3QQXA

Reduced native intermediate of the multicopper oxidase cueo
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
494
structure length
474
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHDDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
publication title CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
rcsb
source organism Escherichia coli
total genus 140
structure length 474
sequence length 494
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA03
1GYCA 1M56B 2FQEA 3ABMB 1MG2C 1JZJA 2HLEB 1AZRA 4YSDA 1WA1X 1PZBA 2BWDA 1YLBB 2PCFA 3AZUA 8PAZA 2DY2A 2CUAA 2XXFA 1ETJA 3CG8A 2UX6A 1IBYA 1ET7A 2GSMB 5B1AB 3CVDA 1TKWA 3ERXA 4KO9A 1ASQA 4YL4A 1A8ZA 1GY1A 3WNIA 3FT0A 5PCYA 5E9NA 3FYEB 1ET8A 2UXFA 3SQRA 3NJLA 3NSFA 3NJIA 2R7EB 1MZZA 1R1CA 5B1JA 2EINB 4DP8X 5I6OA 3OD3A 1DYZA 1V54B 2VW4A 4HCIA 5D4JA 2IDFA 2BW4A 3X1EA 4GP8B 3FQYA 4JHVA 4YSAA 2FJSA 3FSZA 2IAAC 1E5ZA 3FSWA 1NIAA 5B7MA 1ZDSA 3IN0A 1AIZA 1ILSA 1PLBA 1ADWA 3ASNB 3X2QB 1KDJA 1V10A 1JVLA 4YSSA 2PPFA 2GBAA 1I53A 2YAMA 2YAHA 4YSRA 2HX9A 1AG6A 1AS7A 4FAAB 5I6MA 1A4BA 2BP8A 4G7RB 3QJRB 1RCYA 2TSAA 2IH9A 2UXGA 2VW7A 3GDCA 3SBRA 1HFUA 2I85A 1AACA 3BQVA 2CALA 3OMIB 2PPCA 3CDZB 3WG7B 1SF5A 1ZPUA 7PCYA 3UABA 1ZIBA 2GB2A 4RH4A 5B1KA 2IDSA 2YXWA 2CCWA 3EH5B 4QLWA 3ASOB 1L9SA 4E9RA 1JZEA 1JOIA 4A2HA 2PPDA 1CURA 4KO6A 2LLNA 2MRYA 4GXFA 2E86A 1UATA 1JVOA 1JXGA 1AAJA 1L9OA 1X9RA 2Y69B 4UANA 2HRHA 4AI7A 4DP6X 4HIPA 1SFDA 1AANA 1JXDA 2CJ3A 2OJ1A 3AG1B 1DZ0A 1NINA 2Y1AA 3CVCA 1BQKA 3PAVA 1N68A 5IY5B 3QJUB 1ZIAA 2J56A 2GHZA 3WKPA 4YVUA 1JZFA 2DWTA 5TK4A 3S8GB 1N70A 3EHBB 1X9UA 2H47C 5D4HA 4WTQA 1NTDA 2WO3B 1ILUA 2XV0A 5F7AA 1NDTA 1L9QA 1W8EA 4DPAX 1E67A 3X1NA 4BDVA 4G70B 2IWEA 3FPYA 4DP1X 2DYRB 2JXMA 3AW5A 1J9TA 1CYXA 1BEXA 2ZWNA 2QPDB 4E9QA 1JZHA 4FA7B 4N4YB 5I6KA 2FT7A 3FU9A 1RZPA 2YAQA 3QQXA 2IH8A 5I5JA 2OV0A 3EH4B 3QJQB 1FFTB 3GYRA 1ZV2A 1SNRA 4M4RB 2XVBA 1GS8A 2XUWA 2J57A 1CC3A 2BP8B 1NWPA 2BWIA 3ZX1A 1FA4A 6PCYA 5AKRA 4HCFA 2XV3A 3AY2A 1RZQA 3HB3B 3WNJA 1A4CA 1NZRA 2PCYA 1GS7A 1XMEB 2X87A 2BP0A 1ASPA 1A65A 1MG3C 1E65A 2XWZA 5I6PA 2YARA 3NJGA 1PLAA 1OE3A 3NJFA 1NIBA 3UGEA 1CUOA 5B7FA 2YXVA 4A66A 4W1TA 3U25A 3UAEA 2YAPA 4UF7C 1J9RA 1KYAA 5AFAA 2OCCB 2AZUA 3L45A 4YSUA 2GIMA 4YSPA 4YVNA 1PNDA 1OCCB 3NSYA 3PAZA 2PP8A 2XXGA 2HRGA 2VSKB 9PCYA 2GI0A 4KO7A 1NIEA 2BZCA 4A2FA 6PAZA 5D4IA 5B1JC 4A68A 1PCSA 4PAZA 4DP2X 3H4HA 1SDDA 1E5YA 1MZYA 3IEAA 2GC4C 2I7OA 2XLLA 1AG0A 1OCZB 2EIJB 3NJHA 4A2EA 1BQ5A 3EH3B 2RACA 3G5WA 3S8FB 2ZOOA 2I7SA 2FTAA 3D12B 3CVBA 3FYIB 4AZUA 5LDUA 5B7EA 1KBVA 4F2FA 2FQGA 4P5SA 3NJNA 3NSCA 2QDVA 4E9YA 5B3SB 2PP9A 2P80D 4DP5X 5F7BA 2BHFA 1JZIA 3QJTB 4DPBX 3PAUA 1W6LA 2UXVA 1V55B 2VM4A 4CSZA 1SJMA 3MBWB 2AZAA 1KBWA 2WO2B 3NP4A 4DP7X 3CZUB 1NPNA 2A3TA 2YQBA 2DWSA 3AG3B 3T71A 2J55A 2DYSB 3OMNB 3FU7A 4GP5B 1KCBA 3IE9A 1URIA 4UAHA 2IDTA 2XV2A 3NSDA 2J5WA 3S3DB 2R7EA 3SBQA 2BP0B 3TBCA 2FQDA 4EF3A 5EHFA 5I5IA 3DKHA 4A2DA 4N8UA 4GYBA 4DP4X 1WS7A 2GC7C 3OMAB 4X4KA 2HX8A 2ZXWB 1AOZA 1SHXA 4E9WA 3HEIB 7PAZA 4F7KA 4ENZA 4A2GA 1E30A 1WAEA 2H5UA 4F2EA 1IUZA 1ASOA 3ZBMA 4G7QB 3ZDWA 3FSAA 1J5CA 3FSVA 4JKNA 2JFCA 4HHWA 1AS8A 3V9CA 3FPXA 1KCWA 2H3XC 2BW5A 1SDDB 4YSTA 3T6WA 2YAEA 1WA2X 4G71B 1PMYA 1W6WA 3CDZA 2XU9A 3AG4B 1PF3A 3N55A 4BXVA 4BK5C 1XB6A 4NERA 4AKOA 1NPJA 3H56A 3T6VA 3UAAA 3UACA 1QNIA 4PCYA 1AZUA 1JZGA 1BQRA 2PPAA 2XX1A 3KW7A 3PLYA 1GSKA 3S3BB 2QPEB 2AFNA 2PP7A 5I6LA 2PPEA 3OM3B 3FQ1A 3NJKA 1BAWA 3NT0A 2VMJA 3FQ2A 4Q89A 1J9QA 5TK2A 1AZBA 1F56A 3PCYA 2IWKA 3TA4D 2B3IA 2FWLB 4E9SA 5I28A 2EILB 2NRDA 3EF4A 3FS9A 1GR7A 4KOCA 1SHWA 4Q8BA 1XB8A 3FU8A 4MFHA 2B08A 2BO0A 1IC0A 1TEGA 3T9WA 5FC9A 3JT2A 3DIVA 3FU7B 1OE1A 1J9SA 1PAZA 2IDUA 2YAOA 1JERA 3T6XA 2XYBA 1PNCA 5I5MA 4DPCX 3ABLB 1AQ8A 3PPSA 4YSEA 2IWFA 4K9JA 4BWWA 4HALA 1PLCA 4YSCA 1NIDA 2HXAA 1B3IA 3C75A 3WIAA 1L9TA 2CBPA 2FT8A 3WI9A 1GS6X 3H4FA 3X1FA 2QT6A 4BDVB 1GW0A 4KNUA 1FWXA 2MTAA 1QHQA 2Q5BA 1WA0X 2HZHA 3IBOA 2FNWA 2FQFA 4G72B 1KV7A 3RYMA 1BXAA 1AZNA 2N0MA 3BVDB 2CAKA 4JHUA 1IKOP 1HAUA 4AX3A 1J5DA 3NP3A 2YAFA 1NICA 3DTUB 2W88A 2BZ7A 2PLTA 1OCOB 4DP0X 2W8CA 1OF0A 3NJJA 1QLEB 1EHKB 4HZ1A 4GY4A 4TXVB 1KDIA 3QJVB 3SBPA 3QPKA 4KO5A 3WKQA 2EIMB 4BXSV 1BYOA 1NWOA 1PZAA 1RKRA 1BYPA 4HCGA 3X1GA 2EIKB 2VN3A 1PZCA 1GY2A 3MX0B 3UADA 1MDAA 2AANA 5I6NA 1EZLA 1T5KA 5I26A 2Q9OA 5A7EA 1NIFA 3IN2A 1OCRB 1XB3A 4BWTA 4E9VA 5B1BB 2TSBA 2DV6A 1M57B 2JKWA 2UXTA 1ZDQA 4E9TA 3PXLA 1SFHA 1CYWA 4KNSA 4G7SB 4KOBA 1OOWA 5AZUA 4ZK8A 3V9EA 2IDQA 4CSPA 3ZIYA 2FT6A 3TASA 1AR1B 1ET5A 4AKPA 4GP4B 2UX7A 2X88A 3ABGA 1KGYE 1OV8A 1OE2A 4NAJA 3TBBA 3X1BA 4HAKA 1L9RA 1AS6A 2AVFA 4NB7A 3TU6A 3OQRA 3NJMA 4E9XA 2ZONA 4DP9X 4L0PB 1AZCA 4M3HA 3ABKB 3AG2B 4BWUA 1VLXA 2VSMB 3QJSB 2VW6A 4A67A 1A4AA 1SF3A 2VM3A 1IBZA 1BXVA 3KW8A 1JXFA 1BXUA 2HX7A 2QDWA 5ANHA 3N2JA 3S3CB 4HHGA 2WSDA 4AKQA 3JTBA 3NYKA 4YSOA 1L9PA 1A3ZA 1ID2A 1HAWA 4KNTA 5PAZA 2XX0A 3T6ZA 1PY0A 2P80A 4WKXA 1WS8A 1TEFA 4YSQA 4W9ZA 4P5RA 1M9WA 1TU2A 4QKTA 3GXUB
chains in the Genus database with same CATH superfamily
