4OCXL

Fab complex with methotrexate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
b'DVLLTQIPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSTRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTQLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab ADD056 Heavy Chain
publication title Water channel in the binding site of a high affinity anti-methotrexate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocxL01
3AFLA 3BGFB 4FQXD 4P2QE 5IVNA 5ERWB 3KLHC 4ISVB 3OAZK 2CJUL 4XTRD 4ZUTB 3SE3A 4YZFF 4YE4L 4LVNC 3GMLB 4PV8A 1VEOA 2I5YH 4YDIH 4J4PD 3WIHA 1DUYA 1QFPA 4U1LA 1R3HA 1HWHB 2BX5A 2B20A 1VA9A 3MRIA 3FFCA 2JB6A 1N6UA 4NZJA 3LRSB 4AT6A 5SWSD 1DDHB 4IRZH 3RL2A 1B4JH 1P2CB 3WFCL 3QXTA 1DCLA 4NWUH 2YC1B 4EEEA 1K4CB 3VFWB 3K74B 1AC0A 4F15B 1W72H 4PFEA 1Z9LA 1QZ1A 1UM4L 1WBZA 5LAXA 3G6DL 1FZOB 3GSVA 3SE9H 4G7YL 3NPSC 3MZGB 3X11A 4XPBH 2DB8A 4QXGH 4FQHB 4XGZA 4IMLA 3TPKA 3JV0A 2Y07L 1G7HB 5D7JD 3LN5A 4Z7UF 2JJSA 5GS1C 4Y2OA 3LD8C 3KHQA 1RUAL 3MZTA 3O3BA 3TF7C 1AP2B 4KVNL 4PR5A 4XP6L 3ISWA 2VC2L 2EDYA 3SDAA 5KVMC 4EZMA 2WIIB 5C0FA 3SKUD 2NR6D 3WJLC 3SQOH 1YEKL 3DARA 5E95B 1WWCA 1GGCH 2R1YB 5DJYA 4LRNL 5CINH 3U2SA 4FXLA 4G8FA 5DJAA 1P4LA 3SKNB 2NX5D 1T5WA 1IGFL 3D6GA 1CVRA 1G7QB 4ZUUB 4PRIE 1MSPA 15C8L 3C6LC 4ACPA 1AD0B 3QA3A 3I9GL 1GXEA 4HIXH 4GLRI 2NY1D 1J9CT 4N0YH 4N8VA 3SDXF 5I1GH 3NOIA 1XR9B 3Q1SH 2MHAB 2DI7A 1UACH 5IT2H 3CFDA 2AP2A 3RA7H 3TN0A 4WTWA 4U6HA 4O00A 5DGRA 1ZWIA 1OTSD 1V3JA 1RZGB 3STLA 1R3JA 1PLGL 3CSBA 4P48A 2YPKB 3AMLA 4FXGB 4Z9KB 3IGAB 3TBSA 2ZCKL 1FV1A 4F7TB 1TLKA 1ZS8A 4APQA 1P7QD 3MRNB 4UV4L 4MAUH 2EYRB 2P7TA 3ARXA 3X12A 1FC1A 1I3VA 5LG1A 1NFDB 2HLFC 2R2EA 1L7IH 2DQIL 2DF3A 3HZYA 3DYMA 2A83A 1WZ1L 3QZWG 3VFOA 2AJ3B 3BWAB 5C0BE 3RWGB 5HYJA 5DWUH 3AXLA 5EZLB 1KCRH 4Q9CA 1A3LL 1A6UL 2Z31B 3BZ4A 1CL7I 2E7BA 2HFFA 4Z95L 3I50H 3U46A 1MJUL 1NBYA 1CR9H 1Z3GH 2BSED 2XRAL 5J57B 1SJEB 2EICA 2OZ4H 2Y6SD 5ALCL 3HPJB 1S8DB 3WNPA 3RIAK 4X4ME 1A1MB 2YZ1A 5FYLE 5CCKL 3SGJC 1D6EB 4NJAL 4Y89A 4G7VL 1F00I 1SYVA 5FOBB 1MFBL 1IL1A 1UWGH 4J6RH 4AEIH 3HUJA 4H5SA 4JVUA 3RDTA 5I8OL 1MJ7L 2EO9A 3LEYH 3EO0A 2Q20A 5T33H 3RAJH 5IHLB 2KZ1B 1T1WB 4U33A 1OB1A 4WHCA 2P5EA 4R26L 1KB9K 4J3SA 1A6WL 2A6JB 1UWEH 3DVNB 2CRYA 1JBJA 2W60A 5KANG 5TF0A 1UKSA 4C56A 4JZOB 1CICC 2H32H 5E1AB 1BQHA 2MCG1 3RNQB 5IG7A 3A6BL 4NKDA 2FX9H 2HN7B 3ESUF 4EUPB 3AS1A 5ID1A 3E6FB 1E4WL 4RMUA 3T0EA 2Y5EA 3S34L 5E9DE 1A6TA 1CK0L 1NEUA 2KKQA 3BQUD 3HTLX 4KHXH 5F7KC 5HHOD 3WLBB 4QOKE 3VJ6B 4DW2H 1UCBL 2X4TA 4ODWB 1FO0L 1F45A 1F11B 5E8DH 2CLZB 1OWRM 2NYYD 4MA8L 5A3ID 5I16B 5DFWH 2GITA 2HRPH 1B0GA 2HVJA 1A7BA 1YN6A 2FX8L 5CLWA 2DOCA 5GGUB 2OCFD 4MXWH 1S7TA 2J8OA 1AKJD 4PGBA 3BFOA 5IMOB 3QULA 3X17A 1KC5L 5KBNC 2EDRA 4JFQB 1NCTA 2WWMD 5HI4C 1EO8L 1FORH 3UYPA 1ETZB 3TO2A 4UINH 1KV3A 5E2TH 4KTDL 1KJMA 1JPFB 3F58L 3HI1B 1OOAA 3ZT5A 5JHDA 1U3ZA 3VWJB 5E6YA 4PJCB 3WS6C 4C4KO 2AJXH 5F7DA 1BIIA 4OLEA 1HYSD 4KJWD 1A3RH 3X13B 4PJHB 1EEZB 4CW1A 3U4EA 3GMQA 3RWHA 1FIGH 4P46D 4Y2DA 2D7MA 2A2QT 4TULH 2A0LC 1D5IH 5EPMB 4YQXH 4JDVB 2ADFH 2ICCA 3N85H 4WWKA 2HT3D 2R0ZH 1NGQL 4QRPB 4JVPA 5JUEH 3QDMB 4MJ5B 3S36H 2VIRA 4OF8A 3TH2T 3MBEB 1NLDH 2A73A 3PNWA 4M7KL 4BELD 2EIEA 5DD1H 4ONGL 3VFUA 5MERA 1S9WA 5HVHB 4XPTH 3QUKA 1XGUA 5FXCH 3KPRA 3CUPA 2PW1A 4JR9L 5IFAL 1A2YA 1DVFA 2DD8L 3MJ7A 4DFIA 1QR4A 1JUFB 3BEWA 2VITB 4DN3L 4U1GC 5BCAA 3C5JB 2CUIA 2CKNA 4CU7A 1QSFE 3FQWA 5I8CB 1DANU 4YXHL 2B7DT 5DRZA 2E5EA 1QRNB 3QCTH 4JJ5A 5FUCC 1QACA 1GSMA 2K7QA 2X70B 3OB0K 1T7YA 4POZD 2BRRL 2APFA 5C0GA 2XTJB 4M7JH 5H2BA 5HTSA 4PJIB 1YNKL 3ZT7A 3BEVA 2HP4A 5F89B 3AC0A 1YPZB 4L4TE 2J88L 3OTTA 1E0OB 1RU9H 4ODUB 2QHRH 2P46B 3J8F7 2QSVA 1MHHA 4Z7UA 4LNRB 4IJ3B 3C87A 4I0CC 3KPSE 1CTNA 3EDJA 4OZHB 2OM5A 5E8NA 4LSQH 2YD7A 2MQ3A 2OTWA 4YGVB 5ISZB 1VENA 1FPTL 1DLFL 3HI6H 5IVOA 3MRLB 25C8H 4PJEE 3FRPG 2BNRD 5GS2D 3JV5A 1IEHA 5FECB 2V5RA 4O5LH 1J1XH 1YZZA 5DQ9B 4JDZB 3QUMA 4IRJC 5HSFA 2WBJD 2H26B 4KAQH 3NAAH 2GK0A 2VXUH 5K59E 2D2OA 1IGYB 3SDXA 4PYHA 4EXPX 2P8PB 1KCSL 4OZGF 1F42A 1QPPA 4GUPB 4OBRA 5BRZA 2BSRB 5DMKA 3ULVL 4C4KT 4JY6B 4ONHA 5DVOA 4GW4A 2QKIB 2I07B 3GHEH 1NAMA 3UYRL 4PJ5D 5F8RC 1DP0A 2A77H 1S7QA 2ARWA 3NFSL 5F1IA 3HNSH 3K1KC 3VWJD 4BH7B 2D3VA 1WIOA 1VDGA 2MPAL 4OKVB 1T83C 3T4AA 4YXKL 4F58L 4GSDL 2BXZA 2DM3A 5TDNA 4WUUD 4XP9L 1ACYL 5I1JL 4FP8L 2FZ3A 1RZ7L 2JCCB 5C2UB 5GJTH 2Q8AL 3VH8A 5E6IB 4B41A 2N7BA 4LSTL 3Q6GL 3BGMA 4G6AC 1BECA 1SYSA 3I02B 3OR7B 5ESVA 4JHWH 1JL8A 4NQEB 3BPLC 1IC5L 3GSWA 5IV2B 4QRPD 3QDMD 2E9IA 5DRWB 3MBED 3BP7A 1UXWA 3BP4A 3QO1B 2P5WD 4MCZB 1PKOA 4PLKD 4XC1L 5IEHA 3RPIA 1FZKA 5C86A 2OLDA 3FJTA 4U31A 1BF2A 3KAAA 3NTCH 1S9VA 5KG9B 4OTXH 4DKEL 4OLXL 2HKFH 4G8EB 2ORBL 4X5XB 1TFHA 3ARBB 1TJIH 2CDEA 5T5FH 2ERJB 4WV1A 3EYQC 3BKMH 5DJXB 4RMRA 3L7EA 3GHBL 2EC9U 5HGHB 2OI9C 4V1DA 1BX2A 3IB4A 1YN7B 2ITCB 3GSRA 3DRTA 4JG0H 3MV9E 3WL9A 5EA0H 3QRGL 1RVFL 5GJSH 5T3XE 4PG2C 2ID5A 3MTRA 1S7UB 3BSZH 3Q3GB 3L3JA 3RVUC 4KMTL 4CUCA 4PTTB 5D7LB 3ZE2E 5FO9B 4DUXA 3FQUA 3KJ4C 2DQTH 