5IW3A

Anti-cd20 monoclonal antibody fc fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structure of anti-CD20 monoclonal antibody Fc fragment at 2.05 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw3A01
4G7VL 1CE6B 5I9QC 4QY8A 4BFIA 4P57A 3UYPA 1CF8L 2Q7YB 4AT6B 3OB0K 1RZ8B 2NW3A 4TNWK 2YBRB 5IHBA 4FQPA 3CFKB 3DOSA 3NCYP 3LQAL 3SDAD 3MO1B 5I73C 4PJ5D 2HRPH 2A6KB 4OD1L 3WNMA 1H3PL 1H5BC 1EGJA 3JWDH 3ILPB 4KZDH 2F15A 2ZUWA 3TYFA 1F6AB 1T1ZA 4MAYB 5J0BA 4LP5A 1VPOL 2AV7B 1P4LA 4R8WH 1UGNA 2BXZA 2X9YA 4TULL 2NR6D 5JLZA 5GGUA 1RJYA 1IAIH 1T66D 5EZLA 5D1XC 4ZXBD 1Q72L 5KSAD 4DZBB 4LNVA 1T5XA 3HN3A 2AJYH 5JHDE 3TH2T 3EJZC 5IHUL 5JW5A 5C70A 3QULA 1ES0A 3KPOA 4ODTH 4JGUA 2DTML 5DFTA 5EULV 3SGDI 4NSKB 1EBAA 5HYJB 1I1YB 3OBAA 3HI6H 1ADQL 4HGMA 3S96B 1KBGH 3BAEH 2H32H 4LIQE 5EB9A 2CK2A 2D7TH 4JRYA 4R2GD 1LD9A 4YXHH 5IR1B 1S9WB 2FH6A 1DZBA 5BS0D 1UXSA 4HV8B 2EE2A 4NQSA 3JWDL 2LU7A 4KZDL 5JO5A 2H2SD 4ODBD 3P30H 1W72A 2NMSA 5J1SC 1F42A 4M3JA 2H8PA 1TPXB 3FO2B 3V6ZA 2AEQH 4OFVA 4NM4H 4NN6B 4Z7NE 4X5LA 4DK3A 4G6MH 4RWHA 3PWPB 3QEQD 3TBVB 2AQ2A 3LPGA 2BK8A 5FCUH 3HRZA 2MHAB 2AJYL 2C26A 4R6UA 4WU5B 3O0RH 2DLGA 4WEBH 2YRPA 3ZKXC 2UVEA 1VGEH 3F58H 4ODTL 3O4OB 5FUOH 2XXMB 3F7RA 2A73A 3O9WD 2VLRA 1NAMH 3QZWB 4FFYL 4OIIL 3UTTB 2VLJB 4M7LH 4N9GA 3VWJC 5KBNC 1AGCB 5D1QD 1S7SB 3HI6L 1SYSB 1KBGL 2ED7A 1CR9H 3BAEL 2D7TL 1T6VN 1BZ9B 3HPLA 3ZMRA 4YXHL 3FQRB 2WINB 4BUHA 2AV1B 4X6EA 1TZHA 4BFIB 4P57B 1C1EL 4X83A 2NY1B 1JNLL 4G6AD 1MSPA 2AEQL 4W4NA 4NM4L 3VGAC 4MA3B 5BZWA 3RZCC 1YPZF 3WLWC 4G6ML 3SO3C 2DS4A 1A3RH 5C0GA 5FCUL 2OTWA 4X7CC 2D7OA 3HNTH 5BV7H 1UADC 5GS2D 3O0RL 1ZVSA 3DJ9A 1U8MA 4WEBL 1I9RH 3Q6FA 3F58L 1VGEL 1T1ZB 2EYRA 5KSVB 1QR1A 5FUOL 4ZUVB 4BSWA 4Q6IA 3C5ZC 4V2CB 4J3WA 1S7WA 3ZYJA 1MCIA 2F53E 1P4LB 5J06A 1IM3A 1NAML 4Y1AA 1BWWA 4D0DA 4M7LL 5AYUH 5JLZB 4JZJC 4JPVL 5EZLB 2DQEH 3BUTA 1CR9L 3O3UN 2EIBA 3MUJA 4J1UB 1T5XB 2BSSB 1I8LC 4XBEH 5JW5B 3QULB 2OBGA 2JJSA 4LDEB 2CH8A 5JMOC 2R4RH 4G3YH 4UNVA 5ISZE 3KPRE 5ALCH 4EVNA 3ZDZE 1ZAGA 4G9FA 3HE7C 2E9BA 1BVZA 4LHUB 4Q7DA 4U1IB 3UTSE 4PRHE 5EOQL 4K55A 2YR3A 4ZMAT 1A3RL 3UBXI 1UXSB 2XRAL 1F8TH 4HCRA 3HNTL 1YN7A 5BV7L 1I9RL 4MNQA 4Z7OF 3X14A 2Z8VC 3TFKC 2GCYB 2YD4A 5ITFB 5HDBE 2H8PB 4X0KA 3V6ZB 5E1AA 2HJKB 2WIIA 4HDIB 3LS5H 5DQJA 1NCDL 4TUKH 5AYUL 3VH8A 3ULVD 3S88L 4X4XB 4XPFH 1N64H 1CDIA 5ICXA 5E9DA 5HTSA 1MQKH 2BSRA 1J1OL 4PJIB 4NUJA 3HRZB 4NC1E 3U6RA 3FRPA 4LVNC 4XBEL 1MJ8H 2VABA 2JCCA 5HVFB 1A4JB 1YMHA 2R4RL 4P23D 3D3VD 2VLRB 4FTVA 2BY1A 4H1LH 2CLZB 1DLFH 4N9GB 1MAML 1AC0A 3P9LA 4U6VL 1FE8H 5CEXA 4CGTA 1ZHKA 5KS9A 3S5LA 3HA0A 3HPLB 3ULUF 5ELIA 4JKKA 5FCSH 4X6EB 1TZHB 1F8TL 4GS7C 4Z78B 3H7BA 4M1CC 2WP3T 3BYYA 2G9HB 4XGZB 1DBKH 3L3KA 4G8FA 4OFKA 3ZSTA 2M2DA 2V9TA 1LEKA 5BZWB 3G5ZA 3LS5L 4TUKL 1TVDA 2ID5A 4PYGA 4XPFL 2I25N 2EYSA 4LVOB 1MQKL 4Q9CA 2OTWB 3BWAA 1ZVSB 5CIPH 3DX8A 2MPAH 1Z9MA 3Q6FB 2N56A 4RRPG 3O6KL 4ZFZA 2EYRB 1I4FA 4Q6IB 2VL5A 5AAMA 4AEIH 3C60C 1IM3B 3LV3A 4Y1AB 4C58B 4AEFA 3IB4A 3SGKA 3I2CH 4V1DE 1I85C 1A7NH 1MFBH 1HXYA 1WBXB 4LLWA 3O3DA 1QA9A 3GMLB 4PG2C 2YUVA 2H26A 1IAKB 3SDDD 4XPAH 2EIDA 3MBXH 4FQ2L 4PGDA 4YHPA 5D1ZB 2Z92B 3DWTA 2R4SH 1MLCB 4ZAKD 4YBLB 3OJ2C 3MA7A 1NAKH 1DJSA 1MFNA 1CFBA 4FQXD 4I0KA 3FQUA 1NBVH 4LCUB 3BKJH 1WCBB 3GHBH 4MNQB 1UH3A 3X14B 2VKXA 5C07B 3Q5OA 5E1AB 5IMLA 2WIIB 4ZTOL 3HTLX 2XZAH 3DGGB 3OXRB 3OGCA 5DQJB 3TNNB 1TVHB 5AD0A 5JW4N 1YY9C 3WS6C 5E9DB 1A7NL 3PWJB 3BH9A 4NRXA 1BD2D 4NUJB 4NKOB 4PGBB 4X98B 3VDBA 1P4IH 1MJ7H 5IW6A 4W6YB 2JCCB 3EZJB 4S2SA 4XPAL 2IANA 1TZGH 1YMHB 3DI3B 4AM0A 4F58H 5T3XE 3MBXL 4NC1C 5IB2B 2KUTA 4FTVB 1Z0NA 4PRIE 2ZUXA 4RSVA 1ZLVK 4RMVA 4C83B 3P9LB 5C0ND 1MCOH 4U6HB 4NO5A 5CEXB 3ROLA 1NAKL 1ZHKB 3NZ8A 1P7QA 3U4EA 3OKDA 5E4EC 4UT9H 3U7YH 1NBVL 1RQ5A 4CMHC 3ZYZA 1WAAA 4NO0A 1WIUA 3H7BB 3GHBL 1JGDA 3IFNH 1P6AB 4PBVC 4G8FB 4MAYD 3G5ZB 7CGTA 3DPBA 1WIOA 5IB3A 1T1YB 5C09B 4WFED 2HKHH 3HFMH 4EN3D 4PLNC 3VXTB 2PYEE 4HX1B 3CFDA 3H3PH 1MJ7L 5FGBC 3DX8B 1EZVX 3SGDH 3QDGA 2X1WL 1H8SA 4U1MA 2V6HA 4ZFZB 1TZGL 1I4FB 5D9SA 4F58L 2VL5B 3LV3B 2MWCA 4HZLA 3H2WA 4PRPD 4NQEB 3W39A 3G6JA 1T7ZA 3AVEA 3CXHK 1MCOL 1F11B 3TBWA 4ELMF 1HXYB 2PW2A 4LLWB 3O3DB 3T1FA 1JCKA 1IC5H 4N0CC 4UT9L 2P42B 4DW2L 2H26B 4KJPD 3D48R 4HIXH 3U7YL 4NCC2 5DD1H 4D9RE 4PGDB 1Q94A 1ZGLP 5JORA 3JBG7 2EECA 3IFNL 2ED9A 5HHPA 3QIUC 3O2WH 5FYJH 1GH7A 4ZOCA 3MA7B 3HUJA 1NBQA 1RZIA 4R4NC 2EDTA 5I1JH 2HKHL 5B39G 3HFML 2FJFA 2Y6SD 3FQUB 4MB4A 5TDPB 5INDA 1NUNB 4Z95H 2X5PA 3PWPD 4XXCC 3H3PL 2E5EA 3FFDA 1KJVA 3S4SA 1BJ8A 4K7PH 3I9GH 5B8CC 4XNUH 4KKAC 3BPCB 2ATPA 4MXQC 4K7PX 5IMLB 1G1CA 3MODH 1QFWM 5AD0B 4QHUB 2I9TA 4KJWD 4HC1H 1SVZA 4CN4A 3CU1A 3BH9B 4NRXB 3UTTD 4BFEA 1IC5L 1GZPA 3S7GA 5IW6B 5D70H 3TH4T 3ZE1F 4HIXL 2P44B 5IV2A 4YIQA 5EO0A 2IANB 4WFFE 5BW7C 1FV1B 2Z35A 3AGVA 4BA8A 4IDJL 4JRXB 1VCAA 1G84A 2OP4H 1OD9A 3T0DA 3O2VH 5DJYA 5FYJL 1GZQA 2HT2C 4LFHG 3VA6A 4HS3A 4FRWA 3D25A 4CNIB 3EJYD 5SWSA 3U4EB 5CFHA 3SDCB 5GGQH 5I1JL 2I27N 4AL8H 1MCHA 1QSZA 4Z95L 