3PAYA

Crystal structure of a putative adhesin (bacova_04077) from bacteroides ovatus at 2.50 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
302
Chain Sequence
GSCDSIREDLPRCELWLEFVFDYNMEYADAFNPQVKSVDVLVFDSDDKLLFTKSVKVAALVGGNRMSLTDELDFGSYKVLTVGSLSDRFRLSDNAGNKLVPGTTTLQQVIVSLKRETGGVNFEFQHLYFGEVVEVDHLPSNTNHKIYPVNLIRDTNRFNLALMGYEENQYTFEIQAPENAVYSWENEPTGQGPITYVPYYTDVVMSARLNTMRLLNRSGWDYKFIIRDANTEAEVWSYNLMTLLSIARPVSRYDGTELPFQEYLDRQSEWNLVFTVVEKNGGGFLQIGIVVGTWIHWLHGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords putative adhesin
publication title Crystal structure of a putative adhesin (BACOVA_04077) from Bacteroides ovatus at 2.50 A resolution
rcsb
source organism Bacteroides ovatus
total genus 64
structure length 302
sequence length 313
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA01
4QDGA 3PAYA 3GF8A
chains in the Genus database with same CATH superfamily
3MFFB 3WU1A 4ZFFA 1CK0H 4ONHA 5HPOA 1U8LB 1GZPA 3HR6A 1Q0EA 2VYRE 2CQVA 4G7QB 3EJTA 4H7VA 4QOKD 5CCHE 2E8YA 3EKCA 5KAQG 1IBYA 1I7UA 5DWPA 3RBSA 5CCKH 2AV1B 3D0VB 2VRAA 5F1OB 5EEZA 4KI1A 4P3WA 1XD1A 3MUY1 1DP0A 3MTXA 4HH9B 1DDHB 4G8FB 2RFXA 4OQTL 2XWCA 3CIQA 1U8OA 2J3SA 4YS4A 2E7BA 5I1EH 2GEQA 1S7XB 4GUPB 5L2KD 2FEEI 1AO7D 1NINA 4C55A 1RL1A 1BPVA 5K69A 4V1DE 4JRXE 5HHMB 3BKCH 1EAPB 1I8KA 2OSYA 4GKZB 1A2YB 2P5PA 2I7OA 3ALXA 3JSSA 3HG2A 3QRGL 4JO5A 4OZ4B 4ANVA 3C5ZC 2XTSA 3C60B 4PJDB 4YZFF 2Q8BL 1QATA 1EVTC 2EILB 3L3GB 1KJVA 1OQOA 1XMWA 1UACH 3M1BA 4F37K 2VDRL 1M71A 4ALAC 5FLVA 2XQ0A 2C7UA 2QPSA 2WUCH 3MOQA 4OFDA 3GSXB 2ENPA 1NIDA 5D7KE 5JOPD 5ESQB 3ESOA 3LH2L 1VENA 2DV6A 3QXVA 4J3UA 3BJLA 4NQXA 4XPFH 1I8MA 2GIMA 4XN7A 32C2B 1CN4A 2IPKB 1HHKB 1R3LB 1C7SA 1ZA6B 4FQJH 3TZVA 5HGAB 2G5RA 2ZCHL 3L5XH 5EV7A 3OMAB 4NENA 3QEHB 5IB3B 1JTOA 3FQ1A 4NKIH 4JQIH 5FM8A 3GBEA 1EEZB 4A6YA 2V5YA 2WZPA 2O26U 2ED7A 1T03L 1IGML 4KX8A 3VGEA 2FEJA 1GKEA 4O51B 5KG9A 1XB8A 4WKZB 4KNTA 4M61A 4I4WB 4N2AA 2QQNL 2BVOA 3LKPA 1D9KA 3AFLA 2NZ1A 5CR1A 3MRKB 3O41A 4PHZA 4FA8A 1KGWA 4B53A 3K72B 4ZS6C 1DSYA 1JGIA 5I1IL 2H5UA 3ARSA 3LHPL 1LO0H 4WKXA 1A7NH 1AJ7H 2H6PA 2R56L 3KPPB 1FYTE 2EICA 2LTQC 4YE4L 2G3NA 4PWJA 3VGBA 3NSJA 3N6YA 5KVGL 4OD2A 1A14H 3AADB 3IDMB 1JZ2A 5IJDC 2OSWA 2QVMA 4YDMA 5EF0A 3ZHNA 4LBEA 5J13B 4L5FL 3BKML 1GZQA 4EQ3A 2VDLH 2GC7C 5FO8A 2OR7A 4K8RH 5CCJA 5IB5B 3IGFA 4MDRA 4BXVA 4GG6B 4JE0A 4LP5A 4JREC 3BVWA 4QR7A 4TQ8A 4FI8A 1Y18A 2IDTA 3OPZL 3QDJB 5DRNA 4AVIA 2Y4SA 3TEYA 1I8LC 3BE1L 2KPWA 5ANHA 1DSFL 2E4TA 1UATA 3DRTA 3MRJA 4HSCX 4LEXL 5D2NA 3NTCL 2K70A 3WY3A 1CXIA 3BWAB 1ASOA 3MTRA 2FQEA 1BBDH 2J1XA 4PTTA 3FFCB 5TE4L 3GINA 4NAJA 1Z0MA 2IH1A 4F5CA 3ZOAA 3ZTDC 2HRHA 1W6WA 4IRSB 4N2OA 3IJEB 3B8SA 4O2CB 3HS8A 4PJHB 3S6CA 1U8IB 1WZAA 3ULVL 3FTUA 1R1CA 4M7KH 5LAPA 5ISZB 1NIFA 1CGYA 2XA8L 1XTLA 3OMIB 3P0VH 4TUKH 5IBUG 3GMLA 3V5HB 1CFNB 5DEGA 4ICXA 5GRWA 4PRPD 3VJ6A 5E1HB 1J8KA 4WV1A 1NOLA 4PUBL 1VFBB 4UOJA 1NCAH 2X6UA 3D85B 4FZ8L 4KQ0A 1CGSH 2HH0L 2R0ZL 3V0WH 2CNYA 3PIQB 5KSAA 5KW9L 1CL7L 3G5VB 4LSVL 5ITBH 1B0GB 4XMVA 4LNVA 2XWEA 3MLRH 1XSJA 2BVTA 1NCHA 2XUWA 5DHMC 4OFQA 4PJAE 5EU6E 4DSYA 1B4JL 2OK0H 3PCYA 3RNQB 2F5BL 2WWOA 4KVNL 3T0WA 1KZQA 4DOHB 5IJKA 4XC3H 2OMVA 4JZJA 3QQXA 4LCIL 4PJ7F 4J5VA 5ADOH 3RBGA 5KBLA 1DBAL 2QGCA 2E0PA 2XPGB 4X6DA 2BY2A 3BGFB 4APQA 3BQVA 3WS3B 2HVJA 3JV5A 3RPIB 4D7BA 4XBEL 3VRJB 1FCCA 2PYED 1P7QA 3KL5A 4JAMB 1E5CA 5ESVA 2J88H 2WKLA 4O5LL 4X4MA 4QRQB 1W72L 1RULH 4IOIA 4L4VD 1T80A 1GY1A 3MNZB 5MENE 4XMKL 3DIVA 3EHBC 3WTXA 2IG2H 3QPXH 1TQTA 1HINH 3R1GH 4Z7WE 4PLKD 5IHZB 5JW3L 3K8KA 2A9NH 4TQHA 1IRAY 3H9HA 3N04A 4NZ8A 1FNSH 4BCZA 1O7DE 2ZAGA 3J7HA 4WFHE 2EEFA 5KG9B 2ZXEB 1IJ9A 3ZRFC 1J1XH 2Q8AL 3NA9H 2LW3A 4P2RD 5F9OL 3SE3C 2LE9A 3L48A 3QXAA 3SPHA 1TOXA 4ANXA 5D7SH 2MHAB 1FL3B 2CH8A 2ZSVB 4M93C 3QWNA 4NI6A 2APSA 4PRNA 3C6LA 5LBSA 3EGDA 4O00A 1EH9A 1ITBB 3PHQA 4UQDA 2OAAA 5IG7B 2MKWA 1NGZB 5EU5B 5F7WC 4HXAH 4H26A 3BZDA 4DGVL 1NDGB 3A21A 1FDLH 4DO5A 5EWIH 1SOSA 2QSCH 2XXFA 1MAKA 4IW4C 3OMZA 3RWHB 2EYRB 4RWYH 3ULUE 1S7SA 5DYOA 2APWA 2DQCL 1DN0A 4KQ3L 3I2CL 3STZB 1YEEL 4JDEA 3OAUL 3PABB 3V7AE 2ZCKH 4E9TA 1G9NC 9PCYA 4UV4L 1M6OB 2O93L 2DQ6A 4GLRI 4NYLB 4S0TD 3T65B 4GI9A 2B4CH 4FYRA 1E5AA 1OEZW 4DO4A 2OXGB 3FB5A 1H8OA 4KZCA 4Z0XA 3CN2A 5I23A 3O9WA 4H2CA 1JNLL 4Y19B 1WFJA 2HG5B 2DQTL 5L9DL 1ADWA 2MPVA 4XP6H 1I3UA 2L7QA 4YC2B 3GHBL 1S3KH 3Q8BA 3VVVA 1BVNP 2OTUA 1S7UB 3MRPB 4CVZB 4Z78A 5I18L 2KLRA 2HKHL 3P3UA 4K3DH 3D08A 1N26A 5BRQA 1X7QB 4RMQA 4Y2OB 1YPZB 1L9SA 2O72A 1L9NA 1A6WH 2GCYA 4YHPB 4RX4A 4LPTA 4AZ8B 2YPKB 5DXWA 4Z3EA 4AQ8A 4CU7A 4KOBA 4FLQA 2XQYA 4GRWE 5A7EA 1U0QA 2W9DL 3G6JE 4GLRH 4ODTL 3S2CA 3ZUNC 5GGQL 4QTHB 4RFNC 5SWZB 1DANU 4WWKC 3ZMNA 3FFOA 1PD1A 1ZLSL 3L3OB 1HHJA 5A3IC 2RHEA 1NCWH 4A66A 1P0SE 5E7BA 1UB6A 3T3PB 3MR9B 3L3DA 5C0BB 5HYSA 1DFBH 2JCCF 2UZIL 3MQIA 4HIXH 1YUHA 2CHNA 3O8XC 2ATKB 4MJ5A 4ESKA 2UV3A 1E8XA 4UTCA 2HVKA 2P47B 4PYHA 3B9KA 5GGTL 4IOFD 2G2RB 1TCRA 4J3OC 4M3HA 4XMPL 3WEXB 4XOBA 3MNVA 3RAJH 2F15A 1RKRA 2QQQA 1WITA 4LHUD 2QSQA 3O2VL 3GPSA 2ADGB 4WK2B 2ZOTA 3HRPA 3UTZA 