3PAYA

Crystal structure of a putative adhesin (bacova_04077) from bacteroides ovatus at 2.50 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
302
Chain Sequence
b'GSCDSIREDLPRCELWLEFVFDYNMEYADAFNPQVKSVDVLVFDSDDKLLFTKSVKVAALVGGNRMSLTDELDFGSYKVLTVGSLSDRFRLSDNAGNKLVPGTTTLQQVIVSLKRETGGVNFEFQHLYFGEVVEVDHLPSNTNHKIYPVNLIRDTNRFNLALMGYEENQYTFEIQAPENAVYSWENEPTGQGPITYVPYYTDVVMSARLNTMRLLNRSGWDYKFIIRDANTEAEVWSYNLMTLLSIARPVSRYDGTELPFQEYLDRQSEWNLVFTVVEKNGGGFLQIGIVVGTWIHWLHGME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative adhesin
publication title Crystal structure of a putative adhesin (BACOVA_04077) from Bacteroides ovatus at 2.50 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
total genus 64
structure length 302
sequence length 313
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA01
4QDGA 3GF8A 3PAYA
chains in the Genus database with same CATH superfamily
4PR5A 5ICXB 3ZDYE 5FGCB 4ZPVB 3ROLA 5FO9B 3QYMA 1WEJL 2A9DA 2JJTC 4KK5C 4TTDD 1FRGH 1CLOH 1T1ZA 2VISB 4N8UA 3FUEA 2ZG1A 3ARFA 2ED6A 1DVQA 3V7AE 1MCRA 3MNWB 5HHPB 1P7HL 3NCCB 4AC2A 2ADFH 2MEJB 2WNGA 3JWNH 4CDGC 3IJ9A 4E9QA 3VQLA 2BSTB 4DP1X 2BCKB 4CBZA 5CLZA 5HI3C 1P7KA 2JE8A 3VI4F 1EJOL 4U6TA 4IOSD 3CZFB 3QC5X 2DB8A 5BO0D 1WWWX 5E2UH 5IQOA 4OJDH 3QDGA 2O5XL 2AKRA 2YSSA 3HS0A 4XXCA 2X41A 4YOKA 4EI5A 2FJHA 4OBRA 2P5WE 2NR6D 1N0XH 4ILDA 2OS7A 3JWDH 4WI0B 1D6EB 4KJYA 1HE8A 4OIAA 5IMMA 2ZXDA 5FYJD 2H3NB 1W72L 1A6WH 3V4PB 3PCYA 2QGEA 2BSBA 3B5GA 3FMGL 4PHXA 1W15A 2B59B 2EDBA 3D2UD 5HYSG 2VNCA 4TUOA 5FF6B 1G6RB 2ZWKA 1T4KA 3BDYL 4YEFA 2JTYA 4MMZA 4TOYL 7TAAA 4NENA 1BXXA 3VFNB 2H3KA 5L6YH 2VCOA 2GSGB 1G9MC 2JTDA 4M02A 1CI5A 4MKTA 5AVRB 4IBUA 2ROXA 1TZAA 4MDIB 1WA1X 1J8SA 3QFDB 3FB6B 4KKAD 5MENE 5EIIB 3NFNB 3RPIB 4AVJA 1EAPA 4JO2H 4UZGA 5IR1B 1FHNA 1FGNL 1P5UC 1D5XA 1MNUH 3D33A 3EYSL 1ZLVH 2BSRB 2P48B 3U30C 5L88L 2W91A 2DEXX 4NNYB 4XR8C 2QVKA 3H4FA 3L1OH 1P0SE 1R3JB 3I9GH 3TBWB 3FT4A 3S35X 1VLXA 1CT8B 2V7NA 3BQUA 3BUBA 4OI9A 2WGNB 3DHPA 5EWIH 1HHJB 1K85A 4GKSA 4P3DA 3L3IB 1MRDL 5CEZH 2YGQA 4RDQG 4JPSA 1D5MB 4Q6IC 1VFAB 1MZYA 4GI9A 2F53B 4LCIH 2H1XA 1YMHB 1AIFA 1B90A 4YQXH 5JQ6H 2LFGA 2J25A 1QTPA 1MLBB 2PPEA 2ZP8A 4Y0GA 1KG0B 5C9JB 2XRAH 3B9VA 4FL4B 4P2OC 3NSYA 5K39A 3NIGE 3V7AG 4AL8C 4FI8A 4ZYKA 4GG6F 3HLAB 3ABGA 2AEPH 3MLZL 4YL4A 1KY6A 5F9WB 4FA7B 2ZUWA 2YQGA 4MAYA 3F7LA 1BVLA 4DJMA 3MJ8B 2WOYA 3MRHB 1BBJB 4LLQB 2ZUQC 3F12A 4GRLD 4FKHA 4IQHA 5A43C 1EERB 3QUYA 3GO1H 3HRZC 3W0WB 3V0HA 4PJ5A 1EAOA 1D7FA 4NKIL 4N2LA 3B5HA 5B22A 1GOGA 4H4NA 3JTSB 1AFVL 1DBML 4ZFOB 5IFJB 2EYTA 3VA2C 4JDEB 3V4VB 3M7OA 4XCEB 4UDTB 3WS6A 2NT1A 3U9WA 2MSPA 4WEUD 9PCYA 3PIQB 2VWEE 1YDPA 2PTTB 3NJVA 4TUJB 2QKIA 5E03A 5I6XC 4HWBL 4HKJA 3T4AB 4E9VA 2WV3A 3FB7A 2AQRA 5E2TL 1E65A 4S2SB 2W65A 5I1CH 2A6IB 4IRJA 3KPOA 3CVHA 4UMSA 3P73B 2NY4D 4OAWA 3DX4A 3FUIA 5F9AC 1B4RA 4PJHE 1FNEB 3G5VB 1UB5A 3ULVD 2VXUL 3NCMA 3RJOA 3NIFE 4HKBB 5C08B 1FSKC 1KJVB 1T04B 2ZD0A 1Q0XH 3SGKA 5I15H 1ZA3A 1ERNA 2GI0A 3QXAB 4K94H 1U92B 1TYRA 1NCCL 4XX5A 2SEBB 5GJTL 1KYAA 1BM3H 1MJUH 3DIDA 3M8OH 4FXGB 1EFXA 4OKVA 4D0DB 3BCFA 2X4UB 1NL0H 2GY7B 4X8CA 1KGCD 5ANMB 4FOMA 3IE9A 4XZUB 5D1ZD 3P77A 4TULH 4PGJA 3MOAL 5ABAA 2GYSA 2J44A 3Q6GH 4FERA 4OF0A 3C60A 4FLOA 1T3FA 1JYVA 4O2EB 1X44A 5KS9B 3L7FB 1FDLH 2QSVA 3JZ7A 5IHUL 5E6RB 5TK2A 4WO4A 2DKSA 1QZNA 5DI8A 4F27A 3BEVA 3BO8A 1RURH 1NUNB 2QQNL 4AW7A 2EKSA 5AAMC 3I75A 1CJYA 2YXFA 4IOFC 1C7SA 1WC7B 4MDJA 2VLLA 4K9JA 3QJHA 3OSVA 5A2LH 1WWBX 3KWXA 4KZCA 1NCNA 1ZEAH 2EZ0D 3H53A 3O2VH 1OTUC 2CJSA 4F2ME 1QLRA 3VFSB 4E42A 4DP0X 1Z6JT 3UDWC 2OZNA 4PJEA 4G1EA 3ZTJH 3FONA 3IGFA 3N44F 4D2NA 1X5MA 1P9MA 5LNEA 5KBNC 2ZP9A 4UOQA 4JFPA 4P23D 4M62H 3GM0A 4X80H 5IQNA 2ATAA 3FO9A 3RUGB 1OP5K 1RUAL 2I9LB 2F74A 2W9DH 4RNRB 2JB5H 4O58H 3ULSA 4N6QA 2IF7A 1CYWA 2AJYH 3V79C 2F15A 4YZWA 5J1SC 2XWJB 4X6CB 5DK0B 4JQXA 4Z7UF 1G7QB 5DMKA 5IT2H 5TPWL 5E8DL 2HJFB 1IQDA 4OJFH 3SOBL 4J7RA 3T08A 1G7MB 3D51A 4QXGL 5C0BD 1Z9NA 3D69A 4G7VL 5ICUA 4QYAA 4CN6A 4OUUB 3RL1B 4UQ2B 2FBOJ 1DEEA 1QRNA 4S10A 4WFHE 3NJFA 4L8CA 1NEZG 3DLQR 3GSWA 3HOGA 1MQ8A 1FUNA 1HZKA 3WTUA 1WQVT 2F1AA 2X6BA 4RAUA 5D7LB 5GZNA 1DBBH 3AFLA 2H5UA 2ZKMX 4PW4A 5GRJL 3CDGA 3NCBB 3QNFA 3WE6B 1MFDH 1X4ZA 1FZOB 1XR9B 1NCBL 5C6WH 1QR1B 1PZBA 3QDJA 4G5ZH 4YBHA 2W07A 3P11L 3TN0A 2X87A 1MUJB 5HYFA 3K8LA 5KANG 3EGSB 2G2RA 5DUJA 2V2WB 4HMCA 5EN2B 3SPJA 3E6HB 4EZJA 1JOIA 1OTSC 1P1ZA 1PGRB 2ZIDA 2OZ4L 2ZAIA 1ZRUA 1D5ZA 2EP6A 2NY1D 3TESA 2WSDA 1HTYA 2WMPB 2WTRA 4IIQC 5DZOA 1S8DB 2AXFA 5E6YA 1NFDA 1SMOA 4YHZH 4B9JA 5DJ8B 1BZDA 2F08A 3IXTB 3HE6C 4X6DB 1A65A 3DOSA 5FHBH 5IVZA 5CEYB 1VESA 2VRKA 3RBGA 1AQHA 1PIFA 1S9VA 5F7NC 5I8EB 1B0WA 1OB1B 3K6DA 3WNLA 1QBAA 3D2UB 3NABH 1MJ8L 4HH8A 1X3DA 3PL6C 4ZMXA 3PWLB 3DHMA 2P52A 3FBQA 2WXRA 1P6WA 5I1EL 1BD2D 3ECBA 1ID2A 3LNEA 4WUUE 3RA7L 1KY7A 3KPLB 4PRDB 4GSXA 4Y8DC 1CFSA 3MV7E 1AQKH 1O7VA 1OAXL 3AT0A 5CZVH 3VO0A 1UTDA 5IFHL 4I1RA 1S7UA 5JOEA 1I1AA 3RJQB 4ZMNA 3K80A 3BZEB 5LBSA 5DJYA 1JPST 3EKCA 1ETZB 4AYFA 4FXLA 4X2UA 3QZMA 3ZDXF 4UUJA 4PVBA 1FVEA 1J05A 1N9PA 2VMFA 