1MUJB 2XY2A 3PWPA 1AGEA 1RHHB 3ARVA 3HE7A 2VABA 4RDQF 5ACMA 1EUTA 1YYLL 1RJZB 1E4XI 2ZCHH 3VRJB 4TNVF 1N3NB 2GCYA 1JYWA 1OCWH 2RQ8A 4XWGH 5DDHA 5IVZA 4KZDH 3DUHA 1YECL 3MYJA 4AM0B 4JKWA 2IQ9H 4PB0H 2CGRL 4R7DA 3OAYK 2E8YA 1JGUH 3EDDA 4U1HB 1NAKH 4DGVL 5DI8B 1CI5A 4DVBB 2IALA 4OLVL 1D6VL 3B2VL 5I1HL 2DTML 2O5YL 2AEWA 2EDHA 4OFKA 5BS0A 3SOBL 4XXCA 3L95A 4GAYB 1CIUA 2VQUA 1IEAA 2H6PA 2Z93A 5DHXB 5KAQG 4LIQE 1TJGL 2G5BB 3JUYA 3OAZH 3D0VA 1KELL 4OJFH 4LPCA 4U7SA 1UQSB 4LGSB 3VA6A 1PY9A 1ZT4A 2UZYB 4EUPG 5K9OA 1PKQB 3QUXC 4PGCA 4F7PA 4M03A 2ESVA 1KUMA 2LU7A 3F5WB 4J3XA 4L8SA 2HMID 1N5AA 3BP6B 3BXNB 4X6DE 1XCQA 4XHJC 5D2NC 4NQVB 4EUPH 3ILPA 1NEZB 2QR0A 3G08A 4NQED 3VGHA 4LLVB 3P0VH 3T77A 3KLHD 3FHQA 4I3RL 2XG5A 4IIQA 5E2WH 1CDYA 4HXBH 4PRHA 3FB7A 3T2QA 1ZHNA 2ZUQC 3W81A 5I75C 2VLRB 4R0LA 1YEIH 5DA0B 5ICXA 3T0VA 3JWDH 4G6KH 4HS8L 1FG2A 2ZUUA 4ZFFB 3ARBD 4EOWH 1OHQA 2I26N 5EWIL 1B88A 1S78C 3C2AH 3WNOA 1LO5B 4Q9QH 4U1NB 1MRDH 5GGTL 2VR4A 3W39B 5HJ3A 1G6RL 1OSZB 2X44D 2BNQA 4CVXB 4RAUB 5HGAA 5KS9F 1RZKC 4ZDHA 3L3KA 3VFTB 1WEJL 5DHVA 3UTSE 4OGAC 2IH3A 4IMKA 1IZKA 3IVKA 3SGKC 5TQ0L 4X6CB 3LHPL 1FNEA 1FIEA 2YMXL 4TRPL 3W11C 1F90L 3O41B 1MY5A 1XAUA 1XH3A 5TFSL 2Q8BH 1U8LA 3BPCB 2R2BB 4F9LA 3B9VA 2F53A 2X42A 3QT2A 2FBOJ 3BPOB 3CZJA 4OM1H 3MCKB 3HG1E 4PY8I 3GM8A 4UBDD 1I75A 1OAUL 4PRDB 4HKZA 3QAZB 2JJUA 3K0WA 3IKKA 4RWYL 4FQ1L 4XCCL 4M1DL 3D85B 3ARFC 3FONB 5DJ6A 1OGTB 4MA7L 3QDJE 3K81A 1X44A 1MFDH 2WM0A 1MCJA 1NL0L 3FL7A 4QRUA 5T1MA 1VKXB 4N5EC 1JNHA 4XP1H 5FA4B 4ZFGL 4EN3B 3QEHA 1W2KT 1WCBB 4S1RH 4G6JL 1MI5B 4MAYC 4Z77B 3C08L 4JN1H 4U6VL 4ZOCA 3MFFB 4TOYH 2FO4B 3SHSA 5HHMD 5F1NB 3P9WB 1LP9B 1H9VA 4M48L 3MREA 1R3LB 1S7WA 3DXAE 3QHTC 2DLEA 1J7VR 3ULSB 3V52H 5HY9A 3VI3E 1G6VK 2AERT 4L8DA 2AJSL 4NP4L 4BSWB 1XZ0B 3TJEH 4E42B 2VLKA 3W0WE 5IB1A 4XVJL 4PJXE 2LTQC 2OL3A 4U2YA 3FO0L 3T4YA 4L9LC 1A4KA 4W6WB 1DBBL 1U8OB 5BZDA 5DRNA 4P2RE 5FGCB 4ZPVA 2AKRA 3TT1L 4XNUH 3MR9B 2RJMA 5INCB 4PJDF 1F4AA 1AGBB 2D7TL 1WFOA 2E7MA 4UNUA 4NRZB 4JFYB 4JFZL 4P3WA 3Q6FB 2XXCB 5DJ8A 4H25B 4L3EA 1I7ZB 5FYKE 3CC5B 3IDNA 5ENWB 2VRAA 3QXAB 1WFTA 2ZPKL 5IW6B 2FH8A 1YDPB 2YA0A 3S96A 1OARL 4MNQD 4WW2F 4D9LL 1BBDL 3ORJA 4LPYA 4LVEA 4X5WA 3BIAX 4FG6D 4L5FL 1I1YA 4XCNA 5IHBA 1MHCB 4NO2A 3O6ML 4QF1B 2R1WA 4ZNEA 1U95B 1XGRB 2A9MH 3V5KB 5L2JB 1KJVB 3LS4L 1JF1A 1IAIH 2X10A 3CAFA 3NH7L 4PRPE 2O93L 5B8CB 5DS8A 4MWFA 3SPVB 3SCMA 3ZDXE 3B5GA 3V6ZB 2H2PC 4PV9B 3GSXA 4MJID 3JTSA 3BH8A 1DQJA 4HMCA 1XT5A 4WUKL 1JZ7A 5FIEA 5CBEB 3CVHB 1CQKA 2XKUA 2WNGA 3HMXL 5I74C 1YMME 3DIFA 3TP4A 4X8JB 2EKSA 5T5NF 4X7SL 5DMYA 2R29L 3KHOA 1AO7E 3UBXI 3QFJE 2J5LB 2IBBA 4JHAH 5TPWL 4Y4FC 4GW5A 1MCWM 2PXYB 3ZTJG 1MI5D 4M1CC 1U3YA 3WXVL 5J7CC 1FVEA 3FCTB 1YQVL 4WFGD 2LVCA 3PWUB 2VYRE 5J12C 3SDDB 1IGJA 1OTUD 4MDJB 1CTOA 2YD2A 3PHQB 2Q6WA 1CU4L 1LMKA 3HC3H 3HNTH 4H20H 3V5DB 3TV3H 4OLWH 3GGWB 3MMEA 3ULUH 4QHLA 2OMBA 1P9MC 4KROB 4F8QA 4YAQB 3LVEA 2ICEB 5IF0B 2CKBA 2K3TA 2JIXB 1EAPA 2HT2D 1JHLL 4UDUB 1LO0L 4K23L 5CWSA 2X05A 2J1KA 5EBWA 1C8PA 4PD4K 4X7EC 2Z31C 3UZVB 5I1KH 1DSFL 4PB9L 4OCRH 3D3VE 4NZUL 5MEOA 1OL0A 2D0GA 4AG4H 1KTRL 3SN6N 5C0BA 4KMLB 3H9YA 5EU6E 3ZL4H 3VE0B 4LVHB 3FQXB 4M7LL 3OB0H 1OVZA 2A1WH 3DVGB 4YWGH 4U7MA 2MWCA 4XC3H 4NFCA 5D7SL 4ZUSA 4S1SL 2DQFA 4HCRH 4X4MA 5IWLA 1HXYA 4Y4KA 4RCAA 2BVEA 1WT5A 4R8WH 4NNYA 4AL8L 3JWOL 4Q9RL 3PV7A 5TDOA 4WU7B 5EO9A 1QEWA 4KK5C 1MFAL 3Q2CA 5DD5L 2B0SL 5D93B 3QEGL 3BP5A 1FZJA 1EHNA 3F7VB 5EU7C 1OAKL 3V4VL 4N5UA 5CP7B 1I7RA 4J7RA 3QNZB 1Y18A 4XP6H 4LOUC 5SWSE 3HE6B 1KENH 1NEZG 4OD3L 3D25B 3DX6B 2ZOKA 3ES6A 4L3CA 1CBVH 2VTFA 1Q72L 3B3IA 1J8KA 1U8IA 2YUWA 1CLCA 1U8KB 5KSAA 4MSWB 4XP4H 4GKOA 4JFDB 4MX7A 5GGSB 2EE6A 1TVBA 3TVMD 5E8EB 2MSPA 1FNSH 4Z0XA 2RB8A 3JWDC 3OAUH 4JRYE 3TNMA 4BFBD 4K9EL 1CS6A 3H42L 4XNQA 5JLZB 5E4IA 3RI5F 1AXSA 3VXSB 3ZKND 5GRVL 3U9UB 4N0UA 3U6RB 1IT9H 1RD6A 4Y4HC 3KS0J 4TSCL 1GGYA 3MCLH 1CN4A 5EB9A 1NBVH 5EOCJ 4F33A 2PXYD 3JWOC 2E8ZA 4KI5C 1PJ9A 4R97B 1TVHB 2XN9B 3TA3C 1PEZA 2IAMB 2DBLH 4U6YB 4CVWA 1S9KC 1A22B 4RMWA 2XWJA 4LFHD 1ZT7B 2XYCA 4W81A 4HFWB 1ZXQA 3CFCL 3EKCA 1XF3A 2YD9A 1WV7T 2JIXD 5DZLA 3MJ9A 3EYVA 4G6AD 4NO3B 2HWZH 4ALAH 1KIUA 4F2MA 5C71A 4YGAB 4WO4A 4NSKB 5F6IC 1KIPA 2D31A 3EDEA 1DQLL 4K9EC 3O3DB 1Y0LA 2G9HB 3NVQA 4K7PH 4ZTPH 3GZKA 1U9KA 4XVSL 5C6TL 4HJGA 2C1PB 5C0AD 4EVNA 1XIWB 1D7FA 1P7KA 4MQ7B 5EO0A 3IDMB 1EGJL 3EW3B 3ULVD 1ORSB 5F88B 4LPVA 1ULVA 4QLRA 1KIRA 4PLJC 3WO3B 4ODSL 1MY7A 2XTJC 4NN7B 5JOFA 2Q76B 1SBSH 1X4YA 1QSFA 2L7UA 4JKPL 3ARGB 1MCPH 1TTFA 3T0DA 2RCSH 3IU4H 2B5IB 3IDYC 3QIUC 1WCQA 3T09A 3OR6A 1T20A 1D5XB 3H7LA 5E2VH 3QUYC 4IJ3C 1A6VH 1A7PH 8FABA 3OAYH 4S0SD 2UWEA 2H9GB 5DZNA 1FH5L 4IM8A 2EDLA 4OFYD 4Z8FL 1HH9A 4KTEH 1B4RA 3S88L 4L4TA 5DC0A 4P5KA 1K8DB 5IBLD 3ZYZA 3MRJB 1OGAD 4XNYH 3QEUA 1T6WA 3KPSA 4OCXL 1KEMH 1SEBB 1IARB 4JFDD 1IC4L 1CFSB 3H9HB 4MA1B 4PJEA 1UM6H 3WLWC 1I8IB 1WC7B 1U6AH 4DVRL 4NT6A 2VWEE 4GRLA 1QVOA 4NKOB 3MLYL 1LE9B 1BVLA 1D5MB 3CFBB 4FFYH 3WUWB 2XZCH 4LF3B 2F19L 4O2CA 5HHOE 3AAZB 