3PAYA

Crystal structure of a putative adhesin (bacova_04077) from bacteroides ovatus at 2.50 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
302
Chain Sequence
GSCDSIREDLPRCELWLEFVFDYNMEYADAFNPQVKSVDVLVFDSDDKLLFTKSVKVAALVGGNRMSLTDELDFGSYKVLTVGSLSDRFRLSDNAGNKLVPGTTTLQQVIVSLKRETGGVNFEFQHLYFGEVVEVDHLPSNTNHKIYPVNLIRDTNRFNLALMGYEENQYTFEIQAPENAVYSWENEPTGQGPITYVPYYTDVVMSARLNTMRLLNRSGWDYKFIIRDANTEAEVWSYNLMTLLSIARPVSRYDGTELPFQEYLDRQSEWNLVFTVVEKNGGGFLQIGIVVGTWIHWLHGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative adhesin (BACOVA_04077) from Bacteroides ovatus at 2.50 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
molecule keywords putative adhesin
total genus 64
structure length 302
sequence length 313
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA01
3GF8A 3PAYA 4QDGA
chains in the Genus database with same CATH superfamily
4BFRA 4ANXA 4LSVL 1MCDA 5I1GL 1RK1A 1NMCC 2QSTA 3PCYA 2XJKA 4XPBH 3WMQA 1TQBB 3WAKA 1P6FA 2E7HA 4PPTA 1ZLWK 5HI5D 3MV8D 1IBGL 4XP9H 1KEMH 1QHPA 5BRPA 2ZG1A 1YCSA 1I8MA 4KTEH 1IM9D 5AAWC 2C7UB 1FAIL 2UY6A 4NRXA 4NQSB 2ZCHL 5CJXC 3AS0A 2UVEA 4GFXA 4N2AA 4NAQA 1A6ZB 1RY7B 1AGEA 3UYPB 3EOYG 3EJJX 3NSDA 5KJ4A 1JVKA 1ZLDA 3VXPA 2CH8A 3QULB 2XWEA 2NY3C 3MLRL 4FFVC 4YFDB 3T6VA 1NEZA 4F7TB 1EAPA 1W16A 4ZXBA 2P8LA 2EO9A 3QNXB 4JJOA 2DS4A 4GQQA 1NDGB 1AC0A 1HKFA 4MA7H 4GT7A 3NSJA 1DVSA 2GTQA 4JQVC 3LHAA 1WQVT 3H42L 4JGUA 5HGGS 1AGEB 3MC0A 1Q0EA 4LARL 1MHHA 1N6QH 3P30H 4KTDH 2VMCA 4Y4HA 1GYVA 2RFXB 3QA3A 3BUDA 3HBPA 3MJ6A 4WI7A 3AM8A 3SCMA 1U8JA 3X3GH 4Z7QF 3TBBA 4PTTB 2E4TA 1IE4A 4HJIA 1MDAA 4MJ4A 1X6NA 3VXSE 4A2HA 3DTDA 3PL6D 3EG9A 3MCG1 4JG9A 4NKIL 1TCMA 4MNQB 3EUDA 1XR9A 2PO6B 4RESB 4XP1H 2CDEB 1TFPA 3H7LA 1MAJA 3NJVA 4JFYB 4P2RA 3HCVB 3BZFA 2XIBA 1J9TA 1KGIA 1S7TB 1OGPA 4PJCA 3CFJB 5GGTA 4DTGH 1SN0A 4HHAB 2DQIH 3TVMC 1BXVA 3ARDB 4KWUA 1XTMA 1JFQH 4ACPA 1S9WB 1FUNA 3LKNA 3TEXA 3THML 4B60A 1FH2A 3JV5A 4FQXC 4KZEH 2H3NB 5I6LA 1ZS8B 3NIDF 1OM3H 2ZF8A 2GY7B 4FHJA 1HXMA 3FUDA 4HUXA 1J87A 1GZPA 2KDGA 4H26B 4Z95L 1EHLH 4JFHE 1ED3B 4L9LA 4L1SA 1M05A 5FXCH 5SWSE 4X4XB 3ZIMA 1LL1A 5EC1A 1OD9A 5C08E 1U95B 1S7SA 3MODL 3L5XL 3NSCA 4KOBA 4OTXH 2VLLA 4RZCA 5I8CB 2Z1PA 2AK1L 4JRXE 4N0FB 5ANMA 4ZX4A 2PTTA 3U4BL 4Z6AT 1BZ7B 5EBWA 2V2WB 1D5BA 2QDWA 2DBLL 1Q9KB 5DF0A 4XCCL 1Y6NR 3ARSA 3NCJL 3UMNA 3DX6B 3JVGC 1HCFX 1YEJL 1W6WA 1JZDC 1JZFA 2OSLB 1G7IA 2EYRB 5BUGA 2OSXA 4NCDA 2IWFA 3BEVB 3G5ZA 4LCCA 4EZMA 5DD1L 4HEPA 4JFZH 1EEZB 5I5MA 4RLDA 4CMMA 2IQAA 4NXKA 4AUJA 4ODXA 3ZY7A 2AQTA 1YQVH 2D03L 3VW3H 1SVBA 3LH2L 4XMLL 7FABH 4U3CA 1Q4NX 3DO7A 1NUNB 4W9IC 5JXAH 1F4WH 4OIIH 4QI3A 4GSDL 5IB2A 3UBXG 4OZ4B 4ZSOA 4G8GB 1KCUH 2YD9A 3IU4H 3M1BA 2IDCA 2B20A 3GZKA 5IW6B 4YE4L 2UXGA 1ZLSL 4PJ9C 5EZLA 1MW1A 4N9GB 2C9AA 3MGOB 1IM3B 2OMWA 2ZICA 4DP5X 1OY3B 1D6EB 5T1DL 1DR9A 1MCEA 2AK4A 2NY4C 3WE6A 1F41A 3OQ3B 5I1LB 3BLPX 4RMSA 3ABKB 1UM4H 2K1MA 4O2CA 5ADOH 1GW6A 2N7AA 3HFML 4OKDA 3ECBB 2A3TA 3P73A 1HCZA 4CVZB 1NBVH 1C9SA 3DSNB 5ANME 2EE9A 3L5WB 4TVPD 5GGSB 3K3QA 2RCSH 2W1NA 2CGYA 4FFWD 1F11B 4WEBL 3EF4A 3W2DH 2VISA 1OV8A 1IBYA 4EI0A 4E9WA 1I8LA 4F33B 3I6LE 1YEEH 1T3FB 1F90H 2AQ2A 5HGDA 5J06A 4R3SA 1S5IL 3U0WL 3W57A 5IEKB 4XMLH 2A6JB 4W9EC 5CJOH 4PP1D 3IGFA 3DX8A 3ZL1A 4DK3A 1QTSA 3JTTA 1P5UC 3L4YA 2J25A 2GUOB 3AQYA 5IF0B 4HIHB 4UYPA 3DWTA 5AW8B 3JWDH 5F9JB 5IBLC 2EE3A 3WUZA 1RZGA 4H1LA 1NBYB 2DLHA 2LABA 3HI6L 1DBKH 3G5YB 4QRPB 4APQC 3S88L 5FOJA 2MHAB 1HN1A 3KJ4B 5DVNA 3QJTB 1ZMYA 2BNQB 2FSDA 3JYCA 4JGNA 3QUML 2AI0L 2NR6C 4OCWL 1CMOA 2VL4A 2WXHA 4QOKE 4TTDC 5D7IA 2F53A 1R47A 2EKSA 3ASOB 4JDZA 4MHHI 4N2OA 1YN7A 3QNZA 4YHLL 2WYTA 3LZPA 1IC4L 1QRNA 1TYEB 5AW3B 3VSVA 3DYMA 2FHBA 4GRLC 4NZRL 5D5ME 3RZCC 1UUNA 3M88A 2BNRD 2FBJL 5GJSH 1F13A 1KB5A 4HULB 2VWEC 4KQ4L 3KPOB 2W0PA 5EO1A 4HIEA 3WBDA 3MLVL 5E6YA 2A74C 3TOPA 3TO2A 1E9QA 3B5TA 3ARBC 4K9EC 1ROCA 4MHHG 1BVZA 4WWNA 3HB3B 2WD0A 2J2ZB 4J6RH 4NKMB 2F19H 2H47C 3QNYA 1VEMA 4OT1L 3C5SA 4JCMA 5EU4B 1L9QA 2QHLA 5DFTA 1HVXA 4KKAC 2KUTA 1NSNL 5AW4B 4AVHA 1P5UB 3K8KA 4YQXL 4L4TD 3AWGA 1FP5A 1YEHL 4KKCD 4LCWE 5D93C 1CGYA 5FUZH 1JGDA 1JGEA 3VFPB 2OZ4A 2XFXB 4PLJD 3BQVA 4OCWH 3KL0A 2AI0H 4PGDA 4X7FC 2YN3A 1JZ8A 5AW2B 3P9LB 5MENE 1WCBA 2DTML 4LGPB 1UKQA 5E4AA 1N59A 1CICA 2AZUA 5E99L 4L3EB 3DX7A 5C6WH 4I48A 1D5RA 1J10A 4CKVX 1U8HA 2VZUA 1BMWA 5FK9B 2X2HA 1HOEA 2A9BA 3QJFB 1DVFA 1FI8C 4YGAB 3OPZH 2IAMA 2FT7A 1KENH 4URTB 4DQAA 1G7PB 4NQDB 4X80H 4Y4FB 5CZRA 5HHVH 5C07E 1FRGL 3QJVB 1RPQA 4NYLA 4XI5D 1NFDB 1Q38A 3BSZA 2X4OB 4MD4A 1OP3H 2XYCA 2ZWYA 3FB5A 3WJJA 1XCQB 5E8EB 2CUIA 2FX9H 1R9FA 1GW0A 4NQSA 4LLMB 3WKYA 3QHFH 4EZKA 3V4VA 4ZMTA 2C3VA 2PP8A 1TU2B 3V0VA 3SGDI 1GC1C 3C6LA 4XMXA 2FNWA 5EFIA 1DCEA 1KLGB 3CN0A 5F8RC 3OKNA 3VRJB 4D0BA 2YEVB 3EGXA 3LZNA 6FABH 4M93B 2DZEA 1UEMA 2QJDA 1E28B 2WHVA 3F84A 4LEOB 4JKMA 4ZO8A 4EJ1C 2C1OA 4F24A 1E4WL 1X5AA 2FIKB 3RWJA 5HBBA 2NUPB 2UZPA 5J4MA 2BH0A 3QCUL 2FYYA 4L5FL 5CHNA 2YKKA 3K71B 1NUDA 4J3UA 3PPEA 5KSVB 1RUAH 1AHWB 5F9WC 3NG5A 1AZBA 2VERA 5BZDA 2EABA 1RZIA 4KC3B 1WK0A 4N0UB 3SKNB 4DPAX 2ADFH 