3PAYA

Crystal structure of a putative adhesin (bacova_04077) from bacteroides ovatus at 2.50 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
302
Chain Sequence
b'GSCDSIREDLPRCELWLEFVFDYNMEYADAFNPQVKSVDVLVFDSDDKLLFTKSVKVAALVGGNRMSLTDELDFGSYKVLTVGSLSDRFRLSDNAGNKLVPGTTTLQQVIVSLKRETGGVNFEFQHLYFGEVVEVDHLPSNTNHKIYPVNLIRDTNRFNLALMGYEENQYTFEIQAPENAVYSWENEPTGQGPITYVPYYTDVVMSARLNTMRLLNRSGWDYKFIIRDANTEAEVWSYNLMTLLSIARPVSRYDGTELPFQEYLDRQSEWNLVFTVVEKNGGGFLQIGIVVGTWIHWLHGME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative adhesin
molecule tags Cell adhesion
source organism Bacteroides ovatus
publication title Crystal structure of a putative adhesin (BACOVA_04077) from Bacteroides ovatus at 2.50 A resolution
rcsb
total genus 64
structure length 302
sequence length 313
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3payA01
3GF8A 4QDGA 3PAYA
chains in the Genus database with same CATH superfamily
2PCXA 1J0YA 4OCXH 1QA9A 2PYEA 5CJ8A 1PY4A 1DDHB 3MRRB 4U33A 2VDOL 1JV2B 1H3XA 4GS7B 1BCIA 1B0RB 2Y07H 12E8L 3RA7L 1NBZB 3HPLB 1TQCB 4ZUSA 4QXTB 2AJ3A 2WSPA 3IPFA 4B9JA 2BY1A 1YJDC 4ZO7A 3U1QA 2FX8L 4Y16D 3TV8A 1N2RB 1QNZH 2Y2TA 4N8CH 4EOWH 3EFDL 1VEPA 2GABA 3CXHK 5IFJB 2WLJA 5E4IA 5ICXB 1EEZA 5ABZA 2GBUA 2Q8AL 4GG6B 3ZDXF 2IXQA 4JKWA 1KGWA 1CK0H 1UASA 3S5YA 1BMZA 3FFDB 1F13A 1V3KA 2WBJB 3QIWC 4MMXC 3WHE1 2GIYA 2NNRA 4GYBA 4LFHG 3PWNA 1YQ2A 3D69A 4RFNB 4AG4H 5C70A 1ED3B 1S3RA 4MAYC 4UQ9A 1TJXA 5I17B 4BK8A 2IANB 4BV1A 2IGLA 4IU3A 3KEHA 3T0BA 5J13C 1JUFA 4AIXA 3CC1A 4HFUL 4QO1B 4DVBA 5IUCA 2AP2A 1JF6A 2BCMA 3D51A 4MMZA 2WGXA 1G7LB 1RULL 1WBXA 2AITA 3E38A 3LB6D 4M1GL 4OIFA 4H26A 1JAEA 4DKAA 1MHPL 2P28B 1IC4H 1FSKC 3LKRB 3KEDA 5MI0C 1R3HB 3PYCA 4JM4L 1SEQH 3KPRB 4JZNB 3NCXA 1RUML 1DQML 2GBVA 3LMJL 4PJ5D 2MKWA 3EGSA 4CUCA 4F37F 3Q43A 2L7EA 2A4EA 4WENB 2NT1A 3RUGB 5T3ZH 3TYGH 5KS9A 1QLRA 1FP5A 4NJAH 1KELL 4BA0A 1B2WH 1KLGA 2N1KA 3BQUD 5LGHH 4XCCH 5B1JC 1QFUL 3VFVA 1W0WB 4QLRA 4X8JA 4UM9A 3RWEA 1HQ4B 5FV2A 2JB6B 2WUCL 3WS6C 3L3KB 2YD9A 3JTSB 3H6JA 3M88A 4M6AA 1J5DA 3IDGA 5CINH 1KWGA 2C9UA 1UCBL 3JYCA 2ICWJ 4X6EB 3UTZA 2HH0L 2IAMD 3TT1H 3MR9B 3I85A 3TBSA 3DI2B 4AE0A 3E7JA 3N2JA 4PWGA 1TQBB 1I4FB 1T21A 4XNQA 3WKNA 4MVBD 3R7QA 4G1MB 4BH7A 1XO8A 5D7LB 3SOBL 3RZWA 1KCWA 4FQHA 4NZRL 3LQAL 3FF8A 3EXLA 1GGCH 2OLDA 1IAOB 4MDJA 3CGTA 1WT5A 4J8QA 5I75B 1PX4A 2NYZA 4WEBL 1FRGH 1LEIA 5CEZD 3ARDB 3CFDA 1JPSL 3CE1A 1R1CA 2X87A 1QFOA 1GSKA 1QPXA 1A02N 3V5DB 3JV6A 4ZQTA 1ZTXL 1CT8B 4I5BA 1JWSA 1JV5B 2J25A 2BZDA 2A9NH 1SDDA 1RZJL 2FGWL 4UF7C 1S7TB 2H0JA 4P2OC 1U3HC 3FT2A 3QCTL 1D5BA 1X9LA 2JQMA 2QV2A 3RWJA 4F80A 1MWAA 2YWZA 4R4FH 4AT6A 4B9KC 3BX7C 4CVXB 1UFGA 5E2WH 5KBPA 4E2OA 3L08A 4P06A 3RQ3A 4NPYB 3FONA 4WGVB 3T1FA 1F6FB 1Y07A 5IP4A 4G5ZH 3RWHA 3U2SA 4CMMA 1L5GB 4KXBA 4DP6X 3OAUH 3R19A 4MMXB 5KSBF 2DIAA 3KCPA 3WFEL 4FQIL 3BAYA 3GSWB 2NNAB 3KWWB 3N42F 3UL4A 2MQCA 3VXSA 4XTRD 2ZJSH 1O5PA 1B4LA 3CZJA 5LKNA 4ZSOA 3N1QC 1U2CA 3WFDL 1RZFL 3THML 5HHOA 1C12A 2P4AB 5B7FA 5HI5D 3W37A 2ZZUT 2M8XA 2B0SL 4KHTL 2LFEA 1NGZB 2EH7L 1BOGB 3FUJA 2FSEA 4P8QA 4LSRL 4LF3B 5IEHA 1QUNB 2CNYA 2WXHA 2W95A 1BYPA 1EEYA 1YSOA 3O3AA 5I74C 2IALB 4HC1L 2HG5A 2WBKA 5PCYA 1B0RA 2X05A 4JHAL 1A6VL 1MAKA 5I1EL 1N6VA 1BD2A 3FH5A 5L2JB 5EO0B 3GGWB 2IXQB 2EILB 2WXPA 4PGEB 1FE8H 1E4XI 2C3XA 1KYUA 1NC2B 3R8BB 4LSPL 1GTNA 3WEMA 3ZR5A 1J5IA 1KLFB 4EI0A 3OJMB 4UTBL 3V0IA 1RU9H 3DVNA 5DK0B 4FHKA 2Q7YA 4GRWB 1MRFL 2NUPB 4Y7OC 3MRKB 3Q5TA 2BSRB 1BP3B 3F83A 3PJLA 3ZUCA 3CZKA 1HOCA 2BC4B 5BZDB 1YMMD 3WO3B 4RRPM 2A74B 5EBWA 3ZKMC 4FFWC 5EO1B 4Z7VB 1UXLA 3UMTA 3TNMB 3NJKA 3MOAL 3O2WH 1YQVH 2OMVB 3S5LB 3WXVH 1LO0H 2V9RA 1NIDA 3KBPA 2WQUA 3CSFA 4L4TA 2WZ6A 5IVZB 2R4RL 3FFCB 2YN3A 1XR8B 1OSZB 3QS3A 2IH1A 2Y22A 2XVGA 3X13B 5JUEL 2DYPD 5IV2B 5F1SA 4YNYA 2NYYC 3KPLA 1YDPB 4Z5RB 2YBRB 4XPBH 1IJNA 4OIAA 4JJ5A 4OW6A 1O0VA 1WFJA 4E9QA 3QIUD 3WY2A 2DM7A 2JJWA 4N2LA 1TPXB 1DQJA 1YLBB 1RUPL 2LAAA 2VDNH 4BDVB 2DWEB 3Q1EA 1E65A 1YC7A 1AY1H 2DMKA 3QXVA 3WXVL 2ETWA 3QNFA 4ZMXA 3IFOA 1YYLH 2ICWI 2W92A 1ADWA 4EI5B 5L9DL 1N8ZA 3FZUD 3HHMA 4WEUD 3MJ8A 1E3XA 1RK1B 2X1OA 5GRJH 1HWGB 5BQ7A 3NPSC 3CCHA 3OZKA 3GF8A 1FDLL 3HR5A 1JIBA 3P77B 4EIGB 3EF4A 4BH8A 1I8KB 5MHSE 1DO5A 2XN2A 4YQXL 1QTSA 4HKXA 1OGTB 4NZUL 5BVJB 3OKLA 3PHAA 4IHOB 3VO0A 1BLNA 4HALA 4OLVL 4LLMA 3LTVA 4MNGA 1F1GA 3BUYA 3KHQA 5CLXA 3SGEH 4BZ2A 2UWEA 3FW6A 2GJJA 1E6JL 5A2AA 5CSBA 4M9OA 1HXYA 7TAAA 3RVVD 3NSDA 4B53A 3Q1SL 3BO8A 1T4KA 4BZ2H 4L18A 2P5ED 1GXEA 5L2KE 1EA9C 1G7QB 1CFTB 4FQJL 4O4YH 3TVMD 2H4EA 3E8UH 1DQTA 3O9WD 4AYMC 1CLCA 3ETSA 4E9TA 5HYQB 2VNCA 4K3EL 1MFNA 2YSSB 3ZDWA 2VC2B 1XTMA 5KVGL 4UTBA 1OPGH 3ZDZF 4KROB 5F9JA 4ZPTB 4B97A 3PL6C 1YECL 1XL6A 1QR1A 5DJAB 4W81A 3WYRA 3S3DB 3ILPA 1L9PA 3MLSH 4WDIA 1F86A 4NKOB 3ESOA 5JQ6L 5E8NB 1IFHL 2VW4A 1NEZA 4XE0A 5EWIL 2DOCA 3ATAA 2VR4A 1QLEL 5KYWB 5E2UL 5EN3A 4DPAX 4YHLL 4WUUB 1LK3H 4IDLA 3T3PF 3B9KC 4A55A 1J5HA 3DOSB 4X6CA 4FKEA 4QOKB 3E8VA 3O2DH 3HC3H 3TF7C 4L4JA 1HH9A 1ORQB 3ULUC 2DI8A 2PP7A 4UANA 2YMXH 1MAML 4RCAA 1QI4A 1VRSA 4LVHC 4CSZA 3RWHB 