4TSBH 3UZEA 2IEPA 1NFKA 1YMHA 1YEJH 5EUOB 5D2LB 1O0VA 3LRHA 1FRGH 5DMGD 5HHXH 1KB5L 4YHNA 3K2MC 1ZA3A 3FOMA 4M5YH 4QHKI 3V5HA 3GMPA 3TPUB 5I2IA 1K2DB 4NPYA 5LBSL 1YC8A 2IAMD 5DT1L 2X4PA 1IEBB 1YUHA 3F7RA 5JIHA 1AQKL 2NY7L 5I17A 1F97A 4U0QB 1T0MA 2W9LA 4LCCC 3BE1L 1RUKL 5E6IC 1JK8A 1SJVA 2VE6A 4AIXA 4UTBL 4LEOB 1NCWL 1OSPH 2LV4A 2PTVA 3I3DA 3P0YL 5JOEA 4TVSa 2R4SL 3GEWB 4EI5A 3O6LH 2EIDA 4HDIB 4KXZH 4Y5XB 1DUYB 5F7UA 2BNUB 3W9EA 1L0QA 1R3HB 4GBXA 4K3EH 4U1LB 3HFML 1E28A 1H15A 5I19H 3MRIB 3C5ZA 3FFCB 2JB6B 2JELH 3SE4C 1IGCH 3CVHH 3EOTH 2CLVA 2Z35B 3RL2B 1MIEL 1KN2L 4KKNA 3UDWC 1B3JA 3CU1A 3E6HB 3L3DB 1A7OH 2W9EL 2GTWA 4P2OC 1MAKA 2ERJC 5J13C 1KCVH 1WBZB 3RZWA 2M26A 3C9NA 4R4FH 4DEPC 1MRFH 3CZFB 1S78D 1CLZH 1RHFA 1WAAF 1XIWD 1UXSB 4XGZB 1N7MH 4IMLB 5IFJB 4Q6YA 4LFHG 1BJ8A 3GRWL 2XWBA 3LN5B 3QHZH 1NANH 5KSBF 3LPGA 5I18L 1PG7H 1IKNA 2BRRH 4D3CL 3O3BB 4UTAL 3ULUC 1MH5A 4HIHA 1BJ1J 2E7CA 5C0FB 3ARGD 4XPFH 2FR4A 5KVEL 3MV9A 5FUOH 3WE6A 3U7AA 5HHNA 4YXLL 5DJAB 1P4LB 1H3XA 5FGBA 3W5MA 3CH1B 1GYAA 4RGNC 1KJ3L 1X5XA 1HN1A 5CJQL 5TQ2L 4BQ6A 1DLFH 3QA3B 3UTZA 3LIZH 5EZIL 1MREL 2YBRA 2ZSVA 5FV1L 3EFFA 1S9YB 2NXZD 4N8VB 1Q94B 3VXPA 3P4NA 1V7NL 3CFDB 3NACL 5IBTL 5A40E 4U6HB 5JXEA 3STLB 1CGVA 1XF4B 1A9BA 1TQCB 4RAHA 5DVMA 5C9KA 3OV6A 4APQB 4G8GE 2VR9A 2YPLA 2HTKD 3GI8H 3ULVH 4HGMA 1QNZH 2BNRE 2MTPA 3QH3B 5DQDL 2R2EB 1HSAB 3HZYB 4OD1L 1GGIL 4OT1L 2A83B 2F54B 1FN4A 4JM2C 2ILLA 4PJFA 4Z7NF 3RWCB 2P24A 1A6AA 2MPAH 1OAQH 2YKLH 3AXLB 2V5YA 4OUUA 1FCCA 1HSBA 4KHTH 3AM8C 3BZ4B 4N1CA 5F7EH 2H3NB 4QT5A 4LCUA 3FTGA 4D8PB 3KYAA 2BOBB 4MNHA 4NCDA 2V7HA 2R23A 4KRLB 1MIMH 5HDBE 4OGYH 4PJ5E 1PY4A 2AXFB 4TVPL 1J0IA 1S5IH 1HK6A 4HUWA 3HC4H 4YBLC 2CIKA 2HG5A 4F9PC 4U3HA 4H5SB 2BHZA 3JVGC 3REVA 4X6DA 3EO0B 2EH8H 1UM5H 4X7TB 5HPOA 4WUUE 2G2RA 4MVBD 1U8QB 1JZ2A 4TUOA 2ADJA 4BFIB 3V8OA 4J1UA 2ORBH 5D5ME 12E8L 4HV8A 3VW3H 1ZVSA 3HZMA 2XACC 4FOMA 4LCWD 1F4XL 5D1XB 2W60B 4ZG1A 1LHZA 2AJVL 1BQHB 1YJDH 1VACA 5DLML 5I9QC 2P5WE 2YEZA 5D7KD 1H5BA 4PS4H 3FB5A 1KFAH 4N0RA 4DGYH 5IQ9A 5AD0A 4AMKH 3VDAA 5CD3A 4XPAL 3GJEA 3LY6A 4NZRL 5FYJU 1XGQB 3KPQA 2RHEA 4JFHD 4UQ2A 3DMMA 2X4TB 1R0AH 1MCQA 3BPOC 4NKMA 4B50A 5L8LB 3LS5L 3S5LA 3CK0H 3T0WA 4F3FB 1I1FB 3VMNA 1NGZA 1Z5LB 2GITB 2HVJB 3CDGA 3UTTD 3QAZC 3QDAA 5LGJB 1ADQA 5FM5M 3LEVL 1DANT 2VISA 4KK8D 2VN7A 2ITDB 4ELME 4RNRA 3QULB 8CGTA 3B9KC 3MV7A 3O8XD 4KKCD 2QQNL 3QQ3A 3HG1A 4MZ2A 1N26A 3TO2B 4UIKH 5GGQL 1RJLA 3GIZL 4NIKB 1S7SA 3NBNA 2D03L 4GG6F 3FOLA 4PJ7B 5F7DB 2R8SH 1BIIB 1ODAA 4M9PA 3CSYB 2O5ZL 4W6YB 3BZDA 4J8RB 2AXGB 3VWKA 4CW1B 5EUKB 3GMQB 3RWHB 2VH5H 4WY7L 3GO1H 1N5YH 5CJOL 1XFPA 5HGDB 4MHHG 4UUJA 4ZPTA 3QQ4A 3BKJH 4QTIH 3WN5B 1MFCL 2IPTL 2Y72A 4P59H 5GZND 5KW9L 3NABH 2F54D 3JSSA 5KVFL 1NUNB 1C1EL 4GAGL 4FNLL 1U93B 4LLQA 2VDOH 3L7FB 4LRIA 3SBWA 3I3EA 3G5VB 5D72L 1UH3A 1PSKL 5DMIH 4I18C 2VN4A 2A73B 4N8PA 3P73A 4RQQA 1P5UA 3GKZA 4N9GA 3MRHB 3SQBA 3VFUB 4UI2A 3VXTA 1YEFH 3TGXA 3DXAA 5F9OL 1D9KC 1CGYA 2APTA 4IRSC 3UO1H 2PW1B 4PUBL 5EH1A 1DVFB 3QIBC 3W0WA 3SGEI 4PJXA 3VXOB 4RIRB 4DOHB 4Y1AB 3QNYA 3IJYA 1P4BL 4DCQA 4MS8C 3TBVA 3D9AL 3FQWB 3V79C 4HWUA 4HUMB 5DRZB 4P2RA 4UT7H 4F57L 3RUGE 3WUWG 5CLTA 4DN4L 1CFNA 2GJJA 4PJGE 4XMPL 1V05A 2UY6A 4MJ2A 5D1XD 3BEVB 4NQEE 1UA6H 2AAVA 2VDQL 2ZCLL 4HFUL 5D6CA 1NQBA 5E8NB 4JANB 1IKFL 1JNLH 4HF5H 4JQIL 4DKAA 5JW4Q 2OTWB 4KK5D 1OTTC 5LGHL 3PHSA 2CIIA 2VDNH 3VD4A 5TQ0H 4HG4J 2IQAA 2MCPL 1TPXC 3QG6A 4G80A 2XZAL 3MRQA 4JDTH 3VRIB 3Q48A 5IOPB 3PL6A 2VKXA 3HZVB 3K4ZA 3O9WC 5LCVH 1LGVA 2K7PA 4UT6H 4OKDA 3OXSB 3NPZB 1BLNA 1CGTA 3IXAB 3GIVB 1D5BA 2VAJA 3WIHH 4PRPA 4HUKB 3RHWK 5ANMA 4NCC2 4FQ1H 5INDB 1G7LB 1T1YA 2EC9T 2V7NA 2Q3ZA 3V6BR 1WK0A 5BRZB 2WZPD 2VZVA 4LU5L 5FAAA 3U79A 4LLWB 2Q86A 5HVGB 2EXWC 3QIWA 5FYLL 3QI9A 5E5RB 4A2MA 3NIDF 1E4JA 3D39E 4CDGC 1GCFA 1WZLA 3WNMA 3B43A 5K9JH 5DR5H 1N0XH 1YMMA 4Y4HD 3O6KL 4PJAE 1FL3A 2YHGA 4LSVL 4M1GL 1S7RA 4IHOB 3QFJA 2PO6B 3VFPB 3VH8B 5KJRL 3QZWA 3NN8B 4IOFD 1SEQL 4N0CC 3CPLA 4XPGH 3O0RH 3OHXA 1KEGH 1R3KA 3I2CL 4MXQD 2VXSH 3O4OC 2BHYA 1R24A 2JKXA 4HAGA 2OZ4A 1UXWB 3BP4B 4HC1A 1AY1L 2JE8A 3RKDC 5MP6H 3RPIB 5C7XH 1T22B 1X5AA 5L7XL 4N8VG 5ECJE 1S9VB 5HHME 2R0LH 4YHKL 3UC0H 2DS4A 3VGBA 2YR3A 4RGMC 1R3IL 5D4QA 3KPOB 4Y1AD 1WTGT 3RWJB 1T2QL 4N0FA 4V1DB 4Q0XH 1SM3L 1EXUB 3KYKH 3DRTB 3PDGA 2EXYC 3D3VA 4JG1H 1N4XL 3T0XA 3NA9L 3QWRA 1KG0A 5MI0B 4QHMB 4RGOL 5EU6A 2FBJH 2FATH 2EDEA 4JLRA 2VXTL 1O7VA 1NFDF 4E41A 1KBGL 1S3KL 1J8HB 1KB5B 4Q58C 4J2XA 1JWUB 1JRHI 2Y06L 5DK2B 1ZLSL 1AFVL 3FHAA 3MLWL 4KVCH 3KYNA 4P5TA 1AIFB 4X9FA 4C59B 4FQXA 4Y5YB 2VABB 1L9NA 4HEME 5JNYA 5HYIA 1CLYL 3QIUD 4M43H 3X3FH 4G6ML 2F15A 1HHGA 3DURA 3NH7H 1QBML 3PP4L 3LKQA 3QUYD 4OCYL 3PGCA 5IVZB 1VESA 3OX8B 3MYJB 4J4PA 4K3GA 4NOFA 3LOWA 3H8NA 1EX0A 2BOCA 3J7HA 4MNQE 2LU3A 4JZNA 4PYGA 5GSVB 1FVCA 5SWSA 3VMOA 1EZVX 1BEYL 3V0VA 3MRPB 5HPMB 1OLLA 3AREC 1TVDA 3EYFA 4F37F 2UYLB 2KBGA 4U0RC 2XKSA 1MAJA 1FDLL 4ZS6C 2C3VA 4UQ3B 3WLWD 5BS0B 3ILQD 3EDFA 4MXVE 4U7KA 3L95B 4K55A 4AENB 1WFUA 3VFNB 1FSKB 