4WTZG 3TA4D 2MQGA 4GXUM 3NSCA 3SDCA 1LYQA 5IJVA 3S96B 1LO3H 1MWAA 2WZ6A 3IJYA 4I3RH 3VTTA 3MAWA 3LS4H 1KCSL 3SJVE 2AF2A 4AM0Q 4WSKA 4ZSOE 4JUTA 3ULAB 2J2ZA 2HFFB 1BIIA 5HDWA 2J8UE 2OYMA 2ZWSA 5SWQA 4C56E 1CC3A 2A0LC 1JPGA 3VD5A 3V10A 1HVXA 3EJPA 1A6PA 2J72A 3QRGH 4LSPL 4RETB 3VI3E 1Q9WA 4A37A 5E8NB 3ZU8A 1XCTA 3HMWH 3C08H 4OCWL 1O7SA 1V7ML 1XGQA 3V2AR 5KUKA 4X9BA 1DANT 1NOFA 4GRLB 3QIUC 3W37A 4LOFA 3VGFA 5TD4A 3MLTB 4ZFZA 1YEHL 3UCRA 1N5YL 1W6LA 1XH3A 2DL9A 2Y3AA 4Q89A 3WKYA 3EBIA 5A16B 1TQTA 4JDVA 4X9HA 5FW6A 3X14B 1YJDL 3WFDL 1M7IA 4Y9EA 3UIZA 3HZ3A 4LQ1A 4X5RA 2VXQH 3KH4A 4RVBA 4HV8B 3DDFA 5DJ0B 2VO8A 3H9SE 5BS0A 1U8KB 1OSPL 1JPSH 3Q9PA 3AT8A 5IV2B 3FT2B 4N2OA 2YD6A 3CFEB 4ZAKA 4B9FA 2E27L 1D5BB 3RUGF 1H3XA 4MYWB 4N9GB 1QFWH 1SDYA 4KRMB 4Z76B 2NY4B 1ET7A 2IH9A 4XO9A 3LQAC 2V8LA 4IOIB 2JH2A 4LIQH 4L3AA 4U3SA 1SMDA 1W8NA 3FN0H 3VG9C 3HCVA 3QIWA 3QXDA 1MQKH 4KDWA 3ARVA 1IM9A 5C07D 3WKQA 2EIKB 3BIAX 4XBGB 3JWOH 2A73B 4TVUA 1G94A 5B4MD 5J4MA 2GIXA 1Y0LB 4Z7NB 3CFBA 3MCKB 1GIGL 2WTPA 1XZ0A 1WCBB 2DLFH 3DXAA 3OB0K 4WV1A 4XO4A 4X4YA 4JG0H 3KLAA 1PKQB 4YDVB 3GSQA 5D1ZB 3C5JB 2QV4A 4ZS6D 1ZKAA 3VRJA 3LKPA 4QHLB 1JUFA 4EN2A 1NPUA 3SDAC 3EH3B 4BQ6A 4OV5A 3Q8EA 3WIIH 3PNRB 1LEGA 4NO0A 4UTAH 3N1GC 4X5PA 4ANWA 3QULB 4GNKB 5DQJA 1EEYB 2F18A 3BN9D 1UWYA 4JFOA 4J3OD 2E7LC 2C7UB 5K9OB 2X6VA 3S5LG 5AUMA 4YSPA 3QCVL 4NJ9H 3L9BA 4NNPH 3L9EA 3IJSA 2J1WA 3V0IA 2GFBB 3UPCA 2VDMH 2DM7A 1ZGLB 2B1AH 3V0WL 3ZL2A 3CDZB 1LGVA 2CHNA 4P48A 3S4SA 3QFJE 4FLHA 5F7HA 5LAPA 3U2SA 2G2PA 3DOIA 2D2CC 1PJWA 4QPEA 5KVFE 1DBAL 3EYQD 3A6BH 4N0UB 5D93C 2WKLA 2Z1KA 3MPCA 5IVXA 2JI2A 2UZXA 3IJHB 1B4TA 2IEPA 1OE2A 1UA6H 1DJIA 3N40P 1WUZA 3PWJA 4Q56A 4XNXL 2AK4D 3TFBA 2NY5H 1S5HB 1XL4A 2V2TB 2I5YL 2FQGA 3KPRE 4F7TA 2CBQA 4P23B 4YIQB 5JO5A 4XMVA 5I2IA 2C26A 2GT9A 2ZUSA 3DJ9A 1NSNL 5C9KA 5HHXL 2IDTA 3IDGA 2HFGH 1AHWC 4N8VA 5L9DL 5FM5M 2Z7YA 1RZFH 3BZFA 3ARTA 3F85A 1A4JB 3GBLA 5A2FA 3MV8D 1U8IA 4HWUA 1ODUA 4E9RA 2B16A 5E00B 3N91A 4C8XA 2XCMC 4QKXB 4XX1E 3OTTA 3VE0B 4NPYA 2OMWB 4UIKH 3HAEA 5C0BB 1JF5A 2BNUA 2L0DA 2XN9D 3EDJA 4G11A 5E9DD 1MFAH 4ODHL 4JPKH 3V5HA 2VWEC 2RQEA 2P7TA 4L3EE 4ADJA 3RQ3A 1MHEA 1A6VL 4LKXA 5FGCE 1B4JH 1KTDB 1MVUB 1YQ2A 2O5YH 2WIIB 2X10A 3OKEA 4JR9H 4PJCA 4XI5C 2Z92B 4JRFA 4PLJC 2WLMA 2WNKA 2DIEA 3FU5A 3RWJA 1NEPA 4MCNA 4B9CA 3HZKB 2RHEA 3SPHA 1E4KC 3JV0A 4A55A 3D18A 2Q87A 4FQ1H 2CDGA 1A3LL 1CFBA 1YEJH 3ARFD 4ZPTB 2YA0A 1N67A 3RI5K 2CO1A 4MBOA 4BCXA 3OBAA 4FI7A 4HS3B 4YC2B 4QRQA 2NW2A 4RSVA 4EE2A 3PP4H 4NM8H 5F1IA 4MCYA 2J55A 3QORA 4RMTA 1I8AA 2NY1B 3L5XH 3HUJF 4X6EB 3F05A 2JK5B 1HXKA 4XHQA 1MFNA 1YYMH 3ARDA 5J13C 3F6IA 1ND0A 4OSUH 4GI6A 4GW1A 1QFUL 2DYRB 5KVFL 3K2KA 3T0ED 1XIWD 1AGEA 1WHOA 1GXEA 4XPTH 3MLPA 2ICEC 2O4EA 2EIDA 1SLVA 4DKAA 3QEHB 4RFNB 1SJHA 4UAOC 1JV5A 1QLFA 1XSJA 2OMVA 1ZV2A 1SHMA 2X4QB 4NCC2 2Z8SA 1BD2B 3O9WA 1MFVA 5E23A 5JXAL 3A6CL 2J6WA 3B9DA 3WL9B 4XX1G 4EJ1C 1KCRL 1F2QA 1PFOA 4H5SB 3HPLA 1RHFA 4Z7NF 4KZEL 4WFGD 1N7ML 4JJOA 2VERA 3GI8L 5B3JF 5AWNL 2A1WL 2D7PA 3MXVH 4H8UA 5IHBA 4P5MB 1UZ6E 1AO7A 3BQUD 2EE3A 2F53E 2ZCLL 1ZGLM 2F5BH 2ZWYA 3WSQL 5KWYC 1ET5A 1R75A 4A2DA 3UZVB 1BLNA 4LVHB 5D7EA 3BGAA 1U4FA 5B1CA 3KCWA 4P8QA 4CGTA 4XCNB 5BRZA 3GKWH 4IYKA 2YJQA 2A9CA 4L1SA 2BIOA 2DYPD 3ARGC 4M5YL 2VITA 2E59A 1EZUA 1OP9A 1XMEB 2CJ3A 2YAPA 3W0WE 4PHZA 1B2YA 1RZ8B 4U1HA 4MAYD 3ZKXB 4LGSB 4WJG3 2BY0A 2Z35A 4J1UB 2BOLA 3TYGL 3N5AA 4KXAA 3H2WA 4L1DA 2YR3A 3GNMH 4F8QA 3C87A 1HHGA 3G6JB 4JAMB 3NFPB 5EOCJ 4CC0A 5A2IH 5ILTH 5HHVH 2ALWA 3GMNA 1KLGB 4J4PA 4Q6KA 5I8KL 3PPEA 5D7JD 3E9TA 1LO0L 3WFZA 1FVCB 2DH2A 1U93B 3WY3A 2GITB 4NLHA 5IFAL 2CO7A 1VACB 2XNAA 3UG5A 3KD4A 5CCGE 5I1IH 3ZHFA 2XBZA 3BUPA 3IDMB 4D0BB 2FB4H 4ZUWA 3LDBB 4WW2B 1PG7L 3BWAB 5KZCD 4G8FA 2PO6C 3CLWA 4PRAA 1H5BB 2BWIA 4FFVC 3RWFA 4IRJD 1RCYA 1XBRA 3CC5B 4KXZI 5EIIG 3T5WA 4IDJH 5DQDL 4KZ0A 4RMWA 5EBMB 2X6AA 3DMMA 1H3VA 3ZKNC 4OCSH 4BCYA 3N43F 2IADA 5C07B 3ATBA 3VQMA 3K74B 3QEUB 4MXVE 4YSDA 4G8GD 3GPEA 5ANME 1YEIH 1ZSDA 4JM2F 1YJDC 1T5XB 4PMFA 1NA8A 3L1GA 5ESQB 3K6FA 5E0FA 3WFCL 2H0FA 1YECH 4PGDA 1I1FB 2EEFA 3O6ML 2WN3A 3ZRCC 5KS9E 1Y18B 1AGDA 4A68A 1JF1A 1OGAA 2AMUA 4U1IB 2A77H 3ZR5A 3THMH 1ZXKA 3MA7B 4PCSA 4H26A 5DA4A 1GOHA 2XLLA 2ZOWA 3MBXL 4OU3A 4R96B 4LP4A 1CVRA 1OAQH 3EUDA 2NNFA 3BPNB 3FU8A 3VD3A 4EPSA 1Q9LA 3Q5TA 4KUCD 1AZRA 3OPZH 3WUZA 4J23A 5LAXB 5MEPB 3L13A 5I6PA 3SE9H 3SDXF 4MS6A 1MCWM 4JO1H 3GXUB 1MW2A 3BDXA 4JVUA 3TT1H 1F02I 1DDHA 4L4TA 4M3KB 4G82A 1KELL 4HJTA 4AYBA 4OI7A 2RFXB 5GGUA 5FECB 2P28B 2WM0A 5DWUL 4BH7B 4JRXA 3VH8A 4OLYH 4KI5F 4LCCC 4MRBA 2VDNH 1T89A 2CSPA 2VE6A 2YC1A 2AK4B 4G9DA 2KDYA 3IDJA 2HKHL 3ZT6A 3IDYB 4NZUL 3RUGE 4LZKA 3HN3A 2G3XA 2VUKA 4JBSA 3V6FB 3FU0A 4YHNB 5GGVH 5JNYB 1PTZA 3P2BA 3U9UA 3ETSA 5IGXL 3ABLB 4WFFE 4X6CE 3CN2A 3E1ZA 5D6DA 1BLIA 4GW5B 3BKCH 1ML0A 3PE9A 3BD5A 1QUNA 3TX4A 3NN8B 3MV8B 5C0NC 5FM5O 1EDYA 5I1DB 5DLML 1HCZA 3PXJA 4RISL 2AVFA 1KFGA 3Q3GA 5HJ3A 2C7FA 4URKA 2AXJA 3NJNA 4IDLA 4EUPB 3F84A 5E1IA 2VKXA 1F4YH 4EKXA 2XN9B 2FGWH 5E9DB 2MOVA 5L0QB 3BEWA 4MNGB 3HC0A 5D7LE 5MERB 