5EU3A 2JJVA 2EE3A 3AS0A 4FQQA 4NO0B 3PWUA 1AE6H 1JGDB 2DRUA 4FFVC 3D18B 5BS0E 4K7PL 5CUSH 4HH9B 1AO7A 2ZNWA 2ZOLA 4XNUL 1NL0L 1FVCB 4W81A 1ZLUK 1CXFA 3RNQB 2FD6H 5IB3B 4HC1L 4DOHE 2PF6A 4H8WH 4L8SA 4WTZG 3UBXB 8CGTA 2DIAA 3OV6A 4C4KT 3CFDB 4OFDA 3QEQE 4JFPA 5D70L 3QDGB 2OZ4A 4U1MB 5C08A 3QXAB 4BZ2H 3P3YA 4F7EB 1E4JA 3VXPB 4YJZL 3WBDA 5JDJA 3W39B 1FZJA 4YHOH 3O2VL 1OLLA 1RD6A 2OR8A 1MHHA 5D5MB 1H3TA 2PW2B 1YC7A 3K7UA 3LEYH 3T1FB 5GGQL 4LHUD 4J3TA 2HFEA 4OFYD 5EU4A 4HLZH 4AL8L 3CVIL 5EFIA 4MYWB 4X7TA 5EU7E 3TH3T 5J57B 4O4YH 4DGVH 4HUVB 1Q94B 1G9NH 1MY7A 2PR4H 1U3HC 5HHOE 2CO7B 1W0VA 3DECA 5E56A 1C7TA 4ZD3H 1MCKA 4RGOH 4D0CB 2X4OA 2N1KA 2FD6L 5HHNA 3V0VA 1I9IH 4G8EA 3GMOB 2FJFB 1RJCA 4H8WL 3WXVH 4M4PA 5C0BB 3MRKA 5LQBL 1AKJB 1HILA 3FFDB 2XA8H 5IROC 3G5YA 1KJVB 2BRQA 1XGQA 4G43A 3CU7A 1CFSA 3MREA 3VG9C 4BZ2L 1EMTH 1BQHG 1NFDE 3IJYB 5E7BA 4YHOL 4JPKH 3EOTH 4IMKC 2JKXA 5CJ5A 3BWUC 3BZEA 4GBXA 5DRNA 3DI2B 1NEZA 3P0YH 4BSJA 1GZPB 3NPSB 2V5RA 1VA9A 5IV2B 4YIQB 1KN2H 4HGKC 1J87A 3T08A 2LVCA 5GGSB 4O4YL 4ZS7H 3PIQA 1G9NL 5B38B 5DJYB 4GRLA 1GZQB 4LEOA 4ZD3L 1X6NA 4HS3B 4RGOL 3FT3B 5SWSB 4GLRI 1U8HB 3LDBC 2AABH 2R56H 1WWBX 3JWNC 4WU7A 3WXVL 5IK3A 2FRGP 5JQHC 5EU3B 3U30C 2NXZB 4MD0A 3B6SA 2DI9A 4UQ2A 1AO7B 1K6QH 3BH8A 3CPLA 1EMTL 1CDCA 5HYQB 1MCRA 3LN4A 4JPKL 5MENB 3EOTL 2Y9RT 4N0UE 1ITBB 1WT5C 2OTUA 2FSEA 4JFZH 4L8SB 4MX7A 3P0YL 4N5ED 5AYQA 1TENA 1R3HA 1CG9A 3QR2A 4F33A 3N0PB 4U6TA 3LVEA 4PJBA 5C08B 1KN2L 4HKXB 2W0PA 4ETYA 1J86A 4OGZA 4ZS7L 3NFSL 4NWTH 3IDIA 5JDSA 3WJLC 4YAQA 3TO4C 3IFOA 3SDYH 1LP9A 1FZJB 4DQOH 2C3HA 3PDGA 1K8IA 5SX5H 5D1ZD 3ZDYF 3D3VE 3KAAA 1MHHB 1HDMA 1GOFA 3WIIL 5EO1B 1FVDA 3NFPB 2P4AB 2AABL 4HWBH 2HFEB 5EU4B 3V6BR 3O9WC 4MDJA 2X70A 4IIQB 3H9YA 5FA3B 4NQDE 5KZCB 3TZVA 1K6QL 5K59F 1W0VB 5EU7C 1IQDA 5E8EA 3ORJA 1UJTA 4MNQD 4CVUA 2X4OB 1OD7A 1RUPL 5EBMA 4JG0H 5IVXE 1NC2A 3L3IA 5C07D 2N4IA 4G8EB 1MCEA 4JFZL 1D6EA 3ZKMC 5E9DD 4X7FC 4QXGH 3G5YB 2DBJA 1XGQB 4YDJA 5C9JA 1KJMA 2FO4A 2X4QB 2GW5A 4NWTL 5DJ6A 1QFWH 1ONQA 3QCVH 3SDYL 2P5WA 4JFQB 5FF6B 4DGYH 4FTVD 5F1IA 3BZEB 4POYA 4GBXB 5DRNB 4HSQA 1SYVA 4HWBL 3F62A 4PBXA 2XQYG 5ESAA 4N8PA 5E5MA 2GAZA 3WNNA 5HXMA 2JJTA 4PJGE 1LE5A 4MD5B 1FO0A 1INQA 4MJ4A 3P4NA 5F6IC 4RAHA 1NGXA 4GRLB 1JVKA 5IB4A 3U0TB 4PV9B 5KSBF 2VQ1A 5FGSA 1FL5A 4YNYB 4PJFF 4JG0L 1JRHH 1WVZA 1Q0XH 3FQTA 3UPRB 1FCGA 3L5IA 4MD0B 4ODUB 5LBSH 5C09D 3B6SB 4QXGL 2LVEA 1K3ZA 4UQ2B 2I07B 3QQ9D 4K23L 3BH8B 5IB1A 3CPLB 5I8CA 1EFQA 1RZFH 5CGMA 3QCVL 4R96A 4DUVA 4OUOA 4Y4HB 3SDXF 3WS3B 4DGYL 3T77A 2YZ8A 2QSCH 5GJTH 4PJAE 2OTUB 2V2XB 4NQED 4MX7B 2YK1L 3CK0L 4R3SA 2GJ6A 5E2WH 1R3HB 2ADIA 1I7TB 3LIZL 2H41A 4PJBB 4N1EA 2GT9B 1PEWA 5E2UH 3AREC 3ULVC 1KENH 3EFFB 4YAQB 5JDSB 4OM1H 4YHMH 5GRJH 3T3MF 3IFOB 4OFPA 3RVWC 1K8IB 2YUZA 3JWOH 2V7NB 1HDMB 1OP5H 2QBWA 1FVDB 2LU3A 1VHPA 3LKNA 5FO7A 3T0XA 2EDYA 4OZHA 2YA1A 4HJJL 5CEZL 4JFFE 3RHWK 4MDJB 4E42B 4D9QE 4OIAA 2B8OT 1B90A 4ZS6D 5LBSL 4X4YB 1TXKA 1R5WA 4BH8B 3TZVB 3ARGA 4Z7VA 4PREA 4RQQA 3TVMB 1BIIA 4WI2A 1IQDB 5E8EB 1RZFL 4BM7A 3LEXA 3VXRB 3O4LB 1NC2B 3K8LA 2O61B 2MQ3A 4Z7UF 2QSCL 1A21A 2VWEE 2AK4B 3V2AR 1HYSD 1G6VK 3CGTA 5KOMC 1D5ZB 5AZ2H 4YO0A 3CFCH 5E2WL 6FABH 1WQVT 4WFEE 3RHWF 4OCWL 4YDJB 5C9JB 1KJMB 2FO4B 3KYAA 2E7MA 1KENL 4ZPVA 4OM1L 4B53A 3MRDB 4HWZA 3BHBA 3ZL4L 2IAND 5JZ7D 4KTDH 2P5WB 4JRXD 5F71A 5F1IB 1R24A 2UUDK 2VXUH 4X6CE 1AGFA 2EEBA 1SYVB 2EDFA 5ESAB 4LGSB 5E5MB 4QRSB 2WAHA 4IRZL 4QOKA 3SDCD 5HYJE 3HS0A 5J7CC 1LE5B 5C0CA 3RVTD 1F13A 1NKRA 4JKMA 3C8DA 4LVHC 3S34H 3OAYK 3EYOB 4KKBD 3V6OE 4EI6B 1FL5B 1ZEAH 3OR7A 4I4WA 3RVUC 4R7DA 4NZUH 4MNGA 3LQAC 4S0TD 2XZQH 3NPZB 5AZ2L 2Y06H 1IZJA 1OOAA 4ZAKC 1FNEA 1U8KA 4Z7QF 4XCEB 1DR9A 1EDQA 1U41A 5IB1B 5I8CB 2PNDA 4FQXC 4LCYB 4KTDL 3VDCA 4P9HH 1M1SA 2DKSA 2ZOKA 1QPXA 1MCCA 2W9DH 4EUPG 1BFVL 3LKOA 4JAMA 2IPUK 1IEBB 3UTTE 3FN3A 2VLJE 3IDYC 4O51B 3O8XA 5LWYH 4Z0BH 4P5MA 4FQLL 2ADGA 3AAZA 4HPOH 2XTJB 4ZFGL 1JZ7A 1DQQA 1JGEA 1QO3B 3ARTA 3S34L 5KAQF 5IBTL 4YFDB 1PFCA 2W0LA 1CGWA 3LKNB 3MXWL 5FO7B 1JPST 4CMMB 4LMQE 3QQNA 5GS0H 4NZUL 1FAIH 3LSOB 2OM5A 4AH2B 1JWSB 4N90E 4UAOC 2X4SA 2O5XL 1FZKB 1NCCH 1D5MB 5DLMH 1UJ3B 3MOAL 4KHXL 1R5WB 5C0BD 3TBTB 2FGZA 3BP6A 4Z7VB 4RQQB 1HYRC 1AKJD 2XWJB 1AGEA 4ORZC 1PW3A 2QKIA 2D9CA 3LEXB 1QBLL 5KVMC 4P9HL 2W9LA 5GS1A 2MQ0A 1P9MA 3LRSB 4GXVH 4LK4A 2W9DL 4YO0B 2W1NA 2I60H 3UZEA 2A2QT 1FLTX 5D7LB 1F2QA 4WV1A 5JPNA 4JFOA 2EEDA 1HWHB 5SX4I 4MAYC 4GMSH 3QUXA 3MX0A 4Z0BL 3REVA 3P4MB 3O81A 4ZPVB 3CAFA 3F6LA 4HPOL 1IAOA 3OF6A 3BHBB 3BP5A 1NFIA 3QUMB 1R24B 3CXDH 2EDWA 2JJUA 4MA1B 1A6PA 1B0RA 4D9LH 3BP7B 5JPMA 5GS0L 3T0ED 2C9AA 4QOKB 2DQFA 1NCCL 1RHFA 3CC5B 4GW5B 5C0CB 4OZFA 3V52L 5IIEA 4JQVC 3QUMH 2YWYA 1OQXA 3OG4B 4JRYE 5I1DB 5DD3L 1UT9A 1DBAH 2XKNA 5D7JA 5E8DL 2CUMA 4Z0XA 4S1QH 4XB8A 2J3SA 3OR7B 3DIFA 3CFBA 3PHQA 4I4WB 5C0RH 1AO7D 3MRFB 4AQOA 3QG7H 2WQRA 1JZ4A 4R7DB 3T4YA 4MNGB 4TNVF 3V6OC 4ERSH 1XCTA 1LO2H 5KSUA 5MHSD 5MEND 1AY1H 3LZFL 5DC0A 1KGCD 2XKUA 5E8NA 2BFVL 3JV0A 1CGTA 1FNEB 