4HKJB 3O6FA 1YYCA 2TRYA 5F3BB 2MPAH 2WAHA 4LARL 4PRHB 4DN4H 1J8SA 2MJWA 1ZSDA 3BO8A 4JFWA 4KUZL 3F65A 4RESB 3VXME 1D5MB 2VR6A 1NL0L 4AJWA 3PHOB 3NFSH 1C7TA 1QSFE 1WAEA 1XZ0A 4EIUA 1HTYA 4PP1D 1UEYA 4LSPH 3GSUA 1YECH 1GGTA 3MN8A 4LCCA 4MXWH 4RFEB 4YQXL 1SEQH 4I77H 2AAAA 4FTVB 5KS9A 2J2ZB 1UXSB 4BKTC 1DQDH 3FT4A 4LDOB 3R7RA 3DX4A 4PB0H 4Y4FC 2FD6H 3THML 1KB5B 3Q8FA 4A2DA 4MZ3A 1M6UA 4KRLB 1HAUA 4JDZB 1Z9OA 1W0WA 2C7FA 4P4KB 2KZWA 3QS2A 1UM5H 3U9UA 4ODSH 3VXUD 1PCXA 5C08D 2P1YA 1H3TA 3DBSA 4JFEA 3CSBA 2AXFA 4Y9BA 1FVDA 3GFUA 3P0YH 3ARXA 1LYQA 3VXNB 4DAGH 4Z76B 5LGHL 4U0RC 1U8JA 4U49A 4L23A 5IVXF 5TDNB 3DTXB 2L7JA 1MNUH 4GXUN 3KPRD 2DAVA 2H47C 3A67L 5KSBF 3FBQA 1JFHA 1Q72L 2NNCA 3BVNB 3P4MA 3CFMA 4Y7MA 2B0SH 3O11A 1QBLH 3HS9A 1EO7A 1JPFA 1RVFL 2A83A 1R6VA 4I2XB 1D5IL 4WDIB 1OP5H 1FLRH 5IGXH 4Z3HA 8FABA 5G2NA 3SDAB 2W81C 2BNUA 4BQ8A 5DJYA 4TULH 3QJOA 1DCEA 1LD9A 1YYML 1IAMA 3LKNB 2VL5B 2Y6TE 4PBVC 1CMOA 3C5SA 1A65A 1UG9A 2FBJH 3QQNA 3VTMA 3D07A 4Z7NE 1CFBA 1NEZB 3OQ3B 3W82A 4ZPVB 3PFUA 2AITA 1ZKAA 4P59L 3PUUA 3GJFH 4AIOA 2OX5A 1SJMA 2Q6WB 2WANA 3VD2A 5LHDA 1S7QB 4XWOD 2OPCA 3UZVB 1ZE3H 4YSQA 2BS8A 4PJ5D 5EOQL 5I6XC 4KROC 1KELL 1OAQL 5TH2B 2I27N 5FB8A 2XZCH 3VX0A 4Z0BL 4ODHL 5FW6A 1QMUA 2DDQL 2Z35A 3HN5A 4ZFGL 5JYLA 3HC3H 4Y4KC 4WFED 1HOCB 4G71B 3O6KL 4PGCA 2ZWKA 2V9QA 4OGAC 3T09A 4EIZC 3LKRA 5DVKA 3BZ4A 1TR7A 5C0JA 4HW6A 2HN7A 3P30H 3BKYL 4LASH 4AIXA 4JQVA 2VMCA 4KO9A 4BSJA 2H1PH 3T2QA 3WNJA 3BD3A 1JD9A 1UB6B 3QP3A 2D31B 4WWOA 3SPCA 4PJEF 1ZHKB 5AB0A 1BD2B 2DI7A 3HG1B 2EKSB 2VXTL 3CHOA 5JDJA 2AQSA 2PW2A 3QJSB 4C56E 3LRHA 3CXDH 2QZQA 2AEIT 4Y2DB 4HPYL 2R69H 4YNYB 3UJJH 5C0RL 3GGWB 5LDUA 2LFEA 3CQQA 4Q9QH 4PRBA 1PKQE 5JHBA 2Y3NA 3BGMA 1EFXA 3FCSB 1VEOA 3K7UA 5IM7A 2Q0ZX 1NLBL 1AXTL 1X5ZA 1XF2B 3TP4A 1UWFA 1QNZL 4C47A 1MCOH 3LHAA 3BW9A 5EO9B 4ELME 1CI5A 2WTRA 2W91A 2ZPKL 2XN9A 3AU1B 1A8ZA 4RQQA 1O9VA 3TBTB 1XCTA 4BHUI 4KNQA 1UOVA 4Z7OF 1FZJA 4GQ9H 1CWVA 2R4SH 3FT2A 3MV11 1AC0A 5IF0B 1WAAA 4ANWA 5A2KH 1A7QL 1KN4L 4LT7A 4X6EA 3NDZE 4EI5D 5JMOC 4NCDA 2VC2H 2VH5H 1COBA 4M9OA 4G7SB 4H8QA 3KPLB 1K72A 1UCBH 1QQDB 1E4HA 4GEIA 2R8SH 3KLHC 5IBTH 4PJ8B 1OAJA 1HKFA 1NEUA 2CRYA 2BSDA 1MAJA 4M8RA 3U82B 3VFNB 1NAKH 5DS1A 5HYJA 2GSIB 3HIZA 3B7YA 2YQGA 1BZ9B 4JY5L 1SOQA 1EQWA 1M7IB 1QBAA 2KERA 3LIZL 4NNXA 5IFAL 2NR6A 3IFLH 4JX0A 3RIAF 4JO4L 5ID0A 3TBYB 5HHOA 5IBUB 3C75A 5BRZD 5FAAA 1Z5HA 3KL0A 5A3ID 3P4MB 3PNWA 3MGAA 2Z93B 3UJIH 1OM3L 4FXGB 4QHNA 1UD2A 3HFFA 5E8PA 5IFJB 5EF3A 4LB8A 2GEEA 1SUHA 3D18A 2VQ1B 3E1ZA 3KPMA 2WYHA 1A4KA 3O8XD 4HCRA 3X11A 5BV7H 4S2SB 1C5BH 4FFWD 2ID5A 4LAQL 3MJ8A 2ILLA 5INCA 3EOAA 4J3OD 3B2VL 4B27A 3ULSB 3SDXE 2VDNL 5E6RB 1ITCA 1UXMA 1FVCB 2WVSA 3QUZB 4I88A 4M3KB 5EO1A 4NN5C 5C0CB 4LLUA 1OGAE 3ARBB 5EU7E 2DM4A 3HG4A 1MFAL 2RJMA 4GSDH 3OD3A 3T0BA 2JKTM 5IVZA 5CN1A 5FO9B 4UB0H 3DX8B 3CZNA 3L5WB 3P3YA 4B41A 4NKMA 3CBKB 4DWHA 1S9YB 3MRMA 1K6QL 2X1OA 4OGXL 4PGEB 1KACB 4TLTA 3GRWL 4UQ2A 5D72H 1ZTXE 2IOIA 2YKLH 3KEHA 3D8MA 2LAGB 2X0VA 2BOBB 3H42H 3CDFA 1DZ0A 3EH5B 3L4ZA 1KTLA 5JIHA 3S4SG 1OAUL 2HT2C 4MSWA 4X8GA 4GH7B 4X9FA 1C9SA 4YIQA 1D6VH 4O9HL 4JN2B 1IM9A 5C6WH 4M56A 3HZKB 4XNMB 5C09E 1OP4A 3GJFB 5DMKB 2NSXA 2BRQA 3IK2A 5KSVB 4FQ2L 2IH9A 4Y4FD 1FAKT 3NSFA 2DLEA 3MOBH 3DJRA 5INDA 1MI5E 5I82A 5E1IA 5G55A 5E94B 1HEHC 4KO6A 4K5PA 1MHEA 4FXLA 4EJ1C 3Q6GL 4PYGA 2BSCA 2GY5A 2WLIA 3OX8A 3QW9A 2DYPB 2EJ1A 3UERA 4OZFH 1IBDA 4W9EC 5I0YA 2O5ZL 4K7PL 4JO1L 4DZBA 2XXCB 4YHZL 3KBHE 1BYNA 3C60C 1MCKA 3FN9A 1PZUB 3NQIA 4TQIA 2C1OA 2YA2A 3D9AL 4PJ7B 2IBBA 2BP8A 4XB3A 4BWWA 5IFHH 1OVZA 5GRVK 3GHEL 4K9EC 2FT8A 2Z8RA 4CKVX 4F58H 2JLPA 1MLBA 4UT9A 1FIGL 1I85A 3AY4A 5F6IB 4OV5A 4K71B 3JUZA 4I18B 3LZNA 4A6YL 1ETZB 4LFHG 3REVB 4EDWL 4L3CB 3MACH 1DVTA 3DOHA 2GJ6D 2ED8A 1MCSA 1DVZA 1E0OB 2D0HA 2P44B 4LSSL 2EIEA 5DGRA 3E6HA 5AZUA 2Z6FA 4N0FA 2FEEL 1QLEL 5HI3D 3E7JA 4G7VL 4JFYA 3TEZA 4KGJA 4KKNA 5I0DA 4QAWA 1DZBA 4R7XA 3U6XS 1AQKH 4HDIA 5L4JA 2F8XC 3RFRA 2AQ1A 2NNAB 4KROD 1F4YH 2ROYA 5EZIL 3RNKB 2FX8H 4PRIE 1OHQA 3ASWA 1T0MB 5SWQA 1OAYH 3GZOA 2QPDB 3QI9B 4G42B 4OFVA 4KKPA 3ZTNL 5CILL 3FNKA 3DX0A 2GITB 4NRYA 4AV5A 1IIIA 3LPOA 3OLDA 4NNXB 3P4LA 1OTUC 5ID0B 3HLKA 5J13C 1DBML 1TZOA 2N0KA 5C0DB 2BMKA 2VLKB 4HJJL 2OL3H 1FFNA 1JPST 4DJMA 4GQRA 2R83A 3PNWB 3ECVA 1OAXH 2OP4H 3ALWA 2VRQA 3MYJB 4X7CC 3FT9A 3JQOB 4A37A 1XH0A 3H0TB 2J1KA 1SRDA 2J5WA 4L0PB 4AZUA 3KPMB 3VYOA 1TVBA 1D5RA 5I1KL 4PJIE 3AZUA 5CBEA 1WCBA 5I1IH 4N2IA 4W9DC 3LHPH 5I5IA 1F3RB 3EYFB 5LN4A 5CEYA 3AUWB 1WUZA 5C0AB 3CFEA 3WL9A 4OZIA 3OAYK 4LRNH 4HIHB 1T20A 3M7FB 4Q0XH 1WBYA 4XP4H 1L9TA 4Z7QE 3SIKA 4IRSC 3C08H 3AREA 4PV1C 1WAPA 3QIUB 3A4EA 4GSRA 2FZ3B 1C16B 3DXAE 3FTGA 5ENWB 4AENB 2ADJA 5E2VH 1SJVA 4NKOA 4GAGL 3RKDC 2HXAA 5I6LA 3FTVA 5E5MB 5JOPE 1MRFL 1CCZA 4QHKJ 3UIZA 3ZKNC 5JHAA 1KTLB 3IE4A 3MNMA 3S8GB 1HJBC 5JW4M 3FYIB 4N28A 1JNNH 1SBSL 2NY3B 4KJYB 5FK9A 2HWZL 3W38A 2PCXA 3BE1H 1FZKA 4ANUA 3QFDB 1DVFA 1NWOA 3QUMB 4CBPA 1A9VA 2W07A 1R3JA 4LEXH 2X4NB 3TO4A 3NTCH 3ETBF 2WMPB 2W95A 2BK8A 3DBXA 2EDQA 3V79C 2EEBA 4K7PY 4R7DA 3WD5H 4TS6A 4MYWB 