1QKZL 4CUCA 1LO2L 2RIKA 3TV3H 3QR2A 5AL0A 3VFMA 3FYEB 3NP3A 4KKCD 3BX7C 3WDIA 2L7UA 4W68A 3EYUL 5JIDA 1Y6KR 2E9JA 3DGDA 3FT9A 2JV6A 3MRPB 4LSDA 2OXGB 2P8MB 2WUCL 2XYCA 3CCHA 1WGVA 4PR5B 3ROLB 3A4DA 3I9PA 2Z31D 3FSOA 4H40A 3U4AA 1T1ZB 3V52L 1I31A 5GZOA 2PTVA 1SN2A 2DMGA 2V9UA 5D1QD 5B8CC 1S9WB 3ARFB 3QDJD 4ZXBD 1QW8A 2Q0ZX 2EDQA 3TN0D 2EAEA 4CSTA 4Z7VA 2C3GA 3TP4A 3CN0A 1AZCA 4NHUA 3DDGA 4Y5XC 3G6JF 3VACA 5GS0D 3SB3A 2FTAA 4L9LA 5EO1B 3E1F1 5EOCH 2QADC 5DS8B 3EOBA 3FT1A 1DYZA 3DPBA 4X6DE 1M53A 5JR1H 3MKKA 3QDGB 2AKRB 2YSSB 3H9HB 3HS0B 1NLBH 5FYJE 5IJKA 2FSEB 2JFCA 1E0OB 1MIEL 1LL1A 2PXYD 4NHCL 3T0EB 1XIWB 1T7ZA 3FRUA 1ZJBA 4KJYB 5IMMB 5TFSL 5FUOH 3KEHA 1FIGL 4HK3J 1XQ4A 4NWTH 1YN7A 5E94A 1TLMA 5DURB 4C59B 1I85C 3ETTA 4EIZC 3QHTC 3VXSD 4TUOB 1KIPA 1T4KB 2XWEA 5DJ2B 4LPYA 1EDQA 4MMZB 1VFOA 3P0VH 5H37A 4PUBH 2AJUH 4NENB 1G5AA 4PJ9C 1S7WA 4UNTA 1OF2A 2FD6L 1F97A 2B14A 1A2YA 5H2BB 4OZIF 2QVMA 3NESA 4KNSA 1TNMA 4WEMB 1EAPB 1AD0B 1HWHB 5K1VA 2ENQA 5DO8A 4OFIA 4OGYH 1I9EA 4NN7C 3II3A 2YN3A 2EDMA 3FT4B 3BQUB 1SRDA 2V7NB 1AYOA 1F56A 1RK1A 5JIHA 1R5VB 2M26A 4Q9QH 4UINH 2DTML 3ZQ9A 4AW4A 3FQWA 1IC7H 2BP8B 2VDKH 1ZHKA 2X5PA 2Z8VC 4KK9C 2A6DA 4QRBA 3TBYB 5I6OA 2VJXA 2C9UA 2WYZA 1J1PH 1BV8A 1N4XL 4QNPF 2Q9OA 3DBXB 4G7QB 2X38A 1IEBB 2BJML 4U1LA 3SGEH 2DYPB 4ZYKB 1W0WA 2ZWNA 1J86A 1E4XL 2VKWA 1INEH 4Y2DC 1F5WA 4BZ1A 2V37A 5TE4L 3WN6A 2VT0A 1BF8A 4BWWA 2AXGB 4MAYB 3KJ4C 1AGCA 3PWUA 1RSYA 2A6KB 3F12B 4U6VL 1AHMA 3BKML 3PAVA 2L7JA 4ZMOA 4TQIA 3VXQA 4PRHD 2Q7AA 4PJ7F 2EYTB 2LU5A 3K3QA 5D7JB 2EC9T 5G4MA 2H2SD 3LNDA 3ZIMA 3IAGC 5T1MB 1IE5A 1KUMA 1S9XB 1UEYA 1YDPB 2EXWD 3ASNB 3VVVA 3EGDA 1Q0YH 4HKJB 2AHIA 5FYKU 1GGIL 2WQ8A 3FFCD 4MD5A 5KZCB 3CV5A 1CU4L 2RQ8A 3EBGA 4ZAKD 5GS1A 3ULVE 5I0DA 1IGCH 1MFCL 4IRJB 4N87A 1Z9LA 3KPOB 4U3CA 4ZODA 3V6OE 2VRAA 3VG0L 4QHNA 1CGUA 4HAFA 4OAWB 2AC0A 2K9FB 4CSZA 5TDOA 1UB5B 3ALXA 5AOKA 1CK0H 1BMZA 4QHUA 4YZFE 1B6UA 3GWJA 3QIWD 5DUMH 1HESA 1A02N 4Z7NE 1N8OE 5FGRA 5T3XH 3WNPA 2WBXA 1FN4A 2QJDA 3F62A 3O3DA 1EA9C 1DQKA 4G8GB 4TQPA 4W4OC 1KENH 1PKQE 2CKBH 1KGCE 5FGBC 5F1SA 3EGXA 2O6FA 2ATKA 2XU9A 2JKSA 4M8UA 3MLUH 2B7DT 3ZO0A 2DQIL 1G1CA 3DXAD 5KYUA 4GJTB 1VEPA 2XTSA 5AW8B 3MCLH 1WWCA 5C70A 2GBUA 4NAJA 1JBJA 3C60B 3NCFB 2R9HC 2Q8AH 3IBOA 5FW8A 4NO0D 1D6VL 2ZP0T 3O3UN 4LSQH 4EDWL 2XIDA 4Z3IA 3GSNA 4QAMB 4HBCH 25C8L 2IAND 3BEVB 3PGFH 1YN6A 5T1LD 1DVSA 4OLZL 2P46B 5FS5A 1MAML 4NOBA 3I75B 4HIEA 4HK0B 5JYMA 3KLSA 1GSMA 2NSMA 4MDJB 4A1RA 1FL6A 4S1QH 4WDIA 4I1PA 4ZMTA 4NJAH 4N0UE 5GSRA 2FR4B 3BIBX 3IF1A 3FZUC 2GJPA 1QLRB 5KBMA 3S8FB 3CVBA 1SDDB 4I9XA 1SVBA 3QQ3A 4G1EB 2G9HA 3FONB 3NSDA 4WY7L 3QPQC 5LG1A 1JVKA 2P3YA 3IETA 4R83A 4FL4C 5H4YA 3WEAA 5IB4B 4OZFH 3WBDA 1LDPL 4U1KB 2R83A 4ZTPL 5F9WC 4TSAH 5TQ2H 2VLJA 3OZLA 1EJFA 1J5IA 4XTRD 5AVTB 4ODSH 2D0GA 3FHEA 3WUWA 4M93B 2A99A 1M9SA 2UX6A 2DZEA 1NMBH 3T0VA 2I60H 3P9LA 4HWZA 4BQ8A 4Z7WB 4X0NA 1B0RA 3ULSB 1J0ZA 4FNSA 4UT9A 2YPVL 1KYDA 3GSXA 4P5RA 5C0FA 1A3QA 5C0BE 1LD9A 2CLZA 4LOUC 4MJ5A 4LEOB 2CALA 3CDCA 2FX7H 1TVBB 2HRHA 2XVGA 1RY7B 1IQDB 4GFTB 4QJ5B 4XGZA 4M3HA 2AEWA 3D69B 3FUFA 3BT2H 4U0RB 3G6DL 4HJEA 3QK0A 4Y5YA 1Z3RA 3P0GB 1A7BA 4GH7B 4W6XB 2Z4QB 3LB6D 2QQQA 3ATEA 5T1DL 3H55A 4GIOA 3ISYA 4L8CB 2QGCA 3OJ2C 3FYIB 1X5FA 4GRWH 4JS7A 3SQOH 1PNDA 2OLDA 4RAUB 1A9VA 4HZAA 3VXOB 4HZ1A 3KYAA 2V5RA 2Z31B 1CTNA 3DO3A 1PNCA 5AL8A 4QRUB 3OAYK 2D7TH 5D1QB 1RD6A 2CG9X 2C9AA 3BDBA 3FO0L 2W07B 2P9RA 3QDJB 5TJWK 5GRUL 3TN0B 1N10A 1NCOA 4MAZA 4ODTL 4I3SL 2G2RB 3NVQA 4R4FL 4X99A 5DK3A 4PM1A 1WS7A 5C7ZA 1IIIA 2ZKYA 1LEIA 3MRKA 3GHPA 5IB5A 1P1ZB 4HDIB 4CU8A 2FE0A 1MCOH 3MTRA 4G9FA 5I16A 3AB0B 1D5ZB 4F5CA 1E4JA 3IU3A 1Q38A 4MJ2A 3BUDA 4BRJA 3UERA 2WQUA 1UATA 2LV4A 3NIDB 2OA9A 3PWVA 4JY5H 2D7OA 1M1SA 1IGIH 2O6PA 3S3DB 2NZ9D 1YYLH 5IVZB 3DOSB 2I25N 5KYXA 4I3GA 1QLEL 1S9VB 1BQLH 3M1BA 4FHBD 3MRJA 2XC8A 2VR7A 1BD2E 4M8VA 3VXSB 2O6CA 4KTDH 4JFZH 5KW9L 3TA3A 4YN3A 4EI0A 3TH3T 3MBEA 4H7VA 4HJIA 1FLRH 2NY2D 1KN2H 3ECBB 4FN0A 5JQHC 2IH1A 1OZTG 1CFSB 3EYVA 2NSQA 3FTYA 1NCIA 3SE8L 3B9EA 1HNGA 3ELQA 1S7UB 3JV4A 3QJQB 4F7EA 3ALWA 2W88A 4AYFB 2JQAA 1J48A 5JW4R 1CE1H 3S48A 1ZMYA 4UUJB 5FOBB 2O1AA 1AO7D 1CDBA 1J05B 3J07A 4FMKA 4QYOA 1TQBB 5EZLA 1OHQA 3GSNL 4NRZA 4QUOA 1BBDL 3ZY7A 5IJVB 3BP4A 4YHOL 3TL5A 1MWAB 1G4RA 3IJYB 1CZ8H 3RIFF 43CAA 5BRZD 1BXVA 1BIIB 4PVLA 1MFEL 5SWQB 4N86A 4JQVC 5CJOL 5C7XL 1JPGB 4KUCF 1JGVH 1IKFH 4BFNA 1XCTB 5JQIB 1FPTH 3G6JE 4GKLA 1XGQB 1QFWI 5EBLA 3TCXA 1IQWL 2X3CA 4JQIA 4R97B 2K4AA 3DV4A 2GTZA 2DWEA 2OTUB 1DFXA 2WP3O 4B6ZA 1PQZA 4ZFZB 1UQSB 4PRHB 3KL3A 5GGSA 1XH3B 1SEBB 5LO7A 3VDBA 4J4PD 5HY9A 3ZJAA 3KBHE 4AGMA 5ADOL 2EEXA 3MUZ1 1W0VA 1JHLL 1CGVA 4LPXA 4QKTA 4PJEF 1M7IB 4WI3A 2QDWA 4ZRGA 4KKBD 1K3ZA 4Q2ZA 4F58H 4LLUA 3WJJC 4YLBA 2R0LL 2QDVA 3BKJL 4ZMQA 3HG2A 3ZZLA 4HQQL 1PG7X 4TTDC 1X5YA 1AXTH 4OM1H 1KJ3H 3FFCB 5TTRA 5F3HA 2LLNA 3ECWA 4ZAKB 5HI5D 2EKJA 4RZCB 4FG0A 3BP5A 3BZ4A 1MHPL 1RIHH 4JJ5A 2IPTL 4MYPA 5C07E 1QG3A 2ORBL 1XF5A 4TVPH 4Y4HA 4U3SB 4F8OA 1UM4H 4BQBA 1FV1B 2UUDK 5HDQL 3HCVB 3QIWB 3QXDB 3DO7A 4DK5A 5TE6H 1F13A 