1PYWB 4OGAC 3PP4H 4GMSL 4J3UA 4FS0A 1TPXC 3GNML 3BOVA 5C08D 1IT9H 2Y6SC 4OQ1A 2W91A 5J13C 1WV7T 2ZOKB 3N1GC 3B5GA 4YHIA 4D9LL 2C7UA 2X4PA 2VLRE 1MWAB 4WY7L 1ZS8B 4KJWC 4N0RA 5DQ9A 2HN7A 4X99B 5KZCD 5CD3A 3QUML 3TO2A 1DQQB 3HR5B 4HFWB 3RGVA 4YHLH 1M7XA 1DBAL 1EVUA 4NHUB 3AXLB 2G75A 5C0RL 1HQRA 4LU5H 1MCPL 4ETQA 3QG7L 3MJGX 5J12B 1MWAH 1X7QA 3MLWH 4MJ2A 4ERSL 1TCRA 3SE8H 1SJEA 1LO2L 5EUOA 1AY1L 3V6FB 2MOVA 3BXNA 1MCFA 1UWEL 4NCC1 1SJVA 3GSNH 4I3SH 3K4AA 1CXHA 3PP4L 4RMRA 2Q86B 2QR0B 4MA8H 4ZPTA 2NY1C 5JIPA 4NPYA 2QKIB 2FX7L 1CICA 1IT9L 2XOTA 2J8UA 4JJHA 1OCWH 4XAWH 5GS1B 1FFQA 1XF3A 2H1PH 3OAUH 3GSVA 4Q9RL 1ETZA 3RA7H 1ZA6A 4Y1AE 4KXZI 4WV1B 1WGOA 4JFOB 5JPNB 5J11B 1XR9B 1OTTD 3N50A 3QUXB 2IPKB 3REVB 1YYMH 5C0IA 5CEZD 5MERB 5DJXA 3BP5B 1IGTB 4CVXB 1CLOH 4XWOD 1FDLL 2R2EB 4YHLL 5D6CB 1YPZB 3BYTA 5L2JA 5HHVH 3RX7A 1B0RB 5JPMB 1MWAL 3U4AA 4Y0GA 3QJFA 4YZFE 3KLAB 3I6GB 2APVA 1E6OL 2DQFB 4G9FE 5TDNB 2RFXB 5ADOH 5MEQA 1F90H 4UDTA 3FB7A 1EUUA 4YH6A 3LQZA 5IIEB 4I3SL 4E0RB 4MA8L 3U7AA 2XKNB 1GJIA 5D7JB 4Z0XB 4AYFA 3PHQB 1HINH 3OB8A 4JGJA 2JIXA 1T21A 3HE6B 1OCWL 3QQ4B 1I1AA 1NDGA 3GSWA 3T4YB 3VI4F 5J89A 1DVFA 5JQ6H 3QCTH 4MNQE 4F15B 4NNYA 5KSUB 2EXWD 4Y4HD 4U0RB 1T1XB 2AJ3A 3DSFH 3H7LA 3RA7L 3VCLA 5IG7A 5E8NB 3PP3K 1Z0MA 2G60H 4G8IB 3JV4A 1ZHLA 3E1F1 3ES6A 3NA9H 3MOBL 2VZVA 1NMBH 2BVPA 1YYML 5E9DE 3RKDD 1KCVH 1CLOL 3QFJA 4Q0XH 3EUUA 1CD1A 4P99A 4Y2OA 5HHVL 4LSRH 2JCCE 1NCUA 2C7UB 3HAEH 2X4PB 3KNBA 4FTVE 4MLSA 3LKRA 5FAAA 4Z77B 4OV6F 1X5JA 4JM4H 1AGDB 1F4HA 5ADOL 5C8JA 3NN8A 5DQ9B 2HN7B 3ISWA 2VZ3A 1G6RH 4JKPH 4O2CA 1VFBA 5CD3B 3TO2B 5KS9E 4RBPH 5ACLA 3KLHD 1J0ZA 3RGVB 5CWSA 4PJEF 4KRLB 1FVEA 4QTIL 1O7SA 1HINL 2G75B 2KQMA 4JN1H 5KJRL 1GGIH 3TZVD 3EDDA 3TVMD 3VXMD 4HG4K 4JR9H 1UXWA 1X7QB 3TBSB 1NBZA 1X5ZA 3QCTL 4Y5XA 5FDYA 3VXRD 2GEEA 2RB8A 3O4LD 1NC2D 2Z31B 3DSFL 4HZAA 4NDMA 5CJBA 5A43C 3MYZA 5E6IA 4AG4H 2AK4D 2G60L 4NN7B 4KQ4H 1D6VH 1T2QH 4ZPTB 5DEZA 3QDJA 1S5IH 3F8UB 1WLHA 3SKOB 1CICB 1YNTA 4Q0XL 5L8KB 2IMMA 1JHLH 2V7HA 2ZG3A 3AUVA 3GSVB 3LKSA 4FN0A 3TCLA 1IKFH 4NZDA 4MQSB 3L6FA 5DEGB 5MI0B 1AD9A 3QAZB 4NBYB 4JM4L 2Z8WC 5A3ID 4Q6IC 3KPNA 3C6LB 1KTRL 4BYHA 4JKPL 1HHGA 5I1IH 3RNKA 4JO1H 2J6EA 5JXAH 1MIEL 1S7QB 1EEZB 4N5EC 3GMPA 4PP2A 5HHMB 4U6XA 3CZFA 4HIIA 4JN1L 5FHBH 2CLVA 1GGIL 5MP6H 3VD9A 4LPUA 1N6QH 4JR9L 5DDHA 5ETUA 3H9ZA 1GGBH 1A6AA 3BUYB 2QQLH 3OMZA 3F5WB 2JJSC 4G9DB 3G5XA 3ZDXE 3QXDA 1OP9A 2GITB 4AG4L 3L3HB 4KQ4L 1D6VL 4PLKD 1YDPB 1T2QL 1S5IL 4YBLC 4OI8A 1I9EA 3EOAB 2JIXB 2BVOA 5F7KC 1T21B 4ELMA 2AXJA 1JHLL 2VDOH 2GFBB 1UZ8A 4BH7B 1DVFB 4QWWC 3MRLB 2AXFA 1IKFL 2AJ3B 2UWEF 4GH7B 3U9PH 3MJ6A 3IAQA 1ZHLB 4NUGH 1OAXL 2BVPB 3K4ZA 1H3UA 4PBWD 2GIYA 5GS0D 3UTOA 5I1IL 4X8XA 1BOYA 3QFJB 1JZ3A 5JXAL 3ULUL 4LDOB 1JYNA 2HYMA 1CD1B 5F9WB 4IOFD 3L95A 3ET9F 3VE0A 1FNGA 5MP6L 2IANE 4LLQB 2AVGA 5KW9H 2C3WA 1GGBL 5CCKH 3LKRB 2OS7A 5ANMA 2YD9A 4LRIA 1UA6H 2P5EB 5MEOB 4B7IA 5D8JH 1YN6B 4O2CB 1VFBB 1MHCA 1UG9A 4POUB 1A6ZA 4WO4A 3TPUA 4O9HH 2YD6A 5CWSB 5JW3H 1FVEB 3WIHA 4P2YA 1H3VA 4AQ1B 5B3JE 1UM6H 1WAAE 3BQUA 5T33H 5ALBH 3VXSA 5GZOD 4UTAH 5HI5D 4B7LA 1NDMB 2PCPA 2AGJH 2YSSB 4MHHI 5E6IB 2VXQH 5IBLD 1U8LB 1VGKB 2W0KA 3ARQA 2NY2D 3C5SA 2J88H 3BZ4B 5D7LD 1X3DA 1YJDH 3QZWG 4RAVA 1YQ2A 4HIJA 5GRUH 3VGFA 3QNZB 4FFWC 3FB6A 3LKSB 1JUFA 4PRNA 3QDGE 1YEHH 1DEEA 3ARBA 3OR6A 5KW9L 5L9DL 4QRRA 1ZWIB 1I9JH 1QLFA 3L6FB 3HPJA 3RIFF 5CCKL 3G6JE 1ROWA 1UA6L 1DLHB 3HZVA 1ZGLM 5D5ME 1HHGB 2YD7A 5HI4D 5IM7A 4QOKD 1JE6A 4LSDA 5F7DA 3RNKB 5C0CD 4O9HL 4Y4FD 3GMPB 4YDVA 5JW3L 4U6XB 3IJSA 4HIIB 2CLVB 5I1KH 3KXFA 3QQ3A 3RX5A 2GUOA 5T33L 5CZVH 4L3AA 5ETUB 5CLTA 1GL4B 4UTAL 2YRZA 1A6AB 3BJLA 4OKVA 1SEQH 2HT4C 3G5XB 3DETD 1X5GA 5E1HB 3QXDB 2Z93A 3UAJC 1VERA 4Y5YA 4G80A 1G1YA 2VXQL 5DD0L 3HUJE 1N59A 3TJHD 1C08A 3WFCH 2J88L 2ADFH 3X17A 1YJDL 4IJ3B 5F7LB 1NLBH 5C0BE 1IILE 2D9QB 5EIQA 3TC9A 4HXBH 4ELMB 5DK3A 4ZS6C 1YEHL 2B2XH 2AXFB 3T0BA 3PHOA 1FFNA 3LB6C 1ZXQA 1I9JL 2Y1VA 4N0YH 1XCQB 2Q76A 1AFVH 2Q20A 3L5XH 4YXLH 3PQYA 1CXLA 2XPGA 1LO3H 1I7RB 2DD8L 3FMGH 2ICCA 4LHUG 3VE0B 5IGXH 1FNGB 1G7IA 3F65A 5DGQA 5CZVL 4AEHL 1MAKA 1XGUB 1C5DA 4R26L 5ANMB 2FEEI 5GRXG 4OIBA 2MNUA 4GKSA 3QUKA 4ESKA 1MHCB 5SWSE 1A6ZB 3WFCL 3TPUB 2VQUA 3LN9A 4UOW1 4PRDB 1P84K 2YPLD 4GRMA 1TZIA 1NLBL 1ZVYA 4HXBL 3BQUB 4FOMA 1A5FL 3RVTC 1WFTA 3KPQB 2BY0A 2IAMB 4KXZH 3TIEB 3CSPA 2B2XL 4PRBA 2PCPB 3MJ9A 1RZJH 1AO7E 1A7RH 1A7BA 3TP4A 5D7IF 1BX2A 2VXSH 1G9EA 5EH1A 3B5HA 2XZCH 4JQIH 4CN6A 1KGCE 1AFVL 3ZYOA 1BQSA 3L5XL 1JHTB 3QUXD 4RAVB 5T3ZH 4PP1C 4HIJB 3FB6B 3FMGL 1JUFB 4Q74A 1F3JA 3MZGB 5C08E 3KPSA 5I1LB 1LWRA 3ARBB 3OR6B 2VZSA 4QRRB 4NQCA 1JPFA 2VH5H 3HC4L 1QLFB 3HPJB 2XN9A 3HCVA 2CKBB 2ESVA 1CK0H 5IM7B 1MUJA 2P49B 4YHKL 5F7DB 4KJQD 4OSUH 1YEGL 4UUJA 5CSGA 1L7TH 3G6DH 4KPHH 4YDVB 3I50H 4CVWA 3IJSB 2FYYB 2NY4D 4PJ7F 5D7JD 4HKJB 1JYXA 2IEPA 1HSAA 1PAMA 1RZJL 3HE6D 2PO6A 1I1FA 1A1NA 2Z93B 4NQVA 2VXSL 4G80B 3H9SA 5IT2H 3QDAA 4R9HA 1N59B 1NLDL 3NIDF 4JQIL 1J8HA 1FFRA 5ACZA 5DRZA 2BSED 4OGXL 