1QW8A 5HHNA 2QVMA 5EG6C 5JPMA 1GYCA 3ABMB 3HE6C 4LU5L 1LE5B 4WCYL 3IETA 1OP9A 5BRZA 5J1AB 3WE1A 1CF1A 4MXQC 5DQJB 3EF7A 1AQKH 1OGAE 3LKPB 4OF5A 2IH3B 1E40A 4JPSA 1WJ3A 5K93A 2K7PA 1XQ4A 4AIXA 3L7FB 4LSQL 5AAPA 3GRWH 1CFQB 2GITB 4P57B 3EXJA 4G6FB 5C6PB 4KKPA 1W15A 1T4KA 2A4ZA 2XXCB 2KQMA 3AMLA 3UJJH 4LHJB 4PJAE 2R7EB 5DUPH 4IDJL 1MVUA 5CP3A 1QSZA 1JF1A 3ZE0F 4Y5VC 1AHKA 2FZ3B 4WWKB 4P5MA 1GCFA 4BZ1H 1A6UH 4L4VA 3CSYB 1LEKB 4NQCE 2YKLH 2ILLA 3RB5A 3BCDA 5DA4A 1UM4H 1D9KB 1MJUL 2IAAC 1E5ZA 1KJ3L 3O6MH 1IM3B 1K8IA 4JPVH 1ZDSA 3DGDA 3GKZA 3X2QB 5I1LA 1VFOA 1CDBA 1NBVL 1I3RB 5DVLA 4YS4A 1N8OE 3F7YB 3T8MA 2WLMA 2FECL 1B4JH 1FI8C 5DEGA 4PJ5B 4U2ZA 2V8LA 4DSYA 3ROOB 2ADGA 4PS3A 3BGMB 3OR6B 2HLAA 5C0BA 5HVHB 3FT2A 2AMUA 2EYTB 5JHDD 3FT4A 2ZYHA 2N1KA 2QQLH 1V7NL 1RJZB 3UABA 4JPIA 4WW2C 4JO4L 5EOQH 2B5IB 3VRLE 4ALAH 1R5WB 1TQBC 4P4RA 1DBJL 2QVIA 3K91A 3BIKB 4HIQA 3DIFA 1YDPA 4JFFD 4JRFA 1XBDA 3BT0A 5EU5B 1CLYH 3VACA 5IQOA 2NY2D 1IKFH 5C8JB 4IMKA 3OGCB 2FHFA 1QO3B 1Y7VA 1T3FB 2CO2A 1GHFH 2WNGA 1TZHB 1X7QB 2NX5A 1FZKA 4Q6IA 4DZ8B 4NIKB 4YHPA 3HFMH 1WIUA 2YD1A 1IBGL 4YDVA 1XGTB 5DMIH 1SY6A 2V3DA 2CJ3A 3LN5A 3EJZC 3U79A 1S5HB 4HK3N 2D03H 3VD3A 4B96A 3HR5B 1N68A 1FJ1A 3CX2A 4UWQB 1S78C 3EZJB 3BC9A 4HUXB 3L4TA 5IQ7L 5C09D 4NNPH 1O7DC 5E23A 1DQVA 4HU2A 4IU2A 3BEVB 2E3VA 1NDTA 4MA1B 2VXQL 5DK2B 4UM9D 4BDVA 3NFNB 3BVTA 2GJ6B 5BV7H 5C0AD 5I6XC 3SKMA 1BMGA 4FNUA 3U9UA 3OL2A 3PG2A 3VNYA 4EZJA 4DH2A 2G3ZA 2LABA 3FQNA 4V2CB 3HOGA 5AVQB 1UT9A 3DK2A 3C5ZA 2L04A 3WD5H 3DRTB 1LP9A 2A83A 3IU3B 1BQHB 1RZPA 4DKAA 2GK2A 4PGCA 1AIFA 2ZWSA 5GGQL 3RZCB 4PVBA 3TVMD 5KYYA 1N6QL 3QEQA 5KOMC 5LN4A 3GIVA 3MCKA 2NQDA 3BQUC 3P0VL 1RZIB 5ECJE 1EIBA 5KS9F 5ETUA 3QNFA 2DBLL 3OAZH 3RIAK 1YY9D 2CHXA 3P0YL 5E00B 3VMPA 3B3BA 1QLEH 1GC1C 3FTWA 1SLXA 2OP4H 1XF3A 3IKKA 3TEXA 12E8H 1RZQA 1PEWA 4DTGH 1U58B 3IJHB 2OM5A 3K72A 3C6LC 3V7AE 3QJXA 4Z3TA 1N0LB 1KTDA 3T0EC 3C2AH 1N64H 3EJSA 3G08B 3GT6A 4N9GA 3VD7A 1NIBA 1J05B 3UGEA 2IALB 3OTTA 5ERWA 3SYQA 4CVZA 1XGQA 1ZTXE 2WYTA 4O51B 1ZK5A 4F1SA 4EOWL 3BOVA 3V0WL 5HYJE 2ADFH 4OB5H 4LCYA 2WMPA 2XN9A 1NAMH 3L45A 5AW3B 5FUCC 4JVUA 4OZFG 1DQJA 2VDRL 4ATWA 1RUQH 1MHHA 4QRUA 3MV7B 4Z18A 5K1JA 9PCYA 2I5YL 1EHNA 3FUIA 1EBAA 2Z9TA 1M9SA 2IPTL 4ZX4A 4PJHB 2NTSP 2Z8WC 4H20L 2OJZH 4JFTA 1J86A 3QZMA 4UT9H 4GQ9H 4K0OA 4TVUA 3BVNA 5LNEA 5GSRA 1KCSL 3HG1E 2FO8A 5FO7B 1AG0A 3BEWA 3DI3B 3EJYD 3NJHA 5KVEE 2VC2B 5HDLA 3RURA 3VU1A 1RZFL 2VJXA 4PRIB 2FTAA 2IC2A 5DZNA 5T8IA 2I07B 2OTUB 2Y0SA 4G42A 3SE9H 3KPSB 4Q9QL 3FO2B 3I6SA 4AZUA 2EXYC 1P4UA 5L0QC 1NL0H 2FQGA 4S1RL 4KRPD 3T6QC 2O30A 4RBPK 2QDVA 3BAXA 5D7IA 3CVHB 1KGCE 1HDMB 4JRXE 3FU3A 2EYRB 1A7OH 3HE7D 5I19H 4F2MB 3IJSB 3KPNA 3S34L 4RISH 1BQLH 3Q8BA 3GNMH 3QA3A 4KBPA 5FS5A 3L3KA 3U2IA 1K72A 2EC9T 2HA1A 1J8HB 3HC3H 4QXVA 5BRZD 4HWNA 4Z7UE 5IM7B 4LSVH 2YQBA 1PKQA 3JBG7 4QGTA 3MV9A 4U6HB 4NZTL 3DHPA 3F7QA 3STZA 1EHAA 3LRMA 4G11A 4ZAKA 3IFLL 3O3AA 5CEYA 3NCEB 1C5BL 5F1NA 4R7VA 4KHXH 2XV2A 2G5UA 2N4IA 2NSXA 2I9LA 2ZOTA 4YXKH 2P52A 3VM5A 4XB8A 5HGGS 1QEXA 5ENWB 1IIIA 5MEQA 4K8RD 4L4VD 5T3XH 1G0XA 4HJ0C 4HK3J 5FO9A 1QACA 1HKFA 3REVA 5BW7C 3EGDA 1E4XH 3U6XS 3RY6A 5K9KA 1LEIB 4F7KA 2XVLA 3T2OA 4A2GA 2IG2L 3ZVVA 3SPHA 5BVJA 1OK8A 1TQCC 3CIAA 3LXBA 2VXQA 3OPZH 1HHKA 4TUOB 4GKLA 4HGKC 4XPBH 4XN1A 4L1TA 1KMGA 5SWZA 1N5YL 2VTFA 4ZS7H 4FJ6A 1SOSA 2FL5A 4X6CF 4YQXL 3DGCR 4IGBB 4RWHA 4YPGA 1TXKA 4ZFFA 2H3XC 5E2TL 3RNKA 2AK1L 3SO3C 5J3HD 3KG5A 4Z5RA 5FM5M 2MHAB 5K1NA 3VRJA 5C0BD 2A6JA 3CDZA 1MREH 1KN4H 4WHCA 1TJIH 1NC4A 4PUBH 4WJ5A 2AJSL 3BUDA 4NERA 4Z7NE 3KM2A 2YSSB 4Q6YA 2BIPA 2WK2A 1MAMH 4AG4H 1BQRA 3R4RA 2XX1A 3KW7A 4C4UA 1X5KA 1CF8L 4QCIB 2CHNA 3CHSA 4J6IA 2QPEB 2FJGA 3DURA 5AL0A 1IM9B 5ESQB 3WKML 1F58H 3G6DL 1THAA 5FGBC 1E9PA 3OKMA 1A21A 1ADQL 5DC2A 4Z7VF 4YHMH 5EIIG 4IU3B 4JFZL 2O5XH 3BKYL 1UXMA 5A2AA 2KQNA 2NX5D 2ZOKB 3QUKB 1TQUA 4UZUA 4HKBB 5AOKA 1FYTE 3O9WB 1A3LL 4P5TB 4Z1PA 4R2GD 4FD0A 4AEIH 3LY6A 1IC0A 2GFBB 1OAKL 3QW9A 1U8MA 3SCMB 3MGAA 4HJJH 3QDGA 2ZNXA 2AJUL 3VXNB 3PWJB 4LEOA 4IBYA 2VZSA 4MMZC 2QMKA 3KPPA 4KROD 4HS6A 5L4IA 1DJHA 4RWYH 2PR9A 1XF2B 5E0QA 2E9IA 1E6OH 3HS0C 4G80B 1EXUA 3KBPA 3GPEA 4BCXA 3C9NB 2XWCA 1ZPLA 3D4GA 3DETD 1QAWA 2A9CA 4QRTB 4HT1L 3QYCA 4JG0L 1V3KA 4PW9A 4NUMA 3ULUE 3C5ZD 5KSUA 3ZN6A 3VI4B 3U30B 3VYOA 1ZEAL 3RX9A 3LTVA 2Y22A 4HPYL 1KIQB 4J4PA 3VAEA 4GI9A 3P9LB 4JRWA 2CKBB 5DWPA 2PXYD 1ITBB 1E28B 2J8UF 5D7LB 5DJCA 4ADGA 3MJ7A 5IHBA 3LIZH 3TN0D 1KY6A 2Z8RA 4JFFE 2Q20A 3GMLB 3BP5B 5A6IA 5GGSB 4U3HA 1KYUA 2YD8A 1NBCA 1FFPA 3ARGA 1S7SA 3VFTB 2VRAA 1TO4A 5KSAB 1KIRA 2IGFL 4U7SA 2GT9A 3FTYA 1A7BA 1XXFC 3O45A 1NGQH 4MJIA 5C6WH 1QKZL 4GS7C 3IXTA 4AE1A 3F83A 3DMMA 5HPMB 4O9HL 5IVZB 4GSDL 1DBML 5IHWA 5F71A 1G9ML 1MCPH 4NLAA 4YL9A 1PD0A 2X6AA 5DJAA 1DP0A 1RJLB 3MX0B 4JFDD 1CFVH 3BHBB 1CBVH 1I9JH 5E1GA 1FAKT 1CU4L 3Q7JA 1F86A 3F65A 4G9FB 2X6CA 2XZQL 1UYWH 3J07A 1D6EB 2XN9D 3SE6A 3WMPA 5CUSH 4NFBA 3LS4H 5CINH 4YUEH 4CN4A 4KVCL 2P5WA 4JM4H 3WO4C 3BJLA 5C0AE 3IDIA 3BKCH 3ECQA 