3QQXA

Reduced native intermediate of the multicopper oxidase cueo
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
494
structure length
474
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHDDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Blue copper oxidase CueO
publication title CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 140
structure length 474
sequence length 494
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA03
4YSTA 1OCRB 4HAKA 3GYRA 9PCYA 3FPYA 1ET8A 5TK2A 3ABMB 3IN2A 4A2GA 3QJUB 1A8ZA 3KW8A 3PAUA 1MZYA 4YSOA 2VSKB 2YAPA 3UABA 2EILB 4DP9X 3PAVA 3S8GB 2HXAA 1NPJA 1KV7A 5E9NA 4A2HA 2XUWA 2J57A 5I5MA 3FPXA 3SBRA 2VMJA 2DYRB 1ZV2A 4BDVB 3TBCA 1DYZA 2IDUA 4A2FA 1GR7A 1RZQA 1DZ0A 1MDAA 2AFNA 3SQRA 4DP4X 5B1JA 3DTUB 2A3TA 3L45A 2MRYA 4AKPA 3FQYA 3S8FB 4HCGA 1EZLA 2X87A 2XLLA 2PPAA 3QJRB 6PAZA 3H56A 1W8EA 5D4HA 3H4FA 4MFHA 2DV6A 1ET5A 1OV8A 3ASNB 3EH4B 2H47C 3MBWB 4KO7A 2PPFA 2FQGA 1ASOA 2AANA 3T6ZA 5B1JC 2VW7A 4E9TA 3QQXA 4WTQA 5PAZA 1ZIAA 1NWOA 1JZHA 2XXFA 2BZCA 4E9WA 2GSMB 2JXMA 4HCFA 1L9PA 3N55A 2UXFA 2I7SA 3AG1B 1CYWA 2IDSA 2AZAA 5I5JA 1BAWA 4NB7A 5AFAA 3FYEB 1A4CA 5ANHA 1SJMA 2HX7A 2YAEA 2I7OA 2H3XC 3WG7B 5I6MA 3JTBA 1OE3A 1AACA 1AS6A 1J9RA 4YL4A 3ABKB 1L9OA 1KBWA 2IWEA 4AX3A 4CSZA 1L9RA 2UXTA 2BZ7A 2LLNA 2QPEB 1KYAA 1ADWA 5D4JA 3X1EA 1JZJA 4KOBA 4G7SB 2AVFA 2YAFA 1A65A 1V55B 3NP4A 2BP8A 3UAAA 4BK5C 2CAKA 2YXVA 1J9TA 1ASPA 4GXFA 4JHUA 3WNJA 1OE2A 2YARA 1J5CA 1BYPA 1B3IA 1E30A 3QPKA 2CJ3A 1AZBA 3U25A 1WA0X 1M9WA 5EHFA 4DPAX 1NIDA 1OCOB 1NICA 1BYOA 3FU8A 1IKOP 1L9SA 2R7EA 2PCFA 4KNTA 3ZBMA 3OMAB 2Q5BA 1MG3C 5F7BA 2FT7A 1AG0A 4NERA 2H5UA 2VW6A 4YSUA 2W88A 3TBBA 2GIMA 4DP5X 4YSCA 4E9YA 2R7EB 1KDJA 4DP6X 2XYBA 2PPDA 1ZDSA 5F7AA 3WNIA 5B7MA 1PZCA 1AG6A 2CCWA 2OV0A 1A4BA 5I6PA 1GW0A 2EIKB 2J55A 1JERA 4YSPA 2PP7A 4ZK8A 2YAOA 4L0PB 3BVDB 5D4IA 3FU9A 1AZNA 2X88A 2YAMA 3HB3B 1BXVA 2HX8A 4YSDA 4HIPA 4BXVA 4DP0X 4AKOA 4M4RB 4BDVA 3NJKA 1A4AA 3DKHA 2XV2A 3AG4B 1PLAA 1GS8A 2FQFA 3TU6A 2FQDA 1AOZA 1PCSA 2DY2A 3PCYA 3AZUA 1NWPA 5I6NA 1SHXA 2ZWNA 3FSWA 4YSSA 4PAZA 1PY0A 4Q8BA 3ASOB 2CBPA 1JXDA 7PCYA 7PAZA 3FU7B 1NTDA 3T6VA 3X1FA 4FAAB 2UX7A 1KDIA 4KNSA 2QDWA 4G71B 5TK4A 3WKPA 3NJGA 2GC4C 5IY5B 3MX0B 3WKQA 3OMIB 3NJNA 3S3CB 4AZUA 4ENZA 3AW5A 3EF4A 4GY4A 2W8CA 1HAWA 1AIZA 1PMYA 1PNDA 3NJIA 2CALA 4F7KA 1XB3A 3QJTB 4YSEA 3FS9A 3NSYA 4YSQA 1XB8A 1J5DA 4HHWA 1SNRA 1JVOA 2P80A 3GXUB 2VM4A 2ZOOA 4JHVA 4E9QA 4QLWA 2FT8A 2TSAA 2UX6A 3T71A 3FSVA 5B1KA 2XWZA 2QT6A 4UANA 2FWLB 3NSDA 2BWIA 2TSBA 1AR1B 3WI9A 8PAZA 2PPEA 2DWSA 2YXWA 3UGEA 3IBOA 1FWXA 2HX9A 2XV0A 3QJVB 4E9RA 2XVBA 3EH3B 4A67A 4DPBX 2QDVA 4G70B 1JXFA 1URIA 2IWFA 2HRGA 2XX1A 2FTAA 1XMEB 2XXGA 2XX0A 2E86A 1E67A 4NAJA 2DYSB 3X1BA 3AY2A 1GY2A 1CUOA 3CZUB 3EH5B 4TXVB 1MZZA 3PXLA 1TU2A 2PCYA 4QKTA 1XB6A 4A68A 1NIEA 3NSCA 1AS7A 1GS7A 1QNIA 1OOWA 4E9SA 4YSAA 2IDFA 3AG2B 4W9ZA 3SBPA 1T5KA 2PP9A 2WSDA 2BWDA 1QHQA 1JZEA 1L9QA 4DPCX 2GHZA 4UAHA 3CDZB 2EIJB 3CVDA 2QPDB 5I6LA 3CG8A 1WAEA 3DIVA 2GI0A 4X4KA 1YLBB 2YAHA 4F2FA 4AI7A 4JKNA 1SF5A 4HCIA 5I28A 1M56B 2HRHA 5LDUA 1BXAA 1GYCA 2XU9A 1VLXA 1ET7A 5A7EA 2MTAA 3UAEA 4P5SA 2VSMB 4G72B 1SHWA 2PLTA 3ZDWA 2J5WA 1J9SA 2ZXWB 1V10A 3IE9A 3NJLA 5B1BB 2I85A 3BQVA 4E9VA 1W6LA 2BHFA 1SDDA 1EHKB 3H4HA 3NJFA 3HEIB 1BQKA 1SFDA 3FSZA 2CUAA 1RZPA 4P5RA 4HZ1A 5B1AB 3QJSB 5I5IA 2N0MA 3NJHA 2PPCA 3X1NA 1CC3A 2BO0A 2BP0A 5AZUA 1FFTB 1SDDB 3TA4D 1PLCA 3UACA 1OE1A 4E9XA 1PLBA 1JOIA 1TEFA 3FQ2A 4UF7C 4BWWA 1L9TA 4YVNA 1HAUA 3NT0A 1F56A 1OCZB 3FU7A 3TASA 1ZDQA 1CYXA 1KCWA 2BW5A 2BW4A 2BP0B 1WA1X 2WO2B 1GY1A 1KCBA 3OD3A 1GSKA 3ABLB 1GS6X 5B7EA 1IBYA 1NINA 4BXSV 3AG3B 3OM3B 1AQ8A 3PLYA 1UATA 3FQ1A 4KO9A 1SFHA 1MG2C 1WA2X 1BQ5A 2B3IA 2IDQA 1BEXA 3X2QB 1ZIBA 3NSFA 1IBZA 1QLEB 2PP8A 2UXGA 4PCYA 2HLEB 2WO3B 4HHGA 3KW7A 3ABGA 4DP8X 5I6OA 1PAZA 2OCCB 3FT0A 3GDCA 3SBQA 2FNWA 4N8UA 1R1CA 2YAQA 1TEGA 3OQRA 3JT2A 1J9QA 1IC0A 1JZGA 2UXVA 4Q89A 2GC7C 2HZHA 1W6WA 3ZX1A 1RKRA 2XV3A 1AZUA 4A66A 4DP7X 5B7FA 1AS8A 2Y69B 3V9EA 3D12B 1RCYA 2VN3A 1AANA 1BQRA 3RYMA 1AZCA 1BXUA 2FT6A 5FC9A 3CVCA 3PPSA 1PZBA 1PF3A 4DP1X 4M3HA 4EF3A 4FA7B 1V54B 1NIAA 4KO6A 1OF0A 6PCYA 1ASQA 3IN0A 1NZRA 1NIBA 2EIMB 1SF3A 5PCYA 1AZRA 1TKWA 3FSAA 1M57B 3C75A 3NYKA 4G7RB 4KOCA 2P80D 4BWTA 5AKRA 1N70A 2AZUA 1A3ZA 1IUZA 3CDZA 3NJJA 1X9RA 2FJSA 3V9CA 1OCCB 4KO5A 1NPNA 2Y1AA 5B3SB 3NP3A 1ILSA 3G5WA 4GYBA 1PNCA 1AAJA 1KGYE 2JKWA 2IH8A 1PZAA 2J56A 1JXGA 1JZIA 2IWKA 3T6WA 3EHBB 3S3DB 2VW4A 1JZFA 2OJ1A 4GP5B 4YVUA 4F2EA 3OMNB 2NRDA 1E5ZA 5I6KA 2Q9OA 1ZPUA 2YQBA 3WIAA 3ZIYA 1N68A 2VM3A 4W1TA 3NJMA 3X1GA 1I53A 2B08A 4A2EA 3ERXA 1ILUA 1HFUA 4GP8B 4K9JA 4N4YB 2RACA 4WKXA 1E65A 2FQEA 2BP8B 3T6XA 4G7QB 3IEAA 2DWTA 4KNUA 1KBVA 3N2JA 3S3BB 2IH9A 4HALA 1NIFA 4A2DA 4BWUA 1ID2A 1CURA 3UADA 1WS7A 5I26A 3FYIB 4RH4A 2ZONA 1FA4A 3T9WA 1JVLA 1ETJA 4GP4B 3QJQB 2EINB 1E5YA 3CVBA 2GB2A 2IDTA 4AKQA 4DP2X 2GBAA 4YSRA 1WS8A 4CSPA 1NDTA 3PAZA 1X9UA 2JFCA 2IAAC
