3PAYA

Crystal structure of a putative adhesin (bacova_04077) from bacteroides ovatus at 2.50 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
302
Chain Sequence
GSCDSIREDLPRCELWLEFVFDYNMEYADAFNPQVKSVDVLVFDSDDKLLFTKSVKVAALVGGNRMSLTDELDFGSYKVLTVGSLSDRFRLSDNAGNKLVPGTTTLQQVIVSLKRETGGVNFEFQHLYFGEVVEVDHLPSNTNHKIYPVNLIRDTNRFNLALMGYEENQYTFEIQAPENAVYSWENEPTGQGPITYVPYYTDVVMSARLNTMRLLNRSGWDYKFIIRDANTEAEVWSYNLMTLLSIARPVSRYDGTELPFQEYLDRQSEWNLVFTVVEKNGGGFLQIGIVVGTWIHWLHGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative adhesin
publication title Crystal structure of a putative adhesin (BACOVA_04077) from Bacteroides ovatus at 2.50 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
total genus 64
structure length 302
sequence length 313
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA01
3PAYA 4QDGA 3GF8A
chains in the Genus database with same CATH superfamily
3RI5K 4B9PA 1MLBB 3HE6D 4NC0B 1EERB 3BLKA 2WNGA 4JM2B 4JFEE 4NSKA 2QBWA 3ARBA 3L1EA 4FNUA 5EOQH 4DCQA 1M7DB 2RH0A 5I0DA 4DP4X 2V2XB 4GH7B 3L3DA 1QLEB 2MTAA 4ODVH 4I2XB 4LL9A 4MS6A 3CFCH 3QHTC 5K1NA 1K3ZA 4UT6H 4EI5A 3VXPA 2KI6A 2O72A 1JVKA 2IOMA 1D5BA 1NFDA 5D7SH 1WK0A 5I1GL 1D9KC 1SYVA 2P46B 1D6EB 1LDPL 4OIAA 5EU7C 2XX0A 5A40E 4JG1H 3VXRB 2ZYHA 1AQKL 3ARPA 2J6EA 3ALXA 3GBML 1O9ZA 3QZMA 3EF4A 3RP1A 3MRIA 3QDMA 5I17A 2WVUA 2OS7A 3VFNA 1JF6A 3I75B 4ZQKA 3WAJA 4J3OG 4HISA 3NSCA 5DMGD 4Y2NA 5LG1A 3L3HB 2R2BB 4PVNA 4CC4C 3L7FB 4QO1B 1GGIH 1VADA 3M7OA 1ZT7B 2DQMA 5J6SA 1XGPB 1XTLA 4ZPTB 3K2UL 4XCFL 3NG5A 4MMXC 1RVFH 2CO7A 5I1JL 1WG3A 3PP4L 4FKHA 3MRPA 4OUOA 2FH6A 4WZ9A 5GGSA 2HT4D 2ZSWB 2H0FA 2W60B 1UEYA 5A1AA 1AS7A 2J8UF 2XETA 4XNZC 4Y9GA 2X4QB 3U4EB 1BVOA 2DWSA 1GOFA 4TUOB 4Q0XH 4JVPA 4AE1A 5ISZD 4X0NA 5JQIB 2OMUB 4F7EB 3EFFB 3H9YA 1XH3A 4NN5C 4RISL 4L1SA 4PS4H 2DICA 1RMFL 4UILH 4PJ5E 4I89A 3DGDA 5JIDA 2PABA 1H3PL 3MU3A 2Y2YA 1A7NL 1AGCA 3IDYB 2EEDA 1Z9NA 4FJYA 5L2JB 4MZ2A 3CU7A 1J9CT 1MFEL 2D7TH 4XN5A 4GY4A 3HNTL 1G5GA 4QOKA 4ABUA 1HXMB 1TMCB 3TF7C 4NEHB 5EWIH 2EYTA 2DQUH 3WIIH 2QHRH 3FK3A 3IYLW 2DBLH 2FD6H 4R8WL 4AYSA 1BMWA 1Q0EA 4Z7UB 1G6RB 2LVEA 4PLKD 5KVEH 3GBEA 3EGDA 4KK6D 3GKWL 4IOFC 2ICCA 2VIRA 4PGDB 4QRAA 2C3HA 2OZ4L 3P0YL 2XZZA 3DOSA 4G6AD 4PJ6A 5MEOB 4I3GA 3NUKA 3IJEB 5KOVC 1WCBB 4PRPA 3X1GA 3STBA 4MMYB 5KVGH 2XIBA 1NBYA 1AI1L 4H5SB 1YNTA 3N1FC 5EF0A 4EIBA 1DQLH 1YLBB 3HS9A 3OR6B 4UV7L 3U2SB 3AGWA 1JYNA 3BAJA 1M6OA 4F7CA 1SOKA 2Y1YA 4PBDA 3CVHH 3JV4B 1XSKA 2VDOH 3L7EA 4M5YL 4PB0H 3OAZH 2YC1B 2LU4A 4AQ1C 4WFHD 5HHNA 1S9VB 1NAKH 1U8JB 2FUTA 4O5LH 4PTTA 1AOHA 2JV6A 4R26L 4OF8A 5GGQH 5H94B 5MI0C 1L0PA 1JGUH 1IFHL 5IF0B 4N2IA 4XO8A 4XH2B 3EO0A 1CL7I 3CK0H 2Y2TA 4NQCE 4P2QA 4S1SH 3FJTA 2CIKB 1EHLH 4Z7NB 3TASA 4WU7B 3GZKA 2E46A 4QJ3B 2ZZUT 3F05A 5FK9A 1I7TA 5EO0A 2AMUA 4NCC2 5AQ0A 5JHMA 5DTFA 1WRFA 1SY6H 4UAOC 6CGTA 1U8OA 3OF6A 2XN0A 3KPOA 4FNQA 2E9WA 5IMMB 2GK2A 5IP4A 5EU5B 1RUKL 4P2RA 5FPIA 1D9KB 5E6IC 3VM5A 3T0EA 5DQ9A 4FTVB 4WI0A 3TNNB 1J87A 4KITB 1JZDC 5D1ZI 2IH1B 4Y9CA 5HGBB 3OMAB 2FIRT 1T7YA 4AIXA 2EO7A 3LRGA 1WLHA 1KPRB 4WI3A 1T21B 4OJDH 3UBXI 3JT2A 4AWJC 1HH9A 3BT2L 1CDYA 3TLRA 4Z3FA 5KAQF 1CFTB 3IXAA 1VGKB 1PTZA 4BZ1H 5JHDD 4GXVH 3K7UA 3BKYL 2GIXA 3DROB 2XA8L 3IDIB 5JOPD 3CJJA 4LLDA 4OIBA 1FRGH 3HE6C 1BF2A 8PAZA 2WYIA 4LMQE 1NDGA 2EEXA 3S97C 4A66A 1K8IB 4HETA 5E6ZA 4MNQD 3EDKA 4DO4A 3IDGA 5D5MA 5C6PB 2GJ6A 3SY0A 4MMXB 2GITB 2I7SA 2AFNA 2BFVL 1UCBL 4JREC 1T5WB 3P9MA 1AP2B 2EXWD 5FECB 1ESOA 1MFMA 1MEXH 3QUXD 2PKDA 4K9JA 4XNZB 4DQAA 2J73A 4GMTL 5M95B 5BZZA 2ITEA 1NAMB 2C3VA 5I1HH 3I6GA 1I7RA 1EJOL 1WFNA 2Y06L 3WFDH 4F9PC 5I6OA 3MGTB 4DPAX 4GSDL 4NN5B 2BSSA 4HIXH 5F1OB 4DW2L 4NQED 1MZZA 4DVBA 1A1OA 4WEMB 1NFIB 1RZKL 1J05B 4K5MA 4G70B 3OL2A 1M42A 2X10A 4IBVA 2IO5A 2IH8A 4V1DA 1IX2A 1Q72H 2XWRA 4NLAA 5DMGC 5HJBA 1GCFA 3TX4A 1NCWL 1FVDB 1MREH 4JZOB 3NSFA 4WCYH 3VG0H 3OKOB 4UMSA 1RULH 3MUUA 4ZMZA 4HOZA 2AJ3B 3DRQA 2KZ1B 1RU9H 5K9OA 4FA6A 3G5ZA 2HLEB 2ZONA 1S7WA 4OF5A 5L7XH 3COOA 3LEXA 3HR5B 3OGCB 1TKWB 3TBWB 3WY4A 2AQNA 3U0WH 3BE1L 2HT4C 4WWPA 5JIMA 3IETA 2Z8WC 3X11B 4HIQA 3FQNB 3KYKL 2OTPA 3QH3A 4G6KH 1TZ8A 3BCDA 4AMKL 3GXUB 4K9EL 4RGMC 5EOCL 1XCWA 1ZE3C 4ZFGH 4XZUB 4XC3L 3DXAD 3RWCA 4GUPB 1TJHH 5EUOA 4B7IA 4AQ1B 1JGVL 3NCYP 4I0KA 4WFED 1KC5L 2WN3A 5ESQB 5F88B 1JZJA 2HUEA 3O6FD 5MI0B 2DLFH 4K73A 1OAXH 4UM9A 4DUWA 4NRYB 2QSQA 1GHFH 4R83A 5GRZA 4N0CD 3GINA 2JJSA 4YE4H 2F58L 4OM0H 4OAWA 2AJUL 4PLKC 3Q8FA 5D1ZD 4KK6C 4ZI8A 1KPUA 1R19A 4EJ1C 4JHUA 5EU6E 2Z7WA 2VR8A 3BMVA 3LEVH 4P2OD 4G6AC 1NGQH 2YPVH 4Y1SA 4AV5A 2XQBH 4S1DD 2OA9A 4Z7QF 3BHBA 4UAOB 1JWMA 1IM9B 1F11B 4JFOB 2KZKA 5HYQA 3B2VH 3KLLA 1KN4L 1GJWA 3FH5A 3MVSA 3TYGL 4GUCA 4TNFA 5E6IB 3SDYL 4X6EA 1T0NA 2ZIDA 5B1AB 4MLSA 4YXHL 5JR1H 2VZOA 5J6HB 5AYTA 3IDUA 1YEJL 3DX1A 2AK1L 2GTWA 4N4YB 8FABA 2B59A 1WS7A 2R4SL 3PABB 3SQBB 3BKML 1IC7L 4ZUVB 3O3EA 4JM4H 4NO0A 4BFKA 4JDZB 3QK0A 3HE6B 1CO1A 4D9QD 2IXQB 4DETA 3D18A 2P8PB 1TETH 3WSQH 1U3ZA 5F1NB 3RLSA 3IGAB 2R1YA 1AGBA 3OC8A 4JREB 4K23H 3DX0A 4WENB 1E9OB 4LPYA 1R33A 2DLHA 4X9HA 4JFYA 2ORBL 4YR6A 3GTNA 