3ZHLA 1BQHG 1JJUA 3VRLF 4GG6A 1MAML 1N6QL 5KAQF 3R4DA 4KRMB 4MJIE 3D0VB 3PWJB 3SKMA 4FFZL 5D7JA 4WFED 3KYMA 3NCJH 3NCFB 1EHLH 2H8PA 5EZJA 3OMZA 4R97C 3TT3L 3WIIL 2ZP0T 1DQDH 1FNHA 3P3YA 4PGCB 4F7PB 5I1LA 1CD1A 5E00A 5GRXG 4JREB 4Z7OF 5C08D 4XCEB 5EIQA 1HHHA 1XCQB 4ZFOA 3ME0A 3MXVH 1MELA 2QR0B 3CVIL 2AV7A 2NX5A 5DEGA 3TZVC 1BWWA 3EO9H 4GG8B 4ODVH 1JCKA 1QFWM 1SY6A 4FQJH 4PRHB 3FB7B 1ZHNB 1H3UA 2DQUH 3EO1A 3HZKA 5I1EH 4PB9H 4R0LB 3NZ8A 4O9HL 4LAJH 1ORQB 1S5HB 1CT8A 1FG2B 1INEL 4DUVA 2FSEB 1FAKT 3LKRA 5FUZH 1IFHL 4YR6B 3REWA 1NCDL 1QLEL 3L1OL 3N1QC 5A2LH 1T7WA 3RWDB 3PGDB 1QLFB 4PJCF 1CFQA 1P7QA 4OF6A 4DTGL 2BNQB 5HGAB 5IB4A 1AGFA 4ZDHB 1I9IL 3L3KB 5DHVB 3QR2A 4I0PB 1VHPA 2QSQA 2V9QA 3M8OH 3SKJL 2IH3B 3GMMB 5HHVH 5KSUB 3IVKB 1KPVB 1J8HD 3WDIA 1PGRB 4CBPA 5CMAA 4YNYA 2Q87A 4G9DA 4JB9H 1XH3B 4WEBL 3UMTA 4FA8A 4KJQC 3BGAA 4EDWH 5FOJA 5ERWA 4ISVA 1CLOL 4HMEA 4JFED 3GNML 3N1FC 3T08A 3BUTA 3S35X 4ZUTA 1G9NC 1A7NH 3DX7B 2X6MA 5DJ6B 3GMLA 4UILL 1X5FA 1UZ8A 2NY0B 4N68A 5DK0B 3R06B 1F6LL 1QBLH 3EOBB 3GKWH 1T1XA 1RUML 2WWKO 1CF8H 1ERNA 1U8JA 5FF6B 2XTLA 2W65A 4QRUB 5T1MB 1N0LA 1S7XA 1SMOA 5DQJA 4ODTH 4S1QL 3P4OA 3QEHB 4FFVC 1GL4B 4OF7A 1DDHA 5CJXA 1P2CA 4MA1C 4O51A 2VQTA 2YC1A 1K4CA 5JMOC 5FM4A 4YH6A 1G9MC 2ZJSH 4KUZH 2FGWH 4X80L 4EIGB 5T1DL 1QFWI 4L4VB 35C8L 5HDQL 4PJIF 3BESR 4JY5L 3TLRA 3VFGL 2WIMA 4OZIE 3AB0C 1S7WB 1NGWB 1YPZF 3RIAF 5HY9B 1V5JA 5C9JA 2HFGH 1OF2B 4L3AA 4OIBA 1BOGA 5DEFA 1GGUA 4S2SA 1DZBA 4OZHF 1AP2A 4KGLA 4MD4A 1W8NA 3CXHJ 1RAMA 5T3XL 3BQUA 5HHOA 2DMBA 3H9SB 4ZXBB 5SV3A 4BZ2H 2R1YA 4GKNA 5BZDB 4M5ZH 3QRFM 3OG4B 3MV01 4P3CH 2ARJA 3SKNA 3C60C 2CR3A 2F5AL 2EH7L 1FCGA 3ELAT 4QRRB 2QV2A 3SE3C 5CSGA 4YJZL 3C8DA 2FEDC 1AD0A 1L0YA 1AD9A 4P2QB 4J3TA 3QUMH 2DLIA 4OQTL 1HZHH 4G42A 5DRXB 3GBMH 1AKJA 1LO2L 2JB5H 1XR9A 3EJZC 5GGRY 1A14H 1IQWL 1LDSA 1IGIL 4RISH 3IDNB 1RZGA 2H1PL 2XA8L 4KI1A 3S96B 1H3WM 3IGAA 3IFOA 1YEHL 4F7TA 1I1YB 4KPHL 3MRNA 1BQSA 5H94B 3QCVL 2EYRA 4I77L 4P46A 5ILTL 4CVUA 5IJVB 1NFDA 2YD1A 4I0PD 3V7AE 1WLHA 5I73B 2JCCF 1TTUA 3EYSH 2AJ3A 3BWAA 5GGVH 3SDAC 1UB5A 4RFOL 2ED7A 1CGSH 5I1IH 3O6FC 4LIQL 4OF0A 5EZLA 3BH8B 1BD2E 3MRBA 3MUHL 3OBAA 3T65B 3V8CA 5C0AE 3BHBB 3WO4B 1QQDB 2WWKT 1SJEA 2V9TA 4AJ0A 1NMBH 2AJUL 1FGNL 3HPJA 3OKDA 1A1MA 4LSUH 5IVXE 4JO1L 1DBJH 3DIFB 2NY0D 3WDHA 1D6EA 4TVPD 2EKSB 1ZAGA 4WHTA 2WSKA 5HYSB 3IU3B 4L1HA 1QPXA 5C0IB 2ATPB 3CDFA 3TN0C 3B9KD 4PRIB 4GW5B 3AS0A 2ZNWA 5E08L 2R56L 5LQBL 1G7JA 1FVEB 1TQCC 1RZJL 4ZD3H 3BRFA 2N1KA 4R4ND 2IFGA 2A6JA 3SO3B 3ULUF 3DVNA 4PJ8D 4APQC 3N0PB 5C0JB 3QJHA 2YUVA 4JZOA 5E1AA 3MMEB 3RNQA 1OGAE 4QWWC 1QSZA 4GMSL 5E2UH 3MLXL 5L9DL 2HN7A 1EAPB 2QQLL 1YEEH 4NM8H 4PG9B 5CWSB 5MEND 1DBKL 1RIVH 2BNRA 4LVOC 5EBWB 3WLBA 3NGBC 3H9SD 5JIPA 4ZXBD 4ZSOE 2NY3B 4ODWA 5MEOB 2PYFB 3BH9B 1F11A 1UJ3A 5C0BB 2WBJA 1XF1A 4ZS7H 4QRRD 1XGYL 1D9KD 5I16A 1UG9A 1H0DA 4OIIH 4LLYB 5ALBL 3H3PH 2XKNA 4AEFA 4P2QD 5GGUA 3FN3A 3RDTC 5DUMH 5IMOA 1GHFH 3C8HA 2XI9A 5AZ2H 4MS8D 5JZ7D 2DQEH 4FFWC 4JFQA 2DWDB 4O02H 1JGLH 2K1MA 4Y4KB 1ETZA 5DZOA 1RZJC 1BFVH 4PJ5A 5FYJH 3E3QE 3HI1A 2PF6A 3VWJA 5EORH 1VADB 3IJSB 4GKZB 4OLZL 3LKNA 1QG3A 5EO9B 2E6JA 1LDPL 2R0KL 2F9BT 1QEWB 5D2NE 3X13A 4PJHA 5J1AB 1AXIB 2YA2A 4WUUA 4BZYA 5GHWH 3BYTA 4XMKH 4HW6A 2HKHH 5D5MA 3BP5B 4KWUA 5MEPA 1FZJB 1TNMA 3MACH 4M00A 4P9MH 4ZOAA 2VXVH 1MCBA 4JDVA 4IS6A 4WI9A 1PAMA 4XVTL 3MBXH 2H45A 2EDOA 3WKML 3IDJB 1Y18B 2DIBA 1B9ZA 1NMCC 3T0EC 2ZOKB 4QRPA 5SWZD 5A2JH 4L3CB 4TTDD 4Y19E 2B2XH 3QDMA 4MJ5A 4NN6B 3IXTB 3B3IB 5C0EA 3I75A 3MBEA 2MOVA 2P5WA 4NJ9L 2VDRH 4KDWA 1X5LA 1P5VA 5KSAB 3TM6A 1MRCH 4KUCF 3HCVA 4MX7B 1TVBB 2C26A 4IOIA 4BUHA 5E9DB 4Z0XB 1MWAL 3GSUA 3WXWH 2BVPB 3TNMB 5D9SB 1JUFA 3X3GH 1MREH 2VITA 4QOKB 4XNQB 2NY2B 3WBDA 1MF2H 3VG0L 1HQRA 1NSNH 1CXLA 1J0YA 4NNPL 4WU5A 3TFKD 3S36X 3WD5H 1CCZA 1I8LA 4PRID 4F33B 1QOKA 3QXDA 1F4WL 1JI2A 2X70A 1MPAL 3MUJA 5E2JA 4I0KA 3V4UH 1NCCH 2R4RH 2AI0L 5DD3L 4YLQT 3BUYA 5F89A 4X6CF 4I3SH 5DHVH 5FYKL 4Y2DC 4ODUA 4PRBB 2ARJQ 3A6CL 3QUZC 4LNRA 1J1PH 4H1LB 1C5CL 1W0VA 1EZVY 3R8BB 4YGVA 1NC4D 4WWKC 4HJJH 1C16B 3EYVB 5F7HA 4I3GA 3EZJB 4ORZC 1ZLVK 1E27A 3KPMA 3OJMB 1N64L 2HVKA 2DICA 3V6FA 4Z6AT 4WO4B 1RMFL 4M3KB 1TQBC 3CFJB 2D31B 4JDZA 1TENA 2AGJH 1MLBB 3LSOB 3U48A 2H26A 3QYCA 1DVFC 1Y0LB 1VPOL 1V7MH 1F6AA 3OZ9H 5JW4N 4JQVA 4HJGB 4GUPA 4KDTA 3DUSB 4ODHL 1IQDA 3M45A 4K8RH 1P7KB 2FH6A 3NIGF 4JY6A 1CQYA 5T1LB 4V2CB 1EERB 5FYLD 1AE6L 1YEDA 2AQ3A 1KIRB 1LP9F 1NAML 4HIIA 1GIGL 3NCYS 4U6XB 4NC1E 4BH7A 1GGTA 1QSFB 5DVLA 3DV4B 4R2GD 3LZFH 1L6XA 5CD5D 4HT1H 3RUGA 3U0WH 3OR6B 1DQML 2JCCA 3MLRL 3L3OB 4PJGA 8FABB 3E2HB 4LHJB 3WIFB 3H2WA 1BVZA 3I02A 1P6FA 1HH9B 3OGCB 2GIYA 4CL7A 1CD0A 4UAOB 1BJMA 4NQEA 5DK3A 1HIMH 5IV2A 4L4TB 4P5KB 4HWZA 4KKAC 4JPKH 5D1ZB 3NIFE 4JPIA 3N06B 1ZA6A 1U36A 4MCZA 3KPSB 4LCWE 5EU5B 1EJOL 4Y5VB 1NCUA 2OK0H 3BX7C 4YO0A 1LO3L 4JN2A 5KG9A 3WHE0 3DO7B 1F58H 2B1HH 1GJIA 4KRNA 1TETH 4PJEB 5E9DD 2DWEB 4LLMA 3IETA 4X5XA 4YHML 3ARBA 2GI7A 2NXYB 4QOKD 1RULH 2W1NA 1BVLB 4W4OC 3ARDB 5DJXA 