3QQXA

Reduced native intermediate of the multicopper oxidase cueo
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
494
structure length
474
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHDDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 140
structure length 474
sequence length 494
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA03
4G7QB 2J57A 4BWWA 1JZJA 2PPFA 5LDUA 1MZZA 4G70B 4YL4A 2IWKA 5B7MA 3FSVA 7PAZA 1MZYA 4E9WA 2ZOOA 1IKOP 2I7SA 3NSCA 3WKPA 4E9XA 2N0MA 2YAPA 5ANHA 2P80A 1SFDA 2IDQA 2VW7A 3WG7B 2HX8A 2JFCA 3X2QB 3S3CB 3ZBMA 4X4KA 2QPDB 2FWLB 4DP5X 3N55A 5B3SB 3PAZA 1X9UA 1ILUA 3AG4B 1SF5A 4AX3A 3QJVB 2HRHA 1NIDA 1PZBA 4KO6A 2I7OA 3FS9A 4NERA 3AG3B 1A65A 4F2EA 2BWDA 4G72B 1E5ZA 2XV3A 5B1AB 4DP6X 2WSDA 3FT0A 1F56A 1PNCA 2JKWA 1HAWA 3IEAA 3PCYA 3AY2A 2QDWA 2FQFA 3NJHA 5D4JA 1AAJA 4AKQA 2QT6A 3PXLA 3CVCA 2PPEA 4YSUA 2Q9OA 1QHQA 3FU7A 2VM4A 3T6ZA 3NSFA 2GB2A 3NJNA 2DYRB 4KO9A 1WA2X 1HFUA 3QJTB 2BP8A 1AZRA 4YSTA 1AOZA 2BP8B 3WNIA 1J9QA 3X1NA 2GBAA 2J5WA 3TU6A 2CJ3A 3H4FA 5B1KA 1GY2A 2PCFA 2PPCA 2GI0A 3EH3B 1AANA 2XYBA 1GSKA 1TU2A 2BZ7A 1JXGA 3S8GB 3IBOA 5A7EA 1KDJA 1ET8A 3FYIB 4W9ZA 4F7KA 2PCYA 5I5JA 3OMAB 4E9VA 1GS8A 3ZIYA 2Y1AA 4UANA 1N68A 3X1BA 4E9TA 1AS7A 1GW0A 2QPEB 5AFAA 3V9CA 5PCYA 1FWXA 2QDVA 2YARA 2YAHA 3FQ2A 4TXVB 1J5DA 2WO3B 2YAFA 3JT2A 2XWZA 1MG3C 3EF4A 5TK2A 2EIKB 4YSEA 1AZUA 3AZUA 4CSZA 2XXFA 2BO0A 3T71A 1SHXA 1ZV2A 2HXAA 1PCSA 1TEFA 3PLYA 4GP8B 1N70A 2X87A 2XV0A 2FJSA 1ZDSA 2FNWA 1CYXA 4KNUA 3X1GA 1QLEB 2FT7A 3NJFA 1KBVA 1BEXA 3AG1B 3EH4B 3ABKB 5AKRA 4ENZA 3QJQB 3NSYA 4DPBX 1XB8A 5B1JC 4KNTA 1AG6A 2LLNA 3FSWA 2YAOA 5I6KA 5F7AA 4M3HA 1JZFA 4G71B 3CDZB 1V10A 3JTBA 2EILB 3NT0A 4KO5A 1V54B 3OQRA 2GHZA 1KCWA 4N4YB 1ET5A 3DTUB 2FT6A 2YAEA 4YSDA 1ADWA 2GC7C 4HCFA 4BK5C 1EHKB 3HB3B 1PNDA 1NIAA 1OOWA 2IDFA 2VW4A 3KW7A 2FQEA 2AANA 3AG2B 2IWEA 4E9QA 4DP2X 3UAEA 2GC4C 3NJMA 1L9PA 4P5SA 1IC0A 1J9SA 1E65A 3T6VA 1IBYA 1A4CA 2XLLA 2XUWA 5FC9A 3SBPA 2IWFA 2EINB 4Q8BA 2VMJA 3X1EA 2DYSB 4FAAB 4QLWA 4DPAX 1CUOA 2PP9A 3OD3A 2BW4A 2AFNA 4YSSA 4HAKA 2IH9A 5AZUA 1AZCA 2BHFA 4ZK8A 2B08A 1OV8A 2UXVA 5E9NA 2GSMB 1NTDA 1TKWA 1IUZA 2XX1A 3UACA 1J9RA 4HCIA 4A68A 4GY4A 5I5MA 1PLAA 2AVFA 3NSDA 2HRGA 1AACA 1PLBA 4KOCA 4DP7X 2EIJB 4CSPA 3PAVA 2DWSA 4FA7B 2YAQA 2HX7A 1NINA 4DP0X 1GS7A 4JHUA 1PAZA 1SFHA 2OJ1A 4YSPA 1DYZA 5B1BB 4GP5B 1FA4A 1WAEA 3TASA 3EH5B 2RACA 1PZAA 2PP7A 4GXFA 4L0PB 4PCYA 3RYMA 8PAZA 5TK4A 3NJKA 3WKQA 2FQDA 2DWTA 1GY1A 1A4BA 3OM3B 4DP8X 2H3XC 3CVBA 1NZRA 4PAZA 1BYPA 4BXSV 2BP0B 3SQRA 4RH4A 3FU8A 2CBPA 3C75A 3IN2A 3S8FB 1AIZA 2HLEB 4AKOA 4UAHA 4DP1X 2OCCB 4YVNA 1MDAA 4G7RB 1WA0X 4Q89A 3D12B 3PAUA 4K9JA 2PLTA 3L45A 3IE9A 3KW8A 7PCYA 2FTAA 1PF3A 2H5UA 3H56A 2XV2A 2IAAC 1OE3A 3FU7B 1L9QA 4AZUA 1T5KA 4MFHA 4E9RA 2CUAA 1DZ0A 1RZQA 4A2HA 3GYRA 1M9WA 4EF3A 2PPDA 3WIAA 4E9YA 4E9SA 3WNJA 4AI7A 1JZHA 3FPYA 1M57B 1A3ZA 1AZBA 1I53A 1JZGA 2VSMB 1JXDA 2J56A 1AS8A 1ET7A 3BQVA 1OCZB 2TSAA 3G5WA 1KGYE 2W88A 9PCYA 3ABMB 1ETJA 4P5RA 3N2JA 1E67A 1GYCA 3FQ1A 3UGEA 4DP4X 1RZPA 1URIA 3T6WA 5I26A 2PPAA 5EHFA 3H4HA 2GIMA 1ZDQA 1KV7A 1NPNA 1NWOA 4HZ1A 1AR1B 4WKXA 1SHWA 3PPSA 1PY0A 3UADA 1NICA 3WI9A 3T9WA 2BP0A 3GXUB 2UXFA 1W6WA 5B7EA 1CYWA 2W8CA 3FPXA 4M4RB 4WTQA 4KOBA 2R7EB 4JHVA 3OMNB 2XX0A 3CZUB 1JVLA 1JXFA 1QNIA 2YXVA 3ERXA 3TBCA 4A67A 4GP4B 3CVDA 3NJGA 2DV6A 2MRYA 3TA4D 2UX6A 1OE1A 2E86A 3MX0B 1NPJA 3S3DB 1A8ZA 3X1FA 2XU9A 4BDVB 1J5CA 1FFTB 3NP3A 2AZUA 3FSAA 5I6MA 2XVBA 3SBRA 1A4AA 3ASNB 2VM3A 2B3IA 3S3BB 2HX9A 1GS6X 2CCWA 1ASPA 3GDCA 3FSZA 4GYBA 4KNSA 1BYOA 3T6XA 2CAKA 1BQKA 5B1JA 2JXMA 1V55B 4A2GA 1SF3A 2IDUA 5I6LA 3ABLB 6PCYA 1GR7A 2CALA 3NYKA 2IDTA 4A2FA 5F7BA 4BXVA 4NAJA 4QKTA 2H47C 1KDIA 1XMEB 4A2EA 3OMIB 2UXGA 1ZPUA 1PLCA 3TBBA 2BZCA 2TSBA 1ILSA 5I6OA 2I85A 4AKPA 2UXTA 1TEGA 4A66A 1JZEA 1VLXA 1AG0A 1J9TA 1CURA 3ZDWA 5B7FA 4YSOA 1NWPA 3FYEB 1KCBA 2BWIA 2XXGA 3FU9A 2Q5BA 1W8EA 2Y69B 1PMYA 1KBWA 2VSKB 2ZXWB 5D4HA 4YSQA 2HZHA 1BXAA 2A3TA 2MTAA 1XB3A 1AS6A 1ZIAA 1L9SA 1L9TA 1E30A 1WS8A 5I28A 2NRDA 3CDZA 1MG2C 2EIMB 2PP8A 3CG8A 1OF0A 2FQGA 4G7SB 1XB6A 2P80D 1BAWA 1SJMA 4YSAA 1NIBA 1JZIA 4KO7A 1KYAA 1BXVA 2FT8A 3QJRB 4N8UA 1AZNA 3IN0A 1WS7A 4UF7C 1AQ8A 1NIFA 3HEIB 3ZX1A 5I6NA 1YLBB 1B3IA 2IDSA 3MBWB 3QJUB 3DKHA 6PAZA 1JVOA 1RCYA 1EZLA 4F2FA 3FQYA 1SDDB 2ZONA 4HHWA 1CC3A 2YAMA 3BVDB 1OCRB 1OCCB 1UATA 3NJLA 4DPCX 1JOIA 1L9OA 1NIEA 4HIPA 3ABGA 4BWUA 5D4IA 1ASQA 1JERA 4YSCA 1SNRA 1BQ5A 2AZAA 3V9EA 4BWTA 1PZCA 3UABA 3EHBB 4HALA 5IY5B 2VW6A 2R7EA 1ID2A 1ZIBA 3SBQA 3U25A 3NJIA 5I5IA 1NDTA 2ZWNA 4A2DA 4JKNA 1RKRA 3QJSB 4NB7A 4YSRA 1SDDA 1ASOA 4HHGA 5PAZA 4BDVA 3NJJA 1L9RA 1X9RA 1E5YA 3DIVA 1WA1X 2BW5A 4HCGA 4YVUA 3AW5A 2OV0A 1BQRA 2YQBA 3NP4A 3ASOB 2UX7A 2X88A 4W1TA 2YXWA 4DP9X 1W6LA 1R1CA 2WO2B 3UAAA 1HAUA 1IBZA 1M56B 1BXUA 3QPKA 2IH8A 2VN3A 1OE2A 3QQXA 1OCOB 5I6PA 2J55A 2DY2A
chains in the Genus database with same CATH superfamily