1LO5B 1W8EA 3BRFA 4PG9A 2GYSA 3VFGL 1J5CA 4K9EH 4PJXF 1P53A 2GSMB 4EN3D 4FOMA 3QUKA 1E7VA 3L3JB 1MCPH 1MVYA 3FB7A 1WFNA 5HGAB 5GS1A 3TPUA 3VG0L 3T65A 4QRSB 3KLHD 1VFBA 1W72H 2Z35A 3KL5A 4Z78B 5B22A 1D5ZA 4QRBA 4IMLA 3I9GH 2KI6A 5DD6B 4NRYA 1X5LA 2UXGA 3I6GB 3KXFA 4P4KD 5IFJA 1P9MA 1MVFA 2C4XA 3KPNB 3OF6D 4KTDH 3WSQL 4XMKL 2BVQA 1ASQA 2EVFA 3K91A 3PAYA 2CZNA 5D6CB 1WA1X 1ORSB 1DQIA 1ZANL 1IKOP 15C8H 2NY1B 4HGWA 1XCTA 3T0ED 5C0IA 5FOBA 3DPBA 1GGIL 1YEHH 3UJIH 4RMTA 4N9OB 4XXCA 5DEZA 3TU6A 4AK2A 2VDLH 1UD4A 3ALPA 1PLAA 4P3CL 5F7AA 4EVNB 4X9GA 1OAXL 2XRAL 2Z35B 1NKOA 2Z0BA 2G3ZA 2YLKA 1NCOA 1WAPA 1FVCA 3ZTCC 3ABGA 2F53A 4IRZL 5J1AA 4A04A 2A9NL 4JFPA 1SDYA 4OFDA 3W57A 5FKAA 1IGTA 1E6OL 3MLUH 5EO0A 4WF7A 4HKJA 4U7MA 5E6UB 4KY2A 2P24A 3JT2A 1FFTB 1AC6A 2BHFA 1PL3A 2X7LB 2IOMA 1KDJA 5HGBB 3MLWH 4LVOC 2VXUL 3N50A 4Y4FC 1Q0XH 2QSQA 2VZSA 1GGIH 1YEHL 4QXVA 3ZE1B 3C75A 5C0RL 1U2YA 5CD3A 2XJKA 2AXFA 5FLUA 5DO2C 2NZ1A 3MXVH 3S4SB 2APWA 2VRAA 4KRPC 4XPGL 4M7KL 3LYRA 5DRXA 1A4KA 5IMMA 3MXWL 1AANA 1I7UA 2EXSA 3UCQA 4A38A 3E6HA 3O6LL 4XNYH 4JPKH 4CAGA 4I0PC 1KXTB 4FQQA 1KIUA 5HDBE 3UPCA 3S97C 4IBSA 1PKQE 5JPMB 1LM8V 3ZZQA 1T1YB 3MUGB 4RZKA 5DO2D 1IGCH 3U4EB 5HJGA 2VXUH 3CDFA 3INOA 4YGAB 3PHQA 2OX5B 4W6YB 3RTQB 1G6RB 1HNYA 4OFYA 4X9YA 5E8OA 4HUVA 1T21B 4XNQB 4DPBX 1QEWB 5F3BA 4WO4C 2ZUUA 5F7UA 4KX8A 3BZDA 3LRSA 5I6XC 2MCPL 5I1EH 3BVDB 1KB5B 1ZIAA 3E6HB 1YNKL 5HYJB 5KSAD 4CVZB 5KSBA 4IHOA 1ZK9A 1CF8H 2X09A 4TULH 4F15C 2HMIC 5C09B 3CBJB 3HOGA 5JZ7D 4HJGB 3IWVA 3HR5B 1UM6H 3P77A 4RFOL 4IGBA 4J3OC 4ZFGL 1HEHC 1NMAH 3HZKB 4LSUH 2QVTA 4JB9L 1J0JA 3HS0A 4KVNH 1AQKH 5CILH 3QIBD 4U7SA 3S5ZA 4YJZL 3DBXA 3LSOB 4P9HH 5F7NC 1M7XA 5EOCH 3BO8B 4EZMA 1CO1A 2E9BA 5HGDB 1BVKA 3T6XA 2NR6C 1F11B 1YNKH 2NY3C 3FT4B 4H5SA 2HRPL 1JPGA 2FECI 4W9IC 2GI0A 1QR4A 4Z7NE 5AD0A 3CN2A 4HCGA 1J87A 4PRNB 5JDSB 4ESKA 5IOKA 2NSQA 4RFOH 2JJSC 4YBLC 2W1NA 5HPMA 1ZLSL 4LP5A 4WFEE 1U8KB 2NY1C 1EUTA 2ZD0A 4UOQA 2XZQH 1MFBH 2OMTB 4LT7A 3C9NB 1CL7L 1JOIA 1YCSA 4Z7OF 5SWSE 3UEQA 1S3KL 3AQZA 4WNJA 3CVDA 4QYOB 4IHBA 1Z9LA 1UWEH 1AHWC 2MQ0A 3VA6A 3OG4B 2A73B 1BQHB 4O2EA 3QR0A 4Z7OE 2FCBA 3GZOA 1NCDH 3GB7B 3GSNA 1M2VB 4TSCL 2Z4QA 2OMZB 2JCCB 3N9GL 4J23A 3F01A 4L3EE 3TEWA 5A2FA 4MXWH 4P4KB 4PRAB 2BFVH 4P2RE 4YGVA 2R1YA 5IMLB 1AGFA 3HS8A 4MZRA 1H3VA 3BP6B 2ZX8A 3MN8A 5IM7B 4FYSA 2V5MA 1N3NB 5KS9F 1T6WA 3Q1SH 4KQ0A 1YYML 1QBAA 5JOEA 3B2XA 4U3SB 1VFAB 2K45A 4BHUA 3TO2B 4HJJL 2AABL 2CD0A 3U25A 1Z3RA 4KQ3H 2BC4A 5BZDA 1NAML 2BO0A 2DDQL 1MLCA 1JNNL 4K94C 1NOLA 5D5MB 4QXUH 4YVNA 4NJ9H 2EDXA 2YARA 4ZX6A 3QCUH 1HHHB 5EOTB 5C3IA 4I0CC 3M8OH 1KB5L 4FXKB 4PLKD 2R8SH 1KV3A 4HEMA 1CUOA 3VU2A 5LAXA 2Y72A 4RFEA 4ZW8A 1CBVL 2E7MA 4OTXL 4MA1C 5AZEH 1Q0YL 1YYMH 1OANA 3VFWB 4HIEB 3W0WA 1HHJA 3MBEA 3KJ6L 1LNUB 3T08A 1DQLL 3V5HB 4PJGE 4I87A 1EQWA 1J1OL 2AJVL 1R3IL 5F9DC 1JTPA 2G75A 3OL2A 3MRMB 43CAB 4I9WD 5M7QA 2CRYA 4I18B 2K9UA 3FCUB 4IRSB 2X9XA 3LQMA 2R2HA 4GNKB 2NCMA 5H35A 3DO7A 1DUZB 3MJ8B 4UT7H 4G8GB 1NH6A 3W2DL 5EHFA 1OGAA 3CDZB 4ETQB 2WZ0A 5EEYA 2IFFH 1XSOA 2DWXA 4L9LB 4G42A 5F7BA 5EBLB 4UNTA 4G7SB 4NDMB 2D9QB 4ZPVB 4KZEL 1KIQB 5BS0B 1NKRA 2O5XL 2Z91A 4XB7A 2AJVH 3RURA 2LU5A 3G5XB 2P5WB 2BPBA 5EZLB 5EDSA 2G9HB 2ZT9C 3T3MF 3GZPA 3IS0X 4M56A 3NP4A 2BP8A 3WN5B 1BAGA 1QFWH 2B1HL 4NQED 3AB0B 3LZFH 1I8MB 2W38A 2H1LM 2D2CC 3U7YL 4Z3FA 1F18A 2Q87A 2FQDA 2X6MA 2B5IB 4HMCA 3VFPA 3V0AC 1PJWA 2CJSA 5H4YA 4PTTA 2W88A 3MA9L 1FO0B 1UT1A 3HR6A 1YN7A 5C9JB 3NCCB 2KS0A 2GK2A 3KDPB 3SGDI 1OD9A 1Q9OB 4AZ8B 5FO8B 4KMQA 3UTSD 5D1XD 3GMOB 3ZHDA 3CXFA 3CVIH 1CR9L 1L0QA 1LXMA 2F68X 3DHUA 4WU7A 2CR0A 2WN3A 2X4SA 3E2HB 3IWUA 5DZOA 5IEKB 3U2SB 2Q6WB 1M9SA 3BISA 4H8WH 1H9DA 1QI3A 2D03L 2C9XA 2EECA 3MYJA 4Z3EA 2QT6A 1CDJA 4IBLT 4FFZL 3RZCA 4QRUB 3AREC 5CP7A 2UYLB 2D2OA 2X12A 4YAQB 5KYUB 1HL8A 3U9WA 1YMMB 4JFOB 3RY4A 2YD3A 3QQ9D 2GC4C 2V6HA 5J11B 2A77H 1B6DA 1OWWA 1T1WB 2MSPA 3L4CA 4NQDB 2YD8A 5E5MA 3HUJA 1XCXA 3SB3A 5L8LB 3HUJE 4K4KA 5AAMC 5F1KC 5HYSB 2Y7SA 4OB5H 3R06A 1NC2D 2GC7C 4N0UE 1T22B 2GUOA 3QG7H 3HE6C 3VAEA 1DQDH 3GMLA 4FERA 2OAAA 2F5BH 4KTEL 4Y1AD 3VXUE 3HC4L 4R26H 3VXOB 1KB3A 2EO1A 4LASL 4O58L 5GRVK 4PYGA 2Y2WA 1SYVB 5E99H 5KJRH 2BINA 4OGYL 1I85C 1I8AA 2P8LB 1TQWA 2BWIA 3OAWA 2F8OA 1SLWA 4HUKB 4LBEA 3G9AB 1JCKA 4MZIA 4QRTA 1LVEA 3NJMA 5AG8A 3REVB 1GHFL 3IAGC 3B7YA 4A2DA 4YBQD 1M05A 3LKRA 4J7RA 3QVAA 1UD6A 3FPYA 1SMOA 5FW6A 1SY6A 2FQGA 4ZX5A 3VXTA 5CJBA 1HOEA 5T1KB 4K5OA 3WE6A 5C0AD 5DGQA 2BOLA 2EDBA 4PJEB 3ZTNH 4YS4A 1SVBA 2I9TB 1JV2A 4ODVL 3M07A 2XPGA 2NX5B 4QR7A 4A7SA 3TO2A 1P5VA 1N4XL 2ZUQB 4FE9A 4HZLB 2AJ3B 4N8UA 1T03H 1F00I 1OKEA 1Z9SB 5IM7A 5I0WA 3EO0B 1RK0A 2CUMA 5GGTL 2Z7ZA 2COVD 1OAYH 1YEIH 4JG0H 3UTPD 4A2FA 3MSPA 1AXTH 2YFOA 3QDHA 1VACA 1ZMYA 3B1TA 3FUIA 3QS2A 1J12A 4ADGA 4YSTA 3HE7A 3NSFA 5D1ZB 4X4XA 2AJSH 3GJEB 4N2IA 3CFUA 3CHOA 3QCVL 4DZBB 4GQ9L 5DFAA 3QXDA 2CIKA 1PDKB 1NA8A 4G3YH 1FNGB 2BNRA 3L4ZA 4QO1A 4NZTL 3AABA 2P52A 3POHA 1NEPA 2EVJA 3MRMA 1JNHA 1J9QA 2E47A 2A74C 5F9OL 1LK2B 1IL1B 2Q1EA 2XIDA 3N06B 4HKBA 4KY1L 5JW5A 4CGUB 3M17B 2NUTB 1BAWA 3M45A 