH 2YMXL 5BJTA 2AV1B 1IGIH 3I75B 2ARJB 1RZIA 3K8KA 1T03H 4N0RA 4K9EC 1TVBA 5L0QB 4HS8H 5L2KD 4XHJC 4AH2B 1KB5H 5EOQL 4M4PA 1BVKA 2I60H 3WFHA 4WNQB 1A1MA 3MTRA 3QEQB 1T7VA 1WWCA 4TUJB 2VDOL 1QHPA 4X0KA 4QOKE 4GW1B 5L2JA 4J3WA 4B0MM 4O51A 1JF6A 1T4KB 5DD6B 4YHKH 2H2PC 1GYAA 2A6IB 2XQBH 1Q0YH 4JFDA 1ROWA 1I3GH 1YNLL 3W39B 2VRAA 4HWUA 2CLVA 3B43A 5F6IB 4LCWA 5T3ZL 3QQ3A 4HIJB 4KPHH 2HA1A 4JO2L 3WNPA 1I3RA 3TBVB 3UBXA 3CVIH 5ACLA 3DHMA 3LN4A 1WBYA 3O3AA 2JJVA 4Y4HB 2F15A 3VA2C 2AVGA 3BKYL 2NY5L 4HIIA 4X99B 3D85A 3P0YH 3L7FB 1PG7W 3ULVH 3QDJA 4JFPB 1FFPB 3O3EB 4QEGA 3MBEC 5FECB 2VLKD 4M6AA 4N0UA 3WDHA 2NTSP 3LN5A 3S9DB 1HHIB 2C3XA 4ZDHA 2ITCB 2ZG3A 3UTTD 1NDGB 4MB3A 1KG0B 3QDGB 4I48B 2XPGA 2VXUL 1F4WL 2XNAB 4N8CH 3OJDB 1FFRA 1TQCC 3PV6A 4WEBL 5J1AA 3RL2A 1ED3A 2GW5A 3WXVL 4FFYL 1S7QB 3HAEG 3VMPA 1S5IL 4MJIA 3JTSB 1EHAA 5EZIH 5HYSG 3HC0A 4LSQL 5EIVA 5FM4A 4U1LB 1FNLA 1E28A 4QWWD 1UG9A 3HUJF 4HKBB 3L5XL 5B8CB 2E9WA 4OD3H 1K4DA 1Q9OB 4OTXH 1M7IB 4JDVB 1AO7A 4P59L 1OW0C 2P43B 2FRGP 1DR9A 2WV3A 5I30L 1HE7A 3HFMH 5I0ZA 1MCNA 2P5EE 4V1DA 4LLWB 4ZSOA 2IGFH 4NN7C 1ZKAA 2I07A 3BDXA 1KLGA 5E2VL 3HZKA 1DBBL 2FYYB 1TJIL 4OIAA 2XTJC 3VXPA 4PV8A 2DICA 1A2YA 1TNNA 4J4PC 4R4FH 1M6OA 4I2XB 3CSGA 3RNKA 3PHSA 4IS6A 4KTEL 2OZ4A 3TNMA 1I3VA 4OLVH 4P23A 2YPKA 2ITDB 5JIPA 3V4UL 4LIQE 3S97C 1IGCH 5EN2B 4Z7UA 2HJKA 1HHKA 1OAYH 4U1NB 4N68A 4DCQB 4D3CL 4PRAA 3KPRD 4G6ML 5IQ7H 2DQDL 2GSIB 3GUTA 2OJZH 4PB9H 1T20B 3W0WD 3ZKND 5BW7A 3OHXB 1NDMB 4NUGH 3EZJB 1MCSA 4LARH 3VI3E 5D7KE 5LBSL 5IFJA 3OKMA 4PREA 2JJUA 3C5ZD 4R4BA 3OXRB 2UZIH 2GFBB 2WQRA 3DXAD 5IW1B 2NTFB 3ARBA 1HWGB 4HG4K 3RTQD 2PYEB 3NTCH 3OPZH 1JZ5A 1NC4D 15C8H 2E6JA 1H5BB 3MYJA 4F7PB 3ZDXF 2DIAA 4RA0C 1J05A 2YMXH 3BKML 3DI2B 3UTSB 4KKBD 2NX5A 5IQ9A 5KS9E 1E27B 1K3ZA 1LEGA 3TYFA 1UEYA 3STZB 1KC5H 5EOQH 4QXUL 1FG2A 1YDPB 2LE9A 3FHAA 1CFBA 1I1YB 5IHUL 2YUZA 4K71C 3GSOA 1JPSL 3A67H 1U0QA 1SEQH 3MV7D 2VDOH 4Z7WE 2ZNWA 3FB8B 1EEQA 1GOHA 4MAYA 3FOMB 3K1KC 4YHYC 1T0NB 4YWGH 4QRTA 2IMMA 3T3PE 5A3IC 1TJHH 2WLZA 3VE0A 1Y18B 3ZDYE 2RJMA 5ICYA 1BOGB 1T1WA 1YNLH 3BW9A 2GJZB 4R7DB 3T4YB 4PRNB 1X6NA 