chains in the Genus database with same CATH superfamily
1RHFA 1JN6A 1OCRB 1RI8A 4WWOA 4GPVA 4UB0L 5DFVC 3S34L 4AM0B 1RZGB 4JPIA 4Z7VB 4B96A 5C0IA 1XGTA 5EEXA 4A6YL 2MOGA 2OJEB 1G1OA 4OD1H 2YOAA 1ZA3B 1WTLA 4P23B 2ENJA 3OR6A 5EOCL 3ULUF 4OJAA 5EO1A 4G8IB 5DF0A 5IP4A 3DUUB 1OSPH 2Z92A 1A1MA 3OR7B 4KUZH 3ZHKA 4HPYH 5DD5H 3P3UA 1HL9A 1G6RH 3FH5A 4M43L 4Y4HD 5HD8D 1KTLA 2I32A 4I0CC 4M7KH 5J89A 3GXMA 3L4XA 2LR4A 2D7TL 4R96A 2A74A 4OQ1A 1FBIH 5EV7A 1YA5A 2G2NA 2ZCZA 3FQXB 3RZWA 1NFIB 5DD3H 2EH8H 1UKSA 3MJ6A 4MD4A 4DP4X 4HWBA 3HHMA 1BW8A 4KUCF 2B5IB 1TYEB 3C2SA 4KKPA 3GKWL 4E5XB 4QHMB 4LCWD 1P7HL 3IDXL 5L4FA 5KVFE 4HZLB 3TF7C 3VFMB 4JFFB 1CXHA 4HXBL 5DJXA 2EKSA 3FDWA 2IF7A 1HH6A 4RISH 4LGPB 3ZR6A 1IC4H 2J1YA 1AKJB 1P6WA 2BXYA 3FQWB 4GI8A 3K71A 4ICXA 3RVWC 1KN2H 2J8UB 2O93L 4N6QA 1BREA 1KCVL 1DQMH 3AS0A 2VDNL 1ZIAA 2DQEL 1K6QH 1CFSA 1DLHB 1WEJL 5KJRH 4HJGA 2ZWYA 3H3PL 3PF2A 5KS9B 1VFAB 1L9PA 3AG1B 1KTCA 4FG4A 1GGCL 5DMIL 1QP1A 5ACMA 5K93A 5CGTA 3THML 5JXEC 2EVIA 3L5XL 1ZK9A 3BPCB 1HN1A 1KIQB 3QUYA 4TL5A 1TVHA 4WUKH 1QUNA 5F7UA 2EDLA 2Y9RT 3C5ZB 2X4PB 3W9DA 4FI6A 3KPNB 4G8GD 5T1MA 1N2RA 4ZTOL 2M83A 4U2YA 1XBDA 4F1ZA 2DWEA 1OTTD 3KXFA 3MRFA 3V0HA 4UAOB 5F89A 4JFQB 2X70A 4B5ZA 3BWUF 3N41F 4IBYA 43CAB 1GOFA 3X1EA 1JZJA 2O5YH 2YAFA 2R4RH 3IFNH 1ZTXE 4KDWA 5KWYC 5DSCA 4DEWA 1H3PH 2C7FA 1HXKA 4B9KC 1LMIA 5FGSA 4UNVA 4IGBA 4KQ3H 4S2SA 1J5CA 5JPMB 1J7VR 3I9GH 4LQFH 4AQ1C 1MIML 1MHPL 1XZ0B 5D6CB 4JR9L 3O2DA 2WNGA 2CBTA 1RIUL 4JPVL 4NSKB 2VC2B 3CQPA 5HHMB 2DQTH 4PRHD 2ALAA 3MJWA 4R4FH 3HTLX 4CSTA 4PHXA 1F3RB 1KEGH 2A6IA 1AG0A 3DO4A 4Q9CA 5IJVB 1J12A 4MKTA 4NCC2 3ARED 1A22B 2YJQA 1R6VA 3MRGA 5ABDE 5C0GB 1SN5A 3F83A 4GEJA 2X2JA 3M1CA 5BPPA 4X8CA 4O02B 4CGUB 1SDAB 2G3ZA 5AW8B 2DPKA 2MHAB 3QSKB 3VFVB 1CVRA 4PJ8D 3O9WA 4YIQB 3LHPL 1IM9A 4MCNA 1YQVH 3BAJA 2J72A 4NZJA 3GO1H 3WIIH 1S2EA 1H6TA 3ECVA 1JDAA 3Q3GB 3ULVD 2YEQA 1WJ3A 3BVTA 1KCUL 3I6GB 2HFEB 4BXVA 3OZKA 4OQTA 3DLQR 3TN0A 2UWEB 3IWVA 1HILA 3UYPA 4QRUB 1T2XA 4UT9H 3EZ8A 4GW4A 5JQ6L 1F58H 1PLAA 4FX5A 3EJYC 3HC2A 3MTRA 2X42A 2DY2A 4RMQA 3AZUA 1SHXA 4QRRD 1XGYL 5CGYC 4JFHE 2ZAIA 4ZW6A 5EUKB 3QEQB 4UNTA 5ECJE 1QLEH 2VH5L 2YRLA 4PJ5E 4N0UB 4GUCA 2ZXCA 1BAGA 1M6UA 3WS3B 5CGYD 1JZ5A 2MNJB 5CKAA 1GKEA 4ZFFB 5EZOH 3AGVA 4HGWA 4FRWA 2GC4C 3TH2T 5CHNA 3WNMA 2L4OA 2ZP8A 4ILDA 3DNKA 4N1HB 3NJNA 4AZUA 1QWUA 3L5WA 3F5WA 3BQUD 1K3ZA 2Y07H 1PNDA 2ZUQB 3O4LE 2WGXA 4LSTH 4TUJA 3NACL 1Q1PA 2ADYA 4AEHL 1UFGA 4KRNA 2DJMA 3CC5A 1J5DA 4NQDA 3RA7L 2E59A 2QR0A 4KKQA 1XGUB 1DQJA 1HX0A 2OMBA 3U4BL 2VUKA 3WKYA 2N1KA 5EBMA 4NAMA 2TSAA 3G6DH 1T80A 4L9DA 4YR6B 5MEND 5KSAA 1J0YA 3QUMB 4X5PA 3Q8BA 2P42B 2X6UA 3PGFL 3EJTA 3A67H 3JT0A 4HQQL 3PQYD 5C3TA 2XN0A 3IDGA 4Q2ZA 4K71B 1S7UB 2ERJB 4P4RA 2NY4B 2YGVA 1HHIB 3T1FB 4BCZA 2WMPB 2DMCA 1GYUA 4YGVB 2CLZA 4CMMB 1TZ8A 3POHA 4CVUA 3IKCA 4PJAE 5KYYB 1F86A 3QRFM 5ESQA 1OSEA 1GH7A 4MCMA 4UU9A 3BVNB 2E6JA 5H2BB 4WFHE 3UMTA 3MLRL 2HFFA 2D0GA 5HGGS 1TU2A 1NA8A 2FIKA 1XB6A 2PCYA 4YL9A 5LGJB 5JDJA 3HPJB 2B1AH 1XGZA 3CZKA 1M2VA 4PRDB 1MJ7H 1UUNA 2P1YA 4G9FB 3RY6C 1M7DA 2BSTA 1RZKH 3E1F1 4XNQA 2V8LA 2VDOH 4JDEB 4XO8A 1FL3B 2YEVB 3I3DA 2GHZA 5DGRA 2CHZA 3ILPA 1QI3A 3L5JA 4W4OC 4JG9A 1EJFA 4OLUH 4UILL 2GI0A 5C3LD 2G5RA 3DROB 5DJYB 3TURA 3Q8EA 1IZKA 3DMMC 4K7FA 4QOKD 4HCIA 5ID0B 3MO1A 3NABH 3SODB 3FB6A 4U6VL 1LE9A 2MH4A 3B9EA 4XP1L 1B4JH 2WV3A 2ATKB 2D03H 1AO7E 2OSLB 4L3EB 3SDCB 4O2EA 2B2XH 3DMMD 3PWUA 5BQ7B 5C0FB 3GQFA 8FABB 4HLZH 5ADOH 4ZG1A 5HVHB 4J3UA 2XPYA 3KPPA 3B5HA 1WBZB 5E94A 4AOFA 3ZQ9A 1BVNT 2YPLB 5EU7E 4JKWA 2QGEA 4E9VA 2BHFA 3JWNC 3TJEH 5AEAA 3LRKA 2TAAA 2IO5A 3RWDA 5EZJA 3E8UH 4PJGB 1F6LL 4PVBA 3KJ4C 4P5RA 4HKZB 4MJHA 4AMKH 3FTXA 4I2XE 3O45A 3R0MA 3L3OB 5JHDB 5EN2B 4JMXA 2K4WA 4Y4HA 2FVNA 5JDSB 2LV4A 3MRQB 1MCEA 4UQ3A 2VLRB 3VXMD 4CVWA 3N85L 1NM9A 4HK3N 5DUPL 1IM3D 4FMFA 3FU7A 2PXYB 3DJRA 2VISB 5GZOC 4MYWB 4JRXE 1D5BB 1JVKA 2JTYA 3HE6B 3DX0A 2F1AA 5DMJB 5CLWA 3OD3A 1OGSA 3MX0A 1G0XA 2GFBB 3SY6A 4LCWA 1SJHB 4L8SA 4KK5C 3T8XB 1CGSH 3STZA 4WUUE 1SXAA 2B3IA 3LB6D 4HFWB 4YN3A 1CD1A 3ATAA 3S5LB 3RWEB 3P77A 5C09E 5DWUH 2Z91A 3RL2A 2E75C 2OZ4L 3BOVA 3FO9B 2PP8A 4R83A 4HHGA 3KGTA 1C08A 1TTRA 4JE0A 2VN5A 