2AJYL 2OXGB 4L9LA 1UXWB 5CEXB 5I6XC 4JZNB 1N6VA 1UYWH 2GBTA 4NAMA 5B1JC 2VXQA 4BQ6A 2N3JA 1M7UA 4L2YA 3NTCH 3Q2WA 3GHBH 2HG0A 3GSXA 3RDTA 2A4EA 3D3VE 1OTTD 4JQVC 5EPMA 1U3YA 1F1AA 1OL0A 1IGJA 3CZUB 2VDKB 4ODWB 1A3ZA 2YEVB 3DRTB 4FQJL 4UTBL 1N12A 4X50A 5F0LB 1VDGA 4DGYL 1RLWA 2X4TB 1IBGH 5D6DA 1KGWA 2IAMD 2H26A 3WKYA 3QXWA 3LB6D 5FOBB 3AZUA 1JFQH 2XG4A 3US0A 3BZEB 7FABH 1GL4B 3TO2A 4N5UA 3SKJL 3KJ4C 4XMPH 1MOEA 3OPUA 3LV3B 4A6YB 3QEGH 3VTMA 4X7EC 3N6YA 2DWEB 2YEQA 4JKPL 4MAUH 3PJSA 2LQRA 4B3EA 5E2VL 1G9ML 2EXWC 5E4AA 1E28A 3QUXC 3FTXA 1T03H 2G4EA 4NN6C 1A6AB 4UM9D 3LXCA 2Y24A 4R4BB 3KPSA 2OJEA 5ISZB 5F6HJ 4RX4D 5A6IA 1EIBA 4RGMB 4GBXA 3VXSD 5FYKD 1J5CA 2XWXA 1NFAA 2H3XC 1IKOP 4YWGL 4FYQA 4KQ4H 4P4KA 1ZLSH 1HWWA 4ZMOA 3EGSB 4JM2F 4J6RL 4UNUA 5DJZB 2BVYA 3VFPA 3BN9D 3Q1SL 1AHWC 4KNSA 3VXRE 2C9VA 5CP7B 3D8MA 4FC3E 4JB9H 4ZFZB 2DF3A 4TL4A 3ZL2A 5DHVH 3F3HA 1WUNT 2AVFA 3WDJA 2O26U 4BZ2L 2J2ZB 2OQJB 2EIKB 1UWXH 2OMTB 4LCYA 4FFYA 3N42B 4IMLA 4OCSL 1GY2A 1MVFA 3BESR 2A99A 2ADYA 3SPIA 4R97C 3WYRA 2F08A 3LKSB 3S36X 2XFGB 3T2LA 1F41A 4BSVA 1HIML 4UOW0 2V0AA 3M1BA 4WY7L 5IT2H 3SGKA 5JIHA 1A1MA 2WBJD 4HJJH 4AW7A 4Q7DA 2J20A 4B41A 1K8DA 3WBDA 5D7JD 3GMLB 1FUNA 1PQZA 1DCLA 4M5ZL 5AZUA 1MCJA 1DO6A 3AW5A 3SCMD 2EYRB 4WEEA 1J1OH 3O6FC 5FGRA 2GJRA 4HSAC 4BYHA 1URIA 1X5LA 4N20A 5HHVL 1U2YA 2OW6A 1BZEA 4U3CA 1YG9A 4QXGL 4N0CC 5CLYA 1C12A 3LMJH 5D1ZC 1P84J 4KX7A 1FL5B 2DQGL 2H0EA 1DSWA 3KE0A 4HCRL 2I32A 3NJJA 4P2OC 2P26A 1U58A 1JZEA 3B56A 3MRQB 3HZVA 3PU7A 4S1DC 1NCBH 1YUKB 1FH5L 1CGSL 1P7HL 1YEKL 5CN3A 5J1TC 2VJXA 2UZXB 4C8XA 5E95B 3QGVA 5I6XB 1ED3B 5SV3A 2SEBB 3QW9A 4JL1A 4Y2DA 4R90H 1VADB 4TTGA 2ZX7A 2WANA 3NFNA 1PFOA 2P8LB 4Z7UF 2HT2D 3MLTA 3BAWA 3MLSL 3MNDA 1JHKH 3ARYA 3DHUA 3TP4A 1PIGA 3T0VA 2CIIB 5JHDB 1OAZH 1GYVA 1HZHH 4XNMA 3TJHD 5I82A 3H3PH 3KPSD 3QFJD 1NA8A 4DGVH 3VW3L 4G5ZL 4S0SD 3J8F7 1MNNA 4NFBA 5F7YC 3MPCA 4MNQB 4XNXL 2NNCA 2V37A 1B88A 3KJ4B 1E4HA 3MJ9H 2NPLX 2BMKB 2ID5A 2VUOA 3OSVA 3SDAA 1VAHA 5C2UB 1SOQA 4EF3A 2BIMA 1R3HA 4BSJA 2ZKMX 2B15A 4QRPA 3F58H 4BGLA 5ILTH 4YZWA 3QUXB 3N06B 2AITA 1EX0A 2FUQA 4NN6B 1HE7A 3HMWL 5F0PB 3VI3A 3NFSH 3UPRB 1IEAA 2VLRA 1JDDA 1J9TA 2CDEB 1OP5H 3V52L 2JKSA 1MFCH 1XSOA 3QUMB 4LAJH 4W9FC 3IAQA 1ZLWH 4CVZA 3VGHA 3GUTA 3O9WA 2WXLA 1CBJA 5KJRL 4NQEB 1OTTC 4N8UA 4P0DA 3UO8B 4WTZA 2AXGB 3ZQ9A 2WVSA 1MIEH 4Z7NF 2P24A 4LBEA 4UU9B 1CXFA 3LQZB 1AQDB 4FXKC 3RZCA 5EU7E 2COQA 4FYRA 3RRQA 4FTVE 1AHWB 2QVMA 4KZEH 3N0PB 3UXFA 2IAMC 5M94B 4HHWA 4UT6A 4F57L 4ZDHB 3LB6C 3CFEA 3X12B 2QGEA 1M6OB 3DTXB 3V4PH 2HG5B 1PLCA 2Y5QA 4OTXH 4HAKA 2WIIA 4OLUL 4Q74A 4WU5A 3ZSTA 1H0DA 1KYFA 3L7EB 3LZLA 4WK4B 3GRWH 1JE6A 2B3RA 5AEAA 5EG6C 1AGFA 2QKIC 3TT1L 1J9RA 1UD5A 1BHGA 5JORB 2WLHA 3APDA 5BNXD 4CSTA 1YYMH 4R97B 3ARQA 2OLDA 2AANA 3EGXA 1I85A 4D8PB 4R96A 1JNLH 3QPQD 4P5TA 2YJLA 2IADA 3FB7A 1MI5A 2F7OA 5IFJA 1NKRA 5C0FB 2FL5A 2WC7A 2ZWSA 3DIFB 3DXAB 4XMVA 1Y07A 1V7ML 4EI6A 3CDGA 5H37H 3F85A 3KVPA 4Z0BL 1X6LA 5KVDH 2Q5BA 3O6FB 2WM0A 5JA8B 5LJYH 3BN9C 3K81A 3N40F 3DO7A 2FCBA 1G7QA 3C6LD 5ECJE 5FA3B 3LH9A 4LSUL 3AACA 1UD8A 3TBVA 5KYUA 3VXTA 3ZUCA 4OCLC 4F2EA 5D1ZB 4KPHH 4X4MA 2WB7A 1MLCA 5DQ9B 5DS1A 4F20A 2APSA 4P2OB 3UBXB 4KHTH 2NY3D 3W11D 1K4DA 4TPRL 1GZQA 3SY6A 2Z31A 2QGBA 3V7MA 1BQUA 4DKAA 5BXFB 5IMLB 2VZVA 3BDYL 4S2SA 3TJEL 1D7FA 2JLPA 1YYCA 1HI6A 3PWPA 4K3EL 4J3VA 1CR9L 4WW1A 1T1ZB 4YSCA 4JPWL 5CF3A 2WBJC 4R4ND 5D1QD 5IVXB 1I1AD 1MN4A 5F7LB 2A38A 3JWNH 3K0YA 3QAZC 1J88A 5I30L 2H45A 4HPYH 5D7JC 5I6KA 4U1KB 4KI5D 4WRLA 4G5AA 4XBEL 1AXTH 1DJYA 3SCMC 3W56A 5HYIA 3ZMRA 2EYSB 2X1WL 1YJDC 1TXKA 2BP5M 1HHGB 2GKIA 1E30A 3UG4A 3P9MB 4RNRA 5IVZA 4IJ3C 4L5FL 4D0DA 2ZWYA 1PNDA 3UMTA 4PW4A 1LO3H 3S34H 2A7BA 1I7RB 1UZ8B 5DK2A 2D2CC 1OE3A 4CN6A 3APFA 1YNKH 1SXNA 2X9XA 3WEBA 3MODL 2Q87A 3V10A 1A1OB 1P7QA 3P3RA 1NBZA 3CVHA 1U95B 3V0EA 2QQNH 4AK1A 3IFLL 3J7HA 1MJUL 3BUPA 2VMCA 4CAGA 1BF8A 1KCSL 2CZNA 1S8DA 4P9HC 3WS3B 1RAMA 5CJXA 2LLLA 1GXEA 3UZVA 1BQLL 3DRQB 2HFFB 1MCDA 1XCQA 1JHLL 4TN9A 2VMFA 2ADIB 2HT2C 1MVUA 1U30A 5DJAB 2AABH 4V2CB 1TJMA 3IGFA 4WK0B 3KR3H 4DAGH 2UUDK 2BDNH 4FXKB 5BRZD 4XE5B 4OF3A 4MQSB 1SUHA 1Y1DA 1MNUH 4XC1H 3TJHC 3C5ZA 3WTSA 1SY6A 3ARDD 2IAMB 3DI2B 5I8EB 2R0WL 5F3BB 1NGPH 1SJHB 4XPTL 3MRKB 2G0KA 2AGJH 3U83A 2X6CA 3RWCB 3MOAL 4CRPA 4G8AC 4U6YA 3NSDA 1UWYA 2G75B 2IGTA 5A2IH 4GG8B 1NWPA 1DVZA 4DN3H 1P6AB 3HN5A 4BWUA 4AQAB 1XQ4A 3ULVD 4UM9B 4AIOA 3MTRA 1A7PH 4WTQA 5F9JA 1QYGL 1AD0A 1HXYA 3VXSB 4F15C 1L9TA 4J3OH 1G9NC 2MNJB 4UM8A 4GRLA 1KPUB 3OAUH 4MLIA 1U8PA 2X0VA 5GJSL 3RNQA 2K0RA 2OTUA 1S9WB 2DWXA 2ZCKL 4PD4J 1QA9B 4TS6A 3HC3H 5KSVA 3C12A 3VFOA 5C0AA 1PY9A 1QABA 3VQ2C 5HYQB 2ZP9A 3CFMA 1CD1A 4RRPG 4NHUA 1TTUA 1CLZH 4MAYD 2XQYG 4XB7A 3CLFL 5JHLL 5D7LD 4GMSL 2VISB 5I1KL 1K6QH 1PU0A 4YDIH 1FNLA 1FFNB 4X6EB 1IKFH 1UCTA 1MCNA 4N2CA 3CE1A 2JXMB 4XCCL 4LDOB 1BPLB 1IBBA 3OKKB 4Z76A 2HN7A 4OZFA 3HPJA 4RWYL 1XF3B 2VDNL 4X4XA 2CALA 3DOHA 3QPQC 1B4TA 1AXIB 2DS4A 3O3EB 5HY9A 2WBJB 4BWTA 4JCMA 4LARH 1ERNA 4JRFA 5T5FL 5SX4H 1YMMA 4WSJA 3QAZB 4YL9A 3V4VA 5D7JB 4Z7VA 1W0VB 2IGFL 