3FZUC 4JDVA 3IRPX 5T3ZL 5F7UA 3FAWA 1EEQA 2ADJA 4NC0B 4JFDB 3P9WB 1MJUH 3PHOB 2NY7H 3INUH 4J3XA 5F7WC 2K7QA 2F8OA 3REWB 2VH5L 1TMCB 4JG1L 4XAKD 3KS0J 3V4PH 3MC0A 3TBYA 2Q76B 3FCTA 3KDMA 4EBQH 3FO9A 4K94H 1G7HB 3ESUF 1K4DB 3PQYB 2B5IB 3DMMA 2GSGB 4KPHL 5CEZE 2DM2A 4WCYH 4JY5H 1OAKH 3B43A 3RGVD 2DJ4A 1U8NB 1GAFL 2NXYD 4OAWB 2LAAA 1L9MA 4X7DC 2CKBL 1T7WA 3NPSC 2BY2A 5IFHH 3ME0A 5D2NB 3GMQB 4F37K 4WWKB 4EI5B 1M05B 4MSWA 1QBMH 4GKSB 5IT2L 1KV3A 3QUKB 2E7BA 1OAQH 2Z31D 2IJ0C 5AG9A 2ZWLT 4Y19A 4K71B 1U3JA 1X5AA 1G0YR 1KULA 1KNOB 4KJYB 5E2TL 1FG2A 2XXCB 4QYOB 1CICD 1H8OA 1WBYB 2F19L 4PJXA 4PRBB 4CJ1A 1WFNA 1GGCH 1MJUL 2NY7L 3INUL 2NXZC 5HVGB 3ULUD 4GSDH 4P5TA 3T09A 2EDOA 2WWKO 4G6FB 4GFTB 4EBQL 4F37F 4XX1G 4K94L 2R23B 1YY8A 5DJZA 3C6LD 4OZGF 2NLJA 1F3JB 4WCYL 4PJBE 5C6PB 1OAKL 1AXIB 2LAGB 4JHBA 4L8SC 4DKEL 2Z9TA 4WHCA 1JPFB 3DUUB 1LP9E 5IFHL 3DRQA 3HCVB 2OI9B 5FFLA 4YXKH 3WFDH 1QBML 2DLFH 4GJTB 4OLWH 4YWGH 1OAQL 1QOKA 1SMAA 4LAQH 4P3CL 3CDGB 3SDXA 4UV4H 4FMKA 1TTUA 43CAA 4P2OB 3QJHA 3DROB 4IIQC 2JIXD 5HD8D 2O93L 1HSAB 3DXAA 1GGCL 2PO6B 1I1FB 4PJHF 1A1NB 2OR9H 2CJUL 2VR4A 3X12A 4ZOBA 2YOCA 1HHJA 5IHZA 1W0YT 3D9AH 3H9SB 2VUOA 5ACZB 3QDMA 4WJ5A 3RVXC 1R5IA 1S5HA 4JDVB 1DBJH 4XNYH 1U91B 1I7UA 2WANA 2ADJB 3EYVA 4HJ0C 3ECBB 3QFJD 1N4XH 2QQNL 1WICA 1KB9K 2BDNH 3GIVB 1DQLH 2HKFL 1CTOA 1AGBA 1I8KB 3UDWA 5DVNA 2P5WE 4YXKL 2GTWA 4HQQH 3TBYB 3KDMB 4DUXA 5M94B 3WFDL 2LTQB 2DLFL 1A8JH 4OLWL 3FO9B 4YWGL 2P8LA 4LOUD 1L7IH 4LAQL 3DMMB 2P5ED 4TTGA 1M7IA 4KHTL 2DQJL 3Q6GL 3LH2H 4GBXC 1X5KA 3CDCA 1AI1H 4UV7H 4UV4L 3ZHLA 3MUHL 3MGTA 3PWLB 1N3NA 1MREL 4M62H 2OR9L 4OJFH 5TE4H 4ZO8A 4MSWB 4RMWA 3D9AL 2VIRA 1OSZB 4GRLC 3P0VL 1T89C 2BRRH 3BSZH 4XCFL 5JXED 4XNYL 1DBJL 3Q2CA 5FKPA 1FG2B 3WFEH 2CR3A 1S9YA 1W2KT 1MJJA 1N4XL 5B4MD 2BDNL 4X9GA 3ILQD 1CGSH 3QIBB 1J88A 1FSKB 4P5TB 3KHQA 1CZ8L 3OXSA 4LNRA 3BZFA 2X05A 3LY6A 1FP5A 4GUPA 4I0PA 4K2UL 5KSBB 3D85B 1XR8B 4AIXA 5DJZB 1L7IL 1E4XH 2EXWC 2YD5A 2NLJB 4PJFB 5FKAB 3ZSSA 1KCLA 5HDLA 3HZYB 3LH2L 2VL4A 1AI1L 3MPCA 3RKDC 2XTJE 3DRQB 1A4KA 4M62L 5EC2A 4OJFL 2P7TB 3I6LD 1ZKAA 1IKNA 3EYFA 4LCCA 4WDIA 3SO5A 5ID0B 1FFPA 4YQXL 5EN2A 4MJ6A 4OZHE 3VG0L 5GGVL 5I76A 5KVDH 1FNAA 5DRXA 1HWGB 3BSZL 3SDXB 1PY4A 4P4KB 5BRZB 4OI9A 4LHQB 1W8NA 4PJ9D 2HVKA 3V5KA 1CDUA 4XNZB 43CAB 3WFEL 4Z8FH 2AEIT 3Q48A 3DXAB 1U3ZA 4Z7VE 3QIWB 1ACYH 1MVUA 5IHZB 5KG9A 1CGSL 1RMFH 1A2YA 4M1DH 3TZVC 3BRGC 1JPSH 4FQHA 1XGPB 1PKQA 3IKKA 3QDMB 1R3IH 3NFNA 4WJ5B 3RJQB 1R5IB 3MUGB 1S5HB 4M03A 1E4XL 3MV8B 1I7UB 2DWDA 1IVLA 3VRJA 5JNYA 4HEPG 2KH2B 3U1SH 4ZUWA 1XIWA 1N0LA 1A1MA 3PGFH 5HHXH 4ZQKA 2GTWB 4XZUA 1VSCA 5CEYA 2ICEB 2P8LB 2WQ8A 2F53A 5KVDL 1M7IB 4XP4H 2UZIH 3P11H 4QOKE 3I3EA 4Z7UB 2NCMA 1F58L 4OUUA 5C0CE 1A9BA 1O7VA 3O11B 5I19H 3SJVA 3JUYA 3MGTB 4QTHA 1N3NB 4A6YH 1BFTA 2A83B 2JJTC 1RHHA 5F21B 3BPLC 5D2LA 5T3ZD 1ACYL 1BQUA 3A6CH 2IAMD 2VIRB 5DURD 3BD4A 4L9LA 1A9EA 5E95B 1RK1B 3CSBA 4ZO9A 3KPRA 4MNGE 1R3IL 1TQBB 3IXAA 2A74A 2ZSVA 5FKPB 1RIHH 2HTKD 2W9EL 4LLVA 1S9YB 4IDLA 1MJJB 3MLXH 2FEEL 4K7FA 1DTUA 4PLKC 5F9DC 5J56B 1T83A 2BCKA 3OXSB 2PUQT 1KFAH 3BZFB 1BMGA 5HHXL 4GUPB 3ARBD 5IOPB 4I0PB 4F9LA 3IETA 4QRRD 1YEJH 2E9JA 4LLYA 5HGGS 3P4OA 5I0DA 5B38G 1Q9OA 4HWUA 1JF1B 5CMAB 2UZIL 3P11L 2DQUL 3R4DA 1ZT1A 3VGBA 1X4ZA 5I19L 4XPHH 4GXUM 5JIKA 2FLRT 3BGMB 4A6YL 5GS0C 1A4KB 5EC2B 2DQTH 3EYFB 4B41A 1S7RA 3A6CL 4LCCB 4UU9A 1FFPB 4I48A 2XTJC 4IOFC 4MJ6B 2DQIH 1B88A 1K2DA 4GAYA 3WCYA 2BNQD 2WK2A 5DRXB 4NGHH 4S1SH 3G9AB 2DQCL 3S36H 5TGBA 2HVKB 3UXFA 3S36X 3GSOA 1TIUA 2MJWA 3E2HB 1MVUB 4PY7A 4Y4KB 3AFLA 4QHMA 1DN0A 2W65A 3B83A 1EJOH 3MYJA 4I5BA 1KFAL 4JFDD 4NCDA 2J4WL 2VN7A 5DC4B 4FQHB 4Z7NF 1PBYA 3O3BA 1YEJL 1AQDA 5ERWA 4KTYA 5HI5C 3DHJA 4LGPB 2DWDB 4DFIA 3VRJB 4DAGH 5EO9B 4M7ZB 4ZUWB 3WNLA 1TJHH 1K5NA 2O26U 1A1MB 3BJ91 5IMOB 4Y5VB 2EH8H 3L3GA 2VOTA 4A2MA 43C9A 2OL3A 2DQTL 5CEYB 4M6AA 4JQXA 3LEVH 3WLBB 3IVKA 4X5XB 2DQIL 4WWKD 4EI5D 2X6MA 1Q9WA 4V1DA 2FEDC 3BKYH 4OUUB 1DQML 1YEDB 2CRMA 3KPLA 4HULB 4QTHB 1NCAH 2NX5B 5HI4C 1RHHB 2BSTB 5I2IA 3S37H 3G9VA 4IRJA 1EJOL 5I1CH 4L9LB 4BUGA 3S37X 1WWWX 3DYMA 1A9EB 2OYPA 4PLJC 4KU1A 4J3VA 3V5DA 3OZ9H 3T2PA 2IG2H 4NFCA 3WO3B 2ZSVB 4G6FD 1D9KD 4NP4L 5AWNH 4DAGL 4QGYA 3P73B 2R0ZL 3TJHC 5J1AA 3R0NA 2VO5A 3GFUA 2AKRA 5JIIA 3EDKA 2HMID 2BCKB 2EH8L 4TUJA 4IOIA 3ZE2E 1FYTD 5KVEH 3T65A 3IETB 1Z2KA 3X3GL 2DLIA 3LEVL 1DANT 5HYIA 3N9GH 1FNFA 1Q9OB 1KTLA 4N5UA 4X6DF 4ODHH 1GGTA 4XBPB 1PG7W 5I1AA 5DQDL 5M7QA 2IQAA 1H15A 3ARDB 3BKYL 3E3QE 3DTXA 4F3FA 1BAFH 3ABZA 1IGYA 3GMMA 3RWIA 5BW7A 2P24B 3O8XC 4L4VA 4P2OD 3ZDZF 5C0EA 3RKPA 2OJZH 4YK4B 4I48B 5I1CL 2WBJB 1INDH 2BC4A 3BT2H 3UCRA 3KYNA 1TCMA 3H9SD 2XV6B 3OZ9L 4HS8H 2IG2L 4JHAH 2LU4A 5BO1L 5EUOE 2APXA 3OHXA 2W07A 5J12C 3K4DA 3GSOB 5AWNL 4YDIH 1EHNA 1CCZA 1WC7A 2APBA 5BXFA 4QHMB 1DN0B 3MYJB 4I5BB 1KEGH 1BBJA 1YMMB 3I02B 4PPTA 2J8UE 4UZGA 3QG6A 5KVEL 1YECL 3MXVL 2GTZB 3O3BB 5F44A 3ULUE 4JZOA 4LSQH 2VSCA 4HAFA 1CT8A 5ERWB 5F7FA 3HKFA 1FORH 2Q87A 4ODHL 5GS1C 2BOBA 2FB4H 