3MNVB 4PJCE 4TNFA 1AE6H 3S5YA 5C6PB 5EPMA 2JLPA 1KTKE 1FFPB 4GW5B 3UH8A 1NSNH 4MLIA 3NCYP 4V1DE 2J73A 1UD4A 3NEXA 3M1OA 1EFXB 4KJYA 2EYTB 1A6UH 2Z93B 1FRGH 3LN4A 5HYJB 2V2WA 3AT0A 1U8NB 2CHXA 1TJHL 4FFWD 2BFVL 2H2PD 3GRWA 3FQRA 1BFOB 5E6IB 2W0FB 3OAUH 5BW7A 1XF4A 2BSRA 2FHCA 1VADA 2K4AA 3N1GC 5BZWA 3FQNA 4G8FA 4AJYV 5DHXB 4N0FA 1URLA 1ICTA 4DZBB 4HH8A 4L8BA 5EIIA 3NESA 1BECA 4FP8L 2AEWA 3DARA 1QFWI 3VQMA 5A2FA 3OX8B 2HVJB 1AGDA 1LO4L 1CE6B 5HY9B 1N7MH 1F11B 1BJMA 1BQHA 1FG9C 5DVMA 1NANI 3NYKA 4G7RB 3V4UL 1DBJH 3HAEH 2X4UB 5EA0H 4NZRL 1NGPH 4P5MB 1IUZA 4XX1G 5LB1A 3GSXB 3NJJA 4DW2H 2FJSA 4GMSL 2R23B 3QJXA 4G7YH 3GGWB 2WINA 3S36H 2W38A 3CDCA 4ZMQA 4DN3L 1I9RL 1TKWB 1JG9A 2E27H 1QTPA 3HZYA 2VMCA 3GIZH 5E9DD 4PY8I 1MAJA 1ZHKA 4PRHA 1BVNP 1X6NA 3QWNA 1JZIA 1QSFB 3HRPA 3GK8L 3RILA 1Z9OA 2ALWA 2OK0H 2DEYX 5HGAB 3AREA 4OFYD 4H8WL 3RDTC 1EPFA 1QYGL 1OXYA 1BG1A 5B39A 1RQ5A 3WIAA 1UGNA 3UIZA 1G43A 3CMGA 2OL3L 2HN7B 3X1GA 1OEZW 2X89D 3RDTD 5DWPA 3ELAT 3DVIA 3T0VA 4LLYA 2D2OA 3NCMA 4NAQA 3U0WH 4PJ8A 3NIFB 4WKXA 3ARGC 4JANA 1E65A 1IE4A 1A14L 1CPUA 4YK4C 1YUHA 1JGEB 5EWIL 3I6KB 2B39A 3VFUB 3CFJB 4TOYL 1T03H 1YY8A 2BPBA 2QQLL 3ARGD 3NGBB 3QDGD 4MQTB 4NUGL 3ALPA 5CM1A 2E7HA 3D4CA 1SXBA 1IJ9A 4K7PL 1FNEA 4UZUA 4L8CA 3W39B 2MCMA 1SYVB 3K4DA 3NIGB 2GK2A 4KPHL 1BF8A 2AJSH 4UYQA 1ZHBA 4X4XA 2G0LA 4HUMB 2E7LA 4BQBA 1REIA 2N3JA 5DJ6B 5MI0C 1O6TA 3O8XC 5JHAA 1HYSC 1BAFH 3QQ9C 1A9EA 4JQVC 3UTTE 1GC1H 4FFYA 4EEEA 1L9MA 3DV4A 4YS4A 4QRRA 4G6FD 3QH3A 3ZN6A 3QDHA 5IF0B 3A4AA 3IXAA 5J13C 5AZEH 5EBLA 1JZ2A 1CQYA 1H8NA 4KU1A 2WWMC 4AYMC 3FPYA 4LEXL 1UZGA 1T6WA 1E8XA 4GRLC 4WWKA 1K8DA 3VFOB 3T2QA 4RBPH 3RX7A 4RA3A 2H0JA 1KB5A 3WNNA 1CLVA 1DBML 2YUWA 2ZQKA 3K2UH 5BZZA 4CVXA 4DZ8B 7FABL 3QZNA 2JI3A 4GRLD 1SOSA 3KWTA 2KZ1B 3UABA 3VI4E 3BQUA 2ZSVB 1CLYL 3SDDD 4BUHA 2COVD 2GUOB 3ARYA 4MJIE 5GRXG 3FU6A 3JZYA 5CCKL 4AGPA 3LKOA 3ISYA 2DJ4A 3ZUNC 1S9VB 1EO5A 4ZX3A 1CWVA 1FHNA 1GPOH 2F5BH 1QZ1A 2PO6D 2FYYA 4N3UA 1IMHC 3GSUB 1K85A 5J1SC 5KUKA 3PQYA 4ZMXA 1DQLH 2IGLA 2DWDB 4OCLC 2HPOA 5IMLB 3HCVA 2XBZA 5I8OH 1TVBB 1I9IH 5HDLA 3CN4A 2WUCH 3OTTA 5DVPA 2C4XA 5J12B 3LEXB 1FNAA 3CQQA 1JPST 2Y6SD 3S36X 3BT0A 2ZX9A 3RBGA 1U8HB 5EEUA 2OTUA 1GHFL 3QQXA 1YMME 5GJSL 5J8OA 3BD4A 3UEZA 2HUHA 3EGSB 2ZP0T 1O9VA 1CG9A 2P43B 3E9UA 2XXFA 4U3SA 4X4MA 2CWRA 4JN2B 3WDHA 1E43A 4G42B 4IKJA 1T20A 2VZ1A 1MCKA 3HJEA 2CPUA 3SDXF 4OZHA 5D6DA 3QZWB 3B9VA 5JQIB 3HR6A 4U31A 2YAEA 3BKJH 2IFFH 1MW3A 1IC7H 3OXRA 3UO1H 3RY6A 4NNPH 2VDKL 3DK0A 4Q0XL 2EEBA 2ZUTA 1SYSB 3FMGH 4N5EC 4P2OB 3ZO0A 1P5UC 4I9XA 3PP3K 4FDWA 1URZA 4QOKA 2VLME 3CFKA 4IIQC 4MYPA 5TD4A 3UPAA 4B0MM 5HJDA 1TSHA 1PSKL 1NCOA 3KPSB 2GEEA 3X3GL 4GS7B 1YC7A 4HJEA 4JM0A 1B0IA 4XXDA 1UB5B 4APQC 2QELA 3GD1C 5LAXA 1OE2A 2WWOA 3P3SA 2YD5A 1RZKC 3SJVD 2NZ9C 3AS2A 4Q9BA 3ZHFA 3N6YA 3HI5H 2IAMD 2OSXA 2ZKHL 4FQHA 5DQ9B 1IKNC 3K6SA 3HG5A 1BM3L 1FG2A 2YS4A 3Q9QA 4HIHB 2ZXDA 4EI0A 2NYYD 1Q4NX 4PJ5B 1QEWA 3L4ZA 2NZ9D 2P5PA 4OB5L 4G8EB 1IILE 3IU4H 3EUUA 3QAQA 4RFNB 4RAUA 4TQPA 2V17L 3SDAC 3RU8L 3VXMA 4MDJA 1R47A 2FT7A 1XH3B 1D6VL 4JVPA 3BUIA 5J57B 5T1JA 1IM3A 4MAUH 5L88L 2QQKH 2YD6A 4XOEA 1A6ZA 3PYCA 1WG3A 4A2LA 2H32H 3BVWA 4PRIA 4PJDA 3O4LB 1IAOA 4A7VA 2CCWA 3UBXI 5DK0B 4BRVA 4AMXA 5GSRB 4H4NA 4OT1L 2EIKB 3BO8B 4L29B 4U1HA 3N3EA 4H0LC 4YUEH 3QO1A 2B3RA 3UZEA 1C5BL 5HHOB 5CWSA 4YHZL 2D7PA 5D2LB 1PDKA 2FJGA 3NZUA 2HLFD 4FEMA 2FO4A 2AQNA 3HB3B 4JM2F 1E4XH 3V7AG 4UIMA 2KLSA 3RNQB 5FO8A 4ZPVB 5CCJA 3K4ZA 2H0EA 5IHZB 1R3LA 3TEZA 5JR1L 3FH7A 1T1XB 3WEXA 2ARJA 1MFUA 2P4AB 5F0PB 1CGYA 4O58L 1MFEH 2ZCKH 1I7TB 3PCYA 1ZSDA 4K2UL 5C9KA 1VFMA 1LGVA 3D8MA 2WLIA 2FEEI 4Z7VF 4EIBA 4WTZG 2OTPA 3W5MA 3EKCA 1R75A 4W9IC 4AVIA 4PRNB 2PYEB 2F58H 2CE6A 2EICA 3OHMB 3J7HA 1IE5A 4KNSA 1G9NH 4K8RH 2XICA 3NSXA 1YVLA 5CZXC 5CD3A 1QQDA 2GJ6B 3H9YA 3R8BB 1CD8A 2NXYC 3VMNA 2J1KA 2DLTA 4OJCA 2B0SH 1PPIA 5C07D 3VDBA 3FOLA 3BGMB 2AQ2A 2XQYK 3BPOC 1PLGH 2IXQB 4I77L 4XNXL 5BZDB 5CZXD 3SIKA 5IJKA 4JCWA 2NXYD 2WANA 5BVJA 4HKJB 3ZYOA 2QSVA 3ETTA 3IWUA 5CP3A 5TE7L 5JW5A 1FAIL 1MLBA 4ZUTA 5KVGL 4KROB 2O5XH 5ISZD 1UXSA 4OQTL 2CLVB 1CD9B 3EJQA 2XWXA 5HVWA 3MRNA 1AO7B 1FVDB 1N4XL 1ZT4B 4PRPD 3AT8A 3SE3C 2O5ZL 3C60B 1FUNA 4EN3C 1MRDL 5E1QA 2HYMA 4MA3B 3FFCB 4OF0A 5G2NA 1JGDB 3TGXA 3RWHB 2J8UF 2E7BA 3HN5A 5D2NC 4PGEB 3GMRA 4OFYA 3QIWD 3QB7C 2ADJA 2XXGA 2OMVA 1EQWA 4EN3D 4RIRA 4N2DA 4RZCB 4TLSA 2DD8L 4ZUWB 5KS9F 5FX3A 3PXLA 2WVTA 4LKCB 5F2FA 2X89A 3BXNB 4BFIA 1P7QD 4DQOL 3BYTA 1BFVL 4ONOA 3PGDA 4NT6A 1WSST 1JHLL 4Y19E 2UV3A 3FT4A 4P2RD 4PP1C 2PP9A 3S48A 4XPFH 3ARGA 1JZEA 1L9QA 3QDGA 