4PWFA 5HHQB 1U92A 1WG3A 1I1YA 3N9GH 5F3BB 1PZ2A 1Q8MA 4NXKA 2VLRB 4WTZG 1OSYA 5CGBA 3MRHA 3PL6D 2Y5QA 3RNKA 1OGSA 1TKWB 4K7PH 3B7SA 3HZ3A 3PHQB 4UT6L 3ZU8A 3OXSB 1ACYL 2AMUA 1BFTA 1P6AB 1G84A 3C8KA 1JWMB 4GQRA 3DLQR 4JPIA 4PPTA 4NNXB 2VZUA 3RIFF 1OALA 1NC4B 1QTPA 2CG9X 3MV8A 3RGVD 3FU7B 1T2QH 4NO3B 4P05A 3U36B 2W60B 1AZNA 1KNOA 4A6YA 4PWJA 4P9HC 3RNQB 6PCYA 2CHDA 4EXKA 3AW5A 4WJG3 2RAMA 5E8NA 3O8XA 3TBYB 5CN1A 3FRUA 3TIEB 4G9FA 4GSQA 4ODXA 4PJ5B 2C9AA 4KMLB 2FWOA 3RB5A 3DROA 5DFTA 2C9QA 2LQRA 3VFUA 1EAPB 5AL8A 3QZWA 2WQRA 3MV9B 1F11A 3U9PH 3G6DH 5E6SB 4ONOA 2AXGB 3CIQA 5AVXB 3WTUA 3SQBB 2PPFA 2VMJA 1H9VA 2JTYA 3BGMA 3DBXB 4JHZA 1THAA 2AQTA 1HAWA 1UWFA 5DQDH 1PF3A 2NY4D 3ISRA 2Q8BL 4Z7NF 3T0VA 3EJYC 2E56A 1UH3A 3HG2A 4N3TA 1SOQA 3I50L 4PI2A 2E7BA 2NDFA 5GZNA 1ZV5A 2PR4L 1P7KA 4YHML 2EEBA 1UEYA 2B4CL 4S0HA 1WC7A 3H9SB 1RI8A 4YX2L 4BCZA 1QNZL 3QDGB 4L2LA 5CWSA 5J06A 1XF5A 2ZXCA 5EZIH 1ILSA 2XTJB 2I7OA 4U4BA 2WD0A 3QJHB 4KKQA 5I0XA 1FGNH 4YHPB 1SJVA 4WO0A 2XWTA 1F4AA 3K6SA 2NXYD 5IMLA 4KDTA 3TS8A 1HC1A 1WP6A 4U1IB 1L9QA 4LRIC 3L17A 4XVJH 4CC4C 5K59E 4GI6A 3PP4H 1PCXA 4Y9CA 1QFWM 3GUTB 1BVZA 3ATBA 3C2SA 5CCGE 4KNQA 3QIWA 2XIIA 3C08L 3HJ0A 3SKOA 4I1NB 4YSRA 4GG6A 1HS6A 2YD4A 2ZYHA 3C09B 3W3BA 5EOCJ 3L13A 4ZFZB 1OSZA 2NDGA 4ZZKA 3F85A 1RZKC 1MJUL 2WSDA 3NT0A 2XG4A 1IC4L 1XMWA 4JFSA 4U3SA 1WHOA 3D9AH 4PBWD 1OGAD 1IZJA 4PHXA 4OGXH 2AXHA 5LXGL 1MQKH 2I24N 5CJQH 4DJMA 2V8MA 4ODBD 4RFEB 3S6CA 1E7UA 3JXAA 5EUOE 3QEHA 1CD0A 4XBGB 2APVA 1N6UA 1ESOA 5I1IH 1TEYA 3DTXB 3PU7A 3WMPA 1QHOA 1I3GH 5EIIG 2APFA 3FUNA 5DJ0A 5A7EA 5LGJA 2WLMA 5M94B 1B2WL 4XWOD 5H4ZA 4MS6A 2J1WA 2BWQA 1NC2A 3GBMH 3MBED 4PVNA 1WWCA 5FDWB 3SJVA 3BSZH 4NN7C 2KLRA 3GMQB 3LEYL 4J3SA 4L4TD 2VW6A 1CFQB 4ZW6A 4HIQA 3D9AL 1LHZA 1ZVNA 2V2XA 3HEIB 1WE5A 4JUTA 4PG2C 4UV7H 4XRCB 3U7AA 3I75A 4HJSA 3WFCH 1DUZA 3Q5OA 3G5ZA 3MU3A 3O9WA 1YC8A 3O45B 4OCYH 3V0JA 4YSPA 1PLBA 5HI4C 1S7VA 1FIGH 2P7TB 4XWOC 4N2HA 3AS1A 1ZAGA 4MWFB 3FNKA 1MH5B 2J5LB 4XNMB 4WFHD 5KSBB 1ZVYA 2AQRA 4IS6A 5HHOE 4RBPK 4L4TB 3L5JA 3LKSA 5I1AA 3CSGA 2OJEB 2YEVB 2Z93A 3IDJA 1S5HB 1AP2B 5DU7A 5FF6A 3PWPE 4DKFL 1X3DA 3IDIA 5EUOA 5F1NA 3L4TA 2VXTH 4JGUA 1U2HA 3OXSA 5D7EA 2BVUA 1MFMA 1U3HD 4OLWL 4XC1L 3SBQA 3QXTA 2JTDA 2ZXWB 4WQOA 2SEBA 4GXVH 5T5NG 1KN4H 2CLVA 3HMWH 1URZA 3QCTH 3Q2VA 2F1BA 1KBPA 1S9YA 3Q2LA 1QSEB 2ZUWA 5IQ7H 2CUHA 4XP9L 1FV1A 5C0BE 4Y8DC 3X3GL 4TQEH 5B4MC 5IQ9B 1J05B 2DQFA 3OKYA 1U3HA 4MS8D 1G1YA 2RMNA 3QZMA 3QNXB 1I8LA 2HJKB 3L3OA 2MNWA 3QZPA 3C2AH 3T8MA 1J9TA 2VXQH 4FLRA 4ELKA 4KK5D 4W9JC 4UDUA 3EO9H 1GJUA 4BKTC 2XVBA 2X6UA 4JE4B 4ZO8A 5KVGH 1A21A 2UZXA 3EYVB 3ZRSA 3AS0A 2L7UA 4J28A 3UPAA 2H32B 1CXFA 1U8JA 2NXYB 2ED7A 5K93A 4MCYA 1XSJA 4GPVA 4F58H 1M2VA 5TDNA 5AB9A 2ZX9A 4UI2A 2DYPA 5J8OA 5CZKA 3VD5A 1NKGA 3B3BA 4XP9H 3CMGA 4XGZA 1II4E 1MIEH 2E0PA 1LD9B 1MNUH 1XEDA 1BREA 2A6KA 2E5EA 5D1ZI 5FX3A 3WKQA 3S3JA 2A83A 2YAHA 4JO4H 2HSIA 4EVNA 4M43L 4OLXH 4U2ZA 2K8QA 4UZSA 3BD4A 4ZMYA 4ZMVA 2G3MA 4CA4A 4IRJC 1BG9A 1QSFE 1TT6A 3WGUB 2HYMA 1OE2A 4D9LH 1PEZA 4KRMB 5KYWA 1I3VA 2PP9A 1KGIA 1DE4B 4JDTL 3EYUL 2XHNA 1KBWA 5GGQL 3FB8B 3V6OC 4J6RH 4PS8A 1KYAA 5K59F 3U4KA 5J3HD 4PW9A 3DXAE 1PD0A 1GGTA 5E8DL 3MLXH 3P0GB 1QTYT 2AEQL 1IIIA 3HZMB 3N1FC 4JM2D 3JTTB 3PQYA 3II3A 1GMIA 2E76C 5T3XD 4FYTA 1PNCA 1S7WB 2WLNA 4P5TC 4QTHB 3U0TA 2NZ9C 1CDYA 2C1OA 3VYOA 3K6SB 5L2JA 1CURA 5ICYA 5JW4R 1Z9SA 4OV5A 4D9RD 3IBEA 4HS3A 1U21A 2R9HC 2E4TA 1CTMA 5IB3A 2YC1A 2BVOA 3L5IA 3TTSA 4G8IB 2XPGB 4MCMA 5AOKA 2EUXA 4U0RB 1M57B 5D6CA 4P5TD 2GJ6B 2NZ9D 5ID0A 3L3HB 5IROC 4Z76A 1G1OA 4ODHL 1N0XL 2WBWB 1HEZB 3QNZB 1DFBL 2ODHA 3KPSE 4FJYA 2XV6B 4XO9A 4EF3A 5DUML 3KS0H 3KLSA 3OZ9L 3VUAA 3O6KH 3D85B 4MA7H 4O02A 4P4RB 3VI3F 3TJPA 2J6EA 2O72A 4IYKA 5GJTH 2BJMH 4M7ZC 3I84A 4N1HB 4OZHE 4ECNA 1SVCP 5TQ0H 3STZB 3QO1B 4Y5YA 5CHNB 2J8UE 5K1VA 3WUWA 4AXWA 2DQMA 2H9GA 4YX2H 2X40A 2QKIB 4MD4A 2NY0B 4NDMA 1NDGA 1VGEL 2E27L 5E56A 3H3KA 3L4YA 1AGEA 4X98A 4PP2B 5FYLE 1ZK5A 4N9GB 5IR1A 4F8PA 3L3GA 4WWKD 3UTTB 4TNGA 3UBXG 5IFAL 4NS0A 3NDYE 2VN5A 4DGVH 4UB0L 2VB5A 2C8NA 3QEQE 4NNPL 1YJDH 2X53A 3QEQA 3DJSA 4ELDA 3FTYA 5LNEA 2QTVA 4AQAB 2X42A 3O0LA 4E9WA 3ARFA 3OQ3B 2OZ4A 4EZKA 5TFSH 4LCYA 1FVEB 4HZ1A 4KK6C 3NFPB 2B5IC 4RWYH 4TLKA 2TRHA 3GIZH 4TTGA 5TGBA 3T4AB 1MF2L 3BUQA 4WTXA 3MV8D 1MRCL 2Q6WA 3MC0A 1BFVH 4I4WA 4PJ7F 2G5BB 1D9KD 2WGNB 2ZX5A 2ODIA 3SD5A 5BZWA 4FG0A 2WVTA 1SUHA 4OZHA 4OUUA 5D72H 1QWUA 1VHPA 1E5AA 4QXWA 1WICA 4S1DD 4DGVL 1FL3A 3AM8C 1RUQH 1A5FH 2I27N 3HG4A 3RRQA 3CX5J 1XF4B 3V4VL 3BT2L 3PL6A 3O3DA 5FDYA 3BGMB 3PQYD 5BO0D 2DQEH 6FABH 4MKTA 5T1LB 1T3FB 3L54A 3CBKB 4NB7A 2R51A 4WHTB 2FL5A 5D9SA 4ZFGH 3TJEH 1T0OA 3GK8H 3B7TA 3IMWA 4JRXD 5AVSB 3WNLA 1RJLB 4MDIA 5CR8A 5JOFA 4UTAH 1G9NH 2VDKL 5SX5H 1A64A 4YZFE 4RZCB 2OJ1A 3KCPB 4JK0D 3WLWC 4XOCA 2IQ9H 3AUWB 3MACL 4JRXE 1YEJL 1AGFB 4LQFH 3F00A 5IESL 4JJOA 2EO7A 1N5YH 4L8CA 1ZVSB 4BZ1L 2WQSA 3WDIA 4HS8H 2HRPH 3ILDA 3PQYE 1LO2H 5GRZA 1DVFB 5BO1H 5B1CA 5I76B 1SFHA 3UTOA 1B9ZA 1CLOL 1TNNA 3QJFA 1DBAL 2H32A 3L3JA 2WVSA 1BBJA 1TF4A 3MCKA 4HBCH 1I3RA 3MRJA 