3P9WB 3O6FA 2HJLA 4IHBA 4YHMH 5KAQF 1M7DA 1G5GA 1JXFA 5B21A 2AQQA 3NZ8B 3SQBA 4Y2LA 2NR6C 4XPBH 3CFBB 4H8VA 3IN2A 1S3KL 2ESVA 3DXAB 4M5TA 4WV1B 4GSDH 3KLAB 1DQTA 3GSQB 1Y07A 5F0LB 2P47B 1AY1H 1JUFB 3WIHH 2HWZL 3ZOAA 4PQXA 4OV5B 1VPOH 4LSTH 1LEGB 4NO0B 4S0TD 4NO3A 4BWUA 2D3NA 1V54B 2VRQA 1OANA 3MLRH 3N2JA 2NRDA 2YN5A 1JYXA 1USZA 5T1LB 2IANB 3CSYB 1EEZA 5E8OA 4KKAC 4KQ3L 2Q1EA 4FQ2H 4N5ED 3RBSA 3VD2A 4HC1H 1T1XA 3PPSA 3IJSB 4K8RL 4AEIH 4PB9H 2DQHH 3L3GA 5L7XH 3CSTA 5DMGD 4H0IA 4XC1L 5DMYA 1C1EH 1DBKL 3S4SB 3HI5L 5KSBF 1EZVY 1IAOA 4HETA 4XHJD 3VGAB 1RK0B 3SN6N 1FRGL 2AK4E 1CLOL 1NFDF 2ZJSH 1QI5A 3HHSB 4PVNA 2BOCA 5IG7A 4G70B 4JRXD 2UZXB 4KXDA 5HDBB 2O61A 4MJ6B 2WK2A 1N19A 4GINA 3LNGA 2ADFL 3PWJB 2UXTA 3L8QA 4IKKA 1F3DH 5DD5L 5CINH 4H8WC 3MV01 2HRGA 2IWGA 3ZQWA 4K5OA 5E4OA 5JO5B 3LYRA 2VDQB 2IBBA 5E2UL 1OP5H 3SIKA 5T1KA 5AZ2H 3MV8E 4GRLC 3IDGB 3R18A 1JV2A 1N0XL 3JWDL 2GUOA 4M1DH 4JGNA 1U8IB 1A6WL 4A2EA 1R3IH 3MRBA 2CM6A 2GEEA 4K55A 1L9TA 3QPKA 2XN9E 1T03H 1URLA 3UAJD 5E9DE 4I0PA 5KVGE 3DIVA 4JM4H 2V5MA 4MNGE 4NPYB 2XA8H 3KGTA 1OSYA 5EPMB 4NKDA 3HAEB 8FABA 3IMTA 4LLDA 5L6YL 2BNUB 2UY7A 3OKYA 3DURB 3UJTH 3O11A 3V5HB 1PBYA 2HVKB 3VRLE 4MNHA 1WAEA 2J6EH 4J3OG 1MHEB 2HX8A 4LKXB 2NY4C 3D06A 3P4OB 5IM7B 4PJCB 1GCYA 2ARJB 3T77B 4JO2L 3AGWA 1S7VA 4P3CH 2VO5A 3ULVC 1MNUL 3INUH 4OF6A 5JIMA 3V6OC 3EH4B 3RWJB 5C0RH 3L1OL 4YSOA 3I9GL 5EWIL 4NCDA 2WZAA 3D18B 1UJ3A 5GZOD 4PTTB 1MCIA 2CDGB 1A66A 3GRBA 3QJXA 2Y7OA 1UCBH 5CEZL 3VXRD 2XX0A 4AOFA 3QS3A 4QRQB 5DD0H 5D1ZC 4FZEH 5JLZA 2DBLH 4LCIL 1VERA 4MCYB 5DHXB 5F1IB 3G5ZB 1JK8A 4YQXL 3QORB 1TR7A 5JQ6L 2OAAA 4ORGA 3C5ZA 3VAEA 3T0EE 1AOHA 3LKQA 5L2JB 1XH1A 1PCXA 2XRAL 2R69A 3DRTB 1OALA 1WHPA 4ENZA 2AEPL 2CXKA 5K1NA 1NCWH 5I6LA 4DK3A 2QFRA 4IMLA 3VFPA 3GBEA 1B88A 1IFHH 3OMZA 2AANA 3GO1L 3BAEH 4P06A 2IPUK 4Z95H 2JQZA 4BUGA 1FZJA 1KIUB 1A47A 1T2XA 1PYWA 3MX0A 4DUXA 4KMLB 1P69B 1TJHH 4OTXH 1KTBA 1QLFB 2OMVB 2QZQA 2B4CH 4FS0A 4EUPG 4HKXA 2NY2B 2EZ0C 4WFGE 2VDNB 2DM2A 1PU0A 2VDPH 2ZNXA 4F9PA 4TNVF 1RZJH 4IU3B 1SJEB 4N0YL 4N2KA 1UM6H 3DETC 3K8MA 2OJZH 1SF5A 2VQUA 3HPLB 4TNGA 5E1QA 5I1CL 3QZOA 3DECA 5TE7L 4AIZB 5CBEA 1IKNC 1SYVA 3TEXA 1ZDSA 2WQAA 3KHOA 1AO7B 2DMBA 3HEIB 4FYTA 3RWDA 4Z7QB 3FO1B 1HWGB 4P23C 2V9TA 5AB1A 3A4FA 1Q0XL 3E80A 5I15L 3PF2A 3QNZA 4L8SB 5I5RA 2K0RA 1EXUB 3PJSA 4K94L 3P3SA 4M8RA 5JHLH 1EHAA 3LZFH 5BRZB 1NPJA 1BM3L 1MJUL 2FUQA 3DA0A 4U1JA 1TCRA 3M8OL 5AW7B 3ME0B 4HJGA 5L2KA 1O6VA 5IEHA 1NL0L 3UO1H 3MUGB 2FYYA 2TRYA 4TULL 2VITB 2CKNA 1F4HA 2E9WA 3BP6B 1RZKH 1HE7A 2VJ8A 3NK3A 3Q6GL 4HMDA 3EJRA 3LKSA 4HALA 1FFNA 2QFPA 4DPRA 1FDLL 1BG1A 5K1JA 1H9VA 3NEEA 3CK0H 3NBNA 1AYRA 1GKOA 1HHGB 4MXQD 3VVWA 1K2DA 2CE6A 3CMOH 2C9XA 3CHOA 1PD0A 2A9AA 2B77A 3BSZH 1J10A 1E9QA 1MELA 1Z1WA 3SKMA 1RURL 3FL7A 5IVXF 2PPCA 4HPHA 2IOIA 2E7HA 5AFAA 1IBHA 1H6UA 5B39A 1SLUA 4DUVA 4JFHD 3BUIA 4OB5H 3VJ6A 1P5VB 1A6AA 3EJSA 4P2CG 4ZUWB 4K3DH 4FQJH 5GIRA 4D9QD 4OLEA 4G8FB 4NQSB 1ZEAL 3O2VL 4QCIB 4L8BB 4FRWA 4MNQD 4R0LA 3LN4A 4M6NH 3K6SA 4AV4A 2YD1A 1DBJH 2F7PA 4YC2C 3PDDA 4G8GE 2EXYD 1J1XH 3DMMB 3DVGA 1TKWB 2NY7H 2NY1C 3VCLA 3ZTCC 4X7TB 1BMGA 2NY6D 1QATA 3QUMA 4DP7X 1YA5A 2AITA 2WYIA 3GTNA 2ZQKA 3VFWB 3H3BC 4M62L 3WEOA 2WSKA 1U8NA 4X80L 3R1GH 2EECA 4TSCH 3ZRFC 5FX3A 1K4CA 2CMRH 2P80D 1QNZH 1RJYB 4PGDB 2ZCZA 4JGJA 1XH2A 2IQAA 3I02A 2W9DL 3QO0A 1AGDB 2HJKA 2JB5L 3NCJH 3NJKA 1JF1B 2IBZX 4O58L 4RFNC 2OMTA 4ANUA 4FQXA 5KG9A 4PJCF 1RUQH 3QJFA 1REIA 2AJYL 2WYHA 4QIRA 2MWCA 1XGTB 2XT1B 2AEQH 5IT2L 2YAFA 4OJFL 5IKCA 1U3ZA 3AU1A 1CDYA 3DPDA 2LTQB 3OG4B 2W9LA 3L9RB 4YDJA 3H9ZA 2VDKB 4KKLD 4YFDB 4XXWC 4U3HA 2XFXA 5AYTA 1PZUB 3MJ9A 1UA3A 4UT6H 1IL1A 1AHKA 2K4WA 4BA8A 1DBBL 3LEYH 1VA9A 1U6AH 3INOA 4KV5E 2OCCB 4NN5B 4W9KC 5DRZB 3CHRA 1MFDL 1HXYB 4Z18A 3ATFA 4LVHC 1BZEA 3G5XB 4JRXB 2WCSA 1E7UA 1L9OA 2FT7A 4G5ZL 4M7LT 4PJBB 3VH8B 5JMRA 2D31A 5K9KB 4TS6A 2XOTA 2QPSA 3G08B 5EU3B 5F2FA 2YC1B 2KYIA 1PZDA 4G9DB 2V0AA 1A7RH 1CFNB 4R2GD 3NUKA 4AZ8B 2YGNA 3UC0H 1XF1A 5KVEE 1HXMA 2UZYB 4P5KA 2YXVA 4X9YA 4XNQA 2ICWI 4Z7WE 2EIEA 3ZKXC 5AB0A 5D9SA 4RX4D 2Q8BH 1JNNH 2ZKWA 5BJTA 4YHZL 4NFBA 1MAJA 4O02H 4QXTA 4JPVH 4AQ8C 3BGMB 5E9NA 2J7LA 3QCUH 4AQ1A 1MDAA 3KLKA 5FHBL 2KLRA 4PWJA 4E5XA 4YFLI 3IKCA 3L4UA 3NABL 1HH9B 1IO4C 3I6LD 2EE0A 2ZSWA 4KKQA 4RQQA 4N2MA 3LDBC 4WW2C 4ELMF 3OQRA 1U41A 2QQLH 4NZRH 3BEWB 3ZTNH 3HC0B 1O9ZA 2R0ZH 4P5TA 1AQKL 5KJ4A 3BD3A 4FC3E 4XP9H 2PP9A 5CZVL 5E7FA 3D2TA 3VMNA 4K3HA 1QFHA 3F00A 3DC0A 3DJRA 3OD3A 1D2PA 2ZUUA 3DRQA 5D1QE 3CCHB 3QDJE 3JWDC 4M7LH 2OJ1A 3WCYA 5I0WA 2ADGB 4L3FA 2RTTA 4JKMA 4ZS7H 1BF2A 3TPUA 5IY5B 5JHDA 1NH6A 2Y5TA 4JK0D 2FATH 5B4MC 5K9JH 3PGDA 4LLMA 5F88B 3VXRB 4MMXA 1J18A 4I3RL 1TEFA 1WLHA 3NIDE 4TLSA 4ZS6C 3LS4L 4L9LB 1JZ3A 3KVDD 2R27A 2BNQD 3UX9B 4FHKA 3B8SA 4WWKD 3QRGL 3ATDA 2OMZA 3LVEA 3HMWL 3C08L 4U6XA 1SXZA 4TNEA 2Y07H 3FRUB 3RWHA 3ZHLA 1QA9B 3QQXA 3ARZA 4J3OC 4NC0B 4ONHA 3VXSE 1P2CA 4LSRH 3BPNC 3KR3H 4PMEA 1YN7B 3GMLA 3U6XS 3VW3H 1CR9L 1F58H 4JCMA 2WXKA 4PB0H 2CHZA 4XNMA 3SDDA 3HIZA 5KAQG 5HI4D 4F24A 1SPDA 3KL0A 5EEWA 4J6RH 5D6CA 4PTUA 1KTCA 