1U8PA 4BKLA 1P9MC 3DMMD 3VXQA 1WBZB 4P9ML 1SY6A 1BAFL 1K4CB 1LEIA 3CZJA 3L3GB 5FGRA 3FOMA 5D93B 2FR4A 4WV1C 1DUZA 1J1PH 2PYEA 4KMQA 5HGHA 5J11C 2OL3B 4WEMB 3QUXC 4J8RA 4LLUA 5HHME 1RZGB 2OJZL 4JFHE 3WHXA 4WW2A 4O58H 2H2PC 1INDL 2YEZA 3B3IA 1Q9WB 1GHFH 4HAGA 4JHAL 5F9OH 1KEMH 2E6QA 1S9XB 5DMKA 5CBEA 2Y5TA 4L4TB 35C8H 4ZUSA 5I2IB 1IGIH 2PYFA 4APQA 1KPRA 4KKNA 1A6WH 2ICWI 4K07A 4IRJB 2AEPH 5TH2A 4DVRH 4Q2ZB 3QIBD 4HHAB 1TVBA 1GOHA 4P5TD 4LSQL 5D7JC 1IE5A 2EDRA 2FJGB 5IUSA 1A64A 4KUCF 2P47B 3C2SA 3PDOA 1G9MH 2P46B 3GUTB 2FB4L 1YYLH 2UZXB 3D85D 3QEUA 4UT6L 1AJ7H 5EOTA 1AR2A 5IROA 5D72H 1A47A 2MQCA 3QFJE 3SDAA 3T65B 1MVFA 4HD9A 4PJ5A 4HUUA 5I66B 2RCSH 2EKJA 1HXMA 1OGAA 1KTLB 3HZMA 5I1AB 3X11A 1GHFL 3VGDA 2Q8AL 1OF2B 1H15B 4WI3A 5F9OL 4JPWL 1KEML 1XEDA 3MV9B 2RAMA 5ECJE 2P5EE 1IEAB 4NQXA 3VFWB 3DTXB 4NHCH 2WUCH 3GMMB 1HQ4A 4P4KD 3RWIB 3HZKA 5BRZD 3MR9A 5TE6L 35C8L 4KDWA 1IGIL 4W6WB 5GRVL 1P69B 5AUMA 3E3QC 1A6WL 4ZXBA 4OB5L 1D5IH 1HI6A 1IC4H 1Q1JH 1ZHNA 3DXAD 3OQ3B 2AEPL 4I0CC 5KSAA 4MCYA 3QIWD 3RGVC 1N7MH 4XP1H 3GJEB 1QYGH 4LSSH 1HNFA 1T3FA 3OHXB 3OKNA 1UZ6E 1YYLL 1HHHA 1AJ7L 1T80A 3C08H 3MV8D 4HK0B 5JOFB 3QDJE 4XVJH 3KHOA 1OLZA 5F70A 4K7PY 3ARVA 3GMRB 3QG6B 3RWFA 3F12A 1F2XK 4JZOB 3HMXH 1CT8B 1CICC 4PJEB 2RCSL 4OCMC 4X5WA 4QEGA 4DK6A 3SE4A 3H0TB 2BOBB 1HEZA 3ULUC 1GIGH 1U8PB 4KROB 3RGHA 5HY9A 3E8UH 4XVUD 2DM3A 1JK8B 4PD4K 4N68A 4DUWA 4NHCL 2WUCL 1SJHA 3FJTA 1LEIB 3FOMB 5MI0C 5HGHB 3OX8A 5FB8B 3QEQA 3TYGL 4LLUB 1VFOA 3C6LC 3FT2A 4MDIB 1FH5H 3WHXB 1D5IL 1IC4L 1Q1JL 1X5HA 1CFVL 4BQ8A 1UM4H 2YEZB 3H9HA 4RA3A 1N7ML 4XP1L 3I6LE 1E27A 1F00I 2ITDB 1GCFA 3QUZB 1B6DA 1QYGL 2HWZH 2L0DA 3QNYA 5CBAA 3DV6B 4ZUUA 1OARH 5DHYA 5BVJA 4XPBH 2E27H 1F3DJ 4M4RA 3C08L 4ZUSB 2PYFB 5D1QA 1EX0A 1A7QH 3B8SA 1AXSA 4ZUTA 4APQB 1J5OL 5H94A 2NNAA 3B9VA 1CLYH 3HC3H 2BXYA 2Y7QB 3SGJA 1CXKA 4Q6YA 4ELME 1T20A 1QR4A 1TVBB 4NO3A 3RVVD 2K9UA 3HMXL 4YFLF 4LPYA 3FQXA 2NY0C 4I0PD 2XFXA 4KRPB 3PDOB 3VFTB 1DVFC 1GIGL 2H9GA 3DO7A 3O3EB 3E8UL 5FOBA 5TQ2H 5EOTB 3O45A 5H37G 5FA4B 4MQ7A 1RPQA 3V7AG 5I1GL 1S7UA 2BHUA 3EOBA 3M17B 3KLSA 4JANA 3D2UA 4QRUA 3U48A 3L5HA 5EC1B 4TN9A 5SX5K 3W81A 1IM9B 4HUUB 1UM4L 4XB7A 1HXMB 1OGAB 1EH9A 5DZLA 1Q9KB 4H0GA 3ZT7A 1AHWA 5F9WC 1NMCC 3ULSA 1F4XL 5ANME 5MEPB 3V0WH 4DN4H 5F7EH 3OJVC 2UWEB 1CD0A 1HQ4B 1ERNA 1OARL 3HZKB 4HUWA 1SBBA 4F9PC 3MR9B 4XPBL 3EHBC 4LOUC 2V2TB 3GB7B 1A7QL 5I71B 5AUMB 2GQHA 1CLYL 3HC3L 2KDGA 1J0IA 3WO4B 5DVMA 1U42A 4DCQB 1JI2A 4L5FH 3C8KA 4Y4KD 3VXSE 3RRQA 3U0WH 3ELAT 1ZMYA 1T3FB 1IAII 3OKNB 3JTTA 5C2BH 3CVHA 5EBWA 4Y5XC 2ARJA 1H8NA 1HHHB 1MFDL 5TQ2L 2YS4A 5ACMA 3BW9A 2BNRB 3DVGA 5E6IC 3IDJB 2VLMD 3O3AA 1H3XA 2X2YA 4M5ZH 5SV4A 2Z4QB 3F12B 1G7LB 2P8PA 2XIDA 4X5WB 2VISA 3AMKA 4QRRE 1HEZB 3MV7D 1LE9A 4BJLA 4XCYA 3V0WL 4DN4L 4U1GB 3ZKQD 5F7EL 4F7CA 1MF2H 4R7NA 1ZHBA 4D3CH 2ILLA 3FT2B 3TWCH 5E8OB 5IQ7L 4IMLA 2NX5D 3KXFE 3RI5F 1YNKH 4L5FL 4JFYB 5CJQH 2FJHA 2PETA 3NA4A 4W4OA 5A16A 2UV3A 4P23A 3RBGA 3QNYB 1QVOA 4CUCA 5DHYB 5BVJB 5BJTB 5GGSY 5DHVA 2YPVL 2CDFA 5H94B 2ZUUA 2NNAB 3TCXA 1KYOJ 4XMLH 3MGAA 4LLAA 2B4CC 4M5ZL 4PTUA 1T20B 4KI5E 4EXKA 4NO3B 4Y8DC 4JFDE 5C6TH 1UVQA 3WNKA 1X44A 1M6OA 3DO7B 5FYKD 3P9MB 4AIZA 5IVXA 3O45B 1MY5A 4MQ7B 1NBYA 5JW4Q 1S7UB 3EOBB 4QRUB 4JANB 3D2UB 3ARDD 3IGAA 1NH6A 3PQYE 5A2FA 3VMNA 4NT6A 1TLKA 1ND0A 4D3CL 1PZUB 4LGRB 3TWCL 1S3KH 2C3VA 1OP5K 1N0XH 4GAJH 4PJDA 1SEBB 1AR1D 1PLGH 1YNKL 5C2UB 3NABH 3ROOB 1AHWB 2R8SH 5DEFA 2WBJD 2O5ZH 1PEZA 3T2OA 4LARL 2XTLA 3VFOA 3UO1H 3D6GA 1OTSD 3MRHA 1DFBH 4HUWB 1Z5LB 4MJ5B 4I2XA 4KGLA 4LSUH 4LRIC 4E5XB 2EDBA 4D8PA 3D5OF 2YXMA 4XMLL 2NY5C 1FPTH 5EU5A 5JTWA 1Q9LA 2F74B 3IDUA 3BO8B 3SDDA 1YMMD 1KXQE 3ARYA 1E0OB 1MI5B 1G7JA 5GZND 3BQUC 2PXYA 3JTTB 3B2UD 2CR6A 1GC1C 1B9ZA 3I6KB 2VLLA 3GSRB 3MJ7A 2F54B 3GZKA 3BW9B 4XNQA 4H0HB 3DVGB 1PQZA 3GJFK 3C5JA 4MA7L 3O3AB 3DYOA 1QZ1A 2ICWB 1U8QA 5HBBA 4M48H 1LMKA 2YZ1A 1NFDF 1CVRA 2NQCA 1S3KL 3FO0H 1CLZH 2HTKC 2P8PB 4GAJL 3KPSE 1A02N 2VISB 4LKXA 1DSFH 4YEFA 1CGVA 4NQCE 3WNPA 1UWXH 3DYPA 5HVHC 3TT3H 2XN9E 1CD9B 3UC0H 3WJJA 3HNSH 3CDYA 4QXWA 2EDEA 1H0DB 2ESVE 3ARBC 3UO1L 1CYGA 2R1WA 3HLAA 4MQXD 3ZTNH 5IKCA 5D7IB 4F7CB 4DTGH 4LSUL 4R7NB 5ICZB 2OX5A 3KR3H 1I1CA 4PV8A 1LO4H 4OFIA 4L4TD 2DJUA 1BD2A 2R2HB 3B9KA 4IRJD 1JZ2A 2JB5L 1HOCB 5BQ7A 1J11A 3H9SE 1J8HE 3T8XB 2BHYA 3N1QC 4WI8A 5F93C 3ZDYE 1XGTA 1H9VA 3KPMA 2XY1A 4AT6A 1RZ8A 4M48L 3R0MA 3RY5A 1DANU 2YBRA 3FO0L 3CFKA 4QXTA 1WIPA 1U8OA 1UVQB 3MO1A 3AM8A 1DSFL 1UFUA 1M6OB 5A40E 1BZ7B 4PJ7B 1MHPH 1RK0A 4KI5C 5JW4R 4XH2A 1MIMH 2A6KA 3MUY1 3HNSL 3ILPA 4EJ1C 3W9DA 5K59E 2JJWA 3K8MA 3IGAB 3MV9D 5GRYA 5CAYB 4NT6B 2AV7A 5KVFL 3KR3L 4RFNB 1LHZA 1LO4L 2C3VB 1K85A 4EN3A 5FUZL 4I77H 2VDQH 4HBCH 2B5IC 3D0LB 5DFWH 2CMRH 2WLYA 5D7KD 4HMEA 3VFOB 3MRHB 3G08B 2HTLD 4PRPA 3NVQA 4NOBA 4I2XB 5L7XH 5GRZA 3TN0D 3VWKB 1FJ1B 3VFRA 4Y19E 4D8PB 4ZSOB 4OZIF 4TVPH 3QHFL 4WENB 1Q9LB 5E5UB 4QF1A 2D7PA 4K71C 3SDDB 1FFOB 4PJXE 1QBBA 2X9WA 4YUEL 1S9WA 5IR1A 2FIKA 2PXYB 3K1KC 5I18H 1MHPL 5DMYA 4PR5A 