5IFJA 1XH1A 3FN9A 4BWWA 1KGIA 4Z7OE 3C5XA 1VFAA 3GJEA 2RQEA 4PS7A 4Z7VA 4UTAL 1KEGH 5IFJB 1OGPA 1WISA 3OBAA 4R7XA 1BQLL 1OK8A 1GGIL 1JS4A 1DQML 2IH1A 3NSCA 3HMXH 4LSUL 4PRHB 4UV7H 3OKYA 4XVUD 5KSBA 1FNFA 3KPMA 4H13C 5ANHA 2YPVA 2E7BA 3RB7A 3UAJA 2BOBA 2VW7A 1UWXK 2HX8A 3HZVA 5DR5L 4D3CH 4M7LT 1CCZA 3QNYA 4PSPA 2Y7SA 4XN4A 5GGQL 4LF3A 5GGQH 3V7MA 5T1DL 2AQ3A 4TQEL 2ICEA 3ISRA 1W0WA 4JHBA 4MAUH 4U1GB 3QIWC 4OR1A 1XL4A 5ALCL 5IHBA 2ZUVA 4P3DA 4U1JA 1QP1A 5LGHH 3WD5H 1HH6B 1ZEAH 3TEWA 3AM8C 3JV0A 2KQNA 4NKMA 2ZUTA 3ZTDC 2EACA 3M7FB 4KJWC 4R4NC 4A6YB 4NENB 3AQXA 4WJ5B 4XNBA 1F56A 1PNCA 3MMEA 3EYUL 2AJZA 1KJ3L 3NBNA 2XKUA 2D7NA 1S7XB 1NFIB 5FYKL 3MV9D 4IOFC 2QL1A 4LASL 4NO3B 1ZSHA 4IKJA 5DLLA 3IDYC 1XH2A 1G9ML 1HILB 1AD9B 1N5AB 1Q0YH 3OLEA 2V2TA 1EJOH 1AD0A 1KBGL 1P2CA 1KBGH 1MF2H 3CZJA 4ZXBC 1I31A 4OFYA 4ZX5A 5CIPB 4X4MA 1KCRH 2EEXA 3V52L 5KS9B 1I8KB 4FKEA 3FTSA 3P3YA 4C54A 5LGJA 1BJ1J 1XZ0A 4MDIB 5DYFA 3D07A 4JRWA 3KHOA 1C08A 4JO2L 4AYGA 3V7AE 3D30A 2CJUH 2XN9B 3I3BA 3JYBA 4G8EA 3RUGE 4WV1C 4R4BB 2QVFB 4KXBA 5I5JA 5I8OL 3F7LA 2JKXA 4G82A 4JJ5A 2WSPA 5HTSA 3B9KB 1T0PB 2YK1L 3MRHB 4K94L 3VXNA 4N6RB 3NFSH 3K71A 3JYCA 3HRPA 3Q6GH 1TT6A 3G6DH 5LXVA 5IVNA 1ZWIA 5ES4B 3P0GB 3RILA 5GGSY 1GC1C 5D7IE 4KFZC 3RPKA 4CDGC 4IHOA 1LEKA 5CJ8A 2J8UE 2KDGA 4XO5A 3UIZA 4JQIL 5EIIB 3NCYS 1FPTL 2BO0A 3FB7A 3K4ZA 2P28B 3RWJA 4OT1H 4G6FB 4GP8B 4PH8A 4L3AA 4JHZA 4F1ZA 2A77H 5EUKB 4IKNA 4UUJB 1KXTB 1QSFD 4PJDA 5HJDA 2P24A 4GQRA 4HDIB 1G7LA 4KJPD 3LD8B 4H1LH 5E8PB 5MI0B 2R4RL 1VA9A 3S36X 1KCVL 1NKOA 5EC1B 4I4WB 3TO4C 5KVGE 3ZKXB 3KNBB 5DD1H 1EEZA 1NCWL 5CWSB 4GMSL 4XXWC 4NM8H 1FL3B 4H8WL 3QUZC 4JFDD 5KBNC 3KVQA 4BCYA 5KTEH 3OQRA 1LDSA 1KCWA 1PBYA 1FL6B 2V5YA 4F7PB 3EOTL 2E6PA 4FFYH 5I66A 4K3JL 5IJBC 2KC0A 4JHWL 1YEDB 3BEVA 2F7PA 4HCFA 4X5RA 5TDNA 4K94C 2F5AL 2I5YL 2D3JA 4M5ZL 5FO9A 4P57B 1GW6A 1S3KH 1TZGH 4N28A 3WHXA 1MCOL 4P5TD 5FIEA 4WEBH 2VDOB 4WUKL 4OF6A 1C5CL 1FZOA 3MZGB 3SGKC 4JZJB 1GOFA 4NQVB 4RWYH 5KBDA 3EHBC 3ETSA 3LSOA 4M7LL 3RTQD 3PGDB 3DXAE 1A7OL 5FC9A 1BVZA 5D7SH 3HE6A 2D9CA 3TF4A 5GGRA 2XWTA 3ZUCA 4LLMA 3DBSA 1JHKH 5DC9B 3BP7A 3TEXA 2GJ6E 4N2CA 4ZW7A 3WLWC 4G7VL 1OGSA 3IGKA 1ND0A 3QWNA 2OL3B 3U7WL 2BHFA 2YKLH 1QI5A 1P7QA 2B15A 1K5NB 4FYRA 4Z7QE 2VDMH 5JO5A 5AALA 3UC0H 1WZLA 5F1NB 1MPAH 4U6XA 3D0AA 4J1UB 5I5MA 1GHFH 4QXGH 2WBJC 3DURA 3RWEA 4F27A 1WRFA 4J3OC 5J12B 4M6OL 3NUKA 3JVFC 1IC7H 3IMSA 3WUWB 3ZL4L 4Z77B 1CDBA 4X6DB 3FUDA 2YSSB 5IMOA 1V7MH 1O7SA 3ULUL 1NMBL 2BY0A 3OKLA 2PYEA 2Z7YA 2H32H 3UTPD 2O6FA 1ZGLB 5FA4B 1DZBA 1JK8B 1U3ZA 2VISA 4GKSA 4QHNB 3FCSA 5HGHB 2YFOA 3MLUL 3MNWA 3LHPL 4PGEB 5HYSA 3FT4A 3QDAA 2XQYA 4JFPB 3HRZB 3ZE2E 4LBEB 2CHZA 3RIKA 4M5TA 2OMXB 4XI5D 4NWUL 3TV3L 1XGUB 5HVGB 2LU3A 3CK0L 3M86A 4H25B 4YC2C 1SZNA 5ICZB 4PJ5B 4KDTA 5F8RC 1JFHA 1NGPL 4YXLH 3T2NH 3VM7A 5IEKB 1U8KA 1Z5LA 2H26B 2WMPB 4XH2B 4GG6A 3MBEC 4UMSA 2R2BB 1N6UA 5BV7C 1AQDA 5IHWA 1XDTT 1TXKA 5C7ZA 2N7BA 2JB5L 3C8KB 3CFCH 3HI1A 4OKDA 4F15B 4AZUA 2KPWA 4E9RA 3V6OE 3QQ9D 2XXCB 2VXUH 4AXWA 4F1SA 1MCWM 3PIQA 1MHEA 3MV11 1RZQA 5FUOH 4A2HA 3JWNH 2H3NB 1GVIA 3PP3H 5B21A 1NBCA 3E3QE 4MGXA 2Y3AA 3DK2A 5IMLA 4QRRD 5D96C 2D73A 5M7QA 1M57B 4C8XA 2GT9A 3LKSB 1AXSA 1TOXA 3EJQA 3P4OB 4P0DA 4AMKH 4L3CB 4UYQA 5JNYA 3VW3H 4GW5A 3EO1B 2E46A 1NUDA 3FCBA 2VERN 4F57H 4XI5C 4FLRA 3W0WB 1AGFB 5FO2A 3CN0A 3AAZA 5TQ2H 4ATTA 2C9AA 5C97A 4PRIA 2W60B 3Q01A 1SLXA 5D7IB 1DVFB 1V3LA 2QGCA 3PP4H 3JWOL 1FH5H 1URIA 3NZHL 4IM8A 5HHVL 1BQLH 2DM3A 3CDCA 4GSQA 2JKLA 3AT0A 4EJ1C 1N18A 2FB4L 5E51A 3VYNA 2ZX6A 1NICA 3ROLB 3WY4A 3RY4A 3N40F 1CYWA 2OQJA 1DSFL 3IXTB 15C8H 5AW3B 1A4JA 1PX8A 3VFMB 2DM7A 2PWDA 4OY9A 3H9SB 2XOTA 2PYFB 2XWTB 5MEOA 1EO8H 5AEAA 2GVYA 2APFA 2ZOLB 1USZA 2UWEA 1T0MB 2DKMA 4D9QD 4HAGA 3EFOB 4NQXB 1ZE3H 2O5YH 5DFVD 2BNRD 4A67A 3CLEH 4NQVA 3MXWL 1FGNH 1TQSA 4IMLB 5ETUA 5I1CL 1ZY9A 2XTJC 2NYYD 1XF5A 3I2CH 1BBJB 4HIXH 4RRPM 4AITA 4F8OA 1FNLA 3FHQA 4GAAA 2F8VA 1BECA 1RVFH 4NO0A 4HOXA 2RH0A 5DURD 1RJYA 4BDVB 3N5AA 3PL6B 1MI5A 3CMOH 4GI6A 1DJSA 2YD4A 1J8HE 2HX9A 1FORH 3C60B 4FQLH 4X4XB 3T0EA 4HKZA 2YD7A 5F1NA 3NEXA 3T0AA 4C47A 3HAEA 2J8OA 3VB8A 3F58L 1R34A 4WFFE 4Z9KB 3VD9A 1MCDA 5FXCH 1U8IA 1DCLA 4U6YB 3CU1A 3KPPA 3VQLA 1KGJA 1Q38A 3SDCA 2J4WH 1BZQK 1AO7A 2WJ5A 4JVPA 1I3RB 5LXGL 3AREB 3RWIA 4W6YB 5F7WC 2R0KL 2WLMA 4P3CH 1PAMA 4I1PA 3IDNB 1S9YA 4A66A 1T1ZB 5EEWA 3BZ4B 4HIIB 3LNIA 3G5ZA 2YFNA 1BFTA 1L7TH 3M1OA 4G3YH 2AJSL 1UGKA 3FYEB 1R3HB 4HMCA 4MNQE 3K6NA 1W8EA 2VT0A 1KCSL 4YSQA 2HZHA 2VDNB 3MJGX 3WS6A 4HJUA 4NO5B 4YE4L 2HUEA 2YBRA 4M61B 1AP2A 4YDIH 4M93C 1MG2C 1KGCD 2EDKA 3FHEA 3U7YL 1TJIL 3LRMA 1JGEB 1U91A 1LE9B 4YAQA 3E38A 5IV2A 5KYUA 4GMTL 1WFJA 2EH8H 3QDMB 1IC5H 1G0YR 2VN4A 4HDIA 3BMWA 3KLAB 4DN4H 5HPMB 4N90D 3Q6FB 4I3SL 1ZV5A 2ZSVA 4BUQA 1HCVA 2GCYA 3GBML 3QSKB 2P5EB 2CHWA 1WWWX 2ZONA 5AAWA 3OPZH 4Z0XA 3OGOE 5J13B 4D8PB 3PUCA 5A2CA 5IMMB 1P4IH 2B2XL 3MLTB 3EYFB 4LP4A 5E4OA 4BGLA 1MELA 5H4ZA 3B7SA 3CC1A 5CHNA 4NAMA 1DUZB 3RFRA 1KCLA 4FFVD 4M56A 3L3OC 4F58L 4QRSB 1BGXL 1BQ5A 3V9EA 5T3ZE 5CUSL 5KW9H 2K7PA 4GSDH 4UOW1 2UV3A 5CUSH 3MNVB 4Y8AA 5HYQA 5IESH 