1F2QA 4PY7A 4H1LG 4YZFE 3VXQA 4ADJA 1OCOB 2NRDA 4L3ED 5F21B 1OF2A 4BCXA 4QJ4B 2UXFA 4HWBH 4IU3B 1AZRA 2YAMA 4XN4A 4WU5A 4Z3GA 1U3NA 2J43A 1MCJA 1E9QB 4HALA 4JG1L 3NCJL 4ZW3A 4M62H 2GT9A 3GDBA 4KK5C 1WSST 3AQZA 5T1DL 1LWHA 1NH6A 2DQJL 3OTTA 5AKVA 3VDBA 2FX7H 3ZE2F 2VXQA 4UV7H 3K1DA 1MW0A 3GXTA 3KGTA 2Q7YB 2PPDA 2YEZA 4QNPF 3BGFC 3P3RA 3LYRA 2L04A 5DJCB 1K3ZA 3M17B 4X50A 4QHUA 4UZUA 3KXFD 4U6HA 2Y6SC 3MLZH 4OZFB 4J1UB 1A1NB 4Y1AB 4G72B 1YMMB 4MNQB 3GUFA 1BZ7A 2P24B 1NCUA 3UTTA 1KB5L 3B1TA 3A0OA 4F20A 2DQHL 3P77B 4UT7L 4NXSA 2VZ1A 1SQ2N 2YBRB 5DHVH 3U4BL 4XB7A 3ATDA 1R3HA 3D06A 5IW6A 2X44D 5H35A 4W9LC 3V55A 1GYUA 1EJOL 5LGJA 4ZD3L 3TIEB 2C3VA 2E46A 2VISA 3D39D 2VZVA 1WEJL 2MQGA 3BLBA 3BUIA 3KWVA 5K9QG 4OJYA 1SOKA 2DQDL 3MRFB 5FOJA 5LBSL 5A1AA 3WIFA 3T8XB 1HSBB 1R34A 3BAEH 3UO1L 4Z3JA 1AQ8A 2APVA 3NJVA 1K4CA 2PTTB 4K3HA 2X89A 4GMTH 4NJAL 3O45A 1BJ8A 1NC4A 1QYGL 2VAJA 3C5JA 4BQ6A 5KWYC 2DIAA 3FB8B 3P4OA 3IXTB 1MWOA 3FL7A 5DA0B 4HOZA 5D7IA 2ZCLL 5C9JA 1DVYA 3N1GC 4PV9A 5EH1A 1GJWA 3VFUB 1KN2L 2CGRH 3E3QE 2VXUH 2G5BB 3KYNA 4CVUA 3A6BH 4NAQA 4DF9A 5F7UA 3EGXA 3FUDA 5H37G 4AMXA 3UTPE 3BUPA 5HHMD 5F8RC 4P2OD 3T0XA 2BPBA 2EH8H 4UMGA 1MVYA 1IGCH 2BVQB 4XMWA 5KSUB 2VL4A 4MMXA 5K59E 2CDEA 1KLUB 1HKLH 3C60D 5CHNB 1JV5A 3ZE0B 1IFHL 1BYPA 4TQEL 3Q5YA 2NLJA 3MMEA 3QIBB 3OXSB 4M8VA 1E8ZA 1TPXB 4I0KA 2OL3B 4WEUD 1U9KA 4K8RC 5IQ7L 4FG0A 5TE7L 3MOAL 2EC9T 3X3FL 1HHIB 4QAMB 1PLGL 4GAJL 5B21A 2TAAA 4ETYA 1I1YA 4RWHA 4WI3A 4ZZFA 1NIBA 3MUGA 4JFFE 1A7BA 2PN5A 1XEDA 3ARFA 3EDEA 4YC2C 4MNGA 2ZWZA 5D6DA 3HHMA 1CGTA 5AVQB 3RWJA 5CAYB 5FKPA 5DDHB 2OSLA 4QWWC 3WXWH 2XYCA 3QO1A 1A7PH 4NBYB 4BZYA 3HJ0A 4MAYA 1KYAA 3KPOA 2WHVA 2F0CA 3NJHA 4ZQKB 1LK2B 3SKOB 4U1NB 2YUZA 3QJFA 2BNRD 4GW1A 4KQ3H 4L4VE 4WEMB 1DLFL 2ZUWA 2HZHA 3OAUH 1D5BA 4FQLL 3M88A 4U1LA 5D4JA 1Q90A 1GS8A 4J3SA 3S36X 4ZDHA 5EU3B 2BDNL 3FQUA 5EEVA 1OOAA 3F6LA 4Y5XB 2P5WA 3BT2H 4FNQA 2F54E 4XT1C 1X7TA 3BPNB 1NMAH 5HYQB 3GLZA 3L3OC 5E8OB 4JDTH 4NZTL 1JOIA 2W60A 4XNYL 2BCKB 5FYJL 5HDLA 3RB7A 4FF9A 1G7QA 4A2MA 1KBGL 4U6YB 1Z9NA 4YXKL 1R24A 1U8PB 1BFVL 2LU4A 3VD0A 1PQZB 1OTUD 4FQCH 4KU1A 5DO2C 3FQXB 3QR2A 4HLJA 1UVQA 1TSHA 2YA0A 1CG9A 3EBGA 3UYRH 5BJTA 2N7SA 3FSVA 4RMBA 4GW5B 4DTGH 1IGJB 3F2LA 1DBKH 4X6BB 2VUYA 1P4LA 3VFTA 3QDJD 2JKIS 3IPEA 2BSRB 4QRRA 2WLMA 3MV8B 4WW2A 4KNUA 1G7JA 2ERJB 4MA7H 1JGDA 1BZ7B 3CH1B 4BK5A 2PPFA 2QELA 3CVHA 3L4CA 4HV8B 4Z7OB 3K6SA 1DEEA 2JKJA 2E6QA 3U9PL 3VSTA 1T0NA 3RY6A 3FFCD 43C9A 3FU9A 1F56A 2NY7L 2BW4A 3QNYA 4LCWB 1CDYA 1MAML 3OVUB 4IRSD 2ZXWB 1HOEA 1ZXKA 2FYYB 4PBXA 5EIVA 3KPSA 2APTA 3NRQA 5ISZD 3RKDD 4ZAKA 4JGMA 2VZTA 4CC1A 4X4YB 3S2AA 3WIFB 2X87A 5I74B 2H3NA 2YHGA 4ZK8A 1M3IA 4P4KC 3ZIYA 4TVUA 1OGPA 1HIML 4C4BA 4LSQL 2WNGA 3U1PA 4QRSB 5HY9B 4WUKL 2HTLC 3WJJC 1ZGLA 2QHRH 5DS8B 2P3YA 3D85D 4YO0B 4KUZH 2AEWA 4KRPD 5KUMA 3UABA 1FE8H 2RA1A 1QFPA 2FH8A 4TRPL 4PSRA 5JLZA 4PB9H 1IBBA 2JF1A 4GAFB 2RBLA 4QY8B 1BQLL 4UT6A 3WEAA 4FGMA 2BIIA 4YQXH 5J5EA 1BXXA 1MCWM 3QNZA 5EA0H 2A38A 1J8HA 3L95A 1JPTL 4XXWA 4ORGB 3BN3B 1R33A 3EH4B 3SDAC 4LXFA 3RFZA 1ZT4B 2R2EA 3QUGA 3THMH 2IADB 4KQ4L 2QTEA 1ZOXA 4TL5A 4M7LH 3QZOA 3KJ4B 2V2TA 3O0RL 1QVOA 4X9IA 3U79A 4LQFH 1SXSA 2HRPH 2IBGA 2Q20A 1QWNA 1KCSL 1XR8B 3GIVA 4OJFH 4XBGB 2E7LA 3QISA 3EYQC 3WKQA 4F37F 4NQCB 3US9A 1YQVH 2DWTA 1ZS8B 4KKCC 4PVMA 4JY4A 3MXVH 5FYKU 3X1EA 3ZTJG 1GJIA 2Y6SD 2ZCZA 1LXMA 5A2JH 2VZSA 3QCVH 4KXZI 3CVIH 1Q72H 3TNMB 1Z3GH 4S0HA 2BHZA 3GEWB 2NX5A 4RFOL 1AFVL 2IANA 2G9HA 1EA9C 1H8NA 5D2LE 3ZMEA 4CGUB 5D1XB 2H45A 3R8QA 1DBBH 3T8VA 2BP5M 2JFCA 3CZLA 3KPOB 1C1EH 4F33A 2NXZB 5CJXA 1GS7A 1A6UL 12E8H 4JO8A 4YPGB 1ID5I 1TJMA 1XR9B 4I3SH 1K3IA 3EFDL 2FGZA 4NQSA 3UJTH 3ZHDA 1D9KD 1UA7A 2BM3A 1U95A 2Y23A 2VOTA 2J1ZA 3GSNA 4LMQI 5BZZA 5M95B 1JYWA 3POCA 2AJVH 2BRRH 5DD1L 4R7LA 3MLSL 4H44C 4AYBA 5ADPL 4KXZH 1JL8A 3L3HB 3SDCB 1GZHA 1VZHA 4ODBD 1UQSB 1WTLA 2MTPA 5EOQH 4NOBA 3SBWA 4WI6A 1UWGH 1BYOA 2YPVL 5H37H 3VXUE 5ID1A 4KY1L 5F2FA 2EECA 2F68X 4Y2DC 3RVWC 4DFHA 3HC0A 4OVVA 1R5IB 4UM9B 4AQAB 3CH8A 3B56A 4TOYH 2H41A 1E5ZA 2DJSA 3G04A 4ZS7L 3DUUA 4L29A 4X0KB 4IRZH 5DVOA 3EGSB 3DSFL 2DYRB 3ZRCC 2TSBA 2PABA 2PR4L 3IXAA 4K2UH 1CE6B 1USQA 1WZLA 1I9IH 3NP4A 3ARTA 3ELAT 3SDYL 4UTAA 5IQNA 3CBJB 2X4TB 3SHSA 3NAAL 1E27B 1Q1JL 2ZE0A 3MV7B 4CN4A 1A4BA 4KKAD 1QBML 3LEVH 4LIQL 5GS1A 2X4OA 3LH9A 2VXTH 1IEAA 1RQ5A 1XWVA 3IPBA 4Y19D 1UD3A 4ISVB 4KTEH 4B5EA 5DJ0B 3IS0X 1TSRA 5J1AB 4LOVA 3LS5H 5J7CC 2QJDA 1HYSC 4QWWD 2MIZA 2IO5A 2DQGL 2Z31A 5DJ8A 3FTXA 1B0WA 1KBWA 2GTQA 1NKOA 4JJOA 4Y7OC 1NLBH 4OF6A 3NCEB 3D69B 3K80A 4PJ8C 3ILQC 2YKKA 1LEGB 3AAZA 1GHFL 4XOAA 2OV0A 4BD4A 4IK6A 4PV8B 5GRYA 4HVBA 2FLBT 4H25A 4LBAA 4PN6A 1NMCB 3VH8A 2DLGA 4N0UE 4HPOL 1WQVT 5KSAD 3G5ZA 3F7YA 5C7XL 5EUKA 4P07A 1T6WA 2O30A 4LL4A 2NY5L 4W6XB 1SDDA 2CIIB 4QLRA 4WFEE 3IJHB 2OMXA 2X38A 4FXGC 2YN5A 5C0BD 2E27H 1FNGA 1JV2B 1W6LA 2RQEA 5IB2B 3VWJB 5DO2D 3RU8H 3B7UX 2CLVA 3CZGA 1ZHNB 3VQ1C 5IMKA 2C4FU 4NUGL 4X2UA 4AC2A 3LD8B 4HJGB 4XH2B 4WUUE 5DQDH 4ZNCD 3JVFC 3QUZC 2X2JA 2WB7A 3F5WB 2DLFH 3E9UA 1DL7L 1T2XA 3ARBC 3FMGH 