4HKJA 3SD2A 3MRIB 4AKPA 1PG7H 4BD4A 3DROB 1VGKB 1KPUB 2ZIDA 1KGYE 4X5XB 4K94H 5MERB 3RFZA 2AW2A 5TPWH 3SZKC 4XMLH 1CT8B 3BZ4A 4HWZA 3AU1B 3TA3D 3QUXB 3SKNA 3INUH 5ITFB 5LAXB 3S98A 1H3WM 1R17A 3RVWD 4DP9X 4L3CB 4U1JA 2YSTA 3ABKB 4I18C 1GGBL 1A8JH 4A67A 3V8CA 3LKQB 5D1QC 3FHEA 1FBIL 4IKIA 3ZW3A 5TFSH 1UM6H 4BINA 3QHTC 1ROCA 2RA1A 1E9OA 2DLHA 3DV6A 1JPFB 1TJMA 3W57A 2APFA 1YEWA 1HQ4B 4FA8A 5L7XH 3BPOC 2Z1KA 3VNZA 3IPBA 4PJXE 3L8QA 4W9DC 5F96H 1S8DB 4WI2A 4ZS6D 4HFUL 4AWJC 4EVNB 3FB5A 2FQEA 1U3HA 2JQZA 4OUUB 3MV9D 2X4UB 1ADQA 2IBZX 3B2MA 1BLNA 2KUTA 2HFTA 4JM2A 1NFDA 4JZOA 4ZAKD 1IX2A 2ORBL 5IVXF 1AGCB 4OF6A 1DLFL 3JYBA 5E9DB 3CVDA 4H1LG 3VE0A 4IJ3C 1JWUA 4NPKA 3TJEH 2YQ3A 3LX9A 3WNIA 4ZPVA 4IRZL 3IK2A 5I76A 2COVD 3VFNB 1RK0B 2WIIB 5I1GH 3IDUA 1GOHA 4KJQC 4MMXA 1A1NA 4K7FB 4OKDA 1BVOA 4G6AC 4IKJA 4HC1L 1XMWA 4O5LL 5D4JA 3ULVD 4I5BA 1OANA 4WEBH 4OJAA 3QZWB 1VFBB 3EHBC 2FJSA 5FGCE 5KBDA 3O4OC 3AC0A 4QRPA 3QDMB 2VDLB 4CJ1A 3MUGA 1E5UI 2H2SC 2HPOA 1XGPA 2K7QA 4F20A 2DQIH 5CZVL 3C5XA 4NYLA 3APFA 4PLJC 4OUOA 1URLA 2YGNA 4WI6A 2DLEA 1NMCB 1FL5A 3R8QA 1JGEA 4C83A 4DCQB 2V5YA 2ZG2A 1ZA3B 5I6MA 3GJFA 5GGRA 1YUHA 2BP8A 1JHTB 1I7UB 3CXDL 4NN6C 3A4EA 5CNHA 3NFPB 4OF8A 3SBRA 3W9EB 2OMBA 3WNPA 3LRSB 1AACA 1GJWA 3BQVA 3W11D 4TSBH 1TG8A 5CP7A 1WP6A 1YECH 3FONA 1IJ9A 2WGNB 4ADIA 3PWUA 5DHVA 2Y7MA 5KVMC 3HE6B 4QLWA 3T3MF 3M1OA 4JLRA 3AM8A 4UILH 4DESA 2C9UA 4TULH 4CU6A 5C0RL 2MRYA 1ZHNA 3OGOE 2GPZA 3F00A 5ICZA 4NUJB 2EDEA 5DQ9A 3VM7A 1QYGH 3L1OH 4AGMA 1R3IL 4HWUA 2B1HL 4AQ8C 3WLWC 2BRRH 5DA0B 5HYSB 4JDTH 1RZJL 4KJPC 4L8BA 4UANA 3QJZA 4L4VE 4E42A 3V7MA 1PPIA 1D5ZA 5CHNB 1IC4L 3FN3A 2OMZB 4PRNA 3AG1B 3NTCH 3QDGD 3X3FH 6FABL 1EDHA 5F0MB 3PJSA 1F90L 1Z9NA 4KKCD 4Y5VB 3QJUB 4E41B 3FTSA 4OZGA 3MLWH 4N2DA 3Q5OA 2DWEA 4EQ3A 1VCAA 3D2UA 5J0BA 3WKPA 5LGJB 4JFQA 4M1CC 2XTLA 3VFMB 2DWTA 4NO5B 3D3VA 3SOTA 1NCUA 4QJ5B 2CGRH 3L3JA 5D4HA 1AXTH 1W9XA 5AOIA 1H6TA 3QRGH 1W8EA 4YFDB 1E67A 2VUOA 3DYMA 1F3DJ 3GGWA 4C55A 6TAAA 4JO3H 2OXGB 2DLIA 4N2IA 2EE3A 1GGCH 2CLZA 1F3RB 2HAZA 5M94B 2O1AA 5KWYC 1CFBA 2DQHL 4H7VA 1FVDB 1XFPA 5IKCB 3QH3B 2Z92A 1CGYA 4Y9FA 4KK5C 3MRCB 2A9BA 5HHQA 4GW1B 5DFVD 3K2UL 1NMBH 1XH2A 4HX1B 1AO7A 5KBPA 1E90A 4FA7B 1AQMA 1J5IA 4M3JA 1G6RB 2WQVA 1OM9A 2PR4L 2YAQA 2YGVA 3RPIA 5SWSB 2BFGA 4LPXA 4ZW6A 5D7SL 5DVPA 1OP5K 1FO0A 4B3VA 2JIXD 4WW2B 1UFGA 2R56L 2YOCA 2WLHA 3DOSB 3HB3D 4Y1TA 3I02A 2V5SA 1TQBB 2NX5E 5EUOF 2DB8A 2A6DA 2BXZA 2DQDL 3P0GB 1M3JA 3R7RA 1GKOA 4MJID 1K6QH 5DZPA 1JGVL 3SQOL 4RGNC 1KNOA 4X8JA 5KVDL 2JKRM 1WGOA 2Z31C 2CLRA 2GTZB 3QEHA 4AK2A 2A9MH 2BP0A 2QVTA 1JL8A 4NT6B 2YWYA 3PHOB 3WEXA 1U9KA 1XCTA 2DBJA 3RNQA 1CWVA 3WIFA 2H1PH 2PTTB 5G4NA 4EZLA 2W0FA 5I17A 3GBNH 1U93B 3ME0B 2X4SB 1SMOA 2R1WA 4JDEA 3V7AG 1JTOA 1XVSA 3KPMB 5EMYA 3GZKA 5AD0A 4NOFA 3HHMA 2DTML 4Z7WF 1FNFA 1P4IH 1EEZB 1R5VB 2HKFH 4PTUB 4OIFA 4TUJB 3SDAA 1I9IH 4HC1A 3LKSA 1YEJH 3IMUA 3FF7A 1PCSA 4Z7IA 4UBDD 1LP9E 3H4HA 2ICWA 4BFEA 5I6XB 1A3RL 1TCRA 4H25A 3QEQE 3GMQB 4GW5A 1KXHA 2F54D 2RACA 1FFOA 2BVUA 4L8CA 3JTTB 5H94B 2VERN 1T5XB 1JGLL 2VLJA 3CVBA 4BFGA 4KRLB 4BFBD 3FL7A 3MRKA 2D8KA 4G1MA 4MXWL 4F37F 5JORA 1SEQL 5DWUH 1U8KA 3VG0H 4CN6A 3BQUB 3INOA 4S1QL 1INQA 3H0TB 4HZAA 4L9LA 1L6PA 4NP4L 4XBMA 2EDOA 2BY2A 2RCSH 4OT1H 1MW1A 3IDJB 3DO4A 3NZUA 3EYOB 3DX8B 2E7LA 4FQXA 3BGAA 3EJUA 2FUTA 3P3YA 4ELMA 3CFJA 3UYPB 4IQHA 2YXFA 1LQSR 3GEFA 4K9EC 4WUKL 1BVKA 3F7KA 3GXPA 1M7DB 3C6LB 4JN1H 4BGLA 4XB3A 2XN9E 3T0EB 1I1CA 3KPRA 4Y9EA 2R0ZL 3DTXB 1JPEA 1NM9A 1YMMB 2FLRT 2YD6A 3ARSA 2WXKA 3GDBA 3LRGA 4QRQB 1P2CB 5DS8A 4ERSL 5I0ZA 4OBSA 4NM4L 2HJFA 4FRWA 4IS6A 5C71A 1C12A 3N5AA 5I8EA 5I1AB 4WFED 4BH7A 3RKDD 4EBQL 5CAYB 1KCVL 5EULV 1YJDH 3QORC 5DD0H 4PJ9D 5DJ2A 1ID5I 4NI6A 1TPXC 3SKOA 5TH2B 4J39A 5KJRH 2QZQA 4QRPD 2HVKB 4UNTA 3V6FB 2WLLA 4R4ND 4G7QB 3N41B 4RMTA 3QDJB 4LQ1A 1BREA 4WSJA 2XWTB 3I6LD 1MIML 2EDWA 2JCCA 4LLWB 3Q2LA 2OAAA 3TCXA 2DQJL 3VGHA 1OPGL 2CHWA 4F15C 5L0QB 2KC0A 3T3PB 5I1CL 1SDDB 1N2RB 3E6HB 5EZIL 3QZNA 4IBSA 3VXPB 3O3DB 5LGHL 4Z78A 2HFEA 3M17B 5B39G 3ARBA 3L1FA 1C5CH 1PKQE 5T33L 1PYWA 4HW6A 3VFGH 3WXVH 2OMYA 5KYUB 3KL3A 3PP4L 3MV9E 1UXSB 5TDOB 2O6EA 4RMQA 3RHWF 1AZUA 1HH9A 3PGCB 2DJSA 5E6YA 43CAA 3PLYA 2UWEB 1OGTA 4XE5B 2KKQA 2NLJB 3BYYA 5AWNL 2HVBA 4LLDB 1WK0A 1DQML 5EU6A 4NCC2 1MFDH 2BNQB 2GVYA 3NCJL 5T3ZL 4APXB 4FEMA 5FO8A 5CZXD 4AVIA 2XQYK 5I8KH 3BWUF 5KVGL 1KJVB 2AJVL 1UWGH 4WNQB 1JPSL 2IFFL 2AXGB 3MV8B 3FU8A 1SJVA 4LCWB 5EFIB 3MGOB 2CMRH 2WLNA 4GXUN 4KXZH 2DJMA 3CFBA 4L37A 5BRQA 2IDUA 3D2UD 4LLVA 4NC1E 4NO0B 5SWZE 2XYBA 2WZ6A 3VD9A 1JNHB 3II3A 1GGYA 2DI9A 2RTTA 3ZQWA 3BDYL 4MJ6A 2WAHA 1FCGA 3O2DH 2FVNA 4WJKB 1TQCB 3VTAA 5HHVH 1ODUA 2W92A 2X1OA 2Q7NA 3X14B 3HRPA 4N2AA 5D1ZI 2HVJB 1O75A 2ALAA 2XIDA 1DJGA 2QT6A 5GS2D 5A6LA 4PP1C 3DX9A 2YGOA 1FWXA 5HJ3A 1I1AA 2ALWA 1AO7D 3SO3B 5BRPA 1QA9A 2VDNH 4Q4EA 2FNWA 1Z0MA 4L5FE 3I3EA 3RYMA 3MREA 5E6RB 1S5IH 2GJZA 3ULAB 4AZ8A 1GTFA 1AXSA 2XQBL 3FFDB 1IJNA 2ZF8A 4FFZH 4L3EB 5LBSH 4W4OA 5AW5B 1LE5A 3H42H 3LKNB 2YLKA 1H9VA 2BZ7A 4XGZB 1CD1B 