2CGRH 1KN2L 4ZAKB 5FYJH 4KITB 2VRKA 4XN8A 2VQ4A 1X5HA 1U8IB 4UAHA 4NQQA 1P9MC 5LO7A 3TN0B 1KBKA 3SDCB 3CVHA 4JL1A 4JMNA 4MB3A 1A9BA 4ISVA 4NO5A 3U0WL 2DJ4A 2F9BT 2VLKE 2HFFB 4NQDD 3H1ZA 1OARH 1TCMA 5SWQB 2GT9A 1IBBA 2BVQB 4LCWB 1U8OA 2ZSVB 2R69L 4ZFZA 1R5WA 2HG0A 3O4LB 4HH9B 4Y1SA 5DD6A 3VFRB 1L9RA 3K5RA 4H0GA 2CJUL 1FORH 3RGBA 1HESA 1JWUB 2B15A 4UIMA 2Q7YB 2CO2A 2DH2A 5D4HA 2ADGB 2XA3A 1IFRA 1EHLL 2JIXA 4R97C 4KUCF 3HNVH 4MQ7B 4JZJC 3TOPA 3LCYA 1F58H 3U83A 2QKIC 4U3HA 4WHYH 3T6WA 3BSGA 3NA4A 4XPHL 5DEGA 1E8YA 5C0RH 4N68A 2Y6SC 2NQDA 1OEZW 3G04A 5C0NC 3S34L 5DUBB 1EJOL 5C08E 5C08A 4JFPB 3VD0A 2OS7A 1HZHH 2CDEB 4ZMLA 2F8VA 4IBQA 1FYTE 1WQVT 4U6TA 4JO1H 2DF3A 2PCFB 3MV7A 3SPHA 2WXRA 4Z76B 3EAKA 3T04D 1NWPA 2X4QA 2EKSB 4PP1C 3QXUA 1N9PA 4KU1A 4UYQA 4L9DA 4EDXB 2VSCA 4UQ3A 1XF1A 1MIEL 5FS5A 1WZKA 1SMAA 5BUPA 4JAMA 3DGGA 3OPUA 4WAFA 1CFQA 1UD5A 4V1DB 2J72A 3CSTA 1EBPA 4G8EB 3OR7A 2XQBL 4PS7A 3C8HA 3P4NB 5E9DA 3MLRL 3RY6C 4NWUH 4QT5B 3I2CH 1N5AA 2Y7QB 3DPDA 5KBKA 1FO0A 4TUKH 3MUGA 3QO1A 4Y5YB 3WIAA 3D87B 3DIDA 3QQ3B 4UT9H 5D2NE 2OJZL 1ZA6B 2BRRH 3AT8A 2IPKB 2ORBL 4LKCB 1MH5A 2X4QB 3U2JA 1XH2A 4LLDA 4PJ8C 2JCWA 2VL5A 4S10A 1P6WA 2HFGL 4ZXBB 4WHYG 1LO3L 4U1HB 5TE6H 4MNGB 1A1MB 1HILA 1ZLEA 3QRBA 1I53A 3V5DA 1PPIA 5EH1A 4Z18A 1ZA3B 4HV8A 3VVWA 4KWUA 4RISH 3OX8B 3LHPL 4B7IA 4PD4J 1LMKA 3I2CL 5ETUA 5LAPA 5JHMA 2W0KA 1UADC 2PUQT 4NQDA 2Y7QA 4QAWA 1B0GB 1U58A 2QBWA 4JL2A 4PJ8B 5I0YA 1LE5A 3HS0C 2QGDA 4QHMA 2JVUA 2DAVA 4LNRB 1MI5B 4ZOEA 4P07A 1HNFA 2PWDA 3DMMD 1QBML 4XP4H 5E94A 3U46B 1OWRM 4CBPA 4FABL 4R0LA 2ZWYA 1OF0A 3Q8BA 4IKJA 4YC2B 4B41A 5JORA 2UZXB 2VDOH 4J5VA 2AZAA 5D1XE 5TK4A 5D1QB 4BIKA 4XC3L 3VCLB 4S11A 3ARGD 4WW1B 5L2KA 1QHPA 4I1PA 4IMKA 5E4OA 4NNYA 2WXIA 3H9HB 4PJFB 1I8MA 1UC6A 3BUIA 5EC2B 4N2BA 4E5XG 2JJSA 3S35L 1UWEL 3Q5YA 2GK0B 1XF2B 3QG6A 5I2IA 3QYCA 4B5ZA 2NNCA 4XE5B 3GRWH 1SFDA 1XCWA 4MCYB 4Q9CA 3IK2A 1MELA 2BFVL 5EA0H 4R0LB 3VSTA 2DKMA 3AG3B 2EDYA 1ASPA 2H32H 4BYHA 1YEFH 4MKMA 4WK4B 5I6MA 5KVEL 1BD2B 3GGWA 4PGEA 3RDTB 4L37B 2WMPB 3LH2L 2WANA 4W93A 2D7OA 1WZLA 3CUPA 3HN3A 3RJDA 3S35H 2UVEA 3VXRB 4R8WL 3UBXI 1XCTB 4D0DB 3I3DA 4HIXL 3QC6X 4HCIA 4ZTEA 3UJTH 1RZQA 1JNNH 4R26L 1MF2H 1V27A 3KAAA 5SWQA 4RA0C 1ZTMA 2FQEA 4FNSA 3W5MA 2UUDH 4TUOB 3FQUB 3RBGA 5GHWH 4NO5B 5FYKL 1OTTD 2JCCA 4NFCA 2VISB 1VPOH 1GZQA 4NQEA 4E36A 5C0JB 3SDXB 5C0EB 4Z95L 2QDWA 5KYXA 5INDB 3SGDH 3JT0A 3B2MA 1EXGA 2ENQA 4KHXL 4H13C 3MREB 1NGPH 4WU5B 5K9KA 3BKML 3MNVA 3WJLC 3RVWC 1MHCB 1PX8A 5AAWA 2BMKB 1LP9E 2XN1A 3NCJL 3OMIB 1I8IB 3GMQA 5ESQB 2Z31B 4YHZL 3NIDB 5A16B 1DLFH 3WO4B 1RZ8A 2P5EE 1ZWIB 4U1LB 1UFUA 1EFXD 1JDAA 5CGMA 5ACLA 1I1YB 4NGHL 4GRLC 1K4DB 3F7VB 3ARSA 4ZFOL 3AXIA 5GRVL 1FFQA 1G7IB 2DI7A 2HFEA 3X14B 1CDGA 4DKTA 1KIPB 1G0YR 3Q01A 2VISA 1A4AA 1FJ1B 1OY3B 4JM0A 4WW2C 5C2BL 2J8OA 2OTWB 1ED3A 3S36L 3QJUB 1E5UI 3V8CA 3HI5H 4R9HA 1NGQL 2C9VA 5HHXH 1LNUA 4KHXH 5EUKA 4XVOA 2DEYX 2FX7H 2QZ5A 3RIAF 1IC5L 3QUXA 1NLBH 2ZONA 3L3GB 2DBJA 3VE0B 2WLIB 3SE8H 5SX5K 4MAUH 4H0LC 1MAJA 3ARBD 3FRPG 4TPRL 2HXAA 3X11A 2W60A 3NEEA 1E4KA 2CGRL 2BSDA 2FRGP 3CPLA 2XXCB 1YEDB 1AQ8A 2CR3A 4QT5A 3RVUC 3GMRB 4MD5B 3OMAB 4YHKH 4AM0A 4UCFA 1ZSHA 5HJ3A 2P44B 2X38A 4GOSA 2BOCB 4GQPH 2VT0A 4P04A 3EGXA 1OGAB 3CDZA 2XWDA 2QELA 5GGSB 2A1WH 3HBZA 3LKPB 4GAYA 3BVNB 5GPRA 1YNLL 5EO9A 5IVXB 1DR9A 5IJDC 1OAZL 3QAZC 4NQCA 5CO1A 2YPVH 2J6EH 4X5WB 3IS1X 5BVPL 5I6XB 5GS2H 1KTRL 2C5DC 4AQAA 2OR9H 3H9SE 4OH2A 4UUJB 4HG4J 3CVIL 5E23A 1CU4L 1MZYA 1JG9A 2KC0A 3RWGB 1ANUA 1DCLA 4KNUA 1WZ1H 4GBXA 3HNVL 4E5XA 4X8JB 4OBRA 5DVLA 5L4JA 2FJHA 3BDXA 4BFBD 1SRDA 3GBEA 3N43B 5DWUL 2O5ZL 4L0YA 1R3LA 2IADA 2V7HB 1EJOH 5CIPA 5DD0L 4HIIA 5DYFA 3S0PA 2A1WL 3Q6GL 1ECYA 2QPFA 5DGRA 1H5BB 1UCBH 1L0PA 4LEEA 3PWPA 1J0HA 3MUJA 2UX6A 2VAJA 3ZOAA 5TDNB 1FZKA 2Y06H 2AQ2A 4X80H 1MJ7L 1UB6A 3Q8AA 2V3FA 4P9ML 4NWTL 4JCLA 4M5ZL 3H9SD 3QUKB 4K7FB 4KXDA 1EUUA 3APCA 1NUGA 3N40F 2NRDA 4S1SH 3VGBA 2RA1A 1WWWX 3QRGL 5MP6H 3QFJE 1CLYL 2YXVA 4TTDC 2GK0A 2AJXL 4HXAH 5EPMB 4BK5A 1ZE3C 4PJ5A 3PWVA 5F6HI 2K3TA 4NKQB 4TV3A 3DC0A 5D4QA 3NABH 3CX5K 5B21A 2VYRE 2NY2C 3RTQC 1CS6A 2JB5L 5INCB 1LDPL 4JREC 2J1KA 3RB7A 4L1HA 2PCPA 3NFNB 1KBGL 4HCRH 4XMPH 4Q2ZA 3UPRA 1IBGH 3AROA 3DX3A 5DURD 1AR1D 2EUVA 1HDMB 3HMXH 3DETD 3KJ4B 5IKCA 3H55A 5TJWK 4X4YB 5MHSD 3BAJA 3X3FH 5EU5B 1J1PL 3EH1A 3M46A 3ZDXE 1H15B 3MRIA 3NIFF 5I1LB 2VLMD 5CXPA 2VJ0A 4P5MA 1CI3M 4P2CG 3RVXD 1GOHA 4TMPA 1BBDL 1DJSA 1TQUA 4FHBD 4KKPA 3ROOA 3GJFA 1XBDA 4R2GD 5MI0B 1IQWH 3L3IB 3PWVB 4IKLA 4OF6A 3US0A 1T03L 1ZPLA 2G5RA 2CKNA 4U7KA 4V2BA 4B96A 4GKLA 3LRMA 4A7GA 1G0DA 5DMJB 4N2AA 1OGAE 3X12A 5JMOC 1T89C 5EZOL 1DVZA 5F7WC 1IBGL 4AENA 2BIHA 2VERA 5K9OA 1GJWA 3HAEG 3RVXC 3UH8A 4DN4H 4TUUA 3RL1A 5DZNA 3S4SA 3A0OA 2AK4A 1OAKH 1Y0LB 3PP3H 4GSUA 1P4UA 3ROLA 1NEUA 5E1HB 1JJUA 5E2VH 1BIHA 5FV1L 1QO3A 2DYRB 4LARH 4DKEH 1I8IA 1JTTA 1YA5A 1U30A 2XTJE 2ZOLA 3CFNA 3GFUA 4MCZB 1NDGB 4MNHA 3QUZD 4J27A 5DHVH 1XIWC 1KIUB 4MS8C 1Q9WB 2CPCA 5F0JB 1WPCA 5CP3A 3PHOA 4IM8A 3E9UA 3T8VA 4X6CE 3UEZA 3ZHNA 4BXVA 3CFBA 5IB4B 2Z93B 3MUUA 2FD6L 5E70A 