1OP5K 1WZKA 3C6EA 5J11C 4P9HL 3L95B 3R4RA 1Z6JT 1ZIBA 2VR4A 2R29H 4XCYA 4YIQB 2WQSA 5I5IA 3ILEA 1DQQA 1H6FA 4HJ0C 5IQNA 5DMYA 1CICA 5EZLB 2YUVA 4G8AC 4I9WD 5IBUB 1BSIA 2NNAA 1X9RA 3J8F7 3ATEA 4O9HH 4KI5E 5F7MC 3GKZA 5DR5H 3EH2A 2VN5A 4YVUA 3PHOA 1ADQL 5T1DH 3ZE0F 4TULL 3BAKA 3FQWA 5F9JA 3PG2A 2FUQA 5E2VL 2W0LA 4HEPA 4W1TA 5E8OA 1YY9D 3TO4A 2ZUQC 2GY5A 3FB5A 3LCYA 4X7TB 2I07B 4XNDA 3R0MA 3VXOB 1IKNA 2QLYA 3HFMH 3MDJA 1LD9A 3QUYB 3ZQXA 2AK4E 3CFQA 3CVHH 1DE4B 1ANUA 2R4RH 5I6PA 3UBXG 3OX8B 5E8NA 3F04A 3EYUH 4CBPA 1U42A 4ZUWB 4RDBA 5A16A 2VRQA 5EZOL 4KI1A 3D25B 4WI3A 3KM2A 3G5XB 3V79C 1I4FA 1XHHA 2IWKA 1HL8A 3IDJB 4MZRA 2CG9X 5HHMD 3SKJH 3VI4A 3O6ML 1B9KA 2IDQA 4NO0D 3X2QB 1NCAH 3N43F 4XVTH 2J43A 3N43B 1I7TA 1KIRB 4HCRA 1E4XL 4XHJD 1LHZA 2XHNA 3DUSB 2ZCZA 4KKBD 2ICWA 4RDQG 3L3GB 2VLRE 4LLQB 5KJRL 5EF3A 1NIDA 5A2AA 4PGDA 4BINA 4NZRH 3ABZA 4KROB 5I6XC 3GTVA 3SGJC 4K3JH 3W57A 5L8JB 3II3A 1O0VA 4P49A 4R96B 1ZD6A 4OZHA 3OB8A 4J3OF 1GOGA 3F00A 2FWUA 2VB5A 2ZOUA 4V11A 2WXHA 1R3JB 4FFYL 2NYZA 2VM4A 1D3CA 3MPCA 4RNRA 5D1QD 1Y6NR 4UQBA 3FBQA 3EOBB 5DC4B 1MHPL 4LLYB 4PJFA 2WZ0A 3BHBB 3FQWB 2YQ3A 5GGVH 3GBDA 1M7IA 1E4KC 5D9SB 2CMRH 1AOZA 4MNGB 4D9QE 2NUTB 1P1ZB 5BUPA 2D0GA 2OYLA 5EU5A 5EDSA 1A1OB 2MEJB 2D03H 2DOCA 4N2GA 4KGLA 5A7BA 2E6QA 3OL2A 4XPAH 3S3SA 5B3NA 5DTFB 3MCLH 2BFVH 3VQ1C 5J0BA 1I1FB 4OCXL 2J1WA 5CLXA 4POZD 3LHPH 5L2KB 2WGXA 3R8BB 2EUWA 4TLSA 2X12A 3KLDA 4URKA 5KYXB 3STBA 1V7ML 2OR9L 1M2VA 2CA4A 4QOKB 3N42F 3X14A 5BRQA 4BQ8A 2XG5B 5CN3A 4OZ4A 2YEZB 4BELD 1QSVA 3Q8AA 2XWZA 4L9LA 3ZN6A 2XIIA 1HX0A 4E5XA 1KWGA 1WYJA 2NY2C 4JFEB 3VGAB 3A23A 4GW1A 3QG7L 1EXHA 3VU1A 5ESQB 1LK3H 1S2EA 4Z78B 4GAJL 1CDCA 4S0SD 4N8VA 1DBBH 2PN5A 2VDLH 3MRIA 4ADJA 3VNYA 1M7XA 5E8NB 5EZJB 3FOLB 3IBEA 4JFFA 4OAWA 5CBAA 2IV8A 1V7NL 2X2IA 5I2IA 4PY7A 5DD3H 3C60D 1YYML 5BV7H 1HZKA 4HEME 4KNTA 1RZJL 4JG1H 2MQGA 3U79A 1WFIA 4PVLA 4XP1H 4W9EC 3V0FA 4JO1L 2F53E 4HEMA 3MGAA 4HF5H 1E3FA 1KWKA 3W0WE 1EMTL 2BNUA 1FORL 4RFEA 1N9PA 1T7XA 3B9KC 4OVVA 1CICD 4ZUSB 2FVNA 5EULV 5IJVB 1IQWH 2QQLH 5DJ6B 2EEDA 1E2VA 4IGBC 5EO1A 3QEQE 3SDYH 1HZLA 3PWPB 4NZ8A 4FI7A 1YYCA 1M7DB 3T2NL 4L37A 4CMHB 4LHUG 4IU2B 1UOWA 4CMMA 1IAIL 4I48B 2RTTA 3QFJD 1WP6A 1A2YA 2KS0A 4KXZH 5L8LB 1HC1A 3EJTA 4HK3J 4QEGA 4ODSH 3TVMC 5A43C 3ETBJ 5AKSA 4YXHH 3DNKA 1IO4C 4G9FA 5D7LE 2Z4TA 2R23B 5SX5K 4ESKA 4PB0H 2YGNA 3H8NA 4YDJB 3WNPA 1OGAB 2LABA 1PJ9A 1XAKA 4TSCL 5CHNB 3FUFA 2A74A 5T33L 1IGTA 2OZ4H 4ILDA 1DSFH 1S7UA 2Q2LA 2A74B 5JHLA 1OPGH 3M1CA 3QDJB 3SGEI 2PP9A 5BZZA 3FAWA 2V17H 3QRGL 2Y1YA 1J5HA 1ZVSB 1AHWC 1DBMH 5AZUA 1X4XA 3I6GB 1YEEH 4YDVB 1F02I 4WSJA 4EPSA 1NTDA 4YR6A 4NT6B 2ZPKL 2FJGB 3ECWA 1J0KA 1HXYB 2LTQC 3TC9A 4HCIA 4N2OA 4KC3B 4MX7A 4NWUH 1E5CA 3FO1A 3NSDA 2NXYD 4XNUL 2HB0A 1BX2A 3G9AB 2H8PB 3ARUA 3HZMA 2KMWA 1E4XI 5DK3A 2ZCHH 1VKXB 4Z3HA 1QNZH 3RGVD 4LDCA 1PAZA 3U1SH 2GPZA 3L3HA 2X4TB 2E7LC 5KSBE 3BAXA 1DYZA 4JGMA 4X7SH 4ZS7H 2X4NB 3ULUC 5D5ME 2J1YA 2OXHB 2J25A 5D7JA 3SDCC 3H54A 4AK2A 1LWHA 1INDH 2FEDC 4L0PB 2GCYB 1WFOA 4U7KA 2AXGB 1BMWA 3OM3B 2CK0H 1RPKA 5F6HI 1GTFA 3ZT6A 4Q2ZA 5DEGA 4NOBA 3ARZA 4Y4FC 1DJIA 3QJZA 1T1WA 3BH4A 3D2UD 2IGLA 5C0EB 1PW3A 3CZLA 5IFHL 4QRSA 4DK3A 5B4MC 1AQKL 2FX8H 1EEYA 2WKOA 3ROOB 1A14H 1LE9A 2JLLA 2NXZB 2M2DA 3DX1A 3IMRA 3KBEA 4PJBB 2WAQA 4N2EA 4UIMB 4XCFL 5E5RB 1UFUA 1MF2L 2J2ZB 3QIWA 5IHLB 4WWKA 5FWQA 4HWEL 4LSDA 3C8HA 2EYSA 2VTFA 4KPHL 1JRHI 3AM8A 1PGRB 2ADJB 4ZPTA 4CJ1A 3KLAA 2FHFA 4JHAL 5L88L 5E70A 2OQJB 1KB5B 2R56L 4JJHA 1JXKA 1IRAY 2PPDA 1NGZA 3NCEB 3DJ9A 2LQRA 4E9SA 3OHXC 5SWZB 4EKJA 4MA3B 1J8HA 3EG9A 5AG9A 1CQKA 5EC2A 4JM2D 2ZXAA 3D9AH 4UT7L 1NBYA 2E8ZA 1TQTA 3VFVA 3PWJB 3VMNA 1DFXA 2J56A 2R2BA 1TTUA 4FXKB 3PU7A 1JHLL 2LAAA 3CAFA 4B9JA 3AXHA 4YHOH 4YHOL 4G1MB 1WD9A 1HQRA 3BHBA 2E76C 4L8SC 2IANE 4K8RD 1W9XA 2CGZA 4X5WB 5JA9A 5AVSB 4JFUA 1S7QB 1FNGA 4IIQC 1DFBL 1RFDL 1NWOA 1UFGA 2X1PA 3C60A 1AR1B 1VGEH 2O6CA 3IXAA 4LBAA 2WANA 5BMFL 1XF1A 2X4RB 3LRSA 4IRZL 4PBVC 2NY6B 3QDMD 4PEEA 5A1AA 4DGWC 1MI5D 3UYPB 3LRKA 3L1OH 1UA6L 5CLZA 4HS8L 5I71C 3CCHB 4ZUUB 4AUYA 4LRIA 2W60A 2O30A 3FFDA 1QKZL 4BEIA 4J3SA 4BK4A 4MCZB 3S88H 1HN1A 2G60H 5H35A 5JW3L 2UX6A 4J23A 5JR1L 1S7TA 2RD0A 5IBLD 1P4IL 4ZQTA 1MVUA 4Y2DD 1PG7L 2XU9A 3F3HA 3O9WD 4IBWA 4I5BA 3L2LA 2J12B 5FGBC 4DW2L 2Y25A 2D2CC 5I6MA 1VFOA 4DAGL 3ZQWA 4BFNA 4L9DA 4LL4A 4JHWH 5LNGA 3OLGA 4GQZA 3LN4A 3BLPX 5KG9A 3FSZA 4N2LA 1BYOA 3U48A 4WTZG 1W0VB 3TJEL 1KB9K 1UCTA 1TQVA 1ZSDB 2IMNA 3PABB 3OC8A 4GRLB 5JQ6H 2YPLD 5F7DB 5DMJB 2Y5EA 1XF3B 3JTSB 4JO2H 5EOTB 4XH2A 1M6OA 2YMXH 1NH6A 3VXOA 1H8LA 3HPJA 5EU6D 4EIZC 1NOAA 4ZD3L 4UQEA 3FHAA 3UL4A 4N8CL 1ZHKB 2C1PB 2VDOL 5JUEH 4P2RA 4Q56A 4M7ZB 1ILSA 4FQXA 5K39B 1B4JL 2IFFL 5C70A 2FECL 2OZNA 4U0RB 3VFUB 1FF5A 4D7PA 1OHQA 4XVTL 1YMMA 5DVNA 3GF8A 3QEGL 4PLOB 2HTKC 4I3SH 2HN7B 2ZKHL 3O3DB 3VI4E 1YEDA 1HHJB 4LU5H 3FQXA 4N0YL 1PMYA 2MNUA 5DK2B 4ANXA 2C9UA 1JZ8A 2E27H 3NCXA 2QHRL 5CSBA 1KN2L 1XB3A 2B4CL 4KKCD 4NHCH 3WTYA 1OP3H 2MNWA 4N9GB 4LLDB 1KTLA 1QX1A 1E8WA 1R47A 2A9DA 