2L04A 1X3DA 2VR3A 2N1TE 3G9AB 2AJXL 1MCFA 4YHNB 1XDTT 1CYGA 2FIKA 3HG1B 3NPZB 3TIDB 5TF1H 4HKXB 4YHZH 2YEZA 1R3LB 3HNSH 1MVUB 1NJ9A 2H0JA 1H3GA 1ZLEA 2IWGA 4QHMA 2D9QB 4XVSL 3QNZB 2YA2A 4PG9A 3HRZB 5IBUB 1JCVA 1UM5L 3NZHL 3TZVC 1AYOA 4DP7X 2FO4B 3AQZA 4U49A 4H25A 1DSFL 3AXIA 3CFIC 2WUBL 4IDJL 1SFHA 1IBGH 3N06B 1ZEAL 2BFVH 2BSRA 2NQCA 3LKOB 4D9LH 1UGNA 1WHOA 2B5IB 1XZ0A 1KIPB 3JZ7A 3QJRB 4Q9QL 5FO7A 3D6GA 1NLBH 2XZCL 4JHAL 5CLYA 1B3IA 3WLWC 1CO1A 2J8HA 3ZJAA 5D5MB 4HJ1A 3US9A 5T3ZL 3T3PB 5AD0A 4ETQB 3MLSL 5GIRA 2AABL 1CDHA 2AK4E 2BINA 3LKNB 3WJLC 5K9KA 3KWTA 1OAKH 1HS6A 4LLMA 2A2QT 5C0BB 3E3QE 4M5TA 4J3VA 3AWFA 2VMDA 3GHEH 1U58B 1IKNA 3EH4B 4H8WH 5CJBA 5E9DB 4QRQB 5EEYA 2NLJA 3QAZB 4TUUA 3MRIA 3DNKA 1PIGA 4HQQH 3TCTA 1IGYB 3C2AL 4TPRL 1BVOA 4XN8A 1MAKA 1S3KH 3LS5L 4XBPA 3ULUE 2CO3A 4AXWB 3CU7A 1A21A 2JLPA 3NCJH 1MF2L 5B7EA 1JZEA 2MMXA 5GS3A 4IBLT 3TYGL 2DQDH 3ARFB 3KVQA 5IJKA 4RFNB 1ZANH 1ONQA 4BH8B 4HMEA 1KGCD 3FT2A 5I9QC 1R5IA 1RMFL 4WTWA 2OP4L 4Z9KB 4I18C 2IQ9H 3VXQA 3HPJA 1G1CA 4MB3A 1DJHA 4IK6A 4PYHA 1ZHBB 3EJUA 4GQRA 4R5TA 1UYWL 4G82A 2O61A 1FPTL 1KWKA 2WNXA 3QGVA 3QJHA 4M5YL 4Z0XB 5DUBB 3SE4C 5BQ7B 5I0DA 5AOKA 3B9EA 2NSMA 4QF1A 1T4WA 1XD0A 4M6NL 1IBHA 4RBPK 4FP8L 1NH6A 1WS7A 3UXFA 1IKFH 2OM5A 4G80B 1U8MA 4ANVA 2ZYIA 3IMBA 2CDGB 1BQHG 3L3DA 1V55B 3ME0B 4JREB 3ZKXB 1A9EB 2HSIA 3GHBH 1IRAY 2VAAA 3AW5A 4PJIB 4CJ1A 1FZKB 1EDQA 2EACA 1XGTA 4GI6A 3EAKA 3MJ7A 3H9SE 3Q1EA 5KAQF 1A7NH 1T21A 4PJEB 4KXDA 1NWPA 2EYSA 3RWDB 5JPNC 3B8YA 3VWKA 5DZAA 2FHCA 2F54E 2UZIL 1NAKL 1U8PB 2JCCA 5KVEE 4FNLH 2DWSA 4WTQA 4DP8X 4RBPH 2B3IA 2VLJE 4FXKB 2YPLD 3KEDA 4NCC2 3TBCA 3QZLA 4KVNL 1I9IH 3VJ6B 3C5ZD 5I9QB 4G7VH 5JYMA 1VHPA 3ZTDC 4RMTA 4KFMA 4NO2A 5A16A 1YY9D 2IFFH 4NDMA 4XHJC 1AXTL 1H6EA 5JMOC 5KYWB 1BVLA 3RVVC 3C9NA 2HFEA 3ARDA 3AY4A 3HS0B 2AQNA 3VXRD 1AFVH 3GUTA 4GSXA 1FAIH 3AU1B 4OM0L 2P8MB 5EH1A 1NCCL 1PX8A 2OX5B 3BHBB 1UOLA 4LLQA 5HYEA 4PRPE 2AERT 4LCYA 4MJIE 4JRFA 3V4PL 3V52L 3P3RA 3FQWA 4K2UH 4EI6B 5HHOA 1O5DT 4XMZA 4X6CA 4S2SB 1DBAH 1NCJA 2DH3A 4K5LA 1NGWA 4OUUA 5D96B 4YDJB 3K46A 3U0TB 4E41D 4P57A 4JL1A 4ZTPH 1N7ML 4ZFOB 4JFDA 4AM0B 4JFEE 4HGMA 3V5HB 4ONFL 2BX5A 1LDPH 2DIAA 1N3NB 1P53A 1TLMA 2ADJA 2PPEA 3CSPA 2Y5QA 4XPBL 2MCMA 5KSAB 3ZE0E 3T6XA 4JO1L 3CDYA 2B15A 1AXTH 4WY7L 5E5RB 2RBLA 2MKLC 4QT5B 4F2EA 2JCCF 4PVNA 4AKQA 4K7PY 5IB4B 2R1XB 5BMFH 1IKFL 3NCFB 1MHPH 1FVCA 15C8L 5DR5H 4XCEA 2F53D 1I1YB 3QUZA 2OQJB 3GSNH 1DQDH 2YD6A 3PABB 4NKMA 2YC1B 1E9PA 4DAGH 1SYVB 1DEDA 3Q3GA 1SBBA 3TIEB 2Y36H 4KQ3L 1JMXA 4CC0A 1A9VA 1OGTA 1EUTA 3C5XA 4LBEB 3CFNA 2P43B 3RVVD 2BVQA 2BRQA 2VT0A 3AITA 3GSQB 1RZKL 5IB5B 2W65A 2NY7L 5C0CD 3B9KD 4L05A 1TJHL 2IBZX 3WL9A 2ARJQ 3CX5J 4RFEB 5E2UH 5MP6H 1CBVH 4GSRA 3WEOA 1AHWC 4U6VL 2F8VA 2Z8WC 3C8DA 1L5GA 4PJAA 1Q0XH 1AQDB 1CWVA 1Z5LB 2PTTB 4PRHD 5EB9A 1LP9E 1T66D 4NIYE 1FFPA 3LV3A 3T09A 2FLBT 1B4TA 4J39A 4C57C 2VR4A 1YMHB 1A5FL 4MAUL 3RL2A 3P69A 2YA0A 3FUJA 1KPRA 2Q7NA 1XZWA 1YPZF 3JWOL 3MPCA 4H44C 2ADGB 3NZ8B 1E65A 4U3XA 1BV8A 1JSYA 1TQCB 4FJ6A 3WHE0 1Q1JL 3V9EA 1OD7A 4C4UA 3V79C 4XXCA 5DRZB 3MBEA 1JFHA 2XTJC 1VRSA 3KXFA 4MMXC 4RAVB 4BDVA 3WY2A 3M45A 2K7PA 3FQ2A 3ARDD 4ERSL 2PCFA 4Y1AA 5BVJB 2OR8A 3LV3B 4X4MA 3BQUB 4X0KA 2WBJB 4NZUL 3GSXA 1ZWIA 2D3LA 3FOLB 4X5WB 3T65A 5IZ7A 1GJUA 2FO8A 1DQJA 5CIPH 4Y2OA 1KXTA 4GXUN 1OOWA 3R0MA 2YO3A 3UBXB 4E41B 3GSVA 3HG3A 1Q0YL 4LSUH 4XCFL 3MNVA 5JW5B 2OP4H 5D7JD 1CTMA 3O2WH 4L4VE 5FAAA 2JKIS 1PZ3A 3KDPB 4P2RE 4F8PA 3D1MC 3UC2A 1TZIA 2Q2LA 1ZK9A 3ZKSD 4ZO9A 2Y9RT 5AW0B 1PFOA 1D6VL 4YSQA 2NYZA 5C08B 3RGHA 3P3TA 2VLKB 1FYTA 2DICA 2GB2A 1TSHA 2EDWA 3IDXH 5BMFL 4OKVA 4UILL 4LDCA 2FX8H 3QIWC 4Q6IC 3HRZA 4Q14A 3SDDB 2V7NB 1PCSA 4A66A 2W8CA 3IS0X 3TO4B 5CLTA 1HHHA 2CUAA 2BP8A 3MNWB 4GKSB 2YRBA 3FT4B 1S78D 3N43F 5EN2B 2BZDA 2OCFD 4XXDA 2NY4D 5D96C 1WZ1H 4UV7L 3EDFA 4FTVA 2EDOA 3DYOA 3MUZ1 1S8DA 5MI0B 5EEVA 4F3FB 2WKOF 1QQDB 2UWEE 3ZRCC 3MV7A 4HC1H 4G6JH 1T0OA 3C08H 3VCLA 1MDTA 4FABH 5JIHA 5FCUL 5EULV 1DBAL 2Y5TB 2R7EA 2BIMA 2XN9B 3GGWA 1BQLH 3PNWA 2ICWA 4KPHH 4ENED 2J73A 2QPEB 3TNMB 3MTXA 4LLQB 2YUZA 3ZE1F 3V9FA 2W80C 2Y7NA 5JDSA 1FJ1A 2I85A 1KGWA 1VA9A 3ZKND 4KI5D 5TH2B 2XN9E 4GLRH 3MLZH 5IKCA 1MRCL 5HDBB 4QNPE 5BUPA 5IQLA 4EOWH 3JWNG 3CFCL 4YGVB 1AO7A 2L7UA 1KFAL 2VDRB 3MBWA 3NESA 4I88A 4CC4C 3F5WA 1B9KA 4V33A 1N68A 4FMKA 3TN0C 3HC0B 5EORH 3PGFL 5KSAD 4I9WD 2XOTA 1G7MB 1YY9C 2R51A 2VMEA 4L48A 4WZ9A 2WLIA 1VGEH 1K4CA 1GGBL 4ADGA 3ZRFC 5CP7B 3WNLA 1J7VR 1FFRA 3KLHD 3ULUC 1TOXA 3RE0A 4OZIF 5SWZB 3IWUA 3QWOA 4YGVA 4OVUA 3GXFA 2Q7YA 4TUJB 2G2RB 1NCUA 2XNAA 3G6JA 4QHPA 5BQ7A 2B59B 3QUMA 2HT3D 3V0HA 1L4IA 3MMEA 4HZAA 3LAFA 2VLKA 3DO3A 5IHHA 1SRDA 1YN6A 4L29A 4Y9FA 2ZUTA 4F7PB 1YUHB 3SY0A 2FT8A 4MXQD 5BW7A 1BOGA 4I2XB 4H4NA 4PGDB 2VDPH 4G80A 5KVGL 3BZ5A 3RWHA 4G7YL 4UIKL 4BH7A 3FUKA 3BRFA 4TULH 3BP4A 3D7PA 1A9BA 4IU3B 2AJUL 2DYPA 4OT1H 2DWEA 3OR6A 4XN5A 3F58L 4IRZH 3DOIA 2A1WL 1XAUA 1TZHA 2BCKA 4G7QB 3FOLA 4PBXA 2WCSA 4L4TE 4FZEL 5FKPB 1WH0A 1L0QA 1I53A 3CWGA 3KVDD 2FL5B 1SMOA 1FHNA 1MRDL 2VXUH 4HUNB 5SWSD 4QYAA 1J0HA 5ITFB 