5LCVH 5EA0L 2LQRA 5ID1B 4WU7B 1OF0A 2D4DA 1GZHC 4GY4A 4TXVB 3QJVB 2IH3A 3FUMA 4ONHB 3QPKA 5B38B 3GSNB 1J48A 3L7FA 4Z9KB 1MCFA 2W80C 3U6XA 4LOEA 3A6BH 3G5VB 5AW0B 1OB0A 3AGWA 3BIBX 3ZIMA 2EQDA 5EOTB 1OTTD 4IBTA 5IBTL 2OA9A 4OIIL 4PJHF 4PJBB 5L4JA 4P2RB 4WWKA 3FFCE 1KBBA 3G5YB 5D1XE 3HBGA 3TJHD 1S7XB 3B8SA 5F7UA 4ODHL 3TIEA 4MQXD 1OD7A 1AR1D 4BZ2H 1IGTB 1D7DA 4FQ2H 4MMZB 4P4KD 2CWRA 1IM3A 5AW4B 3B4NA 2IDQA 3MHZA 2EEBA 4ODVL 2CDFB 2UZYB 2VC2L 3TYGL 2N1TE 3GXDA 5CGYD 3WXWL 3CFCH 3MTXA 4MDIB 3RWFB 2WGXA 3B1TA 1I3RA 3W0WB 3HS0B 3SYPA 5IW6B 1OLLA 3CMOH 5I30H 3F7YA 4HAKA 5DHEA 4KY1L 1AS6A 4OZFH 4YGVB 4JZNB 5ICYA 5GS0C 4PJ5A 1FLRH 1OAJA 5HHPB 5FK9B 3ROOA 3CVHL 2Y6SD 4LSRH 5FEBA 2R9HD 5EWIH 2VLJD 2VM9A 3DA0A 4X98B 3VQ2C 1Z9SB 2ZXAA 1KYOK 1RJZA 2WSKA 1UZGA 3UBXA 4B3EA 4DUWA 3SE3C 1WZLA 5IV2A 1N8ZB 1R5WA 2GAZB 3WLBA 3HIZA 1J11A 3N2JA 4LL9A 4TSCL 3RZWA 4CBPA 3W39B 1MFMA 3BIKA 4GRWE 2CE6A 3HBZA 1B0RB 2R27A 5C8JA 1EANA 4XTRC 2XC8A 2IOIA 1WS8A 3OGCA 1KB5B 2VDMB 2DMKA 1A14L 2UY7A 3PJNA 1QO3A 4QTIL 4W9LC 4XBEH 5T1LB 4HJ1A 1X7QA 4XXCA 4DZ8A 1DFBL 4QXWA 4GS7B 1DDHB 3ZKXC 4ZODA 5AZEL 1JZJA 3OAWA 3KPRD 5DJ6B 3Q9PA 2A74C 1KSRA 3HR5A 2ZUQC 2P7TB 2P5WE 5BS0B 3M8OL 1HWGB 4APQC 1ET7A 4WF7A 1SOQA 2NZIA 5IGXL 4MCZB 5F7EH 4MNGA 4JEGB 2JLLA 4YL4A 1Y1DA 3H7LA 3OG4B 1BFVH 2A9AA 1HOEA 1A47A 3BEVA 1UD8A 3WGVB 5JLZB 1ZLVK 3UAFA 1RUKH 1ZT7B 3RAJL 3KCPB 3WO4B 4JPWL 3S4SB 3UP6A 35C8L 1ZV9A 3EO0B 2EH8L 4QHMA 1AD0B 1YN6B 5I73C 2O61B 1HILA 2NR6A 4S0SD 3WUZA 4N6RB 1P69B 4F1ZA 2VIRA 1GTNA 1I1YB 2X44D 1AE6H 3DRTA 1CFSB 3MRHA 3IU3A 1BQHA 3HHSA 3K8MA 4O02B 2HKHL 3ASNB 4JY6B 1OHZA 5I1IH 3P30L 1V10A 3F6LA 1Q1JH 2HT4D 1XBRA 3OMZA 3V5KA 4I18B 2M8XA 4Z3JA 3UP1A 3FQWB 3FCUB 1R3HA 4GFTB 5D1QB 1AS7A 5KSVB 1DEEB 4X9BA 5E00A 3MNDA 4PRHD 5JDJA 1JZDC 3ARBD 1RY7B 4NGHL 2VKWA 1HFUA 2ZCHH 1ZHKA 1GZQA 1CJYA 1U58A 1MNUL 3BPOB 3IJHA 5JHAA 1NFDE 4X5WA 1RVFH 1HI6B 2N0KA 1N0LA 2B77A 1TSHA 2AQNA 1IT9L 4KMTL 5EC1B 2IMMA 1ES0B 5L9DL 4FNLL 2B15A 1ZWIB 2B1AH 5IB5B 2IALA 4XCCH 1ZVSB 1JOIA 1A6VL 1TTBA 5CCGE 1IKNA 3WUWA 4YFLF 3VXRA 2QQKH 2ZPKH 2Q0ZX 4P23A 4X83A 2X1PA 3PABB 3O8XA 4PG2A 4JO1L 4W4NA 3KLSA 3MV7A 4IJ3B 4MBOA 4N0FA 4HIPA 3EO9L 3V4PB 5LNDA 1DVQA 5BOJA 4QRPE 1CK0H 1ND0B 3L08A 4ONOA 5EU7E 4BE5A 1T21B 4W9CC 1KV3A 1NAKH 4ZFZA 3TBVB 3H3PL 5FO7A 1TKWB 2FE0A 1NMAH 3S8GB 1XGRA 3RI5F 3B2VH 4GSUA 3EHBB 1T20A 4LSTH 4OJCA 2DJUA 3O4OB 4PRIA 4YDIH 2OTUA 1MJ7L 2K8QA 3KPSA 2V9QA 3FO2A 1YEFH 4QD2E 1QW9A 4GNKB 5KANG 3ZPDA 1T0OA 1UTDA 4FZ8L 3S3JA 4BK8A 1HDMA 1EJOL 1MFBH 3NOIA 5AVVB 3SGEI 3TIDA 2EYRA 4DKEH 4JKPH 4FHJA 3I50H 3EYUH 3IJSA 1U33A 4NN6B 1KXVA 1MQKH 2X70B 4H44C 1MCLA 1Q72H 1Q9KA 4OKVB 5MEOA 1GIGH 1MCOH 3P77B 1J8HA 5CN1A 5ELIA 1B0GB 5IM7A 1C8PA 3G5XA 4FQ1L 4M4RB 1R34A 1UH4A 5JIDA 3KBHE 4MSWB 4BSWB 1IRAY 2YEQA 4FFWD 2EO9A 1REIA 4LRIA 2VXVH 3QC6X 3BRDA 4HOXA 1JG9A 3E9UA 2R29H 2XN0A 3ARPA 2OTPA 3S36L 2LE9A 4NHCH 3VDCA 1HNYA 5HHMD 4XCEB 5IK3A 1LO5B 2XOTA 2WIMA 4HKZB 4OZGE 1OW0A 1QWNA 2VXTL 3LCYA 3OLEA 5ENWA 3UO1L 1A6TB 2EECA 2P5EB 3D3VE 4P46C 1GJIA 3MLSH 3H7BA 3MGTB 5DMGD 1U92A 2WOYA 1I8IB 1J9RA 4XNZC 4M62H 3BVVA 2FIKA 3GHPA 4MQSB 2GIMA 5F1SA 3MJ6A 1VIWA 2G2NA 5FW7A 3EO1B 4OFQA 2DS4A 3OKOB 2ZJSH 4PM1A 1MI5B 5E5MB 1BOGA 3CLWA 3MMEA 4KUCD 4D9LH 4DKTA 1RQ5A 2NXYD 2ZUUA 1R9FA 2DN7A 4GG8B 4JHAL 4HGWB 5HDBE 2C34A 2YXMA 3DJRA 1MZYA 4EIGB 2MHAA 2P4AB 1T22A 4A2EA 2X2JA 4JG1L 2HYMA 3N1GC 5KBNC 1F1AA 1USZA 4PS8A 3WENA 4PJDA 2I9TB 5B7EA 2YRPA 1K2DB 2NY5C 1RZ7L 3AWGA 5HI5D 2X2UA 3MAWA 1WD8A 3V5HB 3P9WB 1JJUA 5ESQA 4P2OD 1IM9A 4BEIA 1L9MA 3JV4A 4NQUA 1JZ2A 1G7PB 2VJ0A 4IU3A 1MCWM 3GJFK 1KOAA 1YEIH 2ZOUA 5IJDC 1F4AA 4GPVA 4MDJA 4OY9A 2B4CL 2XQYG 4HKBA 2DQGH 4RGNB 3O9WA 1RIVL 3RFRA 2Z31B 4H8QA 5IVXE 3MLRL 3MXWL 4L1SA 4KJWC 5T3ZD 2GFBA 5C6TL 1JWMB 2WWMC 3RA7L 3HUJB 1A9BA 3K8LA 3O3BB 1OTUC 2CPUA 3DXAB 4JUTA 4N0UB 4ODUA 2CO1A 3Q8FA 2MKLC 3CFIC 4FABL 1ACYH 2XIIA 1XF2A 2E76C 4G80A 3MRJB 4F7TB 3C9NA 5CJXC 4ZT1A 1DVFC 4ZUTB 4QRTA 4BIKA 1JRHI 3MJ8A 1SHXA 3HI6H 4H1LH 4QYOB 5FV1L 2X10A 5CJOH 3QEGH 4TNEA 3VVVA 3UMNA 3CMGA 3VI4A 5TF1H 2BNRD 5FM8A 2H5UA 5CSGA 5HDQH 3MRGB 3P9LA 1ASOA 3IGKA 5KANI 2VITA 1E28A 1IGMH 5D7LA 1N4XH 2EYSB 4IOSA 3UTPD 3PXJA 1YSOA 4JMNA 2FGWL 2R4SH 2VLRB 2AEIT 1GAFH 4ELME 2YAEA 2D9QB 4A2LA 4XXWA 3VFTA 2VXSH 1JYXA 5JXAH 3L5WB 2W0KA 2HN7B 4OZ4B 4X7SH 3KPRE 3ARYA 2L7EA 4UV7L 5IVZA 5F2FA 3UAAA 3OB0H 3FBKA 1K5WA 1FL3A 3ZYIA 1PQZB 3QT2A 2JKIS 3MX0A 5DO2D 4DO5A 1JNJA 3S3BB 4KH2A 4TLTA 3X12A 3ALXA 3FQ1A 5L88H 2YPLD 1L6ZA 3VXRD 3FUEA 2E47A 3NAAH 5D4QA 1T0NB 4P23D 4KH9A 5AYUL 1WAAF 3O8XD 5GGVL 4JGNA 4HEPA 3MZGB 4NFCA 3KGTA 1ZXQA 3IGUA 2Y5TB 2WZPA 4PRDB 1F11B 1QHOA 4UUJA 3VGFA 2ADIA 1YY8B 3DROA 1FG2B 3TT3L 2AEQL 5J1SC 1KPUA 3VA6A 2BSTA 1KCUL 4X5XA 3JQOB 4XNYH 3E80A 1LTXA 3QORB 2GCYA 1IC7H 1UVQA 1CT8A 1S7TB 3AU1A 5AW2B 1TPXB 3H9ZA 1ZAGA 3QUXA 2JCCE 5ITFA 5J12C 2Q2LA 5LAXA 2Q6WB 4TNFA 4XP9L 4L3CA 1QASA 1T83A 2J1ZA 1E4KA 2AF2A 5H37A 4H8PA 5AAWA 3HLAB 1G6RL 3LKQA 3WFDL 1ZGLM 3BRGC 4KTEH 3WI9A 1NCWH 2F53A 5EN2B 1U41A 1UC6A 