2DQHL 4QGYA 4JO2H 1BWMA 1DQTA 1G6VK 3EJJX 3QIBA 3UP1A 5CFHA 4JKPL 2VDNL 3BGMA 3SCMA 5CJXA 4TPRL 4U4BA 1N4XH 1DVFB 1KULA 5D1ZA 3MMEA 3KS0J 3BKYH 3BE1H 2NY5H 1HOCA 2Y6SD 5MEPB 3DUUA 2XN9A 2HJFA 3F5WA 4X6DA 3S4SA 5F1IB 4Z7QF 4HS6A 4PRPE 4JDTL 4NNYA 4PRDA 3PWUA 5DA0B 4JZNA 3MJ7B 4DZBA 3DYOA 1BQHA 4IDJH 5DJXB 4UTBL 4NQCA 2SEBA 4M7LH 1EFXD 2VXUH 1F4WH 4OZIA 4KDTA 3PIQA 1JWSA 1OOAA 1RZGB 1FJ1B 3WXVH 1D6VL 4FFYH 4BSJA 4Q0XL 4C4KO 3EDKA 4LGRB 4LCUA 4QTIH 4LSQH 1P7QB 4PJ7E 4FTVE 2Q6WB 3MV8B 3PQYA 4KI5E 1IAIL 1T89C 4NOFA 1CFVH 3FT3B 3L5XH 4N0FA 1HZHH 2HH0L 1LK2B 1KCUL 4I4WA 3KWWB 1PX4A 3WN5B 5SWZB 4EKXA 4GMTL 3ULSA 4A6YL 3UZEA 1V7ML 5E2UL 3FL7A 2OI9B 5I30H 4FQ2L 1F6FB 2CKBL 2NXZC 4K3EH 4KRMB 4R4NC 4K23L 1FZOB 1JTOA 3HNTL 1NBVL 3GJEB 1KTRL 2CRMA 5TE6H 4D0BA 3VMNA 2VERN 3IU4H 2HVKB 2X1PA 4JGJA 5DS8A 5I75B 4X4YB 2R9HD 2AJXH 4RBPK 4L29B 5E8OA 3KPLA 3W82A 3OB0H 2IQ9L 1A3QA 2FO4B 2XFXA 3E2HB 1T7ZA 4HIEB 2IFFH 4KTEH 1T0MB 2G9HA 4M03A 5F70A 3BPLC 1KPRB 3V4UH 1CR9H 5J12C 3V7MA 1OAZH 3LKPB 3P73B 4PV9A 1FGNH 1P1ZB 4M8QB 4XXCA 2CKNA 2Q20A 4D3CH 1HEZA 2DWEA 5DMYA 3VA6A 1NGXA 2B5IB 3B3IB 3SGDH 3FO9A 4XVJL 4WCYL 4BUHA 3MOBL 5DRWA 1KYOJ 2A2QT 1S7UA 2XZZA 4JJHA 5E7BA 4CNIA 2GYSA 4WI8A 1RULL 5GS1A 3IDIB 1LO2L 1XR8A 3NIFE 2ZG1A 1QSEA 4CRPA 5FO9A 2BNQE 1QBAA 3KPQA 2FR4A 3E3QC 1RZ8B 5MENB 3IFPA 4F15B 5DI8A 2JK5A 1XCQA 5DZNA 2AK4E 1RZJL 1KENL 5IVXF 2EKSA 4LSTH 1U3HD 3MCLL 1MNUH 1ITCA 3RZCB 1G7MA 3MLTA 3AMKA 3W11C 1UT9A 3BKMH 3WIIH 4YPGB 3BPNC 3MFFB 4NQSA 4PJFB 3OKKA 4PB0H 2Q3AA 5DVOA 3QJFB 2BMKB 1FAKT 2VAAB 4QXUH 5ETUA 2VN7A 3OKDA 1CQYA 3NFPA 4YZFF 2LTQB 4MB4A 3VMOA 5IHUH 4Y5XB 3BEWB 3HLAA 2DTMH 3TEUA 1IKFL 1JPSH 4P46A 3ZKMD 4AT6A 4OZHA 5ITFB 2EXYD 2BOCA 4PGEA 1GGCL 4X6CB 2ZOKA 1P4LB 2VITA 3CGTA 2NR6D 5H8DA 4HUWA 1CLYL 2DQHH 3N1GC 3HB3D 3C9NB 5JNYA 1FH5L 1V5JA 4JKPH 2VDNH 3D6GA 4KMTL 5D5MB 4JFFD 3E0GA 4PLKC 3BZ4B 3HS0A 5DO2D 43CAA 1EXUA 5HVFB 4I13B 4OCRL 4F3FB 3J7HA 1N6UA 4X5XA 1RZFL 4BM7A 3QEHA 4O2FB 1OP9A 5ID0B 1NBZB 5J8OA 2JKXA 1KN4L 1JE6A 3B2VL 4RFNC 4PJDB 2J8UF 2Q76A 4JR9L 3S37X 4Y4FC 4YDIH 5ACMA 1A22B 1EAPB 4OZFA 4Z7VE 2W38A 4HMCA