4QHNA 4XBGB 4MJ2A 1S3RA 1SXAA 3SCMB 1RL1A 3VDAA 1OM9A 1SXSA 4L0PB 3ARGD 4XVTL 3B9VA 3MR9A 1YN6B 5F97E 5ISZE 4RFNC 1NGWB 2G9KA 4FMKA 4IJ3B 4JFYB 1TLKA 1TITA 2D2OA 3GSOB 3C6LC 3P11H 3KNBA 4YR6B 4OKVA 4GQ9H 5AD0A 3VQ1C 2IMNA 5DJ2A 4QGTA 3P2DA 1WHPA 5JUEL 1NLDH 4FP8H 4FJ6A 5D7KD 2M2DA 3GSXB 3MV9A 4AOFA 4WKXA 2NY3C 3W11C 4R0LA 2ICEC 3TTSA 3MXVH 1R46A 3ZSSA 3KXFA 4GW5A 3UTZB 4KI1A 3ZU8A 1W15A 2OKMA 4I1NB 4IK7A 4X8GA 1JYXA 3SE4A 3DUUA 5T3XL 1YC7A 4R4NC 2LAGB 4RMBA 5D1QC 1I1AC 5I1CL 4CDHA 2DIAA 4BV1A 5B38G 4X98A 4X6CA 3A6OA 3UC0L 4YJZL 4KI5C 3UTSA 5D71H 1KCVH 1KGYE 5I9QB 1TTAA 1USQA 1B0WA 5LXVA 3LS4L 3NACH 3BKCL 4J3WA 5K5YA 1SJEA 2I7OA 1F2QA 3WLWD 1AYRA 4BXSV 1MFNA 3D34A 3N42F 5DS2A 3WUWB 4HLZG 1HYSD 3KPSB 3QFJB 1NEZA 4RA0C 3R8BB 2A6JA 2FYYA 3PRZA 3L9YA 4WFHE 3CHQA 1TLMA 4ZUTB 4EOWL 1W8NA 2VCOA 4XO4A 4IKJA 3FUEA 4AIZA 1ZVNA 1E7VA 2OMWA 4GI9A 4RGND 2K3TA 2CKNA 5ICYA 3BUYB 5C0GA 4QD2E 1QWHA 3EOYG 1DUZB 2VITA 3EHBD 5LG6A 3OPZL 1FN4B 4UBDD 5C71A 1Q0YL 1AOZA 2YBRA 4EE2A 1QFUH 4ZZKA 1FCCA 5EZIH 1KCUH 1ZHNA 4KDVA 3FSWA 4S1RL 4F15B 4LP8A 4H0HB 4LSRH 4O02L 2DLEA 4PRNB 4O2EA 3K6DA 3PXJA 1A3QA 2WBWB 4WI6A 5ANMA 3AAZA 3KVQA 5EBMA 4DGIH 4XX1G 5C7ZA 4GI8A 5D96C 3O8XA 3FFCA 2VC2H 3GIVA 1OK0A 3TIEB 3T9WA 3V5DB 3TEZA 2L4OA 1SHWA 3ARDC 2R2HB 4Q4EA 1OP3K 4IMKC 1QEWB 1DJXA 1I7UB 5DI8A 2NY6D 1KB5B 2PXYA 5HDQL 5LQBL 1OT2A 1K8DB 5GSRA 2B3IA 5E8NB 2MCAA 5JHDE 1ZXQA 3VFUA 5JOPE 4ZS6D 4NGHL 2P5PA 1NUGA 5CO1A 2O5XL 3ULVC 2A9ML 1DEEA 4P4RB 3MV8D 5G2NA 2CLVB 2NDFA 3I74A 1C12B 2ODHA 3QEUB 4ORGA 4P49A 4V11A 1LDPH 2ZNXA 2VR7A 4Y4KD 5FWRA 3KWXA 2IFGA 2EE2A 1AQKH 1L9OA 4JPKL 4ZNCD 1JXFA 2BERA 3Q2LA 1FG2B 4QOKE 4E9YA 5EO9B 5AG9A 2V2TB 2R8SL 3O3BB 4RFNB 3WLBB 3ZZQA 4L29A 1I75A 2FGWL 2OW7A 4MXVE 4GEIA 4X6FA 3NAAL 4UUJB 2VZUA 3C6LB 4MAYC 4F7TA 4JLRB 4NO5A 1IBHA 7TAAA 1QLRA 5JOFB 2P44B 2XTJD 3APNA 2XBZA 5GGTL 2XTSA 3AXLA 3LHPH 5GS0L 4WHTB 2WYTA 1JZ6A 2ADJA 4AV0A 3K2UH 2A9NL 2A6IA 4XCFH 2NY3B 3QORA 1R3JA 3OGOE 2ICEB 4MXVF 5I1JH 3PP4H 3QWRD 4KJWD 1BM7A 4XP4L 2N7AA 3G5YB 2ZPKL 3IS1X 5ICXA 3WE6B 3U9UA 1UT9A 3L5WA 5CMAA 1BPVA 2WUCL 5JNYA 4R5XA 2UZIL 1F3DJ 4J3XA 4RFOH 5D1QB 4HULB 1I1AB 3S88L 2G3NA 4HJ1A 1WH0A 5FUZH 1VHPA 2C4FU 3DWTA 4HLJA 2NNAA 3MJ7A 4OUUB 4W9JC 1RMFH 1YDPA 1JPGA 2OYKA 4Y1AA 2XX1A 1N59B 3ARGC 2YK1H 1NOLA 1H3PH 1A7NH 2GJPA 3B3IA 4A39A 4HIEB 5G5DA 2IBGA 3PE9A 1MFEH 4IRJD 1OGTB 5AZEH 3U7WL 1Z9PA 2Z3FA 4LPXA 3FO0L 1N0LB 3DXAE 3W9EA 4Z78B 2NYZA 1DDHA 4LSQL 4WFEE 3L4ZA 2WSDA 4R8WH 4X5PA 1HQRB 4QDGA 1EDHA 2VDQH 4QXTB 2CMRL 1U91A 2NW2A 2VW4A 3RGHA 1P5VB 4M8VA 4XMXA 3GKWH 1BD2D 3IU3B 1F6AA 2OMYA 4X9IA 2WLIB 4ZXBD 4NKIH 2OZ4H 3P0YH 5LGYA 1GYCA 2IPKB 4WHDA 1QSFD 2G5BA 4G1EB 3TEXA 4LBEB 4MXWH 2XPGB 4NC1C 2ZCLL 4FL4C 4LCUB 3F2LA 2XJKA 1AI1H 3WCYA 1BECA 3T0EE 3T2PA 1DANT 4OGXL 1XGTA 4UV7H 4J8RB 2WXRA 1YEIL 3BRFA 4AYEC 1CGYA 3C5XA 2NNRA 4WU5B 3GMNB 4M5YH 1KEML 5AW7B 4DIXA 2DM2A 4HCGA 1AGFB 4N2HA 4I13B 5F9AC 3DX4A 2Y9RT 4HBCL 5IVXE 1HESA 4A7VA 4R26H 2KDGA 4MNGA 5BRZB 5D96B 3WLWC 1IFHH 5IIEA 1HYSC 3P4OB 3ARDB 1RIHL 4OJFH 1LEKB 2CDFA 1U42A 5A2AA 3B3BA 2X4UB 3GHPA 4G1MB 5IVXF 3BKJL 1JWUA 4KKRA 1GGCH 2ITDA 2FJFA 1IBZA 4RGNC 3DLQR 4JDEB 4CW1B 4JN1L 2GSGB 2QKSA 4D9QE 4JW3A 4NT6A 3F7KA 3EHBC 5LXGH 2OSWA 4GOSA 4UBDC 1SEQL 1WV7T 3D5OF 5AW3B 5B7MA 1X4XA 1N9PA 2R23A 4HOWA 5C0JA 3PWJA 1E8ZA 1ANUA 2ESVA 3FDWA 1BCIA 2MFNA 5FA4B 3SKUD 3U2IA 1RXLA 1M05B 1Q94A 2WZ5A 4MJ6A 3N2JA 4UTAL 2PN5A 1AIFB 1R5VB 3MJ9A 4Q56A 3BT2H 4OCXL 5F21B 5BVPL 5K9KA 3GI8L 4MKTA 4JAMA 4J1UB 3BZ4A 2R9HD 4MJIA 4PJGA 2PETA 1RHFA 4S2SB 2E7LC 1SM3L 3K2IA 4WNQB 2XA8H 1DVQA 1HI6B 2WY3B 4MAYB 5E2WL 5GGVH 3DOIA 5D7LB 2J5WA 2NY6C 1BFVH 3PGCB 2NUTA 3SD2A 2MTPA 1T4WA 5E8OA 5HYEA 1MKFA 2YUVA 2F54A 2L04A 3R19A 5TDNA 4KVNL 4K94L 2WTRB 5K59E 3LZFH 4Y1AD 2VLJA 2BFVH 1UCBH 3IJ8A 3QUKA 4ZS6C 3REVB 2OX5A 1ADQL 1U93A 4JDVB 5C7XL 5DUPH 5IVZB 4EXKA 1A4JA 4J6IA 1UJ3A 3VWKD 4GMTH 1XZ0B 1N3NB 1FO0A 1U8KA 3PFQA 3T0XA 2XVKA 4Y4KC 1E65A 1EZVY 1XL6A 2XZQL 5EUOE 1EJOH 1WBXA 2Y06H 3A6BH 3EKCA 4Y5YA 4FS0A 5K59F 3B7SA 4BUQA 3FCTA 1UQSA 1INQA 1MRFL 4DW2H 1YY9D 3V4PA 2EDLA 5ALCH 3ARGB 3CVHB 3TCTA 1A1NA 1BZ9A 3GRWA 4QY8B 2PWEA 1MDAA 3ECUA 3LRHA 3VAEA 1AO7A 3UEZA 1XL4A 3VXSE 4AUJA 1NCWH 4WUUA 3OKDB 4JGUA 2Z92A 4EKJA 2XTJC 2IH9A 3WTYA 2EUXA 2Z0UA 2AV1B 3UZVB 1Y0LA 4M02A 2EDQA 2IQAA 4QRFA 4N8VB 4NKDA 4EDWL 1XCTA 3FCSA 4KJWC 4N3TA 4YSQA 4BHUI 3DGGB 4P99A 2QT6A 4PEEA 1QATA 1D2PA 4ZPVB 5HHOA 3ASOB 4JANB 1KIRA 4YHPA 4P2AA 1FZMA 1SJVA 4FL4B 4PSPA 3WD5H 4M1GH 5I16B 2X3AA 1L7TL 2Q7YA 2NY0D 1MJJA 5AOMA 4K9EH 1ZIAA 5EOCH 5L4FA 4ODXB 3WXWL 4LIQE 4CN4A 2AEPL 3CXHK 3M8OH 7PCYA 2VRAA 1BIHA 2L7EA 3VH8G 3L3IA 1KC5H 4HIHB 2K6YA 3E6FA 2ZX5A 4IRJC 1GAFL 3TNMB 5ESAA 4CMHC 5IJBC 4OD2B 4MTMA 2HJKB 2ICWA 5AZ2H 4JRXA 2UWEB 5E6UB 4LRNH 4MZIA 2WO2B 3CXDH 5IOPA 1AD0B 3DBXB 2F58H 1CXHA 4R5VA 5DVMA 4Z5RA 5DRZB 4JCWA 4UM8B 4NZTL 3HNVL 5CHNA 4AEFA 4YPJA 3GSQA 3OQRA 3RNQB 4ZXBC 4MKMA 1VFBB 1Y6NR 3ORJA 3AY4C 4RGNB 5C86A 1SFDA 5E1HB 4F8TA 1EXHA 3RIFF 2EKJA 3GXDA 3MRDA 3K4AA 3LNEA 1N70A 2VXUL 5HI4D 5D7IB 1JGLL 1F2XK 1TZHB 