3QCUL 4MA8H 5D7JB 3UMNA 2HA1A 4QXTB 5T3ZL 2QPDB 3LKRA 3LQZA 3TIEB 4DH2A 5FYLE 5TE4L 1E5UI 4JAMB 4PP1D 1YLBB 2WB7A 1VA9A 4HLEA 1FO0B 4OJYA 3HVDA 2OMUA 4NRYA 4OM1L 1SF5A 1MCOL 3CVHA 3PGCB 1RHHB 3WFBL 32C2B 1NC4B 4QRBA 1FZOA 2EDWA 1MCWM 2ZXGA 5GRWA 2VDLH 3P4LA 2DLFL 3QXUA 3W9EA 4ONGH 4YPJA 3LD8B 4O2CB 5GGVL 3LJ3A 1W91A 1G87A 3QO0B 3BAEH 2OCFD 5ITFA 3VD1A 3Q43A 2A9BA 5DZVA 1X5XA 4YDVB 1RZ7H 4LLWB 5C71A 4U6HA 1LILA 2IOMA 4E0RA 3QFGA 2E4TA 3Q9PA 4UINL 4G6MH 4GRLA 4RVBA 2D0FA 3FW6A 5J0BA 5GJTH 3SDDA 3WXWL 4M7ZB 4AVHA 1FFTB 3F85A 2JCCF 1HEZA 1F00I 1GC1C 1IGMH 4XMKL 4KZCA 4ZUUA 2DEXX 2Z0UA 3ZL4L 4D2NA 5FYJL 3TCXA 4XMVA 2X3AA 2BH0A 1IBDA 3ZKXB 4JDZB 2W65B 1KEMH 2PO6A 1ULVA 1HKLL 1OB1A 1UVQA 3ATBA 4P23D 1NCGA 4JM4H 4JZJB 3U4EA 5C70A 1A3RL 3D09A 1DVXA 4KVNL 2UWEF 4FFZL 3HBGA 4H8UA 3WIHA 3FUEA 4XPTL 4RMTA 4PJXB 4YBLB 1A7BA 1A6VL 3FONB 1LO0H 1QEXA 2OJZH 2VYRE 1UXWB 3IJ7A 4OZGE 2IPKB 3HHSA 3N9GH 3P3RA 2PYFA 4M1DL 1DQQA 5T1LD 3TYFB 3ARTA 1HHKB 3SBQA 4OCWL 1KENL 3V7MA 3CU7A 4JZNA 1SLXA 3RZCC 1KYFA 1NMCC 3V2AR 2Y5QA 3O0RH 5DT1L 3KLAA 4Q9QH 3ESMA 4ISVA 3LRLA 3O6LH 3WEBA 2WXFA 3TTYA 4DP7X 2Y69B 5IHUL 3E1ZA 4MA1C 1YRKA 3HUJA 1KXHA 3TFBA 4S1QL 2BOBB 3CVCA 3PWJA 2EC9U 1PZBA 5F3HA 3G5ZB 5TDOB 2AERT 2AABL 1H8LA 4FA7B 4N2CA 5DA0B 4YHMH 5FUCC 1BZ7B 3VXSE 1NBZB 1GZHC 1U9KA 2AW2A 5B8CA 1P5UA 5EUOE 1NIBA 2EIMB 1U3ZA 2OA9A 4FQXB 1UM4H 3I02A 1NGYB 1JD7A 1HHHB 5AKRA 3FCSB 4P9MH 3F6LA 5J6HB 2COQA 3MA9H 4OFKA 5IMKA 3CDZA 3SJVA 1T0PB 4P06A 2BNRB 4PCKA 3U6XA 3S98A 4W9EC 5INDB 2IAMA 1S5IH 1VJSA 4OCXL 1J05A 2DRUA 1LO3L 4R0LC 3LRHA 4TULH 5D1XB 1OSYA 1F2QA 3OKYA 5EDSA 1AQKH 3F58H 3LNHA 4F7PB 1UADC 5KSVB 5FECB 4KAQH 3EHBB 1MSPA 3KH3A 1UYWH 1N3NB 1ZCRA 1XFPA 4F2MA 4L05A 4TSAL 3MOBH 4MSWB 4QPEA 5I6KA 4CN6A 1G0DA 4B9CA 1RAMA 3BUYB 4Y5XB 2B08A 4X4YA 1SEQH 2BVQA 3MLYL 4LMQI 4DKFL 3V6FB 1ZV5A 2FK9A 5TFSL 1N8ZB 1YEHH 1ZHLB 5HHMD 1VGKA 4KNUA 4XP6L 3VACA 4ATTA 4AYGA 1GKOA 4YBQD 4OZ4B 3S3BB 8CGTA 4HALA 4A2DA 2XQYA 1RULL 1PG7W 3ML9A 4WNQA 3BKYH 3TT3L 3MR9A 5IK3B 5EF2A 4O2FB 3PUCA 4XCFH 3SPCA 1V7ML 1U95A 1RZJC 2EINB 3F7YA 4ORZC 3NMEA 5DJCB 4AKQA 1EUUA 3G6AB 4K94L 3BDBA 4OI7A 3AC0A 2E6QA 1MAMH 3MRDA 5B22A 4Y1AB 1AYRA 3WY1A 2VXUH 5A6MA 2V4LA 2ZCHH 4RAVB 4XP5H 3FCUB 2AXHA 5ILTH 5SX5K 4GB9A 5LBSH 3MLWH 2EE6A 5F7EL 1A7RL 5AAMC 2C7UA 6TAAA 1TZIA 3J2PA 3LQAH 1P84K 4NO3A 4IBVA 4UQCA 1M4KA 3IN2A 3UBXB 3KAAA 4R26L 3SGJA 2VDMB 5DA4A 3F04A 4PBWD 3FTWA 4XMPL 1KMGA 2NPLX 1AQHA 3MRPB 2EILB 3E3QE 4DP9X 2Q6WA 1I3RB 3DJ9A 4RRPA 3L1FA 3AQYA 4JREB 4M61A 1KV7A 2DQJL 5DTFB 4GXUM 1NAKH 3QI9C 3MV8B 1BYNA 3MGTB 3Q6FA 5DHVH 5JHLH 3C6SA 5ISZA 3TBCA 4JO3H 4A2FA 2DQGH 3NFSL 3SQRA 3SDXA 4K8RC 1I75A 1FYTD 2A3TA 1FV1B 3MRLA 3UCQA 2OSWA 1Y18A 2QTVA 4PRPA 1AXTH 4FFYL 4HT1L 2IG2L 1PBYA 4R3SB 1UJ3B 1JRHH 4HA1A 5F9WC 2L7UA 3FTGB 3MOAH 3UTZA 2YBRA 3UOAB 3VYNA 3T08A 5DI8B 3DV6B 5LGKA 1H9DA 3SE3A 1HIML 2CO3A 2XFXA 3NAAH 3QIWA 1MCLA 3TH4T 2VDRH 1SOXA 4LLDA 2P8MB 2R9HC 4J3OF 1UD8A 3K4AA 1DJWA 3DX9A 1IAIL 1KB5L 1LQSR 2EIEA 4KZ0A 3SCMC 1MHEA 4BA8A 1P7QA 4E9WA 3NZHH 2WKLA 1LP9E 1U2HA 3GF8A 4AY0A 1KGIA 5CUSH 1D7DA 5D8JL 2NY4D 3SCMD 2I9TB 2IDSA 3M88A 4POZD 1EAJA 3D39E 4P2RA 1MREL 1OPOA 1DQTA 2BIMA 4I3GA 1I4FA 3EGXA 3FUMA 3VD5A 3K81A 4PWKA 1Z5LB 4NN6C 4BSWA 5IG7A 1J9RA 1ZVYA 4LFHG 1UD3A 3T0EC 4QXGL 2I07B 3L9BA 4HIJA 3BSGA 4IRZH 5DEFB 3QQ3B 5EC1B 4J12A 3GFUA 3K6OA 2UY7B 2B4CH 4PLKC 3KGSA 4LLVB 1AHWC 2K8MA 2XZAL 4GAFB 1IQDA 4P3CL 1B4RA 4JO5A 3T0ED 1K72A 2VDOB 4QY8B 5I74C 2X40A 4G9FD 1FGVH 2D9QB 3A4EA 4G1MB 4IU3B 1DJGA 2Y5TA 5AOMA 5T1KB 1RMFL 1JWUB 2QGBA 1TFPA 2FECI 3DVNA 4ZMYA 3P9WB 2F7RA 4JM2A 1S9YB 4MMXC 3DI2B 4JRYB 1MFAH 1NIDA 3ZO9A 3L4YA 3QWOB 3DDFA 1CT8B 3IDYB 4I9WE 3M17A 2FJFB 3LDBC 1V3MA 5F21B 1NCAL 25C8L 4L3ED 4QR7A 4DCQB 3ROOB 1WF5A 4HIEA 4F1SA 2WQUA 1W72B 2WZ0A 1EHAA 3SDCD 3VXUB 4BHUA 1F4WH 5J3HC 4Y5YC 1KG0B 4W6WB 1E4XI 4AM0A 1QFUH 4A63A 4FD0A 4Z7VA 4DEPB 2YPLD 3NIFF 1UC6A 1JNLL 4GBXB 2V3EA 2FX8H 1PQZB 1KFGA 2B77A 2AAVA 2OJEA 5E4AA 1AG6A 4M3JA 1OLLA 3F00A 3MFFB 4Z7WB 1KC5L 4P23A 1MLCB 2DI7A 1U3HC 2PP7A 4OF3A 4PB9L 3WEAA 4G8IA 4AENA 3V4PH 2V5YA 3OR7A 3DGDA 3PWLB 3WXVH 4F33B 1RK0B 5GIRB 2VLRD 4GEIA 5DQDL 3PDGA 4HIPA 3C12A 3MNWA 4NQQA 4BRJA 2H26B 1GVIA 3IRPX 5I0ZA 3A6BL 5BS0E 4I87A 5ICZB 1NFIA 4Z76A 3HE6D 1EANA 1JPEA 2FQFA 2WSPA 2FQDA 4LE8A 3HRZC 2J25A 4U0RB 2QLYA 2ODHA 3B37A 1E90A 3IJYB 1NQBA 4P57A 4PAZA 4QHMA 1PVHA 3GNML 4DKTA 9CGTA 3VFMA 1D5IL 4V11A 1LO5B 3LNDA 3HZKB 4W9CC 3W3BA 1VACA 4OGXL 4HJSA 4YAQB 3VRJB 1F1GA 2Y6TE 1YMHB 4OLVL 1AKJA 5TDNA 5C7ZA 4D9RD 4XO5A 2R2HB 2GJRA 3ILDA 3FQWA 3HFMH 2J8UA 