2PYEE 5CILH 4AK1A 5HGHA 5IP4A 4O2CB 1YN7A 4Y8AA 4LK4A 5GGQH 5T1KB 3MLZH 3GB7B 3GJFB 2AQ1A 4GQ9H 4YHNB 1SBBA 1S7UA 1ZA3B 2VDKH 3EYUH 5JW4M 1DN0B 3EJYD 1I1AB 4JJHA 5I2IB 4YEFA 2X4UB 3SE8L 4HXAH 1P7HL 1JRHL 2OP4H 4M6MH 1MUJA 3UTTE 5I17B 1Q0XH 2Q7YB 1QBBA 2AJYH 1T0MB 3MOQA 2P49B 2LAGB 4XBGA 2WUCL 5CZXC 4NWTH 1JK8B 3UJIH 1I9EA 4RMQA 5KVFH 2OJZH 3UAJD 3OG6B 4PJAA 4EI5B 1RJZA 4HHAB 3VRJA 4NUGL 4G5ZL 4BSVA 1N3NA 1JHKH 3W9EB 2KQNA 5HVFB 6FABH 5A2FA 4HPYH 1E28B 1X3DA 3C5ZB 1KTKE 4AM0A 4JE4B 3BMVA 5F9OH 1JN6A 3RZCC 2Y5TB 2CUMA 5JPMB 3FMGL 2V17H 4Q7DA 2X1OA 4OCMC 5HYSG 4GT7A 5J89A 1GC1H 1YEGL 1FHGA 4FQCL 4GMTH 4WV1C 5DI8A 1KXQE 3C9NB 2BFVH 2BJMH 4WW1B 1TIUA 3AMKA 1G1YA 5IESH 3GBNL 5T1LD 1UT9A 2XWBB 1T7VA 4NQUA 4Q6IB 5DA4A 3BRGC 1J1OL 3CXDL 4OM0H 3GI9H 1MH5B 1F4YH 3LQAL 4HIHB 3OKKB 3VGEA 5F9WB 1UQSA 2CR6A 2CDGB 1PKQA 2CH8A 5ADOL 2FR4B 2EE2A 3MV9B 4NQCD 3JUZA 1O7SA 3WE6B 5HHNB 4HFUH 5FK9A 4G3YH 2XZQL 4WDIA 1U8HA 1I7UA 3F5WA 4YFLF 5ESQB 2GAZB 4YX2H 1IKFH 3HE7C 4G6FB 2CKBH 3BXNA 3MLUH 5I1DA 1YYMH 4NQVA 1J0JA 3ZDYE 2BP3A 2VZTA 3G9AB 4P99A 3QHFL 3RIFK 5LXGL 4LLVA 2ZSVB 1KYOJ 5D1ZD 1M05A 5SX4I 4KV5E 9CGTA 4HWEH 3VXPB 1DUZA 3P4NB 4JFFE 1P4IL 4FHBD 2AK1H 5LWYH 3BZFA 5L2KD 1AI1H 1F3JA 2ADIB 4N1HB 5FKPB 1A9BB 4JO2L 3ULVF 2JJTC 4ZFFA 2NXYD 4JCLA 1LO5A 5CEYA 4U1NA 3ALPA 4GRWH 3ARDD 3W39A 3RVTC 2FHFA 5EU7E 4XXCC 4KKLD 5B3JF 1OSZA 5T1KD 1FSKC 3BKYH 3ZO0A 1KPUB 2F5BH 4P4RA 1BGXH 3VFTA 4MQTB 2P24B 3O6KH 5TF1L 1A6AB 3O2WH 2ICWJ 4YBQC 2AXJA 4LSVH 1ZANH 4OUUB 4Y88A 2YK1L 4RBPK 2R15A 5F96H 2VDMH 1KJ2L 5C2BH 3BPCA 1OAZH 4L8SC 4CAGA 3FTGB 3PV6B 4OSUH 1FFOA 1X5JA 3O2VL 4HIEB 4XP5L 3CD4A 4R9HA 4MNHB 4K2UH 3QO0B 3ET9F 1K3ZA 1ZT1B 5K9QG 5DUPL 2R23B 4PRDA 5CSZB 3VXMD 3HB3C 4HUWB 2VZSA 3C60D 4IIQC 1OGTA 3BPNB 3CLFL 2PN5A 1M71B 3REVB 4X6DB 1LE5A 2GSIA 5L7XH 4UV7L 3DWTA 4JAMB 4PRNA 1U2CA 2G2RB 4R0LC 3AY4C 4KI5E 4QNPF 4KK6C 4J1UB 5E6ZA 1VKXA 5FA4A 5DEZA 2G75A 4KH2A 1R5IB 5CUSH 3S4SB 1WCBA 3UJJL 4KY1H 3T3ME 2YWYA 3VGFA 1ZVSB 3HZMB 3S3JA 4J3WA 4ZTOH 1JPSL 1AGDB 1C5BH 1MI5A 3WMSA 4B53A 3RY5A 4Z77A 1GH7A 3B5HA 3BD4A 1VACB 4DAGH 2YD6A 1QFWL 3TYGH 5E4EB 1XCTB 3X14B 5F1NA 4YIQB 3WS6A 5BQ7B 3VGDA 4RGOH 5AD0B 1R3LA 5IQ9B 3UPAA 4H8WH 3ULSA 2D9CA 2QQKL 4XPHL 4ZO7A 4IMKC 1EFQA 1V3MA 3GJEB 4FABL 4H1LG 4BSWA 4JM4H 1AGCB 1NMAL 1XZ0A 2WUBL 1ZLSH 5KOMC 4OCLC 3DMMB 4KZEH 2CD0A 4F9LC 5T3XD 4LKCA 43C9A 4U3CA 4H1LH 2OL3L 2BVOA 3W5NA 2QADC 1BM3H 1KPRA 1M6OB 4N8CL 5JW5A 4NKMB 1JZ3A 3UTSB 1ZSDB 2O5XL 4G6FD 2DQGL 3S5LB 3O6FD 1U8OA 3MJ9H 4U1IB 4Z7WE 4ZAKB 1AR2A 1NGZB 3TWCL 1RIHL 1NH6A 1OD9A 4XWOD 5INCA 4YHYB 2VISB 4YHLH 1AGBA 4RNRB 1KXVC 1PG7W 3HA0A 4RAVB 5MHSD 2IGFH 3KWWA 5FO8B 3DI3B 3QQ3B 3HG1B 3VI4F 2OJEA 3DV6B 3UXFA 4FQQB 1RJLB 1R5VA 1S7SB 4JO3L 3Q6FA 1JYXA 3V7MA 4H25A 1EEQA 5EBGA 1I7ZA 1RIUH 3CC5A 3QDJB 4H88H 4L1DA 4U6TA 4YUEH 3P4LA 1DL7L 5F7LB 1MEXH 1KIQA 4ZPTB 4WI2A 3QQ4B 1JPST 2RGSA 1MHCA 5HI5D 1XGRA 2W91A 2WMPA 4OIAA 5IGXH 1GAFH 2FB4L 4QWWD 1KJVA 3V5KA 5IQ7L 4MQXC 4Z5RA 5HXMA 1JI1A 2IG2L 3RGVB 4RQQB 5B8CA 4OZFB 3V0WL 3SPVA 1RZIB 4OZIA 1JMXA 1TXKA 1WQVT 2VERN 3QEQE 3DXAB 4FZ8H 2A6IB 4PV9A 4QXWA 5I8KL 3QFDB 1FL5B 2ZZUT 3W0WB 4LSSH 2Z92A 5CBEA 4NM4L 4PJXB 4ZFZA 3TVMA 4QY8A 3T1FA 2L0DA 1YY8A 3IJYB 4DCQB 1XGPA 1MWAB 1WBYA 4PJBE 4WFEE 2LABA 5IJKA 2GEEA 2NLJB 5AWNL 3MRCB 4P2RB 4BYHA 5C6WH 3INUL 4HKBB 2ZKHH 4Z7VE 5CGYC 3U7WH 5C08E 5IHUL 3KLSA 2GHWB 5GRJH 4HBQA 4P3DA 2PXYA 1MNUH 4AQOA 3RVVC 4XHQA 3IFLH 2QJDA 3T2NH 1FNAA 3P11L 5FV2A 5EUOF 5D2LF 3FZUC 2EIZB 2V6HA 3PWUA 5J3HC 1AQDB 1RI8A 4MDJA 3PHQA 3FT3B 3MODL 5D6CB 3RTQC 3KXFE 2EZ0C 3LH2L 2JJVA 3V5DA 1T1ZB 4LAQH 4FQLH 5F71A 1HHIB 1HILB 3KLAB 5K93A 1A1OB 4YAQA 1INDL 4OD2A 3LPWA 2ICEA 4M6NL 3NCYP 4G80B 5I1AB 3MRQB 2JIXA 3PL6B 3BN9D 3AS2A 2AK4E 1CIDA 5GRUL 5CEZH 3WHXB 2NY4B 4M62H 3SCMC 3DUUA 3IDXL 2ZOLB 4LQFL 3UTSD 1BLNB 2DKSA 4G9FE 1ROWA 1D5BB 1FFNB 2VUYA 5H8DA 1A5FL 4GFTB 5TE6H 1T1YB 2J4WL 2M2DA 5EIVA 1EMTH 4MMXC 3VE0A 3FQXA 3L5IA 2IC2A 2R69L 4HZLA 1CDJA 1J8HE 4TUJA 1I9RH 2ZUXA 3QIWB 2BDNH 5C0AA 5C0RH 2OXGA 1DJSA 2Z8RA 3PWVA 4CADA 1YMMB 5IVXA 4L8BB 3QDJD 2FGZA 4AYFA 4GS7B 5C0DA 3BT2H 1H3PH 1FL3B 1XR8B 4JFEE 3M1BA 3MUGB 1AO7B 5GRYA 2WK2A 5HGBB 1T5XA 5I6XC 5JMRA 4P9HH 1ZLVH 3QFJB 4RGNE 2AEQH 4WU7A 2JK5A 1JFQL 3UJTL 5BO1H 4O58L 1BQLH 3L5JA 4PY7B 4HUXA 1Q0YL 2I24N 3CPLB 4POUB 3BI9X 1T6VN 3OHXB 3C09B 1LO4H 2DLFH 4MLIA 2A9NL 5IFHL 4OFYA 2OXHA 3QUZD 4R90H 4JGJA 3VD3A 3AROA 1EH9A 4L8CB 5T3XH 1CWVA 3D25A 1OWWA 3RGVD 3RRQA 5CAYB 1Z9OA 1OGAA 3IAGC 1OP3K 3SKOA 1A3QA 2NY3C 1QR1A 1U8KA 4LSPL 3TEUA 3ZTNL 4OLUL 2GY5A 4MSWA 5SX4H 3BDYH 3DROB 4JFDA 3CMGA 5F9JB 1Z6JT 1QKZH 3Q0HA 3KDMB 2UZIH 5BZWB 5T3ZL 3G6JE 3JV6A 4N0FB 5HD8C 3IRZA 4OQTH 4EBQH 1IC7H 5JLZA 1Q38A 3D3VB 4OQ1A 3VXSA 5I30L 1QSED 1KG0B 3U9UA 1IQWH 3MPCA 1PW3A 3IFNH 5EU6B 3ZDZF 1HQ4B 1T66C 4DUWA 5IWLC 3K46A 4Y4KC 4YHZH 4JLRB 5CZVL 1WT5C 2B1AH 1CE6B 4HWBL 3FKUS 3RPKA 1B2WL 3HC0A 4LLUB 2DQJH 5KANI 5F7FA 2IAMA 4U6YA 3KR3H 2C3GA 3KYNB 3LKOB 2C4FT 4FQXB 1ZT7A 5FYKD 4HFWA 1JVKA 4M7ZB 1W0YT 1HHGB 