5I1JL 1M53A 3QS2A 1BV8A 4F15B 4F8NA 1LMIA 3QK0A 1JPFA 2JXMB 5CCKH 4H88H 1HQ4A 2YD9A 4W6WB 1T2XA 4WRLA 3CVIL 2N0MA 4UOJA 3NIGB 3NZSA 2QQNH 5C92A 1S8DA 1IC5L 4RBPH 4F8LA 1AGBB 1DDTA 4ZMWA 4EVNA 1EHLL 5KVDE 1Q0YH 2YAFA 1NICA 2EXTA 5EU6E 5GGTH 2YQ2A 2FJFB 4D9QD 4PWHA 3A3YB 1MHEB 1OPOA 5ACLA 4DGIL 1AY1L 3MRNA 2BNUB 1DSYA 4HMCA 1EHKB 3CBKB 2A1WH 1QSFB 4HJGA 5JUEH 3NRFA 5I8OL 4QNPE 1L0YA 3X1GA 1UWYA 1OKEA 3S36X 2YEVB 2WIIA 1KYDA 1AMXA 1UADC 4KPHH 2KZWA 3MACL 5HGBA 3ULVF 1KJ2H 1SOKA 2IWGA 2VWEC 4XC3L 2GSIA 5B1BB 3WBDA 1CN4A 5A16A 5CEXB 3QZWA 2BVQA 1VFBA 4LHUG 2G9HA 3QIUC 3ZTNL 1ZDQA 1DHKA 1NKOA 3I85A 1RZGB 1T89A 1CQKA 3EFDH 3J7HA 2ZF9A 3QDMA 4A55A 1YYLL 1HHGB 2XTJC 1XCWA 2EZ0D 4H8UA 3ZIYA 1X44A 2A99A 4GP4B 2E5EA 3QR0A 3ABGA 3FN0L 3FUFA 4HIEB 1ZA3A 3GBMH 4TMPA 4DN4H 4P9HH 1JHTA 5E51A 3VH8B 4AV0A 1IMHC 1XGYH 3MFGB 1QSEB 2AQTA 3U7WL 2MQGA 1OP4A 4AL8H 3HNTH 3LRSA 25C8H 1ZTXH 4URTB 1A2YB 3UJTH 4CC4A 1NANI 3V4VB 3CSGA 1WITA 2NY0C 4HUWB 4FI7A 3UH8A 1KYOJ 3ZHKA 2FECI 2KZBA 1BG1A 4GBXC 2DM3A 4ZTPH 1U8QB 1BFSA 1JFQH 4L1BA 4OGAD 3HE6A 4WI0B 3VD5A 5J57B 1ID2A 3C08H 2OZ4H 5E2VL 1WZ1L 1IC1A 4LZKA 3HRZC 4NUJA 2ENYA 3V0GA 4EDXA 3ZKND 2FBJL 1T7ZA 1VACB 4DFIA 4WI4A 5D7KD 5KVEH 4AM0B 1AZVA 2DKUA 3O6FA 5K59F 1ZY9A 4IBZA 4DQAA 4YXLH 2JE8A 3MO1B 4LSPL 2XXFA 3AS2A 4V1DA 1YUKB 1UD5A 2UX6A 4Y5VA 4E41A 1BZ8A 5FCUL 2F5AL 2VLLA 5BPPA 2H45A 3TO2A 1B2WH 4EUPA 4PEEA 4NO5A 1S9WA 4A7VA 3QNXB 4HUNB 2AQSA 3S88H 3VFOB 3LHPL 4UT7L 3TEWA 3F7VB 5TDPB 3N41F 4N22A 4U1NB 5FKPA 4PJ5E 4AMWA 1DQTA 1N7ML 2ZKHH 3AB0C 4L48A 1BM3H 4M6AA 4TNVF 1E8ZA 3LH8A 3RWCB 3T3PF 5J13C 3E1ZA 3ARUA 3IF1B 1V54B 5TJWK 3RWDA 3VGGA 5GRUL 5KTEH 1FVDA 5IKCA 3QH3A 4AJ0A 2A9NH 4GP8B 4GW1A 1MRCL 2OYKA 4Z77B 2VZVA 3GJEB 4AQ1C 2APTA 4OLEA 1G7IA 2EDRA 2NSMA 4FG2A 4ONFH 3IN0A 2WKLA 1AIZA 3R7QA 1QMUA 3FW6A 2Z93B 3HNVH 1AG6A 3L4YA 2UWEF 4WW2A 4KK6D 3VDAA 2A2QT 4LL4A 3ZTDC 3KMDA 3DDGA 1A6AA 3GS4A 3IDNA 1JFHA 1NOLA 1OALA 3OKNA 4YE0A 5EO1B 3R0NA 1OSPH 4ZZFA 3H9SB 1KFAL 4X6DB 3J2PA 2JK5B 4QT5A 1CL7L 3GSWB 3ZJAA 3GTNA 5T3ZE 3DVFA 1OD9A 4NT6A 4WFGD 1DQQB 3PHOA 2APBA 2IDSA 4O58H 5KVGE 1KLUA 4FULA 3BJ91 5F0PB 4ZI8A 3ZKXB 5BO1H 2PTTA 2WXQA 3R8BB 4E9RA 4F37K 2A74B 3ME0A 2EVFA 1VEMA 2ZUQB 4GXFA 3WNLA 3WJJC 3KPMA 1UATA 2D3VA 4R4BB 2C9PA 4APQB 2WYHA 3RWHB 2GJ6E 4OJDH 4JFXA 1JXGA 4XP6H 1TU2B 4K5OA 3STLB 1CD9B 3SJVD 1OGPA 2APSA 1OZTG 1EEZA 1X9RA 2Q86B 5K9OB 4XNBA 4L4TB 4TUJA 4KC3B 1QNZL 4R5TA 4ONGH 3CVCA 2Y1AA 5CZRA 5IY5B 1S7WB 4J3VA 1J87A 4U6VL 4ZOEA 5FPIA 2E56A 4HCRL 1WC7B 4JCMA 5FW6A 5I73B 1EXGA 4M6ML 1F4WH 4Y4KC 2LAAA 4JO5A 2LVEA 1AGFB 1UWEH 4GQRA 1WZKA 2DQTH 4WFHD 3JTTA 4BBWA 4GT7A 3KXFA 1FGNH 4WTQA 5H94A 2XV0A 3D05A 5I71C 5D55A 1BDYA 2GBVA 4G70B 4MDRA 2F53D 1OQXA 3U0TA 2BY3A 4YHKL 3P4MB 4G7YL 4LMQE 3BQUA 5LWYL 4I8DA 2KBGA 1TVBB 3UZEC 4YO0A 2QPDB 3IDJA 4FDWA 1JZHA 3DX8A 3EYOA 1EVUA 3GWJA 3MA7B 4N4YB 5HYIA 1BBJB 1YC7A 4FZEL 3V0AC 4GMSL 1L0XA 3UYPA 1QFWM 4Z7OB 3GSNL 4F9PA 4A63A 1PX4A 2YOAA 2YRBA 4AMKH 3C6LA 1YEHH 4J2QA 1S9VB 3VXRE 4PJBF 2ATKB 4D9RD 2VDOH 1FNGB 2Y4SA 3ZX1A 3MV7E 4X9IA 3MOBL 5I15L 1YMMA 1U4EA 4OGQC 4U3SB 1FA4A 4C56B 1RZKH 3PDOA 5F6IB 3QUMB 5TE7H 3RWEA 3WNJA 4OV5B 4PJHE 1QQDB 3OZLA 2XTSA 3P9MA 3ULUH 1JHKL 1TQVA 3WFCL 4PRPD 3BI9X 5JPNA 3U9WA 1WIOA 4GI8A 2PN5A 4ZMYA 1ZLEA 4HA1A 2FWUA 3TTSA 5C2BL 3KJ6L 2BIOA 4A66A 5TH2A 2XIBA 3LN9A 4PRIE 4OLVH 4ZUSB 5TDNA 3KPSE 1JV5A 1G6VK 2WUBL 2HVKA 2OCCB 2XWRA 2AZUA 4L2LA 2EVHA 1NBZB 2OI9C 4OD3H 4IBQA 4HG4J 5D9SB 2TRHA 1D5XB 4M1DH 4RAVB 4Y89A 4YVNA 5DJDA 3O41A 4P5KB 1MW2A 4BQCA 3VW3H 1CXHA 2PYFB 3BXNB 3KLDA 3R1GH 2CO7B 1EJFA 5L8LB 4LLWA 2VYRE 5EBLB 4F2ME 4S1SH 4IBVA 1EAQA 1SDDA 1N2RA 3E6HA 5JHLL 4FXGC 4X8XA 2V2TA 3PHQA 3VXPA 2CG9X 3O3DA 2I7OA 4NC2B 1J8HE 3MRBA 4A04A 4Y88A 1KXTB 1FIGL 3KWWB 2X4RB 1PDKA 2ZOOA 5KYUA 3QIWD 1OAZH 1MQ8A 3MNZB 4JMXA 1KB5L 2VDML 1UXSA 1IGFL 3BKML 2UYLB 4CSSA 3I9GH 1NC2B 1WAPA 2BOCB 2D73A 1FV1A 2AXFB 4HEMA 4LPUA 4MCMA 4CVXB 3N3EA 2NLJA 4KKLD 5HTSA 3SGEH 2BHFA 2OW6A 2CUHA 3AS0A 2BNQA 4PW3A 5K39B 4AYEC 5FB8A 4APXA 3P3UA 3HKFA 4LESA 3ZE1F 5GRJH 1U8CB 4AW4A 3L81A 2F8XC 2WQXA 4R3SA 4UT6L 4DP7X 3O6FD 3KLHD 2PWDA 3HZVA 4WNQA 2X7LB 2JJWA 3MV8A 3QHZL 4M3KB 2N7AA 5EFIA 4WHDA 3MGOA 1RIUL 4XO9A 5FW8A 4S11A 4Q9CA 2K78A 4F8QA 3QZBA 2CK0H 4P46B 2FYYB 5FWRA 2KZ1B 4RGOL 1JNHA 2RR3A 4IEFB 5JIPA 1KTJA 4XNZB 4LIQL 3DX2A 1P5VB 3V95A 2AQQA 5I5IA 4JDVA 4UB0L 3N9GH 3E2HC 4O02L 2HVJA 4HCRA 2AQRA 2KS0A 4EXPX 1WBZB 1MAJA 3OKLA 4L9DA 5CMAA 1MCJA 3PIQB 2QTVA 3LNHA 4PJDE 1B0WA 3ATEA 4U05A 3PRZA 3S37L 4POUB 1OF2B 1I3GL 5FOJA 2VDPB 3RY4A 1PSKL 2H1LM 2DDQH 3ZDWA 1ZCRA 3CFEB 3D9AH 3I2CH 4L2YA 4HOZA 2JKJA 3IS0X 1T03H 3MRRB 4P0DA 3LKNA 3QEUB 4H4NA 1F8TL 3SEPA 4PWEA 3QIBC 1EAJA 1G7MB 4XGZA 3V2AR 3VFUB 3VXQB 3MBEC 4XCFL 1OO2A 4WU7A 2R8SL 1QPXA 2BSRA 3QXTA 4M00A 1MN4A 4ZQTA 3FRUB 1EZUA 3U1SH 2W91A 2PYEB 4ONHA 4Y4HD 4D0DB 5B38A 5FGBA 2ARJQ 5DK3A 4XXDA 1GGTA 5B1CA 1KGIA 2UUDH 3G5VA 4YWGH 1OP5H 2ITCA 4F7CB 5EOTA 3MRMB 2X4NA 1DCLA 1FSKC 1L7TL 2B0SL 3HI5H 3QR1A 15C8L 2W5PA 5IBUB 3KWUA 2WXNA 4PB9L 