2Y2YA 1DQKA 3HNTH 1UWGL 3GB7B 4XNYL 4EVNB 4N0UB 3PGDA 5SWSB 1JZIA 4X99B 3TZVD 4YWGH 4NNYA 1FAIH 1FDLH 1YEWA 3HJ0A 3QIUA 3QRFM 1SY6L 1E5BA 3RAJL 4TSAH 1HHHB 3GZKA 1AQ8A 2DDQH 5EU4A 2ZKXA 1BYNA 1VIWA 4LOUD 3UJIH 4EQ2A 2C1OB 3DUHA 5EN2B 1H6EA 5EEZA 5ITBH 1QLFA 1WBYA 1USQA 3IWVA 3O8XB 4JG9A 4ELME 2WLLB 2BVEA 2C34A 4Y9GA 4F2FA 3QWOB 2YJQA 4F7PA 3K8LA 1UYWH 4I3GA 2WP3O 4WI8A 4OGAC 4K3EH 4FLHA 1J5OH 2VN7A 3EOTH 5AVWB 2TRYA 1MCKA 4Y4HB 2X41A 3WFCL 1QFUL 3I85A 2V7HA 5FA3B 5GS3A 1XTLA 5DUPH 5EO0B 1Q9KA 4N2KA 4Z7WE 5ERWB 5D6DA 1UGNA 1JJUA 5JIDA 4GH7B 2YZ8A 1FVEA 3TWCL 4OLVL 2EDJA 2JKTM 4PRAA 1WC7A 3AWGA 4JRYA 4JJ5B 4UQ9A 5F0JB 2FJUB 3WJLC 3EDFA 1C7TA 5DD0L 2ZWNA 1QTYT 5L2KD 3I84A 3EYQC 3EDJA 3W2DH 2OYKA 5C6WH 3FCSB 3WE1A 3GEFA 4K9EL 1F1GA 4DGVL 3QO1A 1U8JA 3IFNH 1U92A 2C26A 3MLXH 1F18A 1HE7A 2R59A 2YA2A 3M1BA 2VABA 3WFDL 4XN8A 1XCQB 1BQRA 3RPIA 1P6AB 3BPNB 1SM3H 4GKZB 1W80A 4I87A 1EAPA 2NX5D 4JAMB 4YX2L 4M6AA 4QXGL 3NVQA 4EUPG 1JPTL 3LTVA 1M1XB 4ES8A 1D7DA 3UERA 2OXGA 4WWID 4TSBL 5FM5M 4A37A 3WIHH 4AW7A 4BK8A 3EXLA 4EI5D 1QG3A 2XETA 1URZA 4KHTL 5DHYA 4WU5B 3PV7A 2GAZA 3T5WA 4BSVA 4R0LC 1MZZA 2CLVB 5KANG 1S9XB 2EDEA 3FSVA 4IW4C 4WHYG 4WSKA 2B0SH 5FUZL 3KYOA 4ZFZA 1RUMH 1BV8A 2K3TA 1RI8A 2WM0A 4YHYB 4MSWB 3AMLA 4LAJH 4EXPX 2B39A 4FX5A 4NQUA 2VZ1A 5D7HA 4Y2DA 1IAIH 2BSSB 1GYAA 4RCAA 4I4WA 3CZFA 1NL0H 2YXFA 3PAZA 1UB5B 2PWEA 4H0LC 1ILUA 1DJGA 4KQ3L 3QJVB 4H8VA 1PZBA 4NQCB 5FLUA 4MYPA 5B39G 1J1PH 2ARJQ 4FFZH 4P57A 4PJDB 3E1ZA 4UNTA 5MENE 1NDMB 3L9EA 1EBAA 2IF7A 4ZPVB 5IVZB 2EE3A 3ES6A 2FATH 2F1BA 2QSCH 5EU7C 4CBZA 1FSKB 3WAJA 2V7NA 3NOIA 4RMBA 3EJZD 5CZVL 2CIIB 3NJHA 2JNZA 4JDEA 2KYIA 3ROLA 1OPGL 3O4OB 4WW2F 4OCWL 1ACCA 5KS9A 2Q9OA 4C4KO 4JDVA 5E4EB 2Y7QA 5EO1B 4WI0A 2QGDA 5K1NA 2XWBB 4ZNCD 4HKJB 3P2BA 4PPTA 4MNGA 4QHUA 1T1YB 5CXPA 3LNHA 1TVBA 5I15L 4WW2B 1RHHA 4HXAL 3V4PL 5I1IL 3H4FA 4Q6IB 5LAXB 1M4KA 3B9DA 4J3OD 4ZBJA 5SWZA 1T5XB 3RDTC 1EX0A 4Z7UB 3LEXB 3HVDA 3BDBA 4PJ6A 2R15A 3RTQC 4XHQA 3A24A 2ZPKH 4ZMLA 1XGYL 3SDDD 4LSPH 3SE9H 5EEXA 5JPNC 3PP3K 4S1QL 2Q7AA 1FCCA 2HH0H 4JQVA 3JUYA 3VFTB 4OU3A 1GS8A 3T3ME 2BVOB 4IU3B 4OI8A 3A6BH 5F7EH 4K8RC 4DKFL 2A99A 2HT4C 4WFGD 5I8CA 2V5RA 2QPEB 2AJXH 5KVMC 2ZAHA 3B6SB 3UEQA 3ZTNH 3HUJB 3KPRD 3H55A 3JUZA 2AQTA 4Z6AT 3MQIA 1D9KC 1XSIA 4Z76B 2Y7NA 1E28A 2EIKB 2WVVB 1IEAB 5CP3H 3QZOA 1AQKH 4LEEA 4NQDE 1WLHA 2BOCB 2F54E 2FX8L 3HC4H 4MWFB 4TRPH 4CSZA 5KBKA 1RSFA 3NCWA 3GJEB 4OUOA 2GJJA 1ZAGA 2A6IA 3QHFL 1CTOA 1JRHL 3QHFH 4PJ5E 2FCBA 3ZRCC 1Q9OB 3DX6A 5DJXA 5GRVK 3ABKB 1RVFL 3OHXB 1NCDL 3FO2B 3E2HB 4NUMA 4HJEA 1OHZA 2OULB 1OLLA 2V3DA 3GJFB 1X5HA 5ESVA 3D0VB 4X6FB 2CK0L 2VL5A 4MAZA 4PJEB 1IC4L 3MNWB 5F44A 4HG4K 4C55A 4Y9EA 3SZKC 4RGNB 2CQVA 4QNPE 1Q9LB 3ALWA 3UFIA 5TE7H 2CE6A 2VZSA 3DI2B 1DBKL 2CLRA 5CU5A 1E6JL 2UZIL 2XZQL 2K4AA 4C83B 2GHZA 1CB4A 3QR1A 2ZNWA 3ARED 1C16A 2QR0B 2FZ3A 2NXZC 1S46A 2Q76A 3QRBA 1K85A 3C5SB 1QEXA 3DURB 4LLWA 2X6CA 3EGSA 4ANUA 1JTTA 4E9QA 2AQSA 1ZTMA 4QCIB 2F53D 4YK4C 2WOBA 5DDHA 2ZUYA 12E8H 5EG6C 2ARJA 3PHSA 4H0IA 2X42A 3EXJA 3I6LE 4JFYB 1IC5L 4G5ZL 2EYTB 4PGDB 1GGCL 4D3CL 1D6EB 4NLAA 2JJUA 2IV9A 1VEPA 2P5PA 4N2NA 5FS5A 3MROA 5SWZD 3UH8A 2A38A 5CR8A 3ARBC 4S10A 4UQ2B 1J9CT 5CGBA 1RMFL 4M62H 3DLQR 3HMWL 4EBQH 5F7UA 1TSHA 3MV8D 3SN6N 1CD8A 1H5BB 2X40A 3R1GL 1LILA 5IMKA 4MVBD 5E94A 4I3RL 5GGUB 2HRLA 4XC3H 2WLJA 4JPWL 2R2CA 5C0AA 5TDNB 4W9DC 3LKNA 2EIJB 3MV7A 5D1XC 5CD5D 1H6TA 1KBPA 4WI2A 4NC2B 5LKNA 25C8H 1TZHB 5DI8A 2B9AA 4WIQA 5D2NB 1XH3B 4JHUA 1NCAL 5JHLL 3MLWL 3ZHFA 2YZ1A 4G1EB 1U9KA 1WAEA 5KSUB 4GRWB 1U8OA 2Y24A 2G0LA 4HUXB 5CCJA 4TNVK 2RACA 4ERSL 2Z1PA 2P5WB 2P44B 3IDGB 2FQDA 5B38A 4K3EL 1MFBL 3GSVA 2BSED 3MYZA 4HQQL 4AEIH 4PAZA 1G5GA 1WIUA 2DBJA 4U3SB 1CD1A 2VLLB 4XN7A 3LEXA 3IDXL 5C0CA 3IN2A 4KJWD 4GXUM 1T7YA 3S36L 1L6XA 4L3ED 4UNUA 5FYKU 4ELKB 1Q0EA 4WEMB 3K1KC 3R7RA 3DJSA 3HFFA 1G7QB 3FUEA 3D12B 3NZUA 5A3IC 5E6UB 3DVNB 1BZ8A 3KW8A 1AGEB 1D5IL 3FU0A 4ABQA 2Y22A 2F61A 4H88H 1IBFA 4JDVB 5JQ6L 3QCUL 5SX5H 3SKJL 4JFDB 3SO3B 4F37K 2WLIB 3OKMB 2YD8A 4NGHH 1F2XK 3HNTL 2BFGA 2A4EA 3OR7A 1FSKC 3QUYD 1WEJH 4MRCA 4OZGB 2A73A 2E47A 2IAMC 3DPBB 4LVNB 1LMIA 1QPPA 4F91B 4XVJH 4RMUA 3MUGB 2A9NH 1I53A 2D0HA 4JAMA 3MKKA 4XPBH 3MRBB 3WIHA 3QDMA 2X1WL 1AS8A 4ETYA 2Y7QB 4DT2A 4ABWA 2C9PA 3GBNH 3EOBA 2G60L 1A9BB 3GSNH 4NO0B 3T0XA 4C59B 4HJTA 2XZZA 5JW3H 4X9BA 1K8DB 5EBLA 3RP1A 2AJUH 3DX9B 4X4ME 5EHFA 3TBYA 4GRWE 1AD9A 1N5AA 3O6KL 5D4QA 4FC3E 1KV7A 1YN7B 1MCPH 2HFGH 3SD2A 3O2DA 4WKXA 5ISZD 3IFOA 3V9FA 5I5RA 4HU2A 1E9QA 5LBSL 4LCYA 3WI9A 4HVBA 1FAKT 2VDLL 4Y16C 5L0QB 3SOBH 1YEHH 5IMKB 2DTML 1NGQL 1M1SA 2UUDH 3MRLB 4ONFL 2X10A 4NZRL 4PIRF 5KSAD 4PRPA 4UT9H 3O0RH 5HVFB 1ZLSH 5T1KB 2ALAA 1DEEA 3AREA 4FXGB 1KPUB 4XRCA 3QA3A 1SLWA 1DDTA 2BSRB 2OCFD 2P52A 3DVNA 5E99H 4AMWA 2EXYC 2BFVL 3OKKB 5HHQA 1TQUA 5BS0D 5F3HB 2BH0A 3VO0A 3ZJAA 1A8ZA 2AEQH 4XBGB 2NZ9C 3O2WH 2CO6B 3T1FA 5DHYB 4Z0XB 2WAHA 3NPSB 3VAEA 4XCCL 5D70H 2EVGA 4QJ4B 3UAJD 4AQ8C 3APNA 4R6UA 4AIZA 5ADPH 2DLGA 3X17A 4B3EA 2VZOA 