3DURB 5CZKA 3VCLA 3ESVF 3PGCB 5D2NA 3T2PA 4GAJH 2DQDL 2NY4D 4NO3A 4LIQH 1KCUL 5D71H 4MJ6B 4D0CB 4NHCL 4KKAD 5KSAC 4NSKA 2IPKB 1JTTA 3MLSL 1EV2E 5BMFL 1BIHA 1NCNA 5SWSB 2I60L 3WCYA 4EDXB 1FGNH 2ICWA 1QFUH 3QCUH 2PNDA 3O3DA 2XOTA 3MOAH 2G9HA 5ICYB 3QWQB 3NZHL 4YK4C 3S4SG 3OF6D 5I71B 4O4YL 3O4LD 1Y6KR 3K2UH 1XIWA 3MJ8B 1P84J 3IDMA 5FEBA 5TE4H 3RWEA 1G1CA 3CFEA 1NUGA 1WIPA 3SKMB 5F88A 4JRYB 5D7JB 2DJSA 2Y25A 1OAYL 3JV4A 2PUQT 5EZJB 1K85A 2OBGA 4BKLA 5IW1B 4OLYL 4H8WC 4UZGA 2EC8A 3TIDA 1CD1B 2R0WH 5IROA 1A64A 1AO7D 2Q76A 1TZGH 3ARGA 1TDQA 3ZYIA 4HG4K 4KQ4H 2VSCA 2AABH 4FQIL 4K7PX 1HHHB 4TVPE 4UOW0 1LK3H 1BREA 4GMSH 4OB5L 4S1DD 1UZ6F 2FL5B 4JZJB 5CKAA 1D5XA 2KL6A 2AV7B 2XFXA 5L9DH 1DBMH 5BJTB 2IFFL 2X2YA 1FZMB 5DEGB 2JTDA 3S5LG 1OM3H 1REIA 5DD0H 1MFEL 4WTXA 3KS0H 5EOCH 4MD0B 7CGTA 2OR9L 1K8DA 3HZKB 1LNUB 2G60H 5I15H 1QUNA 4M4PA 1NLBL 1ADQH 1SEBA 5FDWB 4Z7QE 3ZSTA 5L6YL 3H9HA 3RZCD 3SDYH 3REWB 1BVKA 1ACZA 1WC7A 4OGXL 1AJ7L 3OJ2C 1S7VB 1CFQB 5GGTA 1D5MA 3WNNA 4PJ7F 1K6QL 3WUWA 3EAKA 4HKXB 5IB4B 1J0KA 5MENE 4M6OL 3AAZA 1G6RA 3STBA 4CN4A 3ARQA 5EUOA 5D7IE 1WBXA 2PCPB 3QG7H 1HHKA 4WW2C 3UZQA 4YNYB 2PR4H 1K2DA 3DLQR 4X4ZA 4ONOA 3RVWD 3DO3A 1IEBA 5ITFA 4F37K 1X4XA 4XMLH 3H0TA 4CJ0A 4OZFG 1I3GL 1T04A 3S97C 4K3JL 3IKCB 4LEOA 3WKMH 4L9LA 2V9RA 4HK3N 4HJ0C 4OZFH 4HDIA 1UZ8B 5H35B 4Y5XA 1DFBL 2BNUA 4LCIH 1T1XB 1MCOL 1U8JB 3FT2B 5ACLA 2W65B 1K4DB 1RUPH 1S7XB 5DQJB 3P4OB 3E8UL 4ZO6A 2Z35A 5KVDH 2YZ8A 1MHPH 1MWAH 4O51B 4OAWB 1NPUA 3L5XL 1AXTL 3BZEA 3E6HA 3L3DA 1KCKA 1Q9LB 2J6EL 4GRLC 2W0PA 2OSLB 2EEAA 4M61B 3ZKXC 2DDQL 4LCWA 4WJ5B 3OQ3B 3MLTA 4RBPH 3L6FA 5SWZE 3CZFA 4AEEA 5ITBH 3CMOH 4GAFB 5JHLL 1UXSA 2IBGA 3RVTD 5C9JB 5IFJA 2EDFA 2W9DH 5CHNB 4JRYD 5I66B 1BOGB 5AYUH 4ERSH 5DEFB 1MPAH 3P9LB 4XBPA 4S2SB 3A67H 4QYOB 1DBAL 3HRPA 4MD4B 1HOCA 5FCUL 4OCWH 3MNZB 3BQUB 4K71C 4ONFH 5HHOB 5BV7B 1RFDH 4A6YL 2HTLD 4GKNB 2EDWA 1T4KA 1RJCA 1FAIL 4UOJA 3FQRB 2ZUTA 2MMXA 1QSVA 2ARJB 3KLDA 3CH1A 1FBIL 3OJVC 4POYA 1GPOH 3LRGA 1HNGA 1WICA 3UTTA 1L7TH 4J23A 1AD9B 1MCSA 1NKRA 4GBXC 4G42B 1S9YA 1AKJB 1Q94A 4HD9A 4OI7A 3DECA 3O8XA 2NMSA 1JZ4A 4E5XA 1OT1A 1G0XA 4PBVC 4Z0BL 2VLJD 1FGVH 1HXMA 1XF4A 1Z0NA 4D0BA 2FHCA 2P8LA 3U9PH 3IFOB 5J9PB 4WI4A 3S37H 3IAQA 5JW3H 5I1CL 4P46B 3MOBH 4P9HC 1T0NB 3QH3A 1NC2B 3T04D 1XF2B 1HSAA 1VGEH 1UKQA 1IKNC 2GJZA 4MA3A 1ZKAA 2F54A 1KN4H 1DQQB 3RWCA 5I76B 4XH2B 1UB5B 1I85C 4QHUA 1JPGB 1PVHA 1K3IA 5CEXA 4QEGA 3VGAB 3TYFA 5EG6C 3MRBB 5E70A 2H3NA 5FGBC 5L88L 2KQMA 4D8PA 3BISA 2BOBA 5JO5B 3U0TB 4HC1H 2QADD 4LSDA 3FO9A 4RMVA 5C09D 3JTTA 3OKDB 5JOPD 2EYSA 3SY0A 2AXFA 1E6OL 3CJJA 1XF5A 1AR1C 5D96B 3GSNL 4WHTB 3HMXA 4Y16D 1FLRL 1NCAL 3HNVL 4K3DL 3WFBH 5JIKA 2VJXA 4KK9C 3T3PF 3HAEB 3WFEL 4HQQL 1LK2A 4X7TA 1BJ1H 1D3CA 1S9XB 5GS0H 3N9GL 1U8QA 3L3HB 5JXEC 2YSSA 2F58H 4BFIA 4BZ1L 5KTEL 2EDXA 5EOQL 4K94H 1G7JB 5FB8B 4H0IA 2VL5B 4PGEA 3U4BH 5D1XA 3QJHB 1LILA 3PWNB 1PYWA 1YY9C 4PJ9D 5E5UB 1U3HB 3VXUE 3VDCA 4G8GB 5JQ6L 2BNRB 1NGPL 1VFMA 1G7IA 4LBEB 3V4PL 1NCBL 1XGQA 3LQMA 4HBCH 2RFXB 4RMSA 3DSFL 4MQXD 3S3SA 2WUCH 2HH0L 2E7LC 1L9MA 3B2UD 5DUBA 1UJ3B 2WBJB 3RWIA 4BM7A 4F3FA 4XNMA 1I1FA 1H0DB 1Z5LA 2XKNB 4P4KB 3TO4D 3CU7A 1IM3A 5LGJA 4FQ2L 4TUKH 3TBTA 4RA0C 4JGMA 3MRMA 2ITDA 5IMKB 7FABH 1BPVA 2UY7A 2M8XA 4JPVL 2FJHA 4P23B 2AS5M 4YDVA 3MV8D 4PJ5B 2J8HA 4BK5A 4HS3A 1FYTE 3OPZL 2C7UA 2CO7B 4HKJA 2FCBA 4LARL 5CGYD 2NY6C 4PJ7A 4PGDB 4Y4HA 3S35L 4CU6A 3LKNB 3CSYA 2MQCA 4J8RA 2AXGA 4FTVE 4CMMA 3EGSB 4UT9L 3GMOB 3RVVD 5I8EA 5JXAH 1JNNL 2AJZA 1MQ8A 4WUUB 5EUKA 5LJYH 1RURL 3FZUD 4E0RA 1CE1L 1XGTB 2I9TA 5D5MB 5HGDA 5MEPB 3BIBX 3CXHK 1NC2D 3RHWF 1H5BC 4XNXL 4LP4A 4IS6B 1FG9C 1JF6A 3WN5A 5KS9B 4NQTA 3RTQD 4R3SB 3PGFL 2EZ0D 1NUDA 1HE7A 1EBPA 5F6HI 5A16A 1U93A 5C0EB 3L7FA 3I75B 3G5VA 5IUSA 2BVUA 2P5WB 5HI3D 5BOZG 1MJ8H 2ZSWB 3DMMC 3MRHA 4I13B 1U92A 2Y1VA 1F8TH 2VDLH 3HCVB 4LDEB 2I5YL 1N2RA 1UEMA 4YDIL 5EO1A 2FX7H 4IOIB 1C08A 3BO8B 3GSUB 3QHFH 4HPOH 1SY6H 2HAZA 2XQBH 4NRYB 1EEYA 4DZBB 3VXOA 4RIRA 4Y1AA 3UPRA 3BMWA 2P44B 3MA9H 5EN2B 1R5WB 1HQRB 3GUTA 3EDKA 4IRZL 1B4JL 1IAIM 5D1QD 1P4IH 4WU5B 1LEIA 4NWUL 4GKSA 4Z7WA 1W72L 2AV1B 4NQCE 4TSAH 3T2OA 2BVQB 3QXDB 4XCFH 1RZFH 4N90D 4X6FA 3SE9L 4QXUH 4ELMB 2EYTB 5GIRB 3ARWA 4QXGL 1UYWH 3VWKC 4JO4H 1MCCA 3BUYB 3FQTB 4JPWH 2YUZA 4YDJA 1TTGA 1Q9WB 3DETC 1OP3H 4KJPD 4JANA 3V6OA 1W0VB 1T03H 1U3HD 1LEGA 5L2KE 5DJ0B 3SQOL 3QIUA 3SJVD 4G8GD 4LRIC 1GGCL 3LN4A 4S10A 4YDLC 3SBWC 3LB6C 1SQ2N 2YK1H 2HYMA 1E27B 3KPMB 3QUYA 4XNZB 3VRIA 2GJ6E 5IOPA 2HVKB 3V6FB 3W9DA 4KRPC 3HZVA 5DXWA 4BQBA 5F7MC 1OD7A 1VFOA 2Y36H 1HEZB 3OXSA 5L0QC 2ICES 4HIXL 5DUPH 3IXAA 3GIVA 4N0YL 5GGRB 1T2JA 5I1GL 1F6AB 3Q1SL 2CMRH 2VO5A 4P4KD 5ADPH 1EUUA 5INDA 1G7LA 4PGZA 1UACL 5IT2L 2VSDA 4NKIH 4YC2B 5DVKA 4X0KA 3RA7L 2WBKA 3CLFH 5DHYA 1IQDB 5CJBA 3HRZB 4KU1A 4LLWA 4F8TA 1YNLL 2R9HC 4P23D 3DJ9A 3SDCB 1YEDB 2PTTA 3CLEH 4HIIB 1EGJA 4PJBA 4MAUL 2IPUK 1T66D 3VXME 1OY3B 4IHOA 1L7IL 2DYPB 1F6FB 2AW2A 2BVTA 3RUGB 1IAII 3GSOA 5C08A 2PO6A 2FWOB 3VFPA 4PJGB 1MCLA 3HI5H 