5LBVA 1R0AH 2BVPB 3PL6C 2JJSC 4P2RA 1F2XK 4PBDA 3G5YA 4RMSA 3BUPA 3V4PL 1S7XA 2KH2B 4RQQB 1MWAH 1IGYA 1FE8L 1TZ8A 4MMZA 1HIMH 1X5GA 2XBZA 1SXSA 1YCSA 2JJTC 3HNSL 2YKKA 1SHWA 5HVWA 3ETSA 5LN8A 4R96B 1OY3B 4QHNB 3RWFA 3FHQA 3VI4E 2N7BA 5IW6A 1XR9B 3Q6GL 1TTGA 1F13A 2IGTA 1COBA 1DVFB 1S7QB 2E7MA 1OE1A 1MUJB 2YAOA 1NFAA 3EYQD 4OCXH 3L3OC 1ZLSH 4YGVA 1VZHA 5ANMB 4MNQD 5D7LE 2OMXB 3CFQA 5IESL 4KUZH 3TT1H 1E9QB 2I60H 3KXFD 4ZW8A 1NCNA 2CXGA 3HC4L 4X98A 1AFVH 1Z9SA 3RL2B 4X80H 1X7SA 3KDMB 5CP3H 1EMTH 1UUSA 2Y2WA 1QLFA 2EDKA 2GAZA 4FHKA 2NYKA 1YA5A 4MXVE 4OLZL 1JRHH 3CHRA 3RDTC 1GW0A 3HS8A 3E7JA 1VDGA 4W9IC 3OZ9L 4GSRA 5SWQB 1BWWA 1KB5A 1MFAH 5AW8B 1GYAA 1YEKL 4KKAC 1F6AB 3V6OC 4DN3H 3IVKA 1HAUA 5DD5L 3EFFB 1QBAA 5LXGH 2QADC 4E36A 1TT6A 2MPAL 4WSKA 1E8XA 2NNAA 1NCCH 4OLXL 3QNYB 5ISZB 2IANB 2R2BB 2F58L 3WL9B 3CLFH 3O6KH 4DP0X 4X9YA 1SVZA 1DVSA 1H8SA 2J21A 1BAFL 4TQEL 4WENB 5J6SA 4M7KL 5BZDB 5A2IH 1E6JL 4JS7A 1X5ZA 4J3OC 4UT6A 4AGPA 4QEGA 5I18L 1QBMH 3RVVC 1VGEH 2WCPA 3V6ZB 3CNKA 4I0KA 4Y4FD 4QXUL 5JLZA 1ZT7A 3KCPA 1H3PL 3AXIA 2AEPL 4K3JL 3PV7A 5I6NA 1A7RL 1ODAA 3F2LA 3FTXA 2O61A 5HYFA 3NN8B 4AIZB 2E75C 2XCMC 5ICXA 1CYWA 5DSCA 1CFSA 1SHMA 2F53E 3APMA 4G6ML 5J12B 1WFMA 1CGVA 2WN3A 2ETWA 5IFJB 1NEZG 5JO5A 1K4DB 4ODSH 2G75B 5JIHA 4N0YH 3WNOA 2VISB 2ICWI 3FQWA 3TBBA 3LZFL 4FLQA 1L9RA 4JN2B 3SIKA 4FGMA 1RULL 1DANT 4MD5A 4E5XB 1XDTT 1UHVA 1IFHH 4XRCB 2ZKWA 5DHDA 2Q7YB 3OQRA 2ZONA 4JY4B 1DSFL 2FX7L 2E0PA 1QSVA 2GSGB 1GA2A 4WJG3 1QVOB 3RI5K 1F4YL 1NGWB 3UDWA 4HJEA 1J1XH 1NH6A 3AACA 5E9DE 3ILDA 1VCBC 4RFOL 4UIKL 5ALCL 4CVWA 3HUJF 1EEQA 2PUQT 5IROD 3NYKA 4POYA 1SDAB 1ZVSA 1W72B 4OTXH 4OZHB 1E5CA 1VAHA 1MXGA 3T6ZA 1RZ8A 4W9ZA 2C3VA 3PABA 3TBWB 3B7SA 1FAIL 4N2CA 4Q97A 1DJWA 2DI8A 4J8RB 3V4PA 1AC0A 3GBEA 1PZBA 3AABA 4JRYD 4PRBA 4MRBA 3LB6C 1ND0A 1C9SA 3QDME 4TSAH 4XX1G 4N2KA 3BP4A 3ULSA 1M71B 2PO6D 1TKWA 3ERXA 3EOAB 2Q8BL 3QQ9D 4XMXA 4LU5H 5JOFB 4CMMA 4WCYH 1ZSHA 3QIUB 3FT0A 4XP5L 5FECA 2FEJA 5PCYA 1UUNA 2OL3B 3PWVB 5E9NA 2K8MA 4LDEB 2XTJB 2Z7ZA 2KL6A 1MZZA 3D4ZA 3K80A 5B1JA 2EINB 4A37A 1EAOA 4MNQB 3B9EA 1A7PL 2XXMB 4LSQH 1EGJL 4F8OA 2W60A 3VTTA 4ZZKA 3V0EA 3GUTA 2E7BA 2ZWKA 4LOUC 5B8CC 2MH4A 4GB9A 1JBJA 4FI6A 3GB7B 4IDJH 1F3JA 5AKVA 5K1VA 4P04A 4YDJB 5F7HA 1Y0LA 4ZQKB 1MJ8L 2BJML 3UERA 1ZJAA 2NY0B 1IBDA 1I53A 1CZ8L 1ZV5A 2YAHA 4I3SL 1V7ML 5JW4N 3BN9C 3FU5A 4BUHA 4XWOC 4F5CA 1UZ6F 2AQ1A 4GBXB 5F72S 3KGRA 1MJUH 3L3IB 1KJ3H 4K9EL 2Y24A 1PY9A 4M9OA 4MYPA 2QHRL 2EDTA 4I4WA 4LFHG 5DJZA 4IIQB 1SEBA 4JFHE 4MASA 1NBVH 2OXHB 2X53A 2ZXBA 3DJTA 3HRZB 1NANH 4V1DE 3L9RA 2KDYA 4XCEA 1LO5A 4HKZA 4CW1A 4E41E 1UB5B 4W9KC 1NCDL 2YXWA 2SEBA 4AQ8A 1UACL 5GRYA 1IQDA 5E8PA 5CN3A 2G3MA 1KLFB 3FO9B 1A6TA 2P5EA 3ABZA 3FFOA 2PPDA 1CURA 3GMRB 3MGTA 1O7VA 2LLNA 5E6IC 5G2NA 3KNBB 2HG5B 4QJ4B 1V7NH 2ZG1A 5IW1B 3UZQA 5FR3A 3N04A 1JYWA 4LPCA 1WT5A 2VJ8A 4JO4H 2D7TL 5DJ8B 4CU7A 2NUPB 1DBJH 2EDQA 3EO1A 1ZSDA 1ZA6A 4KX7A 4KXAA 3OKOA 5E5MA 1MI5A 3SOBL 4K3EL 2OSXA 1A5FL 1I7ZB 2DYPB 3UOAB 3BH8B 1CR9L 1RK7A 1XF4A 2JV6A 4JAMA 2QV2A 3AB0B 1WPCA 3VXUB 3ZDZE 3BUIA 1P6AB 2L7JA 3CFDB 3HAEA 5D6DC 4KKZA 4A2MA 3ZUNC 2GHZA 5J13B 2F74B 4XWGL 5SWSE 4BA8A 2PTUA 3ZKQD 1IBGH 2E6JA 1TJXA 4D8PA 3NIGF 2H47C 4H8WC 1ACCA 4AQ1B 5FFLA 3T2NL 2LV4A 2I9TA 1S9XB 1H15A 1BQHG 4TVPL 1ZT4B 1BD2B 3LEYL 4URKA 2MOVA 4U1KB 1MAKA 4WZ9A 1A0QL 1FZOB 5IQ7H 5A6MA 1U2CA 4F58L 3H2PA 1X5FA 2FWOB 1ZOXA 4G2AA 4GSQA 5E8OA 4R9HA 3RVXC 1G7PA 2VXQH 2ZUYA 3U4EB 4JFVA 1WLHA 3ECWA 1NOFA 5GSVB 2D7MA 1JSYA 2Z31A 4HSAC 1WD9A 4DF9A 3PFQA 2HJLA 4WI8A 1TQSA 4YBLC 2ZXGA 1VEPA 2HTLD 4JFPB 1ZE3H 5D72L 1O7DE 4O2FB 3O3BA 4FCAA 1YN7B 3RP1A 3JSSA 5GGQH 3DX7B 2XWBB 4N0UA 4UQAA 3AY2A 1N6QH 1LNUB 3WTWA 4IOFC 3P0VH 4LNVA 4WO4A 1A4CA 2ZYIA 1NZRA 1HSBB 2YD5A 3IFPB 2QSVA 2DBLH 3PNWB 3P0YH 2VR4A 4L5FH 2DMCA 2LAGB 3L3HA 1I8KA 2RAMA 3DARA 4OJEH 4ZUTA 3EBGA 5DMKA 2EVIA 1U3YA 2Z7WA 1SXNA 3U25A 2NXZD 4KTYA 3UC0L 2X4QB 2YAPA 3FC8A 1UWFA 1ZGLP 1LO0L 1CD8A 2P8MB 5DRWB 2VZTA 4JR9L 2G30A 1ZLVH 4ISVB 1T0PB 4ELKB 4Y4KB 1Q90A 3PP3K 2OSLA 4MX7B 4ZXBD 5KAQF 3EAKA 4U3XA 4XMTA 4HAFA 3F05A 1JGUL 4UINL 3MKGA 4EOWH 5T5NG 3V4VL 1EGJA 3V0WH 5I71B 3EBAA 4QOKB 2FO4B 2ZX7A 4GAGL 2VDRH 1YEDB 4DETA 3TBSB 4NQVA 1EXHA 1DJIA 1GRWA 3KLAA 1P5UC 5FIEA 2BMKB 3L5WA 2I5YH 3QFJB 4OZ4A 2WWKO 2ZG3A 2IPTH 4U6YB 4EIBA 3BYTA 4KK8D 4H20H 5E1AA 2KZKA 4G8EA 1YMME 1PQZA 1KCSH 2XA3A 3GSXA 3OB8A 4B6ZA 3LVTA 3QWRD 4DP5X 4LPTA 1UFUA 2ZUVA 1RZFH 3FF8A 3SE4C 2C9VA 4HVBA 3GXIA 3RY5A 3TP4A 5MHSD 4Q9QH 1XZ0A 4MA7L 2J4WL 5K59E 2CGYA 4PV1C 2XFXB 4GW4B 1G0YR 4S1RH 5EU3B 2AZAA 2WO2B 3B9KD 5HHOB 1WWBX 3WNNA 1OAQL 1OL0A 1WWAX 4PRDA 4LEEA 3SDDA 3W1ZA 2WVUA 4GAFB 4P06A 1YY8A 3BN3B 4YIQA 5BVPL 3UEQA 1RPUA 2YRLA 1H8LA 1AQHA 3MC0A 1MHPL 3OMNB 3BPCB 4FTVA 2YA2A 5F7MC 3S34H 2OFQA 1A4JA 1SHSA 2EDJA 3STBA 3QUYC 4AUJA 5DD6B 1SRDA 2Y7LA 5BZXA 4GRWH 3T3PE 3CSFA 2OI9B 2WOBA 4PWFA 4KGLA 5EHFA 5GS0L 2A9DA 3HPJA 3UBHA 4GYBA 4NZTH 1U3NA 2J7LA 5JYMA 4W70A 3ETBJ 1ACXA 1LDPL 2D0GA 3IFLH 3LPFA 1C5BH 5EN2A 4AC4A 5F9JB 4YPJA 1YEGL 1LGVA 