1IGIL 1A6ZB 2L3BA 3F65A 4NOFA 3S3BB 3D3VA 3QPXL 4GYBA 4OM1H 4NPYA 1GGYA 5T5NG 2XQBH 3CSGA 4L8DA 1BQKA 3VE0B 2OP4L 1MCSA 4Z7NE 2VZTA 3FTUA 1NCBH 4X7TA 2AAAA 2BVYA 4EOWL 4EVNA 1VESA 2A83A 1H8OA 1I7ZB 1CI3M 2DIBA 2AAVA 2Z7WA 1MH5A 3HAEG 4OZFB 2F19L 2YA1A 5LCVL 4E41E 2H47C 1KDIA 4A2EA 1IFRA 2Y2TA 4ZFGH 4YX2H 2Q3XA 3IF1B 5HI3C 4UDUA 3X11A 3VXUE 3F5WA 1RAMA 3WDIA 4U4BA 3MYJA 4KUZH 4NNXA 1BJMA 5FCUL 5I71B 1H8NA 5FW7A 3NDYE 3WFDH 4HD9A 3VFPB 1AG0A 2OTWB 3R06B 3NEOA 1NOFA 2DPKA 1UOLA 5I1KH 4KKBC 4AQEA 5GS1B 2VWEE 2FEJA 1D9KD 4PWKA 5FHAH 2V4LA 1L9TA 3F7QA 5D71L 4KXZI 4L1TA 4XNZC 5D71H 3KH4A 3RDTD 4N3UA 5LDSA 2ZXDA 1E4WL 4JM2C 5CU9A 4OJDH 3TFKC 1FFNB 2OLDA 3Q13A 3E8VA 3BRFA 1X5FA 5AKTA 3FTXA 1AHWA 5JOFA 4QI3A 4YZWA 1CE1L 4LO9A 4LCIH 3U4BH 3HEIB 2XN2A 5GXBB 1UH4A 5K9QG 1N0XH 2BJML 4N86A 4Z77A 4JRXE 5L6YH 2JV6A 3QJUB 5AYUL 5BOPA 3KYKL 3F6LA 3V55A 3U0TA 4DEUA 3MRNB 4TPRL 1U8QB 4NBYB 3ZE0E 5HHXL 1CC3A 1QAWA 3B83A 4KJYA 5HI4D 2OJZL 5IJKA 3WBDA 5IROA 1OPOA 5FF6B 4WUUB 3SE3A 2C3WA 3NJXA 2AGJL 1HSBA 1N3NB 4IMKC 1JPTH 3A6CL 5IQ7H 3LIZH 2IXQA 3KWUA 5MHSE 4XXCC 4V1DB 1S7VB 3QUGA 2X53A 4UV7L 2K9UA 2V9UA 4ZUVB 5DMGD 5F7EL 1VPOL 5IB2A 2I69A 3RVTD 2D0FA 2LHAA 4AGNA 4FCHA 4FADA 2FB4H 5K9OA 5DRZB 2AEPL 1BQHG 3QJSB 4V2CB 3ZMEA 1NSNL 1D6VH 4EUPA 2B59B 5DURB 1CFQB 1JNLH 2E5EA 1W72B 3F7KA 3S96B 4Q6IC 2VIRB 3T08A 5JORB 1NKGA 3ZZQA 1HIML 2NY1B 1BJ1H 1E43A 1NBVH 4LRNH 1YMHB 3U4KA 4RMVA 2GBVA 1TFPA 3B7UX 4LSSH 1MH5B 1WK0A 2UY6A 4JPWH 3LS5L 3KS0H 5DJZB 3QPKA 5F9OL 1U6AL 2QKSA 3TPUA 1U6AH 1IVTA 2X3AA 3WNKA 4P2OB 5D1XD 5CD5C 5C8JA 1CDHA 3QPQD 5C07A 1R4XA 2G0KA 3MO1A 5AW6B 2Y6TE 2ZOOA 4R5XA 5EUKA 5E8DH 2MKWA 3FXIC 2Y06L 3NRQA 2YD5A 4WI6A 1MWAB 5FO8B 5C08A 3ZYZA 5IKCB 2NDGA 3S3CB 3PPEA 1TETL 1UTDA 1EH9A 2VDQH 1MIML 3PWJA 2CRIA 5LWYL 5IT2L 5I16B 3I50L 1E90A 2A9CA 3EG9B 1HNFA 3TCTA 1NMAH 1SOXA 1C12B 4GI8A 4MB3A 2W0FA 2DL9A 2DQUL 3LSOB 4NI3A 2BSTB 3CLFH 4YPGA 2J88H 5B1AB 5TH2B 4L1LA 2WSDA 4NQDB 3PV6A 4KVNL 1FHGA 3ZOAA 4K71B 4W4OA 3FTZA 3WE6A 4G3YL 4PJ8D 3W11C 2X4QB 2XVGA 4Z7IA 1CPUA 4Q58C 4RZCB 3PHQB 2ADJA 4R4BA 4ODHH 3BQUD 3FU7A 2K6ZA 3IT8D 3GXIA 4X83A 2V3FA 3C5ZB 1XGTA 2YOCA 4N85A 2DF3A 4F7TA 2YOAA 5ERWA 4N1EA 4Y19B 5JW4R 5CCHE 3NAAH 3QDHA 3FO0L 4GMTH 32C2B 3FN0L 2M8XA 3P73B 4Q9RH 4JQIA 4QRTA 1BVOA 3EJUA 4LHJB 4MX7B 4UV4H 2GI0A 3I74A 2XYBA 2BNRB 2WLYA 2Z64C 1A6WH 3K72A 3OKNB 3GPSA 1M42A 3MLPA 3GS7A 4DK5A 5D72H 4V2BA 3MV7E 5IK3B 3C5ZD 4J5VA 1JAEA 1QBMH 1HDMB 1P4LA 3BUBA 4JKPL 1F11B 4H8WH 4HH9B 3IE4A 3QYCA 2EUVA 4LLAA 4OKVB 2JH2A 4UANA 3X1BA 1NC4D 5IF0A 1CXHA 3UAJC 1AH1A 4ELMB 4P46B 3SE8H 4CVUA 1ONQA 3C6SB 3KPSB 4GQQA 2XVKA 1BLIA 3QWRA 5JHLH 2QDVA 4JRXD 4LCCB 4ZOCA 4XPFH 4LLVA 3KWWA 3P9MB 2UZIH 4XP6L 3U9UB 3H9HA 3QUMB 4KMLB 1KGWA 3MNMA 1OP3K 1AE6L 3L1OL 4TQPA 4ZOAA 1LP9F 3H9ZA 5SWSE 5DVPA 4HXBL 1UENA 2HXAA 5GS2D 1TEFA 1JPGB 4KXAA 1GJIA 3JV6A 3O8XC 1HCFX 4NKOB 3SY6A 4OUUB 3GS0A 4OQTH 3VFPA 1GKEA 1T3FB 1U2YA 4DTGL 4AZ8A 3QUZB 3RY6C 1DVFC 1QLRA 1JN6B 4Z7VB 4PRAB 4IYKA 2IAMA 1HEZB 3VFUA 5B1JC 3RWHA 2OSYA 5F6IC 5C9KA 1I7RA 1BF8A 4M6NH 4RDQF 3C09C 1U8HB 3IJEA 1KACB 2KZ1B 2F8IA 2UZYA 2VR6A 3B43A 4QY8B 4F2MA 4G8GD 1UKQA 2EILB 3NT0A 2IH3A 4R7DB 5ID0A 4H40A 3VJ6A 5EOTA 2K7QA 4NT6A 2H1LM 3C6LB 4FQHA 1KN2H 5B4MD 1X4YA 2W0KA 3BP5B 3SJVA 4F7CB 4OT1L 2CJTA 4PLJD 5I0ZA 1MWAA 2GC7C 5FO8A 3GBLA 1K5NA 1NMCC 1YEKH 2VW4A 2AANA 3FQTB 3OKEA 4KROD 4WNJA 1D5XA 3DIFB 1S7UB 1CXIA 1L9PA 3JVGC 1G7PB 5J1SC 5I19H 4P4KB 3VI3A 5FEBA 1DLFL 3VGAC 1XTMA 5E9DD 3BP4B 3LV3A 2XWJB 2O6EA 1IBYA 3I9GL 1FG2A 1QSFE 4M9OA 3SBPA 4IOIA 4HMDA 4LIQH 1ZT4A 4NHUB 2DYSB 3D4CA 4ERSH 1OT1A 1JGUH 2E7HA 4OV5A 4AVIA 4MASA 3G08B 2EYTA 1B2YA 4FG6D 2X6MA 1ZXKA 4P4KC 2I9TB 1CFVL 4WRLA 5DMKA 5A6LA 5DTFA 3T09A 3K4AA 3UYPA 5C7XH 1ZS8B 4B9ZA 3PWPA 1MJUL 2PXYC 5IOPB 4M5ZH 1MJUH 5JPMA 2HFEB 2HJKA 2AC0A 2FL5B 4R5TA 3Q1EA 1AACA 1C08B 4HWUA 3WXVH 3QUHA 2JB5H 3MV8E 3GINA 5MERA 4JRXA 3CGTA 1YUHB 3HNVL 1TTFA 3LJ3A 1T04B 4N2DA 4AVKA 3FFCB 3WTXA 2QLVB 1MRCH 1X7QB 4QYOA 2WCGA 1SUHA 1IFGA 5C0FB 1K4CA 1SFHA 5HGDB 2E4FA 1PSKH 3REVB 2F6AA 4PY7B 4PRDA 5L2KA 5EO9A 1F4WH 2ICWJ 2X9XA 4N0CD 4MNQA 3HE7D 1QHPA 1G5AA 1A3QA 4NGHL 3RRQA 2KT6A 2HG5B 2X09A 5LG6A 4YHMH 1WEJL 2AI0L 2G5UA 4BXSV 2NT1A 2AI0H 3QJFB 3L8QA 4U1SA 3GXTA 4JFVA 5KVGH 4FNPA 1MPAL 1YPZA 2XJKA 4JFEA 3RWJB 4M7JL 5C0BE 5T3XE 3C75A 2ZYIA 2R69L 3FB7B 2NDFA 3GEWB 3A6CH 4G8GB 1O7DE 2R2EB 3EAKA 5IQ7L 3BGMB 2YGQA 3F7VA 5HHVH 4MJIB 2EVFA 5K9JH 2NY4C 4L4TB 1CJYA 3EBIA 4HS6A 2PF6A 1MCEA 2XZAL 1W2KT 4PY8J 1S9WA 5I74C 4IRJB 1EAJA 3DMMA 3L3OB 5IFAH 2WBWB 5GIRB 4PWJA 2R1WA 4HD5A 3U9WA 3MBWA 4NKQB 2JMRA 3D25A 3UMTA 3OLIA 4JZJC 5LBSH 1JNHA 1FVCB 1TTGA 5IM7B 3PWNA 2NYKA 1QBBA 5AUMA 4BZ2H 2HKFH 1F3RB 4BH8B 2WXPA 3ARDD 5HDBE 1RZGB 2WXQA 1AZBA 4FI8A 4LSVH 4AGMA 1JZGA 4LCIL 2CLRB 2DWDB 4PCSA 4LMQE 1NLDH 1OWRM 3ZYOA 3HI6H 1RP9A 1IAKB 2WNGA 5LAPA 2XVLA 2BY3A 3BH8B 1GMIA 2OSLA 4HKJA 5DHVH 3SYCA 3T04D 5ABAA 2HSIA 3PWPD 4IMKA 3TT3H 3UCQA 2BSBA 2QVIA 1VKXA 4J7RA 2AV1B 5B8CA 3G6AB 2AQ1A 5HHOA 1DQIA 5FKAA 