3NIDF 3BI9X 4JY5H 1YDPB 2AHIA 1A0QL 3LZQA 2JKWA 4AXWB 4M1CC 1P7QD 2DKUA 4HK0B 3RDTB 2CPUA 1AYRA 3IGAB 5DTFA 1NGYB 1NANI 4LSUL 4HUXA 4LOUC 3DDFA 2I85A 3QUML 1RUAL 4LCYB 1CTNA 4RDBA 1N10A 5KVGE 5E4AA 4IOSD 2EC8A 3TIDA 3VGFA 4XNBA 1S8DB 4F7MB 3DX1A 5J6GB 1JERA 1URLA 2BZDA 3QHTC 1JGEA 5AYQA 4JQXA 1YEGH 4FTVD 2IPTH 5AW3B 1QWHA 4HQQL 1UJ3A 1QP1A 3P0GB 4BFEA 3GS0A 3SE4C 4QRBA 9CGTA 1U2HA 1YVLA 2CJUL 4HUUB 3WFHA 4AJVA 4XZUA 2OSXA 2XBDA 2BCMA 5LO7A 3CC5A 3GLDA 4G2AA 2XBZA 3MYZA 4KK9C 4HIJB 5CSBA 1XQ4A 3O3DB 5DMGD 1H19A 4CSTA 2CJSA 3OKEA 4I1NB 1HDMA 2HTLD 1OP3H 2D7NA 3AITA 2OJEA 1ET5A 1NANH 2X4RA 3GI8L 4JB9H 4UT9L 4HJEA 5GGRB 5IT2H 1ZT7A 5LBVA 1A3LL 4OGZA 3RQ3A 3VWKB 4JCMA 3UCQA 1ILUA 1DUZB 4HCFA 2X4SA 1FAIL 1R3IL 3C9NB 5I6PA 3BH9B 1Z7JA 3MX0A 3ULVE 4Y9FA 4OI8A 3QEUB 2J72A 3ILPA 2FYVA 1A6AB 1SEBB 3DUUB 3L7EA 4P9HH 4PEEA 4X4KA 5F0MB 3SDAD 3SYAA 3PV6B 2IAMA 4AEIH 1MJJB 2HUHA 4I18C 4K71C 2ITFA 5DQJA 2DL2A 3LQZA 1CTMA 2VITA 2ESVB 1FGVH 4N9GA 1MFDH 2PCYA 1SYVB 5FCSH 3QXUA 5DK3A 3ZTJH 4DP1X 2QKSA 3T0EA 5ESAB 4XPBL 1KPRB 1IZKA 1VADA 5GS1B 3VI3F 5F9JB 2XVBA 5E1AA 1LP9A 5E6IB 4HAGA 5BW7C 3KBEA 4ZO7A 3O9WD 5C6TL 4FI6A 4UQAA 1XGUB 1Y0LB 3DK0A 5TF1L 5DC2A 5B3NA 3UC0H 2GPZA 2OJZL 2JTYA 4N2HA 1AOZA 1JPGB 1N6VA 3S5YA 2HAZA 3NT0A 1FHGA 3QI9C 4MQ7B 1WK0A 5DUBA 2CO2A 3TBWB 5L8KB 1T2QL 3DETD 3LIUA 3APCA 4MJIB 4RX4D 3I6LD 2H0FA 4XPTL 5EC1A 3NN8B 4RDQF 4ZYKA 1KJ2B 3JV4B 3ROOA 3VFOB 1KCVL 1NUDA 2WUBL 3QO0B 4LF3A 4CU8A 4HS8L 2LT9A 2JV6A 2UWEE 5D5ME 1QUNB 1X5GA 2H0JA 1QLEH 4H5SA 2XQYG 3I6KB 3TT1H 3O3BB 4JFTA 3T0DA 1U58B 1AXIB 3K4DA 4FNPA 1CQYA 1GC1L 5DJXB 2ADFH 1ACZA 1BD2D 4KK6C 1M1XB 4QI3A 2HJLB 5HYSG 5E9DA 2P49B 1FZOA 1MREL 4Y2DD 4GRLB 5F9DC 3RVWD 2BC4A 2ZXBA 2Q2EB 1Q0XL 2V9TA 1NM9A 2NY5C 2FSEA 2YFNA 2YS4A 3CN3A 5JTWA 5FGCB 1D5XB 5FYJD 4O58L 5CILH 3PL6B 4JRYA 3V6FB 3AUVA 4MDIB 3VD3A 2UY6B 5ACMA 4ZZKA 2Y7LA 5BO0D 2RD0A 5MHSD 1JK9A 1XO8A 4AKQA 4ABWA 1UT1A 3QIUC 3C6SA 1E7UA 3W0WA 1MCPL 3KH4A 1M56B 5D1QB 1WZMA 1NICA 1JZDC 4FXKB 3HLAB 4UIMB 4M7ZB 3RUGA 5LQBL 5I1KH 2NY3C 3F7PC 4GIOA 3IMUA 5DHXB 4UTBL 1YYLH 4DVRL 3U1SL 4XO5A 1A47A 2VWEC 2ZZUT 1JVLA 3ZDZF 5FV2A 1CXFA 5EOCJ 4P3DA 5ICZA 3S5ZA 4IU2B 3AMLA 2ZSWB 4PJ8D 1MHCB 3ILQD 5BMFL 4QXGL 1JPEA 1RZ7L 2FK9A 3GEFA 2F53B 2JXMA 2VDMB 2VXQL 3OKEB 3QUYB 4YDKH 3B4NA 4CN6A 1ZAGA 1BG9A 3ZY7A 4EDXA 4G1EA 1HEZA 1PEWA 4L4TB 4N2CA 5E9NA 2VXSL 4DUVA 5B22A 5JPNA 3DIFB 2F8VA 2YRLA 1U8CB 5DC0A 5CO1A 5DZAA 5F93C 5F7BA 1JUFB 3B7TA 4UQ3A 5EU4A 4A7GF 5J6HA 4U2YA 4UM8A 4E9LA 1HYRC 2EYSA 4XWGH 1WPCA 1E5YA 5C07E 4M5YH 1B2YA 5CGBA 1OIOA 3AROA 2J44A 1F4WL 5I1JL 2WLJA 4TUUA 2Z8WC 2YSSA 1NOFA 3F05A 3MNWB 3J07A 1FNFA 2D0GA 3P4NA 3T0EB 5DHDA 3VW3L 3ARBD 3TWCH 5F71A 1M4KA 1W0VB 2CNZA 2BXYA 3KD4A 5C0GB 2YUWA 4M1CD 3HG0A 4TSCH 1S7WB 1PTZA 5CGYC 1TU2A 3FU6A 5T5NF 4NUJB 1KTDA 4LOUD 4MMZA 5K9KB 4X5WA 1D5ZB 1U36A 3PY9A 1TQBB 3UGXA 5D7JA 2AS5M 4R2GB 1EGJA 4U1JA 1R5VA 2X12A 4R90L 1CVRA 1O9ZA 1U8NA 3DV4B 1H3WM 1M9WA 4I9XA 3TJPA 1ED3A 4JFDA 3JV0A 2NQ3A 3GMNB 3WIHL 4JFZH 1TJIH 3IMSA 1AGBA 4FFVD 3QHZL 4NFDA 3U4EB 5AYUL 1I7RA 2DM7A 4KK9D 2VQ4A 1ECYA 4JVWA 3BP5B 3EJYC 2M83A 1SHWA 3U6XA 4H20H 4AQ1B 4MLIA 3LTVA 4XCCH 5DD5H 3P2TA 5I1AA 4QGYA 3NIGE 4PLOB 2X7LB 5D7LA 1Q9WA 4UILL 1JBJA 4PCSA 1K2DA 1RZFH 1CICB 2YMXH 3LXCA 5LBSH 2OYMA 4HZLB 5IJCC 1R3KA 5I17A 4XVOA 4L3EE 1FJ1A 1FZOB 2VLRB 4NQEB 3BIAX 3QUKB 1CJYA 2CRIA 1A6ZA 1JVOA 5E6ZA 1P53A 1T0PB 4UNIA 3QIBC 1IT9L 1FRGL 4JN1H 1TPXC 3IJYA 1UGNA 4EEEA 3FTSA 3DYPA 4M6ML 4KXAA 1OPGL 3L9BA 1IBZA 3V4PB 4RCAA 3KNBB 1RUKH 3QZWA 1KB9J 4AIEA 1X5YA 4R3SA 1MFCH 4JM4L 3KYOA 4LLMA 3A47A 4TM9A 2NSQA 1TQWA 4HS3B 5I8OL 5GHWH 1KTRL 2VDKL 3UTSA 5AAMA 1Y6NR 2PNDA 3BMWA 3KXFE 3LN5A 1J5HA 3UAEA 1XIWB 3L54A 4QT5B 1HQ4A 1KLFA 2AJSH 2X6CA 4PJCF 3FPYA 4WENB 1T3FB 2C3HA 2WBJB 4R5TA 1WYJA 1KC5H 3I50H 4Q7DA 4OFYA 1AR2A 3EDFA 5EFIA 2N1KA 3UBHA 1S5IL 1ZV9A 1ZWIA 2A6IA 2IDQA 4Y5XC 3QI9D 5ETUA 3UBXI 5IQ7H 5IW1A 3BPNC 3K2UL 3RDJA 1ACYL 3DV6A 1TZ8A 3AG3B 2BNQB 3D39E 2VAAA 2OZNA 3G3LA 1O7VA 3QDGB 3LRMA 4IHBA 1I7TA 2P80A 1NBYB 5C71A 3IU4L 1IGTB 1OM9A 3MBEB 1UEMA 2X88A 1AP2A 4QHLB 2GBUA 4RZCB 3GSRB 1ZLVK 3QUXA 4GAYB 2L3BA 4P5TB 3AS1A 2EIJB 3CLEH 2VLKD 4M1DH 4M00A 4XX5A 2ENSA 1DQTA 3IJSA 4HJIA 2OMYA 5CNHA 1TTFA 4F15B 4G70B 3I9GH 4UIKH 1XF4A 5FV1L 3JWOH 3OXRA 4NM4L 4FQ1L 2JQZA 3CVHL 3NACL 3IJ9A 4TTGA 4UQ3B 4KK6D 5TFSH 2VN3A 1RFDH 1E4XH 1N5YL 7FABH 2FL5B 4Z95H 3IAGC 2RMNA 4YL4A 2BDNH 4TF4A 2FATH 1HL4A 2GI7A 2ERJC 1IKFL 1KB9K 4GO6B 3KCWA 4WJ5A 1HE8A 3QS3A 4J2XA 5CJQH 3SO3C 3JWNC 5DWUH 1CT8A 3FT3B 3BUBA 5C0AD 5LWYH 2OJ1A 1KBGH 4E9RA 5IESL 5FM5O 4Y5YB 3MAWA 3HMXL 3QE5A 3O2DA 4HBQA 3X1GA 4X5WB 4RMRA 2BX5A 3WENA 5BZDB 1KMGA 1LHZA 4N3TA 4N4YB 3D0AA 1RLBA 5I74C 1INEH 1PDKA 4I9WE 1GR7A 3S3PA 3Q06A 4M4RB 5JR1L 3VXSB 1ZJBA 2HUEA 4WW1B 2D2OA 3V6ZA 1L3WA 4YDZA 3D51A 1PGRB 3HNSH 1MVUB 1BZQK 1U92B 2HFGL 5H2BB 3W3BA 1PLCA 1I3RB 1IAKB 3V0FA 4Z7AA 5DO8A 3V5DB 3MJ7B 1T7VA 2GQHA 4D0DB 1AIFB 3S36L 1H6UA 4GYBA 4TV3A 3MGOA 1JXDA 5FF6A 1WH0A 2BNRE 2J56A 1T4KA 3E8VA 2E56A 3V4VA 1FBIH 3QB7C 5IHHA 2PPEA 1BFOB 1S78C 