1GYAA 2L7QA 1HL4A 4G11A 4U0RC 4GUQA 1TFHA 1YEDB 2QPUA 1ES0A 1U8LB 4P3WA 4XE5B 4AVJA 1OGAD 2H8PA 3CHPA 2WTOA 2OTWA 4PWEA 1HK6A 3HHSA 3RZCD 1PSKL 3D85A 5I76B 3O4LA 1NEZB 3B83A 4DERA 4F7TA 2B4CH 4JY5L 3OR7B 4ETYA 3MUJA 4HHWA 1T89C 4LRIC 5JW4M 3A4FA 1JNJA 1P7KA 4J6RL 5D5MA 3CXFA 4WSKA 1WA2X 4JO3H 4M7KL 4PS8A 5F3HB 1LEGB 4HJJH 5KSBB 2F68X 4Y4KC 1KDIA 2V8MA 5GS1B 5CUSL 4KV5E 4WF7A 3GRWL 2EXWC 3MNVB 4KO9A 5LG6A 5GZNA 3OKEB 5T5FL 4M8RA 1JDDA 2DD8L 1VFBA 2JFCA 3II1A 3NCEB 1C7TA 4FG0A 3DBXA 5CEYB 4Z7WA 3IBOA 4LSQL 2OZ4H 2EIDA 1CFTA 2I07A 1P2CB 2H0PA 1J0JA 5EBMA 3MXWH 2WXNA 3DVFA 1J11A 4G9FB 4NJ9L 3V0WH 4ZUWB 3N0AA 4R4BA 1OXYA 4TQIA 4HIHA 5F7KC 2Q5BA 3RRQA 1CD8A 2Q3XA 1TENA 3B7SA 4FQPA 1OP5H 4AY0A 5BZWB 4RNRA 4YBLC 4ZW8A 4YXHH 3HZKA 1EVUA 3II2A 4Q97A 2W9DH 4PJ8C 1RQ5A 3HPLA 4TVPL 3UAJD 1R3IL 2BVEA 4D9QD 5H35B 1BGXH 4OJCA 3O2DH 3QUYC 4BQ6A 2H3KA 5C0IB 5DZLA 1O5PA 1WDAA 4P59H 2AJVL 1YQ2A 2P48B 2Q10A 5HI4D 4ZG1A 4IHBA 4ZQKA 1LGVA 3BH9B 1MUJB 4PD4J 4RZKA 4ISVA 3HZ3A 3ZX1A 4MZRA 4IK7A 4OCXL 2Y06L 3VQLA 2J56A 1D5BB 1IZKA 1CYWA 1U3HA 1DE4B 3VFSB 4MA8H 2JJTC 4PRPB 5HYFA 3UPRB 5KBDA 1LHZA 1IJ9A 2YMOA 1FH5L 3RPBA 1K2DB 3B56A 2APWA 1O6SB 5CINL 4LGRB 1S78C 2IDFA 2SEBB 1E4XH 3O6KH 3QUMB 1QR1A 1KCLA 2GC7C 4NT6B 1PG7X 1T1YB 3WFCL 3QS2A 1JGUL 2C26A 3TASA 2A0LC 4XGZA 3MXVH 3QFJE 3GSNA 3N41F 4WUUD 5JQ6H 5M7QA 2VLJB 3HB3C 1I3GH 2CNZA 2IQAB 1K4CB 2V4LA 3LOWA 2DQEH 5HDQL 4I0PA 1AC6A 2VSDA 2BDNL 4K07A 4M02A 2CAKA 2ZNXA 3W9DB 5FA4A 1WJ3A 1TTBA 2ZXAA 1YMHA 2PLTA 4XNYL 3F64A 5CZKA 5GGTH 5BOPA 5A16B 1GPOL 2ZNWA 3MXWL 3PWLA 2F54D 1JOIA 3VI4E 4C83B 5GZOC 2CU9A 4J4PA 4N2MA 1XIWC 4LF3A 2HTKD 4AQ8A 4JFOB 3SEPA 4FLOA 1OARH 4JGMA 4QLRA 4R96B 5EA0H 1NLDH 2VC2L 5FLVA 3HI1B 6PCYA 2BNRB 3GMPB 5JZ7D 1NCWH 3FB5B 2ROXA 5INCB 5MEQA 3T3PE 2N01B 1J05A 1SDYA 4PRIE 4DAGL 5F6IC 3MNZB 3QEUA 3BP7A 3ZBMA 1R0AL 2PXYC 3OXRA 5AVZB 1ACCA 4XMPH 1IAOB 3QWQB 4NM8H 4WI3A 1H19A 4QTIL 3TO4D 2FRGP 4FNQA 2IVFC 4XOBA 1IGCL 3BZFB 4KX9A 1ZT1B 4NHUA 3SGJC 3OKOA 1F18A 1R33A 5IP4A 2BP8B 3MNWA 4W68A 5C70A 1W0YT 3MLZL 4O58L 5ACZB 1KC5L 4RAUA 2DQHH 1LD9B 2Q20A 3B7TA 3EYVB 4P5TD 4ZI8A 1Y0LB 5IT2H 1J5HA 1PAMA 4KTEL 3BPLC 3SOTA 1C16B 3JWDC 3C12A 3FQNB 3LIUA 4XXWA 1RUML 4FE9A 2I9LA 5L4IA 5IUCA 5ENWA 5JR1H 1U8IB 4KKBD 1G5GA 1EO8H 2ZKWA 2FUTA 3EO0B 1CGWA 4KK9C 4XPFH 4CMHB 4D7BA 4MMZC 5DC4B 4NQVA 5EF3A 2IWKA 4FQCH 2FSEA 3L3HB 1NCCH 3BHBA 1M4KA 4KJPD 3M86A 3GMNA 2AV1B 2NY6B 1FZJA 1OT1A 5F7MC 2A73A 3QWRD 2D3NA 5I0WA 3JV6B 3MBWB 2YR3A 1JGVL 2BWDA 3G5VA 1ID2A 1ZJAA 4FTDA 4AX3A 1BF2A 3WY4A 2BPBA 3O45B 2WWKO 3BFWA 2P7TA 2ADYA 3UBHA 3VH8G 4U1IA 5FHBL 1G9NC 2C4FU 4FCHA 4KVNH 4JFQA 2CKBB 2DDQL 2QR0B 4LKXB 2VLRA 1N67A 3FONA 4KO7A 3BUIA 1CXKA 2ITEA 3AREB 3F5WB 5FCSH 3D0LB 3VYPA 1HDMA 1XGRB 4PJHE 3OAWA 2Z92A 1SHXA 2UZIH 4YVNA 2DKSA 4P46D 4WRLA 2ENSA 2YHGA 4JRYA 4HH9A 1QFWM 2N0MA 4H0HB 4A6YL 2EDMA 5IW6A 1ZGLP 1BIIA 4EVNA 1PKQE 4C58B 4ONHA 3AS3A 2X4TB 4EIBA 1IBDA 1M71B 3N44F 3KPRD 1NAMB 4ZSOB 5DS2A 3EJYC 4KUZL 5SWQB 1CI5A 3CMOH 1ADQL 4C4KT 4N0UA 1M7IB 3FO9B 2BNQD 2P80A 3FBKA 1CLOL 1MCWW 1U8KA 2D8KA 3GRWA 2NTSP 4FQ2H 1KB3A 1EANA 3Q8CA 4JJHA 4IS6B 4P2OC 5E2VH 4CVZA 3E1ZA 1CICC 4LOEA 4KGLA 3L9RB 3BRDA 1RHHB 3RVUD 2UWEB 5L88L 2WNKA 3M1BB 4L3FA 2AK4B 3VM5A 4X99A 2O5YH 3LXCA 3WE6B 4DCQB 4XVJH 3ZRSA 3MUHL 4OCLC 4Y4FC 5I1GH 1V05A 4LAJH 2EICA 7FABL 2XZQL 5T33H 3SGJA 1Q9WB 5JORA 5EC2B 4WHTB 1DUZB 4PN6A 4UTAL 3MRFB 2ZKYA 4Y1AD 4UT7L 1RZ8B 4G9DA 2X6VA 2PXYA 1E2WA 1LMIA 3B2VH 3GS4A 5KSBF 3WTUA 1VADB 5LBSH 3ZQ9A 3D30A 2UWEA 4OZHA 4APXA 1M7XA 1NFDE 1T83A 1WA1X 1Z9PA 4QHKJ 2LLNA 5JO5A 2ZUVA 2EADA 1R3KB 4GT0A 3U6RB 1DDHA 2DL9A 4G8FB 1TJXA 1PQZA 4F57H 1HTYA 4U6TA 3FH5A 3ARXA 2B1HH 2FH8A 1N8ZA 5CIPA 3RA7L 4BE6A 1PG7W 1RUKH 3T2PA 5HHME 3G6DH 1W72H 1XIWA 2PCPA 1Z1WA 4KMLB 2BMKB 2FYVA 4ZZFA 5JHLL 2LAGB 1L0PA 3FCSB 1WWWX 4MDIB 4C4KO 4XOAA 1GMIA 1XF1A 3NSYA 3D3VB 1F2QA 3TV3H 1RZKC 1AO7B 4K3DL 3L4VA 2ZP0T 1DQMH 2ENYA 3LRHA 2Y7MA 4CMHC 3CFEB 4OAWA 3Q9QA 1KIPA 4JR9L 1KWGA 1BLNB 3EOBB 5CSZA 3S34H 3HIZA 1Q1JH 2VDNB 1FNFA 3VWKD 4PRHB 1JVOA 4LPTA 3WSQH 4WJG3 1IGFL 2RFXA 5JUEL 3BSZH 1EHKB 4XPGL 1GC1L 4I0CC 5D1XD 3SBQA 5ACZA 4LT7A 4FA6A 4HZLA 2WOBA 4AT6B 1YC8A 1P69B 5D6DC 5ADPL 2AJYL 3VFMA 3VD1A 1RK0A 2J57A 4NUPA 3DIFA 1MNUL 3MMEB 1I8LC 3EBIA 1QQDA 2QZQA 5D72L 4N8VA 4LBEA 3S35L 5LNDA 4YR6B 5D2LB 2R56L 1X5LA 1LK3H 1THAA 3QWOB 4ANWA 1S4IA 2AQRA 4JZNB 1U3HC 4V11A 1K4DB 1OAZL 3IXTA 3VDBA 4XVJL 1SF3A 5AEAA 3H8NA 1A6ZA 2ZCLH 2I26N 3K6OA 3UAJC 1RUAL 2XN2A 3BKCH 3WNIA 3FCTA 2ZWZA 3T2LA 2ISDA 4BGDA 1P4LA 4ATTA 1H6FA 1TEFA 1WC7B 4GW4B 1UHVA 2BW4A 4DVBA 4M7JL 5F0LB 1FGNL 1P1VA 6FABL 3O0RH 1HQ4B 3QI9C 4M6AA 8CGTA 4WWKC 3SPJA 4PJXF 4E42B 3QDGA 4G5AA 2XWJA 5DJZA 1IEHA 3CSYA 4GXVH 5SX4I 4JCLA 1JRHH 2DIJA 2BJML 2XHNA 4JPIA 3ZL4L 4WU5A 2HJFA 2VZOA 2PF6A 2ZP9A 2GC4C 3HNVL 4LAQL 5JIQA 2C8NA 3T3MF 5LNGA 2VCOA 3D5OF 4TSAH 8PAZA 4OLZH 2ZJSL 4XP4L 3C9NB 3RURA 5BO1H 1KZYA 1A4KA 3V4UL 5DJ6B 2FJGA 3C8HA 3FMGH 2YD3A 2JELL 2CJ3A 1H15B 2ERJB 5EOQL 4M6OH 2JKLA 1RIHL 5FA4B 2J44A 4X6EB 2X6AA 3I6SA 4Y4KA 3TURA 1AFVL 1D3CA 