3RVVD 4DEUA 2VXQL 4YDNA 1OF2B 4FP8H 1A64A 5IWLC 3SGEI 3A6OA 1JPSL 3EYQC 4HP5A 1E4WL 1L6PA 4Z9KB 3QXTA 5IIEA 2GJZA 1G9MH 2BO0A 1QFWL 4XBMA 3W11D 3FB8A 1NM9A 4WTQA 3H9YA 4LIQL 3IDYC 3IVKB 1OP4A 1CDHA 2CR6A 3FN0L 3REVB 3AWGA 1MQKL 4IRSD 4UNUA 1G1OA 4HVBA 2QHLA 4QTIH 3JWOL 3AW5A 2HH0H 1CLVA 3EHBD 3MRNA 4JZNB 2CDEB 1DVUA 1GOFA 2AV7B 2YD2A 4KO5A 4RSYA 4UBDD 5B1BB 3T65A 4BUQA 4AYGA 3X3FH 3M1CA 3HMXH 5C0AA 2DLFL 2W9EH 3LAFA 2WXLA 4U6YA 3IDNA 4JG0L 4HUMB 3LV3B 4BKLB 2G4EA 2XETA 1GHFH 4GUPA 3KS0H 4ESKA 5I8CA 1YNKH 3FCTA 4POZD 4PRHE 1ZANH 3WIIL 4UTAL 1AGCB 3PWUB 4X5WA 5B1AB 1L0XA 4W81A 1C08A 1ZPUA 5L0QC 5DJCA 1JZFA 4JX0A 5INDA 4AL8H 2QSQA 1CQKA 2O6DA 2ZOLA 2QVTA 1G9NC 4FFZH 2X6CA 2X7LA 3CGTA 1BQUA 4NLAA 2ZXCA 4NJ9L 4NNPL 5D2LA 3FFCE 2VDML 3QAQA 5I0XA 3EGDB 5C1MB 1FG2A 1OM9A 2VZ3A 4Y4FA 1XCXA 3WNIA 2YXMA 4P46D 4MD5B 2PYFB 4XVTH 3K6OA 5GS1B 2JCCA 2A3TA 1WAAA 2JXMA 3ARFC 5J89A 4L3CA 4C58B 4MNQB 4Z7OB 4QHNB 2OL3H 1AXSA 3F83A 2LHAA 3A6BL 4WIQA 1USQA 4BSVA 1BAFL 4Y4HD 2YEVB 1IGYA 4QHUB 5FO8B 1UA6L 2NY6B 2DH3A 4ANVA 2NY5L 3MNVA 1J8KA 2WVTA 3DXAE 3TO2A 5F9OH 5IEKA 3HS0C 1EDHA 4L05A 1NLDH 3EGXB 1INDH 3MODH 4U49A 2ATKB 3CIAA 3GGWA 3T0EC 1XIWC 4X4XA 1C9SA 4GPVA 3QS2A 5KYUB 1HSBA 4WHCA 3I2CH 1I7RB 2HFGL 3DWTA 1BXUA 3V9CA 4UIMA 3C6SB 1RZFL 3OAUH 4EZMA 4LESA 1JNHA 3T8MA 5E8PA 5EU7E 4FX5A 1J9CT 1T0PB 2FSDA 4MMZC 1MCSA 2IANE 2PPAA 4HOMA 1IVTA 3ARBD 1BA9A 2O6EA 3BUYB 4UIKL 1E8YA 2WZ5A 4GOSA 1YN6B 1E2VA 1FCGA 5FB8B 4ZX3A 4PGEB 3DX6A 4BFRA 1MFAL 1JXDA 4JPKL 4PLOB 2BPBA 1L3NA 1OW0C 1P84K 1SXAA 3ELAT 3LVTA 4JFDA 4Z7VF 1UZGA 4HIEB 1O6TA 5EOQH 3IS1X 1B4JL 2O5YL 3LMJH 4EEEA 4JR9L 4FXTA 1AQ8A 1FL6B 2Z0UA 2EXSA 2WOBA 1EAQA 1LK2A 5GSRB 4NKOA 5HDBE 3IF1B 4M5ZH 1EGJA 4PSRA 4KK8D 3Q13A 4BFKA 1DO5A 1FYTA 3OXRA 4FQ1L 3DGGA 3GF8A 1B0IA 5BQ7A 3QQ3B 1YEJL 4PBXA 1P1VA 4OD1H 4OLWH 4R2GB 4Z77A 3IETB 4BWTA 3RWGA 5D70H 3PP4L 4B9KC 3KBPA 1J9RA 3TYFB 4HGWB 3L5XL 5CU9A 3BKYL 2GI7A 2VLJB 1JNJA 4UOW0 4PJ8D 1VENA 5T1KD 3WUWB 1YYML 1CICD 3MRMA 4CVZA 1WITA 3MC0A 3CBKB 4OSUL 5D2NE 5AALA 3P9LB 5FO7B 3MRDA 1B0RB 1DVZA 3VM5A 3ZYZA 1TQSA 5T5FH 5BVJB 4XPTL 3EDDA 4JRLA 1LHZA 3RDTD 5D7JC 4PP2A 5C0FB 3STZA 3WS6C 3W38A 3VMOA 2CK0H 2CLZB 5DJDA 1I7ZB 4JG9A 1T0MB 2FCBA 1Z0MA 1G7LA 5DCCA 2DM3A 3ABZA 5DHYB 2GY5A 5HGAB 4XGZB 4XPGH 4C57C 4NOFA 2IJ0C 4TPRH 4YO0A 2PCYA 2UY6A 4PJCE 4YHLH 1UD8A 4LE8A 1S46A 2ATPA 3D4GA 4NP4H 4AM0B 4HFUH 4IRJC 3OKOA 4Y4KD 3F65A 4HS6A 4L4JA 3N85H 2V7HA 1KB9K 1WE5A 4LVOB 1N18A 2E6PA 2ID5A 4XN4A 5EC2A 2ZOKA 5HHNA 5EOTA 1MVFA 1GYUA 2JF1A 3LX9A 3MXVL 4AIOA 3GJFK 4F92B 1RUKL 2YD3A 3SGKC 3S4SG 3S88H 3MOQA 1FO0H 2F5BL 2UWEB 1OT2A 5K59E 4XNYH 1LO5A 1XAKA 1GZQA 1MHHA 4X99B 2MTAA 1ZLUK 1LEIB 2Y7NA 3FOLA 3ZGHA 4QRPD 4A2GA 3OJDA 5T8IA 3GKWL 4UNIA 4J8QA 2VDOB 3F64A 5I16B 5CWSB 4YHYB 2BNQB 3IU3B 3WN5A 3C5ZD 3UGXA 1A25A 3EG9B 4WWKB 3FF8A 3EJUA 1KB5A 4OFPA 3MO1A 2VJ0A 5F7FA 1WF5A 2E4TA 4GIAA 4GLRH 1ZHNA 4GFXA 2NNCA 1JPFB 3T4YA 1XH0A 2CNYA 4ZO9A 5KYXB 5CFHA 1CD0A 2FLBT 3GNML 5ILTL 1INQA 3MRJB 4L4VA 5HHVL 3UZEA 1A4BA 3L2LA 1WUNT 2WKOA 4IBZA 2QQKH 1CFQA 1A3ZA 2YGVA 4W93A 2COVD 1TTFA 3DX7B 1NMAL 2IH1B 4XPFH 1WFOA 3HAEG 5I1IL 4I5BA 5ESAB 3W1ZA 2FB4L 3EYVB 4ABWA 3FPYA 2LLLA 3SE3C 4NUJA 1AO7E 4HIXH 4GMSH 2PWGA 3JV4B 2VLKA 4F7EB 3TEUA 5AG9A 4Z7QE 4L0ZA 1JZ8A 2G75A 2EILB 1P9MC 4BIKA 5JHAA 1KBPA 4PJIF 5BOPA 1QEWB 4OCSL 5EZLB 4W9CC 4NRZB 4EXPX 1S4IA 4IRSB 3IMWA 5BRZE 3BP4B 1T7XA 4DN4H 4ICWA 4M93C 5GJSH 1IBBA 1M57B 1YEIL 2CCLA 2Y5EA 3EHBB 4G6MH 1WISA 4WJKB 3D09A 1X7TA 1WBZB 4R8WH 3QDHA 4AV5A 3BPCA 1ZK5A 2KERA 5J6GA 4XN9A 2IAMD 1BVNP 3BWUC 2A77L 2HTKD 3CFMA 3THML 2D4FA 5AVQB 3DV4B 4JHVA 2GTZB 2CZNA 1PQZB 1ZTMA 5FDYA 3PABA 1ZLWK 5C0IA 5LXVA 1OAQL 3KLLA 4X8JB 4NKQB 5HY9B 1ET8A 4KTYA 5J12B 1W0VB 4KKCC 4KKZA 2E9GA 1NICA 1FFTB 4MVBD 3OPZL 1XGYH 2Q76A 4ZZKA 4FLRA 5K9QI 1QPKA 5GZNC 1UVQB 1KBVA 4YHIA 3ZE2B 4J5VA 4XNUH 3SE9L 2Z31C 4JO1L 1L6ZA 4P46B 4ZO7A 5AOLA 1E3XA 1HHHB 4HGKC 3RVXD 3TT1L 4F15B 1IMHC 3OR6A 3QEGH 5F3HB 5D1QC 3R0NA 2GK0B 4ZXBC 2E4FA 3BP5B 3TN0C 5CFAA 4U1MA 4PG9A 5GS0C 1XF5B 2HTLD 4Y4HB 4AUUA 4OLYL 3RGVA 1JFQH 3AB0C 4MBRA 3T71A 1LEKA 4EMZA 2HLAA 2I9TA 4DGUA 2HJLB 3H42H 4K2UH 1I3UA 4EIUA 3QDAA 4PCYA 2BH0A 5CJ5A 3ESOA 4B9IA 1KWGA 3SQBB 3U9PH 2RAMA 5GGVL 2PXYC 3AG4B 3LQAH 4R4ND 1MCEA 4XMLH 5A3ID 3ZZ1A 2XWTB 4DP9X 5C0CA 1GJUA 4JB9H 2GJJA 5EUKA 1NFKA 3QXUA 1GVIA 3UYOD 2E6QA 4KC3B 4ICXA 1C12A 1MG3C 2FRGP 3DX8B 2VDPB 3ESMA 1CGYA 2XJLA 2ZSVA 3QQ4A 5TH2A 3CZSA 3ARBB 2FJFA 3DX3A 2XY1A 5KSVA 5FR3A 3M17B 1UXSA 3GZKA 4RRPM 4WRLA 3D5OF 5E8OB 3US0A 2NY5C 3QUHA 2FGWL 4LNVA 1XF4A 2MHAA 5I0ZA 2WXPA 4ZOBA 3QW9A 5IMOA 2C9PA 3HJEA 2VABA 3SKJH 2VR4A 1AZNA 2GC7C 3L3GB 2GJRA 2DPKA 1U2CA 4G6KH 1TQBC 3DVFA 1IAOB 4FABH 4JRXE 3B37A 4PJBE 3CFQA 3BMWA 1HH6A 1SUHA 1U2YA 1UKQA 2WQXA 4XCCH 4A38A 1OCRB 2GC4C 5I71B 4L29A 2OR9H 2YZ8A 1ADQA 2Q86A 4EZKA 3KDMB 4PS4H 2O61B 1AG0A 3NZUA 4JFEA 2EO7A 3T04D 4GAJH 5LJYH 4M7JH 4NT6A 1IBGH 3RKDD 2CIKA 1NMCB 2C4XA 2R2CA 4XO3A 1FH5H 1TETH 4L2LA 5JR1L 1MH5A 3QSKB 4PJ8B 5T1KB 3RNKA 2WO3B 1CICB 4R97C 3RZWA 1NLBL 1V7NH 3TFKD 1JV2B 