3CZSA 3NEOA 2DM2A 4MVBD 3VDCA 1SM3L 1M7XA 2P8LA 4I13B 1W8EA 4NC1E 5GQBA 3US1A 1KBKA 1RZJH 2B59A 4Q58C 4ZO8A 5D71L 2XWTA 5JO5A 2YGVA 1FJ1B 3KJ4C 4X7SH 4BEIA 1DVUA 1Z0NA 3QJQB 1WWCA 1HIMH 4FL4B 5ECJE 2GSGB 4LRIA 4WUKH 3WE6B 2BVUA 1FL5B 4FFYH 4I8DA 2R7EA 3B1UA 4NO0B 3NIDB 4A2LA 2O5XH 3RGVA 4YMPA 3N40F 1CR9H 2EDEA 4Y1AD 3FN3A 2YR3A 1YMMD 4MNQD 1QSEE 3QG7H 4D9QD 4N0YH 4NHCL 5AKRA 1RJLA 1EK3A 4FE9A 4P5RA 4Y88A 3WDJA 3QC6X 2ZQKA 3V0HA 5I16B 1CBVH 5D1XC 3KPNA 2YGQA 3EFFB 3LRSA 4P06A 1UWEL 4PJAA 4F9LA 3UPRA 5F7FA 5CGYD 2NXZC 5CEZH 5CSZB 1J87A 5D7EA 4B9IA 4DVBA 3DNKA 1VFMA 3V6OC 1G4RA 2DIEA 4A55A 5L7XL 3DO7B 3CX5J 4F2MA 1BPLB 2H2PC 1IM3A 4W9KC 3TA4D 1W80A 4YHIB 15C8L 2AGJL 3CUPB 4GSUA 1VCAA 5C3IA 1I1RA 5JZ7D 1TTAA 1AGCB 4UQIM 4ZMVA 5ISZE 2HMIC 5C0ND 3RY5A 3SDCC 2DBLL 1TTGA 5I2IA 5MP6L 2MQ0A 5KZCB 3QRBA 5F70A 2IWGA 5AD0A 4UU9A 3HNTL 1JZ4A 4G83A 1RSFA 2YARA 3EJYD 4L9DA 3BP4A 4QF1A 2RCSH 4UTAL 1ICTA 1BQSA 1N0LA 3EYSL 2QVKA 4KXCA 4YFDB 3WN5A 3C12A 1RP9A 2YWYA 3LEYL 4L37A 1HXMA 3D52A 4FI7A 1TQSA 1J9RA 1LE9A 3U2SA 1VACA 1OAZL 1E8YA 2ZWYA 5L4MA 1U41A 3TV3H 4N22A 3VSQA 3W5MA 4JPIA 2YAOA 4D7PA 5DD1H 3QIBD 4A2HA 3MRGA 1LDPL 2VUOA 5ADPH 1FNEA 3NZHL 3OKNB 4DOHE 1V5JA 3VI3B 3P40A 4ABQA 3BXNB 2FWSA 4X9BA 4KY1H 3DURB 4MS8C 1JXJA 3ARED 3DC0A 4WGWB 2AI0L 5EIQA 5EPMB 5KYUB 1KJ2L 3SE9H 4BH8A 3UBXB 3D2UB 4Q6IA 5CKAA 5CZXD 5T1KB 3TEWA 2F19H 5GGSB 5IROC 2BIHA 4YAQA 2D3NA 3CX5K 4NZRH 4OCNC 3EG9A 5TDPB 4S1SH 4NP4H 4XBPA 1JF1B 1RHFA 1DQLH 2H26A 3BUTA 3CSYB 1MJ7H 1ZA3B 3O3UN 1V3JA 3AWGA 2QQKL 4AIZA 5IMLB 2EH7H 1J5DA 4O4YH 4KXBA 2GJJA 4N6RA 1QFUL 1NMCC 4GS7B 3TCXA 2CA3A 1DUYA 2V17H 2QVTA 3IM1A 4S1DC 2DTMH 2ARJB 3MGOB 3MSPA 5SV3A 5JXED 2E6JA 3T2PA 1HQRB 4EZKA 3TN0A 3NJFA 3Q3GA 3VWJC 3TWYA 4KHXH 5C2UB 1ZV2A 3OWRA 4GY4A 3L9EA 4PJGF 4PMEA 3LD8C 2AXWA 5C8JA 3GTNA 5AW5B 2IQAA 1A7RH 2ATPA 1MPAL 2AMUA 5K1NA 4M7LT 3CFKB 2CLRA 4BINA 5BOJA 5HGBA 3SJVB 4OB5L 2O61A 1IX2A 2GBTA 1BFSA 2XLLA 2LHAA 4EI6A 5L0QC 4HCRH 2UVFA 3GTVA 3RDTC 4XGZB 5JQ6H 2I24N 3L13A 5D1ZA 2PO6B 4HKBB 1PY4A 1C5DB 5E24E 4FCAA 5AB1A 6FABH 1HFUA 35C8H 2X4QA 4WFFD 2DBJA 3UCRA 5GGRY 1SUJA 1TQUA 4IMKA 1MFMA 1BOGB 3O3EA 4OUOA 1GVIA 5F44A 3PWNA 2VDML 3BAJA 4LCWD 5D8JL 5E8EB 5D2NE 5JNYA 4PJBF 4R4BB 4P57A 1AE6L 4GKNA 4ECNA 1FWXA 2CD0A 1EIBA 5J9PB 4HC1H 4E9QA 1NC2A 2AEQL 1DVXA 4F5CE 5ITFA 2OCJA 1WVZA 3DX7B 4XNUL 2WVTA 1VB9A 4Y19E 1J10A 3UTOA 3UZEA 3FH8A 2FCBA 3T6ZA 5JHLL 1KSRA 4OIAA 4P23B 5DC4B 3UXFA 3P9WB 4W9HC 1MRDL 2G4EA 4U1MB 4AE1A 1MW3A 4QHMB 1I8IA 3KJ6H 4FQXA 4OCWH 4AM0Q 4F7TA 4XCFL 5HYEA 4LPXA 4AEEA 5FO2A 4X8XA 3VWKC 4CMMB 5DVMA 3MLYL 5CWSB 1E42A 2Z92A 4W6YB 2IJ0C 5CBAA 4OLXL 4ZSOB 4LZKA 5FX3A 3LRLA 5B3JF 3M8OH 3RIFK 1S78D 2EDWA 2IH3B 2V2WA 2Z4TA 1L7IH 4QRPA 5IBLC 1K5WA 4YFLF 4DW2H 3Q2LA 4LVHB 5ANMA 1I82A 5GS0H 1E5BA 3NFPA 4DEPB 4F57L 2R29H 3E0GA 4PTUB 4YVNA 3W9EA 5D70L 1KJ3L 3MV9B 2WLLA 1F90L 1RMFH 1EJ6A 2CJ3A 5K9OA 4UWQB 1MCDA 5HD8C 1K8IA 2J57A 4FQPA 2JWYA 4R5XA 2ZKYA 4Y9CA 2YIHA 4LSRL 5FUCE 1T7WA 1YEKL 1G5GA 3GMPB 5E6IC 4YSEA 4BYHA 4CSZA 4URTB 2ODHA 3FQRB 5BS0B 3UDWC 2CDGB 3RWFA 1X5KA 3WNNA 4JFQB 4X6DE 1R3IH 1E50A 2EDMA 3NCBB 4RMWA 4QCIB 3WKPA 4OF5A 4WRLA 5C0EA 3GK8H 2MCPL 4X98B 4L3FA 4X4ME 1EMTL 2NXZD 1R17A 3QSKB 4X80H 2PPAA 3L9RA 5DMYA 2Y69B 1AXSB 1Z1WA 3SGKA 4N6RB 3GDCA 3O6LH 1DHKA 2H2PD 1E28A 3WKYA 4IIQB 2D3LA 1P6FA 3IETA 1CDJA 1LJMA 3QHFL 1FO0H 3LS4L 1MUJB 4PW3A 3WUZA 2XWXA 3SSGA 4KFMA 1D2OA 1N59B 1U6AL 3L3JA 3TPUA 2HMID 3SDCD 3TEUA 4YHKL 3PJSB 2B3IA 4HX1B 4HKZB 5JW5A 1B6DA 5CEXA 4WWID 2VIRA 4N8UA 1N8ZA 3DRQB 4GRLC 3Q2NA 3R0NA 3U7WL 3T04D 1GGUA 4MD0A 1NFKA 1T2QH 3PL6C 2N56A 1ZTMA 3VG9B 4XNXH 3V4LA 3ARUA 3JZ7A 3R18A 2WUBH 1IQWL 1TYRA 5I0XA 1VERA 1G43A 5CGTA 5H4YA 4G6KH 2TSAA 2WINA 4DZ8B 1AGDA 1BGXH 2BIPA 3MV7D 5D1QC 1KGCD 4FXKC 4K15A 4LEOA 3DMMA 5DD0H 1S7RA 2DICA 5AZ2L 3FSZA 2NUTA 3NRPA 4FFZA 4HAKA 4PJCB 4M7ZC 2OQJB 3FRUB 3UAAA 4XMLH 4EAEA 4U6TA 1ZANL 4NJ9L 1KV3A 1QRNA 2DQIL 4GI6A 4NNYB 3GM8A 3RWCA 1G6RA 2FJGA 4ZAKD 4XP5L 1HH6A 2OR9H 2CPCA 4GO9A 4NZJA 1U8MA 1GYCA 2ZXDA 1N3NA 4JKLA 2FLMA 2VR5A 2C3GA 1T5XA 3KL3A 3NK3A 3JYCA 3QUYC 4XCNB 3LQMA 2BIOA 1KBPA 3S96A 3QEGL 4OZHF 2PCPB 1F6AB 1MIMH 1V10A 3S34L 4ELMA 3DGGA 2ODIA 3TESA 2VB5A 5HJ3A 4Q4IA 4S1DD 1KULA 5IJVB 3FQWA 3ROLA 2A6KA 3TFKC 3G7TA 1ULVA 1HH9A 1R19A 5CGMA 1U91B 2R51A 5GS2D 1F4XH 4E68A 2XV2A 4B9ZA 3WSQL 4Z23A 3OAYH 1RIHH 3VWJD 4P5KB 3FO1A 1CDIA 3Q8CA 4MQXC 3RGBA 4N26A 2MTAA 3VFGL 2EXWC 3LN9A 4FG4A 3IDNA 2WLLB 2WWMC 1XF3B 5A2FA 5BMFH 3RP1A 4TUOB 2AK4B 4AV0A 1A4JA 2KKQA 1XFPA 4LHQB 5FA4B 5HHVH 1BEYL 2B1AL 4NWTL 2DW5A 3FO2B 3ZDWA 4MA8L 1SYSB 5GISL 1N2RB 2A3TA 4Q74A 5FYJE 3KLQA 5TDOA 4N1HB 4JG0L 5TPWH 5JXAH 1NCCL 3GPEA 1TQBC 2NX5D 3QG6B 5CFHA 5HJBA 3MHZA 3EO1B 4U6XA 1RZKC 2XKNA 5MHSE 4R7NB 1D6EB 4HXBH 3SCMA 1PD6A 3GRBA 3HUJA 3R8BB 3P11H 2A74C 4R2GC 3LN4A 5KVEL 5DUML 3VACA 1T22B 4F7CA 4ZODA 3HOGA 4MXVF 4OAWB 5CMAB 5DLML 4NS0A 4OD1H 1RXLA 2HKFH 3QPQC 3OKKA 2YAPA 3UP1A 4YSSA 1EJ8A 1UUNA 1KIUB 2AJXH 2COQA 2ZICA 3QWOA 4NQVB 3SDXA 1EBPA 5KS9E 2QDWA 3B7RL 3KE0A 1UKTA 3CVCA 4AQ1C 2R23A 4CU6A 4OF0A 