3TZVD 4IBYA 1KZQA 2Q2LA 3GHEH 3JWOC 4ZODA 1ZGLA 5K9OB 3J8F7 2DTML 2YKKA 3SDAC 4P2RD 3UYPB 4ANVA 2QZQA 1U33A 5JXEA 5DS8A 1AHMA 4BSWB 2BVTA 1P4IL 3VXMD 4LARL 4F2ME 1YEFL 5KVEH 4P5KA 4BZ2L 2GUYA 1BQRA 2R0WH 3PWUA 2C1PB 1E50A 4A7VA 2CIKB 4K3EH 2CK2A 2FX8H 2GVYA 4OJYA 3OKMA 1K85A 1T0NB 1YEGH 4PV1C 3V9FA 3VD2A 4PV8A 3BMVA 4KI5D 3WFBH 4NIKB 4EIZC 5K33A 1HQRB 3TYFA 3OX8A 4JY6A 1AR2A 1V54B 4F7TB 1I7TA 3LY6A 5I15L 3SQRA 2D4FA 5J12C 3KBHE 4HBQA 2GJZA 5J3HC 5IVZA 2H2PD 3T2LA 2YGVA 4CKQA 3MRBB 2LU4A 1XFPA 3HCVA 3O8XC 3ULUL 3L4UA 2BSSA 2AQSA 4XHQA 1NDMA 2FJHB 2GBTA 2WKGA 3VFGH 3FB5A 5KW9L 4Z77B 2Y1AA 1NBQA 2Z34A 3N0AA 2LLGA 1BZDA 4JFYB 3BQUA 4YQXH 3RVTC 1F5WA 3VWKD 3GXMA 3KXFD 5DMYA 3B4NA 2ATKB 1W72L 1MXGA 4YHYB 5ENWA 4NLHA 4FNTA 1IM3D 1S9VA 2DQIH 4JQVA 4TOYH 3CQQA 1SGKA 3WIHH 5T5FL 3BAEH 2WYTA 2XWRA 1NICA 4HIIB 4ZMQA 2ZKYA 1E3ZA 1WA2X 4XI5D 4PR5B 4MGXA 3TYGL 1TVHB 3ZHLA 4DOHB 3NJLA 4LLAA 2CKBH 2V3EA 4EJ1C 2AXGA 4K5LA 3UO8B 4YHOH 1IFGA 1TQVA 3BUYB 3E3QE 3K81A 1XF3B 3MUHL 3CFKA 2E6JA 3NCWA 2Y3NA 4MYPA 5AYTA 3C6SA 2BW5A 3MLSL 4JHWL 3HTLX 3K0YA 4JVPA 1N18A 4CVWA 5JA9A 4PRHB 3GHPA 1GOFA 3UX9B 5BV7C 4JR9H 3US9A 2AXJA 3JYBA 3BPLC 1MNUL 2HH0H 1V3MA 4KGLA 1FFPA 3EYSH 2YMOA 4AH2A 5JPNB 5CJOH 5DWPA 4DGUA 4EXPX 3MLTA 2XN9B 4FTVB 1F0LA 3FCTA 2GIMA 4O51A 1M7IA 2DM2A 3MCLH 1JRHI 1ZJAA 4I77H 5LXGH 4ETYA 3LNDA 5I6OA 5GRWA 2ZWSA 3FPXA 3K46A 4GT7A 1BAFL 1KPRA 2VMFA 2AC0A 4EUPG 3LRLA 1I9IL 3GSOB 2DRUA 3B6SA 4ORZC 3QDMB 3SDAB 1TLMA 5E8DH 4PGJA 1I3UA 3OV6A 1PAMA 4LU5H 1GZQB 3ARDD 2O93L 3FTWA 3NACL 4KJYB 2YQGA 3HKZA 3WSQH 4RAVA 1WBZB 3GHBL 2BSRA 2IDQA 5J11C 2Y06L 4XH2A 3TEXA 1BYOA 2ALAA 5EU6B 4ZUUA 3F12B 1IGCL 1FNLA 2IPUK 1ZHKA 5J4MA 2NTFA 3GEFA 4I77L 4HJUA 4P2OD 1ZWIA 4S1SL 1FBIH 3QWOA 3V4LA 3H42L 1UHVA 3B5HA 1S7WA 4JPWL 4M7LL 1JZJA 4I3SH 4QTHA 4UDTA 5ALCL 1DANT 4MCZA 1QLRB 1U0QA 1V7MH 2V5TA 3NJHA 3NJGA 4WJ5A 4HK3J 3LS5L 1LE9B 5JW3L 5GGSY 4AIEA 5DK2B 3TC9A 1UWGL 4FQIH 1JGDB 4ETQA 2IG2L 1DQVA 3DHPA 4RGMC 4XXDA 3NN8A 3SCMC 3O9WC 1LK2A 4Z8FL 1LWHA 1QW9A 1YDPA 4Z5RA 4BQ8A 4ZXBA 2JE8A 2UY7B 4YSSA 2JNZA 3L3KA 5SWZB 1IKFH 1Q9KA 4OJAA 2LABA 1DL7L 4UT6A 1MIMH 4OD1H 4NO2B 1OM3H 3NMEA 2YFNA 3ET9F 4H2CA 2DQGH 1GYUA 1PJ9A 4XCYB 1K5NA 5C0DB 1WUZA 9PCYA 2OYKA 3UTPE 3LKPA 4GAYB 3SGJC 4PCKA 1DBJH 4O2CB 2Y36H 5TF1H 3PAVA 4F7TA 3CVBA 4NNPH 5IHLB 1SLVA 3PJSB 5ITFA 4RZCA 2V7HA 1ZT1A 1BZ7A 2FTAA 4BFEA 2XN9E 4OLYL 2W8CA 5TFSL 4U49A 1I7UB 4ZD3H 4AYGA 3GIZL 1FFNA 5BJTA 5BXFA 1BMWA 3A47A 3ABLB 2CMRL 4RIRA 5ESVA 1PZAA 1I8LC 3AZUA 4N0RA 1CPUA 3O2WL 1EMTH 4Q9RL 1AIZA 1TCRB 5IQ9A 3F6IA 3NRQA 2ZCHH 3M7FB 2LGNA 3LAFA 4OBSA 4PJHA 3PGCA 4UMSA 3EH2A 1RZJC 1D7BA 4DZ8A 3BT0A 5BUGA 4IOSD 4KRLB 1WS8A 4OZIA 4PLJD 1FNAA 2YKLL 5EOQL 2J57A 2G5BA 4AVJA 3T4YB 1JPFB 1UA6L 4YHIB 2ZSWA 4NCC2 4QHUA 2WNWA 1R5WB 4L8DA 3S3BB 4LDEB 1DVTA 1QX1A 1A9EA 3C6LB 3LVEA 3UAAA 4UIMB 4JANB 4O00A 3UMNA 4AQEB 3UGXA 3VFOB 3QIUC 3KPOB 5AL0A 1AE6L 1M05B 3ZKXB 1F6AB 3U0PB 3A67H 5H37A 1T20B 4KTYA 1E43A 5E9DD 1FC2D 3JWNH 2QR0A 2EXTA 4MYWB 1FDLH 1BQLH 2XWBB 3PAUA 5T1KA 3DX0A 1UOKA 2JKXA 2QSCL 5AD0B 4NJ9L 4G7YH 1C5BH 3B7UX 1OW0C 2QLVB 3LSOA 1KYFA 1E27B 1L4IA 2JKNA 3BYYA 3KPNA 4YN3A 4DP7X 1EFXA 4RRPG 2V0AA 1ZEAH 2ZP8A 3CFQA 1BVKB 4A39A 1T83A 3FO2A 5A2IH 4P5TA 4P3DB 4QJ5B 3PDDA 2EYRA 3CZNA 4HC1A 3ROOB 4N8PA 1FIEA 1O7DE 4UINL 4WHDA 3ZGIA 4M7ZB 3VXMA 3UAJD 3FQNA 2DWDB 1MWOA 3D4ZA 4AYSA 2Y9RT 4Q89A 4XPAH 5KW9H 3C5ZC 4WTZA 3HFMH 4N2MA 4CL7A 1FSKB 1RPKA 1A9VA 3OKDA 4GRLB 1UENA 4HIJB 5D96B 4E0RB 3F5WB 4IBUA 2UZPA 3RVUD 1BVNT 3B6SB 1FI8C 4FFVC 4J3OH 4XCNB 1MXDA 2B8OT 3QQ4B 4PRIB 4WI2A 4TOYL 3KW7A 2FR4B 5CUSL 5EU6D 1NANI 1J9SA 3IE4A 2OV0A 3ARQA 4N0UB 2VN7A 1ICTA 3MLZL 3CHRA 4OZGF 1PZDA 3CJJA 4F3FB 3G5YB 2YZ8A 4FHJA 3SBWA 3GPSA 4P59L 1O75A 4N25A 5AKRA 1OP3K 3GMRA 3ZQWA 5HY9B 3VMNA 2BOBB 3M7OA 4TLUA 5IFAH 2O6DA 1OAJA 4F1ZA 1MJ8H 3I3BA 3MGTB 1S8DA 5DK2A 2IPUG 1UA3A 2PETA 3MRHB 4JO1L 1D2PA 4AXWB 5HYIA 5KVEE 1N2RA 4HS6B 1SXZA 2IH3A 3K6IA 5E4AA 3UOAB 4J3OD 3B2VL 3GXDA 2VABA 3ZYIA 3A21A 4AEEA 3Q9QA 1P7BA 4OJDH 5IREA 3PUCA 1EZUA 5ALBL 5IFHL 4DP1X 3ZMRA 3IF1B 3LKOA 1D7FA 1MFVA 2DLTA 3LX9A 3FU7A 1U6AH 3NZHL 3G5VB 5FUCE 2WNXA 3D5OF 1AYOA 4HIEA 4OCWL 2J1ZA 3WY3A 1D7CA 1R5VB 4WV1A 4MA3A 4IJ3C 4X98B 3MJ9A 5CCKL 3QDJA 4H8VA 4WI8A 2CHWA 4YWGL 4TM9A 2CKBB 4FFZA 4PWIA 5C71A 1QHQA 4DVBB 4Y2DD 3PABA 4K5PA 4U1NA 3CFTA 4GMTL 3T0EB 4H8UA 1ZXKA 2NY1D 3DX8B 2IGFL 4FADA 4ZNEE 2DQEL 3PCYA 4XVSH 6FABL 4KFZC 3SO3B 4N0FB 1WD9A 4IKNA 3CMOH 1TO4A 2HFGH 2QDVA 4ODTL 4ICXA 1T5XA 2BP5M 2HT3C 4FMVA 25C8H 4PLNC 2IWKA 1L3NA 2P47B 4YEEA 2EUZA 3WAKA 3P73A 1EK3A 3NZHH 5JIQA 1CLVA 3KPMA 4CGTA 3IDXL 3FU0A 4DTGH 1PY0A 4F7EA 3AS2A 5CBAA 3P0YH 5EB9A 3EOAB 3BUBA 5I8OL 2AJUL 2UWEF 4QKXB 3NCEB 5TQ2H 4XN9A 1IO4C 3M1OA 1KIRA 3ILQC 1DVUA 3DHJA 1V3LA 3MRNB 3QXWA 4MMZC 1I9RH 4M6NH 2DIBA 5DD5H 4B3EA 2J71A 2X4PB 3HE6B 1NLDL 4JFDB 2RH0A 3LQZB 4GMTH 2BP0A 5JIKA 4LHJB 1EAOA 3VRIB 4U3CA 5C92A 5E99L 5HTSA 5T1DH 3KXFE 2F6AA 5CS7A 3SPVB 3PV6B 3P3YA 5HHOD 4QOKD 1T5XB 4XGZB 4X7DC 2PXYB 4ABQA 3DX6B 5JHLL 4LVHB 3T65B 4LNRA 1A7QH 1ERNA 4FQXB 3TIDA 