1O6SA 5ACZA 5BVPL 4HGWA 2AXFB 2G5BA 2VERA 3ARGD 3N06B 4JDZB 4U1NA 4HP5A 5DUBB 4L1HA 1KB5A 3CZEA 3GXFA 4PSRA 1QZNA 1KB9J 3V6FA 3SKOB 1R0AH 2I07A 1TQWA 4XGZB 4P5MA 4HXAH 3V4PH 3D3VD 4PB0L 3TBCA 1S5IL 5JXEA 4TSCH 4BUHA 3HZKB 4DO6A 4I77L 3IETA 1XGPB 5I17A 5MENB 5AAMC 3O11B 2VLKD 2QFRA 5CEXB 3HG3A 2NY0B 4UDTB 4NQCE 3T4AA 5C09E 4Y1AB 3AACA 4WUUD 1T5WA 4X9HA 1T1WB 2VXQL 1KPVA 2B3IA 4RVBA 2WQUA 4UTAH 1KEGL 4BCZA 3MRLA 3QULA 1KJMA 5D1ZA 2CAKA 3EHBD 4TNWF 4AQAA 3C9NB 2A1WH 5INDA 2IIJA 3BD5A 1SYSB 1U8NA 4JUTA 3A5VA 2BNQE 3CLWA 2FK9A 1SJHA 1UQSB 5IQOA 5AW9B 2X7LB 4LEOA 4A2FA 5F7BA 3VYPA 4KTGA 1Q0XH 1O6VA 4NN6C 3F7YA 3MRPA 1J8RA 3BYTA 4LPXA 1T80A 1BAFL 4WK2B 1D5MA 1KLUB 4FQIH 4U7SA 4NP4H 4OJFL 3Q1SH 1INEL 4PLKC 4YIQA 4M29A 5D1QA 1F00I 1MCNA 3GMOA 4JFFB 1UD8A 2MOVA 3FU5A 1KJ3H 1KYOK 2ATPA 1NM9A 1OZTG 8FABA 2YR3A 3MUUA 4GG6F 1FVCA 3GSQA 1RH8A 3MREA 2ARWA 4PJBE 1EERB 1GYWA 3GLDA 1WS8A 1AMXA 4JFDA 4JM2B 2EJ1A 1LEGB 2JKJA 2BSSA 3ARBB 2CJSA 5ID1B 2EDFA 2YWZA 4L3FA 3QZWB 4G43B 1XQ4A 1ETZB 4Z7WB 1WIOA 2DQIH 4DN3L 3C2SA 1OT2A 3QNXA 2WTRB 1RZIA 4KVNH 5GGSB 1NSNH 5C6TH 1UG9A 5CCKL 3V95A 1JVOA 5DGRA 1RCYA 4ACTA 2PTTB 5E6RB 3AROA 5FKAB 4IGBB 4MKTA 4WFGE 2EEAA 2HT3D 3DV4B 1OTTC 3DMMD 4UU9B 5LGHL 4HZLB 3CFKB 2C1OA 5EN2A 3F85A 1KV3A 1EHLH 3HFML 1UATA 3V5HB 1ZA6B 3QQ4B 1UASA 1HINH 1WAAE 1YEJL 5IG7B 4P06A 5IW3A 3U6XA 5C9JA 3DROB 4EDXB 4NUQA 2SEBA 1I8MB 2EDTA 4Q4EA 4C56B 3FMGL 1YNKH 4TVPH 1TTBA 4KZCA 4QD2E 5AVVB 4PVMA 2DQDL 2XRAH 1RIHH 4KVCH 5IY5B 1JZ7A 2JCCB 2ZKMX 2XNAA 4HSCX 4FGMA 5HDWA 1J0JA 1GYUA 3TBSA 3GD1C 3QIUD 1BM7A 4XP4H 3WMQA 1QUNB 1RKRA 4LE8A 1OSPH 1CBVH 3V8OA 5PAZA 4HULB 1H3XA 1PLGL 1TJGH 4Y4FD 3OSKA 5KN5A 1BZ7A 5DHMC 2XKNA 1PZDA 5AAPA 1OGAE 5HDOA 3WS6C 1NFDF 4D0DA 2CUHA 2E9JA 2W9DL 3AW5A 5I74B 2OV0A 4NN5C 4OV5B 1BQHA 2PKDA 1WIPA 4P46C 1TLKA 1FZMB 4NSKB 3DX2A 5GZOC 5KVFL 2BIMA 2YD6A 4HJIA 5DQDL 3EO1A 5TQ0L 3ZR6A 3DUSA 1R1CA 2WVTA 3PGCB 3CN2A 3PWUB 3QZPA 4PJHE 3NH7H 4JFOA 3MI6A 1E50A 3N04A 5DRWA 2VE6B 1L4IA 1MFCL 2VN3A 4Q97A 2EUXA 4JS7A 5C8JB 4DGIL 1U8MB 4GUPB 4Z95L 4UB0L 4BSWB 3AXLA 5M94B 4L05A 4LPTA 2ZP8A 3KLQA 3MLZH 3FRPG 3HE7C 1S78D 4YL4A 4WJG3 3MX0A 2AV1A 1SJVA 4HEPG 4MHHG 5B7MA 7PAZA 4WEBL 2WCSA 2O4EA 3ILQD 4JGUA 4U2YA 1CLOH 2P3YA 3QCUH 4ZSOE 4S2SA 1MW3A 1JI1A 2JIXA 4JM0A 2JCCF 4P4KD 2WMPA 3WIIH 3JVGA 3DA0A 1CIUA 3WNLA 1VFBA 3MRCA 1T1XA 5IB5B 1JZDC 4L2YA 3ECBB 1REIA 2AK4B 3M1BB 4APXA 1SF5A 5DA4A 4N9GA 2PW1B 4EZJA 2EDLA 3QJHA 2GJRA 2I7OA 2B20A 3CFDA 4TQ8A 4KK6D 4GXUN 3TYFA 2OMXA 4HUUA 3DECA 2O61B 3FAXA 3GMPA 3D8MA 3ZE1F 3RE0A 1NBZA 1RP8A 2YKLL 3ZW3A 4UQ3A 4DP6X 3GJFA 2ALWA 1DLHA 5TE6H 1S5HB 3UC0L 4L0YA 3AY2A 4ZODA 2CO2A 1AAJA 1JGUL 3AABA 1ORSB 4OSUL 1ZTXL 2VISB 4GKSB 2IG2L 1H6UA 1SPDA 4NS0A 1AKJB 3T6ZA 1N67A 2BIOA 3OKLB 4MJIE 4ENED 1ADQA 2GJPA 2AK4A 2ZX9A 3WN5A 4S1RL 4PV1C 2QQKH 5D93C 1OOAA 1MCFA 3NFNA 2VN6A 1RIVH 1OGTA 4PWFA 3FQUB 1SYVA 1VHPA 3AWFA 2OMUA 3MA7B 1IM9D 2CH8A 2DQFA 3UJIL 4AQ8A 2KLSA 4CC4A 3VH8A 5DT1H 1XT5A 4P2OC 3EO9H 3VH8B 2J7LA 2VOTA 4MXQC 3S97C 3GIVA 1ED3A 3NCBB 2P8MB 3H6JA 3IDUA 4FQ2H 1MSPA 2BNRA 1UZGA 1IQWL 2VZVA 3DC0A 2OI9B 2NSMA 5IW1B 2YD2A 1NGWB 4F2MB 1GW0A 3N42B 5AFAA 2R69A 1JMXA 4HOWA 1NGYB 3V6OC 1IZKA 1QBLL 2YAFA 3BN9D 3QQNA 5DYOA 1IJ9A 1O9WA 5TK2A 3ULUF 1P0SE 1KLFA 5H37G 4YXKL 5FFOA 2Q8AH 4J39A 3VWKA 1B4LA 2WO4A 4MQXD 4JFPA 4PREB 4DQOL 2FE0A 1SHXA 2MFNA 5BJTB 2AJ3B 3MJ6A 2O6DA 4OCLC 1UZ8A 1C8PA 4F8PA 2HLAB 4XB7A 3VSTA 4BFGA 5KVGL 4F8TA 2XBZA 2YPVH 1YN6B 1ETB1 1V27A 4ENZA 3WO4C 3HOGA 5JIIA 3FH5A 1NCHA 3NSYA 4FQXB 5EIQA 3VXRA 4XPAL 1G9NC 1UOVA 3HE6C 4M43L 3Q8BA 4JFED 3INUL 1BEYH 1FCGA 5H37H 1I3RA 2X4NA 5F7AA 3QEQA 4JMNA 3KXFB 4NQCA 3VE0A 1FHNA 3UTOA 2FR4A 1AI1L 3NGBC 4K8RH 1ZA6A 2G3ZA 3QQ4A 3KBHE 1IC7L 3GMLA 3VCLB 3VXQA 5E8EA 2FSEA 3X3GL 1CYGA 4IBLT 5KVEL 1BFOB 4KJQD 5KVEH 2ETWA 1TVHB 3M07A 2FEEL 1FC2D 2WBJA 3UMNA 5AD0A 4PJXF 2EVHA 5DZAA 1RZIB 1ZVYA 4M9PA 2RFXA 5HDQL 3VFRB 1D7BA 2VQUA 5C0AE 4NQQA 3NCJH 3DYPA 5IJKC 2XC8A 4M1DL 4H5SB 4MD4A 3LY6A 1IM3B 1INDL 4OZGF 1FYHB 4TNGA 1RJYB 3P9WB 1R33A 1CFTB 3IPBA 4NP4L 1A4CA 3CIQA 3STLA 4F5CE 4JB9L 4HZAA 4MMYA 4K5LA 3ZDYE 4M1GL 3L9BA 1OP9A 4U3XA 1IL1B 3H3PH 3BKML 1E7UA 3QDJE 4N1HB 4KNQA 1RZJH 3L7EB 4LVEA 3UROR 3SYOA 2AFNA 4LEXH 2GYSA 3DVFA 4DUVA 3GSQB 2BHUA 2N1KA 4X5PA 4FP8H 1UXMA 3TPKA 2J8UF 3VFMA 3KVPA 5I9QB 3DHPA 3EIFA 3D39A 3UACA 1KXQA 2E7CA 3MCYA 4FQLL 1OAYL 2H0JA 1PZ3A 1FYTD 1ITBB 1WTLA 5T1KD 3UGXA 2ZIDA 3SDDB 3KPSE 4CSPA 4HIJB 3BWSA 3L54A 2XQYK 2DWSA 4W93A 4D9LH 3X12A 1D5ZB 3FB6A 4WEUD 3W81A 3DBXA 4PRPE 3UTTB 1NCNA 4JPVH 2IEPA 2YD3A 4NWTL 4GP5B 4XNMB 1I1YA 1KTBA 4F33B 3EH5B 3C08H 3QEQB 4YEEA 3C08L 1JK9A 2FWOA 3W38A 4IRSA 3TN0B 3ARFA 1D7CA 2BC4A 4IGBA 2A4ZA 2P9RA 2OJZH 4ODTL 4JW3A 3SBWC 4D7BA 3PWVB 1KPRA 1QRKA 1HI6B 1YNTF 2EKJA 2ZYHA 1NZRA 1NBQA 2HKAA 2HLFC 1L3WA 2NLJB 4DOHB 2NQ3A 2J71A 2ZQKA 4JR9L 5GJTL 1CL7L 3CC5A 4G6KH 4UT6L 1JZ5A 4LSSL 1J87A 2VNCA 1ZOXA 3GIVB 3OZKA 3PNWA 3V0VB 4LXFA 3K2MC 5IHUH 3T4AB 2A6JA 2ADFH 4BQ9A 3PL6D 4RMQA 4Q89A 1MXGA 1FN4B 3HI6L 