2HJKB 1DLFH 1MW3A 2R2HA 3M8OL 4FG4A 4Y5VB 4S1RL 2Z8SA 4TNFA 1A7QL 2JJVA 1XHHA 2BP0A 2ALAA 1TVHA 5E4EB 1P4IL 3UJTL 4JQXC 2E7MA 1JYXA 4XP6L 3SQOH 3APMA 3D3VD 5B7MA 2AAAA 5KYXA 2AXWA 1E7VA 4JQIL 3OF6D 1Z9OA 1ZGLA 1Z0MA 2JCCB 3WXVL 1TG8A 3HAEB 4XNXL 4NS0A 4MLSA 3ROOB 2EUWA 1JV5A 4FQXA 1ZCRA 2F54B 1E8ZA 3KLQA 4MXWL 4ODUB 4AYBA 4J3SA 4H8WL 1NJ9B 1JNLH 5JHBA 2YAQA 1F02I 1SYVA 1OZUA 4GINA 3H6JA 3LCYA 2CZNA 2XG4B 2IGTA 3D4GA 4HCFA 5D71L 5JO5B 1D5XB 2OMZA 4YHNA 1KBBA 4NUGH 3VFRB 3WU1A 2DQTL 4HSAC 1UA3A 4MMXB 1MRFH 1A14H 4NJAH 4Y19A 2YWZA 5BW7C 3HVDA 4Z5RA 3T1FA 2WVVA 3X12B 1CDUA 1DJSA 4GUOA 3IAPA 3VSTA 2ZF9A 4HZLB 1WSST 2IPKA 3VRJA 4Y5YA 3GMMA 3N1QC 1F3RB 4EPSA 4PJ5D 2OMYB 4K73A 3PWPE 4Z1PA 3RHWF 3P11H 1LO2H 3QHTC 3PS6A 4MJ6A 3IU3A 5K9OA 1I7UA 2UZXA 4H8WC 4WTXA 5C7XL 5HYSB 1UD4A 1ED3A 4NC2B 5EPMA 1FPTH 2WLLA 4PJDA 2C9RA 1T0PB 2X3CA 4JQVA 2EYTB 3UL4A 3IE4A 1YJDH 3IVKB 1RMFH 4GIPD 4M61A 3OKLB 3GSUB 3MRPB 4EUPA 2A73B 3GZPA 4Y9EA 4Z7WF 2DI7A 1S2EA 3TN0A 3HMWL 3EJYD 4YXLL 4I48B 2QDVA 2ICCA 2WBJA 4WW2F 4B27A 2EVGA 2YZ8A 5TDOB 4AV0A 3GSOB 5IQ7H 2V0AA 4YWGH 4F58L 5MEOB 1A3RH 1G7PA 4NQDA 4NQQA 4Y4FA 4DK5A 2YC1A 4I9XA 1ADWA 4Z3FA 1DBBH 5KTEH 4QTHA 1IFGA 5AAWA 4BSVB 3AS2A 1HILB 1RIVH 3ULSB 4H88H 3S36L 3GHEL 2EEDA 1TVBA 5EOCL 2OULB 2PN5A 2VDQH 5E4EC 2WXGA 3C5JB 2PWHA 3LIZL 3RL2B 3BDXA 3T0WA 1DVYA 2CNYA 1IC7H 1JWUB 2HZHA 2OR9H 4HFUL 4P3CH 4RGND 4I5BB 4XAWH 1UZ6E 2X0UA 3PXHA 5CBEA 4M3JA 4WTZG 4TVPH 3FTYA 2WAHA 4WO0A 5CINH 3MJ7B 1TTFA 2WLKA 4WUUB 2IDTA 3Q2NA 1NCAH 2VN7A 4P5MB 2B9BA 2VITA 4MCYB 3TEWA 4W93A 1OAXH 1A14L 4L1TA 1DBJL 3FUEA 5C3LD 2NDFA 4NUMA 4TLSA 3S36X 3SQBA 1NMCB 4QGYA 4WDIA 5AUMA 2RQ8A 2WYHA 3GNMH 5H4YA 4LGSB 1ZK5A 3CC1A 2Y06H 3ILQC 3B9KA 1O9ZA 1QG3A 1JTPA 1BSIA 5T1LA 5DJAB 4A2LA 2R15A 2J7LA 1VKXB 1HKLH 4M1CD 1IJNA 1VENA 2PTVA 4NKDB 3DV4B 4F9LC 1J9CT 4LNVA 3ULUL 4HPYH 3KPOA 1U3YA 3QEQB 2E7CA 5KYWA 5C0JB 4LEEA 3S96A 4Z7VE 3RGVD 5EOCH 2HLFD 3BLKA 3S3PA 1UD6A 4E5XA 1LD9A 1T2QL 4U1JA 2LQRA 2EUZA 4TNVK 2H9GA 1QBLL 3RIFF 1HINH 4R97B 4TSBH 3E3QC 5IVZB 1HCVA 3E6HB 4Z7UE 1FWXA 2ARJB 4NPJA 2C3XA 1F3JB 2EP6A 4H8PA 5AVVB 4QRPD 4I8DA 4CSPA 2VDOB 3F7RA 1A4JA 3GIVB 3OV6A 3LNGA 2YSSA 3ZDZB 5ALCH 2BM3A 3IYLW 2BSSA 3V0AC 1ANUA 3QDMB 3KYMA 3MBEC 4Z95H 5E1GA 5LBSA 1EHLL 3QIWD 4E5XB 2WQSA 2OZNA 2VDQB 4EI6A 4KKAD 3LN5A 3IF1A 4OJFH 1JBJA 3D08A 3W0WD 3MV7B 4V1DB 2DLEA 1JYWA 5FGCB 4G9FD 5FW6A 3ESNA 5DWUH 4FZEH 2PMZA 3T0XA 2APVA 1YYLL 4G43B 4L3EA 3DGDA 4TVPE 4J8RB 2N0KA 2G5RA 3OLGA 4OF8A 4RA0C 1MWAB 2LFGA 4V1DE 2MSPA 1JV2A 2K3HA 5GSVB 3MOAH 4X6FB 3E1F1 3SDDC 1OSPH 5C07B 2NY1B 1AAJA 1BFTA 3ARPA 1JPFA 3BFOA 3BVNA 1OTUD 5KBKA 1S7WB 1CT8B 3ZKXC 3DXAB 3WTWA 2VITB 4I18B 6CGTA 1D5MA 1J1OL 5A2BA 1E42A 2Q8BL 3K1DA 4WKZA 4YVUA 5DSCB 4AG4H 4ZNCD 1KSRA 5DD3L 4TOYH 3ARGC 3S37X 3L9BA 3EYSL 3EGSA 3FT2B 1N5AA 1N70A 4CDGC 3PAUA 1FF5A 2D7PA 4U1KB 4XN1A 3VFPA 5HYJB 1KNOA 2YS4A 1HNFA 2ZUYA 1RP9A 5LLIC 3WELA 5EO1B 3CLFL 2W0FA 4J4PC 2ZOTA 5C07D 3ULSA 5GZOA 3NCWA 1G7JB 1MFNA 5A2FA 1HHIB 2J1KA 2NTFB 4FQLH 5FO8A 5IMOB 1BBJB 3LRLA 4KRPC 2WINA 2ICEC 4UDTA 4Q9RH 5KVDH 4AC4A 4OCMC 3RU8L 4X4YA 1AE6H 4PJHB 3CXHK 1KTJA 3BN9C 4XBGA 5DHYB 3AG1B 4KITB 5J11B 1F4HA 2VN3A 3BXNB 3TBTA 4B7IA 4FLHA 1DE4A 1PLGL 3BEVA 4LCCB 4QD2E 5DTFA 5D7SL 1XD1A 5J13B 1GYCA 2JI1A 1AHKA 1GC1H 5DI8A 1OW0A 4JRXD 4YL4A 4P5MA 3FU0A 5E1HB 1CK0H 1INQA 1IGTB 4I87A 2Y7QA 5IQNA 3BUBA 1BD2D 2D7MA 4LCUB 4QEGA 3HZMB 4M1CC 1UACL 4HH9B 5ALCL 4OV6F 3ZDYE 3B2UD 1YC7A 3C08L 4TLTA 3IJ7A 5DA0B 4Z78B 4G2AA 2ZAIA 2LR4A 2RTTA 4UWQB 3DX3A 3C5JA 3EOTL 2P49B 2Z8VC 3B6SA 4NPKA 1BMGA 3BZEB 2BSCA 1DVQA 3FCSA 3OAYH 3FAWA 4GBXD 4XN4A 3RVTD 2H45A 1IB5A 3RIAK 1PZDA 4JO4L 1I1FB 5JHLA 3UTSE 3PAVA 3VXUD 1YPZA 4P8QA 4EOWL 2X6UA 2VZ3A 3QJZA 2A9NH 3MCKA 4P9HC 1HSAB 1VGKA 1A7QH 2VSMB 4POYA 1OLLA 1F6AA 1A6VH 1QFOA 2G5BB 2GVYA 2VXQH 4Z3JA 4ECNA 5KZCD 1B3JA 2CBTA 4PBDA 3NQKA 4F7MA 3V4PA 2GAZB 1WFUA 1VFOA 3UJIL 2L4OA 4NRYA 2DBLH 2A9MH 1S5IH 3G6AB 1C16A 4MNQD 1OSZB 2V2XB 1ORSB 4JVUA 4R6UA 1FNGB 1KBPA 2XQ0A 4LP4A 4UQIM 5CN3A 3EGSB 2VIRB 4UQ2A 1BXUA 1AZRA 4Z3HA 3E9UA 5IM7B 3FUHA 1CR9L 5KSAC 2HFFA 1QA9A 3OZKA 4XNMA 4APXB 5ADOL 4WFHD 2N4IA 1R5VA 1PS3A 3MLXH 2CALA 1XH2A 1AY1L 3FFCA 5E08H 4R7DA 5GGUB 2JH2A 2Y2YA 4F92B 2F7RA 2VXVH 4AIZA 5LQBH 1KCRH 3ETSA 4MA1B 3PWPB 1LP9A 2LU7A 5E1AB 2GHZA 1I8KA 1QZNA 4YSSA 4WEMB 1K3IA 4HPOH 2CCWA 4FOMA 2HKFL 4NERA 3MX0A 4L1DA 5F1OB 5AOZA 4G1MB 4BSJA 5E2TH 5GZNC 5LCVL 3HG1A 1S7WA 1ZHNB 4F27A 4R83A 1R3HB 4AGNA 1BM7A 4I18A 1MIMH 2EAEA 2JKXA 2GYSA 3DGCR 4MMYA 3LN5B 3RDJA 5J13C 2OMXA 1G9MC 2X89A 1KMGA 2YAOA 4LRIA 2H32B 3S6CA 1CR9H 2X40A 3WIIH 4Z18A 1AZNA 3KYNA 2ERJC 4IJ3B 2JKWA 5HHQA 4KNTA 3AY2A 4KKLC 4ZPTB 5FGRA 4P2OD 1CFSB 5GHWL 1EXUA 5J1AA 3GLDA 2XNAB 5JHLH 4U1SB 2R39A 5C09A 3UGXA 1JZ5A 1A47A 3S3SA 2WTRB 3LXAA 1RZFL 3GJFK 5GGRA 3ZT7A 1BLIA 2HMIC 5E1IA 4WFGD 3F7PC 1B0GA 4NQCE 3B9KC 4C56A 4TPRH 5MI0C 2PR9A 2WXQA 3T4AB 5CGYC 4LSDA 2UVFA 1V3KA 3DVNB 4PWIA 3K7UA 2CUMA 4PJ5B 3GMRB 5A7BA 1U2HA 3P0VL 4QXUH 3QEHA 4KX8A 1K2DA 1MCNA 4HP5A 4X5XB 5IIEA 3LEXA 4YDKL 2AJSH 4EBQL 