4OCRH 5L4FA 5AKSA 1BVLB 3KJ4C 3RI5F 1SDAB 3CHQA 2KPWA 3EUDA 3GBLA 3NTCL 1ROWA 3QQDA 2X4OA 5DS2A 5ABAA 3KS0J 1KCSH 4KUZL 1Q38A 3QEGH 4JZJB 3ECWA 5DRZB 5AW8B 5B1JA 5E08H 5C0EA 2WOYA 5FWRA 4PHZA 3FSZA 4R7XA 5HI3C 2HX7A 4HHGA 5IK3B 2HTLC 2DQ6A 3GRGA 4UU9A 3T2OA 1ODUA 2CJUH 1AVAA 3H4FA 1MCKA 3PPEA 3BP4B 4WO4B 4XB3A 3D25B 3V7MA 2OMZA 1IVLA 1B4RA 3KLQA 4F57H 3GSNL 4AJ0A 4PJ5E 2Y07L 3KPOA 4KV5E 5TF1L 3AJ7A 4JKLA 4OB5L 4MJ6B 4APXA 4JG1H 1TDQA 4O51B 5FKPB 4QRQB 4NEHB 5D7SL 4P49A 1AGDB 4LLVA 2YC1B 4JZJA 4U6HB 2F7RA 2GFBB 2YD2A 1WT5C 4M1DH 3QARA 4MNHB 5AOLA 4JY4B 4O58H 4DEPB 2CMRH 4CVXA 2WMPA 4I18C 3B83A 3VE0A 1EZVY 3VQLA 2IVFC 1DBBL 2NY6C 1AZVA 2G3XA 1MVUB 5DUJA 2KUTA 4JFTA 4UT9A 2EDKA 4MNQE 4N87A 4TYUA 4GSDL 4CW1B 1TOXA 4GAGL 1FCGA 2Z6FA 5CBEA 1DJIA 4P2OA 1LMIA 2G5UA 1RJZA 1WFMA 1AHKA 2EE2A 4UAOC 3W1ZA 4KQ4L 1P0SE 1U8QA 3MKGA 4PJEA 4BE5A 1DJXA 1KGCD 4KGJA 4V33A 4FAAB 1UYWH 3HA0A 4FA6A 4NUGL 1CL7H 3FTSA 1M2OA 4N9GA 1X7QA 4U1GB 3RY6A 5D7KE 1SEQL 1F4WH 4FF9A 1EEYB 3O3AB 2Z1KA 1KTDB 1A6TB 3BJ91 4OVVA 2XNAA 4J6IA 5LJYH 4Y89A 5TTRA 2AHIA 3D05A 4JN2A 2Y1ZA 3W82A 4EN2A 4F7CB 4GKSA 5JIMA 3BVTA 4OD3H 5DHVB 2XQYK 3W9EB 4YLQT 1E67A 2YOAA 1RFDL 2IFGA 2JKJA 4U1SB 2X2IA 4XX5A 3HCVB 2BDNL 3NFPA 1V7NL 3QCVH 2IPTL 4MMZB 1T80A 4NN6C 2F19H 4M8UA 3EH4B 2IV8A 4BCXA 5E51A 2Y1YA 1OSPL 3HKFA 2XBTA 1JXDA 1F4WL 4KO9A 3QQ3A 3DIVA 2VLME 1KTDA 4IOFC 2LR4A 4LEXL 1C08A 4LLDB 4APQA 3AY2A 1DEDA 1G0XA 1OAZH 1JCVA 5DEFA 2JI1A 3V55A 2CO3A 1AG0A 1GS6X 2D3JA 5HVHB 4WJKB 2Y5TA 4NUMA 3WTTA 2DIJA 4JRXA 4KXZH 4KAQL 1RFDH 5CZXC 3S35X 2X41A 3PABB 1LE5B 1H6EA 1Q9OA 1A22B 2AANA 3X1FA 4R0LC 3EYFA 3S5LG 43C9B 4BA8A 3PGCB 4DZ8B 3UP6A 2BK8A 5D7HA 3UC0H 3E3QC 4K2UL 2K6ZA 4EPSA 1EGJA 3MLZH 2CHXA 4IOFD 2EIMB 4C59B 1XCQB 1U92B 3GRWL 3OG6B 4LLWB 5DQ9A 1HYSC 1RVFL 1FGNL 4I0PB 4P2QE 3HUJF 2RCSL 4M4RA 1AKJA 3B8YA 1A1NA 1EDQA 3VCLA 2H7WA 5F6IB 1INQB 3HG5A 1EV2E 3VI4B 3BPOB 1KFAH 2HVJA 4GRWE 3N3EA 4XNUL 3QDJE 4WI4A 3F7RA 5DJZB 3ISWA 4D8PB 5I76A 4OM1L 2ATAA 5D7LA 3ARWA 3BP7A 2PTVA 4PY8J 5D7LE 2BSEA 4DGYL 4JFQA 5EZJA 1Q9LB 1VERA 4HA1A 4L3AA 5FYLL 3PWPB 1BZ9A 5B7EA 3S37L 4UQBA 3BPLB 5AKTA 2XT1B 2JELH 1YY9D 3MFGB 4GW1A 2OL3L 4OD2B 5CD5C 1RVFH 3WAJA 2QHLA 4OCWH 3U0TB 5IBLD 5E8EB 1JPEA 5ECJE 1SUJA 3UTSE 3HAEA 1QQDB 3EOBA 2JB5H 3BGFB 2IMMA 1KLUB 3BP6A 3DXAA 3ML9A 1NIBA 4AMWA 3D6GA 2VSKB 3D25A 2PR4H 4BFKA 2J12B 1CE1H 1RZFH 4ZW3A 5GGUA 4AYFA 3L6FA 1TVBA 3GKZA 1VDGA 3GSVB 3ARBB 1J1PH 5LCVH 4EE2A 5CD5D 3WIIL 3ARXA 1YZZA 4YSEA 4GRLD 3M1BA 2CK0L 4XODA 3O6FB 2VC2H 3K4DA 4GW1B 3OSKA 3GSUA 4IOIA 3WJLA 3P0YL 2A6JA 2JKWA 1TZIA 5AAWC 5I75C 2HA1A 4NN7B 4AGNA 2HLAB 2JXMA 2O1AA 2NY5L 4N0YL 4HQQH 4G9FD 2ICES 4ZX3A 5BV7B 5I71B 4JDVA 3VB8A 1SNRA 4IKIA 3Q8EA 3TP4A 5HHXL 1R75A 1HXMA 2AQNA 3NZ8A 5MEPB 2L04A 4Z3HA 3OKDB 2CCWA 4GRLA 5I18H 5E7FA 3OR6A 4LGPB 4OI8A 2KERA 2XV2A 1I1AC 5D2NC 1HKLH 4OM0L 4WW2A 2BRQA 1WWBX 4G7VL 3SCMB 4LE8A 3OB0K 3ZIMA 3V0VA 3B9KA 2VC2L 3TLRA 2FEEL 2HB0A 5DA4A 2W9DH 3HPJA 4G6ML 4J4PD 5E9DB 1UUNA 4DN3H 5FFLA 1KTKE 2C9SA 1DSFH 3VU1A 1CICC 2CAKA 5ANHA 5F44A 2WP3O 3RUGA 1P7HL 4JPVH 2VKWA 4XPFL 1T7WA 3ALWA 5F6HJ 3GSXB 2I07A 4M9PA 1TMQA 2VAAA 3VI4E 3D0AA 4N85A 4RA3A 1W8NA 3WCYA 1HXMB 2YAEA 4EZLA 3V6ZA 1Q94B 3ABMB 2M1KA 4HWEL 2OSLB 4LL1A 4BD4A 4NQTA 2NUTA 3AQDA 5IW1A 2BNUB 2ARWA 4RGND 2IAND 4Z77A 3U7WL 2NYYD 3WD5L 1SYSA 3BSZL 1KCRH 1AJ7L 1RKRA 3IDGB 4R84A 3IJEA 1SQ2N 2WUBH 4OLZL 1MG3C 3WTYA 3ZDYE 4XBGA 2EKJA 1R3JB 2DWTA 2OBGA 3DHMA 3OKNA 3QPQC 1HYRC 2ZYIA 3IPBA 4PJXA 4U4IA 1YYLL 5HDOA 3SE9L 1NGXA 2AEPL 4P57B 4ZMNA 2W0FB 2UY6A 3FS9A 5D93B 2XQYG 1YY8A 2N7SA 3K8MA 5MERA 3X1GA 5CMAB 1MCHA 1T3FA 2VDQH 4U1SA 2FUQA 1EX0A 3WNIA 4AGLA 1TVHA 4AYID 1NBYB 1Q94A 4CDGC 3NK4A 4GUCA 4DFIA 3DUUA 4IRZA 2M26A 4Y16B 4ZUWA 5AENA 5A6MA 1Y1DA 2F8IA 1KJMA 3TX4A 2X2YA 3QPQD 4UIKH 1ZLDA 4QJ4B 1AS8A 2X4UA 1ADQL 4LPXA 3ARGB 1BFOB 1XH1A 4UQCA 4FQJH 3BH8A 2J6WA 3BDYH 3IFNL 3FOMA 3ULUH 3GKWH 2PO6C 3EG9A 2KL6A 3B5GA 5L0QB 2XG5A 4LESA 4YL4A 4Y4FA 3UIZA 1FLRH 2BW4A 3SZKC 1IQDA 4GXVL 2Z8SA 3FAWA 4H25B 3ZO9A 2BWDA 3K74B 2G0LA 1CL7I 3APFA 3FN3A 3EIFA 4GO9A 3MRJB 4ZAKA 1ETA1 1WBYB 1MNNA 3L8QA 3VD7A 1UJTA 4Z0XB 3HN5A 1V5JA 1TFHA 1G6RA 1M42A 5E8OB 1WEJH 1GCYA 1J5OH 1O9WA 3QR2A 4AG4L 1NJ9A 1OB1A 4I0PA 3BAEL 1W16A 3FZUC 4UV4L 1JD7A 1JI2A 4K5MA 3T3MB 4GINA 4XNDA 2G4GA 1BVLA 3ZL4L 4F7MB 3N42B 1KTLB 4OD3L 4PV9A 4LLYB 4JHAH 2PPAA 3A6BL 3V4PH 1FE8L 1BQ5A 3L5WB 4Y9GA 1M1XB 3MZTA 5BCAA 3JV4B 3VD9A 1NIFA 5IF0A 2BY3A 5BMFH 2PTUA 3MAWA 4DK3A 4X5PA 3NSCA 5IOPB 5EZOH 2QQLH 5ANMA 1JZIA 4MJ6A 5C0CE 4APXB 1LP9A 2F54E 3L3OB 4WO4A 5I1KH 5KAQG 3U6RA 3IYLW 1WTLA 3DWTA 4N1EA 5DUMH 2V7NB 1M6OB 2P8MA 1MWAH 1Q72L 2WZAA 3D3VD 4YIQA 4UV4H 1K5WA 4XWGL 4C4UA 4PGZA 2K0RA 2PCFA 1OQXA 3MV7B 3GI9H 3P2DA 4LF3A 4DOHE 1E90A 4WSGA 3SKMA 4L4VD 1F4YL 2F7OA 2VDRB 1GIGH 5J9PB 3II2A 3QDMD 3SDAD 1CXKA 4QXGH 3APMA 3G3LA 1XB6A 3CN1A 1UZ6E 1DVFC 1U42A 2WUCH 2WWMC 3MLTB 4G6JH 1W0YT 4P3CH 3OAZK 5ICZA 3CU1A 1Q0EA 4XCEB 4BK4A 1ILUA 4W9GC 4UQEA 5FECB 4B0MB 1BJ1H 4M5SA 4MAZA 2Q8BH 2NR6A 1ZLUH 5GSRA 4A67A 3NACH 1TZIB 3VTMA 1Z5HA 4S0SD 