2PLTA 1IEBB 3HLAB 1IARB 1EPFA 3S8WA 4U1GC 1CLYH 1F4YL 3K0WA 3SOTA 2A74C 2IAAC 3ZZ1A 2XG5A 3VMPA 2R23A 4HLZG 2WBJD 3WDJA 4A7GF 1GGBL 3WN5B 8FABB 4WEEA 1Q8MA 3ZDXE 5A2KH 3DDFA 4FJYA 1E9PA 4OI9A 1YC8A 2HAZA 1LM8V 3WIAA 1XZ0B 4MDIA 4ABUA 3TVMD 1YEIH 1JZHA 4GQPH 3FPYA 2HLAA 2W0FB 5ANME 5GQBA 1HHJA 4OB5L 2QZQA 3RDTB 4PRNB 4P9MH 3GTTA 2R2HB 3MYJB 4RISL 1JXDA 1KJ2B 2A6KB 3KPQA 3TT1H 4TTGA 1DQJB 1DANT 5CJXC 2IOOA 4OZIB 4APQC 2H8PA 4ODVH 4EDWL 3VRJB 35C8L 4GXVH 5ELIA 1G7JA 3VMOA 2QADC 5J6SA 2ITDA 3S5YA 4KV5F 1RXLA 4YGAB 1FVDA 4MMXB 3IK2A 1R3KB 4OLEA 3OGCB 1YEJH 3FW6A 4L8DB 4XWGH 2OBGA 1CGSL 3TIEA 2KERA 1VERA 1OM9A 3WU1A 1N10A 5EUOF 5T3ZH 5KG9B 4X5XB 4PJ8B 1ODAA 4G9DB 4OW6A 1DCEA 1W0WB 5A2BA 5C0RL 1JYWA 3K2UH 4NZTH 4H26B 1Y0LB 3P4MA 3QQDA 4DVRL 3QIBC 3IETB 4XTRD 4MAUL 3QXUA 5E08H 1K4DA 1RZFH 4OGYL 3FJTA 3BSHA 4IGBD 1U8KB 1E2WA 4P2AA 2DV6A 3RGHA 1CXFA 4KK9D 2QBWA 2PABA 4P5MB 4KUCF 3G5YA 3RGVA 5BVJB 4JFZH 4FS0A 4UT7H 1OCWH 2VLRD 4YHYC 4FZEH 2AZUA 3EGDA 1HQ4A 2EVIA 2JJWA 2WXRA 4X6EA 1NC4A 4QHKJ 3U7YH 4PWEA 2NTFA 4LFHD 5K9OB 4NIKB 2XKNB 1TDQA 4FE9A 3B7TA 3NAAL 4MB5A 1KXQE 3PUUA 2VQ1B 5I1JH 5B1JA 1RUPL 4PJAE 5ILTL 1VZGA 2X4RA 1RIHL 4KVCL 5DJCB 1SF3A 4TSAL 1Q0YL 3BUTA 4XVOA 1GR7A 1ZTXE 3NYKA 2BVUA 4YGVB 2JF1A 2EXTA 4PS3A 2HTKD 1J48A 3PGCA 3PWUA 2J5LB 2FIRT 2GJ6A 1UD5A 3VXMB 4PJ7B 1KCRL 4Y1TA 2BZCA 4ALAH 2B1OA 5FR3A 3EF7A 4JRXB 5AVUB 1BOYA 3MLSL 1UYWL 2KUTA 1FV1B 4ZYKB 4G6JL 3UO1L 4IIQA 1JNNH 4B5EA 4LP8A 4CN1A 5E0FA 3CHSA 1IGYA 5EZLA 4TS6A 4N5EC 2JTDA 3LHAA 3MU3A 3WFBL 3KPOA 4MJ5B 4PV8B 2I26N 5GRJL 3FF8A 1JBJA 2R83A 3G6DL 1MHCB 1BWWA 3BZ5A 3L3GA 2XXMB 3EJYD 2WIIB 4G11A 3F01A 3AY4A 4P2QB 4AOFA 3CH1B 3HG2A 4GOSA 1FG2B 3BO8B 3WY1A 3BFWA 3AB0C 3C12A 3BGMA 2IPTH 4P4KA 1SMDA 2FLRT 3LNFA 4RGOL 4R5VA 3A6OA 4ZFOA 3IFNL 5J9PB 1S6NA 1FL5A 1OT4A 4MB4A 3CFBA 1RJLB 3CFJA 1Z5HA 2CO3A 2H6OA 4MMZC 1BZ7B 1UJ3C 2ZKHH 3DKHA 2ZCLL 4LPUA 4NXSA 1A8JH 1I75A 1XH0A 2AQNA 2RR3A 4FFTA 4E41D 5HPMA 2O72A 2XPYA 3FQYA 1A1OA 2G5RA 3WYRA 1YN7A 4JQXA 3C6LA 1B4JH 3BEWA 2BVPB 3MZTA 3VFNB 2NY7L 1INQA 4Q2ZB 5DEGB 5JIQA 1TJHH 2CD0A 3FUMA 3IDGA 4I13B 3O9WB 4JG0L 4YO0A 1KJVB 1TYEB 2HTLC 5KYUB 1PD6A 5FGSA 2ITCA 2AZAA 1FIGL 4ORGB 4P2YA 3HG1D 1QQDB 5L2JB 1KMGA 1FIEA 3FT3B 5FUZH 2B4CH 3JTTB 2QQNL 4LESA 4KKAC 1YQVL 2B16A 2NCMA 3U36A 2R9HC 2VKXA 4NUJA 3NJIA 5KVDH 2OX5B 1X5YA 1K3IA 1MRCL 4HSAC 5DT1L 4GAJH 3ULSA 2VC2B 1TZGL 1MCOH 3H7BA 5IQMA 4B6ZA 4LOEA 4PJBF 1QSFB 3HAEH 1FJ1A 4BFEA 3TJHD 1X7TA 1CFVH 4ZTPL 3V0GA 3H9HB 5ITBL 1BPLB 1MY7A 2YUXA 4LSTL 1RD6A 3K6SB 1BIHA 1ONQB 3KPSA 3VXSD 1LEGA 2VDRB 1ULVA 2R69H 2CLVA 3VRLE 2GUOA 1X4ZA 2PO6B 2QGEA 2AP2A 3POCA 3QQXA 4A7GA 5DO2C 5BZDB 2WD0A 2WWKT 4QHMB 1V5JA 4XPGH 4G7QB 2H9GB 2QELA 5DD0H 5C0CB 3DSFL 4WO4A 1JZJA 3SJVE 3VD1A 3QPXH 3B37A 5FOBA 2J73A 3NQKA 5K59E 1I3GL 3HLKA 2DLIA 3TWCH 2MHAA 1ZT7A 1DJYA 2J1XA 1GZPB 3PDGA 5IQ9B 5I1HH 1MHHB 5J3HC 1A1MB 4YO0B 2EKSA 3TEYA 4I77H 5DJ6A 5B3SB 4BFFA 3AS1A 3LNEA 4Y4KA 2BIIA 2MNJB 3I3EA 1I3UA 1MFAL 3EFOA 2IOIA 1OAUL 1R5WA 2DWEB 2ZZUT 2A5UA 1U58A 4RFNB 4RGMB 4WO4B 4AQZA 4PB9L 4B9YA 4XGZA 3UJJL 4A7SA 4QAMB 2ZJSH 2FYYA 4CNIB 3IEAA 5F0MB 1RJLA 3CFJB 3ME0A 5CM1A 3G5ZB 5E24E 5D4JA 4JO4H 4HGWB 3TH3T 1E7VA 5E9DB 3H9SE 4U6HB 4X8GA 1CF8L 5EUOA 1JNHB 4U2ZA 5ISZB 3NSFA 3JZ7A 4Z7NF 3QC5X 4EN2A 2OW7A 1WICA 4JY6A 1HH9B 2GI7A 1BVLA 3FUKA 4MRBA 2BINA 3U82B 5HHOD 5BQ7A 4TN9A 4YSTA 3EGXB 1JI2A 1U8IB 3H3PL 5BRZD 3HCVB 5I23A 2XN9E 4Z1PA 4ELKA 3ZIMA 3RDJA 4NBZB 3GLZA 3HNSH 1GY2A 4L3EA 4ETQB 3EH3B 5HJ3B 1G9EA 2X4PB 1L9MA 4H20L 4KZDH 3VWKD 3SBWA 3ZHKA 4H7VA 3UX9B 2VH5L 3BYYA 3ESVF 3DSNA 2GITA 1TPXC 2H6PB 1RIUL 5AYTA 1RUKH 2J3SA 2YD1A 2Q6WA 2PR9A 3O3AB 3BUYA 3ZIYA 4MJ6B 1N0LB 3D39D 3CNKA 2VXSL 2AGJH 3DO3A 4YGVA 4JPVL 2YARA 2YAHA 2EADA 4IRJD 5CZKA 5F8QC 2ZUQB 3JT2A 5HDLA 3RU8H 3HW7A 4FTVA 3REVA 5C0JA 5CEZL 3N3EA 4LSUH 2DD8L 4AW4A 5KZCB 1Y6MR 3UPRA 4I85A 4CVZB 2EZ0D 3LAFA 1JWSA 4FMKA 4PV9A 1N70A 2Q86A 4WKZB 4U1HA 3WFEL 2AVGA 3N9GH 1Q72H 5EB9A 3REWB 2HT2C 3RY5A 2AABL 4EI5A 5ACZB 15C8L 1ZT1A 2A6DA 1JWUB 3GXPA 4GIAA 1MCHA 3EUDA 1F90H 4N8VG 3IJSA 4FQIL 3QRGH 4R4ND 1B0RB 3ARDB 4ISVA 5FK9B 1A1NA 4PP1C 2MQ3A 2VAAB 4Y9BA 1F2QA 3EDDA 4LRNL 3FSWA 1MHCA 4G9FE 4J12A 4M1GH 5D7LA 3KZ8A 4RGND 4MQXC 3L5XH 5FYKH 4LSRH 1V54B 2WVUA 3U6XS 3LN4B 5G4OA 2AF2A 5DDHB 4KTYA 3ZDXF 4HKZB 4ODUB 5T8IA 4RISH 5CKAA 25C8L 4J2XA 4JE0A 5AQ0A 4BK5C 4PRPD 1U8LB 1JRHH 3HB3B 2ISDA 4EZLA 3NTCL 3KEDA 4PG2A 3ARGB 1RJCA 5DZOA 4XMKH 5FB8A 3DI3B 5IZ7A 5EOCJ 3GLAA 4M48L 2DLTA 3LS4H 3FFDB 4JY5H 3IMUA 1CK0H 1YG9A 1LP9A 3LIUA 4MQTB 1GH7A 1M9SA 1F6FB 3ASWA 4MS6A 2ZOTA 4Y89A 3WIFA 3GNML 3DIDA 4LLMB 4QRRB 3S37H 2EVJA 4NC0B 1U8CB 2DIAA 2OMBA 4WW2C 2X1XR 2VO5A 3FCTB 3SEPA 2VABB 1XR8B 2JKRM 2XWJA 1W72A 5TE4H 4R4FH 3WEOA 4HOZA 2DQ6A 1XMWA 2E9GA 4CN4A 4KH9A 3RA7L 3C87A 1L7TL 2HKHL 1EJOL 3D39B 1JWSB 4PV9B 4OH2A 2ERJB 1NFKA 2Y0SA 3FT9A 1UJ3B 4H1LA 1X9LA 1AGCB 1AGBB 3JV4A 3MFFB 3VA2C 3DX7B 2AEWA 2MH4A 4WUUE 4M1CD 2P5ED 1K4DB 4C4UA 2K45A 1BD2A 4B9GA 5DMIH 3RFZB 1CFSA 4WWKC 2LT9A 4DP0X 