2LLGA 3ALXA 4ZNEE 4NJ9H 3GMLB 4IRJC 4CADB 4W70A 3SPIA 3LKPA 2W8CA 3QP3A 1PMYA 5I1JL 5DVLA 2KLRA 5CN2A 5KS9A 1MRCL 1EFXD 4GT0A 3HI1A 3KGRA 4Z95L 4HKBB 5HYJD 2JJTA 4IRJD 2YSSA 3HKZA 2ZOOA 5SWQB 1GZHA 3BPCA 2UX6A 1JFQL 3C5ZA 2X4PA 4MHHI 3DHMA 2BSBA 4FG0A 4HVBA 2CM6A 4M6NL 3H7BA 5E8NB 4E2OA 3T0AA 3KPNA 4R97C 1AR1B 5KSUB 4PBVC 1A6TB 1L9NA 1RU9L 4JQIA 4AEIL 3B6SA 3GDBA 4JFQA 3EH3B 4YDMA 4OI9A 3JWOL 43CAA 1E3XA 2M1KA 4PHZA 1KJMB 1AOHA 3QVAA 4J23A 4K3JH 1GL4B 3NQIA 5AZ2L 1KTRL 3HAEB 2RQ8A 4ZOAA 3KWWB 1MWAB 2ZOKA 2BP3A 1G7LB 2Z8VC 5BQDA 5T5FL 5JPMA 2BSDA 4KDVA 5KG9B 4ZSOB 2R0KH 5D6CA 5HDOA 4WEBL 4NP9A 1SY6H 1YEDB 3NSCA 4OD3L 5C6TL 3MC0A 4LK4A 5D71L 5C0BE 4NSKA 4WNJA 2C34A 4XI5D 1QSFD 4R8WL 2WVSA 1ETZA 1M42A 3CFEA 1F4YH 2WSDA 3X3FH 3V8CA 4AW7A 5FHBL 1WFNA 4GT7A 1TQBB 4Y4FC 4NQXB 1SHMA 5C0GA 5CD5D 1FVEA 4F2FA 1IGCH 2APTA 1PIGA 4WK0B 4O02A 1WCBA 4QD2E 1XQ4A 1VLXA 2XU9A 2MHAA 2PR4L 4K5PA 2E46A 3NA9L 1K9TA 3T4AC 4DVBB 4XWGL 1KBGL 4BCYA 4K07A 3U30B 2PLTA 2J5WA 2XA8L 1AIFB 3Q3GA 4PJIE 4QGTA 1FVCB 3DJZA 1EJ8A 4P2QB 1YNLL 2HFEA 2XTSA 1QPPA 2W60B 3ZZSA 1P4IL 2Y23A 3NJFA 1YYMH 3ZDXB 4OFQA 1GJIA 2R56H 4Z7IA 4QRUA 3SQBA 5AUMB 2JJSC 4OF6A 3UGXA 5EZLB 2N0KA 4F5CE 3H2QA 2R0WH 3H9SB 3NIDF 3VWJB 5IB3B 2XWCA 4FXGB 5IBUB 4RNRB 5JUEL 5HXMA 1BJ8A 5F0MB 5EUKA 4Y9BA 4EOWL 2ZJSH 3IJEB 1JI2A 4FYSA 1OCWH 3WS3A 4GRWB 1T4KB 3OC5A 4M6ML 1EXGA 2V9UA 4ZFFA 1OLZA 2AS5M 1TLMA 1GSKA 4ZUVB 5D2LF 1RV6X 1FYTA 1VIWA 3LEVL 3LQAC 4J8RB 5F1SA 5B7EA 3HC0B 3CVHL 2VJ0A 3NTCH 1TZOA 5DLML 2NOYA 3FQ1A 3WNLA 1WA2X 4GG6E 4LCYB 5EF1A 1BEXA 2AQRA 1J8HB 5IUSA 4GAJH 1XO8A 4X9YA 1A7PH 3T0XA 3Q06A 2LW3A 3MCG1 3QEGL 1XGUA 3WHE0 1GJUA 4EAEA 3A6OA 3UPRB 1CF8L 5IROD 2HRPL 1JPFA 3NH7H 1CIUA 4H13C 4YR6A 3CSBA 2RQEA 4X4ZA 1DBBL 3TOPA 3VTAA 3Q8CA 3QUMA 4A37A 4HUWA 1BZDA 3GMNB 1UWEL 3FT0A 4JMNA 3WY2A 3LH2L 5LCVH 1JE6A 1Z3GH 1R1CA 4AK1A 5C0AB 1N6QH 3SCMA 3T1FA 4NQCE 5IWLC 2KS0A 3L13A 1T6BX 2GC7C 3LIZH 4JKMA 4CMMA 4GSUA 1CBVH 2W9DL 2NUPB 4OIFA 1F90L 2OCJA 5LAPA 4LP4A 5DS8B 5B7FA 2UZIL 3D12B 3QJZA 5KZCB 1R3IH 3BVNA 3RX8A 3ZDYE 1AP2B 1FFNA 2JJVA 4MNQE 1PKQB 1JPTL 4HX1B 4Y7MA 1SN0A 1RUPH 5CLZA 2X2IA 1DJSA 3E2HC 5K9KB 4WI4A 3HPJA 3PWPE 4EKXA 2CQVA 3DJTA 2DI9A 4PRDA 3T0EA 2Y7MA 3QK0A 4Z7UF 1AHMA 4G9FA 2LVEA 1JDCA 5K9OA 3E6HB 3QCVL 5IR1B 2P80D 3TESA 3IDJB 4JDEA 1KGJA 3PDOB 5I2IB 3S5ZA 2YQ2A 4AYFB 3VSQA 1FL3A 3IPBA 4D8PB 4PBXA 2RB8A 2ITEA 3HZVA 4KO5A 4S1SL 1BIIB 2Q0ZX 4IHOB 4ZXBC 5GZNC 1ILSA 3VD2A 4P4KC 1SRDA 4MA7L 2F2HA 5DJYA 1NFKA 5L8KB 1SM3L 3CBRA 4UT7L 4RFOH 1RURL 5H37H 4GI9A 5E2VH 5CFAA 2E0PA 5ESAB 3KPSD 4JO4L 1Q0YL 2YXFA 2KZWA 1T89A 4L3EA 2H45A 2OSLA 1LTXA 4XGZB 3B2XA 3SDCA 2H1LM 4YHNB 4LPTA 4F9LC 5BQ7A 1PG7H 5C0FA 2ENSA 8FABA 1TITA 4NPJA 4CVZB 4OUUB 2YPLA 3QC6X 3V5HA 3C5SB 4XNYL 1WD8A 4S1RL 4M5SA 3BKMH 3U9PL 5CJXC 1YNTB 1C5CL 4JFHD 4PJGA 1HFUA 3D3VE 4ZFGH 4PEEA 2CKBH 4HKZA 5FA3A 4PJ5D 2NY6B 3L3OA 5JHDA 5EN2A 1SPDA 1E6OH 4Y2DB 3QBTB 5JDSA 3ILQD 3MRQA 2VLRA 3WS6A 2IH9A 4YFDB 5BUAA 3RB5A 4AE1A 4KK8D 3DIFA 4QRTB 3WFDL 1RVFL 2YBGA 1D5BA 1KCRL 2HT4C 3HE6A 4MS8D 4PJHE 3O4LD 1EH9A 3IJ8A 3O6FC 5DD1L 1RZ8B 4TLKA 2JWYA 3EOAB 4DAGL 4FNUA 2GFBA 4NPYA 1HSAA 4AQAB 1SJHA 2OSYA 4XXWA 3TFKC 3T8XA 3W56A 3V52L 2NX5B 2E76C 3PAZA 5F93C 4HFWA 5IBLD 2CA4A 5AL0A 3D48R 3RWEA 1X5HA 3BWAA 2VKWA 3HB3D 2WNXA 3MLUL 3TFKD 3K91A 4JUTA 1T21B 3FO9A 5TK2A 1W0YT 3L3DB 4KTYA 2J5LB 2FSDA 2VIRB 3EOYG 3MJ9H 3QRGL 4PCTA 5JIMA 5HPMB 5K9QG 5SX4H 4F15C 1QO3B 2YAPA 1FFPA 4GW5A 2LTQB 1KJVB 2IJ0C 4EUPH 4FEIA 4IJ3B 2YJLA 5F70A 1EFXA 3U1SL 2EVJA 2Z93A 4N25A 1JRHI 1NDGB 3Q44A 3ZU8A 4NQEB 1DFXA 5HYJA 3MODH 3MACH 4WFHD 3BLKA 3EYUH 4X9HA 2DYRB 4DKAA 5L6YL 3EFFB 4FTVB 1MEXH 1BFOA 1YEIL 4PU2A 1DZ0A 4ZBJA 1IX2A 4LGSB 5BRZB 2W0FA 3US0A 1T5XB 4IBLT 4U3XA 2MRYA 1WAPA 1OWRM 1UENA 3UZQB 3GSVB 2MTPA 4RWHA 3WN5B 2XRAL 5ENWB 4DT2A 4X9FA 4HP5A 3UJTL 4PJXF 3COOA 5GRJL 3ZQXA 5BV7H 4UT6H 1XMWA 4Y9FA 3OX8A 2HVJA 3H4FA 1E5BA 2VWEE 1MCPL 5HY9A 1F11A 4KH9A 4XN1A 1OVZA 5DC4B 1HL4A 4GUQA 3G6JB 2VLKB 4P5MA 3GSXA 1P9MA 5IREA 2R23A 2AEPL 3GGWA 4ELMB 4G82A 1NUDA 4Y1TA 2WTOA 5EU7C 1GOGA 5DVNA 1AO7D 3W82A 3EOBB 5C97A 1YEKL 4HCFA 2X1PA 3INUH 2Y2YA 1AY1L 4PJEE 1RY7B 3C60D 1QSFA 4ABVA 4LVHC 1A0QH 1A4CA 4HAFA 5CJQH 5I6XC 4GNKB 5HGAA 3UP1A 3WG7B 4IMKA 2YD3A 4QYOB 5KOMC 2YHGA 3BRDA 2HN7A 2WJ5A 4AGNA 2JIXB 3FFDB 4K3EH 1FZJB 3D85D 4ZMAT 1NMBL 3VD0A 1FL5B 3VGAB 3HMXH 4N2LA 1A3LL 2H6PB 4A55A 1T22B 3QNFA 2CHNA 1WZAA 1I1AB 3Q2LA 3B2VL 3O2WL 1M6OB 2R27A 5AW0B 3KYKH 1JGEA 3I6KA 5H4YA 3WO4C 4KKZA 3CFJA 4JRXD 4APXA 3C9NA 1QFPA 2YD4A 3T4AA 1YPZE 5D7JD 2O5NA 4UTAH 3C08H 1NBCA 