2NY5H 3EHBB 3ZBMA 3OZLA 1KN4H 4XXDB 4UQ2A 3TYGH 1HC1A 4AVKA 4M29A 2EDJA 3IFOB 1YEEL 4X99B 4MCYB 3QIWA 15C8H 4H1LG 3FZUD 1XD0A 5TDOA 5HJ3A 5E1GA 4PV9A 4A63A 3BWAB 3B9AA 1YEJH 4U1JB 4P8QA 2WIMA 4ELMB 2RACA 3VXOB 3GXTA 3WGUB 1HILA 1UXLA 5DD0L 3EG9A 2IPUG 2R4SH 5F1SA 5J1AA 5CBAA 1KIUB 1M7IA 3BKMH 3OXSA 1PZ2A 4RQQA 2VSMB 4Z9KB 5TDPB 4HPOL 2H8PA 3LZPA 5EU3B 1THAA 2NY6B 1WZMA 2P80A 4JY5L 1B6DA 3CXFA 1WZAA 1DUYB 2D3LA 1RUPL 5SX5H 1IGTA 1MRCL 1OLLA 1HHIA 4X5WB 2DMKA 3HVNA 2J56A 3KPSE 3MR9B 3QFJE 4P57B 4OLZL 1QHQA 3OKMA 5AW2B 1CE6A 1IQDA 2YLHA 2Q2LA 4TV3A 3MV8B 2ORBH 2GJZA 1S5HA 3BUDA 3QJOA 2AJYH 3KH3A 2E9BA 2HPOA 3WN5A 4QIRA 4WUUD 4Y4KB 1ZV5A 5TQ2H 3ZKXC 3IB4A 3KLAB 2J71A 2XICA 4LPCA 2BHZA 2DWDA 5BVJA 2DJMA 2ATPA 4ZODA 1R3LA 1ROWA 4RAUB 3H2PA 5AKVA 1N67A 2EO9A 3Q05A 4RAVB 3C8KA 2H1PL 1H3VA 2BPBA 2JF1A 1X44A 2R9HC 4TVPL 4FQJH 4UTBH 3V0AC 3SPHA 1IE5A 1ZD6A 5EEYA 4EUPH 3E1F1 4DGYH 1H8SA 2VZ1A 1JZIA 5CCKL 3QZOA 5PCYA 4HIIA 3K8KA 5FOJA 3VE0A 2XTJB 3EDFA 4ANWA 1JERA 4K3HA 2QGCA 3FT4B 3RNKA 3SKJH 4C56A 1RZQA 4JFQA 4HUNB 4MCNA 3RVVD 5E8DL 1L5GB 5E2VH 1G9MH 1NIBA 3DURB 3Q7JA 4G8IB 3VWKC 1T4KB 1WA2X 1WBZA 4A67A 2LR4A 2W5PA 3QZWA 3I9IA 1XIWD 1NEZB 5EDSA 2W9DL 1MH5A 4OLYL 1MAML 1AR2A 5J5EA 1XDTT 2FEDD 1YY9C 2HX7A 4WUKL 1PD0A 4YWGH 1KJ3L 3GSNA 1FFOB 2UXGA 1NCUA 1P69B 2EEBA 2IMMA 1LEIA 1MRDL 3GTVA 3R06A 4IRJB 3VRJA 3RWJA 4CMHB 3GXIA 2DZEA 3Q1SH 2NZ9D 5MEPB 4DP1X 2YBRB 3T6VA 2PTTA 1ZEAL 5I6LA 3RUGA 1BOGA 2EVHA 2EXYD 4GIAA 3SZ6A 3JWDL 5FFGA 2HKHL 1BD2B 1WISA 3CPLB 3QYNA 4ZXBB 4U1LA 3I9GL 5EBMB 1QSFB 4DVRH 4OCSH 4YDMA 3EO9L 4GSRA 3TBBA 4B97A 1RPKA 1I3RB 1HIMH 1UA6L 4WY7H 2NY0C 4FFZL 4U1HA 4TULL 1TQSA 4BIKA 2F9BT 3FO2A 5J8OA 3HCVB 1U8IB 1FVEB 3NDYE 3D48R 2WKGA 1ZGLM 3KCPB 1J0YA 2JJUA 4M5ZH 4YUEH 3X1NA 1LM8V 3LN4A 3VFUB 4L3CB 2WLJA 1OARL 5K9QG 5D1QE 1O7VA 1IGCL 3I6SA 3P77A 3TF4A 4DOHB 5GS1A 5IBTH 3WNKA 2V6HA 5DWPA 4QXGH 3LKNB 2H47C 4KI5E 4HUKB 4G80A 3GGWA 4Z95L 1MUJB 2IFFH 4PN6A 5CP3H 4JE4B 2AXFB 2DQGH 1SBSL 4HCRH 4LPTA 3W38A 2LU7A 3DJSA 4L8CB 1XF5A 1FL3A 3C9NA 3FFDA 1B3JA 3B2DC 4KI5F 2W0PA 1FH5H 5HI4C 2ZG1A 1BFSA 1CGSH 3HG1D 3IKCB 2PW2A 4G7QB 4CGTA 3B4NA 1YEKH 4KQ0A 5J13C 2EDTA 1DZ0A 1WT5A 5C2BL 3PDGA 3JTSA 2W0FA 1MWAA 3ZKXB 2BVUA 2W9EH 3FZUC 4PV1C 1QO3B 2D03L 1IFGA 4HZLA 1PZBA 4J3OD 5JW4M 1PLGL 4UIMA 1W72H 1X9LA 1NAML 3L5WB 1BFOA 3QR0A 3QDJA 3NN8B 1GPOL 2EKSB 3VW3H 2X87A 3O45A 4ZMXA 5J0BA 4G5ZH 4H26B 1ZA3B 4ZS7L 3N1MC 2Y25A 4HXBL 5BO0D 3QWQB 4QWWD 2H3KA 5BRZE 2NNAB 5DHVB 3W37A 1JPGB 5L4IA 4Y1AB 3UZEA 3R0NA 2X1OA 3BVXA 4PI2A 2D7MA 3B3IB 5I71C 3EYFA 1FI8C 3GBNL 3O0RH 3N55A 3SE3A 1NCOA 1W9XA 3Q8CA 1DQJA 4JFFA 3VWKB 4EQ3A 5J7CC 3HMWH 3MLYL 4YBLC 1CTMA 4ZW6A 2H6PA 4Z7OF 2FJHB 3MFFB 4R7NB 4X6DA 3V52H 4NKQB 2VDRL 5KJRH 3S98A 2BIOA 2EDRA 2BHUA 3BP7B 3S3BB 3EF7A 4L05A 3L5JA 2OMYB 2UX6A 1EAPA 2EQDA 3PWUB 5C9JA 3S3PA 1QNIA 3D0LA 5DJCB 3GMQB 2GT9B 5HGDA 1A47A 1GOHA 3LKPB 2G5BB 1VSCA 1WWAX 5EHFA 2FX9L 5DF0A 1OPOA 4UOJA 1QVOB 2BOLA 4U7SA 3ULVF 3UAEA 4Z6AT 4TVSa 4OLUH 3VG9C 1U8CA 3T77B 5IR1A 5KUKA 3FB8B 3PWVB 1BYNA 3ZKQD 4JX0A 1FNSL 1SYSB 3RVVC 3TT1H 5EEWA 12E8L 4ABWA 3KL0A 1UVQB 3RAJL 3FH7A 5A16A 3TCLA 5D7LE 4E41D 3L95B 4BDVA 5D9SB 4A7TA 3D05A 1XIWC 2NY0B 4AW4A 1A9EA 3RE0A 5KVEE 2WLLB 4M8RA 4F92B 2FEDC 3ATFA 1ITBB 4WO0A 1RP8A 3NA4A 1OAUL 1D6VL 1V7MH 3JWNC 1IGML 5G55A 3Q3GB 2AEIT 4N2BA 5AVZB 1KV7A 4FG6D 2CPCA 3RL1B 1FFPA 4MSWB 2YGOA 1PZUB 5KVGE 1AKPA 4PHXA 3KYOB 1JMZA 2A0LD 3QUYA 4GO6B 2F5BL 4BSWB 2NZ9C 4HGWA 3WJJA 2HMID 3B2PA 4WTWA 4LSUH 1KFGA 2YFOA 2P7TB 2EXYC 3VM7A 5C0JB 1B2WL 1ZDSA 3PWJB 4N0FA 3ZMEA 5CSGA 2LFEA 1JUFA 2V9RA 2VQTA 1OGPA 4MJ6B 4TPRH 1B0RA 43CAA 4FFVD 3VFWA 5KSAA 2ZP0T 1U8NB 1F90L 2QSTA 3BDYH 3TJEH 3R7QA 3ECWA 5D7KE 5C07D 4YFEA 1FCGA 2BSEA 5J13B 4JEGB 4AYFA 3EO1A 2BY3A 5EDXA 2X1PA 3FU5A 5T1KA 3QBTB 4JG9A 5I30H 2FATH 3LD8C 3LN9A 4NC1E 5TDNB 1R4XA 4PGBA 1ORSA 3LVTA 3QUKB 4LOFA 1CFVL 4MMZA 1JI1A 4A7GA 4Z77A 5J9PB 3QG7H 1PZAA 5DRNA 3WNJA 4L5FH 3MA7B 4TKWA 5DD6A 3H9SD 4NQSB 2NSQA 1ZHBB 2AW2A 2Q2EB 3QJFB 5E6SB 2EZ0D 2WLMA 1MXGA 1N64H 4LEBA 4KC3B 3ESOA 4LESA 5TPWL 1JZGA 2VR3A 4YSDA 1I1FA 3ARVA 1E0OB 4BWWA 3LKOA 3BH8A 3FUIA 3QA3A 3V4PB 2VDKL 1PYWB 2E8YA 4PUBH 4LQ1A 4NENA 4HKJA 1S7SA 1FG9C 1JK8B 3KEDA 2XACC 4G2AA 3GSUB 3S36L 2ZKHH 5I71B 1K3IA 3MRLB 4X8JA 1MJUH 3TO4A 5I1DB 4I1RA 4LHUG 1AANA 3CX2A 3CHRA 4YBLB 4M6OL 4WUUB 2IH3B 1LYQA 2VM4A 3A21A 3F84A 5AW4B 1BQLH 2UWEF 2QADD 4FQCL 5CUSL 2JKWA 2Y6SD 1GIGL 1N8ZA 3FCSB 4J3OC 3CX5K 5EZJA 1LXMA 2VQ1A 3VWJD 5DC9B 4FFWD 4XO9A 4JBSA 1HNGA 5DUML 2PCPB 4JO3H 4KH9A 2BOBA 4RDQG 5EIIB 5I66A 2W94A 4CSPA 5EBWA 1S9XB 5I76B 4HMCA 2AK4D 5D7IF 1MJJB 1OF2B 2HX8A 3QJVB 5GZOA 4NNXA 4PJ8A 2FLMA 4QWWC 4XPTH 1XH1A 3VG9B 4ELME 3LX9A 5IUCA 1P0SE 1MAKA 4XRCB 4I3RH 5DSCA 1RZJL 2X9YA 4PCYA 1F8TL 5HGGS 4QHUA 3TBCA 3VI4B 3NP4A 1PIFA 1GR7A 3Q01A 1XGQA 4ECNA 3CNKA 4HS6A 5IW3A 4K8RH 4FF9A 3M88A 4ELMF 1XIWB 3MRBA 4KWUA 1BGXL 2JK5A 4YNYA 4ZUUA 3PQYA 2Q86B 4X9YA 2YAEA 4IBSA 5J56B 4JQXA 4N9OB 2Y5EA 5GJSH 3MV8E 5AVRB 4JO1L 1MXDA 4GP8B 3JSSA 2YAPA 2C1OA 2ZCKH 2R15A 3MUZ1 2F7PA 4YS4A 