2VLLB 1MIML 4M3KB 1A3LL 4OF3A 3FKUS 4XNQB 5BOPA 2L7UA 3IJHA 2F58H 1PQZB 2AJXH 3LMJH 4KVCH 4KROD 4X80L 1U8QB 2G5BB 1YQVL 4PJFE 1FL6B 4U3HA 1NAMA 1P1ZB 4EIGB 1IGCH 1FGVH 4I77L 2VDQL 1LO0H 4LKXB 3PWPA 4HBCL 4NO2B 4JY6A 2EE9A 2CMRL 4ONOA 3VW3L 4U1SA 5IWLA 2MHAA 1OT1A 3P0GB 3MGOA 1DEDA 3ZTJG 4AENA 3F7PC 3HLAB 2R9HD 5A2JH 1QTYT 3QUZD 4L8CA 4U49A 3KS0H 4IRSB 2OI9C 4HK3J 4Y8AA 2IF7A 5DC9B 3WIFA 4H26B 3SDXE 25C8H 1CFNB 2FHCA 5IP4A 4TVPL 5KN5B 4FXGB 4APQD 1C5CH 1MRFH 1WJ3A 3B9KB 4TSBH 2DJSA 4OZGB 1KCSH 1BZ9A 4YX2H 3DXAE 1QKZH 3HC0A 2AV1A 5CJ8A 2P1YA 4P2OC 3HHRB 4KRPD 2PO6C 2AJXL 2QHRH 3QDME 1XGTB 2VDPH 2DQGH 3KPMB 4Z18A 4IS6A 1F97A 4G6JH 4N9OB 3CJJA 1NGZA 4MA3A 4QXTB 1IGCL 3AC0A 1U8OB 1FGVL 1LO0L 4ISVB 3E6FA 1JMZA 2EXYD 1RK0B 1IM9D 3ZT5A 5C0FA 4XH2B 2ZJSH 1OGAD 4KK9C 1KF9B 3W9DB 3BZDA 5CP7A 5J6HB 5KSVA 3MNVB 4ZUVA 2A0LC 2EDLA 4XVSL 1S7TB 2LTQC 4EN3B 5D6DA 4ODVH 5CP3A 3DMMC 1C5CL 4K3GA 3SHSA 4TSBL 4CU7A 4D2NA 4J1UA 2BSSA 2H32B 4M8VA 3W0WA 1QKZL 3RWGA 1A22B 2VERN 4PRPB 5CINH 5C71A 5DFVD 5CGTA 1FN4A 3VFRB 3EO0A 2QHRL 5GSVA 2EIZA 4FHBD 3DO3A 2J8OA 1BF2A 2FX8H 2VDPL 2DQGL 1QEWA 4XRCA 4CADB 4O5LH 1X5FA 4RMUA 4OLEA 4LHUA 4M9PA 4AJ0A 2BNRD 4OFYA 4G6JL 4QF1B 4U1IA 5DK2A 3V5HA 4NM8H 2FIKB 5I9QB 5FYLE 4PR5B 3DARA 3O6MH 5IVOA 2HRPL 2ZJSL 4FFZH 5JA8B 1KJ3H 3JVGA 1X9QA 4YBQC 3IJHB 1BGXH 1ZE3C 4MZ2A 3QIBC 1FSKC 4P5TC 1ZANH 2GCYA 5ITFA 3THMH 4PJ8D 4LCWA 5FYKU 2WZPD 4XP5H 1KCRH 4X9HA 2HJKA 4HDIA 4R8WL 3TIDB 5I73B 5JOPE 1NAMB 2CPCA 2YD1A 4H1LA 4ODVL 4X4XA 5E24E 5IJKA 1IAIL 2NPLX 1UACH 4JY6B 4X6CF 4ZTPH 4U1SB 2E9IA 5C6WH 4PJIA 3MRCA 2ERJB 3SE9H 3MGOB 4AENB 4RDQG 1GVIA 3STLB 5DJ8A 4L8CB 1A4JA 2J12B 3WIFB 2D0HA 4D94A 2CLZA 2Y36H 4EOWH 2C3XA 2C4XA 2B1AH 5E70A 1DUYB 3FFCA 4F7TA 4NM8L 3GI8H 3HC0B 4QHKI 4XNZC 3O6ML 1KJ3L 4LRNH 2V2WA 4Z78A 4QLRA 1PKQE 5BV7B 2BY3A 3P30L 5CIPA 2G9HA 4IS6B 4XGZA 1F45A 1EO8H 3BMWA 4R0LA 4XP5L 3VFGH 4KAQH 1NGZB 2R2BA 4WVRA 1T22B 3D2UD 4ZG1A 2J7LA 3E6FB 1WF5A 1UACL 4ZTPL 5C0FB 1QLRB 2FECI 3SE9L 1M71B 5CP7B 5T5NG 3UDWC 1T7YA 4RBPK 3HB3D 2Y36L 4EOWL 4JM2A 2ARJQ 4QKXB 3RPKA 5HSFA 4LLMA 2FDBP 5AZEH 2B1AL 5F3HB 3GI9H 3SJVE 1WBXA 3UYRH 4OD3H 3GMLA 3W0WB 5D2LE 1IAMA 3GI8L 1RY7B 3RWGB 1IAKA 5EUKA 2QHLA 1MI5D 5JUEH 2IFGA 5D1ZA 3BE1H 2L7JA 1FN4B 2Z92A 5I8EA 3EO0B 5GSVB 2EIZB 1QEWB 4XRCB 2F54D 1MLCA 3IT8D 5DMGD 1EO8L 3PNWB 3Q1SH 3T3PF 5DK2B 1EHLH 2NY6C 5GRWA 5HGBA 3V5HB 3VFGL 2BP3A 4KAQL 1I3GH 9CGTA 4X9IA 3U9UA 4J4PA 1CN4A 2BVQB 5DS8A 4LSVH 3WN5A 1PDKA 3RWCA 1NCNA 2YA0A 4JY4B 4LCUA 1WCBA 1RZKC 3IS1X 1QLEH 2ZSWB 1T5WB 4WI6A 3F7QA 3RVVC 1S7VB 5FYKE 3RZCB 4POZC 1KCUH 4LCWB 2FLBT 5C07A 3U2SA 3ETBF 4GRWE 4I0PC 2Q7NA 2XG5A 3DGGA 3OXRA 4Y89A 1FIGH 1TVHA 4H1LB 4OLUH 3TNNA 2NY3B 4NNPH 3PWJA 2Q3ZA 2DQEL 3GI9L 3Q3GA 3UYRL 3MRCB 1V3MA 4GW4B 4NKOA 4OD3L 4PGBA 4X98A 3C5ZB 3E6HB 1EK3A 3FHQA 1VFMA 4Q58C 5CZXC 2QQQA 5DJ8B 3VRIA 2EDHA 4G3YL 5CJXA 3BE1L 5IB2A 4JZJB 1IKNC 5ALCL 5L8LB 2VDKH 4LCCC 1YEKH 4X6FB 3L1OH 4OQTH 4C83A 1QHOA 1OVZA 1EHLL 2R0LH 4U6HA 1I3GL 3FFCB 5I1EH 4NKMB 4L8BA 4X6DA 4F7TB 2WWMD 3OL2A 3QXUA 3EZ8A 4LSVL 5C3TA 1WSST 3BP4A 1P4BH 5JHDB 3QI9A 4LASH 3E2HC 4UBDC 2V2WB 4LL9A 4L3CB 5C3LD 4OCSH 5E4IA 3SCMA 3RWJA 5CIPB 5F6HJ 3ZO0A 3UROR 2LE9A 4R0LB 3S6CA 1KCUL 4P49A 4TRPH 3DURB 4M6OH 3IDNB 2R2BB 4U05A 1HCVA 5T1MA 1FIGL 4NKIH 4OLUL 4YFLI 1N64L 1D3CA 1T1YA 4MXVE 4U2YA 5C09A 3RTQA 4NNPL 5F1KC 1I75A 1IC7H 4EQ2A 4KY1H 3VXTA 4HUNB 2R0WH 4HX1A 1XIWC 4RNRB 4ZFOB 4TVPD 4H25A 2ZUQC 3DGCR 4RGNB 3F7YB 1MJ8L 4K3HA 4Y5VC 3C8HA 2CGRH 3CFIC 1NMAH 1T0MA 1Q0YH 4LP4A 4NQEA 2VDKL 4LIQH 4TVSa 1YEKL 4JM2B 5INCB 3VXNA 1DLFL 1YEIH 3L1OL 4LLMB 4OQTL 3VWKD 4UOW0 3FOLA 5EZIH 2R0LL 1F11A 4LQFH 1FE8L 4N1CA 3T2NH 5I1EL 5HDQH 4L4TE 4ORGB 4OLZH 2BVEA 3GRWH 2H45A 2EIEA 1P4BL 3UJTH 5EUKB 2MMXA 4LASL 2VAAB 4QRTA 3MLZH 4RCAA 2PXYD 1CI5A 4WI4A 4OCSL 5I8EB 4KV5E 1DBKL 4L8DA 4L9LC 4Z5RB 4MHHG 3MROB 4ZODA 3SY0A 4JZNB 4TRPL 5HGBB 1PZ5A 4M6OL 3U9UB 4I9WD 5F9AC 5DS8B 4GS7B 1B4JH 4HC1A 4JO3H 1IC7L 4O2FB 5TDPA 3WN5B 3RWCB 5C86A 1J0JA 4KY1L 1IBGH 2KL6A 2R0WL 4WGVB 1TJIH 3GEWB 2MPAL 1T83C 1GYAA 5BVPH 1YEEH 1D5XB 3QEHB 4ONGH 4AEIL 2CGRL 3BPCA 3U2SB 5FK9A 1NMAL 3KPPB 2MCG1 4OV5B 1Q0YL 4F9LC 4LIQL 2H3NA 4QHUA 1YEIL 3I2CL 4IRSD 3SGEH 2MSPA 3MV9E 2X89A 5EZIL 1MFBL 1OQOA 4LQFL 3T2NL 3Q3GB 5FIEA 5HDQL 4ZFOL 1VADB 4OLZL 4UIMA 3GRWL 1NPUA 3B9KD 4L4VE 3UJTL 3QO0A 4HS6B 3VRIB 1FV1A 4JRXA 4LF3B 1UENA 3MLZL 5D7KE 2Y5EA 3I3BA 1MOEA 1OW0A 1U92A 2R4SL 5T5FH 1OGTB 1KPUB 3WMSA 2WBJC 4EDXA 3Q5TA 4W70A 1QFWI 3LKQA 4CNIA 1GGUA 2XT1B 4D0BB 3MNWB 4L8BB 4X6DB 3SDCA 1WK0A 3PABA 4G42B 3V9FA 1B4JL 3NIFE 3BP4B 5IEHB 4JO3L 5DZNA 3QI9B 3VD7A 3BKJL 3L3OB 1DQJB 1P7HL 1XFPA 1TJIL 4GMTH 1WFOA 4X6BB 3SCMB 3RWJB 2GHWB 4F2MA 3D18A 2ENSA 5ISZB 4HH9A 4MWFB 5BVPL 4OI7A 3FL7A 4ONGL 2HLAB 4MVBD 3AROA 1B6UA 1FVCA 2Z8RA 2XZAL 3UTSB 3RNQA 2BHZA 4PRHB 5T1MB 1BPVA 1JGVH 5I17A 2EH7H 3RTQB 1NFKA 4NFDA 3DUSB 4XHJC 3UBXA 1NCWH 1P4IL 5EA0H 1JRHI 2D0FA 4K8RC 4H25B 3DV4A 5C1MB 3VFMB 3QXAA 5D93C 1KTDB 4F7EA 3VXPA 1T0MB 