1ZV5A 5I5IA 5GGSA 2UUDH 1UQSA 4IJ3C 5CFHA 3A6OA 4F2ME 2BVTA 2ATKA 4LVNB 5JNYB 3T0EE 3I75B 1YVLA 4ONFH 2VDLH 4X4KA 3H53A 3D39E 4XTRC 5I1JL 2Z8RA 3TZVA 4WFFD 1T5XA 2DWXA 5CF3A 4Q9QH 1FJ1B 2WNWA 3ROLB 4YFEA 3KWUA 3ULVL 1OCWL 3L3DB 1ZEAH 2BFVL 4O5LL 4OLEA 5BQDA 3QK0A 3BUYA 1SXSA 2YPVL 3B9KB 3VXRB 7PCYA 1HH9A 1RKRA 3TVMD 1K6QH 1NGPH 3FRUA 2XJLA 1KTRL 4DGVH 5GS0H 4LSSL 1XH0A 3BEWB 2YD4A 5DUBA 2IGFL 5HI5C 1O7SA 2XBTA 4WGKA 2WBJC 3QUKB 1UM6L 2HTKC 4WV1B 3TZVB 2LVCA 1ZHNA 4G3YL 4M00A 3IJ8A 3BZ4A 4NBZB 4OM0H 5FOBA 4UUJB 4J3OG 2XZQH 1UH2A 5T33L 4JDVA 3UTQA 5D4JA 1QSEE 4WU7B 1ZV2A 1FNGA 3P4NB 1HEJC 2XWRA 2Z35B 4W81A 3OJ2C 1TJIL 3OAUL 2ZOLB 4MNGB 1T22B 3AJ7A 5INCA 1RLBA 4I77H 3PWPD 4DF9A 1KJMA 4Y16B 5FUCE 4FFYL 4U1GB 3U1PA 4F9LA 4Q0XH 4XPTH 5JLZB 5KANI 1JK8B 1SGKA 4ZMXA 3BI9X 3CJJA 2QQLL 1CDIA 2VYRE 1S7UA 1SOSA 6TAAA 3OXRB 1R5VB 2A4EA 3QULA 3FMGL 3IPEA 1CI3M 3RWEA 2ZE0A 2FWOA 3MJWA 1NQBA 3C6LC 1I9RH 5AW5B 3CN2A 1FGVH 5ID1B 1RJYB 4OLZL 3ARWA 4RAHA 5AVUB 1TQUA 2LTQC 4NFDA 2P5EA 3WJJC 5EU6E 4K9EH 4GAJL 3WAJA 2OMUA 5I15H 2ZUWA 3FPYA 3A47A 3CGTA 3GTVA 2GITB 4D3CH 2CHXA 5CSBA 1NCDH 5E2WH 1EZVX 4NZTL 3D05A 4UB0H 5CU5A 2MIZA 5FYLE 4LVOB 3HRZC 5C0AB 3VXNB 1VEPA 1XF3A 3DV6B 4PJAB 1L5GB 3L4XA 1FIGH 3BDBA 4P2YA 5EU7C 2ED9A 2DJMA 4QIRA 4L3CB 1OAUH 3D3VE 3VFRA 3H3BC 2IXQB 5C0GA 3R4DA 2X9WA 2OXHB 5HI4C 2ZWLT 4D9LL 5A6IA 4A1RA 4YLQT 4ETQA 4P5SA 2B1AL 3VFWB 2QGEA 3O9WC 2H26A 3OKDA 1HZKA 4C8XA 4N5ED 5J9PB 1KUMA 5BXFB 3UMTA 4FZ8H 4LSTL 2BOCA 3NIDE 5HYSA 4QAMB 2VLRE 4LSSH 1KEGH 3GLZA 1JP5A 4XC3H 4LVOC 1SEQH 1CFVL 2HTLC 3L2LA 3UTTB 3W1ZA 1EZLA 4NLAA 4URKA 3UZEC 4IGBD 1I3RA 4OD1L 2DMCA 3BKJL 3AREA 2XWXA 1UASA 5J1TC 3VMNA 2XXFA 4FQHB 2C1OB 5CXPA 2GABA 1Z7JA 3O6LL 4DT2A 1OP4A 1TQWA 2KLRA 1DBJH 1R46A 4ZX6A 5F72S 1EFQA 1BQ5A 4Y2DB 1SDAB 2HX7A 2XETA 5T3ZH 1AHWA 1QEXA 3E8UL 4NAMA 3MRBB 5HGBA 1GPOH 4GMTL 2HT2D 3FQTA 3QEHB 4HT1H 3B3BA 2F61A 3DRQA 2GBVA 4LSQH 1E9OA 3LIZH 4Z76B 2KYIA 1JYNA 4D9RE 4XAKD 2O5ZL 3IJYA 1RZFH 3CZKA 3SDXB 1MFVA 3EGDA 4AQEB 4YHYB 1AJ7L 3EJQA 2W0LA 4K0OA 2XCMC 1UM5H 2DQFA 1UWEH 3FO0H 4RWYL 3NK4A 3AG4B 3HUJB 1X4XA 2OMVA 2PR4L 5DJDA 4DUVA 2ZWNA 2VAAB 5TF0A 3MJ9H 1CDBA 4UBDC 3MV9D 4OD2B 5HXMA 5I1DA 1JK8A 1NC2B 1TZAA 4EF3A 4ZFFB 3R8QA 2C9XA 4E5XG 4FMFA 3FU9A 3P77A 3MV7D 1WWBX 2PYEE 4IHOA 4YSDA 4KZCA 3U9PH 3ILDA 5E8PB 3MREA 4XVTH 4K8RD 3FH8A 2XRAL 1L9PA 3IGUA 3BZ4B 3PP3H 4DGIH 2NXYC 3GS7A 1L7TL 2A5UA 5DD3H 2D7TH 1KG0B 2I32A 4MB1A 2X6CA 2H6OA 1NC4A 2BSTB 2ZXEB 4NENB 5AVRB 4ODSH 4UZUA 2JMRA 4PB9L 3TPKA 5IG7A 3OL2A 4M03A 1CDCA 2VMJA 5D1XA 1KCRL 3D4CA 5IBLD 3MLYL 2COVD 3NSXA 4S0SD 2AFNA 2WUCL 5DC2A 1KY7A 4A2DA 3DK2A 2BS9A 1G1KA 4E41E 3PWUB 4N6RA 1E9QB 1M9WA 1JXDA 5TK4A 4LIQE 4HKJB 3ZGHA 4UU9A 3SGEI 2NZ1A 4J2XA 2NPLX 3AY4C 1LEKA 3UTPD 3A23A 2NW2B 1A7RL 1BLNA 3EOBA 3O8XA 5CSZB 5EU5A 4KY2A 3QRFM 1TCRB 3VFGL 3SE6A 1AS8A 4HUWA 4BFIA 1E8WA 4PV8B 4WWKA 3A4AA 4DQOL 5JOFA 3QI9A 3VXUE 4I2XA 5A2KH 3AB0B 3TCLB 1VLXA 5T3XH 3ZE0B 3UROR 5I18H 1UB6A 2WV3A 2AJZA 2QQNL 4V2CB 4Y8AA 4L8DB 3VD0A 1FFQA 1S7RB 3LVTA 3TH3T 2ZT9C 1P5VB 1LO5A 1MCPH 2OYPA 3OQRA 2PWFA 3BD3A 5EBLB 3S5LG 3ZDWA 5D2LF 3UAJA 2EKJA 3L2NA 5AKTA 5TQ0L 2VLJD 4AIEA 1GOGA 4G7RB 1F8TL 4J3WA 4Y8DC 1DN2A 2NY6D 2C3WA 3EYUH 2DQFB 4KJQC 1T0MA 4PW9A 5CP7A 1M42A 3FZUC 4ZFZB 3QBTB 1WF5A 1SLXA 4OIBA 5CMAB 1J12A 2JNZA 2VW6A 3V7AE 2NXYD 3WL9B 1WLHA 3FQUB 4OLUH 5H37G 1A7PL 2BS71 3GLAA 1ETB1 4GKNA 4BFFA 1LVEA 3W38A 4NJ9H 4F20A 1XH1A 3TEUA 2A38A 1X5ZA 4BZ1H 4HS6B 3QEGL 3WTXA 5ILTH 3UGEA 3BVTA 4UTBL 1QI3A 1RJZB 3HG2A 3BX7C 4XC1L 3UTTD 3VGFA 3SE4A 5TDOA 1TQVA 5E9DD 4AZUA 4TSBL 5I16A 2XU9A 3RTLA 1DP0A 5AB9A 2EUXA 4B96A 1FNAA 1RZ8A 4G9DB 3O4LD 5C09D 4ALAC 3AMKA 2BZ7A 1MZZA 4W9CC 3KBFA 4UQDA 5KAQG 1IGCH 2FBJH 5GJSL 4OF7A 1X5KA 5J6HA 4ZYKB 3WFEH 1QTYT 1Q9WA 5JORB 4Y19B 3NJKA 1H6TA 3AM8C 3EHBD 2X6MA 3H9SB 3NACH 1GIGH 3PNRB 4NP4L 4A68A 1TUPA 5GGSY 4Y4HC 1AZVA 2GIXA 3QCTL 1N19A 2DWTA 4ELMB 1DN0B 3W39A 2YQ2A 5B8CA 5CBAB 2K0RA 4IEFB 5GSRB 5TGBA 4FQ1L 1EAJA 4POZC 1N6UA 4JNXA 1XCTB 3G04A 1L9OA 1MCCA 5DU7A 1MLBA 3CDGA 4IM8A 4MJIB 3FB7B 3DIVA 4U6HA 1TU2A 2WSKA 4E41A 4OGYL 1EEZA 5IHZA 2JSFA 3GBEA 1YEEL 2OFQA 4NZ8A 2NY2B 4PS4L 3BH9A 2VR9A 4JVPA 3I02B 1NDMB 5DJCB 1MJ7L 4W9DC 4ZS7H 3C8KB 3CAFA 4W9ZA 2XTJE 5D72H 2R8SH 2CCLA 1NGWB 2G5BA 4OUUB 3PJSA 3TJEH 4M1GL 5CD3B 1AGDB 1UURA 1AKJD 1J8HD 1EX0A 4KXCA 4WNQB 3UAFA 5JXEA 2E9BA 1L9RA 2FECL 1P2CA 1NCGA 1UWFA 32C2A 4FQXB 4F80A 3ARGD 3S37L 4EN3A 1U4EA 5LNEA 4KVPA 2XKNA 3BWAB 4MVBD 1XGQA 3HFMH 3RVWC 5KYUB 1QEWA 1C5BL 1ZSDB 3ZU8A 1S7TA 1EGJH 4XXWC 3F7QA 3MUGB 3FFCE 3P9LA 4OFPA 1HE7A 2WLZA 2CR6A 5CS7A 5FX3A 5GPRA 1L0XA 2EO7A 4MNQA 2W59A 2ITCB 2Z31A 1GGBH 4C56E 4AEIH 1W0VA 4XWOC 3REVB 1PG7H 3RILA 3B9DA 5JXEC 1QSVA 5EPMB 1S7SB 4MJJA 2H1PH 2OPCA 1AO7D 5IESL 4YE4H 3L1EA 3RTQC 3LQMA 3D2TA 4PJCB 4S10A 4Y7OC 3WTYA 2Z7UA 1PD1A 2AQSA 3ABLB 1BZDA 1PFCA 1NUGA 4G6AD 3VXOB 2X7LB 5L4MA 3AACA 4CSTA 3IDYC 3ULVE 1BWMA 5JXAL 3LNHA 1OE1A 3P0GB 1K4DA 4DVRL 5KN5A 3AWEA 3EFFA 3NMEA 4W6XB 2ZAGA 3HNTL 3VDCA 2P8PB 2ZUXA 5C0ND 4F57L 4NFCA 4FF9A 4JRYD 4S1SL 4Y1SA 