5DVOA 4Q14A 2P52A 1FSKC 4QNPF 2W0PA 3HVNA 2G3MA 4WUUD 4OLWL 1T0MB 1M1XA 1S78C 4ETQB 3X11B 1IBBA 4XZUB 4UOW0 1NC4D 5IFAL 1K4DB 2VDLB 4Z0XB 5IF0A 2VL4A 1AH1A 5GGSB 4U7KA 3TPKA 4E41B 1NGQL 2VABB 1GGIL 2W9LA 5AYTA 5JIKA 2R69A 3CZGA 5IHHA 1QFOA 4B41A 3OLIA 3VFOA 4YO0B 1JWMA 4XVJL 4V1DD 3EGDB 2R29H 3HG1B 1IGYB 4DZ8A 1IVLA 4YSPA 1J1OH 1FNGB 4KY1L 1CL7L 3OHXB 4LZKA 5J6SA 2ZSVA 3HS8A 3QFJE 2EUXA 2DH2A 2GUOA 5F7DA 5FO2A 2D0HA 1ZLUH 1H3WM 4XT1C 2J6EH 1S9VA 5IROA 3SOBL 2G60L 4KTDL 4AGOA 4DETA 4TQHA 5CIPA 4JFEE 5HP5A 2ENQA 3V0DA 1GS8A 4L1HA 3SBWC 1KPVB 2QQNH 4XC1H 2QPUA 5EU6B 2J88H 2CGRH 2A0LC 4GSRA 2CO1A 4M5YH 4I1PA 3RVVD 2X4SB 5C6WH 1KV3A 2DWDA 1P4LA 1E4WL 1JXDA 2NW2B 7PCYA 5IMLA 4DGVL 2Q87A 1TVBA 2A0LD 2HKHL 4AGQA 2CR6A 4DSYA 4FTDA 4JDVA 3OLDA 4KMTL 3ZKSD 5DRXB 2V7NA 1G7IB 5IWLA 4E5XG 3V5KB 3LEXA 3WKQA 3SGKA 1AGFB 3X14B 4RX4D 2WHVA 1MHHB 1U8HA 3SE9L 5AB0A 5E5MB 5GSVA 4UQAA 4IIZA 4N22A 3ZR5A 3LH8A 4JN2A 43C9B 4G42A 4D94A 5BUPA 3C09C 5I0XA 4N90E 5DUMH 2IPUG 1RIHH 5BRPA 2DKMA 2P80A 3QZWA 1JYNA 4FQ2H 3D25B 4UNUA 4KZDH 3EBIA 1OAJA 4XOAA 1DBKL 3T71A 4XBMA 2YPVH 1BIHA 2Z8WC 2ZOTA 4P2OA 4JFZH 5I18L 5KJ7E 1M2OA 1MW0A 5F1NB 3P1VA 1ZK5A 2N59A 5DVKA 4UV7H 4I48A 2ICWI 2XV0A 2QBWA 3BCFA 5CU5A 1AXSB 3KPSA 4K9EC 4C54A 2PTTB 3V6BR 3OPZL 1EJOH 4N85A 4OBSA 4YXLL 2MNWA 4MNHB 5D55A 2APBA 1I9JH 1WIOA 5KN5B 4FQXD 4ZMNA 5ANME 1UB5A 5LWYL 1JZ7A 3CXHK 2ZICA 1I3VA 4FG6D 4TXVB 3HS0B 5F7KC 1CR9L 1NUFA 3C2AH 5CEXB 3SQOL 2BNRD 1BZQK 3SKOB 3DECA 3F7VB 2VJXA 3WTTA 4HIHA 3T3MB 3L17A 2QFRA 4PJ5A 1R24B 5D1XD 1XSKA 2GSGB 4G8EA 3IPFA 1K4CB 3MUHL 1Q1JL 3EHBD 4WENB 3QJFA 1QHQA 2PR9A 2OYMA 1ODAA 1XH3A 5FYJU 3Q8FA 4NKDB 4DPCX 5I17B 1OAKL 3P4OB 1IKFL 1JF1B 2Z7ZA 3L95A 3QYCA 2ZF8A 3A24A 1BBDL 3BKCL 4X4KA 3VU1A 1IFGA 4ATWA 4ZW8A 3MLVH 2VN7A 3O4LA 4GQQA 4H20H 4NNYB 1D7BA 1BXAA 3QW9A 4YDJB 5DK0A 4Q97A 2HLAB 4G1EA 5GSRA 3BO8A 4JQIL 2JV6A 5FW8A 2LHAA 3AXHA 4EKJA 5HHOA 3V79C 3OL2A 3H9HB 3L6FB 2WQ8A 2EDTA 5KAQG 4PREB 2E7CA 1EZVY 1L0PA 3ZHNA 1EHLL 4GG8B 5EOQH 1TZHA 3GBMH 1CFBA 3I9IA 1WD9A 3TZVC 5IHZA 1AKPA 3MOQA 1AJ7L 1T1XA 2AJYL 5HDBE 3MMEB 4LCIL 1R3KB 1RZPA 3BE1L 5DZNA 1I7TA 3QJSB 3MKKA 4J3XA 3QIBC 3TZVD 2ADIB 2VC2L 4MJ4A 3VXNB 1F0LA 5DUBB 1N10A 1TEFA 3BESR 4QUOA 2VZSA 4PRNA 1Z9SB 5IHBA 4RFEB 5FOJA 2D7NA 2CUMA 1L7IH 3IFOB 3ZT6A 2XY1A 1ZGLP 4Z7WF 4XN7A 2JMRA 4XR8C 3PV7A 3B56A 4EMZA 4X5QA 1H6EA 4ZW3A 3DJSA 4FERA 4YDKL 5I73C 5GGQH 3LPOA 3MA7A 2XKSA 1YN6B 4O02L 1KGWA 4N0RA 3DA0A 1RJCA 1DBAH 2IXQA 1U33A 3POCA 5BZDA 4WI5A 1E0OB 3UEQA 5DMKB 3X2QB 4KH2A 2XWEA 1VDGA 2OLDA 2ZG2A 4HPHA 3KXFE 4HKJA 3F12B 5DHVB 1SHSA 3MV8D 5INCB 4DESA 4NN5B 1I8KB 4CDGC 4ALAC 4OCRH 4XCCL 2GJZB 2KDGA 1N0LB 1M3JA 2CLVA 2ZUWA 3BGFC 4PY8J 4RETB 1OGTB 2EIDA 1AO7A 5DK2B 1D7CA 4Q6IB 5DYFA 3RY5A 1FVDA 4HUXB 1B88A 1HHJB 1WFMA 1ZT4A 3LXCA 4MJ2A 1JFHA 1TEGA 2X0VA 3OQRA 3C60A 1TFHA 2JB5H 2XIDA 1KN4H 4RMWA 4YE0A 3UAFA 3MRCB 2AEIT 5JIHA 5D1ZB 1JGDA 2BMKB 1BOGB 3EUDA 3L1EA 3M8OH 3RWHA 4OKVB 1KIPB 2WVVB 1OP9A 1Y6MR 2W07B 1AS8A 4PGEA 2C9PA 3A4DA 1P7BA 1AANA 3SO3B 4NYLB 2ZUXA 1A6PA 4RZCA 4ZUWA 5KVEL 4LLMA 3FO0L 1FAKT 3UGUA 5FUOL 4XP4H 3BXNA 5ALBL 5IVXE 4YXKL 2OMWB 3D85A 5EEYA 2V2TB 2GI7A 1T7XA 1DL7L 2KL6A 1OF0A 3TJPA 6PCYA 3LPGA 2C3XA 3VFGH 1Q38A 2IV9A 1UB6B 4NZDA 3ZE2E 1W0WB 4A7UA 1VKXB 4KOCA 4W81A 1FN4B 5F0LB 1T0OA 3OKEB 4F91B 4JFTA 4JN1L 5D7JA 2P46B 5ALCL 4JFDE 1WLHA 4QXTA 2NYZA 4W6XB 2EEAA 2FH6A 3TIEA 5LN8A 3GMMB 2EXSA 1V3KA 2XFGB 4FKEA 4HSAC 4JAMA 4RWYH 4HEPA 2BIQA 1FO0A 3QUML 4G3YH 5DD0H 4WUUA 4UQDA 5CLTA 1TCMA 5KVGE 5IJCC 2JELH 3WD5L 2OR9H 3PGCA 5GS2H 2C9QA 3H2WA 4GQRA 1RHHA 2GTQA 4ZO6A 32C2A 1NC4A 5LNEA 4WV1C 1IV8A 3K6NA 1TEYA 3WFCH 1DVUA 3BZEB 4Z6AT 1GAFL 3L81A 5KBMA 3FBQA 3QO0A 4YHOL 2B14A 4NQSB 1MJJB 3EBAA 5T1KD 4O4YH 3VG0L 4V1DA 4AMWA 2GYSA 1IAKB 4Y89A 4YDVA 5BJTB 4LLWA 1BGXH 2GTWB 2PN5A 3DRTB 35C8L 4JRYD 1K2DB 5E2JA 5D93B 1G94A 1T2QH 2EH7L 4B95C 3T6XA 4LSQL 1HINL 1XTLA 5B3JE 1MPAL 1J1PH 4DFIA 3L4WA 1C7SA 3EFDH 4MRCA 2IALB 5IKCB 4JY5L 3WMPA 1NCTA 4FMKA 1TIUA 2D31B 5F88A 1VCBC 4MWFB 1UEYA 4ODHH 4QXUH 5FUZH 3V55A 3N91A 3P11L 4FA8A 1RPUA 4GP4B 4JDZA 3O2VL 3QYNA 4NQDE 1A1NB 4GBXD 4DUWA 2VUOA 4DVRH 5IUCA 3UBHA 3N06B 5SX4I 3HZ3A 1YUKB 2O6PA 3KYMB 5T3ZE 1UM5L 2CDEA 3V4PB 5JIPA 1TTFA 1WS8A 1WFJA 4FXKB 4MCZA 2VAJA 4AGLA 2NXZC 5MEQB 3FRPA 4BZ1H 3SBWA 4CNIB 1E9OB 3TJHC 4EDWL 4U1LB 5F96H 3ZDXF 4YHLL 3N40P 4MCYB 4ODSH 4J7RA 4IBWA 2NXZD 3VQ2C 2Q86B 5GS0D 5JQHC 1OPGH 4PJXA 3EOTL 2APSA 3REWB 3FONA 2FATH 4ZMOA 4K5MA 4RX4A 5FA4A 2A77H 2IPKA 7CGTA 4ODWA 3S5LG 4WFFD 3TYFA 1A6WL 4RMSA 1HHKA 1HTYA 1RUQH 2WXRA 1OARH 