1TZGL 3NDZE 1H5BC 5CCHE 4FXGB 4IRSD 5GS3A 1V3MA 1ICTA 2WWNA 1UKQA 4NENB 2FO1A 1S3KL 4HEME 2UWEE 3A24A 3AXLB 4I0CC 1AGBA 2WWOA 5AOLA 3OXSB 3GIZL 2NCMA 2BNQE 2D3NA 2F0CA 4X0KA 2FJFA 4OFKA 1PX8A 4JJHA 2MQCA 1MHEA 2IG2H 3IPEA 3ZMEA 3TCTA 2BNUA 5C07B 4GH7B 5LG1A 5F1IB 4HH9B 3VXSA 4KI5D 1AMYA 4LMQI 3MV8E 1N5YH 2YHGA 4YQXH 2FJHA 1XH3A 4XN8A 5JOPD 2KMWA 1ZK9A 5IT2L 2QLYA 5E2TH 4YR6B 5EB9A 2AK1H 1SYSB 3NEXA 1MW3A 3F7PC 3QQNA 5E99L 4PGJA 3ZSTA 4RNRB 3LKRB 4QY8B 2W0PA 2P26A 3GINA 3OKKB 2R1XB 2VMJA 1L7IL 5CEXA 5E70A 1IBFA 2AJSH 4PJ8A 4Q89A 1SMDA 3MRDB 5D71L 5B22A 2YEZB 1HHGA 2VO8A 2IMNA 1CF8H 1DUYB 3WKMH 1MCNA 3G6DH 4TM9A 5IMMB 3ZHLA 1ADQH 4J1UB 5FC9A 3E2HB 1WCQA 4JFZH 3BKYH 4HIEA 3C5SB 4OLUL 2CJTA 1CMOA 1J5OL 3MNWB 3IJYB 3PQYD 1G84A 2NY4C 3FHAA 4ZXBB 3V0JA 1A3LH 3GZOA 1DO5A 3D0VA 1U8JB 4ZFGL 3O4LB 1PLCA 3V4VA 1DEDA 4HBCL 5DK0B 4CNIB 4Z7OF 2AJUH 3P3RA 4B9CA 1WTGT 4OI9A 1VADB 4HXAL 4J27A 4YLBA 1PX3A 4Y16C 1H3TA 1LM8V 5DVNA 5A1AA 4XB7A 1LQBC 3CLEL 4WI0A 2LU7A 5FYLL 3QIBB 4LLAA 2MNWA 2MTAA 4FYSA 4L29B 3MBEB 4OGXL 1CCZA 1GZHA 1NLDL 2PMZA 5TE6L 5F7YC 3JWOC 1SZNA 3G04B 1MDTA 4GFXA 5D2NC 1MFUA 4N9OB 4P2RE 4WQOA 5D7HA 1IKOP 1QLRA 2A4CA 2E9JA 4HT1H 2YZ8A 3QUML 4JG0H 3ZL1A 1D2PA 4AM0A 3KLKA 3WN6A 3B7RL 4UTCA 1VSCA 1OCOB 1ZEAH 2AAAA 1FSKB 3GJFH 4GKSA 1P7QA 4QXTA 2X6UA 3MO1A 4HPYH 2NZ1A 1D7CA 1YNTB 5IF0A 4PJFF 3PL6B 1FH5L 2NTFA 1AGEB 2ATPB 4WO4D 4JJOA 3K5RA 2EIMB 2KPWA 3MCLL 3R19A 1NWOA 2FYVA 2ZSVA 4KK9D 3W0WE 5BO0D 3CCHA 3QNXA 4B0MM 1U6AL 2G2PA 8FABB 3VFOA 1HZHL 1C5DA 4HEPG 2VMFA 2R0WL 4U1NA 5IEHB 4BUQA 3SDCC 5DHVH 3IWVA 3B56A 3P2BA 4HKXB 4NUGL 1EZLA 4UTBL 1CVSC 2IGFH 1QZ1A 3IN2A 1UM5L 3U36B 3KLLA 3QXDB 1M6UA 3CU7A 7FABL 1QKZH 2TSBA 4PYHA 3QJHA 1ZGLB 1SUHA 3TCLB 5SV4A 5DTFB 4O9HH 4GSDH 1DBMH 1TOXA 1G9MH 5MEND 4Z77A 3L3OB 3GJEA 1HJCA 1I9EA 3SGKC 5J9PA 4ZK8A 3VFPB 4NKDB 1WFTA 5DS1A 4PJEB 2BS9A 1CU4H 2NYZA 4EZKA 3S6CA 4XNDA 2XZQH 4PLNC 4Y0GA 5C0GB 1S7VB 1G7LB 3DYPA 3K2KA 5A3ID 2NT1A 1OE2A 4CN1A 2NUTA 3H6JA 4WNSA 2C3GA 3ECBA 4Y2DD 1FNSL 2P44B 4KVCH 5H4YA 3EJPA 3V0VA 5BNXD 3TU6A 3MU3A 1WICA 3RDTB 5MP6L 2MCMA 5EO1A 5INCB 1G7JB 3L1EA 3VFVA 3H9SA 4PSPA 4G5AA 4X6DA 4UOZA 1GL4B 1EAPB 3P4NA 4L3AA 4G9DB 3W2DL 5BS0E 3GSWA 2EXWC 1VLXA 3QJSB 4XVSL 3DJZA 2ICEC 3G6AA 3NSXA 2QADB 2NNXA 5GGUA 1JXFA 2HX7A 3U4KA 2ENSA 3CFKB 4AKQA 1WTLA 2F7PA 1H3GA 2A74A 3F5WB 3U9PL 1UA3A 4KXCA 3Q5TA 2PW1B 5IMOB 3BZFB 4G8AC 1GGBH 1U2YA 2QPFA 4R4BA 1LE9A 3STLA 3FB8A 4QHKJ 4ZDHB 1TU2A 1GXEA 1FBIH 3VG9C 4HPHA 1R3KB 3OKDB 3SDDD 5K9OA 1M56B 4B7IA 1B2YA 1KGWA 1B0IA 4Z23A 2HLEB 1AZRA 2XPYA 3E8UL 4L1HA 4LIQE 4I48B 1AYOA 4IRJD 4FTVD 3RU8L 2VZ1A 1A6WL 2CUAA 3MJWA 1S7WA 4NN7C 2OQJB 4JFEB 1GYUA 1RSFA 1MCWW 5FLVA 1MW0A 2BVTA 4HFUH 1YRKA 4KO9A 4ODTL 4OSUL 4U49A 3WS6A 1KB3A 2MCAA 3MODL 3QZWG 4HDIB 3M86A 3CN1A 4HZLB 5D1QE 4OZIA 2VABA 1KBPA 2GUOB 2NY6D 1QHPA 3VFWB 3UAJC 2VDPL 2NNRA 1CDYA 2PWFA 3I6GA 3E1F1 3KEHA 4PRAB 4C58B 2ORBH 1DBAL 3OD3A 1ETB1 1DLFH 4HIXL 2O5YL 3A4FA 4GRLC 4UOW1 3WTUA 4M29A 1TVBA 4IRZH 4OFYD 4JHVA 4I89A 4EJ1C 2P24A 2LLGA 1I75A 2XT1B 4LSSL 1NIAA 5K69A 4ZNEA 5E2UL 1CDJA 3V0DA 3ZE2B 3L5JA 3NUKA 2EC9U 1WSST 3KYMA 4HC1H 5DRNB 4GXUM 3IRPX 4O5LH 3QCUL 1S9VA 5HGAA 2CUMA 3V55A 1FNGA 2E8ZA 2YC1A 4G7RB 4QO1B 1XIWD 2DQUL 3VXSD 4BM7A 1GMEA 3UYRL 2IH9A 4U3SA 2DMGA 4C56A 4N68A 5CZVH 3DSFL 5GZND 1TETL 1GSMA 3QUMA 3S0PA 5C0EA 3HZKB 4LCIL 4EMZA 4OV5A 1QQDA 2H6UA 5IB1B 1OCWL 1PG7W 5LDSA 2X9XA 3TF7C 3TH3T 3CXDH 5DI8A 1IAIM 1I4FB 4HAGA 1AGDB 4PJ8D 3WFEL 3NQKA 4ZUSA 3Q13A 4JQVA 5ID0A 4YX2L 3WTSA 3AMKA 2HWZL 4WFFE 1NBZA 1S7UA 3S5LB 5D9SA 1L9OA 1R6VA 2ED8A 2EUWA 3RTQA 5CD5D 1R19A 1U8IB 2PYFA 3BXNA 4UTBA 5EBLA 5C0RH 2XJLA 1NCHA 3MSPA 2DM7A 4D0BB 1R3IH 2YK1L 2J56A 2B1HH 5F88A 4M02A 3CZSA 1RZJH 2HCZX 4UQDA 1ETZB 4NQEB 3GXTA 1KXTA 2YBGA 3KWWA 3DBXA 1KBGL 1IC4H 5B8CB 4F5CE 1N67A 1I31A 3T04D 3MNZA 3V0HA 6FABH 1SMAA 4DPAX 3ML9A 1ZHLB 1F90H 4HETA 4ZX3A 2UYLA 2ZE0A 2OLDA 4BCYA 2BOCA 2RBLA 2AXFA 2C1OB 2C4FT 4CVXA 5AZ2L 3NZ8B 3BUTA 5E2WL 5C70A 5IFAL 4G8GB 4E0RB 2AQ2A 3DJSA 4JO8A 3TNNB 4PR5A 5D7JC 2IFGA 3ZE0B 1U8CA 2P5EE 1G94A 1JD7A 1TLMA 1IGJB 2WINA 5F9OL 3GSUA 2DQHH 2CHZA 2JJUA 2X7LA 4YBQD 3RIFF 1P7HL 3VX1A 4PJGA 3SYOA 2VGLM 1P7QD 4PU2A 2WD0A 2QL1A 4EN3C 2RQEA 3AADB 3K2UH 2R29A 2QHLA 4W6XB 4K3HA 4AUYA 3BSGA 4P46A 2PR4H 2ED9A 1MI5E 1QG3A 4PD4J 5DUPL 5E6IB 1QOKA 1T04A 5D7SH 1XMEB 2DQCL 1P5VA 1Z9PA 5AB2A 1RIHL 1A6UL 2R56H 1KN2L 3HA0A 5I0XA 2DQDH 1PLAA 2NY1C 5F7DA 2VUYA 2NY3D 2PWHA 5B7FA 3PV6A 4HUVB 3WELA 1IQWL 3SQOH 2ZCZA 3BMVA 5KVDH 1JV2B 3UTZA 4EZMA 3RVUC 1OM3L 2W9DL 4XCNA 1E4WL 3FTZA 2G4GA 3Q43A 2CIKB 2J1WA 2BCKA 2ZZUT 4NRXA 5AW9B 4YXHL 1CICC 1EDYA 2APWA 3TV8A 4QJ3B 5F0JB 2VR5A 3K6NA 3CFEA 3AAZB 3TXAA 3U0PB 1ZS2A 3VWJD 5A40E 3LNIA 3MRRA 5CBEA 4G8IB 2E27L 4OF3A 1JZ8A 1KENL 1VRSA 1NSNL 2A6KB 1G7MA 1LK3H 3VXQA 8CGTA 2DTMH 4RGNE 3LZLA 5CGBA 4EI0A 4OZHF 4OCYL 3H3BC 1A25A 4KV5E 2NQ3A 1I8UA 3GI8L 1ZLWK 1WZAA 2QQQA 5B4MD 4D0DA 2WC7A 4ZG1A 1W72L 5DFTA 2Y5EA 4JCLA 2UV3A 3HUJE 4P9ML 4KHTL 5JHMA 3G6JF 4K7PL 5LDUA 2W81C 3RVTC 