5MEQB 1YAZA 5EOCL 3MODL 3Q44A 5TGBA 1LTXA 3RL2A 5IZ7A 1CICC 1DVSA 2G60L 2R2BA 3CZFA 4BH7B 5PCYA 3GB7A 4LP4A 2I26N 3EDKA 4QTIL 25C8H 2VR9A 1CD0A 2JNZA 3NJJA 4ODWB 3TYFA 2ZIDA 3QARA 1FO0B 2A9ML 3DROA 1Q4NX 4R90H 1DE4A 2R2HB 4EKJA 5I5RA 5L6YH 5FUOH 1ZVNA 4GI8A 1HWGB 4X9YA 4YSDA 4YFLI 3PQYB 3QNXB 2BSEA 3ME0A 1CYGA 2ESVD 3BQUB 2CUAA 4FLOA 3EFOB 1HHHB 1IGYB 2X70A 2CM6A 2E74C 2IV9A 2YC1A 4IBSA 4ZG1A 3BZEA 3VXPB 4MYPA 5HD8D 4JFSA 4G9DB 2CO1A 2P7TA 1TQCB 4TN9A 4LCUA 3HR5B 4R4FL 5K9JH 4NEHB 4LLVA 1XIWC 2F8OA 3HRZB 5E6ID 4EMZA 4M5ZL 3OF6A 2WBJC 4MNHB 4PCYA 5C0FB 1HU8A 3W57A 2CO6A 1UXWB 2BOCB 3QORB 2GK2A 3I6GA 2PWHA 2W38A 1MQKL 2ICEA 1L7TL 1GAFH 5IREA 2MCG1 4NM8L 4XBMA 3SQOL 3M7OA 2EDXA 2SEBA 5EF2A 1XH3A 3MA7A 5DR5L 1H3VA 1EVUA 2YXWA 1QPPA 5DZNA 3AW5A 4WLCA 4MJID 4WNQB 3EOBB 2WM0A 4YHLH 3MBEC 4JCWA 1AD9A 1OSZB 4P5TC 3Q6FA 3SE8H 2O6EA 5HJ3B 2A1WH 2A9AA 2ROXA 1NTDA 3F12A 4KI5D 2AJZA 1CUOA 1ET7A 1SMOA 3PAVA 1IU1A 3AB0B 5H94A 4ENED 5KTEH 4JM2A 4F15C 5KYNA 5E2UH 2DD8H 3BHBB 3OKDB 2C9PA 3FHAA 1EO8H 3B2UC 3CFBB 5E8NB 3MXWL 4IHOB 5LG6A 4CGTA 5AAWA 2XNAB 4OKDA 3BP6B 4NO5B 4WO4B 1AKJA 2Y3AA 1OCWL 2CMRH 4R8WL 4GRLD 3RJDA 1DJHA 1YEDA 3KWWB 4Q56A 2XVKA 4QEGA 4BQ9A 1GTFA 2JB5H 3PGDB 3LKQA 3B3BA 4J7RA 4L8SA 2CXGA 3D7PA 2MMXA 3PL6D 1IBFA 1URZA 5IR1A 1BXVA 3DOSA 3SKNB 5B3SB 1QLRA 3MJ9A 3INOA 3ZGHA 4Y5YC 1YAIA 5L88L 3WNOA 3CXHK 4JGNA 2NTSP 2Q2LA 2YD5A 1MEXH 2GG1A 4JANB 4WHYG 4QOKA 3EZ8A 5D1QD 1MH5B 4Q14A 1V7ML 1M3JA 3CVHH 5EBLA 5MERA 2UZXB 2BVPA 2FO1A 1P4IL 3FHQA 2JKXA 4LPCA 1UHVA 4NIYE 4BZ2A 3E8UL 3Q9PA 1FH2A 5GGVH 1KBVA 5IEKA 5PAZA 5TQ0H 1N64L 5L2KA 1AO7A 1FFQA 2NT0A 3BIKB 3ZDYF 4PJIA 4HWUA 4DP2X 2IPUG 1G7HA 5JA8B 1WAAE 1BBJB 3MO1B 4G6MH 4PJFB 3BPOB 3ZE1B 1URIA 2Q10A 2PW1A 1CYWA 3CDGA 3QRFM 1VLXA 2ZOLA 5MEPA 2F53D 4X9HA 4N86A 4UOQA 3QUYD 3ZKXB 4X4XA 2MSPA 5DYFA 1WLHA 1KIPA 3FHEA 1FFTB 5E2WH 2VN4A 3MJ6A 5A2BA 4LIQE 2ZP9A 3HTLX 1MLCB 4OCYH 5TGBB 4PJGB 1IQDA 1I8AA 1VCBC 4NLHA 4UT6H 5GSVB 4DQOH 4X6CF 5F0PB 1BWWA 4FL4C 1B0RA 3T1FB 4ODXB 4QTFA 3ML8A 3VE0B 5B38G 2J55A 4G8IA 3IWVA 5HHOE 2IAMD 5EORH 5JPMB 4MD4A 3GF8A 1P5UA 2EXWD 3JVGC 3EYUL 4OT1L 2E47A 4M6OL 2HLEB 1IC7H 3I9IA 2YD4A 1Z5LB 3FZUC 3T0ED 4D0CA 2B7DT 2R1WB 4NQDB 1XHHA 5HI5C 1NCTA 2X9WA 3CFQA 3ZSSA 2LU7A 4XP1H 2ICWJ 1C08B 5EC2B 4LPVA 1JG9A 1A9EA 4PJBB 1TETL 4YDVA 4OZGB 4W9CC 1B2WH 2QSVA 1UB5B 4XVTH 5C0AE 2WBKA 4UDUB 1MJUH 3OKOA 4Q6YA 4PP2A 2R39A 1CF8H 1SFHA 1MCCA 4NRXA 1TZAA 3K8LA 1YMHB 2NUPB 2VE6A 4NKDA 1IC4H 4I5BA 1G7LA 5IMOA 4X99A 4U3SB 1HE7A 1GGBH 5AWNH 4K3JL 4GIPD 3CFNA 3HI1B 5EUOA 4AOFA 3U6RA 1MRCH 4JJ5B 4D3CL 4F7PB 2A9CA 1TZIA 2I25N 4ACPA 3GSVA 3GSNH 2DKMA 5B1JA 2VXVL 4KAQH 2CO4A 5DMIL 1IZJA 4JM2B 3B43A 1AI1H 2VWEE 4FLSA 1KGXA 1TZHB 4FAAB 3AS3A 1A1MB 2J8UB 3QH3A 4AE0A 5IV2B 1BM3H 3UMTA 1KG0A 5GGSY 2CLZA 4M6AA 3FRPA 2ARWA 4NQED 1Z9PA 1FN4A 2GJPA 2DLHA 3NA4A 2AXHA 3KBFA 5F7MC 4JRYD 4B96A 2GUOB 3QDMB 1MCRA 1WT5C 2Y7SA 3D4ZA 4KDWA 2M26A 1KPVA 3L1EA 4NDMB 1E4JA 4H8HA 4MBRA 3HNTH 4PRPA 1IB5A 1E4WH 1ADQH 3DA0A 4JFHD 4P4RB 2OYPA 3GBDA 3DPDA 2RR3A 4IDJH 4X7FC 3X3GL 2WQVA 3FSAA 4WK0B 1XIWD 3KGSA 5E4EB 5SWSB 2DQFA 4E42A 4YHNB 1P5VA 5FM5M 3FOMB 3K2MC 5HHPA 2WBJD 4CA4A 4D9QE 2YO3A 3TC9A 2WSPA 2I9LB 1HILB 4XPGL 1P2CA 1XAUA 4PRAA 4HHGA 4YBQC 4H8WH 2AV7A 4PGBB 2H32B 3LMJL 4G1MA 1F6FB 4GS7C 4J28A 2NW3B 4HETA 1N0XH 4UNTA 3VO0A 3QZMA 1JXKA 3OR6B 1M2VA 1UYWH 4OKVA 2YA1A 3EJJX 5IHUH 4JVUA 4ADIA 3RTLA 1MW2A 3AQDA 3QDGD 1CZ8L 3KLDA 3ZO0A 4BFJA 4HGWB 3PWUA 1GRWA 4KVPA 3TBSB 1Z66A 1MCEA 3OR7A 1A1OB 4WY7L 3HFMH 4I87A 4F24A 3VD1A 4O02B 4PRDA 4RISH 4P5TD 3W1ZA 2GFBB 2ICWA 5IQ9B 4UZGA 1SXZA 2OZ4A 1G7PA 1OSPH 1MELA 2PYEA 1BQHG 1KIRB 3N42F 3S88L 3B2UD 4W4OA 4J27A 2QQKH 5G5DA 4IBZA 1M7DB 4HIIA 3TBCA 2R1XA 1T5WA 1PZ5B 4KDTC 3VB8A 2PO6C 1Q9LA 4KKRA 3DX9B 2XI9A 1RZJC 5DJ2A 5F3FA 4LO9A 1F1GA 2CHWA 2AANA 5E2TL 4G8GB 3TJEH 1VPOL 1YCSA 3ZE0E 4FCHA 3CN4A 4M43L 3VXTB 2VRKA 5B39A 4DUXA 4WHYH 4P2RA 1X5FA 2OXHB 4ZTPH 1YNKH 4M3JA 5B7FA 1NM4A 5EIIA 2DI9A 3T9WA 2GJZB 3GSWA 3ILDA 1TJHL 1ZIBA 1TO4A 4ONGH 1MPAH 5FLUA 4OZIE 1PIFA 4OTXH 4YHML 2CK0L 4MDJB 3MVSA 3P3SA 1SJXA 4HU8A 2QGDA 5EN2A 1O6TA 3VXSD 4BKLB 5I0WA 1QHQA 4X7DC 2XZAH 1UA6L 3D1MC 4DP4X 3T2NL 4RNRB 4P23C 4WQOA 2YRPA 4U4BA 4BUHA 2JE8A 3WKMH 5FECA 3AGVA 4OZHB 4AYEC 3UYPA 3KG5A 3D3VB 3E6FA 4DPRA 1T21A 1WGVA 3QJZA 1NBZB 1Q0YH 4HS6B 3ETTA 2EP6A 2FGWL 3C5ZA 4MHHG 2DM3A 3UADA 1I3VA 1KOAA 1OALA 5D8JH 4POZC 2XY2A 1UM6L 3FH5A 2WQSA 3L6FA 4WEBL 1Z32X 4LVHC 5D7LD 1MDAA 3TO2A 4DEPC 1RIUL 5DZLA 3VYPA 5DD6B 5CFAA 2UY7B 2XWDA 3QEQA 1XVSA 4ZMOA 5C0IB 5CJOH 5EF1A 3DARA 3QQDA 2HLFC 1NPNA 2ADIA 3V6BR 5KJRH 4F93B 4Y16C 1LE5B 1NMBH 2DZEA 1G9MH 3GNML 4NO0D 5TTRA 4XPHL 4ILDA 4FQHB 1UD6A 3GMOB 4XCFH 2Y5EA 2ZOWA 5LKNA 1QWUA 3MLYH 2P45B 3QZWG 2H7WA 2CAKA 2FLRT 4MBOA 2EUXA 3ZBMA 3BAWA 1ZV5A 5ALCL 1JHTB 3X14A 5HI5D 2Z4QB 5DUPH 4BFIB 1A3RH 4NO3B 4X5PA 2Z7ZA 3IDUA 4F57H 3M07A 4YGVB 4R4NC 3BLKA 1RJYA 1AMYA 3UTTE 4ETQB 1EDHA 4APXB 5F88A 2OBGA 2W5PA 5BRPA 2WXLA 3QULA 5LNGA 2EIZA 4NGHH 4U6VL 3MLWH 2IAAC 4IIQC 4Y89A 4ZOCA 1MWAA 1WS8A 2V5MA 4RMTA 4ZUUB 