5ADPL 4PJHA 3GNMH 4X80H 4P05A 4PRDB 4L3ED 1AGEB 2GSIA 4TOYL 4JRWA 4W9LC 5JHLH 4GMSH 2YD1A 2LU3A 5C0RL 3QP3A 1QHOA 3QEQD 3DMMD 2DWTA 4YDVB 1KPVA 5JDSA 3R8QA 1AJ7H 2E9IA 4ZK8A 5TDOB 1T89A 3QDGD 2BFGA 4E9WA 4GINA 2MQGA 1SGKA 4XCCH 5F9OH 2V2WB 2A1WL 1FNEA 2ZXEB 1YSOA 2XTJE 4KUZL 2H1LM 4RWYH 5L6YL 1G84A 1GC1H 2VDNH 1KBKA 3CWGA 2R0LL 5LGJB 1CDBA 2H8PB 1OW0A 2J1YA 4XO3A 2RQ8A 4CUCA 3WNIA 4I4WA 4D0BA 5T5FH 2J6EL 1BXAA 4M8QB 1KXTA 3VFSA 5FV1L 5B39G 3U36A 2Y7NA 2IGFH 3LD8B 3DDGA 3FTYA 4YSEA 5LVEA 4FG6C 4XVTH 1K85A 1U33A 4UT9H 1Y1UA 1E3ZA 1TTFA 5IVOA 4FERA 2A0LC 1CE6B 4PP2A 1QLFA 3TO4D 1PVHA 3LNIA 2HJFA 2XWEA 1P1VA 2HMIC 1S5HB 2PR9A 5E4IA 3AC0A 3RQ3A 4TTDD 4WGKA 2X05A 3HLAB 3MV7A 4LDCA 4OT1L 5FKPB 5JUEH 1JK9B 2FBJL 1OCCB 4N2LA 2N01B 2ATPB 1SZNA 3CLEL 4JG0H 3MJ8B 2ROYA 5AVYB 4FFVC 4TUJB 4XP5H 4A2DA 1W16A 2EIDA 3OKNB 1CFSA 3HG1B 4RZKA 5T3XH 3NQKA 3SGJC 1G1OA 5LNGA 3WIFA 1P4LA 5I1CH 1ZVSA 2BNUA 1NMBL 3O41B 1QSFE 1RUML 5GIRB 5GZOD 3RNKB 3FT9A 5KSBA 1VENA 1MFVA 3U4KA 1I1CA 4MYWB 3WO3B 1WZ1L 3QNYA 3UZEC 3M86A 2QQKL 4WF7A 3NZ8B 1BVLA 5ECGA 3SJVA 2K6WA 2G3XA 3OMZA 3BKCH 5DZVA 4QXUH 1EZVX 2AXWA 2XXFA 4H8UA 1K5NB 5L8KB 2EZ0C 3QZWB 1FL6A 2WXMA 1TENA 1EAJA 3EYVA 4OB5H 5EF1A 4WI9A 1B0GA 1DFXA 1BBJB 2APXA 4EOWH 4AYID 1DVFD 1W80A 2Z93B 4DOHE 1G1KA 5A2BA 5KBLA 2OSLA 1R24A 4NYLA 1LEIB 4HUVA 1D5MB 2BM3A 1I9JL 2DTMH 3FCGA 1Q9OA 3OPZH 1HHJA 5FCUL 1T83C 1Q0YH 3LNDA 4N26A 5DLLA 2ZAGA 5ACMA 3ZTDC 4DSYA 5JQ6L 3S8WA 4HGKC 1BLIA 2QADC 4S1RH 3QEHB 5B3SB 1PDKB 2Y6SC 2ZJSL 2QV2A 4ZMWA 5LAXB 2ZXCA 3AG3B 3KG5A 3HVDA 3K6NA 2X70A 3VWJC 2PYED 3P3YA 4FFWC 3WI9A 4F7MA 5HYSA 3O2VL 4C59B 1CGWA 1OAKL 2OYLA 2AQTA 2XV6B 5BO1L 1A0QH 3IU4L 4E0RA 2XNAB 3GBLA 1J8HA 2ZQKA 5C0ND 2BWQA 3MLPA 1AS6A 5HDQH 4GEJA 1A2YA 1TCRA 4H88L 3OD3A 3MRCA 1ZJBA 2CH8A 4MZRA 4XVUD 4NGHH 4E41B 1PZ5A 2A9MH 4PWKA 3Q6FA 5F0MB 3UO1L 3STZA 4XVJL 2UZYA 2WXNA 4KK9D 4FQHB 4EUPA 4Y1AE 5CLWA 1KCWA 3WN6A 1AXSA 3LKQB 3LPGA 5IB2B 1OALA 3BCFA 3FRPG 3UAJA 1KNOB 3WL9A 3HFML 1I7ZB 4EIZC 3JQOB 3VX0A 2R8SH 4O00A 2E7HA 1FAIL 3O2WL 2FGWH 4YAQB 2DQIL 4K55A 4QHMA 1NCIA 1SVZA 3NAAH 5FKAA 5C0DA 5T5NG 3NCYS 4Y16A 4D7PA 3PHQA 1BV8A 2EDOA 2W0KA 5HHMB 5F7EL 4FCAA 2W0FB 3DMMC 3GO1L 1HJBC 3UADA 1P7KA 3ZX1A 2BP8B 4AG4H 4YDZA 4OZGB 5C3IA 1OGAA 4YHNA 3JT0A 1KN2H 5FO2A 2YSSB 4QAMB 3U1PA 5C0EA 4U05A 4H25A 4APXB 2Z4TA 4NKMB 1ZGLP 2ZPKH 1OAQL 4OVVA 2A4ZA 1OPGL 3RWDA 2V7NB 1Y6MR 5AALA 5C07B 2WUCH 3D69B 3BDBA 1N5YL 35C8L 2XY2A 3HC4L 5JLZA 1ZT1A 1WQVT 5A2LH 1FP5A 1U6AL 1KLFB 2CHDA 4E5XA 2IV8A 1G43A 2F5AL 2P47B 2KL6A 3ZE1B 5ID0B 4MS8D 5EU4A 2LLNA 2GEEA 3BJ91 4IJTA 1RUAL 4NCC1 3PGFL 5JW5A 3U7WH 3B5TA 3H9SB 3FO0H 1DQJB 1WWCA 3CVBA 4TTDC 3EFOB 4S1QL 4G42A 4FRWA 2TSBA 2VC2B 2DY2A 4HKBA 4NWTL 3SKOA 2CMRH 2BNRD 4R7VA 4OQ1A 2QDWA 1OHZA 3VO0A 3LS5L 1MHHA 5AW6B 2WZ0A 5F89A 4PIRF 4ZMPA 2I85A 5B7FA 1DQDL 1NSNL 5CNHA 4F7PA 3BZFA 4H1LH 2ZCLH 5DJ6A 1WITA 4OGXH 3TH3T 1CDGA 2Z35A 3FCUB 1KV3A 3IJSA 4PRAB 1YEIH 1LDSA 2C4XA 4NP4L 4AEIL 4ZMVA 2QADB 4QRBA 4J5VA 1KEMH 3HNSL 3KZ8A 3L3GA 1ODUA 1EEZB 1BLNB 1TVBB 3CSBA 4LO9A 4Z7WA 2CRMA 5CJQL 5IM7A 3VWJB 3BRDA 3BGFC 5DR5H 4HBCH 1MCFA 3T65A 2VYRE 4O9HL 1BAFL 2WKOF 3VD7A 5TE6L 4V33A 3OB0H 5DGRA 2F54E 3HG3A 3BP6B 1A9EB 2AK4B 1YCSA 2HLAA 3BEVB 4ONGL 2EDDA 4N87A 1SFHA 3BD4A 5EZLB 1DVFC 2NSMA 2BS9A 3CG8A 2X4SA 1XB3A 3BKJH 2ODIA 3EH2A 4PJDB 2G3ZA 2X89A 1GRWA 1UUSA 4MFHA 3E8VA 1ZT4A 5FYKU 1R34A 3NJHA 4G3YL 2VABB 4JN1H 2A6KB 3UTQA 3BVVA 3ROLB 4AZ8B 2XN9D 1TEYA 4XAKD 1WC7A 5C70A 1SEQH 4HGWB 4H20L 3ES6B 3NRQA 2H6UA 1W72A 1Q8MA 4FNLH 3BIKB 2VJ8A 4F1SA 1SJXA 2WGNB 1SVCP 2G2NA 2WVVB 1KYUA 5I0WA 2ADGB 2WQSA 3FQUB 4IW4C 5DZJA 2ZP8A 3MQIA 1R3IL 3F00A 1JUFB 1J12A 1HKLL 3K46A 4ISVB 4KNTA 1E9QB 1E42A 4BKTC 4RMQA 4RMWA 5AG8A 4HA1A 4WUUE 1AY1H 2JIXD 5BVPH 2FSDA 3GI8H 3MRFB 2DD8L 4YBQC 3SYCA 1GZPA 1W0WA 3QWOA 1RZKC 4HHGA 4KFZC 3IMBA 2WAHA 4L3EB 1JL8A 1SM3H 3L4TA 2C7UA 2F53D 3WO4C 3BWZA 4F24A 1I8LC 2R2CA 3FU7B 5E2WH 3RBGA 5AB1A 3AT8A 2BVEA 4FQQA 2C9UA 3FU6A 3QEQB 2WSKA 1AACA 3DMMB 4EEEA 5C0NC 2GK0A 4PJAB 1HZKA 2VDML 3ZDXF 3QDGB 1QRKA 1YJDL 1S78D 5CWSB 4KVNH 3LXBA 2VDQB 4OCYH 2CAKA 4WHYG 5KVDE 4XVUC 3GXFA 1ADQH 2Z0BA 5C7XH 3NCEB 5DRNB 2XHNA 1QFWL 1WGOA 2PO6D 3BAYA 4M6AA 4F8QA 4KK9C 1F3JB 4GKSA 2VXQL 4AXWB 3NEXA 2CNZA 2XZQH 2QZ5A 4JFUA 3QULA 2DQDL 4KXDA 1UG9A 3T8MA 3VI4E 3ASWA 2V5TA 5BV7L 2X41A 3VFRA 3EADA 3ZIMA 1J0IA 3MNMA 3NSJA 4K9EC 2H3NA 5AB2A 2JKLA 4LCWA 2C9RA 5ICUA 1L7IL 1IVLA 2OSXA 3MJWA 4FHJA 3VGGA 4ETYA 4M93C 5C09A 3EOBB 2XKNA 3TO4B 3V4UH 1LE5B 2ZWKA 4M1CD 3HC2A 3VI4F 3DTUB 4XP9H 5L0QC 3KHQA 4WHCA 3L3JA 3L3OA 4FI8A 2YD4A 3JWNE 1EFXD 1XBRA 4B9CA 2LV4A 2OP4L 5I1AB 1L6PA 1C5CH 4UCFA 3ZW3A 2HLFD 4UQEA 4EDWH 3O2DA 4URKA 4EVNA 1RK1B 3QPXH 4E9SA 3WXVL 1NDMA 1QR4A 1F02I 5IB3B 1L7TH 2BOBB 5E8PA 2RCSL 2HVKA 1M71B 5CEZH 1X5IA 4YE0A 1E8WA 4QRUB 5DZ9A 3QPKA 2AJVH 5FYLL 3EOTL 3FBKA 3S5ZA 3WXWH 3GJEA 3IAPA 3NABL 2D0FA 1CFMA 3BP4A 1BAGA 2X89D 4RGOL 1F3DH 1TEGA 4MS8C 5H35A 2BIIA 3BGFB 3L2LA 1MCPL 1UZ6E 4OD3L 3QNZB 2G0LA 1XR9A 4RBPH 4U7KA 3UJTL 2X4OA 2IDUA 4WWKD 2HT3D 3TV8A 1QPXA 5DA0B 2RFXA 