1VESA 2NZ9C 5KS9F 5L8JB 2FZ3A 3VXNB 2J5LC 2C1PA 4JQXC 3FOLB 2F9BT 5D5MA 1PSKH 2DWEA 3OTTA 2VUYA 2APFA 4MQXC 3V4UH 1IRAY 1IGFH 3K74B 1CS6A 2ZCKH 2HT3D 2VKWA 4GXUN 4WUKH 4QRTB 4HUVA 1J0KA 4OF8A 4P3WA 3IU3A 2X1PA 4IRJC 4L8DB 3SY0B 4XI5D 1PZ5B 2VE6B 4NZJA 5CHNA 1N26A 4D0CA 1E28B 1A6TA 1JGVL 1D7FA 2EH7L 1U8JA 5EG6C 4CMHB 5HGDA 4L1DA 3GMOA 3QPQC 3FN0H 4AEEA 2B0SH 5C0BA 1NCWL 4NZTH 5EA0L 1R5VA 1AKJA 4NBZB 1QFOA 4YC2B 4EIZC 5HHQA 4PJ5E 1U3YA 3DX6A 2JLLA 3PWNA 1OGAE 5FK9B 4LHJB 3DX7B 1MFCH 3IJYA 2H3NB 3BDYH 4GAGH 5KANI 3QUYA 3NCJH 1GGYA 1PSKL 4LKCA 3V4UL 4YGAB 4UIMB 1IGFL 4M6MH 3KJ4B 2ZCKL 2MTPA 1BJ1J 3QO0B 4JO4H 4PIRF 3ZDXF 2CLRA 4N0FB 5DD1L 2AXHA 5GGSA 4JO2H 5GSRA 2QTEA 1U92B 5B38A 3LRHA 3RP1A 1YC8A 2ZZUT 3O2WL 4EDXB 3BGFB 2ED8A 5E5RB 3LKQB 5T1KB 3T0EA 3FT3A 2PW1A 1U8HA 1T03H 5DVLA 2GK2A 1ZLWH 3U4BH 3KVQA 3PABB 4CAGA 1G0DA 1B0WA 4ONHA 3FN0L 4NZTL 2E7HA 5GS3A 4FQIH 5SWZA 3M8OH 1Z6JT 4F2MB 3U0PA 3I9GL 4J12A 1MFCL 5HYQA 3DRTB 3MODL 3BDYL 4GAGL 5I17B 5MENA 2WBKA 3NCJL 2DQDH 2BMKB 1X5IA 4PGJA 4M6ML 4HWBA 1ED3B 3DV4B 3D1MC 2WIMA 1KELH 4HKXA 1IQWH 4GG6F 4WHYG 5IVZB 1QRNA 3W0WD 4TTDD 3LD8B 4JO2L 1UCTA 2OP4L 4P4RA 2C1OA 2FZ3B 4TSCH 2C1PB 4WW2C 4CRPA 5I75B 1JPGB 2DWEB 5EO1A 3NFPA 1WAAF 2FECL 2PKDA 5GGTH 3U4BL 4KVNH 5D71H 3KYKH 2OJEB 4IIQA 5FA3A 4X9BA 1J10A 3FHAA 3FRUB 1NGQH 5IF0A 3IAGC 5K9QG 4APQC 1AE6L 4KMLB 3IU3B 5CUSL 4PRIB 4ELKB 2MFNA 5CHNB 3MRQA 1F4WH 4JPIA 3L5WB 1A6TB 3RZCD 1I8IB 1JGUH 4OCYH 4OGYH 1U8JB 2IPUG 4LCWD 5HGDB 2DQDL 4KRPC 1WEJH 1Z3GH 1PG7X 5T3XH 4G8GB 1R5VB 2NY3D 3NTCH 1LILA 5HHQB 2D7NA 3G6JF 1KELL 3DX6B 1IQWL 2CIIA 3PWNB 1A6UH 3C5ZD 2X4QA 3SDAC 1DN2A 4Y88A 3H3KA 3QP3A 2EXYC 4TSCL 3EFDH 1CLCA 3EO9H 4JFQA 3QUYB 5FF6A 4RX4A 3NGBC 3VMOA 4LKCB 3LEYL 3DLQR 4JFXB 2P43B 4JKWA 4KVNL 2XG4A 5D71L 3UPAA 3KYKL 1J18A 2UYLB 2QSVA 3FFCD 2DMKA 3GSXB 4QGTA 2CLRB 1KG0A 3ARWA 4MD5A 2Z0BA 3RWHB 3OKEB 4DGVL 2NR6C 4NN5B 3MLTA 5GSRB 2VAJA 5JHDD 1T66C 3HUJF 2NTSP 2PR4L 4OF7A 1RIUH 4ZXBC 3HE7D 3KLDA 5KSAC 1MI5E 1R3JB 1T89A 4PV9A 4JHWH 4V2BA 5DJ0A 3U0TA 2GY7B 3T0EB 1F4WL 4YNYA 2PW1B 1MRCH 3MNZB 5IFJA 4OCYL 1S9VB 1UWGH 1I9IL 3KYMA 4ONHB 5DFVC 1KB5B 1WEJL 2EO9A 2X41A 1Z3GL 4U7KA 4WNQA 5T3XL 3UPRA 1U3HB 5C0AA 4X7SH 4ODUA 5SWZB 3A6BH 2XA8L 4DJMA 1X4YA 4M00A 3U0PB 2I07A 1ZTXH 3S98A 4R2GC 4LAJH 4RGND 2KBGA 5EZJA 3EO9L 4Y4HA 3WS3A 1NGWA 1KB5H 2UY7A 4PGZA 4OCXH 3SE4C 2V2XA 2H2SC 4JM2D 3ULVE 2FBJH 3O6FB 3VGGA 5HPMB 2CKNA 4XC1H 1I7TA 3SQBA 1QHPA 2GT9A 2RBLA 3FB8A 1QRNB 1UM5H 2FATH 3EFFA 4P4RB 1K8DA 3EGSB 2C1OB 1KN4H 1RIUL 5C7XH 4DKAA 3LPWA 4C57C 2FGWH 2V7NA 3DHMA 1E6JH 4NFBA 2AJSH 2A77H 1UB5A 2R56L 1BJMA 2VQTA 4N1HB 1R0AH 4ZOAA 1MCQA 4E42A 4J4PD 4X7SL 5IF0B 5D1QC 1DBMH 3QWRD 4X4YA 4OLXH 1PVHA 4BH8A 1ZTXL 3LDBB 3TVMA 3VXMA 3SGJC 3O6LH 4PJ7E 3MRQB 4JPIB 4K9EC 4XPGH 3VXRA 4HT1H 1XF2A 4MGXA 3O4LA 1KB5L 1KJ2B 3U30B 2O61A 3JV6A 4GKZB 4OCXL 2AK4A 2DF3A 5FO8B 1O0VA 1D5ZA 2FBJL 2ZKHH 1JPTH 4XC1L 3RUGA 4XNMA 4G6AC 4QRQA 4EUPH 4PJDE 2F5BH 2CIIB 2OLDA 1UM5L 2FATL 3C60D 3MRDA 1CL7I 4ZDHA 4DQOL 1KJ2H 2XNAB 2HLFD 3BN9D 2FGWL 1E6JL 2X1OA 5F1OB 2G2RA 1AHWC 2A77L 4K3EH 4DOHB 4I2XE 1RUKH 1R0AL 4UMGA 4QRSA 1MCWM 3HB3C 4E41A 1KG0B 4G6KH 3MLTB 3QI9D 5EZOH 3EYOA 3IDXH 5DJ0B 4EI6A 1XF4A 4OF6A 3O6LL 4U7MA 3SCMD 4XPGL 5ISZD 3LN5A 2XACC 2PTVA 2B20A 1T1WB 5DJCB 3EW3B 5IFJB 4NKQB 4NC2B 3KYMB 1V3LA 1S7XB 3UTSD 2AJZA 4PRHD 2ZUVA 4WNQB 5C0AB 3RTQD 3B9EA 3TF7C 3W2DH 2ZKHL 1JPTL 4JKLA 4RMQA 4XCEA 1KIUA 1XT5A 4QNPF 5HHOB 1QFWL 4OZIA 2HJLB 5IMKA 3AY4A 5EZJB 1KJ2L 4LCYA 3K2MC 3SKMA 1NGWB 4GG8A 3CDFA 1SJXA 4DVBB 4OD2B 4K3EL 1RUKL 2EC8A 5FYJD 3K46A 3EDEA 1IEBA 1BD2E 3G6AA 4O51A 3FB8B 4G6KL 1UB6B 5A2KH 1K8DB 3AS3A 1QO3A 4ALAH 5GGRY 4U1LA 5E00B 3IDXL 5GGVY 2DYPB 3PJSA 1S8DA 1J0HA 1UB5B 4W4OC 4CMMA 4LMQI 4OLYH 1JRHL 1RJZB 4P23C 3AMLA 3LSOA 4AH2A 1JWSA 1Q0XL 4CJ0A 4JJ5A 4QT5A 1FZKA 1JV5B 2YKLH 3ALWA 1JFQH 1D5MA 2F8XC 1UJ3A 3OKKB 2EDKA 4OZ4A 2K7PA 1WFUA 3MZTA 4XP6H 3TBTA 2CIKB 5TQ0H 4X4MA 3VXMB 2XWJA 5C0DA 3GJFB 1PY9A 1FHGA 1XF2B 1JWMA 4XMPH 5AEAA 1N2RB 2M1KA 3JV6B 2CDGB 5GJTL 4PJBF 4ZOEA 3LRSA 2WWKT 2X4UA 2X89D 3GIZH 1EVTC 1VEMA 3SN6N 5D7LA 4KUCD 3RUGB 4XNMB 4QRQB 1LP9F 3HG1A 2WLZA 3FB5A 5E2UL 1AC6A 3GJFH 3P4MA 4F8QA 5GRJL 4YHML 4LSTH 3CVHH 5D96C 4ZDHB 1MCJA 3QRFM 2JK5B 4ALAL 1JZ6A 2JELH 3QUMA 3JWOL 1CDYA 3U46B 4H88H 2G2RB 3L7EB 4BZYA 4PJCF 4PRPE 3MRBA 4MNHB 3FT4B 1CFQB 4OLYL 3BP7A 3CX5J 1DP0A 3L3DB 4N0CD 4X4ZA 5T1KD 3AREB 4HIHB 1F6LL 4U1HA 4E41B 2YKLL 1JFQL 3CC5A 4GW5A 1EEYA 1NANH 2DB8A 4ZYKA 4Y4FA 4J3OC 4MMXC 5TQ0L 5I1DA 1U6AH 3QIUD 4KTEH 4O02H 1XF4B 4OT1H 4P2CG 3LN5B 3SDDC 3MRFA 1QSEA 4XMPL 1I3RA 4UDUA 5I8KH 3AU1B 2PXYC 2AJZB 4YGVA 2LQRA 4NQDB 3MLRH 3CFCL 6FABL 4F80A 1PYWA 3WKMH 3PWPE 4OZIB 1PGRB 2IALA 4MXQD 4LSTL 5IMKB 1JYWA 3SKMB 1WUNT 2JELL 1CGXA 4PG9A 2EEAA 4GG8B 2J1KA 2VXUL 4MAUH 4H88L 4J3SA 3R8BB 1VEOA 1E4KA 1HCFX 1I1RA 3WJJC 5JIHA 1MWAA 3G6AB 2EDNA 2MCPH 1BFOA 1ZS8A 1W0WA 3O2DH 4X99A 2IWGA 5ENWA 1OB1B 4J6RH 3HR5A 4KTEL 4HFWA 4U1LB 1B2WH 2HT2D 1ZEAL 4OT1L 3B9KC 