4LSRH 3HBPA 1E67A 1JTTA 2H0EA 4KZEL 1HZLA 1KJMA 3HI6H 2FWLB 4FZEL 1FNHA 2P80D 3HBZA 1JGLH 2Z0UA 5EO0A 3MLUL 4PGDA 1LO5B 1FL6A 2VO8A 3MUUA 1RV6X 1FPTH 2FHBA 1A5FH 1YLBB 3QUXD 3RL1B 3F85A 3P1VA 4E5XB 4RGNB 3QXDA 2W65A 3EUUA 3R06A 4LHUA 1F11B 5CINH 5JDSA 3T77A 1ILSA 3PHAA 5GJSL 4OLZH 3VRLE 3L2MA 5DK0B 2WLYA 3UZQB 1F00I 1JHKH 5D2LA 3ESPA 5HGHB 1I8LA 5D7IE 1PJ9A 2AVFA 2Z91B 4PAZA 5EEWA 4P2QB 4FFTA 4XXDB 4JDVA 3VG9C 1CLYL 1MCLA 1EZLA 4R83A 4PGZA 4X6FB 2VJXA 3NCWA 3H54A 1XGYL 1ZVSB 5BZWA 5KYWB 4CC4C 4TNFA 3BMVA 3INUL 2WIIA 4A7VA 4N8VA 1SF5A 4XVUD 2PCFA 1JZ6A 1G6RL 1OLZA 4FYQA 3UEQA 1U6AH 2VZOA 1TYJA 2RH0A 5I19L 2VJ0A 3CTTA 3GBML 3SY0A 4AUYA 4M7JL 3L1OH 3VD9A 2Y7QB 4D8PB 2BERA 2CWRA 3RZWA 1CFVL 2B9BA 4YX2H 4GT0A 3WHE1 1N6QL 3EF4A 3MBXH 4FEIA 3VXUA 4NUPA 3UAJC 5C08A 2PXYB 3KPQA 5BXFA 3BPCA 3N85H 5HDBE 5T1JA 1H0DA 1QAWA 1ASQA 4DUWA 5E08H 4XO3A 2FNWA 1IQWH 3KPRA 4MNGE 2YGNA 4KJWC 3BWUF 3H53A 4PY8J 1FV1B 4YBQD 3T4YB 2KMWA 3IDGB 4FKEA 5JIMA 1SOXA 3RILA 2JH2A 4NP9A 1YO4A 5BVPL 3MREB 4NSKA 2P9RA 1HWHB 1MFBL 3F3HA 3LXBA 1P1ZA 4G6JL 5HDQL 1J05A 2DQIH 3CLFH 2VDOB 4PJAF 4GBXB 1W0YT 1OD7A 3B2XA 4ABVA 5K5YA 5GRUH 1VDGA 4LDCA 1OT4A 4MCYB 5FYKH 4JPWL 4N87A 3QFJA 4JNXA 2NXYB 1RJZA 3UTQA 4ZUWA 3SQBA 5DJDB 2K4AA 1B4TA 1CLOH 1YN6A 3OJ2C 1RU9H 5KYXB 5DGQA 3SJVD 4PJ5A 4TMPA 1JWSB 3IU3A 4NHUA 1W91A 4M4PA 3UH8A 4AV4A 2PO6D 1BX2A 3L17A 1X5HA 4PWGA 5GS0C 4KZDH 3B37A 2ZP8A 5DRXB 2P52A 3WFEL 3DI2B 4N0CC 4R9HA 1PJWA 1ZEAH 3A4FA 4DQAA 4M48L 5T3ZL 2E76C 1AZCA 5B38B 4P46B 4TYUA 3N9GL 1O6SA 4G6FB 2VLJB 3LPWA 4Z7WF 4U1IB 1NA8A 3SE3A 3VFGH 5F7EH 3KCPA 3O3AB 1LNUA 2B2XH 5ICYA 1ZHLA 4Y8AA 4HCIA 3ZDYB 3CZKA 3Q5OA 1B0IA 3RTQB 3VD5A 3QYMA 8CGTA 1U8QB 1DANT 4X7EC 5AVXB 4AL8L 3TTSA 1ZT1A 5GISH 1T1WB 4YDNA 3KPSE 4P23D 4GQQA 4L3AA 1EGJH 5B1CA 4PGDB 2FTAA 4JG0H 1VZGA 3ZR6A 2VLLB 2BSBA 2UX7A 2KLSA 1KGUA 1RP8A 2G5UA 2Y5TB 4TSBH 2OMTB 4LOFA 1MJ8H 1IBGL 3P9MB 4NRZA 1PZAA 3ARQA 1BEXA 4JO2H 1G87A 5AVZB 4Z77B 3N43F 1IC5H 4X6CB 1S9VA 3BEVB 3DX3A 1RUMH 4POZD 1A6VL 1GPOL 5DUMH 2W0FA 4JMXA 2VERA 5F1IB 4N2BA 3AWEA 1RUQL 3LQAH 4ODVH 4YE0A 1HXYA 1J8RA 4Q9RH 1OSYA 1NUNB 4K3EH 3BQUC 3GSQA 4JY6B 1QEWA 4IMLA 4PJXA 3BZFB 5DHEA 3ULUF 2ZJSH 4LLYB 1J8HE 3NFNB 3TNNB 3PP3K 4Z7IA 3CHPA 1TQCC 3DYMA 4HJ0D 3OJDB 3A6OA 3ALPA 5EOCH 3MODH 3HRZC 1LO3L 3MFGB 5IKCB 4M1GL 4OCXH 3JWDL 1DJZA 3QORC 4E9WA 3ARWA 4KMQA 1FG2B 1JMZA 3Q48A 1SF3A 3H7LA 3FU7B 4BZ1L 2N3JA 2PWEA 1VFAB 1OTSD 3BVVA 4QYOA 4XNDA 5JXEC 4W9FC 1BLNA 2AKRA 1NFDB 3PF2A 3BRFA 4R4ND 2A7BA 3EO9L 1EV2E 4GW4A 3UFIA 2I9TA 3LKSA 2VDPL 5BRZA 4WWKA 3VXRB 5DRZA 2NX5E 1I4FB 3T0VA 3KYMA 4XCEA 3QVAA 1T89C 4P3CL 4OGYL 1I3GH 1T04B 3FFDB 3MRLB 4NNPH 2XN2A 4N2EA 4GRWF 3W39A 3MRHB 2P28B 3G6JF 1NIEA 3TBVB 3V7AG 1MZYA 3AB0C 3HE6B 3O8XA 3WJMA 2L0DA 4M8QA 1MHHA 1EO5A 1XH2A 1OAKL 4OJEH 4KO7A 3TN0D 2DMHA 1J05B 1I8UA 3MJ9L 1DJWA 1L0PA 3NABL 3NIGB 1UZ8A 1U8KA 1TMQA 3EJSA 4WO4C 5FOBA 1YG9A 5BQ7B 1TCMA 2ZUXA 1NJ9A 1PS3A 4Q2ZB 4XMZA 5GPRA 2LLNA 4CMHB 1BG1A 4LNRB 2PWFA 5I76A 1TENA 2ORBH 3TBBA 3VB9A 5HP5A 5C6PB 1M57B 2NY2D 2DQEH 4FHJA 5D6CB 5I1DA 2LR4A 3H7BB 4J3BA 5AL0A 5F7DA 4K5MA 3K2KA 3NJGA 3FQNB 1GGCL 3C8DA 5DRWA 4K7FB 4XMTA 1AVAA 4NWUL 1BQHB 3OV6A 4TSAL 1QA9A 1GGYA 2EZ0C 1W72A 1ND0B 2ESVE 1WWWX 4Y4FA 3VCLB 4XVJL 1IL1B 4YXHH 1C5CH 1YY9C 5HGDB 2Q9OA 3O2DH 1M53A 3TYGH 5F1NA 1N7ML 1ORSA 2H3KA 2V7HA 3N2JA 3UAJD 1IC1A 4QXTA 4EVNA 4O02L 4GMSL 2YD1A 3OJMB 4LPUA 1NC2D 5CP7B 2EDBA 1PVHA 3BPOC 3A6CH 1G7IB 5AAPA 4P9MH 4HJ1A 4OLVH 2C3XA 3FB6B 5KANG 4LVOB 4X8JB 5JIKA 4BSVA 4KJWD 5DZ9A 3ZKXC 2WCSA 3HZ3A 5DFAA 3OGOE 1BSIA 1MG2C 4JLRA 4LMQE 4L8DB 2FJHA 1H3XA 4XVSL 3O6MH 2D7TH 3B9EA 2WN2A 4EZJA 1RK0B 1YJDC 1G9HA 4LKXA 4AL8C 4DP6X 4JZOB 1J1OL 4F8TA 5CIPA 5DSCB 2WYIA 1KB3A 4W9JC 1QR1B 3FCBA 3V4VH 4ZMTA 3KEDA 3O2WH 4Z7VB 2E9GA 2GJ6A 3HCVB 5A2AA 4AT6B 2EYTA 3RIFF 2FECL 4KI5E 1HHGB 3QZPA 4HWEH 5JPMC 5EB9A 1YEJL 1E9OA 2OMZA 2BSTB 5B4MC 1HSAB 1YEIH 3L3IB 1AY1H 1DSWA 2XC8A 4MCMA 1FZMB 2AK4D 5JOFB 3GKWL 4DKTA 3ABLB 3N1PC 3T2LA 2VM4A 3DYOA 5DEJA 4Z7NF 3II1A 2PKDA 4TVPD 3BC9A 4I48A 3X13B 2P5EA 4IBWA 1V7NL 1NDMA 3IF1B 4YH6A 4KVCH 3U0TA 5T1LA 5GS0D 1Y1UA 3E1F1 3I02A 3HNVH 4MMXC 4NZUH 4ZFOB 3HE7B 5T5FA 4N0CD 1NKGA 5I15L 2EIDA 4BFBD 4J39A 3DTDA 4PGJA 5DHYA 2YD9A 4RMSA 4Y4KA 1NFAA 2YPLA 1JWMB 1VHPA 2CGYA 3EYOA 1ZS2A 2RTTA 2EDOA 3GMRB 2Y07H 1BLNB 1HNFA 2I5YL 3JWDC 4F3FA 3KM2A 1CFTA 2EAEA 1J48A 4TNEA 1SVCP 4XRCB 4N2KA 4RSVA 3GXUB 4ZBJA 4MKMA 2A73B 3CCHA 2JELL 1FH5H 2G75A 2VW6A 4FABH 5EZLB 4NB7A 4LLQB 3FO9B 4QGTA 2WV3A 3MNDA 1ETA1 1XD0A 5L2JA 1RK1A 4YEEA 2H9GA 2WXKA 3NJMA 2EEAA 4V1DB 1RZGA 4JRXB 4RIRB 3S5LB 4Z7UA 4HOMA 4B5ZA 1OPOA 2YSTA 3PWJA 2VKWA 3G6AA 3L3KB 1JSYA 4L8BA 5HHXL 3B9DA 4B95C 4PJ9B 1YY8B 1OT1A 3S97C 1OGTB 5I6NA 2XFGB 1JDDA 1NPUA 2XSKA 3GI9H 4JR9H 1I7ZA 2DIBA 1ORQA 1KEGL 4H88H 2KL6A 2X1WL 1BECA 1D7CA 1UOKA 3PQYD 4U1HB 4ZTOH 3E80A 5LXGL 2IXQB 1KPUB 3BQUD 3A23A 1IAII 3VAEA 1KLGB 3ETSA 2JJVA 5E99H 4L18A 2AJ3B 3WFCH 4ELMF 3ES6B 1J86A 2UYLA 3J2PA 1WA2X 3HMWL 4JHWH 5DFWH 3SZ6A 1CFMA 2R1YB 2ZOOA 3N44F 4QRUB 5AKTA 3DMMD 1YN7A 3JV6A 5GGVY 