4NX0A 1UB6A 2CH8A 2GUOB 3W9DA 4GO9A 2NW3A 3COOA 1R5WB 2WQWA 3LRMA 1Z3GH 2W5PA 3STLA 4ETQB 3HA0A 4NWTL 2PYED 3HG3A 3MDJA 3RDTB 3KZ8A 3NEXA 2H2SC 4PW3A 4AG4H 2ITDB 4OGXH 4QHMA 2MPVA 4KGJA 4QXVA 4MZ3A 3PGCB 2IOMA 5BW7A 2EXWC 1Q94A 5CD3A 3P0VL 4NKDB 2AJUL 4PUBL 3LXUX 3H3PH 2XYBA 4XMUA 3O11B 5HYIA 4ZAKC 1KBWA 4MNHB 2DI8A 1BYNA 4BA0A 1OAUH 2NY3D 3PV7A 1U8PA 4JPIB 3IFNH 4Y1AD 1S7VB 1PY4A 3QIWC 4A7UA 3F7QA 1ZS8A 3CDFA 5MEOB 3RLSA 4YS4A 3LHPH 4KTEH 4X7EC 3VXRE 5JHDD 3KE0A 1FH2A 4Q9QL 4MWFA 4RIRA 2DWTA 2LVCA 4UINL 4P4RA 1Q1JH 3FQNA 1OP3K 1IC7L 3DGCR 2XTLA 1V5JA 1A6ZB 5D72H 2BC4A 4WV1C 3DSFH 2GKIA 5HGDA 2H6PA 5HHOD 3VRIA 3VH8G 5IK3A 4QRPB 4RA0C 1J1PL 4PU2A 1HOCB 4RH4A 4EI6B 4QDGA 3GMMA 2X09A 3C5ZB 4TKWA 1IAIM 3LKQB 3L17A 1N0LA 5BXFA 1INEL 1AR2A 2EXTA 1P4BH 2PCPA 3I3BA 1PPIA 3SO3B 3UPRA 5K93A 5EU7C 1ED3A 3ZE2F 4CN4A 5HVHB 3MROA 1MLCA 4XO8A 4IMLB 5ESVA 1TJGH 3R0MA 5GGTA 3OWEA 5KOVC 3VFPB 3F7RA 4C4UA 4DPBX 4PREB 1YCSA 4YPGA 1GS7A 1BFOA 1BECA 3KYKH 3KW8A 5E99H 5DZVA 5CU5A 1B2WL 4AYID 3MX0B 3SDDD 3CFJB 3VGGA 1WTGT 4DP4X 1YEFH 4R7XA 3K6IA 5CLXA 5I1LB 5T3ZD 5HHQB 2AJZA 4HKXB 4NUPA 4NUGH 3VGAC 1Q0YL 2CGYA 3IDUA 5DQ9A 3EFOA 4AKPA 2PLTA 3T2QA 1H8LA 4U7MA 5FIEA 3MRQA 4DCQB 3D39D 5I9QB 2F1EA 1IGCL 4QTFA 2CLRB 1SYVB 3CN1A 1BVKA 3KVQA 1TO5A 1CK0L 1FAIH 1ASQA 1IJ9A 3RWDB 5DUML 2BZDA 1ESOA 3LQMA 4WWID 5T3XL 5J56B 2AQTA 4XTRC 3PWPA 4C4KO 2ZX5A 1KENL 2CKBL 2VXSH 1TXKA 4AKOA 3MLUL 4U1JB 1WFNA 1IGJA 3VX1A 5IEHB 1S9KC 5I5JA 1ILUA 5F89B 5D2NC 2IAMB 3MCLL 3VI4A 3LKSB 3H2PA 2Y7QA 5E5MA 5DWPA 5E95B 2Q8AL 1FFNB 2X6UA 3MGOB 4ZUSA 4RMSA 2IV8A 3ASOB 5EZPA 1ADQL 3AITA 4LSQL 5IF0A 4QHKJ 3VXMA 1HL8A 2PP8A 3WV0A 5GQBA 2R1WA 4HBCL 3LB6C 3SGJA 4JFHE 3R7RA 1E9QB 1O75A 3PGFL 5CN3A 3MV9A 2XPGB 4X4ZA 5DHVH 5AW3B 4D9QE 4HLJA 2OXHB 2BDNH 5JW3H 1JI1A 2PPDA 3VJ6B 1BX2B 1KGJA 1XB6A 1E8XA 4MNQE 4Z7OE 4S1QL 1IBZA 4AT6A 4NJAL 5GIRB 1ZVYA 1G1YA 2F1BA 4HUCA 2PW1B 3O8XA 3FT3A 3VM7A 5AKSA 3RX9A 1RZPA 4KXCA 1J0YA 4YSTA 4TQ8A 5C3IA 3LN4B 4H25A 5F9JB 5HSFA 3WIAA 4JO8A 3QRLA 1QSFA 4DK6A 1PZ3A 1TOXA 2UUDH 3BZ5A 3NP4A 2VXTH 4NQDA 1TSRA 5AVVB 3NQKA 3VCLB 2AJ3B 1RIUH 3PDOA 3QUMB 4L5FE 3D87B 3N41F 4HIHA 1N6VA 1CLZH 4PRNB 2R0WH 3DNKA 1AZZC 4NQXA 3S2CA 3VD4A 3GS7A 1CTMA 2NZ9C 2WXIA 4TSAL 4OFQA 1KCBA 5TQ2L 1E5AA 4AYMC 1Y6NR 1YUHB 1K4CB 4ODSL 3LIZH 5HBBA 2IQAB 1NMBL 1JDDA 1JCVA 2I60L 2IWEA 1M05A 3QRBA 3L45A 5JPNA 2OMTB 6TAAA 1O0VA 3QUZA 5F9DC 3QJFB 3SPIA 5KG9B 4GG6A 3EAKA 5HYJA 1E5CA 1JXJA 3EDKA 4KRLB 2XIBA 2FX7L 2VXVH 2NY2C 5E6SB 3TH2T 4F8LA 1TT6A 3FQ1A 5IKCB 4BK8A 3AU1B 5LVEA 3DYMA 2P24B 5CCJA 1ILSA 3BT2L 1D7DA 3IT8D 2XG4A 3QIBD 5AVYB 5HVGB 3GS4A 2COQA 4JFDD 1IT9L 2G5RA 1BZOA 2H32B 4YDJB 3LRKA 5DS1A 2XFXB 3SQOL 1EJ8A 1IL1B 3E2HB 1X5JA 3EBHA 1F6AB 1JMXA 1Q72H 2NTFA 3DX9A 2OW7A 4L8SC 1PDKB 4GO6B 2ROYA 1FYTD 4DGVH 2D7TL 3S3SA 4ZT1A 2KI6A 1XMWA 4KNTA 2D31B 3U4EA 4LARH 3FW6A 1TEYA 1A0QH 1F4XH 4EIBA 5ITBH 3L4CA 4U4BA 3KYOB 1NPNA 3VYPA 2Y69B 2YRZA 3OX8A 5D7IB 1MCOL 1HXMB 4P5KB 4Z5RB 5DC9B 4BUHA 4XNQB 3GMPB 5D9SB 2HCZX 3QUXD 1ES0B 4JY5L 4QO1B 4HCRH 4N0FB 1IGIL 1F3RB 2RR3A 1P4LA 5DC2A 4NRXA 1YYLL 4QXTB 4UU9A 2AI0H 4AQ1B 5CCKH 4J4PC 2WWOA 1XBDA 4WNJA 3I6LE 3DHUA 4E5XB 2PYEB 4EF3A 3ZE1F 1BQLL 2I32A 1OTTD 1RJLA 3BWZA 3DROA 4KKBC 1N8ZA 2ZE0A 4I48B 1VB9A 4LL1A 4DWHA 4F7KA 4N24A 2A4CA 4KTDL 4JFZL 5EF1A 3P69A 4M48H 1R4XA 3QR1A 5CXPA 3IMVA 1HAWA 4JFQA 1XSKA 1FLRL 1KN2L 1NAMH 1UH3A 3AABA 3NJJA 4F7MA 4AYDC 3VXUD 4B7LA 2NY3B 4IKLA 2R2EA 2G5UA 4Y1AB 3VYOA 3WHE1 2GAZA 4BZ2A 3DRQB 3TIDB 4BD4A 1CE1L 2UWEE 3FB5A 1U3HA 1IJNA 1YPZA 4NAMA 3T2NH 5JHDB 3TPUB 3L3JA 3UBXB 2Y5TB 2CO6A 3V0GA 1ZIBA 3E7JA 4JDTL 1X5LA 2Y4SA 4LLMB 2GJ6A 2BNQE 2WAQA 1CYGA 4MMXB 2CBOA 5GGRY 4IJTA 3AXLB 5HHOB 1E9PA 2HT4D 5C0JB 3WTYA 4I18B 2E6JA 1KJ2H 1BOYA 3ESPA 3JT2A 4M9OA 4D8PB 1NWPA 2XUWA 3MLSH 1Z5HA 5FA4B 1BF5A 1JGVL 1IKFL 4K7FB 4HWNA 3HE7A 1FPTL 1JMZA 3HZMB 4KPHH 4LT7A 3OF6A 2PUQT 4Z7AA 3A21A 3RWHB 2J1XA 3WUWG 4ONHB 4F3FB 2N0MA 4FQCH 3Q8CA 1GZHA 2LTQC 2ETWA 5EU6D 4N5EC 2XXFA 4L4VD 4WO0A 2H26A 3FO2A 2EUZA 3V5KB 2XJKA 4GXUN 4KWUA 4YAQA 3SDDB 1A9BA 2K7QA 2RA1A 3RIFK 1FZMA 1U21A 5DMGC 3OC5A 4UOZA 2HSIA 4BFIB 5D6CB 3GUFA 4PTUB 1AACA 4TUUA 4F58L 4XHJC 4NN5C 3OKKA 2R4SH 4B9PA 1AXTL 4OM1L 1KJ3L 1XXDC 1I1CA 3D39B 2PW2A 3V0DA 3UG4A 1UKSA 2EVHA 1T89C 4IGBD 1RIHL 2X70A 4FTVD 4TVPL 1UM4L 2VIRA 4WGWB 1U8QB 4XOBA 5TE6L 4YHML 2Q10A 2FECL 4ZG1A 4OFVA 4JCLA 4XH2A 3KLQA 2P5EA 4FQQB 1DCLA 4ZO6A 3V0VB 2BVPA 2WNXA 3IMUA 3KXFA 1QRKA 3T65B 4XPBL 3PNWA 1SY6H 3SDYH 4A7GF 5JW5A 2FIRT 3X1GA 3A47A 4GSDL 3IDNB 4H13C 4F7PA 4Y8AA 1OV8A 3QT2A 3FFDA 5CJXA 3H7LA 4TSBH 5LXGH 1AY1L 1G6VK 4GUPB 2CR0A 3UAJC 3WIHL 2L4OA 4YVUA 4TL4A 5I8CB 1MKFA 2YPKA 1VPOL 4LSTL 4UB0H 4X5WB 1THCA 3LJ3A 2UVEA 3PU7A 3NRPA 1E40A 1C08B 1JHKH 1PG7W 3MLRL 4MD4A 5H94B 5MEQA 2BNRD 1AC6A 2KKQA 2RBLA 5DJCB 5INDB 1ORSA 5KYNA 2ZOLB 4FQ2L 3CHSA 3ZE2E 4AVHA 2X7LB 4X6BA 5DRXA 1FO0B 5IB3A 3GBML 3HC4H 5FV1L 3WU1A 4AEIL 4PB9L 3X13B 5L7XL 4IHOA 3S6CA 3UBXI 4DPAX 4HUXA 1C1EL 1ZJAA 3NTCH 5GZOC 2JCCB 2JXMB 1ZVNA 3CBJB 4L3CB 5HJDA 4ANKA 1WWAX 1JZGA 1Z9OA 3D0LA 