4OCYH 5ABAA 5EEWA 1R3HA 3WJMB 3NACL 4GB9A 5DK2B 4WSJA 3VFTB 3CBRA 5DFAA 2Z7ZA 5T1MB 4OZIB 5B8CC 3GWJA 4MAYB 1BM3L 2WY3B 3B37A 3QQNA 4F8TA 2O61B 3D8MA 4JPVL 3VGBA 4XZ4A 3DJRA 2ZWKA 3GRGA 4APQD 5J89A 5MEQB 4PRDB 4KKZA 2XC8A 2I60H 4FI8A 3CZSA 5CHNB 3LQAC 4NUGL 2I7OA 2ZUUA 4MSWA 3BPOB 4JHZA 3ILEA 1SLWA 2P24A 4R0LB 4L29B 4FG2A 4AH2B 1BQHB 3L13A 3MAWA 2NYYD 3H9HA 4A55A 2XACC 3QXDA 4Z7QB 5GGRB 2R1YB 4U2YA 3TN0D 4P3CL 1MFDH 3BUQA 3DHUA 4TQHA 2ZPKH 3D25A 1E5BA 4GP4B 1XGPA 2R2HB 3EDDA 3GZQA 2YD5A 3IETA 3OLIA 1E5ZA 2QMJA 2QQKH 5DEZA 2TSAA 3IN0A 4RMQA 2AGJL 4BK8A 3ZHNA 2HX9A 1S9KC 1BECA 1MLCA 4KK8D 3PQYA 2A83A 1JHTA 3UG3A 1KCBA 3HN8A 4C83A 2ITDB 2B8OT 3CSBA 4HJJL 4JFOA 1IV8A 3MRBA 4B7LA 1PX4A 2WQXA 2HWZL 5I75B 1UQSB 4N2CA 2G60H 3HUJA 3VX0A 3H2QA 1PQZB 1WUNT 1TLKA 1CURA 1Q72H 2CUHA 4UI2A 2DQJL 1DVZA 2B1AH 4ZMWA 4DETA 3SDXA 2Z6FA 4K7FB 3IFOB 1OANA 4BQBA 5F7HA 3Q8FA 3V9CA 4Z7WE 2LV4A 4YFLI 4BRVA 1Z6JT 2V9RA 1XF2B 3X3GL 5GIRB 3OC5A 3QHZL 3TO4A 5DMIL 3BGMA 3I9PA 1G6RH 3TBYB 2RQEA 3O6ML 3Q7JA 4JFFA 4UB0L 4M8UA 3GMLB 3ECQA 2CKBH 3O3DB 5BZZA 3HG1E 3SYAA 4DP0X 5FA3B 1LO3L 4LASH 5IHLB 2IANB 2M83A 3QDME 4G72B 3V4LA 5L9DL 4NGHH 4X8JA 1LK3L 4P0DA 2F58L 4YL9A 2D31B 4GI9A 1D5XA 2OMZB 3QAZC 3U7AA 1TQCC 1XGQB 3O8XC 5IVXA 3HG5A 5I15L 1E3ZA 5C0RH 4MJIA 3UTZA 4OI9A 1NCOA 4XCNA 1O7DC 3NA9H 4FFWC 4NJAL 4WGWB 2IADB 4LLYB 2WVVB 1PIFA 4DGVL 5GS0L 1A4CA 2OMXB 4LOUC 2HVJB 4R8WH 3WKNA 4UDTB 5AWNL 4L2YA 3TV8A 5T1LD 1SY6H 2E6QA 5C2UB 2PW2A 3KWVA 4M6NH 5B3SB 2F5AL 5HYQB 3NK3A 3Q5YA 3QIBD 1XV8A 3DHMA 3JT0A 2CO2A 1YO4A 3BQUD 5C09E 2CHNA 4ZUWA 2FTAA 5C0IA 3LN9A 1J86A 4XX1E 3CFTA 1YA5A 4P2QE 2NZIA 1ET8A 4LPWA 2EDLA 2VL5B 4G3YH 1JF1B 2OLDA 3V6OA 4AIZB 4JFHD 5KYNA 2FQFA 4JFDE 3EXJA 1A25A 4L5FE 2ICEA 3HPLB 5DJ8A 4ISVB 2DF3A 1IIIA 1U6AL 2BVPB 4XP6H 1BJ1H 4N86A 2YUXA 2PCYA 1RHHA 5F8QC 1UCBL 1CT8A 1X44A 4KROD 4BSVA 4YBQC 3TBWB 1K6QL 1P7HL 3DV6A 3P4OB 2NMSA 5TDNA 1WTGT 4WFHE 3PWNA 3S7GA 4TMPA 3NEXA 2QFRA 4Z7VF 4TSCL 5F2FA 4PG2C 1ZS8A 2NXZC 2ZUSA 2R27A 4G5ZH 4JAMA 3T71A 1RVFL 3ARGA 4H7VA 4PJBA 1CU4L 3PXLA 3FQUA 3FYEB 2R4RL 3QI9D 1G6RB 2XWTA 4OZFG 4PCYA 2VUYA 2XICA 3OX8B 9CGTA 2CK0H 2X4TA 1KPRB 1AGFB 2X4OA 3S4SG 1SLVA 3I2CL 2EXYC 4G8EB 3VFUB 4AKPA 5MEOA 4I1RA 1HI6B 1UOWA 3A24A 1T6VN 1JWMA 4CILA 5HDWA 4UTCA 5JA8B 3Q6GL 4RRPA 1KY6A 1SXAA 1A2YB 1DEEB 4KXZH 5KVDE 1B2WH 1N0XH 1LNUA 4KJYB 3LX9A 4PI2A 2AXJA 4NBYB 3Q8EA 1VIWA 3QFJD 5ESVB 3FO2A 3DX7B 3A22A 4RMUA 3STBA 1PDKA 4KHXH 4X6DA 4MCMA 2WUBH 1AXSB 1FO0A 1QNZL 4CBZA 1HNGA 4F9PC 1C08A 3CVDA 2VDLB 5KJ7E 2ZZUT 1LEGA 3GDBA 4GG6A 4NLHA 3MUUA 1BPVA 4JY4A 4X4ME 2Z91A 3GJFH 2E9GA 5IEHB 1J8RA 2CDFA 5FM5M 2HRPL 4ZFOL 4C56D 5I76A 3D2UD 4JM2A 1C12A 4MNHB 4OY9A 3KHOA 4YDJA 3CFJA 1UXMA 4B95C 5LAPA 1WZAA 4G7SB 5GZND 1S7XA 1T89A 5DQDH 1GTNA 3BDYL 3GJFA 3L2MA 4UT9L 4PJBE 2FB4H 4GQ9L 5GQBA 2ADJB 1F4XL 2BNRA 3GMPA 2QSCH 3KE0A 1OHZA 2ED8A 2ZTBA 1K3ZA 3P3SA 3OHXB 4ELMF 4OU3A 3ZUNC 1QI5A 3BD5A 3CDZB 3U82B 4M3KB 4UNIA 4ZODA 2DM7A 4L37A 2XN1A 4OD3H 1UG9A 1EDHA 5DUPL 3IM1A 4MZIA 5LGKA 2ZYHA 4BZYA 3B7UX 3IFPB 3GQFA 4DPBX 3UTZB 4KHXL 4ZDHA 3WEMA 1UKSA 4YHKL 2NQDA 2YMXL 3D3VA 4I1PA 3S8FB 4N4YB 4LPCA 4HW6A 4ZUSA 3ZE1B 3NA4A 1OL0A 3J2PA 3UIZA 1WV7T 1PMYA 2XPGA 3WN6A 5LVEA 2BOLA 3ARBB 1YYML 1AY1H 2E3VA 4KRPD 2PPFA 2Y07L 5FKAA 4A7VA 4DK6A 3QORB 5D1XE 4JFEB 1U2CA 5KYYB 3IKKA 3QWRA 1J1PL 2QQQA 4K8RC 5I8KL 1W0VB 4XP5L 3FHAA 4PJIF 4Y16C 3HE7D 3MREB 4JRXB 1ZIBA 3HLKA 4AQ1C 1DANU 1XCWA 4PJGA 3OMZA 3F65A 3OJDB 2J71A 1BQSA 2BSBA 3F12A 5G4MA 4AEFA 3LZLA 3QFDA 1GMEA 1X5IA 2PWEA 5AVTB 2KT6A 1I4FB 5DWPA 1FN4B 3WS6A 5EEZA 1FBIL 1GY1A 2O6PA 3ISRA 2NUTA 3T6ZA 2ZKXA 5IT2L 3MLTB 2FJGB 1KJ2A 2K8QA 3FW6A 3QJFA 4DVRH 4DZ8B 4XNQA 1N26A 3D4ZA 3CK0H 2A6IB 3ARFC 5TD4A 3FSAA 2HRGA 3ZTJG 5E70A 5DHVH 4NI6A 2R2BA 5KZCB 4NP4H 4Y19E 1A7BA 4HX1A 4KKPA 4JFUA 4Q74A 3RZCB 3ZE1E 4TNEA 3FC8A 4H5SA 2VO5A 3FQRB 4I5BA 2Y7SA 1S7XB 5J12B 2XKSA 1RHFA 3F8UB 3JV0A 4JKWA 4JW3A 5F70A 3TO2B 3UP1A 2JB5H 4YHOH 1I8UA 2FEDC 5BS0B 4A37A 3RY6C 4WO4C 2GKIA 1NAMA 1NCWL 3QG6B 3QQ3B 3OD3A 4KUCD 3QJHB 1DBML 3T3ME 4M9OA 2Z4TA 4GO8A 3VXSD 4K94L 1AKPA 1X7TA 1U8KB 2E86A 1VF5C 1BD2B 2EO1A 5I1HL 1EXHA 1C08B 4RSYA 4WI8A 1YPZB 4KRNA 3ENEA 2CRIA 2XWDA 1AH1A 4NM8L 5FECA 1DQKA 3F7YB 2P3YA 2P44B 4OZHF 2KDYA 4AJ0A 4FQLL 5I1AA 1LO3H 2OCCB 1RU9L 1GYWA 3B6SB 4Z0XA 1QLEB 4H0GA 4YDMA 3H1ZA 4EIUA 4PS4H 1NCNA 1R3JA 4XH2A 1K5NB 4P2CG 2BSDA 2GJPA 4F7MB 1HHGA 1JZJA 2N56A 2AEQL 5MEPA 2YJQA 4RDQG 1MQKH 3KVPA 5DJ2A 3P40A 1WBYB 3ZKNC 5SWZD 3WKPA 1XH3B 5L0QB 5IJDC 3EO9L 3NVQA 4JHBA 4K94C 4JPKL 4YLBA 3SO3C 4NHCL 3WFBL 4DPRA 3BAKA 1S3RA 1OAQH 1JGVH 4F33A 1G7QB 1EH9A 3DJTA 3L45A 3VXUB 2CCVA 5IW3A 5I73C 4XNUL 2NNFA 2YEQA 5F9WB 4TXVB 1U33A 1MIML 3VFGH 3L81A 4JQXA 3BZDA 1PJ9A 3LPPA 5IF0A 2I07B 4YSCA 3OM3B 4YZWA 3L3OA 1JGIA 2I9LB 3QR1A 3VMPA 4EEEA 5DTFB 3ASNB 3C2SA 3WIHA 5C0BE 3CX5K 1GYUA 2ZPKL 4CUCA 2NY2D 1N8ZB 2IADA 3UX9B 1CCZA 1CXFA 4BINA 4NQVB 3TWYA 3L5WA 1NCTA 3FQRA 1XR9B 3GI9H 1RCYA 5EIVA 3K71A 1EXGA 2E6PA 4JFPA 1S7VA 1OP5K 3TWCH 1Q94A 4M5YH 3LB6D 2GW5A 5EU6A 2ZAHA 4LQFL 2IOIA 2NY6C 