5C0BB 3MLUL 5D5MF 3NH7H 1INDL 3QDMA 4GFXA 4Q4IA 3CFCH 2B4CH 3SDAA 3LNGA 3DURA 4Q6IA 4HYTB 1V8HA 4PRHD 1Z3GH 5CGTA 4UNIA 1XEUA 1F4YH 4HHWA 4GO6B 4G8IA 4UNUA 1G4MA 2FNWA 4IIQB 4V11A 3S37H 4ALAL 4AMXA 2UWEE 2YGQA 1FRGL 2P26A 1BFVL 1QSFD 2A38A 2MRYA 1VKXA 2D31B 4ALAC 5ICYB 1HI6B 3LEVL 4F92B 1AHWA 2YK1H 5IHUH 4Z3TA 2XFXA 1UWGH 5E6ID 3K3QA 5HGHA 3LXUX 4OT1H 4OSUL 5I15H 3K2IA 2R56L 1DBKH 3PDOA 4IDJH 5H94B 2ADYA 2NNFA 3GPEA 5TD4A 2XZAL 4N0FA 1S6NA 2YS4A 3C8KB 2DQCH 1CYWA 3FTGB 3IGFA 4UQ2B 3T0EC 4QPEA 5D2LA 1DEEA 2BS71 3L9YA 2X70B 3GSXA 2Z8VC 2QADD 4M93C 5IQMA 4HJIA 2D7TL 3KLLA 3LIZA 1CQKA 4HKXB 4PJHB 1EGJL 3DECA 2E9WA 4L5FE 4XPTL 1S78C 5ADPH 1HHKB 5HVGB 4UTAL 4WFFD 3VWKB 1N8ZB 3WS3A 4CMHB 3QRLA 4PJ9B 4PRPB 3MNZA 4GUPA 4W9HC 4YDVB 4R6UA 5AVWB 5D1QA 5G4MA 2ZWKA 2DQTL 5C0CB 2DQJL 2HTKC 4G8FB 2JCCF 1N10A 2WQWA 1T0MA 5KYYA 2QADC 1VF5C 4FN0A 1HHJB 3FK3A 2RALA 3ABKB 4HS8L 3SPVA 2X1QA 2Y5TB 3L5XL 1TTBA 3L81A 4QEGA 5GISL 4M6MH 5AW7B 4U2YA 1AC0A 1R3HA 2DW5A 3EOTL 4UBDD 1UM6L 2IWFA 5I8EB 5F1IB 3QZOA 4CSSA 1GZHA 1T4KB 2VR9A 1BSIA 1E4WL 1QOKA 4JQVC 3U1SL 3WBDA 2B0SH 1HKLL 2GG1A 3A5VA 1JS4A 2QR0B 3KCWA 4G5AA 4M5YH 5JIHA 4NIYE 1OK0A 3QZWG 3LEYH 4FZEH 3MV01 4AOFA 5C1MB 2DICA 4X6CF 5I16A 1B88A 1E5BA 1GW6A 4DEUA 1U8LA 1XGTB 3RGHA 3FSWA 4G8GA 4Y4HD 3MBEC 1AS7A 3F84A 1DSFL 1S7XB 3OGOE 5DF0A 1ZPUA 1C5DA 5D5ME 2VL4A 1D9KB 2CLZA 5HHPB 4JR9L 2ERJB 2WW8A 1IGJB 4Y19E 2N4IA 3QAQA 5FGCE 3S4SG 3EKCA 4AUYA 1ZHNA 3L5XH 5GISH 4DP9X 2IOOA 3FUKA 1XF3A 3TURA 3LOWA 1MPAH 2P46B 5GS1B 2FL5B 1F58L 3HAEB 1F4XH 2HJLA 4XCCL 1EAJA 4FNLL 4M5YL 4YDJA 4B3VA 2R29H 1DSYA 1KCUH 5F1OB 1G9NL 1ZLWK 1AGDA 3T71A 4M3HA 2JKSA 3V6OE 4MMYB 4X7CC 4K7PY 3SKOB 1BQHG 4XMVA 4NENA 2HMID 4FFYL 1KBVA 2AEPH 3J7HA 2YEZB 4XC1H 4XZUB 2FR4A 4ABUA 3OHXA 3BZEB 3T1WA 1PW3A 3A24A 3DVGA 5FFGA 5MEND 2WWNA 3HLAB 2VLJB 3VA2C 4YFEA 3AT0A 3BFWA 4QF1A 3S3SA 4Z7QB 5EN2B 4PRNA 3C5JB 3WIFB 2F53D 3C12A 3GDBA 1ACCA 3GTNA 5F7YC 2WO4A 2WWMD 2YPVA 3IJ7A 1T20A 3DDFA 4KNTA 2NY0C 1TZGL 2HFEB 4JKNA 3BKYH 3D85D 3LHAA 2OMWB 4YXHL 3GIVA 2XQBH 2WO3B 5K1JA 2Q3ZA 4NWUL 3GKWL 1ETB1 1IGTB 1T04A 2MTPA 3L7FB 4AX3A 1DJZA 5HDRA 4K73A 2EAEA 3CQPA 2WNGA 4JE0A 3FONB 4B9GA 1DO6A 2AEIT 1FZOB 1P84J 3D7PA 2CHZA 3Q05A 5GXBB 2A9MH 1JHTB 3CSYB 1KBBA 1IGIL 1CD8A 1JPTH 5DC0A 4PJAE 3ES6A 4R4FL 3QHZH 4IU2B 3UBFA 5J0BA 1AI1H 3O45A 2C9PA 3VFTA 1CBVH 3K72B 4ZXBC 5DURB 3BKYL 4MQTB 1UZGA 3BWZA 1FG2A 3CN0A 4JM2F 4S1DC 1MW1A 1TR7A 1PIFA 2CBOA 3E8UL 3EJQA 3SYCA 1ES0A 2AXFB 4YK4B 3QQ4A 1T1ZA 1QATA 3RWIA 4JFDE 2MFNA 1J1OH 3HRZA 4HLZG 2HRHA 2W9EH 3J2PA 4ZS7H 5J13B 3VX1A 4JRYE 1P4BL 1I85A 1FZMA 2WYIA 3CG8A 4PJ9D 3WO4C 5D7JA 1CFNB 4LSTL 3W2DH 2XFXB 1MSPA 3W38A 1RJCA 1ITCA 3EO0A 1FVEA 3HW7A 4G9DB 3FQTB 4V1DA 2FJUB 5FC9A 3GSRB 3PP3K 1QAWA 1NDMB 4UAOB 1LO4H 4L3CB 2HLFD 4H26B 8FABB 1TJGL 1U8HB 4PLJC 1T1ZB 2D7QA 2DEWX 4YWGH 1YHPA 3J27A 3JZ7A 4FQCH 5F72S 3ZQXA 1WZAA 2FECL 4JKPH 4LSVL 3PWLB 2J56A 4XXWA 5IB1B 2R0KL 3QNXA 1IGMH 4DK5A 4LKCA 2VLJE 2P8PA 3F7KA 3N44B 4Y19A 2IGFH 4KKZA 2VXSH 2WVUA 3KNBB 7FABL 4D3CL 5AYQA 3TZVA 2BIQA 4CC1A 4Z7QE 5IJVB 1X5AA 1PS3A 1F8TL 4Y4KC 3TCLA 4Y4HC 4XAKE 3GXNA 2X10A 1MFBL 3TL5A 3BKCH 2GPZA 4H1LH 1RHHB 4FQLL 3BH8B 4MZ3A 3BE1H 3JWOL 2GITA 4PWHA 4UOW0 5DJXB 5KSAA 3AMLA 1QRNB 1KV7A 3EYOA 5DQJA 4Q97A 5FM8A 4KRNA 3WV0A 4YHNB 4RIRB 5K9JL 2Y25A 2PLTA 5KTEL 4JLRA 3UJTL 3NJFA 4POYA 1FYTB 3UJIL 2Z7UA 1G1KA 4NHUA 3ZE0F 2QTEA 5AWNH 3WY4A 3WGVB 1TQBC 5FFOA 3VQ1C 4XNBA 2EDFA 4PS4H 4RBPH 4OKVA 2Y5EA 3GXFA 3QUMH 3ZTDC 1R6VA 2FDBP 1PZSA 2A9BA 3KWXA 4QRRD 3GDCA 4N2NA 4W6XB 4TXVB 4M7JH 2OMUB 4W4NA 3TJHC 1JPGB 4C56D 4DGIL 4BXSV 1OO2A 3VFPB 4HLEA 1JGVH 4LEOA 4HK0B 2Z64C 3F6LA 4HISA 4OZ4B 4LHUB 4WWKA 5CLYA 4XN5A 2X89D 5KVFE 3D12B 1JNLH 3DIFB 4PYHA 2VW7A 3H9HA 5AZUA 5TDPA 4DHLA 2AV7A 3NSXA 3AG2B 2ENPA 4Z3IA 3CVHB 3S8FB 2Z9TA 4KZDL 2LU7A 3ZSTA 2AABH 3L5WA 1ML0A 3ZMNA 3BWUC 1T83C 3MYJB 1R19A 1UOLA 4JDEA 1BVOA 1NFDF 4NENB 3D3VB 1EAQA 1EFXB 3FU6A 5DHYB 1EAPA 5EU4B 2VCOA 5E6RB 3LB6C 1MJJA 5LNGA 1QO3B 3AXLB 3MRCA 3AWGA 3TFBA 4FYQA 5E0QA 1KB5H 1A6AA 2DQTH 1RPQA 1MFDH 2K4WA 2EE6A 4H1LG 5E5MB 1GH7A 1CICD 4MNQD 4PTUB 1UXSB 5DSCA 5BV7L 2BXYA 4H1LA 2AFNA 2E75C 2JKTM 1Z9NA 5IB5B 3WL9B 3V0VB 3VH8B 4LIQH 5F88A 3ZTNL 4D0DA 5L6YH 1CGXA 2GSGB 2NY3B 1YNTF 3K2UH 3ZKND 4ELME 1FO0H 1AO7B 3F5WA 1UM5L 4KVCL 3WEXA 3WNOA 2YXMA 4H0HB 4HWZA 4ZTOH 3W81A 1JZ6A 4X42A 1R17A 5FKPA 3KGRA 4OAWB 1FZOA 1YEJH 3SDYH 3KPSB 3CTTA 1WHPA 2MWCA 3US1A 5KYXB 2LHAA 1P6FA 2DS4A 4O5LH 5G4OA 2MOVA 3RDTD 2R23A 3FU3A 2XWTB 1BD2D 3ENEA 4MBOA 3TPUB 4OZGB 3FFDA 4AC2A 3VW3H 5E8PA 1QD0A 1QZ1A 3FQUA 3RX9A 3KGTA 4WI0A 2JKIS 3FHEA 5FM5M 5CCKH 2VO5A 4MVBC 3ZTJG 1DVQA 2VR6A 5IVNA 1QPPA 4IBWA 4KVCH 4OFKA 1UYWL 1QSZA 2AKRA 3UG5A 2Q3AA 5ADOH 4IEFB 2OZ4L 1RJZB 5HXMA 2X70A 4P4KC 4WV1C 3LKOB 5DD0H 4Q0XH 4QHLB 3KH3A 1FJ1A 3IETA 3IJ9A 4KDTC 3RPIB 5HHNB 3TT3L 3S36H 1EFQA 2CHNA 2J88L 2R69H 4W9LC 4LRIA 2H3XC 5FW7A 3PNRB 4MQXD 2YQ3A 4X80L 1TZOA 3DO7B 1G7HA 5EORH 5T1MB 1BD2E 3IDXH 4DTGL 4ATWA 4NWTH 1NBVH 4OFPA 1MFEH 1N26A 2J44A 2DH3A 1EHLH 5CGYD 4NO0D 4LGSB 2JF1A 1PYWB 1QSFA 