5DR5L 4GRWF 4LRNH 2J57A 4ZMPA 3D9AH 1I7ZA 3M1BB 4YPGB 2AMGA 1JGVL 4BQ9A 5DRWB 1ZT7B 1HZHH 1U8JB 1H3TA 4I4WA 4OZFA 1VSCA 4XRCA 2BVEA 5FYJE 4KQ4L 2BOBA 2W91A 5TPWL 3G5ZA 3BVVA 5TDOA 1CDYA 4KMQA 4GMTH 4WHCA 2GTZB 3P4MB 1NBZA 3SE8L 5IESL 4GRMA 4KFMA 1I8LC 1TETH 1W8EA 2BOLA 4F80A 2YMTA 3I50L 3M45A 3S35L 4OLZH 4FQXA 2DV6A 3T77A 3A22A 3CFTA 1NGYA 5FYLD 3ASNB 5FW7A 1HHHA 3FCSA 2Q7YA 5J6HA 1KELH 4FZ8L 4AWJC 4LL4A 2L0DA 2BNRA 2Q8BL 4XODA 5B4MC 1NBVH 2CUHA 4MAYC 1RZIB 1CFQB 4W4NA 1BD2B 3TC9A 3CX2A 5D1XA 1OAYH 1UFUA 3D05A 4OTXL 3KBHE 4NC2B 4WU5B 4CU6A 3O41B 5B4MD 4F7PA 1BAWA 4Z7QE 5TQ0H 5AFAA 5FECA 4BK5A 1FPTH 3BPLC 3CX5K 1CE1H 1N3NA 4FI7A 1U91B 5J9PB 5KSBB 3JTBA 2EE3A 4MSWA 5AOKA 3WIFB 4U1IB 3LS4H 4XTRD 3DUSB 3VI4A 1MCWW 3EO0B 3STBA 3BUYA 4Y5XA 1KBWA 3TL5A 2ICWB 2DBLL 3QEHB 4UDTB 4BFOA 1YJDL 3NRPA 1J10A 2JTDA 4ZAKC 3H2PA 3WO4B 1KCSL 5GISH 1N8ZA 2VR5A 4HJIA 1A65A 2RD0A 4OCSH 1CF1A 1IZJA 2AJUL 3QORC 3FQUB 4OZ4A 4P9HL 3CXDH 4ZDHB 4AG4L 2YA0A 5HHNA 1B3IA 4LT7A 2FX9L 5AD0B 3QPKA 4FQLL 3IDNA 3CHOA 1AZBA 3ARBB 5IK3A 2NY5L 4O2FA 2XY2A 2CG9X 5A7BA 5E4EC 4K5LA 1NICA 2XOTA 2A38A 5DJCA 4KNTA 2VR3A 3G6AA 1UUSA 1UTDA 3FUFA 3GZOA 4WFGD 3UTPD 4JCMA 1Z1WA 1NCBH 2H5UA 4J8QA 4RAVA 5FGRA 5L4JA 2WB1A 3EJPA 1YEEL 4LSDA 1YNTF 4HJ0C 1BPVA 2WCGA 1M05B 1X5KA 3QWRD 4Z3GA 3K7UA 1CTNA 3UBXA 3ZE0E 1X7TA 4XPAL 3TWCL 4R2GC 4HJ0D 4LXFA 3TA3C 1INQB 3BFWA 3MRPA 5I1IH 2KH2B 3FU3A 3VWJD 2XNAB 1XR8B 4XN2A 1AZNA 5CEZH 4KZEH 2W94A 5DTFA 2HT3C 5DJZB 2NYKA 2VOTA 4OGYL 3MV8A 4YSDA 4D8OA 3MGTA 4NZUL 2KPWA 1U8LB 1DHKA 2JKXA 3EBHA 3ZGHA 4GAAA 2KLTA 3NZSA 3NJKA 2BCKB 4IOFD 4WI7A 5C9JB 5AVRB 4HBCL 3WJJC 4DF9A 3TU6A 2AAAA 1ZD6A 3K1DA 3EYQC 2ZWNA 3UTOA 1FV1A 2EEXA 4XMUA 3BUQA 3GSNH 1F3JA 1G9MC 4JLRB 4R3SA 4XHJD 5FYKD 1UJ3A 3VXQB 4MBOA 3IGFA 1KCVH 1I1FB 3FTGA 2VDNH 4WU7B 2DQEH 1C9SA 1SEBB 1J8HD 4Z7NE 4P5KA 5DI8A 3DV6A 3H3PH 5E95B 1PJ9A 5HHXL 1NCNA 3WGUB 4PRHE 3RIAF 3U7YL 1GGCH 1P4BL 2P8MA 1JZDC 4PIRF 2YK1L 1B2WL 4WI6A 3S3CB 1AC6A 3THMH 1IEBB 1J88A 5FKAB 3RVTC 1OP5K 4GY4A 5EIVA 3GI8L 2QMKA 2CALA 3P30L 4X7EC 4OM0H 3FS9A 2AJZA 2ATPB 2WNWA 4HCRH 5C0AD 2AKRB 1BVLB 2I9TA 3KPLB 2M8XA 4ZTOH 4NKOB 1X5GA 3MYJB 4JHVA 3APCA 1PS3A 3JWDL 4HDIB 4C56B 2P5EE 4LOUC 3FQ4A 3WEMA 4PGBA 3ZTCC 3LH9A 1MI5E 3FSVA 4CILA 5DJ8A 1Z5LA 4HOXA 5G4OA 5I9QB 3DTXB 1MXGA 2YXWA 3ETBF 4I0PC 4FZEL 4LOUD 2I07A 4XAKD 5DEFA 3TTSA 3GUTA 2BRRL 3QQ3A 1PFCA 5EC1A 1HDMB 2WZPA 3IXTB 2WZ6A 3AU1B 5DFTA 4F57H 5IV2B 3BP7B 2UY7A 3G6JF 4LLVA 3V0FA 2SODB 4M29A 3HN3A 4R5XA 3VM7A 4EXKA 4E68A 4I0PD 3KMDA 4JR9H 4QY8A 4HGKC 5L2KE 1ZV9A 4G1MA 4YLQT 4ELMF 2Z8SA 4P2YA 2EADA 3BEWA 4YFEA 3GHBL 5T1KA 1GTNA 3UAJD 1F8TL 4N0CC 4IBSA 2XWJB 1JWUA 4EBQL 3VMPA 1S9YA 2NMSA 4YLBA 2RCSH 1AS7A 4JRYA 5CP7B 3QWOA 2NLJA 1CT8A 4PJ7B 4N0CD 4E9SA 3D2UB 4W9ZA 4N8VG 4RSYA 1CTMA 5BZXA 3SYPA 4DCQA 3ROOA 2WNKA 1W72A 3E3QC 5EN3A 5CZVL 1VCAA 3UERA 4OJFL 4UAHA 2C9UA 2IBGA 2P26A 5I6LA 4HIIB 2UYLB 2ADGB 1G9HA 4NUJB 3DHJA 3X13A 2CPCA 3NCJH 4GBXA 1PQZA 1RUML 1MRFH 5DZJA 2CKBB 1GYCA 1KCUH 3MFFA 4Z7WA 4M5ZL 1MLCA 3QNZA 2C9AA 3K8KA 1CZ8L 3NPSB 1LLAA 1OW0C 1BP3B 4X83A 5JQ6H 4JPQA 2FHBA 3PWLA 4F33A 1RK0A 2GQHA 5GIRA 3WAJA 1Z6JT 3EYSL 3W11D 3U2SB 1XGYH 2CJUH 2DQIL 2DTSA 5ICZA 2YD2A 1CFTB 2CUAA 5KVDH 4RGNE 4ESKA 3L3KB 1Q0XH 3VYOA 4OU3A 2PPCA 4M1GL 1NCIA 2O1AA 3UACA 4HJ1A 5L2JB 3VXTB 2NX5D 1E9QB 3U2IA 2X05A 3FCBA 3QUHA 1LO5A 1NCDL 4X4ME 4QHUA 3NT0A 1B90A 4IRSB 1A21A 3WFEL 4TF4A 4YAQA 3VRJA 4I1NB 3SD2A 1W8OA 2WO2B 2R2HA 5E2UH 1JK8B 4OZHE 3LNIA 4NS0A 3DWTA 3QJOA 4BXSV 4F8LA 3MKGA 1RD6A 3GMLA 4CADA 2EZ0C 3U4BH 2H8PB 2CRYA 5ADPH 4AIZA 3T2NL 3DHPA 3R19A 1HU8A 1OAUH 3QUXC 2EZ0D 1TNNA 2JJUA 3LZRA 2GJJA 3PGFH 4X7CC 4EQ2A 5I1CL 3S3PA 4O9HL 1I8LA 4FTVD 3HKFA 4KJWC 5JO5B 3K6IA 1ZXQA 1VHPA 3QUXD 4EZMA 1OM9A 2FGWH 1A3QA 3CU1A 4QKXB 5BRZD 3WE6B 5E8NA 1PAZA 5KSUA 4DKEL 1A6TA 4Z77A 3PHQB 1GIGH 4PSPA 2VRQA 1JV5B 5AB9A 3ZZ1A 3FCTB 3HC4L 1KJMA 2NY2C 2YZ8A 1XCTB 1MN4A 4LCVA 5EO0B 3KWWA 1MWAA 4PY7B 3QS3A 5MEOB 1G7LA 2ZT9C 3Q5YA 1MFNA 1BQRA 5AAWA 2DWYA 3L48A 2Z31C 2YKKA 3VXME 5D72L 4ZMZA 1J1XH 3P0GB 3SE4C 4AV5A 3LN5B 1TT6A 3F84A 4ZSOA 1ZLVH 2NY1C 2Q76B 4JG1L 1YEDA 3QEUB 2YLHA 4KKNA 1JTPA 4BKLB 4HOZA 3BMWA 4PRIE 4PJDE 2Z6FA 1TJIL 4GIAA 1G6VK 4IBUA 2NY1D 3HFFA 5KW9L 2DI8A 2AZUA 5D7IB 3BUPA 5E6RB 1JK9A 4XP1H 4UWQB 1Y1UA 5E70A 4IKKA 2DIBA 5I19H 4NQXA 2CK0L 5JYLA 4BK8A 3WE1A 4MTMA 1YCSA 1O0VA 5A6LA 4FHJA 2JIXD 3G9VA 2I5YH 2F19H 4Y16B 4ODVL 1T04B 5AW6B 2P8PB 4DVBA 2ED6A 1I1AD 3BJ91 4EPSA 3OMNB 3B3IB 1JCVA 1UA6L 4G9DB 1FVCA 4KKBC 4NOBA 5FK9B 3T3MF 3QWRA 2VM3A 3P0VH 2W60A 4PJBB 5E99L 4JL2A 4XVSL 