4PWFA 2ZJSL 5IROD 5L4MA 1CF8L 2YARA 4NDMB 1IEAA 3ECUA 5CZRA 4B7IA 1ZWIA 4L9LC 1IGYB 2AQ1A 3RGVD 1Z9SB 4KJWD 2OK0H 1S7SA 1A8JH 4JRYD 3T3MB 5CINL 4LKCA 1MN4A 3MNVB 4L1HA 5IEKB 1NIEA 5IJKC 3X2QB 1MY5A 5F1NA 5C71A 3AMKA 4IBTA 3V0FA 1ZT7A 3GGWB 4Y19D 4X4XB 2ZTBA 2QSTA 5C0CD 5LWYH 5AZ2L 2QMKA 5JIKA 4DP5X 4QMEA 1DR9A 3OGOE 3HI6H 3MZTA 3ZUCA 1GW6A 4HPYH 1JNHB 5KVDE 4M1DL 5E8PB 5F1OB 3W5NA 2NUPA 1XFPA 3WJLA 1YC7A 1T03L 2R39A 4Y9BA 1EO7A 2OSLB 2CUAA 3QUGA 3PV6B 4N6RA 1PLCA 2L7EA 1I9IH 4JM4L 3TO4D 2XA8L 3V4PH 4EDXA 3U0PB 3W56A 3OKNB 2A6JB 3ZBMA 3BZDA 1HNYA 3DX6B 3QIBB 1G6RH 3UJTL 4HUVA 4LEEA 3I6GA 4JFDB 1TF4A 2J6EL 1JF6A 4YDKH 5TDPB 2N4IA 3APMA 4BCZA 5EH1A 1AMXA 4FLQA 2BY2A 3C8KA 4KMTH 4P3CL 1A1MA 3INUL 4NKOB 2XVLA 3WKMH 3GC3A 5C0RL 5I6NA 1SHXA 1CXKA 2VC2B 2CA4A 2XKSA 2N7SA 3AS3A 4FHJA 4ZW8A 3P9MB 5DHDA 1FYTB 3OXRB 4MSWB 4JL2A 5BQ7B 3SCMA 3UFIA 5EFIA 3EJYD 5LGJB 5IB2A 1A1NB 4JFED 1E7VA 2BS71 4Z77B 1YY8A 1WO2A 3BRDA 5DD0L 3PWNA 4FZEL 1DJXA 4Y5VA 2DBLL 3SBQA 3ZYOA 1NCUA 3BAYA 3JV6A 3UTTA 3HZYA 4GBXA 4HUUB 3D0VA 3QUXB 1MXGA 1T1WA 2AQPA 2JWYA 4TLTA 3C9NA 4MXQC 4ZOEA 4Z3TA 1NCWL 3MRDB 2FH8A 2NUTA 2DJ4A 5AAWA 2MCG1 5AKTA 4ES9A 4ODWA 5FAAA 3VDCA 3CD4A 4LRNH 3BHBA 1IFHL 2B3RA 5LBVA 4PP2B 2MJWA 4LAQL 2FNWA 3BAEL 2JJUA 4Z95L 4YGVA 3STZB 5C0DA 1BZ9B 1G7LB 1XCQA 2JIXA 3GRWH 3POCA 4JJHA 1TJHL 4OTXL 4E9LA 1EJ6A 2X2IA 3AADB 1BOGB 3QWRD 1M6OB 1FZKB 2UY6B 5CN2A 3CU1A 3NJLA 4XE5B 2ATPB 2J8OA 5GS1C 2WUBH 4IK7A 2RGSA 2VDPL 3OKOB 3VXUB 1J5CA 1RZJL 4CVXB 4G2AA 1UM6L 2EYRA 2V7HB 2IBGA 5FA3A 1U3YA 1HEHC 1JAEA 2OJZL 2EXYC 3E8VA 4EKJA 5EC2B 4GLRI 4CJ0A 5HHNB 5EOTB 2J21A 3EJTA 2NY6C 5CM1A 2QLYA 2KPNA 5EEYA 1OL0A 4A04A 4JO3H 4U6HA 5LGYA 1P84J 4UTBA 4QRPE 3DI3B 2J88H 4K15A 1UURA 1LO5B 1GZQB 4P57A 2FQEA 2EE9A 5DD6B 5J1AA 5HPMB 5JHLL 3EO1A 4JFXA 3RWCB 3QZPA 4DQAA 3WN5B 4JKLA 3SE4A 2A38A 4TNVK 1CDUA 1J87A 4WW1B 4BGDA 3UEZA 3UO1L 1KB5B 5D2LF 2W8CA 3LPFA 1RZKL 2R1XA 3RFZA 2RALA 1ZHNB 1VFMA 3DUUB 4YDZA 4AIXA 3MRGA 4Q14A 1VFUA 3CK0L 4ZNEA 5EU6B 2JCCF 2GHZA 1N64H 1WAAF 4A63A 4L4VB 3CMOL 1CG9B 3VXPA 4QXUH 2AZAA 3HG0A 4PGBB 4BFEA 3E9UA 5C2UB 3BSZL 3QI9A 4KKLC 5FYKH 1ZXQA 4N9OB 4Z7IA 3JUZA 3FSZA 3X11A 3O3EA 1J0HA 1XV8A 1RFDH 3T3MF 4OB5L 5EU5A 4P07A 2VGLM 4FQJL 5GS2D 2CO2A 5ITFA 2JJVA 5DYOB 4M6NL 2G75B 2OMYA 5ETUB 4R2GC 1DBJL 3GSRA 2XV6B 4FTVB 2B08A 4K9EC 3K4AA 4RZKA 4HLEA 1J1XL 2DWSA 2YWZA 2NY7L 1L4IA 2KBGA 3Q2NA 4H1LA 4AGLA 4LLVA 3OB8A 4ODBD 3S37H 3VA6A 1UOVA 1TZHA 4PJFA 1KB9J 3F6LA 4U2ZA 3MOBH 3R1GL 1XVSA 3D30A 4TSCL 2VMJA 3WENA 2CMRL 2H3XC 1QNZL 5E08H 2X4TA 3B2VH 3BPCB 4QY8A 1GYVA 5J6GB 2OKMA 3NCJL 4HW6A 4EQ3A 2D3JA 2VR9A 2DY2A 2EDFA 4YPJA 1RUQL 1XEDA 5PAZA 2IGFH 1XB8A 2AEQL 4K07A 5DFVD 1DVXA 2J73A 2BNRB 3WMPA 5C0IB 1VGKA 1K8IB 4WWNA 1CXLA 3CPLB 4ODUA 1RP9A 2CUMA 4LVOC 2Q76B 2FNBA 3ILPA 5CMAA 1X5IA 5E4IA 3WFBH 4LPWA 4UQDA 4YHIB 4AEHH 5H8DA 3QA3A 5AKRA 4MHHG 1AMYA 4J3BA 2DQJH 4UT6L 2RD0A 3LEYL 1U6AL 4Q6IA 2DKUA 1S7QA 3C8HA 4JG5A 3T0BA 5DXWA 2C3VB 2YD7A 4PG9B 1V10A 2EABA 2NX5D 2FO8A 4XNAA 3RYMA 1SZNA 4NQDD 4P2OA 3RGVB 1H8OA 3WS3A 2ADJA 2YHGA 4JRYB 2I9TB 4WWKC 2WINB 2ODHA 3UC0L 1DP0A 3K5RA 5CP3A 1ADWA 3AACA 3HRZA 4Y19B 4LNRB 2Q8BL 1KOAA 1JNNL 5C0CB 3GTVA 1WFJA 5EUKB 1UUNA 4ZNCD 2VSKB 4O02L 4HIPA 1CURA 4JPVL 1QVOA 1TZ8A 5BPPA 3QCUL 4Z78A 2AJXH 3U0WH 1W80A 3CNKA 3PS6A 2OL3A 1KXQA 3QUZD 1G0DA 5HYJD 1D5RA 1OO2A 5TH2B 3L3HA 5DFTA 2FJFB 3N42F 5FYJH 3RVVC 3Q2WA 3TO4B 4JHWH 1KT2B 5KSVB 2Y72A 5ICYB 1UXSB 4GB9A 1HK6A 3HG1E 1HCVA 2HG0A 4QTHA 1M1XA 5CD5D 1XF4B 4NZRL 2QQLL 1EFQA 1NBZB 3DOHA 3ZTNL 4LP8A 2VAJA 1SNRA 5AW4B 4FULA 4Z3GA 2R0ZL 1TTAA 3IPBA 3W11C 2VABB 3WMSA 2VLRD 1YNTA 4XP9L 4XODA 2ERJB 1AXIB 1I7TB 1SYSA 4I1NB 3W57A 2D9CA 3U7WH 3GBNH 5DVKA 4AJVA 5EO9A 4IRSC 4PSPA 1HH6B 4M7LL 1LMKA 2XV2A 1XGPA 5F7EL 4ZS7L 2H0PA 2VDLH 4L29B 2FATL 3EHBC 2HKFH 2Q86B 4UBDC 3WO4B 2QV2A 5K9JL 1ZD6A 5D7IE 1MG2C 2LAGB 4OLUH 3VU1A 5C09D 4ABUA 1NCDH 1A4KB 4JFEB 4YFLF 3C6LD 1A14H 4NT6B 1I1RA 3RPKA 1QSZA 4OQTA 2CIKB 3AU0A 3J8F7 5I5IA 4PJXF 3QJSB 1K3IA 5DGQA 1PZ2A 2GSIA 4XMXA 3J7HA 2KZBA 4POZC 5IB1A 1U8HA 1W8EA 2PWEA 2VR5A 2K8QA 1MH5B 4ZZFA 1VZHA 4K5NA 2ZUTA 3RNKB 4JM2A 1J5HA 4BJLA 1JZHA 2PYEE 4H8WH 2QL1A 2R0KH 1UB6B 2Y07L 4EZLA 2WXOA 1AGFA 5AAMA 1BQ5A 4CRPA 4GAYA 2JB6A 1F6LL 5J12C 4LSRL 3STLB 3KR3L 2F0CA 1SM3H 3UMTA 2FWOA 4QHMB 4D0CA 4PB0L 3BXNA 3US9A 3LZQA 4YVNA 3TONA 1Q94B 1NWOA 5CD3B 4ZW5A 3BW9A 4IKNA 4P46C 2GHWB 4J6RL 4F15C 1N5AA 1GCFA 4TTGA 4GAFB 2J4WH 2Y22A 4Y1AE 4ZMLA 2K78A 4FP8L 1E6JH 3S36H 2N01B 4F33A 3AAZB 1U8PB 4AUYA 4PCTA 3VD7A 2XACC 4JKPH 5JHDE 4Y4HC 2BCMA 4NGHH 4NPKA 2WXGA 1G9ML 1ZS8B 4M6OH 2VM3A 4OJEH 1E6OH 5D5MA 2QEJA 1U3HD 1E42A 2BVEA 3B7TA 3F5WA 2X9ZA 2NDFA 2FUTA 2R1YB 3BP7A 3GJEB 5HHOE 4LDOB 4DVRH 3G04A 3FQNB 3ULVH 2GJ6D 2B15A 3T0WA 2KQNA 2AJVH 1M3IA 2BC4B 4M9PA 1ZLUH 4MCZA 1JK9A 1BVNT 2OMXA 2H6PB 2Z0BA 4QTIL 1ACYH 2HH0L 5HGDB 3SZKC 3LD8B 2XPZA 2B4CC 4DKFH 3ULUF 3X3FL 4YSRA 3HMXL 3GMMB 2W9EL 1N0LB 4A6YA 3MJ7A 3K91A 1RZJC 3HI1B 2VZOA 4Q52A 5BXFB 1GHFL 2OCFD 3ARBC 2PCPB 3HE7D 4M5SA 3CFIC 3GMOB 1YNKL 3L3KB 3UPRB 1ED3B 3OF6D 1VAHA 