5E4EC 1INQB 3DPBA 3PWPA 4XXCC 1RHHB 1I1FA 1J0IA 3S35L 3NPZB 1BZ8A 1BVLA 1XTMA 3HZVA 2QKIB 2WVVA 1Q9KA 1BIIA 1PYWB 2YZ8A 3T0EE 3QORD 1RI8A 2CUMA 5F1NB 4XAKD 3Q01A 1MXDA 2NNXA 1LP9E 2BP3A 4OIBA 4F27A 1JCKA 2BSSB 1KFAH 1KNOB 4ODUB 3SOBL 5IQLA 2IV8A 1ONQB 3C87A 4LK4A 4EUPA 2CSPA 4HUVA 1IAIH 5TJWK 1FYTB 2FHFA 4UNVA 1PNCA 2Y36L 2AEPH 3KWXA 5LCVH 3ULUH 1ZY9A 4K9JA 4K5LA 5CD3A 3CPLA 1A6TA 2WO3B 5JW4N 4LLWA 4PLJC 2Z64C 4WJG3 1VJSA 3HZYB 1QTYT 1JVKA 3KXFA 5FO7A 5EULV 4DKEL 3BFQG 4G5ZH 1Q8MA 2VERN 3GT6A 4OLYH 1VGKA 4LKCA 2IALB 5KVDL 4WO4D 4MZ2A 1S7TA 5JIPA 3LNDA 2X3CA 2Q86B 4KPHL 1A3QA 4OLUH 4HZ1A 4NCC2 2VDQH 4E9VA 1CGUA 3OKMA 2EQDA 1OP9A 2CKBB 2D03L 4PREA 3ZU8A 4RAUB 1U2CA 2GK0A 3SDXF 3MA9L 4MB3A 5E9DE 4WY7H 1JZGA 4GPVA 3ULVD 3SBPA 1DO5A 3MFFA 2KDGA 3LKOB 4ZPTB 1JDAA 5JHDB 1HZHH 1U8LA 5GZOC 1JFQH 4AM0B 1UM4H 2CDFB 2DWDB 3ZHFA 4YHOL 1K8DB 5JOEA 2ZD0A 4GRWH 4JRYE 4EBQH 1L5GB 4Q4EA 2AV1A 3D0VA 3SBQA 3AJ7A 2EZ0D 4C83A 4DERA 4HH9A 4W9IC 4OLWH 4G8FA 2F7RA 3EYOB 3QAZB 5AUMB 4MJ6B 3SPVB 5IIEB 1YY9D 3W0WE 3FF8A 2X0WA 1PLAA 1RUPH 4GP4B 4JFHE 1E3ZA 1S7XA 4GUPA 1MCHA 4E2OA 2QT6A 2VDOL 4ELDA 3IDXH 1EAPA 1JRHH 4ALAL 3RUGE 4AQOA 1CLZL 1A2YA 4GKZA 4OZ4A 1C12B 2XG5B 4PJDA 3C60A 3GXNA 3PPSA 2GAZB 3TXAA 4DPCX 3T6QC 3ARDB 3IJ7A 3PAYA 4BV1A 1IVTA 2DPKA 3L3GA 1RIVL 5DEFB 4HOWA 2ZP0T 1RZGB 1PU0A 2F08A 3TS8A 5EU6B 4FMVA 5T3XL 1JGUL 3SYCA 3S37L 5BVJB 1DJXA 5E00B 4E9SA 3GSXA 4U1KB 1H6EA 4PU2A 4JPVL 3LXUX 5ESQA 1E2VA 5FWQA 4MWFB 3COOA 2F1AA 1MCWW 2IGFH 4PS4H 3T2NH 4ZMYA 1I9RH 1ZD6A 3BD5A 4BUQA 3KLAB 5FFLA 4QXWA 1KXQE 32C2A 4OM0H 2IPKA 1UZ6E 5JUEH 1HHKA 1GMIA 1R3LA 1ZA6A 1QFWI 1G6VK 3EYVB 4WTWA 5HGAA 4MMYB 4AX3A 3QCUH 1S5HB 2BSED 4OJDH 4G9FA 3QEHA 3EW3B 2WKOA 3CMOL 1NPJA 1QX1A 2R4RL 5B4MD 5IB3A 3T5WA 3PREA 1EEZA 2F18A 2C5DC 1LM8V 3K46A 1FFPB 4LSTL 5I8KH 5F96L 3VFVB 3PXJA 1N70A 2V4LA 3L81A 3KLSA 4NQDD 4O51A 4WKZA 4OIIL 2F7IA 5SX4I 1EXUB 5TD4A 4AQEB 3IFNH 4I4WA 1FHNA 2YJQA 2FR4B 3ATBA 4Z7WB 1CGXA 3VTTA 3MRKA 2EE3A 5IK3B 3KLKA 1OARL 3K72A 4XAWL 1BXAA 2NY4D 5I1GL 1J18A 3OKLB 1KUMA 2EIBA 3KPPA 5DEZA 2HCZX 4NZFA 5AENA 4UDTB 4EIBA 1NQBA 2R0KL 5J1SC 2Q1EA 3IDMA 2X5PA 2WW8A 4UQEA 2R27A 2VTFA 4BK8A 4XMUA 2VMJA 2Y2YA 5AW8B 4WTZG 3CBRA 5KVFL 1QKZL 1I53A 3DUSB 4L9LB 5BCAA 1MKFA 5IB5A 2DQUH 2GIYA 1DBJL 4HWZB 5F6HI 4RGNC 4CVXB 4GG6A 4H8WC 5SX4H 3BSZA 1BAGA 2WOYA 3N43B 1Y07A 3QDJA 3GXMA 4F8LA 4XPAL 3K3QA 4JM2D 1LK3H 2P46B 3T8MA 3C2AL 3WXVL 3DHJA 5F3HB 2GABA 1PAZA 1DDTA 2QSTA 4F8PA 1AKJD 5KVEE 3FFCA 2DJ4A 4PJIF 5GJTL 1NSNL 1OY3B 4DN3L 1R47A 1RD6A 1PZCA 3E9TA 4PREB 5D7LE 1RURH 2E7MA 1J12A 2WOBA 3IJEA 3MRDB 1CC3A 4IRSA 4O2CA 4PJHA 4PR5B 5FYJU 3WNMA 1U8IA 2A77L 3VGAB 3QDMD 1WWAX 5ISZA 4WI4A 4XNAA 3DHMA 2VN6A 5DJ6B 3V5HA 1CFNA 1WO2A 1NGPH 4Z7QF 1AGEB 3N1FC 4MD5A 3CK0H 2PXYC 4L0ZA 5AW7B 1JNHB 1VFBA 5I73B 2O61B 3ZTEA 1BW8A 4C83B 3ABMB 2VDQB 1U3HB 3D85A 4AEFA 3GRWA 1DJSA 4FFZH 2ED6A 2ZXQA 3KGUA 1AMXA 3IDJB 3PIQA 3G5VA 3CDCA 4H4NA 3ZYZA 1B0GA 4JFPB 1TEGA 1SLXA 2LGNA 3UTSE 3L2LA 2HT3C 3BUQA 4GRWB 3ZKSD 2G3XA 3GBMH 3G6JB 3WTSA 2UZYB 3DIDA 4MA3B 3WNLA 3RNQA 1OB1B 4HIEA 4DPAX 3ABKB 3ZQXA 2WWNA 5CUSL 2AK1L 2J1WA 2WBXA 3GLEA 3PWVB 3RA7H 2V2XB 2RAMA 2F9BT 4PBDA 2XPGA 4GBXC 5C97A 4PLJD 3I84A 3WS3A 3RPIA 5DT1H 4HF5H 1EPFA 3VRJA 1YQ2A 2NXYC 2P26A 2XWBB 4JAMA 1J0HA 1U2YA 4KTDH 3T2OA 4QRQA 2XG4B 5CLTA 1YHPA 1EEYA 3MNZA 4QHPA 5FW8A 1QSVA 4J6RL 4ONOA 4RSYA 4G9FB 5LAXB 4FLHA 5IHZA 3K8MA 2WCGA 4NC0B 1AD0B 1IARB 4HBCL 2WGXA 3IDIB 3VXMB 4G8GD 1GGIH 5HVHB 1W15A 5HDQH 4P46C 1H9DA 1QSFB 4L2YA 1EHLH 4HFWB 5GZOD 4BA8A 3FF7A 1G9MC 1KCKA 3FT1A 4MLSA 5HDRA 3DHPA 4JPQA 5KBKA 2MHAA 1FL3A 1NCBH 3NQKA 1SXCA 1FORL 1IC0A 2ZSVA 2NW2B 3RTQC 1MW1A 3BP7B 4AC4A 7CGTA 5JORB 4J3XA 1FGNH 3OLIA 3WLWD 1WBXB 2GUYA 2GTZB 2N1TE 3ZR5A 2MQCA 5ES4B 3ARRA 1NGXB 1ZSHA 5IG7A 4KHTH 4H0IA 3VI4B 2JKNA 1NGZA 5EU5A 1HX0A 3QWRD 1DQKA 4AYFB 3TM6A 1G9NL 4GFTB 1X6LA 1NDGA 3FOLB 3VMNA 3D3VD 4AMKH 2YD0A 2AEOA 4IS6B 3RWHA 2BVYA 2EE6A 2EYRA 1WIOA 4ZW7A 5DQ9B 4Z9KB 3STZA 2XWZA 4G43B 3PABA 2YQ2A 1LO4H 4TNGA 4FQQB 1M6OA 5FR3A 3WTVA 3L9YA 4NYLA 3T65A 5K59F 2QVFB 1EZVX 1NCDH 2OXGA 3PP4L 4ZFOL 3OZKA 1XF5B 1ZTXH 2D7PA 2B1OA 1F3DJ 2ZX8A 3ZZLA 3B9AA 1FG9C 1MFEH 1QZNA 1LO2H 3CFDB 2HG5A 2Z9TA 1XGQB 1VFUA 4LHJB 2V9RA 4Y19A 5EHFA 4Z7NB 3QT2A 4LE8A 2QPFA 4F92B 4ORZC 4UYQA 4NZDA 3MRPA 1S7UA 2CR3A 2YAHA 4CVZA 1CS6A 4IBUA 1RZPA 2HYMA 3T6WA 2ZUTA 2G0KA 1X7QA 4Y2OA 1YPZA 4MD5B 4AGNA 2OS7A 4BGLA 3FC8A 4YHPA 3WUWG 5CJ8A 4NLAA 2LLGA 3REWB 1AQDB 4HWNA 4AZ8A 2YPKA 5DF0A 1GL4B 2WZAA 3T1WA 2XZQH 4EZMA 2NY1B 5D4IA 5F97E 2Z8SA 4QTHA 3LRGA 5SWZA 5J4MA 3L3OA 2R9HC 3UG4A 4U0QB 3JTSB 3P73B 5E8DL 2CCLA 2APBA 3MR9A 5C0BA 5I8CB 4JS7A 2Z0BA 2Q76B 3HE6C 2ATKA 4P5MA 4QXUL 3FB7B 1JF6A 4HIEB 2P43B 1IGFH 1NAMH 3MRRB 2P8MB 2G2RA 4F2ME 3GXDA 3WEXA 4GXFA 1L6ZA 5DFVC 1XL6A 4WI7A 4RGND 4PLNC 1EHNA 1S9XB 2ADGA 1V05A 1FP5A 4HKJA 4GEJA 4J8RB 4C56B 1KT2A 1I1AB 4QJ3B 4CMHC 5F3BA 3JTTB 4JPKL 2RIKA 4PRHA 5DZVA 2ZXCA 1P69B 2WXQA 3QWQB 5EBGA 4I0PB 5FUZL 2A9DA 1KENL 3QBTB 1CU4H 1D5MA 2YK1H 1F6LL 1EEYB 4FKKA 3PHOA 4IOSA 4U3CA 3F6JA 1OK8A 3K74B