1FNGB 3CH1B 5E8EB 3HOGA 1YN7A 3W1ZA 3X3GL 1T7ZA 1XH0A 1DVFB 5SWQA 3POHA 4HSCX 2OMXB 4FFYL 4J3TA 2GI0A 2ZOWA 2Q20A 3IE9A 5E99H 4CVXA 3CCHA 1FV1A 4FZ8L 1XB8A 2C3XA 1FE8H 2N0KA 4PJHB 1KT2B 1RY7B 5DQJA 1L3WA 1SN2A 2UY7B 3I02A 3T1FA 5EN2B 1KTDB 2NR6A 4NIYE 1CK0H 4L9DA 3KGSA 5IJKA 1IE4A 1YEEH 4U0QB 2F61A 4NXKA 4I5BB 1XD1A 3HI1B 1U3JA 3HG1E 4ZFOA 3QRFM 3PDDA 2LVCA 3LOWA 1JV5A 2WN2A 3BWSA 4MD0B 1TT6A 3BEWB 3O6LH 2PYEB 1MCWW 2WLZA 1FNEB 5DD0H 1Z6JT 5FHAH 3RTQA 3BP5A 4KY2A 1EEUA 2FIKA 3WO4B 2RIKA 5FFLA 1ZGLA 4PBWD 5FB8B 2DEWX 2MPVA 1BWWA 4JY5H 5DRWA 3TBSB 4IK6A 1UWEL 1ZLUK 1V3MA 1URLA 1H5BC 4LVNC 1HHKA 2X2IA 4PW9A 4UQDA 25C8L 1RUPH 1FHGA 4QRTB 2GHWB 4G9FD 2Z4QA 1MRCH 4DN4L 1EO8L 3FF7A 4OLZH 2BZDA 2IBZX 1A7OH 2Z9TA 5ES4B 4J3OF 2HJFB 1ORQA 1G9MC 1TU2A 4BH8B 4HC1A 1V3JA 5F7NC 1HSAA 1KXQA 2FRGP 4DGWC 3DI3B 3LCYA 1RHHA 3O6MH 4PJ9A 4XWGL 5F7DA 3GT6A 4ES9A 1CLOL 5DEGA 5I15H 3AQZA 4U6VL 3GMRA 4YN3A 1DLFL 1KJ2H 1YEFL 4KQ3L 2LLGA 4DK6A 1SF3A 2WKLA 3WS6A 2EDMA 4TVPH 4JJ5A 4M93B 3NRFA 3QB7C 5IEKA 1ULVA 2WVTA 1KBGH 3OJDA 6PCYA 2ALAA 5L0QB 3F7LA 3X17A 2BNUB 2JTDA 3VVVA 1A5FL 4ZX4A 3U0PA 3QISA 3ETTA 3TZVA 1LD9A 3Q8BA 5D1XD 4Y4HA 1S78C 1FGNL 2F68X 5KSBB 5CIPA 1N0XL 3JV6A 1EVUA 3N5AA 3P4NA 1F4HA 1Z5LB 3Q8AA 1CGUA 3QI9A 4HVBA 5ABDE 4OF7A 4KV5E 4L37A 5IMKB 5E8DH 1JYVA 1C8QA 1F6LL 3IJHA 1YAIA 2PO6C 4M7JL 3P2BA 1WIPA 3WJLC 1O9WA 3CZFA 3GSWA 3MACL 1CGXA 4M3HA 3RWEA 1IBDA 3DK0A 5BJTA 3EYVB 2W9DH 5INDB 4OLYH 4W4OA 5I1IH 4GW1B 5T33L 2VMEA 1D7DA 1I1YA 3PWLB 4KV5F 4E41E 2WXGA 2CU9A 1I82A 1A22B 2Y2WA 3IJ9A 4WUKH 5EOQL 4P23A 3OKYA 5LLIC 1KJ3H 3HI5L 5D4HA 5E2UL 5CJ5A 3DO4A 4MA3A 2DN7A 2Q3ZA 3CXHJ 3KWWA 1ETA1 1PFCA 1MRDH 3Q2VA 1E4XL 3H54A 1DE4B 4M1CC 4UT6L 2OMVB 1MCEA 4X9FA 3H85A 2ZOUA 5D7SL 1ZEAH 4HIJA 2UVFA 3LDBC 3KPRD 4K71C 2BNRB 4PJXA 4OV5B 4X7TB 2HKHH 2RR3A 2HLFC 4XAWL 1TNNA 4LSTL 3C75A 4IKIA 4PCTA 5E51A 2M8XA 3P0VL 3P4MA 3E3QC 4EN3A 2DV6A 3LPPA 3N1QC 2X70B 3I9GH 3NJVA 5HHME 1VKXB 3EO9H 2BP0B 3N85L 1SHSA 4UT9A 4EDXA 1UA6H 5L88L 4AY0A 4OZGE 1DJGA 4FFZH 4UZGA 1BX2A 1I8AA 4NO3B 5GPRA 4N25A 4TULH 2XWTB 3PIQB 1NFKA 1KJMA 2L7QA 3W0WA 1IKNC 32C2B 3IPFA 5A2JH 2E6QA 3SDDD 2ZXAA 5C07E 4LNVA 2H9GA 1RVFL 1EZUA 1AZUA 2EXSA 2WNWA 2VN7A 1OARH 4OZGF 2AV7B 3L9RA 4Y9FA 4ZRGA 1IGCH 4HS8L 3SGEH 3D51A 4WWKC 2HT3C 3HHSB 5IWLA 4M7LT 2I5YH 1IM3A 4CILA 1FJ1B 2BVPB 1N5AB 2YPKA 4Q0XL 2XPYA 4Z95H 3SKNA 4EUPB 4L8DB 5AVVB 3QCTL 3ZE1E 1KCRL 1XMEB 3HZMB 1SBSH 3HJ0A 1H5BB 1QI5A 4LVNB 3A4AA 3MAWA 3H9SE 5BOPA 4LSVL 4QLWA 3HS8A 1E5YA 3VCLB 2AQPA 4XZ4A 4ZQTA 5TF1L 1QG3A 3IAGC 1S6NA 2XN9B 4MDJA 3VA6A 1U92A 1KXHA 4U1MA 5TD4A 4QR7A 2D7TL 2NW3B 3ZE1F 3TONA 5EEZA 5FXCH 1YUHA 2WWMD 4LF3A 3LPFA 5C2BH 5I0ZA 4IRSD 2DQUL 1ACYH 2NLJB 3WIIL 2QHRL 3ZTCC 4JS7A 1P7KB 2J12B 4M43L 3TZVD 3GMOB 2D03H 5LDUA 5IB1B 1WAAA 3AU1A 3PWNB 2XFXA 2JIXB 2NTFA 2ZX6A 1PLGH 5ERWA 3K2MC 4HCIA 4MXQD 2WWNA 2C9QA 2F53B 4HFUH 3L2NA 3ZOAA 3GZOA 3T8XA 5CGYD 4DP2X 5KVGL 4HV8B 4K7FB 2HH0L 1GPOH 1F97A 4LLAA 4NUPA 4L4VA 3N41B 3DX7A 1A6ZB 4ZS7H 1G1YA 4YL4A 4HXBH 1JHTA 4IGBA 3KYNB 4LLQB 3NZHH 2QMKA 3CVHL 3SPVA 2VDOL 5FV2A 1BQHA 3IDNB 4PB0L 3AABA 2CSPA 2QL1A 5I23A 2ZAHA 2A4CA 2GEQA 3U7YL 4LU5L 4O5LL 1JVLA 2W8CA 3WY2A 5BW7C 2AK4E 4GLRH 2RALA 2PO6B 3D39A 3GBNH 1FZJA 2EDFA 1F5WA 3G3LA 2QTVA 3RYMA 1JGUL 3MLYH 4XOBA 5HVWA 1BZ8A 4X5QA 3L3OC 4XTRD 4PJDE 3CK0L 5B1CA 1TEFA 2W07B 3ZXAC 1EUTA 2CR3A 2FEEL 2VDRH 3CDYA 1EEYA 1LEGA 4PS8A 3ZHDA 4AE0A 4ANUA 5HJGA 4HFWB 5IV2B 1EHLL 2J25A 1E5AA 4HEPA 3GDBA 3NJXA 1DL7L 1I8KB 2CHWA 3F7VA 4NQXA 5AUMA 2B7DT 5MERA 3KWUA 1QNZL 2D31B 3L08A 4JFXB 3W5MA 3FHEA 4HEMA 3SE6A 1T04A 1H9VA 4PJDF 3CFBA 5E5RB 2OMNA 4JHBA 1SY6L 1OOAA 1ZY9A 2FX9H 4U6XA 4OZHB 1MHCB 1VF5C 1UOWA 3E9UA 4F33A 1TFPA 2EE0A 5I75C 3LDBB 4DUVA 4N6RB 3ATAA 4K71B 5D1XC 4PI0A 2DIBA 1WFUA 3C09C 2I27N 3L3GB 4R7DA 3LIZA 1FNSH 5HYJD 1ZDQA 3RTLA 2QELA 4LHJB 4A1RA 2KH2B 4DP7X 1KF9B 5B8CC 3T2NL 1ROCA 3F7RA 3RY5A 3T65B 3V79C 3V6FB 3QEQE 3QUZA 4QTIL 1HOCB 4PJAE 5I5MA 3KJ6H 3QXUA 2MCMA 2XWZA 3QDGE 4GXVL 1HKFA 4DK3A 3F62A 3FB6B 3QNXA 2R0KL 4GRMB 5T3XD 1FRGL 1KLGB 3V0FA 1J10A 3N1PC 1H6EA 3P4LA 1D6VH 2CK0L 2Z7ZA 1C9SA 4PJAF 1OVZA 4G9DB 3IMRA 3T6QC 1KTKE 1ZHKA 1J8RA 2F5BH 4KO5A 4ONOA 4WTZG 3C5SA 3QQDA 4WWKB 1MEXL 3DX8B 2A5UA 3SDXB 3NPZB 2XWJB 5C92A 5E2TL 4L1TA 1W72B 4PR5A 2FYVA 3WFEL 2OR8A 3WFDL 5FX3A 1XX9C 3WNOA 4HIXL 4OFYA 3G6JA 4UDUB 3MBWB 2XWCA 5CSZB 1FZOA 4TSAH 5IHWA 4NQVA 1EH9A 1F90H 4NIKB 1YQVH 3OB8A 4FQXD 4O2CB 4FAAB 1H3WM 1DN0B 1RIVL 4WCYL 4MCZA 1JOIA 2HXAA 4L4VD 3V4VL 1RULL 3PREA 1OF0A 4HKXA 4MX7A 2BY2A 2GK0B 4AQOA 4NUGH 4G8FA 3KDPB 3SDDC 3UTTA 5DC4B 1VEMA 4PLNC 3ETBJ 3TA3A 3PNWA 3D2UD 3ULSB 1KIQB 2X6AA 2ED8A 2QHLA 1JFHA 4JRYD 3C2AL 1WTGT 5TPWH 2MJWA 5AKTA 2FNWA 5IW6A 2DEXX 1YECL 3VFRB 3ML9A 4GKOA 1H19A 4G9FB 2ENPA 3VSTA 1ACCA 2H3NB 2YRZA 3IRPX 5DHMC 4H2AA 3RWHB 4XC3H 1WJ3A 3IRCA 4ZW3A 3WS6C 1ZAGA 2V3DA 4PTUA 1CUOA 3V6ZA 5GS3A 4BGDA 3EJSA 2DLFL 3P73B 1OAXL 2WWMC 2B1HH 3CFNA 1P6WA 3QRBA 3L3OB 1UH2A 4IRSC 3AQXA 2WBXA 1GHFL 4WO4A 4DERA 4NPYB 1S7VA 5K93A 3TZVC 1FVCB 3G6DH 2PF6A 2JVUA 3B7UX 2CLZA 4JPIA 