3PJSB 4NHUA 3AXLA 1S8DB 1NUFA 1T6WA 4PRID 2OSLB 2FX9H 2XZQL 4JJ5B 4M9OA 4QT5B 3MUZ1 4LVHB 3MLRL 3V6FA 2Y06L 4OCRH 3V0AC 2DICA 4OZ4B 4TYUA 3VGEA 3JWDC 4DZ8A 5C0NC 5ILTH 2YPLA 2Q86A 1JI1A 4ODSH 2UVFA 2R1XB 2WNGA 2QR0A 4G8GD 4RFEA 1KC5H 5C0DB 5I15H 5FM5O 5TFSH 4H20H 1FZOA 1JWMB 1WISA 3AM8C 4MAUL 4XC3H 1IEHA 1QPPA 2YD2A 2NY2B 3QUYD 4XHQA 2X4UB 4MVBC 1IGJB 2IADB 3HG1B 1XR9A 3FB5B 2CRIA 2MCPL 2IPKA 5LWYL 5MERA 3LQAH 1QSVA 2IBBA 1IGTA 4CVXA 4KH2A 4OZHF 4EN3C 4TNVK 5EOCJ 2R2EA 3C6SB 4OD1H 1B2WL 5D6CA 3W0WE 5IBUB 1YPZA 3MTRA 1Z9OA 3V7MA 3TESA 4XBGB 3MRBB 3LHPH 3IDYB 3P2TA 1FAIL 2FX9L 3KLAA 1VFAB 3I6GA 4U1HB 3K0WA 5TDNA 2RFXA 4ZYKB 1EEYB 5DLML 4OCRL 1N5AA 4Y4FB 3SKJH 3OAZH 4NNXA 4E0RA 4ODSL 3UTQB 1U3HD 1XMWA 3GBMH 1Q72H 1RFDH 4HPYH 1U9KA 5SWZD 4NZRH 2QEJA 5TFSL 2HT3C 3PUCA 4KJPC 5IHUH 2HFFB 1QSEB 1I3RB 3HE6A 3QQ4A 5J6GA 4UDUB 4RWYH 2ORBH 4I8DA 4XC3L 3V95A 4GXVL 5IFAH 1BVLB 4YGVB 3ZE0E 1T1XA 2X7LA 3IFLH 2I60L 4LCWE 4P48A 5DD6B 3HAEA 3MMEB 5HGAA 4G8IA 4XI5C 1ADQH 3MRMB 3VXUA 3O6FD 2GYSA 2IALB 2F8VA 1BECA 4NN6C 2FBOJ 1G6RA 4PJIE 4R4BB 4RFOH 1QRND 4PG9B 3CXDL 4BELD 2EKSB 3A6OA 1K9TA 5IWLC 3LHPL 4R97B 2ERJC 1LVEA 1VB9A 2P45B 5GRVK 3BRDA 4Z77A 3O4OC 1AGDA 1BFOB 2BVYA 3TEUA 1W0WB 3SKJL 5CSZB 3EJJX 3FFCE 5ENWB 4XPTH 2VDRH 5LG1A 3GSNB 3GBML 4YHYB 1JTPA 1RFDL 2ICES 4HPYL 2X1QA 4WFFD 3WDIA 4NZRL 3FONA 4TNWF 4S1QL 2OXHA 2CXGA 5GIRB 3VRLE 1NEUA 4X6CB 4N8VA 3TBSA 4RWYL 2ORBL 2ZG1A 4FFYH 4OIIH 5BOZG 5IFAL 2Z31A 3IFLL 2YPKA 3QISA 4DZ8B 2YPLB 5BV7C 1CL7H 5T1DH 3TT1H 2ZNXA 3EJYC 4RFEB 3SKOA 2W60B 1KIRA 1FZOB 4RFOL 3VA2C 3JSSA 1NGPH 2YD8A 4RGNE 4LLDA 2HFGH 3A0OA 1C1EH 2VSDA 4RX4D 1JNLH 5DEGA 1M7DA 3CCHA 4X8JA 2H6PA 3C6LA 1Y18B 1NKOA 3QCUH 5J13B 4JREB 4F7PB 3RBSA 5FYJU 4M7KH 3TO4D 4XPTL 2VDRL 5L6YH 5D6DC 1S7QA 1EEZA 1ORQB 3VXOA 3SKUD 4LU5L 3W82A 1FNSH 3AB0B 3AS1A 3MLWL 3WUWB 4TTDC 1F02I 4M6NH 3SE8L 3BUYA 3F5WA 5IVNA 1NQBA 4G9DA 1N5AB 4NQTA 3AS2A 4NNXB 2GITA 5F7HA 3GSNL 3L3HA 1CL7L 4JPVH 2NY4B 5T1DL 3TT1L 5C0AD 3FO1A 3EDJA 1YDPA 3MCKA 3WL9A 3BISA 1KXVC 4M43H 3U36A 4IM8A 3GSUA 1RI8A 3EOAA 4JVWA 5LCVH 4B5EA 5HHOD 4XAWL 5J6GB 2GFBA 1NGPL 1WTLA 3OAUL 2H1PL 4BH7A 3W5MA 3MRLA 2HFGL 4QY8B 4YHNA 1EPFA 2X7LB 3JVGC 3ZKMD 5C07E 3L7FA 3HAEB 5HGAB 1A14H 3C9NA 2NW3B 4KMTH 3VXUB 2YUWA 1ZLSH 1A1OA 3QCUL 4LBEA 5EOQH 4M7KL 3ZT6A 1JHKH 5CJOH 1G6RB 2XRAH 5L6YL 4NKDA 5IJKC 4I3RH 5B22A 2NY3C 1JNJA 4CN1A 3TYFB 2FIRT 4XWGH 4LLQA 2NW2A 1FNSL 3LRGA 4XX1E 5FUCE 5LKNA 3Q5YA 2DYPD 4M6NL 4F9PA 2CDEA 1EV2E 1F90L 2P5EA 4GKOA 1NCDH 5FM8A 5MEOA 3S88H 5GGUB 1YN6A 1RJYB 3B4NA 4X6DE 1OL0A 1EGJH 5IB5A 1J1OH 3FONB 2NXYB 4M43L 5BCAA 1LDPH 5BZDA 1FIEA 1ES0B 5LCVL 3KPOB 5HYEA 1PX3A 3N1MC 4N8VB 5JQ6L 3NCMA 1NDMA 1Y6MR 5ESQA 2YPKB 2YSSA 1CQYA 5CP3H 3MA9H 1QG3A 1A14L 1MAMH 1M4KA 4EKXA 1U8LA 1VGKA 3ZE2F 3NA9L 4KMTL 4U6VH 5JXEA 3S35H 3TLRA 1NMBL 3BZ4A 4JRYB 4R0LC 5C09E 1ZLSL 5F3BA 1LD9B 1KCVL 1KIRB 3S35X 1JHKL 5CJOL 3R1GH 3T1WA 3X13A 4MB3A 4I3RL 3QNZA 4NQSB 4LLDB 4LSRL 4LVOC 5JO5B 4KKLD 1W72B 4XWGL 1QSFA 2X44D 4LPCA 4WEUD 1ZWIA 4RGNC 4UOJA 4NQEE 1M7DB 3CCHB 3NZHH 4JE4B 1N8ZA 4U7SA 4X8JB 2H6PB 1DLHA 4LCIH 1JF5A 3ARED 3PWVA 5FYJE 1G6RL 4JGMA 4E41D 1UKTA 4JM2C 3RVWD 1EGJL 3VXOB 1LDPL 1W72H 3D39A 2X1XR 5EUOF 3WHE0 5DYOA 4UNTA 2X4TA 3O6KH 5F72S 3BKCH 2A73B 2AI0H 2DN7A 5D1ZC 3MA9L 3MBEA 2J8UF 1TQCB 3FO1B 4NQDD 3S35L 3MCKB 3WL9B 4PJ9A 4WWID 4JVPA 3U36B 3GSUB 5DF0A 2CD0A 3PL6A 3R1GL 1NC4D 1ACZA 4J4PC 2CUIA 4I18A 1V8HA 4FQ2H 4P46A 3WN5C 4YHNB 1QBAA 4GKNA 1ZVHA 3WDHA 3ARFA 3L7FB 2GY5A 3U82B 5K9OA 3C9NB 1HH6A 3NZHL 3T0AA 1CXEA 1XF5A 4LCIL 1XCQA 1A1OB 4LBEB 1JBJA 4PUBH 2VZUA 3PGDA 1BF8A 4Y2DA 4JO1L 5C0GB 5TF0A 4NKDB 1I7RA 2P48B 1W72L 5FHBL 1U8MB 1EBPA 1K3IA 4JRXE 2NW2B 1QR1B 4BSWB 1N6QL 3BKCL 1U2CA 1XGUA 1S7WB 2AI0L 3LAFA 2QQLL 2CDEB 2D31A 4ZTOH 4D0DB 3VGHA 2HLFC 3BN9C 5CJXC 5FUCC 1ITCA 4JEGB 1JWUA 2BNUA 1ZK9A 5IB5B 4GT7A 4PRDA 5BZDB 5KVGH 1CDGA 3RVUD 2VDOL 3VU2A 3RIFK 3LPFA 3KPQA 2IAMA 3TIEA 3QI9C 4OKDA 7FABH 4U3XA 4EVNB 5ESQB 3U9PL 4G9FB 2DQHH 1Y6KR 3SCMC 4NUGL 5F3BB 4PUBL 3HG1D 1JHTA 3X13B 3RTQC 4X9FA 1NSNH 2ITCA 1YN7B 5EDXA 5I1LA 3QQ9C 3CMGA 1QSFB 4X0KB 2VTFA 2R29H 4HJGA 1N8ZB 2CKBA 3WEXA 3VH8B 3PWVB 5D8JL 5ICXB 3IAPA 1EFXD 2BSRB 3BPNB 4HCRH 5J1TC 3K1DA 3U6RB 5KVGL 2FYYA 3D39B 4J7RA 5DYOB 1UM6L 2X4TB 2VABB 1E4XI 5ALBL 1UYWH 3B8YA 2D03H 4WGWB 4HKJA 3IS0X 1UZ6F 2WUBH 5LGHH 7FABL 1QSED 1VKXA 1EJ6A 2AGJL 4U3CA 2DQHL 2BNQA 4JFFD 4GG6A 3T4AA 1SVCP 3MBEB 4D9QD 2APWA 5F7YC 4PJ9B 5KS9B 2E7LA 2AW2A 3S5LB 4CDGC 1RURH 5FO9A 3PL6B 4DW2H 1UWXK 4G8GE 4I18B 5GRUL 2R39A 2KPNA 1NSNL 2AQ3A 4P46B 4JFDA 3IF1A 1HIMH 4GKNB 3HI1A 3ARFB 5K9OB 3L3KB 3REWA 4YC2C 1HH6B 2R29L 1XF5B 1LEKB 5F96H 1XGYH 3PGDB 3ZKND 1G7HA 4Y2DB 2EYSB 1K4DA 1HYSC 4HCRL 1OTUD 3GDBA 2GSGA 3BWAB 5C9KA 3IU4H 5L2KA 5I1KL 1Y0LA 4EDWH 3WNOA 1HHKA 5DUBA 3RWEA 1U8NA 5CZKA 1UYWL 4OAWA 2D03L 3BEWA 2WUBL 5LGHL 3KJ4C 2D31B 1NCTA 1SEQL 5D2NA 5JZ7C 3GMQA 1FAKT 4WWKA 4EI5A 1M05A 3T0EE 1JWUB 1OW0C 5GQBA 2BNUB 3CXHJ 5HYJD 2ADFL 4KGJA 1QA9B 4NWUH