3WTSA 5ESAA 5GZOA 4RMSA 2NY6D 3JWNE 1N0LA 4N8CH 1OB1B 1OF2A 1RUPH 4X6DA 1OP4A 2C7UA 4MA7L 4JFHD 3NFSL 2MKLC 4GG8B 1QBAA 3GMNA 2A0LC 5EZPA 4X42A 4FEMA 4PJIA 3MLTA 2NCEA 4S11A 4O00A 2WBJB 1GCYA 1KNOB 5J12C 5AD0B 4AIZB 4HUWA 3ZDYF 2BHZA 4GNKB 1A9EA 4KHXL 5K9QI 3FOMB 3JWNC 1YNKL 4FI6A 3N91A 4GRMB 5JR1H 4YHZL 1OL0A 2AJUL 4X8JA 2D4DA 4OZGE 3CDYA 4GRWH 2Q7YA 5BW7A 5EIIA 4YJZL 2NX5A 4FLOA 4Z18A 2H26A 3KXFA 1EAPB 2B5IC 3T77A 3FBKA 1CU4H 2NY3B 1M05A 1X44A 4XNAA 1BGXH 4HUMB 43CAA 4WHYH 4LASH 4XP6H 3H9YA 3RJQB 3CHXA 4P04A 1NCGA 2VR8A 1FDLL 1G9MH 1KTLB 1QFWI 1YSOA 4G6AD 3ESNA 3V4PA 1F6AB 1NOLA 1KCVH 1YPZF 4K7PY 4XZUB 4ZZFA 1QYGL 1UD3A 1BPVA 1CN4A 3FOMA 1ZLWH 3T0EC 4E9YA 1CR9H 2Y72A 4PJGE 2P8LA 2P8PB 1ACYL 1UJ3A 4B5ZA 4LRIC 1Z9SA 3V4VB 4G7YH 5FKPB 5IJDC 2CK2A 4E2OA 2O61A 1B0GA 5GZND 4FG0A 4CU6A 1N19A 4J3OG 1Q9KB 3NRFA 2G3XA 4Y5YA 3BQVA 1K6QL 4TLUA 5TTRA 1EHXA 1A25A 4NQEE 1D5IH 1MCIA 4P5RA 1NCOA 4XBMA 3UGEA 1QFWM 3LKOA 2X2JA 1NDGB 1M71A 1CLOL 5LBVA 3CPLA 1TPXB 4B9CA 2FIKA 4OKVA 3WHE1 3EYSH 4AVJA 4JO3H 4R97B 3L3IA 1QUPA 3L6FB 1WAAF 3PHQA 2BP0A 3QORA 5EZOH 5GISL 1W6WA 3MV8A 1KNOA 1HWGB 3MTXA 1CGWA 2YPVL 2VAJA 2IBZX 5IEHB 5LBSA 3BP7B 3MC0A 3VX1A 3ESMA 1NCTA 2C3GA 2FJHB 3DBXB 3UTTA 3M17A 2X2HA 3TPUB 2EXWD 1XGRB 3TA3C 4X6BB 1FNEA 1W16A 32C2A 3OR6A 3O45A 1ZWIB 3MFGB 2BMKA 4MCZA 1MDTA 5F9AC 1RU9H 3ARVA 3VB9A 1QLEL 1ZGLM 4ZQKB 3MN8A 5I1KL 1AKJA 5HYJE 5GSRA 1NPJA 3S3DB 1UCBH 4AYSA 1XGTB 3AQZA 5KEZA 1HEJC 3VXNB 3W9EB 4L4VA 5CF3A 2N7SA 4M3KB 4GPVA 1WCBB 2Y1ZA 3H9SA 1ASPA 1TYJA 5IUSA 2HVBA 4YWGL 1AOHA 5CGTA 5B38B 2FH8A 2WGNB 3VWKB 1NGQH 5CEZD 1BG9A 2MWCA 4HC1L 2AJVL 3UTZB 3UYRL 1E27B 5FYLE 3GMRA 4M03A 5EPMB 2HT4D 4ACPA 3LZQA 4Y88A 4NJ9L 4RQQB 1G4RA 1DJXA 2KKQA 1IC1A 7FABH 3U9PH 3KG5A 3S5LA 2RFXB 5KYWB 3E80A 4Y4KC 5CN1A 3MLXL 2I9LA 1P5UA 4JFDE 5I1HL 1QA9A 1WF5A 1UT2A 3B7RL 3EO0A 2WTOA 3ZDWA 3O3AA 1VFUA 1IGIH 1JXJA 3GWJA 3L7FA 3LN5A 4AYDC 3AXLB 3CHOA 5CGYC 3FU9A 4M7JH 4OCXH 4ZW5A 4XCEA 3P0VL 1I3GH 3PP4L 3SE6A 5ITFA 3U0TB 2R4SH 3O2WL 2YEZA 4BKSC 1CGYA 2CM6A 3U7WH 4FNQA 4XPGL 1NAML 4B9KC 3GB7A 3BXNB 3I6KA 5AVRB 2H1PL 4HKXA 1XB6A 1WJ3A 2GK2A 1OTUC 2IOMA 2FT8A 4OQTA 3RFZA 3N1QC 2YPLE 1E8XA 3FSOA 3QORD 1CZ8L 3HUJE 1NIFA 3KJ6L 4PRHA 4QXWA 4F57L 1MEXL 2GTZA 2DQHL 2IDSA 4U31A 1AMYA 4GLRH 2GITB 4GJTB 4NUGH 5DFVC 5D8JH 5BZXA 3W5NA 1EZLA 5EA0H 5DS8A 3GSRB 2H2SD 2XYCA 4A1RA 4I88A 2W91A 4OZHF 5EU3A 4PJFB 4Y5XC 3GZPA 1PKQA 2P42B 4KX7A 5D7KE 2W95A 2DWEA 3CVIL 4DK6A 1AIFB 2Z9TA 4OM0L 1EDYA 1SNRA 3GPEA 1XIWC 3B2VL 4BWTA 4AWJC 2XBDA 1HOEA 1RUKL 2Y1VA 1UQSA 3GK8L 3Q8CA 4V1DD 1TSRA 1MI5E 3B8SA 1TZOA 4PJCA 5IUCA 1ID2A 2NY0D 1DQLH 1KEML 3N50A 4U6HA 4PJEF 5GGUA 2X28A 4OTXH 3QAZC 1UWEH 2E7DA 1U36A 1KJMB 4Z7WF 5GZNA 1OB0A 4ES9A 4J4PA 4FNSA 1QW8A 2BCMA 3QFGA 3ZO9A 3D18B 3QNXB 4MJID 4NC1C 3O6LH 1L9RA 5E1QA 1Y18A 5KOMC 3D3VB 5JMRA 4NJAH 3TCLB 3DX3A 2XG4B 4N0RA 3HKFA 2Y36L 2DLFL 2A0LD 5CD3B 1UXWB 2UYLA 2WKGA 5TF0A 4FTVB 2GQHA 1QASA 1BIIA 3CSYB 1CLCA 2VXSH 1KUMA 5EUOE 1OSEA 1T66C 1T6VN 1S3RA 2OZ4L 1EXUA 4BZYA 1FZKA 2WYHA 4OCWH 4BRVA 3I75A 2WNWA 3V2AR 5D6DC 1OAXH 5C0CD 4M1CC 1UJTA 2ATPB 1QRNB 1UEMA 5HYFA 5E9DA 3BZEB 1CE6B 1GJWA 3BISA 3QHTC 3QGVA 4FTVD 4G9FD 4WW1B 4PJAA 4M5SA 5B39A 1S7QA 2R39A 1A6ZA 2GIXA 4JFQA 4QHMA 3TGXA 2HYMA 2H6UA 5F1OB 3WG7B 5D7JB 1Q9LA 1SEBA 3P0YL 1B2WL 3OAUH 1QFHA 1BFVL 3P9LA 4JN2B 4JL1A 4UIKH 3L81A 1BFVH 3EH1A 2ZXCA 3CXFA 4FYQA 4L4VD 2V2XA 1N8ZB 5AW2B 4UT6H 4AX3A 2DQGL 3RDTA 2Z91B 3TNNA 3SKMB 4U49A 2DWDA 1YJDL 3SY0A 4U1MA 1RSYA 5JPNA 3WJMB 2QHLA 3DSNB 2F54A 1A6AB 3HZYA 4WO0A 3BRDA 2JQAA 3MUGA 4UZUA 2ILLA 3P30H 4I0CC 1OZUA 5F97E 3VX0A 2NNFA 3RKDD 4J6RH 3CVCA 1N5YL 1VEOA 3BKYH 4YSUA 1GGBH 2WB1A 1QHQA 3NZ8B 2XPGB 1YA5A 4IOSA 1GZQA 2OR7A 2GB2A 1CK0L 3T3MB 2ODIA 5BQ7B 4PJDF 5I8CB 1MUJA 5D93B 5HYSG 3U4EB 4EUPH 3QXVA 4HKBA 5EWIH 4Q9CA 5ISZA 3SDXB 2CJ3A 4DN3H 2PCFA 4HPYL 4MJIA 1QUNA 2DQIL 1INQB 1A6AA 3HZYB 2PCPB 4XWOD 3UBXI 5C6TL 1EHAA 1EAQA 3CDGA 5J4MA 4GI9A 5AZ2H 4WU5A 4F7KA 2E3VA 3TOPA 4R0LB 5DF0A 2VR7A 2Y4SA 4UOQA 2B14A 3DRTB 3QI9C 3GRGA 4N3TA 4R4FL 3V10A 3FB8A 4E9TA 2NW2A 1TFHA 3KWVA 4L4VE 1IGML 3TBYB 4W9CC 5BS0A 4JPKH 3MKGA 5PCYA 2FX7H 2P5WA 2EKSB 5HYJA 4JUSA 1XL6A 3H7LA 2N1TE 5DLMH 1R6VA 1P7QD 1P7KB 4AEHL 5EU3B 5D7LD 1T2QL 4XMZA 3BVVA 3WTWA 4FQQA 1QSFA 3CDGB 4W9KC 1QSED 1A6WL 3FO9B 5T1LB 1VFMA 1MWAL 4S1SH 1S9YB 2KLRA 3HBZA 4JPIB 2FL5A 4PIBA 4HFWB 4KNUA 5C0ND 1CBVL 2Z7ZA 3HN5A 1KBVA 3RWIB 3D06A 3CHPA 4OBRA 4Y16D 3Q2VA 4JZNA 5ID1A 1NA8A 1QLEH 3AUVA 1ERNA 1FZKB 1XB8A 4X6EB 2APBA 3BAWA 2EIEA 1IGTB 1MFBH 1TZIA 3LPPA 5F1IB 3D09A 1DP0A 1AQMA 2H41A 4NRYB 4JG0H 4YPJA 5TF1L 1KYDA 3ZRFC 5I1EH 5I6KA 1NCWH 1U3HC 2L7QA 2WC7A 1ZHBA 5F93C 3VXUA 3K6DA 3L5WA 5J13C 3BJLA 3TCLA 5I1AB 3IAPA 3HZ3A 4QO1A 4ECNA 3D0LB 3V6FB 3VFRA 3H2QA 4NDMB 4P2OD 5D1XB 1E5UI 1G7IB 3EJRA 2B5IB 2MPAH 3OF6D 4YMPA 2HT2D 1ADWA 3QHZL 2IPUK 4KTDH 5A6MA 3KW7A 1QLFB 1WBYB 4QWWD 3OKDA 2L7JA 4ZTOH 2F53B 2DJSA 2OA9A 1ZK9A 2WTPA 2VLKA 4CSSA 4P5SA 4HWBL 3T6VA 2CIKA 4YFLF 1MREL 4ZD3H 4I18B 1M7IB 2J5LC