4KJQD 4HAFA 3AROA 4X0NA 1D7DA 2DTMH 3DXAA 3WEAA 1T20A 5L2KE 1RLWA 3VWJD 5EF0A 5A2CA 1GSMA 3KCWA 4LDOB 4Q56A 3T77B 4FERA 3X17A 1WG3A 2WSDA 4XCYB 2CJSA 2H7WA 1EHXA 4MLIA 4G6KH 5KSAA 5MHSE 3QORD 1SN5A 4OZFH 1LP9F 4FLRA 1M6OA 4YK4C 3VXMB 4DOHE 4KRPB 1FIEA 3IFLL 5ICZB 3ULUH 4N6QA 1BJ1J 3BRGC 1FQ9C 4M93C 5FYLH 4CN1A 4ZOBA 4PRHE 4JFDB 4AM0A 3OKKB 1MELA 4MXVE 1A66A 2JKRM 3BAEL 4OFYA 3RPIA 1A6VL 3P02A 4U0RB 2VDQL 4X4ZA 3N50A 4PJXA 1LDSA 4UQEA 3CVHL 4PJ9D 2IH1B 3OWRA 3IFLH 4XI5C 2CLZA 5T3XL 3SDYH 1SHWA 3WFDH 5BOZG 4TLUA 5DURB 3BGFC 3QUZC 1IFHL 4PG2A 4QGTA 1GGCH 1WA0X 4YDIH 5C8JB 1MLCB 2AABH 3ZHDA 4QYOB 2UX7A 5FW8A 5F88B 4P48A 3LZOA 4A7UA 1QPKA 4LEOA 2Q1EA 3CHSA 1HHKB 4DGWC 2RB8A 4DZ8A 4TUJA 4LHUD 1F90L 1L7IL 4N1CA 5EDSA 1FG2A 3D0VA 1AQHA 3FZUD 3RPKA 1H3VA 4UQ3A 3ATBA 4YC2B 3OR7A 4IOFC 2VZSA 3QUMH 5KG9A 3FB8B 1IL1B 5CP3H 2AJ3A 2DJ4A 2HLFC 3Q6FA 1T7VA 5E6ZA 3C6SA 2KH2B 3B1TA 1E27B 1F58H 1PD0A 1YDPB 1YY8B 2MNUA 1ZAGA 1OW0C 1ZLWH 1RZJH 1OPGL 2X88A 2KZ1B 4IKIA 4XNZB 3WFCH 5I17A 3DETC 2J8UF 1ZPLA 4JN1L 1QRNE 4FYSA 5KUMA 1NEUA 4WDIB 5DUPH 3U2IA 3TJEL 4KQ0A 1BJ8A 5CJOL 3MACH 1WYJA 2OAAA 2K9FB 2KZKA 3DGGB 5GGVL 1LWHA 4CBPA 2LFEA 1JGLL 4NZFA 4K71B 4ZPTA 5DMYA 2GTWB 4XBEH 1I9JL 1NCHA 1SOQA 1MQ8A 1RURH 5CBEB 4JY6A 3D25B 4W9HC 4L0YA 3ZYOA 1QOKA 3EBGA 3MRCA 1XR8A 3U6XS 5TE6H 4DW2L 5F7EL 5I1EH 4YSAA 3OKOB 3VU1A 1J8SA 1SDDA 3MLUL 4OKVB 4M62L 2BXZA 4PRNA 1PTZA 5DZOA 2QBWA 2GSGB 2BIOA 2NY0D 3CDZA 2I27N 3MRLA 4GRWH 4PJFB 3TO4C 1P1ZA 3QUXC 4MS8C 3UG5A 4HKBB 4E9QA 1J9SA 4B97A 4BQCA 3FH7A 4UT6L 5A3ID 5FFLA 2NY4B 1BAFH 1TZGL 2RHEA 2KQNA 4LHQB 3ETTA 3QO0B 1G0XA 3ESOA 2AKRA 1I8IB 4L8SB 3SDDA 1S7QA 2WKGA 3OJVC 1MFEH 1T6BX 4Z7WB 3LKPB 1G4MA 3QC6X 4O2EA 3LN4B 3W0WA 5CILL 4S1RH 3GKWH 3UTSA 3RX8A 4N2KA 4AYFB 2EH8H 4H40A 4OQ1A 2ZSWA 3F01A 5JIMA 1PW3A 1T2XA 2X09A 4LOFA 4S1DC 1V5JA 3FU7A 4AEEA 5E2JA 3IWVA 5C0CA 4P2OA 2OZ4L 3VSUA 1RIHH 2X7LA 1ZS2A 3DSFL 5F89B 2DM2A 2EIKB 5CP3A 2JE8A 1E4JA 3L4ZA 1DJWA 5F7LB 3UYRL 3IU3B 3SPIA 1B0RB 1H0DB 2YIHA 2PPCA 3DOSA 3IK2A 3LSOA 2Y7LA 1ZVSB 2XN0A 2CLVA 4G6MH 4K3HA 3UZQA 1NFAA 4BWWA 4Y5YB 1OOAA 5ISZE 2EYTA 4JFWA 2ARWA 2ETWA 4LPUA 3ZL4H 2OW6A 4QTFA 4MCZB 3APFA 1IC5L 2WBKA 3K91A 5H37H 5IQOA 3MTRA 2OXGB 2YKLH 3K72B 5IB2B 3B3IA 1MCPL 4IU2B 3WFHB 3ZZLA 1HE8A 3BAJA 2HT3C 3B7YA 3APCA 4HXBH 3G5XA 4HV8A 4Y4KD 3DMMB 4Y5XA 5H37A 5E1QA 5I82A 2DH2A 3HFFA 1KYAA 1OT4A 1ODAA 2E7BA 4BELD 1CD9B 2WZAA 2QLVB 3WTSA 1PZUB 4KQ4H 2OL3L 3GBNH 3CG8A 4F7PA 3QG6A 3QQ3A 5IV2B 1N18A 3RWJB 2F5AH 4PRID 2AJUH 4OJYA 3WJLA 2H2SC 2WK2A 3L54A 4FXGC 1CGUA 4PY7A 3OLDA 3P4MA 4GKZA 1QW9A 4Q6KA 3TTSA 1JPST 4LL9A 5KVEH 1KXVA 4ZAKB 3RTQA 3HN3A 4R26H 4PRIB 4BUQA 2XTJB 3QJQB 4K15A 3D09A 1HYSC 5F6HI 1OWRM 1EJOL 1OWWA 2VUOA 4MMZA 2H6UA 3MLYH 2BNRE 2Z31C 4NHUB 1VZHA 4Y4KB 4DIXA 4KROB 3GS0A 4DN3H 3PV6A 3OB0H 2VB5A 3CN4A 1K9TA 4M7JH 1Y18A 5KVFH 4R2GB 3D18B 4NQCB 2QQLH 4HUUA 4YWGL 1L7TH 2WXIA 4JZOB 4UQ3B 1J0ZA 4G8IA 4MRCA 3NEOA 1L9MA 4I0KA 2G4EA 4EN3C 4D0BB 2FCBA 3MCKB 5DJYA 5KBPA 4Z7UA 2VNCA 2KHAA 5M94B 2CJUL 1M7IA 2GCYB 1YDPA 2L8AA 1UOVA 2WO2B 1E5CA 3W5MA 1CGVA 1NTDA 5AYQA 5ECGA 5EUKA 1B0RA 2QSVA 3SKUD 1F4XH 3GI8H 1YJDL 4PJXE 1G84A 2C9UA 1U8PA 3CFCH 3IJEA 5DLML 5I0YA 1PKOA 3GM8A 4F2MA 1JNHA 3MA7B 1X5GA 2XXMB 5CJQL 4ZUVA 1EMTH 3ARBA 3S9DB 1LLAA 1XFPA 3RKDC 5F1SA 5KVFL 5HHPB 3MI6A 5HDLA 2OMUB 2COQA 3LKPA 5I73B 1IM3D 4N6RB 4JJ5B 4H13C 1J5OH 3MRKA 5EV7A 4YNYA 2VDNL 2V33A 5F3HA 3RKDD 5FYKH 2X70B 1N4XH 3UTQB 1NFDF 2D9CA 3PWPA 2EDRA 2GJ6D 2NY7H 1NDGA 5HJDA 3MDJA 2VE6B 4BUHA 4L18A 3OHXA 1UD3A 3CDCA 2XA8L 4AIOA 3LKRA 1IZJA 3SD2A 5JLZA 2VXSL 4CNIB 4M43L 1RK0B 1LQBC 1IARB 5C08A 1UB6B 5IY5B 3ARZA 3NFNB 4ES8A 3ESMA 1KYUA 1DL7H 1NIFA 2WCPA 2FX8L 1NGQL 4JFZL 1AD0B 2N3JA 3KDMA 2KL6A 2HRPH 4WI6A 1DQDL 2OW7A 4LVHC 1BA9A 4ZNEE 3D85D 2BSED 3SE9H 2E8YA 3QXDB 5I30L 5M95B 2GPZA 1RXLA 2J8UA 2R2BB 3MNMA 3LS4L 4KVCH 1P5UA 4BSWA 2X4PA 2IPTH 1WICA 3RTQD 1ZY9A 2AV7A 3MV8B 5AOJA 1MPAL 2HFTA 3RP1A 2WIIA 5B39G 4MQXD 4ELKB 2V2TB 5BOJA 4UAOC 5CSGA 4EZLA 1AD0A 5IFJB 2BP3A 3G5XB 1MREH 1QHOA 3A67L 4GUPA 1W0WA 2WBWB 3D4YA 3ILPA 2YPKA 2CQVA 5F0MB 4F8QA 1EWHA 2KS0A 2VXQA 4MX7B 5DVOA 5LGYA 1CD1A 5EWIH 1ZV9A 5FYKL 1MH5A 1NKRA 5HJGA 4FYTA 4YC2C 2WXMA 4HLJA 1FL3B 4A38A 3NUKA 4H20L 3MZTA 2R0KH 1TIUA 5JPNB 3TU6A 3VXPB 1IGYA 4OBRA 3X13A 5BO1L 4KMTL 1TYJA 5AWNH 2X4NA 2W5PA 5D70H 1NFKA 1KB9K 2A74A 1CYXA 1X9LA 4G5ZL 3TBWA 4I1NB 3QUYA 1CE1L 4M1DH 4PREB 4NO5A 4PJ9A 4MQSB 3C6SB 2OYLA 4AJYV 4HJTA 1EBAA 3CVCA 4IOIB 2FH6A 5CO1A 4PJ8A 3T5WA 2R0WH 1PLGH 3L7FA 4W70A 2IFFL 2R0LH 4MWFA 3MLXL 3QHFL 3V4VH 3RLSA 1U91A 1U8OB 5B22A 3LNFA 5DHYA 1QUNA 4KZ0A 5I1KH 4NWTH 1H5BB 1KN4H 3NCYP 1EFXA 4JHVA 3KJ6H 3RY4A 5TGBB 3INUL 2IMNA 3LEVL 4DCQA 1NIAA 2MOVA 1INQB 4IKLA 2EDTA 4YJZL 3DVGB 5D1XC 2J6EH 3WLBB 1VCBC 4F93B 3HMXH 4H20H 1HHJA 1SJHA 2JQZA 2FNBA 2A9ML 4APQA 1S9VA 2KKQA 2X2UA 1BD2A 4JDTL 4BM7A 4KTYA 3U7YL 1XTLA 3AG2B 2QPSA 4PYGA 3NDYE 3VCLB 1NIEA 1ACZA 3CZFB 5A6LA 4MD0A 4AGMA 2BW5A 3DXAE 4HGWA 4NO3A 1T20B 2AAVA 4L3CA 4ELMA 3S4SB 4DHLA 1XGYH 1QLFA 3T8XB 4BQ8A 5IHZB 3ZT6A 3LH9A 1P4BH 