4PJHE 4PMEA 1GIGH 1N6UA 3IMTA 2Y07H 4Y2OA 4KTEH 5DEFA 3BQUD 4YHYC 1D7CA 4OJAA 1RPUA 1DJHA 4MXQC 4URTB 5JO5A 1A4CA 4GFTB 5DUMH 1U4EA 1Z9MA 1CFNA 2X9ZA 3Q6GH 3BH9B 5CGYC 2B08A 2OM5A 1TQUA 1JGDB 3B2VL 3QJHA 2AHIA 3PFUA 4LAQH 2XWDA 4RWHA 3ZKND 5I75B 2PYEE 2OFQA 2EVGA 4G7YL 3C09B 1DLHA 2NYYD 1HHHA 1RZJH 4JMXA 1I9IL 1F8TH 2P8MA 4NQCD 5GS0D 1Z9OA 1H15A 1KB9K 3WHXA 5GGUA 3ZZLA 5B8CB 4JHVA 1BQSA 1HL8A 3KL5A 1CVRA 5IKCB 4B9YA 4XTRC 3W39A 5B38B 5F44A 3V6OA 1VGEH 1BGXH 4WKZA 1ND0A 2HA1A 1GC1C 3TEUA 1CXLA 4MHHG 1YN7B 2F7RA 1ACXA 5F70A 5FR3A 1TETL 4W93A 4UMGA 2GIMA 3KWTA 5PAZA 3H42H 4IOSA 4JO1H 1MJ7L 2V3EA 4HGMA 1PJWA 1J11A 4CVXB 1JZ7A 4K23L 1ZSHA 2AKRB 3CDCA 5DXWA 5E1IA 5ADPH 2FJGB 1IAOB 3NFPA 3BGAA 3RL2B 1R0AL 3TS8A 2K7PA 1M1XA 4NXSA 4TOYH 1OSEA 4PRBB 5LAPA 2DI9A 3GMPB 2WQVA 3DUHA 1KGCD 5C0RH 2H0JA 3E6HA 2ZTBA 3KPRB 4HUXA 1S7TA 3EYQD 2JNZA 3HZKB 3NOIA 1Q9LA 3TYFB 3AMLA 3NTCL 1VFMA 4X4YA 2OPCA 1BJMA 5D93C 4ZT1A 2QDVA 1X5YA 1G7PB 2A1WH 1HEZB 3LJ3A 3UTTD 5CR1A 5FAAA 1ES0A 4KUZH 4HUWB 3FTGB 4XVSH 4DNLA 4M4RB 3T3PB 4JKLA 5L6YH 3G9AB 3ZE2E 1X7QA 2DI8A 1LMKA 2P45B 5KSBE 4YHIA 3TEWA 4M61A 4H13C 4FLSA 5AVTB 2B9BA 2J6EH 3HRZA 3FPYA 1JFQL 1UACL 5IB4A 3BGMA 1PLAA 4NKOB 4XMPL 1HH6A 4XBPA 2O6DA 3QEGL 4N85A 3SDDB 3MRMB 5C1MB 4KGJA 2DRUA 2AERT 4F2MA 4MAUL 3DHJA 5IQ9A 1J86A 2A6DA 3KBPA 4PJIA 5ESVA 4F3FA 4ZUWB 4RSVA 3II1A 5HGAB 1XV8A 4TSCH 4GQQA 3N9GL 4O2FB 4OT1H 2ZXGA 5F1IA 1MCKA 5E7FA 2OL3H 2FBJH 2EP6A 1KXVA 1S5IH 1CYGA 2QV4A 3ARED 1HDMA 3HPLB 1C7SA 3CLEH 4M62L 3H0TB 5CJBA 3DUSB 1JDAA 1OP4A 2GY5A 3EYSL 1UWXK 1MSPA 4WI8A 5KG9B 3BAXA 4FQXC 4N2GA 2BNRE 1F18A 2AZUA 4A04A 4RVBA 5E70A 2R1WB 1PPIA 1KIPA 3OJDB 4R9HA 5IESL 4BQ8A 4OZFG 4IRSB 4ZYKB 2V8MA 3REWA 1EJ6A 1CXEA 1NMBH 2ICWJ 3MXWH 4HX1B 4DQOH 4QRQB 1HCYA 2FWLB 5JMOC 1RUMH 1D5XB 1KBVA 2CO3A 3TZVB 5E5LA 2TSAA 3LAFA 4HT1L 3QZBA 1WZ1H 3DVGA 2QQKH 1FPTL 4YHYB 3CX5J 4FXGA 1MFUA 1XGRB 1F86A 2XN1A 4JFDD 2YPLA 1Q9KB 2CJ3A 2D0GA 2EIZA 3D50A 4PG2A 1LNUB 2GUOA 4KKBD 3PL6A 5DFAA 5DMKA 1CG9B 4JFWA 1MCIA 1E40A 3VFMA 1MJ8L 2OZNA 2BC4A 4YVNA 1JI2A 4HS3B 4PBXA 4MZ3A 2AJSL 4P5RA 2E27L 4O51A 3KWWB 2CHNA 2HZHA 4AEEA 4F5CA 3WFHA 1K4CA 1NTDA 3UEQA 2CUIA 1ONQA 4GS7C 5EU6D 5FCUH 2WP3T 4DK5A 2P52A 1QUNB 1TVHB 2CJUL 3A4FA 1Y18B 3LMJL 2VDNB 3ZO0A 2Q8AH 1S3KL 3FO9B 4U6HA 2JWYA 2IF7A 3AG4B 2ZJSH 1T1XA 2I60L 2GTZB 4LRIA 4CC1A 3BQUC 5CFHA 2A9AA 3QQNA 4UDTB 1NCBL 3UGXA 2XKSA 4X6BA 2DQFA 2J72A 3O2VH 4FA7B 2X0UA 1R6VA 4XCYA 4KO7A 3AWGA 1KYOK 3CDZA 1ACZA 3RFZC 3IU4H 4NM4L 1Z5HA 1T5XA 3ZKNC 3ROOA 4PRID 5MENA 2NYYC 2WHVA 1ETJA 2BRRL 1NEZG 2WXFA 4XNQA 1G4MA 3RVUD 4HG4K 5HYJB 4H88H 5D93B 2F53E 3O3DB 5GS0C 4FNPA 1XFPA 1G0XA 5A43C 3ZHKA 3MREA 2Y7OA 4HK0B 1KJ2A 4FHKA 3MNWB 4LLYB 5I73C 3MKKA 1PGRB 5CD3A 3NA9L 4XVJH 2WMPB 3KWVA 3OWRA 1NCAH 3PG2A 4OFQA 1OAZL 3FHAA 5D72H 5CEYB 5CJOH 4Z18A 1AHKA 2VL4A 4ZO7A 2MQCA 1G94A 5CEZD 3N41F 4NRZB 1CICA 3LRMA 3MJ9L 1FNAA 4WW2C 4N24A 4MCMA 3HFMH 3RY6A 1FAIH 4LLMA 2JJTC 4HCFA 4AM0Q 4I0PD 1JZFA 1IEHA 5DUBA 3NFSL 5F7EH 5IBLD 3GO1H 2PYFB 3EYQC 3MUHL 1IU1A 3EYOB 1BJ1J 3BSGA 4PSRA 3NQIA 3C60A 4GSQA 4OJEH 1X3DA 4OZHE 4AJVA 5IGXL 2Y22A 4OH2A 5JXEA 2IVFC 4ZW8A 4KNUA 3PS6A 4WNJA 4FHBD 1OAQH 1FO0L 1OPGH 2QQLL 4FQXB 2BZ7A 1MFBL 4P5KB 4FYSA 2N56A 3PGDB 1N5YH 4BKLB 3HC4H 5F72S 4L4VB 3L5IA 3VSQA 4OZHF 2BHYA 2NT1A 4Q6IA 1U6AH 3V4PL 3D08A 1T1WB 4OTXL 4ACPA 1IIIA 4X0KA 4M56A 4TLUA 3VJ6B 4WFFD 1W8OA 4ZO6A 2F5AH 3GRWL 5F3HB 5GRJH 3RPIA 3F7YA 2DKSA 4KXZI 4K5PA 5DYOA 4ETQB 1V27A 5FGSA 3TBTB 1RZPA 3D2UB 3PGFH 1I8MA 1X5XA 4J2XA 4ZSOA 3TPUA 1YYML 3LRSA 2ENSA 3CN1A 5T1MA 1QQDA 4JRYB 3MRRB 4LXFA 2K3HA 3DV4B 4NDMA 4S1QH 3TWYA 5EEXA 2KHAA 4FZEL 3MZGB 4X9GA 3RVTD 1YEHL 1E9PB 4WLCA 4ZX5A 3BSHA 1OB1A 1JZ2A 2IAND 3AREC 4C4KT 3IE4A 1KLUB 4NQXB 4K2UH 3KYMA 4WJ5A 1NIAA 1SRDA 3SDXE 1NSNH 5F2FA 4ZG1A 1T04B 5J1SC 4QF1B 3TFBA 3DV6A 1FC1A 3HZYB 1NM9A 4GS7B 4GIPD 1AD9A 5L2KA 2X7LA 2C1PB 2NUPA 4QPEA 4BCZA 3BO8A 5AAWA 1NPUA 3L4VA 4NP4H 3Q5TA 4AEIH 5E6RB 5JZ7D 3G08B 3SDXF 2W0LA 3WMPA 3HNSH 4AH2A 1GSMA 4F37F 3MYJB 2X9WA 1TZOA 5E5MA 3BQUB 5CJQH 2O61A 3S5LA 2YGQA 4ZUSA 3OXRA 1N10A 1DO5A 4O9HH 1Z9LA 1JPSH 4LEOB 1BAFH 1QSZA 4BK8A 4FA8A 2XSKA 1NOFA 2X6BA 3KLSA 2DDQL 1NMAH 1QR1A 3D2TA 4MYPA 3RFZB 4TVPD 4KKBC 1Q38A 4FQLL 3JWOH 2K6ZA 4ONGH 4UINL 3BVWA 3MRHA 3DYOA 3MRNB 2G2RB 4IQHA 2UUDH 2JI1A 2XUWA 4HPYL 4B95C 4JO4L 2DAVA 4NQCB 1AXTL 4KTYA 1RSFA 1OQXA 2WLYA 1N2RA 1X5JA 5I73B 2YAOA 3C5JA 2E5EA 3G6AA 4NUJB 1F1GA 4D0CA 1K5WA 3WFBL 2ENYA 1WA0X 2Z8VC 4G9FE 1HU8A 3VXNB 2VR6A 3D4CA 4N0UB 4RFEA 4LCWE 5JXAH 1HXKA 3WKNA 3B6SB 2GCYA 2NYKA 4U49A 1R3IH 5ADOH 1EHXA 1HKLH 2Z7UA 3GJFA 4OCMC 3FRUA 3E1ZA 4WW2B 3DX9B 2QQNL 1NCHA 2DD8H 1IAMA 4HBQA 4LK4A 5GZND 2I9LA 3UC2A 4R3SA 4ZAKD 2WJ7A 3FU0A 4MD4B 2I9TB 1YZZA 1ZV9A 4XBMA 3CFUA 5CBEB 4KRPD 2ZWZA 1A8ZA 3D25A 2VDMH 1NGYA 3MCLL 3FL7A 1U8LB 2HFTA 2XXMB 3RVUC 5ID1A 2APTA 3AUVA 2R2EB 3IXTA 3MI6A 3UTTB 5T1LA 1XT5A 1S9YB 4PGEB 2HJLB 2J8OA 1EZSA 4DAGL 2N7SA 5JW4N 1UD3A 2IALB 4DO5A 5FF6B 1AKJD 1MNUL 4HHAA 2VXQH 3DIDA 2JELL 4H1LB 1QBBA 2LTQC 4PAZA 2C34A 3DHMA 5SWSA 4AYDC 1UB5A 