3KPNB 5EU4B 5DWUL 5GISH 5LKNA 3NN8A 3MXWH 3EOAA 5ESAA 5FHBH 4XPHH 1KCRL 4U1SA 5CIPB 4C55A 5BV7H 3I50L 4HWZB 1CR9L 5IEKA 4JPIB 2V2TB 3PL6C 2CK0H 3KPLA 1ZA6B 3FN0H 1FFQA 1BAFH 2OZ4L 3M07A 2YS4A 4LVNB 1T22A 1I9JH 3MROB 4YO0B 1U2HA 5B22A 4JN2B 1W8OA 1UWGL 4J6RL 4AEIL 1RIHH 4LLMB 3IETB 4WIQA 2J2ZA 1A7QL 1MCHA 3KPOA 3LEYL 1OQOA 1ZHKB 3CNKA 5T33L 5IM7B 3RAJL 5T3ZD 3U1SH 3RWJA 1G7MA 1EXUA 3EUUA 3MC0A 3QI9C 1A6ZA 5CBAB 4KMQA 4YBHA 1UWEL 5AUMA 1QYGL 4LMQI 4QHMA 2EKJA 4I4WB 3NPSB 4JFOB 2XWTB 2B4CH 4WCYH 1J8HA 3ECBB 1KB5A 2ZUWA 5FHAH 1JWUA 5DK2A 3O3EA 5GS1B 2FX9L 5DJCB 3D39B 5FGSA 4XBGB 3NA4A 4HX1A 5MHSE 1AIFA 4Y5YA 4KHXL 5EULV 2VLLB 5GZOC 4PJAB 3OB8A 4JFEA 5BW7A 5DGQA 3PE9A 3QXUA 4BSVB 1BFOB 1EDQA 1IGTB 3RX7A 1Q8MA 5E8DL 3OX8A 1JN6B 3C6LB 3STZA 3VFSB 3WNKA 2HRPL 3LCYA 4AIZB 4X83A 3EJJX 4MXWL 3G6AA 5BVPH 2GFBA 3HHRB 5GSVA 3ARSA 3HAEG 2ADGB 2OX5A 2C3XA 5JDSB 3MRPA 1FORL 5HPMA 4K94C 4UINL 2UYLA 5AWNH 3HAEH 3ZE0E 5HHMB 1LEKA 4UQ3A 1JPTH 2AJXL 4AENA 3VFNA 3SDCD 2QSCH 3RNKA 1A3RL 5HYJE 1UB6A 2R1XA 2QSTA 1RZKL 3PWJA 1HKFA 1FIGL 3GRWA 1VFAB 3ZKSD 3BAEH 2X4SA 3ABZA 4TULL 5IHZB 5DC4B 3B8SA 4YQXL 2DYPD 2V5TA 5IR1A 2ADFL 5FK9B 3L5HA 4WDIB 1U8HB 1I7UB 3N85L 4LHQB 4P5TC 2R0ZL 4NGHH 4XCEA 5F44A 4FQXC 5JUEL 4A6YB 1UKTA 5I1DB 2FRGP 5D70H 3S36L 3C5SB 1GGBL 1NLDL 1HWGB 1EBAA 4TYUA 4RA3A 3ZYOA 1L0XA 4ZFOL 2FO1A 2X9YA 1INDH 3HUJE 4DGIH 5GS2H 2XXMB 4XPTL 1M05B 4NRXA 4GG8A 3GMRA 1DUZB 4J4PC 4YDKH 4IDLA 4J12A 1QLRB 3BZFB 3IAPA 1Q9KB 3CDCA 1F3JB 2P5EE 3QPXH 4FXKA 4EI6B 3IS0X 1ORQA 1S5HA 2BC4B 4GRWF 1KXTB 1IGMH 1WWWX 2FSEA 2E3VA 4BH8B 4C56E 1IBGH 5CEYB 3OKOB 3QCTL 2HT4C 2BY3A 4YR6A 3OXRA 4MNQB 5FA3A 3RWDA 4QXTB 3PGDA 4KQ3H 5DMJB 1QLFA 3B9DA 3AS3A 4M7JL 3VG9C 4P4RB 3OKMB 3T0EE 1CICB 4I0PA 5EZOH 3I85A 5D7JC 5KSUA 1ZGLB 3GMMA 1RU9L 1KPVA 2QHRL 5HYQB 3LMJH 1QD0A 4TNWK 3EFDL 2VDPH 4LSQL 3D39D 4DZ8A 2NR6C 1JFQH 5JA8B 5HHQB 3LDBC 3MLVH 1FFOB 3HI6L 4MJIB 1BFSA 1QA9B 1VFUA 1OAXH 25C8L 4TN9A 2FHBA 1HCVA 2BSSB 4OCSH 4O5LL 1J5OH 1J1XL 5J6HB 1LVEA 3H9ZA 1ED3A 3DX7A 4FZEH 1WZKA 3MNWB 1HKLH 1RUQH 5DK0A 5KVGL 3WHE1 3U7YH 1LE5B 1CFVH 1JHTB 2XNAB 3R06A 2GSIB 3EOBA 2J8UE 2NY1C 2VXUL 3C6LD 3GSNB 3NAAL 4PRNB 4CVZB 5FF6A 1ND0B 4NQDD 1A7RL 5JHDE 3P77B 4JRWA 2G75B 4ZUWB 2IF7A 3NCCB 4LSRH 5J8OA 4HS6A 3R1GH 3U30C 1MJJA 2A6DB 3GHEL 4OV5B 1JWMA 2A77L 4PJ8A 4L4VA 3HNSL 3FFDA 5E7BA 43CAA 1NGWA 2X40A 1OF2A 2VAAA 5GJTL 2HLFD 1Z0MA 1TJHH 5FO7B 5SX5K 1ZHLA 3KPRE 5MENA 4GXUN 4LKCB 4YZFE 5F1KC 43C9B 2BVOB 1KPRB 5JW5B 4L4JA 3H9SA 3BGFC 4ZXBA 2IADB 4QRSA 2W0LA 5D7IA 1SVZA 5E99H 4ZMAT 4M8QB 3K3QA 1FO0B 1QSEE 3RU8H 2A38A 3U0PB 2Y6SC 1A0QH 2FD6H 2O26U 4QRRA 3I6GB 1CDBA 1D9KA 2EDJA 1I3RB 4OTXL 3KWWB 2Y4SA 3FB6A 4P2QA 4X4XB 2P47B 2HKFL 4QHKJ 2OJEB 2BVYA 5DRXA 3ZSSA 1TJIL 5T5FL 2L7JA 1AR1D 1R5VB 4WFFE 3BKML 2MFNA 5KZCB 2DQCH 2WINA 2FYYB 3TNNB 2VQ1A 4JG0L 4F15C 5EA0L 2NY5H 5GJSL 4Z7UE 3BSZL 1KIQB 3OKNB 3EHBC 1MCEA 5H94A 5FGRA 3ZZ1A 5IJVA 1SHMA 1CICD 1BZ7B 1T21B 2CRZA 3D1MC 4CJ1A 4Z5RB 4QTHB 1YY9D 2ED8A 2UWEF 2DLGA 5SWZA 5AYQA 3BQUC 4OZIB 5BV7C 4H26A 4PTUB 2ZG3A 1KYOK 1CL7L 3OKYA 4KXZI 1JIBA 3ARYA 3WSQH 1OCWL 3O4LE 2XY1A 4XWGL 3CX5J 5CIPH 3T65A 2W0KA 2LU4A 3SDXE 4KZDL 2Z92B 4ZFZB 2NYYC 3BHBA 4NCC1 3TVMB 4QY8B 1IRAY 1QQDA 2CXGA 2EE9A 3T1FB 3WDJA 5A3IC 1YY8B 2IQ9L 4I9WD 4WI5A 1XGPB 2YD5A 5E94B 4IRJB 1WBYB 4PB0L 4W4NA 4GXUM 4PJEF 4NO0B 1JGUL 1NAKL 5IB2A 2V2XB 5HYSA 3IU3A 3MGOA 1KLGA 3WJJA 1NGXB 3DX9A 5C0IA 2ATPA 4P3DB 4PRIA 3UBXA 3KJ6H 5HI4D 2ZG2A 5K59F 1J87A 1KGCE 2YRZA 1BP3B 1NANI 4KJWC 3WFDH 2B4CC 5C07D 3ZTJH 4NFDA 5C0JA 1DN2A 2NY6D 2KUTA 2NTFA 3E0GA 4M6OH 3MO1A 1FE8H 1CDIA 3ARZA 4NN5B 3OSKA 1NGYA 4TTGA 5ETUB 4OD2B 2HLAA 1Q1JH 3THMH 2A0LD 4OFPA 1NC4A 1DR9A 2HT3C 5C92A 1IAMA 3OKEA 5IMMB 4V2BA 4XBEH 1P6AB 4BUGA 4PG9A 4CMHB 3BPLB 4TPRH 4I2XE 3DUUB 4WFHD 4YFLI 1I7TA 4D9QD 3CSPA 4WI3A 2PYFA 2CJUH 4XB8A 1QBAA 3BH9A 5D6DA 5E2WL 5EBLA 4HXBL 4YE4H 1B90A 1ZMYA 4HZLB 4LLYA 1YEIL 4OBSA 4TUJB 1BD2B 3JWDL 3O11B 4G6KL 4X7CC 4NHUB 5C0AB 4EOWL 3C2AL 1DEEB 1MRDL 1N59B 4GW1B 2YXFA 2OI9B 3PWVB 2DWDA 3EBAA 5KZCD 3MYZA 4CADB 3WFCH 5IVXB 3S7GA 4U3XA 5C0DB 4POZC 2X4RB 4GXVL 3M1BB 3PWPE 1UM4H 1T5XB 2DDQH 4NNXB 1VADA 3IJSA 4GKZA 2HA1A 3G6DH 5J1AA 2YOCA 2JK5B 4G7YH 3KJ4B 4HUXB 3U36A 2Y07H 2I9LB 1AH1A 2Q8BL 3R0NA 1RUAH 1IVLA 4KVNH 1M7IA 3GDBA 3IDJA 3DETD 2VC2H 3ZKQD 3ZE2F 4OM1L 2YXMA 3IXTA 1OGAB 3IDGA 1YEKH 3MCG1 3VMPA 4LRNH 3SKOB 1QR1B 5J0BA 5C0CD 1SVCP 1IGFH 2IPUG 4KRPD 4MCYA 1UJ3C 2GKIA 2WBJC 1MFDL 15C8H 5E9DA 3I9GH 4IRJD 2BVPA 3JV6B 1TZHB 5D9SA 4QOKA 4ZSOB 4NO0D 4XP1L 4S1RL 3D48R 3UCRA 4A2LA 1SJHA 4JN1L 1IAOA 2A6KB 1T89A 4TOYL 5AEAA 1PLGH 3HC0B 2ESVE 4Z76A 1SJXA 3VWJC 2ZCKH 4PJFF 4IDJL 1PZ5B 5JDJA 3V52L 4UV4H 1MVFA 3LKPB 2BCKB 4P2CG 1DQTA 2FJGB 1MVUA 3TJEL 3QUXB 3QJFB 3VFRA 2DI8A 2DQIH 4PRBA 1QTYT 3CCHA 1WZ1H 4H1LA 3IDIB 3VCLB 2EE3A 5D2NB 3BIKA 3UTPD 1C16A 2VLJE 4LHUB 1A3LH 3MBEC 1A6UH 4XNUL 2KDGA 4Z95H 1MJUH 5HVHC 1QRKA 2XRAH 3ALWA 4X6DF 3CFJA 3K1DA 4I5BA 5ALCH 1MLBA 1WWAX 2ICWB 4U2ZA 3LSOA 2VL4A 3MGAA 2CSPA 