2ODHA 1A3RH 4FQHB 4N0UE 4U1MA 3LPOA 2BVPA 3OHXC 2WB7A 5AB1A 5HYEA 4QTHB 2VAAB 4YBLB 3IAPA 3A4AA 1JGLH 2CDGB 4RQQA 3PAUA 2XPGB 5BUGA 5J4MA 3ZYZA 1N5AB 1EVTC 1KTRL 2IVFC 4MXWH 4XAKE 4XNMA 3MBWB 5EU4B 1SEQH 3P40A 1QRNB 5CD3A 4X5RA 1PZ2A 4J7RA 3EBIA 4S1QH 4GG6B 4NP4H 4R96A 2A3TA 2JKLA 3RG1C 2OL3L 3UPAA 5D2LA 3KH4A 5GZOC 4X9GA 2ZSWA 3UBGA 5CJXA 1S7QA 2DM4A 4FXLA 4LAQL 4LASL 1T5WB 1ULVA 3MLYL 2YR3A 1JNNL 4WUKH 2OMXA 3OQ3B 1URIA 4MAYC 1P4LB 2RGSA 5G4OA 5KS9B 4WK2B 2OMTA 2VLRE 4PGZA 1NFKA 1X4XA 4JHWL 2R0ZH 3RL1B 3N42B 1DN2A 1TITA 3UTTD 4ERSH 3RUGB 2K6ZA 1JCVA 2A4EA 1UXWB 3ZL4L 2J73A 2Z34A 1HEHC 1N19A 4NM4H 4QLRA 4ZMXA 3VDBA 3WFHB 3IDMB 3HEIB 3IYLW 1MCEA 3NIFF 4A7UA 5EORL 4I0PD 1JDAA 3ARQA 5SWQA 1WAEA 3N0AA 5DF0A 4RA3A 2O6PA 3TO4C 5IBLD 5T1MA 4EBQH 1P5UB 3ARDA 4XNUL 1KCVH 5FHAL 3A6OA 3EFFA 4OQ1A 2V6HA 4JKNA 2VRKA 1Z32X 1ZVNA 5AKSA 1H19A 3WEAA 4UOW0 3QNYA 1PZSA 4PJAA 5ISZA 3PE9A 3WL9A 4FS0A 2AV7B 3KPOB 4NWTL 4JKWA 4P3DB 5DGRA 2NYYD 5BZDA 1OTSC 3NQIA 4NQCA 4NKQB 1MIMH 4BK5C 2DQJH 5D7EA 3V6ZA 1Q9LB 1OPGH 3H56A 2J72A 5I1CH 4XPFL 1OAUL 2Z35B 4KVNL 2X89D 2VN7A 5EZIH 3QQ3A 5LGHH 2E59A 3ARXA 1SQMA 4XHJC 1BJ8A 3T09A 2BXYA 4PY7B 1XSJA 5T33H 2WXHA 3FQ2A 2WTPA 1C08A 3NN8A 3PP4H 1AZBA 1F56A 3IKCB 4KRNA 5GISL 3RTQD 1XCQB 1PKOA 1HVXA 7TAAA 2DKSA 3QUYB 4HUUB 3EF4A 5F3FA 4JANB 3L5HA 5AWNH 3U4BL 1K4DA 5IFJA 2KDGA 1KT2A 1DQMH 2XZZA 2VISA 4U6XB 5KBLA 5JW3L 3NCJH 4NHUB 5T3ZH 4ILDA 4TVPE 4ZMQA 3N1PC 3A23A 3NIGE 3FOLB 3SBWC 4WEUD 4BSJA 5KVGH 2X4OB 4LGSB 3S7GA 2AJVH 4JZJC 4LQFL 4XRCA 3SKUD 1JPSH 2IFFH 3T0BA 4XH2B 1H5BB 1QABA 3DLQR 5KSBB 2IF7A 3HZMB 2GSGA 3T65A 3JWDC 1QVOA 4YSCA 3T1FB 1NIDA 2HXAA 4NXSA 3VXSE 1QSFE 1HQRB 3LRLA 3VQ1C 1GW6A 3IT8D 1Q1PA 3X1FA 3QQDB 1KPVA 4B5ZA 3PY9A 1HHHB 3BDYH 3SY6A 2BIHA 1U4FA 4TTGA 2EUXA 1W72A 1I85C 3CBJB 1QHQA 2DWXA 3NPZB 3DX6A 5H2BA 2RFXB 3IMVA 2HT2D 3IGLA 2K70A 2QPUA 4LP5A 3TBWA 2BFVL 5GGTA 5B38G 4LP4A 1CQYA 2Z65C 5CLTA 5HI4D 1VFAA 2M1KA 3LSOB 4NEHB 4W9HC 2JB5L 5D96C 2J88L 5G5DA 4MD0B 2Z6FA 5I2IB 1E4HA 4IMLA 3SBPA 1KDIA 1AHWC 2XQBH 3JWNC 4YAQA 4WUUB 3MLZL 1M71A 3IS1X 4N5UA 1NCBL 1RKRA 2X1XR 4X6CB 1FH2A 1TCMA 5IB3B 1VPOL 3NVQA 3IGAA 3QIUA 3K6SB 2OL3A 1CDIA 3CHOA 1X5MA 5EA0H 4C4BA 3KJ4C 2ZUSA 2QR0B 4KZ0A 4H13C 5ILTL 4XPHH 2CLVA 4BQ8A 5J6HB 1INEL 3CFUA 2EIZB 1T80A 4X4YB 3NEOA 1TTFA 1ZXKA 1FF5A 2WP3T 2FD6L 3ATFA 3VMOA 4RIRA 3K4DA 3L3GB 5KW9L 2NY4B 3GB7A 1FN4B 5IBTH 4OIIH 4B5EA 4IIZA 2MCG1 3TF4A 1EPFA 2K9UA 2H9GA 1ORQB 4ODHH 2AK4B 3UEZA 1I7RB 3ARZA 3L3IA 2IAMA 4MQ7B 4Y16B 2QSCL 1XD0A 3K71B 3QGVA 2DWDA 4ODVH 3NBNA 2VC2H 3TYGH 2CGZA 3WXWH 1BJ1J 1MRFL 4UNUA 5IVNA 1J0KA 2OXHA 3ARFA 2YJLA 3PDGA 1PIGA 5E8NB 2VMDA 4H8HA 5D2NB 3WE6B 2EEXA 5A2BA 4KY1H 1IBZA 1BXVA 1CLVA 3ZL2A 1KG0B 4KNTA 3CWGA 3GMRA 4HLJA 1CL7I 1T1ZA 4JKKA 5F6HJ 2WBXA 5IW1A 2GEEA 1TEFA 1RZKC 3BE1L 3PWLB 4YSQA 3HJ0A 4BKLA 4JB9H 2BVEA 4QKTA 4PQXA 3OHMB 1I8AA 3VSUA 2NUPA 5JIIA 5ALBL 1OWRM 4TSCH 1MG2C 3VXMB 2X28A 5TGBB 3FAXA 1I7ZA 2DYPA 1I82A 2PCFA 1L0PA 3BH8A 4PGBB 3SDCB 3AFLA 5F9WC 5H35B 3T8XA 4QTIH 3CDYA 1A14H 3VXUA 5C0DB 3ESUF 3S4SG 1Z3RA 1WE5A 4QRRB 2F74A 4B50A 1DFBH 3ET9F 5F93C 2NY2C 4YH6A 5AZEH 3WNKA 1RI8A 4XX5A 1AH1A 1N0XL 5F3HB 7CGTA 4OCRL 3M8OH 1ZT4A 1BD2A 5DMYA 2HSIA 4U1KA 1FZOA 5IGXH 3H9SE 3W9DA 1BVLB 2WXRA 4X6DE 1OGAD 3TGXA 2VW4A 1CGTA 3NJXA 2IDFA 2IPUK 4PV9B 3UIZA 3U48A 5C0CA 2BW4A 4LO9A 4GUOA 3MYZA 1WRFA 5F8QC 3UGUA 4P3WA 4BSVA 1B88A 3ARDD 4JM0A 2Y06L 3RAJH 4JPWH 5CJ8A 5FV2A 35C8H 1PZ5B 2EH8H 4YSSA 3Q2CA 5EBWB 4PJ7B 1P7KA 2GTQA 1UOWA 3FRPB 4BRJA 5F6HI 2ICEB 4DK3A 2VERA 4NQCD 3BP6B 1JTPA 4PGEB 2HKHH 1RL1A 2WLIA 1VESA 3DX7A 2XWBA 3P30H 1LNUA 4FHBD 3OZKA 3FUJA 3WJJA 5E08L 4OD2A 1A1OA 3GSOB 4UQ9A 3WG7B 1HSBA 2VDKB 3VB9A 2QPSA 4CVUA 3PNWA 3D7PA 3VG9B 2EH7L 1KEGL 3TVMC 4WDIB 4NQXA 3EOTL 2IEPA 4NGHH 3K2IA 3JTSA 3ROLA 4OZIE 3AROA 4KO6A 2X4QA 2YD0A 3A6CL 1YY9C 3VI3A 1MNUH 2PABA 4QTFA 1T7WA 2VMCA 4ISVA 1IT9H 4KMTH 5DLLA 4ELKA 5CF3A 5FKAA 4FJZA 2W0LA 3F85A 5L9DH 1HEJC 4FNLH 4Z6AT 1JXDA 1A6VH 2D7OA 2JTYA 2WBJA 1UENA 3PAVA 4RDQG 3CUPB 1A1MB 2PNDA 1EDQA 4ZNEE 3D85D 4DGWC 3TBSA 4JO1H 4F57L 5HY9B 4IHOA 2W9LA 1S9YB 4GRLB 4HIJB 2BMKA 3LQZB 5FYLE 3UZEA 3QFJA 5ABAA 5AVZB 2BSEA 3DHUA 3EO9H 1EFXB 5TFSL 2Q8AL 3O3EB 1WBYB 4U6YA 5F7AA 1A02N 1MFEL 2VMEA 4X6BB 4BE6A 4C56E 3H3PH 4ANKA 5IJVB 5IEKA 2YUVA 3FQRB 4TPRL 4UYQA 1IL1A 5AVXB 3W5NA 4LLMB 4CDGC 1YNTF 4YEEA 1N3NB 3MRFA 2ZWNA 3SPVB 3GLEA 3ZZQA 2A73A 3I9AA 4CC0A 1FZMB 1MJ7H 4GQZA 5DZ9A 1HT6A 3NCCB 4TUKL 1OSYA 2F61A 3EJYC 3MTRA 3B7UX 2VLKA 5EU3A 3GSRB 1W0WB 3MRPB 4HPOL 2GBTA 1UCTA 4FZ8H 3MYJB 3UPRB 4BFIB 2XACC 1EJOH 1ZV2A 3ZR6A 3U2SB 2AV1A 4B9KC 1NQBA 1E43A 1CC3A 4KRPC 1GMIA 3BPCA 1NWPA 3FAWA 4HJUA 3X11B 1I3UA 3P73A 4Q0XL 5DHXB 1SM3L 2WCGA 2NNCA 2BSBA 4G1EB 2IIJA 4ZTOL 1EUUA 4ETQB 3TWCL 5KZCB 4MJ4A 3HE7C 4P2QB 4PPTA 1BX2B 4Y19A 3D39B 2X87A 3HTLX 4FQ1H 1ASPA 4PJEF 2LU5A 2K45A 4QAWA 1MWOA 1UCBL 1F2QA 4H2AA 3NJGA 1UKTA 4EO5A 4JFOB 2BVOA 4OAWB 4Q2ZB 3WNMA 2VN4A 2FCBA 1BCIA 1T6BX 2DWYA 4XO8A 5SX5H 2VXTH 4YSPA 1PNDA 4OFVA 1TDQA 4NENA 5TQ0L 5HPOA