1NOFA 1T2XA 2MKLC 3KLAB 1BJ1J 3LNEA 3S8WA 3QZLA 5CEZH 3ZVVA 3QJVB 3N04A 4IOSA 1PSKL 4TQPA 1S3KH 3FFCE 2AAAA 4OI9A 3LKQB 1WLHA 2A77L 4PR5A 4G9DA 3VNZA 1SJEA 4N4YB 4JFFA 1A7RL 1JNHB 2XWZA 1RL1A 4GT0A 4S1QH 1OTSC 5C8JB 2CBTA 4JQIA 3U46A 5BVPH 4BHUI 5JHLH 2VJ8A 3NIGE 3HMXL 4DVRH 3K1KC 5L88L 5AUMB 3MV11 2DD8L 2VTFA 1G9EA 1MHHA 4QRAA 5HJDA 1HE8A 1IEBA 4OFYD 1YEKL 4UNVA 1E8ZA 1KG0A 1MCLA 1QQDA 2O30A 3EOBB 3NJIA 1NSNH 4CU7A 3QEGL 5E08L 3CNKA 1I7RA 4NFBA 3IFOB 4Z6AT 4PJDA 5DWUH 1T5KA 1BJMA 4HC1H 5F9WB 4L0ZA 1AFVH 4N2KA 4G1MA 5B3SB 2JV6A 1KT2B 2CO6B 3QQNA 4YE0A 3L2LA 1E3FA 2R39A 2K6YA 2BP0B 5FF6B 3MRGA 2XLLA 5FB8B 3MRDB 3RIAK 3SOTA 1BLNB 2IBBA 4JNXA 3ARRA 4OF5A 1ZHNB 3D2UD 4KPHH 1GYAA 4G9FB 4KDVA 4ZS7L 2ZX7A 1KJ2H 1RIHH 2ORBH 1U3NA 4YO0B 3LN5A 4R7VA 4NHUB 2OP4L 2Q86A 4OKDA 4FULA 3UG4A 4E9VA 1NSNL 2UZIH 2EDDA 1JGIA 4DSYA 1JF5A 1K8IB 4PCSA 1T22A 2NY6D 3VFSA 2YSSA 2BVPA 4BWUA 3FU8A 1CVRA 1LO0L 4LOVA 1IEAA 4OQ1A 4ZPTA 4FRWA 3BD3A 3GYRA 3BJLA 4F5CE 3RJQB 1CIDA 4G6FD 1BZ9B 3QORD 4NPYA 5JW4M 1AXTL 3GLDA 1AXSA 2NXYC 3SEPA 4I8DA 1T7XA 4NUJA 3GIVB 4G8AC 4HIJA 1BHGA 5DA0B 1PTZA 3QUGA 1CGSH 2WY3B 3CZUB 4KQ4H 3TCTA 3VWJA 1MCNA 1FAIH 4HZLA 5C7XL 3FO1A 5LLIC 5H2BB 1A6WH 3O6MH 5F7FA 1AZUA 3BGAA 1HSAB 4GSRA 2XX0A 4JB9H 4HXBL 2R0WL 3BKCL 3X1NA 1JERA 1BPVA 3PWPD 3TBCA 2AJYH 3EJJX 3K8LA 3L3OC 3L3IA 3LEXB 5ITBH 4QRRE 2ARJB 4OY9A 1FH2A 2LFGA 2NX5A 3CU7A 4ODSH 4W9KC 5CBEB 2EDNA 4YBQC 2XWXA 5J56B 3NCYP 2MPVA 1MW0A 4MTMA 3QULA 5BOPA 1DN0B 2ICEA 2NTSP 3RIKA 3HG1E 1URLA 3CFMA 3BSHA 4D8OA 3DX7A 3IDYB 1XXFC 3DVNB 1NCCH 3RL1B 1U8CB 3LZFL 3NDZE 3QFDA 4ZMZA 1XH3A 4GW4A 5J6HA 3BFOA 1FAIL 5C0AB 1HAUA 1EXUA 3EH5B 3FB8A 4P2AA 3OWEA 4K7PL 2ICWA 3FQWB 1AQMA 3VG9C 5CMAA 1BX2B 1SOXA 2IPTH 4Z7WF 2XI9A 1UACL 1GPOL 3GWJA 3BWAB 5C07D 4GG6F 2P1YA 1OSPH 1NAKH 2XA8H 3NSYA 4MQXC 1A7NL 4XVTL 1OVZA 4APQD 1CR9H 1EVUA 1AOHA 5CEXA 3ULVL 3H2QA 1AMXA 1HILB 2QVFB 1GW0A 2YRPA 3TFKC 4FI8A 4GRWH 3QDME 4WI0B 5CZXD 3GHEL 4EEEA 4U0RC 4Y1AB 5IMOB 2VQ1A 5EC1A 4NQCB 1KELH 3BVWA 4BCYA 1IFHH 4J12A 1CDCA 5IW6A 4EKJA 3PG2A 4MNGE 4Y4FB 1L9OA 1NM4A 5CCJA 1VPOL 1WDAA 2RB8A 5IB4A 1NFDB 2KKQA 3P4OB 2FHBA 4APQC 5EU6E 2M2DA 3RHWK 4ANXA 1K2DA 5F9WC 1JK9A 5KVGE 1O9VA 3HI1B 3P2BA 2VXTL 3T2PA 3W0WE 4YUEH 4URKA 2FO4B 1RJYB 1KEMH 2HT4C 1QKZH 4X7FC 5KVMC 3OJDB 3M1CA 3RVWD 5I1GL 3WI9A 5DRXB 1KN4L 2IO5A 2QL1A 3LQAC 4FQ1L 5F3HB 1NCHA 2OM5A 3JWNE 3JTBA 1LQSR 5MEQB 2OMXA 3QIBC 4XBPB 3CHPA 4JEGB 3JUYA 5EEWA 2UY6B 4F8QA 3BGFC 1MLBA 4M8QB 2IDUA 2ROYA 5D1XB 3VFOA 4WVRA 4JFZL 4OZFH 5SWZE 1NIEA 3GMNB 4URTB 5LXVA 2C7UB 2XN0A 4WIQA 1QRNA 1NLBL 1NFIB 1JPSH 3P3SA 1ZANH 3MCLL 1FHGA 1TITA 4Y5YC 4PJDB 4PEEA 2B1OA 2Q9OA 3ECVA 3UTTD 1RZJH 3DTUB 3R7RA 1IEBB 3IE9A 3V0GA 4AT6B 5FO9A 4MJIB 2J3SA 1J1XL 4OF8A 1AZCA 2ATKA 5LHDA 2NY0D 5IJCC 4KOBA 1MCOH 3L1FA 4L8BB 5DJ2A 4P23A 2XKNA 3K4ZA 2MJWA 3W56A 3H0TA 5BS0D 5FUCC 1N7MH 4OIIL 3V9CA 1PD1A 2R1WB 3INUL 4K3DH 4JY5L 4CNIB 1J8HA 4LSDA 3D18B 5E8EA 5KJ4A 4EI5C 4XOBA 2J8UB 5EORL 2P5PA 3ILPB 5H37G 4AJWA 5ICZB 4TSBL 3ARFC 3I6KA 1WGVA 3PF2A 4JKKA 3BVUA 2CU9A 4PJBF 1IMHC 3VXRE 3NA9L 4LP8A 3KR3L 5GSRB 4HKZA 4JDTH 1UB5B 2B2XH 1NCJA 2FT6A 4AEIH 1V7ML 4N8VB 3IDYC 1QFWL 2B1HH 2J2ZA 5I5JA 5DC4B 5I1IL 1ORQA 4H5SB 3MXWH 3WG7B 4XBEH 3U7YH 8PAZA 4NRYB 1K4CA 1CFVH 3AM8A 1D6EB 4HCRA 2CUIA 2ED9A 4FS0A 4YVUA 3TO4D 2AK4B 1ETZB 3JSSA 3QWQB 3BCDA 1OLLA 3AVEA 4HWZB 4L48A 2D31A 1OTUC 1UJ3B 3P3UA 1XV8A 4OCMC 4L8SB 4ZSOE 2OMTA 3BKJL 3MPCA 2KDYA 1EEUA 3DOHA 1VFMA 4FQXD 2BSTB 3RU8L 4HGWB 4ZI8A 1HSBA 1L7TL 2K9FB 4Z7WA 1T4WA 3HC0A 3RFRA 3RWJB 4PRPE 1A3LL 4JO2H 4PLKC 4HWBA 1FIGL 5DLLA 2JLPA 3KYOB 4G6JL 1K6QH 2F54B 2J20A 2YPLD 1NFKA 1QW8A 1CICA 1N0XH 4MNQA 4W1TA 1A7BA 3V0EA 1A6TA 4OF3A 4E9YA 3KGSA 4JFDD 2EIZB 3T2NL 3QFDB 4X6DF 2NNAA 3WFDH 1ZV2A 1F45A 2DQUL 4KXCA 4PGBB 1FZJA 2GSIB 1ZLVK 3BVXA 2DIEA 5LQBH 3MNZB 4GUPB 5CEYB 3OQRA 4U1NB 2ICEB 4PM1A 3PWUB 3VWKC 1FBIL 3LJ3A 3QWOB 4OJEH 3DK2A 4I3SL 1HSBB 3TBVB 4KKRA 3HC0B 3O4OC 1IKNA 4KJYA 4F20A 1VZGA 1WF5A 4JDZA 4ALAH 4L4VE 1WIUA 3JVGA 4XH2B 4L5FH 2ZYRA 3IFLH 4UUJA 2MH4A 1KXVC 3DRTB 3NRPA 4ZMWA 3IKCA 3E6FA 3KBEA 3MVSA 3UERA 3ZZSA 3CZFB 1YUHB 1HH6A 2VM4A 4LAQL 3S2CA 4M00A 4NO0A 4XNMA 1BQKA 4K3GA 4PY7A 1F97A 2C3HA 1H3GA 2QSVA 2F2HA 3WN6A 4F24A 2DQCL 5EDXA 4UOZA 3GJFK 1AS6A 1HI6A 1MW2A 2IOIA 2YPLB 2R0LH 5I30L 4U1JB 3HI6L 5CU5A 2VZOA 3EYFB 2ID5A 5E4EB 3U48A 3WTWA 1A4BA 2QKIA 1NM9A 4LL4A 4DESA 2AW2A 4Y4KB 5KVDH 2CE6A 4WGWB 4RH4A 1I7ZA 3SQOH 4C56A 5I5MA 4ZOBA 3RX7A 4F33B 2ZXQA 3BP5B 1Q9KB 2PXYA 1U3HB 1AE6H 1R46A 3O41B 4PRBB 1YUHA 4A63A 1Z7JA 5HYJA 2R2HB 2I7SA 4G7QB 5FW8A 1N67A 3TO4B 2OMXB 2ITFA 1X4YA 4ZAKC 3BT2H 2FWLB 5GGVH 5C09A 3LIZH 3Q2CA 4GO8A 4PRPA 5F7HA 2YGPA 5EIIB 3WLBB 5T5FA 2O6PA 5I6PA 3EZ8A 4HWBL 3U1SH 1CFSA 1I82A 2MNUA 5D55A 1UM4H 3ZT5A 1W15A 3RWFB 5HGGS 1KIQA 4X6BB 3B2DC 3C5XA 3I6SA 4F33A 4PRID 4OI7A 1YECH 2BZ7A 2PW1A 5HYJD 4DGWC 2YJQA 5JNYA 3GMNA 3DOSA 3K6NA 5D70L 1NBCA 1U4EA 4J2QA 3MTRA 5JYMA 2LVCA 3GLAA 5D4JA 4LCIL 5JXAH 5LUMA 4GW5B 4HDIA 4L4VA 1IGFL 3ZKNC 4AYFB 3KM1A 4DO4A 4HUXA 5DZJA 4PJ8A 2ZG2A 4F2FA 5A2KH 2BIMA