4Y19B 5I75B 5CCKH 4NJAH 1JNJA 4G7VH 1MFBH 1BD2D 2BMKA 3OGOE 4K3DH 5I8OH 1MJ7H 3DUSA 3EYQD 3RWEB 3CFEB 5T1LA 3O3AB 3T8XA 3JV4B 4BKLB 4R26H 1M4KA 1KOAA 1A6WH 4U6XA 3TIDB 2F53E 3RVUD 3DV4A 5C09E 5JOPE 2E9JA 4HK0A 2A9ML 1U91B 4NQCA 1BZQK 1IAIL 3A6BH 3HS0B 2XFXB 3L3OA 2P43B 3WIFA 5DYOB 4S0TD 3OGCA 1E4WH 2X4OB 5JQ6H 3S34H 4DWHA 1CK0H 1PEWA 4FMKA 5D1ZA 2NXZB 1N6VA 1UCBH 4BSJA 1FO0H 2FNBA 3ARFB 5EU5A 1ZK9A 4OZGE 5L2KA 4Y5VA 5K9KA 4MA8H 3ZLQC 4BFEA 4NBXB 3DO7A 5F9DC 2CXKA 4CU8A 1BVKB 4KC3B 2DWEA 2FX8H 2VLME 5C0NC 3IF1A 4JQVC 1X5YA 4JHAL 4PBWD 4U1MA 3ARDA 2IAND 1IE5A 4JPVH 1KC5H 4MAYB 2NY5C 1ONQA 1G6RB 1EO8H 5T1KA 3RIFF 1WBXB 2VLKE 4KTDH 3F58H 2WP3O 3GB7A 3GJFA 4HUVB 2APBA 1HHKB 3HC3L 4LARH 3HNTL 1DN0A 4H20L 1I1AA 3TV3L 4OLWL 1WTLA 3ULUL 5CJ5A 2X4UA 3ZHKA 1HDMA 5ITFB 3S8WA 5CFHA 3H0TB 2JF1A 2Q7YA 4JHBA 3TH3T 3EYOB 1T04B 3QUXD 4Z78B 4X6EB 2HMIC 2LTQB 1MCIA 2ZUSA 4L9LB 4FRWA 1KF9B 1GOFA 3H3KA 4JFXB 1NGQH 3G5ZA 1E4XL 4XHJD 4HHAA 3VI3F 3VXMA 5I1KL 3MV8E 4OCRL 2GK2A 4LHUD 4PJXF 3C60A 3MQIA 4M7KH 4AG4L 4ONGH 1I1RA 5GRZA 3P9MA 3ZL4L 4L3EE 2A1WL 4YWGL 2Y5TA 4GH7B 5JPMA 4K7FB 4JR9H 1PX3A 5IFAH 3KGRA 2DD8H 3U82B 4Y19D 4LPTA 1INQA 3BZEB 4DN3H 4GOSA 3ARBC 4XC3L 1KTLB 4LCWB 3N50A 4HCRL 3MLTB 4CKVX 1CFTB 3L6FB 4ZNEE 4CNIB 4YXHH 4R8WL 4WW1A 3HLAB 2HT4D 5HVWA 4WWID 2VZUA 3TBYA 3DX8A 4XBPB 4Q6IA 3DHJA 2PYEB 1X5KA 1HOCB 1YNKH 2OTPA 4WHDA 3OKKA 4FQPA 2MKWA 4OGAD 4JRXB 2CDGA 2J88H 1T4KB 2ATKA 3W11D 1KENL 1URLA 1BMGA 1H3GA 5ESQA 2JJWA 2GAZA 1CBVL 3V7AG 3O6FA 4D94A 1FPTH 4S11A 4UBDC 3UTTB 4OF5A 3DTXA 4MB3A 5KOVC 2DKUA 4N90E 4XP4L 2HJLA 3WUZA 2X7LA 3ZDXF 3O8XB 1UGNA 1FNSL 4HGWA 3ARFD 4OF3A 5I74B 4E5XB 3OAUL 4OQTA 1L4IA 2QBWA 1CZ8L 2ADIA 4ORGB 4QRQA 1HXMB 4D0BB 5TGBB 3I6LD 5FKPA 1P84K 2P8LB 3QDGD 1A1NB 4N5ED 1KCSH 1IT9L 4Y4FB 3MCLL 3SJVE 1NBVL 1U8PA 2PW2B 1HCFX 2WP3T 3SO5A 5HHPA 4MAYD 5SX5H 4LASL 1YNLH 3NMEA 3UYRH 5J12B 1KPUA 4ZUVB 2DBLL 2GJZB 3NFSH 2XQYG 4MA3B 2Z8VC 3F7PC 4UOW1 4QHUB 3AGVA 4YXKH 4F58H 4GSDH 3VXRD 5GRVK 4NYLB 5CEXB 4XP9H 1ACYH 5I1JH 4FP8H 3TYFB 4WI7A 2SEBB 3ZMRA 1RZ7H 4M02A 2Q8AH 1CGWA 5GGVY 2DLHA 2GUOB 4DFHA 1ES0B 4LSTH 3PV6A 3Q6GH 5DF0A 4HIEA 2HWZL 1ZLWK 4K07A 4ALAL 3FO9B 3PUCA 3QO0A 3JTTB 1IC5H 4I48A 5IK3A 1ZT1A 2EYSB 3SY0B 5CSZA 1GOHA 4ZQKB 4ZNCD 4ZOBA 1XF5B 1F3DJ 1WVZA 4GRWE 5IIEA 2VXQL 2D4FA 4XC1H 1J86A 3VFVB 5BOPA 1M71A 5M94B 2MKLC 3S9DB 1LK2B 4JAMA 4C58B 4K7PL 2WBWB 4ZTPL 2GSGB 4DKEH 2DQHL 2YSSB 4OLXH 1X5HA 4P5MB 1E6JL 1R5IA 1A7QH 3S4SA 5C8JA 4PGEB 2W59A 5KS9E 4JFFB 1KULA 2EDKA 1AGDA 5HYFA 3GHBH 3HR5B 3OWEA 3TCLA 1Z9SA 1UWXK 1XCTA 3X14A 4YIQA 4FG6C 5DJDB 5BQ7A 1PYWB 3QRGH 1QYGH 1RVFH 1SBSL 3K8MA 1MOEA 2GT9B 1MCPL 4F7CB 3EHBD 2RCSL 4KMTH 2I27N 2EO1A 3IU4L 2XG4A 2PYED 1C12B 1JGDB 4FS0A 1AGCA 2XA3A 1G7IB 5E2VL 4JRXD 1A6VL 1A7PL 1QO3B 1WWBX 4KTEL 4LHUG 5T3ZE 2WQRA 5JORB 1M6OA 5DUBB 3UTSA 1ZSDA 3RWIB 1YYLH 4ZAKA 4XNMB 4U1IA 2H2PD 4XNYL 1FNGB 1FNFA 1IM3B 3TBTB 1T0PB 3TBWA 1WZMA 4YHPA 1KEML 4N0UE 3MRMB 5BVJA 5SWQA 1YECH 4NUJA 4KDVA 4RAVA 2HJFB 2APWA 4ZOEA 5FO8A 1UM6L 2FJHB 2Z0BA 5B38B 2CGRH 3D2UB 1U6AL 3DV6A 4YDVB 4FQQA 4B0MM 2BY1A 4FFYL 4HS3B 4DGVH 3NFNA 2WANA 2C7UB 4EN3C 1CG9A 1KLUA 4HKJB 2XZCL 4Y4HB 4OLVH 1D6VH 3B2VH 3QDJA 4TSBL 5I1HH 3IJHA 2DTMH 3MGTA 4O2EA 1VEMA 2O5YH 3B4NA 4NDMB 4Y4FD 5J4MA 1YEJL 2J8UA 4CMMB 5I8EB 2AJZB 5DD6B 1OTUC 4M1CD 1FRGL 5HHXL 4E0RB 3SOBH 3SGDH 3WV0A 2I9TB 4M5YL 3TA3B 1A6PA 4HMDA 1TJGH 1O5DT 5EC2B 5EC1A 1RZKH 1KSRA 1KELH 5A16B 1I1CA 2HT2C 3QUZA 1KCLA 5B3NA 1OSPL 3RGVA 2FEEI 4OZFA 4PJDE 4AH2A 1RZIA 1U92B 2QHLA 3Q5OA 4OFVA 1JGEA 3O6LL 2C1OA 1N2RB 2A6IA 5EO1B 1K8IA 4K3EL 1GGBH 1C08B 5IBUB 3QFDA 2Z31D 1FL5A 1EEYB 4RX4D 5F6IB 5EIIA 5I19L 2JELL 4I3RH 3UPRB 1IGCL 1CD8A 3CVHL 4KJYA 4WTZG 3EOTL 5B21A 3GUTB 1MWAA 4HZAA 3MUZ1 1MLCB 3FT4A 1UEYA 1LEIB 4GKSB 2NLJA 4Z7WB 5JTWA 1A7OL 1WF5A 3MRCA 1QSEA 1KCVL 4PREB 4HKBA 2WW8A 4HS8H 4R4FL 1MRFL 4X6FB 1CLZL 3AU1B 5EWIH 4X99A 1A4JA 5GGTH 1J10A 3RX5A 3UP1A 4JFFD 4DKDC 5KN5B 1N7ML 4I1NB 2EIZA 3QHZL 1G6RH 3S98A 1AQDA 4UDTB 4YDJB 1PG7L 2R39A 3FT3A 3CDYA 2UWEE 4OUOA 5J6GA 2VOTA 1NBQA 2AQ2A 2UVEA 1WEJH 1T1ZA 1LEGB 4XPFL 1OW0A 1CVSC 3QIUB 3IDYB 5FUOL 1HHIA 1HILA 3KLAA 3LN4B 1NUFA 1A1OA 3LHPH 2B8OT 2W0FB 3L9RB 3QUYB 1GVIA 3EFDH 4R7NB 2YMXH 4TRPH 5I1AA 1F90H 1OP9A 5C6PB 3W9DB 5B8CC 5TFSH 3WHXA 4LOUD 4OCNC 2ZOLA 3LIZL 4YPGB 1OAUH 3RY6C 1FFNA 3TVMC 4RWYH 4XCCH 4M1DH 3C8KB 4X0KB 4MA7H 3QEQB 5KVGH 5DHYB 5IJKC 1DE4B 2VMFA 3OF6A 4U49A 32C2B 3O4LA 1A7RH 3ZKNC 4JKMA 1NL0H 3D2UD 4UB0L 4W4OA 2PTTB 2COQA 2J5LC 4ZFGH 4K3HA 3GI8L 2PXYC 4PJBB 4G6JH 1QNZL 4L8BA 3C08H 4U6VH 1XR8A 5CEZE 3VA2C 3MUGA 3SDDC 1AO7A 5HGBA 5MEQB 4KI5D 3GSOB 3PDDA 4Z7VB 5C08B 2H41A 3LKSB 3TA3D 4M48H 5DSCA 1FP5A 1UENA 1OAQL 2YKLL 3EOAB 4PY7A 5ESAB 4NN5C 3PHOA 4U1SB 4KHTL 4NQDE 4KROC 3M17A 4NP4H 2AJSH 3PQYB 4MZ3A 4LCCB 2E9BA 5F7EL 2GQHA 3UEZA 4XVJH 5IEKB 3KPLB 2C3WA 3KXFB 3G04B 3C6SB 4L8CA 3FO0H 4CMHC 4X9HA 3O2DL 1OT2A 1DBBH 1MIML 4OGYL 1S5IL 3MA7B 3HC4L 4Y8DC 3RX8A 3MX0A 3JBG7 3TT1H 4LEXL 1HH6B 3AVEA 3DROA 4R6UA 1CYGA