3MROB 5AEAA 1XT5A 4TNFA 3OM3B 3EDFA 4J8RB 4YPGB 5GS3A 2BXYA 3AM8A 4RDBA 5KANI 5T3ZE 4AL8L 2X4OB 5DEFA 4J2XA 2OTPA 5DR5H 4E5XG 5JOFA 2CM5A 2LAAA 4FFZL 4YSQA 2APXA 3RIAF 2AS5M 1WBYA 4IW4C 4LLWA 3D39E 3FULA 4YK4B 1AKJD 5LNGA 1U9KA 5DQ9B 3EFOB 4W6WB 1P7QA 2Z8RA 4KK8C 4MA3A 5I71C 3AY4A 3MRQB 4XVTL 2AK1H 3FQXA 4GEIA 4LPCA 1RZKC 4UDUB 1T80A 2EDRA 2X89A 3HN8A 2OL3L 3NCEB 2VOTA 2FLMA 3Q0HA 1BVKB 1XZWA 5DS2A 1FJ1B 3QH3B 4IIQA 1NMCC 2AXHA 2ICES 5D7SH 3M45A 4NFCA 2E7CA 1H6EA 2ENYA 4PJ8C 3HE6A 1CICC 5F9OL 3Q43A 1LNUA 1RKRA 1NLDL 1G1KA 2EDYA 3KXFD 3MODL 4HMEA 3RY6C 4PPTA 2E0PA 2GVYA 3IAPA 3OHMB 4ONGH 2BLFA 4NZTH 1T7YA 3CSGA 1T66D 3I2CL 3NMEA 3RDTC 4AMWA 4CNIA 2BFGA 3OAUL 3VI4B 3S3JA 2HPOA 3ETBF 1HSAB 3U46A 4FI6A 1TVDA 4FMFA 1DSWA 3DYOA 4OCLC 4W9DC 5DHMC 4ZUSB 3TIEA 3L7EA 2PWDA 4HZLA 1Y1DA 1ZLWH 1V3KA 1M3JA 3OVUB 5IF0B 4IBWA 2DLTA 1ZLSH 5GPRA 5IBLD 4FLSA 4Y4KC 2G4GA 1MFBH 3E38A 4IRZH 4HIIA 4M7KH 4H8PA 1CL7H 4Y88A 1QWUA 2VZTA 3QQ9D 2Q3AA 5EOQL 3J2PA 3LMJL 4XRCB 4G8IA 1KXTB 3WG7B 5C08D 4HOZA 3FT3B 3IFPA 4OZIA 1LO4H 2H0EA 2Z65C 3QC6X 4NQCA 2NCEA 2IDUA 4M5ZL 4QEGA 5EF0A 4H25B 2DQGH 3T3ME 2QPFA 2NX5B 4OVVA 5HYSA 4Z0BH 4NQDB 3QAZB 4ENED 1LK3H 2LU7A 3PDOB 4OD1L 3C5ZC 4OLWL 3QCTH 1Q9KA 5D70L 1MPAH 1EPFA 5JOPD 4NQXB 5F0JB 3OLIA 3QIUA 4AMXA 3SO3C 5EF3A 1AE6H 3QNYA 3ENEA 5HVHC 3ZHDA 1WV7T 3TCLA 3ZE0B 1QAWA 3UABA 5FYKD 1FVDA 1NDGB 5EF2A 1ZT1A 3OAWA 1M05B 2HN7A 5SWSA 2TAAA 5DHEA 3ZMEA 3MRCB 3QUZB 4HF5H 2OCJA 4JVWA 2CQVA 1I9RH 4GG6B 5HYJB 1FNSH 2CK0L 4YEEA 4KFZC 5AOIA 5I0VA 1L9RA 5TGBA 4JFDE 4L0PB 3AQXA 2BOBB 4XPGL 1AJ7H 4TPRL 4U4IA 4YHLL 1KIRA 4PJ7A 4NP4L 5I9QC 5E2VH 1QI4A 2XDHA 4NKMB 3RX5A 3SPGA 1BJ1J 2VLRB 2DIBA 4OJYA 2O93L 1N2RB 1L9PA 3N85L 3QZLA 3SY0B 1MAKA 4UTCA 3BRGC 3SPVB 1FYTE 4Z1PA 1IBYA 1E50A 3N9GH 1T0NB 4GRWF 3GB7A 5D4JA 2RCSH 3S88L 3O4LA 4BSWA 1FO0L 3Q5YA 4HWBA 2LU4A 4KK6D 3FC8A 4MLSA 4WEEA 3RRQA 3SCMD 4TRPH 2P5WA 1OSEA 2VMDA 2YBRB 2OSXA 1QACA 4KY1H 4XNYL 5GSVA 4WAFA 5C09B 3C6LB 4AKQA 2XA3A 3SDAA 5T5NF 2IAMC 4KTGA 3QO1A 1LXMA 1AOZA 2HTKC 4LGRB 3TVMA 2B2XH 1UZ8B 2VQ1A 3I6SA 4P9HH 4XMPH 3PFUA 1D3CA 5BO1H 1KFAH 1DE4A 3II2A 4GSUA 4CC4A 4HBQA 4NO2A 4NRXB 1WZ1H 2MRYA 4UU9B 4FQLH 3D50A 1DVTA 3IFOA 2ADYA 4OV6F 1C16B 5AVWB 3R4RA 2BMKA 3GT6A 3G9AB 3CN3A 1VADA 4PV9B 1HKFA 3UZQA 3O2WH 5MENA 1RJLB 2E7MA 4MVBC 4EN3D 3DROB 4YFEA 5I17A 3FCUB 1N8ZB 3S8WA 5IOKA 2JIXD 2QQKL 1WIOA 2NPLX 1T6WA 3VXUE 5FV2A 2W94A 3RVXC 4PG2C 2WZ0A 4HCFA 4XPFL 1JZEA 4F7MB 3TU6A 4LO9A 2R2EB 3TBSB 1WH0A 2FEEI 2HTLC 3BPOB 3QEQD 1J1OH 3A67H 4GMSL 4HIXL 5E56A 1DVYA 2QBWA 3GLDA 4PLKD 3FB5B 2H41A 1U3HB 5E6IC 1BSIA 4I2XB 3L3JB 3NJXA 4XCYB 1XF2A 2CO6B 1I9JH 1QMUA 4UQBA 4R4NC 1T2JA 2FO4B 5BV7B 1AHWA 1SJVA 1V05A 5A3IC 2GJ6B 4DN4L 3V5DA 3NJIA 5B7MA 2ZWZA 5GJSL 4G6ML 2VSDA 3N44B 4OH2A 1X5AA 4R8WL 2YD8A 4FQHA 1ZK9A 2JLLA 2X4SB 1C8QA 1NEUA 4UV4H 3HE7B 5EU6E 5FKAA 1SOKA 3ZXAC 4L4VE 3PRZA 4NO5B 1OE3A 3TT3H 3B2DC 2DMHA 2J71A 5DJZA 3CVIL 4JLRA 4FNUA 3V4LA 3F2LA 2J5LB 1FG9C 4FG6D 4R3SA 3Q05A 4ZQKB 2H26B 4AX3A 1H0DB 4QRTA 3D9AH 4XP4H 3QI9D 2DM4A 1FZMB 4Z7UB 4KQ4H 1MRDH 1XHHA 4J3OH 1XGYL 1HHKA 1E4KA 1J0JA 3MUUA 3VQ2C 1AKJB 4LLYA 1GYCA 1S78D 3OKKB 3T3PF 4XNUL 1LDSA 1T20A 1NDTA 1YHPA 4NZ8A 4FTVE 5DVOA 3QEGL 3BMVA 3QVAA 4ZMPA 1Z0NA 2PW2B 4LMQE 1JGLH 3GSOA 2XWBA 3ZE0F 3U36B 3J27A 4XMWA 3EO0A 2NLJB 3RKDC 4B9ZA 3CLEH 2WTOA 2VIRB 5DTFB 1DUYB 2X4RA 5AD0A 4KO9A 1X7SA 4K2UL 1G7JB 1OXYA 1AGBB 2F2HA 5FCSH 4XH2B 1HWWA 1J8HA 1KEMH 2BVPB 3TFKC 3U9PL 4OGZA 3KXFB 3ES6A 3LQAL 1VZIA 4XMLL 1NEZA 2VR6A 3FQRA 2EYSB 1OT4A 4AQ1C 3CSPA 4JB9L 1KLUB 1WA0X 1ZTXE 4F7PB 5JIIA 1NFIA 3FFDB 1RI8A 5C0EA 1H3PH 2EJ1A 4WCYH 3UO8B 2BNRE 4X5XA 1AKPA 1BJ1H 2BINA 1U42A 3Q1SH 2OZ4A 1EQWA 2WLZA 1OWRM 4G7RB 2B0SH 1QABA 4BINA 1ORSB 4KAQH 4JFYA 4EUPH 2NY3C 1MCHA 2C3HA 3RY5A 5ERWB 4X6BB 5DRXB 4PCKA 5IB3B 2PTUA 1S5IH 4GSQA 1EBPA 2BVOA 5SV4A 3SKJL 3L48A 5KVGH 1LM8V 3OJMB 4YHKH 4K7PH 3RP1A 1IX2A 4GP5B 4IHOB 4MRCA 4WGKA 4G6KL 3UXFA 2IC2A 4HUXB 1NIAA 3V55A 3FRPA 3O0RH 4X9IA 5FGSA 1G9NH 4FABL 4FXKB 2JVUA 2ZKXA 3MOAH 4XCCL 3AUVA 3DKHA 4JRYE 3WD5H 4L18A 2OR9L 5FCUH 1ITCA 1ZWIB 2OULB 3ARGA 4PS4L 3WDJA 4I18C 1TZOA 4GAJL 3ZDXB 4M7JL 4Y19E 1IBGL 1JGDB 2BIMA 4LKCB 5C0CE 2ENSA 5L4IA 4B9GA 5F1NB 5F1KC 1FH5L 1H8NA 1TETL 4G59C 1KJMA 1MCPH 2EEDA 4QF1A 1FFQA 3BAIA 4BRVA 4OF7A 4XB7A 1GH7A 1JWMA 1V7NL 4KVNL 3QJOA 1EVTC 4MQ7B 3SDDC 4A39A 2NUPB 4G6FD 5EBGA 4AG4L 3ILQD 2J1YA 4OGXL 1U36A 3B9KD 1NAKH 5EZOH 1YEEH 1YPZF 4UQAA 2QGBA 2VDRB 4PY8J 4H0HB 3NCXA 5LCVH 3L3OA 3H3PL 2HUHA 3GXFA 1SEQH 4LBEB 3I6GB 3OL2A 5DGRA 1QWNA 3N1MC 3OC8A 4TUKH 4MA8L 1FHGA 1U8JA 4GKOA 2OFQA 3IFNL 3C8KB 2XWDA 2WZPA 1A1MB 5IP4A 1RUAH 3RZCD 4IMKA 5DFAA 1EMTH 4CKVX 3LHPL 4JFEE 1NKGA 4KTEL 1VKXA 4BSJA 4QT5B 4AI7A 5E0QA 1UYWL 1NZRA 2J8HA 1Q1JL 3SCMB 3NPSB 3ZYIA 4XP1H 5EFIB 4HKZA 5D72L 4N8PA 4HG4K 1XF3A 3DSFL 1YY8B 2IMMA 2BHZA 4Y5VB 5CEXB 4GO8A 2QT6A 4RMBA 1AP2A 4G7VH 4QGTA 3HZYB 2DI7A 4N2BA 3QUKB 1D2OA 4X98A 4UZUA 1UD3A 4NUMA 3L95A 2ZCHH 1BPVA 1T1WB 2DQFB 1M71A 4JM2D 2BP3A 3C9NB 2NUTB 1A4AA 2HRPH 2EH7H 4WI6A 3O0LA 2JELH 4XMKH 3ZTEA 4ODWB