3AXLB 4KVCL 1FO0L 1X9QA 3L3IA 1S7VB 4L9LC 2DIBA 4XPAL 4HS6A 3S97C 2AEWA 4ZFGL 5JPMA 2H5UA 2IALB 3IMTA 4PJGE 5D6DA 2VDKH 4F91B 4BGLA 3K6FA 3HB3D 5HI3C 3QG7H 1U41A 3I3DA 4K5MA 1FNHA 1L3NA 3FO9A 1MFAL 2NY1D 5T1KD 1KIUA 1BREA 2RR3A 4EDWL 4WI4A 5I16B 4HBCH 2VLKE 4ODTH 1BYNA 2HFGH 4OV5A 3FTGB 4MNGE 4DSYA 3X13B 2EDQA 5DVKA 1HESA 4EE2A 1IGML 3AT9A 4OGQC 1FN4A 4XWGL 4GS7B 1AGFA 3VXNA 4YHPA 1FZJB 4MXVF 4NRZA 3KPLA 5DYOA 1MJ8H 2V17H 1Z9MA 4JE4B 1KBKA 5KW9H 1S7RA 5A2AA 4PJ8B 3VM7A 4M6MH 3PP3K 5B38G 4EUPB 1HIML 4GAGH 2FQDA 3ZK0A 3D33A 3D48R 1JNNH 1MJUH 1BZQK 1HXMB 5F97E 1J5CA 4HLEA 2HKHL 4ALAL 1GZPB 1FG2B 3ARBD 2E46A 3GXDA 5LHDA 2Y1VA 5LGHH 5I30H 4KK5D 1SVCP 4YDVA 3AREC 1FNEA 2J6EA 2ROYA 1Q90A 5IHUH 5IKCB 4PP2B 2YBGA 4UDUA 4DGUA 2ADGA 3HOGA 3LNEA 3NZ8A 4PAZA 1K5WA 3WXWL 2Y69B 1OIOA 1PZCA 3KYOB 4LL4A 3UO8B 3W82A 1MH5B 4EN2A 1CFQB 3BVXA 4PJ8D 4JS7A 3CH1A 3ZTNH 3BVVA 2P4AB 2YAEA 4U3HA 3M17A 3O3AB 2I5YL 1FFOA 4CC4A 5E8OA 5EBGA 3P9MB 3ZHFA 5KVMC 1GGUA 4WWKB 4N24A 5SX5K 5JOFB 1IUZA 3A4EA 2AV7B 2D0FA 3O9WA 3VD9A 4KHTH 5GJTH 4XCEB 3US0A 4IKJA 4OFVA 5IB5A 4MSWB 5D1ZC 3ZDXB 3ARYA 4PS3A 4ZW6A 4WFEE 4LQFH 2OV0A 3TWCL 4XRCB 2Y2TA 2J12B 5T1KB 2HN7B 2EILB 4JFYA 4P2RB 1XR8B 1ESOA 2Q6WA 3SZ6A 3M17B 5T1DH 3VTAA 2WOYA 2ZKHL 2DTSA 4XMKH 3MQIA 1GY2A 1YUHA 4KDWA 1AVAA 3VYNA 2VXVL 1Z3GH 2D7NA 3F83A 4FKEA 3ZSSA 1BOYA 1OCOB 3BH8A 3WN5C 5HHNA 5I26A 4JB9L 1OB0A 2Z91B 2KERA 3N40P 4GG8B 4N22A 2J5LC 2VQ1A 5CGYD 1HSBA 3QDHA 2HPOA 5IESH 2VIRA 4UQ2B 2IWEA 5TE4L 2R8SL 1IFHH 1YNLL 4YDIL 2VWEE 1OF0A 1AXSA 1FO0B 1WVZA 5EEXA 4Q2ZB 3UYPA 3V0WL 5IVNA 3QIWA 4Q6IA 4PJIE 1HEZA 3JWNH 4K7FA 4Y2OB 3FFDA 3GUTB 1ND0B 3JVFC 4H1LG 3L3OB 1UWYA 3S0PA 3GEFA 3GSWA 3CMGA 1DUYA 1DVFD 5DQ9B 4U7SA 4AYDC 2HX8A 5LGHL 3RWFB 5J12C 4B6ZA 2AJVH 1THCA 4P46C 3MVSA 1R3KA 2HKHH 1EZSA 4YSPA 2BSSB 2YD7A 3H2PA 2WLLB 6PAZA 1E9OB 1EAQA 2CO6B 3BAEH 4HU8A 1PLBA 2XKNB 3BWAA 4JO4H 5KVEL 5K9JH 4PRAA 4A63A 4LF3B 1I3VA 2ENQA 5HHVL 3GSUA 1PSKH 3MRPA 4PGZA 2XWCA 2D3JA 3HBGA 5KWYC 4YHIB 4GG6F 2GFBB 1QSEB 4G8FA 1KN2L 2MEJB 4XCYA 2ITCA 3MLWH 3HLAA 3VA2C 2A9AA 1HNYA 4IIQB 2JCWA 5LB1A 2C5DC 2YFNA 2NDGA 4WK0B 5FF6A 3WFDL 4MMXA 2DYRB 1PEWA 2HVKA 4FRWA 5BS0E 5K69A 4HZ1A 5HHQB 3D34A 5DK3A 1S8DB 2EDDA 3NTCH 2BCMA 2JI2A 2HFGL 3MN8A 1IAIH 1ZT7B 1O6SA 2WGNB 2OSWA 5LGJB 3QXTA 3DECA 1EZVY 4NWUH 4QR7A 1KB5L 2JJUA 3MLWL 4IMLA 1JD7A 3ARTA 4P9MH 4P99A 2HUEA 1FVEB 5AZEH 4YX2H 5C0CE 3ULUF 4PJXB 4JEGB 4UNTA 3PWJB 3NN8A 3GIZL 3MRDB 5D2LA 5BVPH 3B3IB 1F56A 5E9DE 3TIDA 3EDEA 4HWBH 1BP3B 3INOA 3QQXA 1SN2A 2NY5H 5AL8A 3DIFB 1MWAH 1WS8A 3CLFH 3CVHB 4HJUA 3VFWA 1EQWA 4M62H 3K6SB 3MHZA 1R17A 2EZ0C 1Z9SB 1IC1A 3VD5A 4PIRF 3DX2A 3PGDA 1ROWA 1EDYA 2FWLB 2C3VB 3P4MB 2CK2A 2XV6B 3LSOB 4GKZB 3P3UA 4I13B 4OGZA 2O6DA 4X4XA 3KBEA 3PUUA 1J1OH 2J6EL 3RI5F 1RU9H 1A1OA 4KKQA 2JB6B 3VWJA 3R06B 4KAQH 1SJEA 4AQ8C 4RZCB 4G8EA 5I8CA 1CQYA 1GHFH 3E2HB 1GZHA 2EXYD 1XSJA 2BIQA 3DARA 1BBDL 4P9ML 3RNKB 4OSUH 3SKOB 2WXOA 3MRQB 3HHSB 2YAMA 4OJDH 2V3DA 4PB9H 1M2OA 1AZZC 4JFXA 4X5WA 1SPDA 2AQPA 2ZP8A 3H85A 4S1QL 5EF2A 1S9XB 4PWFA 1GTFA 1YAIA 4FKHA 4G42A 4FJZA 5CN1A 4MQTB 1KEML 1CFBA 2PCFB 4FJYA 3R4RA 4JZJB 4N8UA 3WEBA 4WWOA 3LQAL 3BN9D 4PI0A 1HHIA 3I3BA 1KN2H 1T1XB 3IDMB 3PGCA 4PJFF 4J23A 1J0YA 3EKCA 4N1HB 5E00A 4U4BA 3VNYA 2AQQA 2QSCL 4G6JL 5DJ8B 3QJOA 4HKZA 5DJXA 3IDIA 4Y4HB 3J27A 3ARDC 2J2ZA 5CR8A 5ISZB 2FL5A 3V7MA 1GGCL 1GA2A 5TDNB 3QYCA 4M7ZB 3MRNB 5EZLB 2VERN 3TL5A 1TMQA 2P42B 2VLKD 2JJTA 2XV0A 4QHUB 3T0ED 4X7TB 3QRGL 2GT9A 1TZHB 2ED6A 3T8XA 2WWKT 43CAA 3KPNB 4AMWA 1IAMA 3LPFA 2NW3A 4BFNA 4XBMA 3RVTC 5FS5A 1UA6H 4U7KA 3X1EA 4CJ0A 3VMOA 2M2DA 3MV7E 2LU3A 1ZLSH 4IBYA 2X9ZA 5J57B 2FDBP 4XX5A 3VWKC 4M6OL 2J20A 4JDEB 3ROOA 1D5ZA 4PJ7E 1P6WA 3WENA 4WW1A 3EJCA 4QRTB 1UADC 3EYQD 1H3PL 4X6BB 3VI3F 3KLAA 1JWSA 4ZAKD 2FR4B 1NIDA 1YEIH 4QRSA 3UDWC 1UWXK 4NNPL 2HTLD 4KNUA 2ESVD 4RGMB 4UIMA 2ZX8A 4N0UE 2EDFA 1J05B 2BJMH 4CU6A 5HYJE 3TBYA 4ORGA 3D0LA 3DPBB 1HHKA 3IPFA 4NZDA 4LLUB 5D8JL 1WBZB 4A6YB 1U95A 5KBNC 2ZOWA 2IH9A 4Y7MA 3SDYL 3OC8A 4N2BA 5L8JB 5AVWB 4CW1B 5JDSB 3HC0A 3GO1L 2YBRA 4LEXL 2JJWA 2R4RH 4PR5B 3TYFA 3N3EA 3H3PL 2DQIL 2PCPB 3SJVD 1KEGL 1H8LA 1X4ZA 3CN3A 3R1GL 3LH8A 5FYKU 5CCKL 2QHRL 4JQIA 2FUQA 3JWDL 2RJMA 1OVZA 5I8OL 3FTSA 5KTEL 1FYTD 2NUTB 1FAKT 4FXTA 4XR8C 3KBPA 5J1AB 3EBHA 2G3ZA 2FJFB 4GYBA 4OZFA 3HC4H 3PQYE 5LJYH 1ZSDA 3BC9A 3CFKA 3G6JE 1G7LA 1N12A 4LP8A 1I31A 2NR6D 4KH2A 3EDKA 4WU5B 3K80A 3OXSB 1EHAA 1HZHL 1P84K 3MX0B 1TJMA 2DM3A 3KZ8A 3F62A 4CKQA 3EYFB 1IBZA 4TNWK 2ICWI 2UYLB 4KK8C 3WNKA 4CVXA 2ZYRA 1VZGA 2H1LM 2YFOA 3TT3L 1V7ML 2GJ6E 3BPOC 1FZKA 3P11L 2DMBA 3SN6N 2CRYA 43CAB 1YNTA 2VH5H 2O5ZH 5AYUL 5F3BB 1U92A 4Z76A 3C5SB 4OZGE 3ZXAC 1WCBB 1QBMH 3R1GH 3WIHH 5JHDD 1D6EA 15C8H 1M6UA 3AMLA 1SBSH 4L4TA 2WZ0A 4N90D 1OT2A 2QPFA 3LNDA 4OLWL 3UEQA 1OSZA 4GSQA 3L9YA 4OZGB 3SQBB 3FT0A 2IF7A 4APQB 3X14B 1MRFL 2O6CA 2ZCHH 1FNLA 1JWSB 2FR4A 4MNHA 2ZKMX 3QQDA 4LSPL 1RZ7L 1RJZA 4NI3A 1QR4A 1WP6A 4IHOB 4JRYB 3KPRB 5B38A 1NOFA 4N5UA 1G7QA 5H94B 3GSVB 4K3GA 3CVIL 5HP5A 1EFXD 3MLRH 4KK6C 4GIAA 5T3ZE 1K8IA 1P4UA