2A74A 3DA0A 2ENQA 2UYLB 4OZIA 1ILSA 5C6TL 2VUYA 2QR0A 3EH3B 3T2OA 1L7IH 3NT0A 3QAQA 5AVSB 5EUKB 3BFQG 1DSYA 4DN3L 3EYUH 4I0PC 5K9JL 5IBLC 1LE9B 4OLXL 2D3NA 1A7PL 3QQ3B 2OP4H 3GLZA 2D9CA 4BH7B 5MP6L 1E6OL 1VACB 5IROD 4OF0A 3FYIB 4OGZA 3S4SA 5IREA 3AREB 3PHOA 5DK0B 4JPIB 3OAUL 4NQDA 2V17L 4PJ7B 1GYWA 4LOUD 5DEFB 2D3JA 4GIOA 4L5FE 4LHUD 3ARXA 4FXGC 5JO5B 3TBYB 2Q3AA 2BK8A 4XMUA 1M1SA 2CXKA 5GSVA 2RCSH 1BVKA 3F64A 1CDHA 3D12B 1T6BX 4PG9B 1CLZL 2XLLA 4QNPE 4AQ8C 1G7HB 5FYLH 3EOTH 4YDIL 3T71A 2MH4A 3GSNL 4NNYB 4QT5B 1WSST 1VCAA 3NABH 3T3PE 5JPNA 4H4NA 4RGOH 4GSUA 3UAFA 4DZBA 3QO0B 3T4YB 5E1AA 4KH2A 4MNHB 4Z0XA 4ZJ9A 1H3TA 1MCPH 4OD3H 1UXSA 4JFDB 4QNPF 5B4MD 3UJTH 4K5LA 5E0QA 4JQIA 4YSUA 1E3FA 2DH3A 4XX1E 2MNWA 1A6TB 1KGIA 2BVQB 3ARFD 3M6DA 3T3PF 2VSCA 4TLKA 3RVTC 4KJQD 3WKPA 3X3GH 2BCKB 2NT0A 3PJLA 2GSMB 1KXQE 4F9LC 1T2XA 5HHPA 3NJLA 5TTRA 2Z91A 3SPCA 5EU6B 4N2FA 3ZQXA 4PWJA 4YGVA 2JKRM 2BVOB 3BISA 5JZ7C 2P5WA 5H37G 5GRVK 1KENH 4LHQB 5KN5B 2Q3XA 1NLDL 3ABKB 3BFWA 4HF5H 2OTWA 1DN2A 4LVOC 5KYXB 5GS2H 4QYOA 1ASPA 3VGAC 3ZDYB 5FO8A 1KMGA 5DURD 1QASA 1CT8B 3S96B 3IGLA 3FYEB 1MCCA 2CHXA 1HSBB 1MAJA 2XBDA 3EOAB 4MQ7B 1IV8A 4K0OA 5C97A 5L9DL 4K5NA 4JY4B 1LWRA 5IB5B 3BRGC 2DWYA 4PRIB 3FB5B 3EDDA 4N2MA 1UWEH 1KFAL 4L8SC 1IEBA 4ONHA 25C8H 3BGMB 1MDTA 2VSDA 2E8ZA 1JGEB 4DN4H 4RIRA 4BFIA 3HMXA 1EO8H 2DYPA 5CN1A 2WZAA 4KBPA 2O6FA 1HVXA 5LGHL 1CCZA 1OP3H 3RY6C 4M7ZC 2J4WL 2VAAB 1EEQA 5IQ9B 3NACL 3JWNG 4PJIB 5ESVB 2Y7MA 4P5MA 4F3FB 3AT0A 1MWAL 3ZDZB 1TQCC 1QBML 3RWFA 2JKNA 4NOBA 2BS8A 2LTQB 2KBGA 2JKXA 1N19A 4H8VA 4XWGH 4E2OA 1WEJL 1CLOH 3FSOA 4U6VH 4ZFFA 4FI6A 1HDMB 2OCFD 2AI0L 1T1YB 1GZHC 3FT2B 3VXUD 3HUJA 5GZNC 1U9KA 3FQTB 2VLLA 4TNVK 1MELA 3AG2B 3IBOA 4FABL 1A7RH 2CGRL 4I0PB 4ZAKC 1IM9D 2D0HA 3GB7A 5LN8A 1NGZA 1J5DA 4KRPC 3JVGA 1E5UI 4NJ9H 1A5FH 2ZUUA 5E0FA 4QHLB 1JDCA 1QFHA 1TCMA 3FQWB 4A2EA 4XXWC 1D5ZA 1FGNH 1JF5A 1VFOA 4S11A 1N0XH 3I2CH 4Y4FD 3DVGB 3B5HA 3CSYA 5FHBL 3CFJB 4FXGB 2Y1AA 1JN6B 2OMBA 1UKSA 3NIDB 4KKNA 4M7JH 2FWSA 4RLDA 2VC2L 3UYOD 4ZOEA 1B4JL 3V0GA 2OXHA 3MACH 3CFKA 3MLXL 3KPNB 4H0IA 4PJCF 4JN2A 4G83A 5HYJE 1V10A 3ELQA 5LCVA 5T33H 3MOQA 4AEHH 4ZNEA 2X4NB 3FQRB 4FG0A 2XV3A 4JFSA 1GYUA 5IOKA 2GQHA 1G7IA 3SODB 1UENA 5E2UH 3HI5H 4MDIB 4LNRB 2EIMB 1GW6A 1KY6A 3DSNA 5T3XE 5IJVB 4Y19D 3MROA 3F6LA 1E4XH 3DVFA 1A3RL 2FQFA 3ZL4L 3BVNB 1T5KA 1JTTA 4MBOA 4PB9L 2EILB 1C5BH 3KPQB 2ZYSA 5IROC 5L7XL 1RJLA 1P5UA 1CS6A 1NUNB 1JAEA 2IANB 1MHEB 4LSTH 4XAWH 2HVJB 3RWGB 3VFTB 3P0VH 2GAZA 3FTSA 3SE9H 1BXXA 4LOUC 5FW7A 4HH9B 3WY3A 5DHEA 3P30L 5LB1A 2WP3O 4G43B 1LO5A 1ZPLA 1ASOA 3KW8A 4EZJA 5D2NA 1BEYH 1U3NA 1F58L 2P9RA 2XTLA 3D4YA 3B5GA 3ALWA 3N85H 4XCYB 5L88H 4NS0A 4BRVA 1UB6B 4I48B 3PDOB 3Q0HA 3AB0C 3DETD 5FGBA 1Q9WA 2JB6B 2TRYA 3S3JA 4LSDA 3MNZA 4M9PA 3QZWG 2AJZB 3LHPL 4ODTL 4GXUM 3RHWK 2OSYA 1RJZA 5EOTA 3D0VA 5TE4L 4LVOB 2P1YA 4P46D 2OL3A 4PIBA 5G4OA 3UYPB 4BK5A 3UJJL 3VGAB 4L4VE 4QTHB 5B4MC 1KJ2B 5FCSH 4HS8H 4ONFL 1NC4A 3BT0A 4G8EA 1JXGA 4N2EA 1AC6A 3BVDB 3RA7L 3ARFC 3UDWC 1UM4L 4X9BA 4E9VA 5HDBB 4RFOL 1T0MA 4KJQC 1OSZA 3VRIA 3QCTH 1KCRH 1CGVA 5FUZL 5FDWA 2P5EA 1BVNP 4L8SB 3HS0C 1OTSD 4U3HA 3KL3A 3H9HA 1ETZB 4JR9H 4LSVH 1BFTA 3QYCA 4OZ4B 1CZ8L 2ED7A 3NRPA 2YK1L 5TF1H 4JRYE 2YXWA 3RWIB 3UZQB 4M7ZB 1SDDA 3WJMB 5BUPA 2LT9A 5AZEL 3L4XA 1I8UA 1LWJA 3KBFA 1OLZA 1TQCB 1JV2A 1DQIA 1UXMA 1ZOXA 2QPFA 3FPXA 2WINB 1E8XA 1I3UA 2Q8BL 2YMOA 1II4E 4HEME 4M43H 2VDQL 4Y7OC 3TIDB 3TXAA 3OHXC 1KG0B 2ATKA 1Z7JA 3QNFA 4I0CC 4LCCA 5CLXA 5DGQA 5BS0A 3BPCA 2ZX9A 3D87B 1UC6A 4NKIL 3PXLA 4FQ1L 4XNUL 3VFVA 2BOCB 4MXWL 1UD6A 4XPGH 4GO9A 4ZAKB 3FQ4A 2FR4B 2HH0H 1HQ4A 3KHOA 4KRPB 3QC5X 2EH7H 2X3BA 5KVMC 4FI7A 1PD6A 4X0KB 3ZT6A 4NX0A 3VXMA 3MCKB 3L13A 3ARBD 2ARJQ 4J28A 4OBSA 2XY1A 3RPIB 4GQPH 3U6RA 1SLVA 1MW1A 2NX5A 4LU5H 3U7YH 4IBUA 2CA4A 2EABA 4AYGA 1SN0A 3GLDA 1R5WB 4EI5D 1AKJB 4KROD 4IDJH 1NIDA 1FLTX 3A24A 3P54A 2WQXA 1B4LA 4M7LL 1TIUA 1V5JA 4C83A 5LHDA 4OJFL 4PJBB 2MPAL 2W1NA 2X1XR 4S10A 4ZOAA 9PCYA 4GW4B 1DL7H 4TQPA 3V0WL 1GGCL 3MYZA 2N4IA 1QNZH 5D2LB 2A3TA 3SOTA 3QDMD 2YKLL 4N0UE 1FZKA 4JHWL 4WGWB 3G5XB 2YQ2A 1GH7A 2EACA 3RPBA 5LXGL 1P6FA 4ACTA 3IT8D 1BM3L 4C4KO 2W65A 1H8OA 1JCKA 3BO8B 3E80A 4IYKA 1B6UA 1OQOA 4I87A 4JG5A 3ME0A 4XCEB 5TGBA 4ERSL 4QMEA 2YIHA 4QKTA 4BFFA 2QVIA 4M03A 1P2CA 4GAYA 5HXMA 1G7MA 3JBG7 4Y4FC 3VRLE 3APMA 1FYTA 4WDIB 3HZ3A 5AW0B 4HJEA 3T2NH 2H2PD 1LTXA 3GJFK 4LHUB 3NIGB 1M6UA 4NZRH 1KGCE 5I26A 3EXJA 4KMTH 5B7EA 4QTIH 4WW2F 1SMOA 3UOAB 2YHGA 1DBAH 1AGDA 1QW8A 3AB0B 5GGVL 4AZUA 2R0KH 5TH2B 4EBQL 3VRLF 3W57A 3IFNL 1BFVL 1EXUA 1P53A 3UTTE 2F15A 2R1XA 4TUKL 4UOQA 5FM8A 1YPZB 3TN0A 4WV1A 5HYFA 3LH2L 2CK0H 2X09A 5EO1B 1UT2A 3PAVA 1CMOA 2A83B 2AEQL 2G60L 3B7YA 3LZFL 4PJEA 4GG6A 4HKZB 4F2FA 3FT3A 1N2RB 4K07A 5EA0H 5DUPL 5EFIB 1JXJA 3QJRB 1NINA 2W80C 3GSVB 5AKSA 3T6ZA 1ZS8B 4QOKD 5E2TH 3ARFB 2BIHA 4JPQA 4CADA 1ECYA 1W2KT 3A6BL 3WFEH 5FLVA 3RDJA 3FOMA 4PY7A 3T08A 2AMGA 1WFMA 3HS0B 1JZ4A 4FLQA 3OKLB 1PY0A 4XODA 1CLVA 4OZFH 2B4CH 4PGCA 2APBA 3SGDH 5ALCL 1YMHB 3G7TA 3PP3H 2V8LA 1QFOA 1UHVA 1P1ZB 2R7E