5A43C 3HLAB 3RVUC 2VNCA 5DUPH 3RFZB 5AUMA 2HFTA 3CDGB 3H9SA 3VWJA 5HDQH 4ENED 1MAKA 1WHOA 3ZLQC 4RNRA 3RVUD 1YAZA 4XAWL 3RU8H 3N2JA 1Z0NA 1BLNA 1DQDL 4R7NB 2EO7A 3ARQA 5CJ8A 3IJEA 4FGMA 4P99A 1MFCL 1T4KA 1HH9B 5LGHL 1GYVA 5CFHA 2CIIB 4ZUVA 3HG1D 1FO0L 4J8RA 5M94B 1D5RA 3MXWH 2OZ4H 3HC0A 2M2DA 3PJLA 2ID5A 1V7NL 3BN9D 1AZVA 1RH8A 1TQCC 2W95A 4LCYA 3VFSA 1BMGA 5EO9A 4HAKA 1QRNE 2X28A 1J8HA 2QSCH 1FCGA 3SKNB 5E8DL 3PP4H 1F97A 3EJJX 1RUAH 4P07A 4PG2C 4QXWA 2VL5B 3P40A 3QJUB 4ADGA 3PAUA 1TJHH 2A99A 3CLEL 4JE4B 1Q8MA 2BFVH 2WQRA 3B4NA 1XCXA 1PW3A 3GMNA 1NPJA 1P84J 4LOFA 4XO9A 3GLDA 3ISWA 3MV7E 3PXHA 5C0AA 3ZZLA 3GJFH 5D7SH 2NUPA 2ZKXA 2EXWC 4PRBA 4XPGH 5DS8A 5L0QC 3FN9A 2EDRA 5EF3A 3U7AA 4M9PA 4TMPA 5JHBA 1HEHC 4OD1L 4LSVL 2R2BB 1LO4H 1D5XB 3SZKC 3V4UH 2GABA 3GMOB 4TNVK 3O4OC 4HX1A 3CFDB 3ILEA 5F7FA 3FB5B 4KUZL 3ARDC 1RFDH 2AK4B 4BFRA 1DE4B 4HPYL 5K9KA 3H56A 5GXBB 4F7CB 4I0PA 4M7KL 3ZYZA 4WO4B 3E6HA 2KQMA 3ESVF 3V0WL 5IR1A 3IDJA 1CXLA 3MBWB 1OHZA 3PDOA 5I2IA 3DX3A 3B9KB 2ZUYA 4KKLC 2AANA 4D8PA 3UAJA 3PPEA 5B1JC 2EH8L 3GTTA 3LZFH 3FF8A 4J3SA 5CSZB 3IJSB 3RI5F 1UD2A 4H8WH 1H3XA 3P3YA 1QYGH 2UXFA 1Z0MA 5DZPA 5ESAA 5E4IA 2XWDA 2L7QA 3JYCA 1BOYA 3QUGA 4XGZA 3TYGH 4H25B 4YHNA 5ESVB 1WQVT 2EP6A 3ZE0B 1IC4L 2I7OA 3F64A 2WLZA 4X6DB 1MCDA 3TNNB 2Y7QB 1NAMA 3ZHLA 4CVZA 3BP5B 4FQJL 1ZLWH 2IH3B 2C5DC 4JX0A 4Y9EA 1A14H 4BIKA 5ID1B 1AS6A 4N0YH 5SWSB 1E6JL 3C5SA 2ZXEB 4E9LA 1KN2L 5EWIH 1L9OA 3MDJA 4TOYH 1DQML 1CGVA 1AQMA 4NP4H 1CFNB 2RIKA 3ORJA 1SQMA 3T65B 3S4SG 5KJRL 3RL1B 5E00A 2AVFA 4NHUB 5CN1A 4RQQA 3SYQA 4KPHH 3BPNC 2X44D 1VPOL 3OGCB 2W59A 4AV0A 4I3RH 1IEHA 4JY6B 5D96B 1KJ2H 3DOSB 4WUKL 3IFPB 2IEPA 5I0YA 5AYUL 1W8NA 2EE2A 1OTSD 1MF2H 4WI2A 4UBDD 3BH8B 4K5OA 3WSQL 3NCCB 2BY2A 5AB1A 1RZ8A 1JMZA 3EOAA 3ETBJ 2A73A 3HN8A 4FHKA 4AQAA 4Z7NB 4DOHE 5A2IH 1EEUA 4PGDA 5T1DL 2R4RL 1U4EA 2NX5A 4I18B 7FABH 3C6LC 3HG2A 1H3PL 1DQVA 5JPNC 2RGSA 1CYGA 1EO8H 4LVNC 4IS6B 4LDLB 3ZXAC 2PCFB 3WN6A 4X8JB 4KQ3L 1T21A 3OAYK 1XIWC 4HJTA 3I9GL 4LQFL 2OV0A 1CICC 5BRQA 1A4BA 1BQSA 2VIRA 1Y7VA 4ETYA 4Z78A 4K7PY 5HPMA 1QO3A 4PW9A 3WTSA 1UWGL 1CDIA 1AR2A 1KJVA 1XIWD 2APFA 2Y22A 3HUJE 2DQTL 4L3AA 3VXOB 1CICD 1QG3A 1IEAB 3FU9A 4H88H 4L4VB 1NDGA 3CAFA 5IJBC 1KEGL 1MI5B 1ZS2A 2RH0A 5J11C 2FNBA 3BH9B 4WW2C 4OF5A 4KBPA 4YC2C 2ITFA 3EFFA 1K8IB 2AXGB 3G3LA 1A4AA 4FTVA 4TNGA 3QUXA 4WIQA 4X80H 2IPTH 5I1GH 3N50A 5BRZA 1PCSA 2AEOA 2C3GA 4PS4H 5HHPB 3PWPD 1T5XA 4NEHB 1IIIA 4F8QA 1GMIA 4Y1SA 3UZQA 5IB5B 2V37A 3SYAA 5ENWA 1TMQA 3U48A 5I8EB 5C2BL 3GO1L 3IMWA 3VA6A 3WIIL 1GHFH 5GJSH 4HU8A 7PAZA 3DXAE 4LVOB 4RMBA 3BRFA 1TTAA 4EZJA 3NJGA 3HHRB 1LWJA 3G6JA 1UKTA 3Q8AA 2VLKA 4FYQA 1WBYA 4UT9L 5I1LB 1F58L 1HI6B 4X9BA 4F2ME 2VDML 3T2OA 1HZLA 3NJIA 2C4FU 2XZZA 3CFBB 3EOBA 1HVXA 4MQSB 1KGXA 5FGBC 1NCCH 1QLEL 1IL1B 1SNRA 2XPZA 4HWBH 1G4RA 3MGOB 2JKTM 5FDWA 2GBVA 1VFUA 2J2ZA 2V2XB 5D1ZD 4M9OA 3X3GH 4MMZC 1JZ6A 4WHYH 4UANA 4BV1A 3JUYA 4QYOA 5H8DA 2DYPD 3B5TA 1FNSH 1DJYA 3NDYE 4L9LB 3Q1EA 1FORL 2JIXA 2I60L 3BZFB 3D0VB 3FFDA 3MROB 4HGMA 4NKMA 1FZJA 3PNWB 4P46B 5E2TH 2FEEL 2PMZA 2ROXA 2Y07L 1L4IA 4IKNA 3E6FB 4G70B 3KR3L 3KL3A 2H6PA 2Y36H 3QFDB 2FB4L 2ZKHH 2XZQH 5KOVC 1T22A 4UUJB 1I1AA 5CINL 1BM3H 2Y3NA 3VQLA 1AD9B 3FT2B 3FAWA 1OHQA 1H8SA 1KYOK 4NAJA 3FUHA 4OB5H 1QBLH 1GY2A 1CUOA 3AB0C 3N41B 2OXGB 3VI3B 4WY7L 1HSBB 5DLLA 1D6VH 3A67L 5L88H 2A83B 1T0MA 4OFVA 2ZWKA 1OOWA 1KGUA 4ETQA 2IDFA 1N6VA 2VZ3A 4X9GA 5KSBF 2DEWX 3NJVA 4JJHA 5J1AB 2VXTH 4GSXA 1W2KT 5IEKA 1HEJC 1GMEA 4CMHC 4NENB 1AFVL 2VABA 3ZE1B 1YEWA 1C5BH 1CLZL 5AOLA 1JNNL 4FQQA 4YHZH 5I1AB 3BEVA 2YAHA 4AI7A 1EZSA 5GQBA 4QJ3B 3EGDA 1VEPA 3HG1A 4GUPA 1IGYA 4HLZG 2AJ3B 4K0OA 4RAHA 1KPUB 3GMPB 2B1AL 5JR1H 1TLKA 3SDXE 5GS1C 1MJ7L 2CGZA 4CU8A 1WTGT 2DMGA 3EDKA 3RVXD 4O58H 2VQ4A 3DX8A 2WBKA 2VDOL 4PJCF 3O2DH 5I1KH 2Q3AA 2GAZB 4ZO7A 4FYTA 3HOGA 3V4VH 4Z23A 4GSDH 5E2WH 1VFBB 4HXAH 4Q56A 2X4RB 4B3VA 1X7SA 2XTJC 4OLUL 2VWEC 4CBZA 3CTTA 5DHYA 3CSYB 1S7TB 4BKSC 4PG2A 1KPVA 1CC3A 1X5LA 3GKZA 5AZUA 3UPCA 3ZDZB 2X4SA 1G84A 2B2XL 5ADOL 1W72L 1E4HA 1J9CT 5K9QI 1NGWB 3LRMA 2EXYC 4I77H 2P8LB 4XNXH 4B9JA 2BP0B 3PWVB 1OAZL 3ULAB 3KPQB 4JFUA 5DRXA 3V5KA 4UQIM 1AD0A 3E8UL 1NOLA 4PUBH 1YEJL 5TE7H 5E5MA 2ICEB 4WCYH 4I89A 2NNRA 4OQTH 1Y0LB 3TBSA 2DWXA 3DOHA 4JKLA 43C9A 3PY9A 4YHYC 4XNBA 4ELDA 2WLJA 3NSFA 2VSDA 3BT2H 2A9NL 2LAGB 1INEH 3P3TA 1U93B 2J6WA 4FMVA 4XXCC 3ZK0A 1RSFA 2XN9B 4M6OL 1ORQB 2HLEB 4FCAA 4Q6YA 3A23A 3D25A 2O5ZH 5GS0L 2OFQA 4A38A 1OY3B 1UZ6E 3FXIC 4G11A 3CPUA 4ADIA 1UHVA 2QFPA 1ROWA 1WIPA 2CLRB 2HTLC 4K15A 5LHDA 3JV0A 4UOZA 5F1NA 5D7LB 2XQBL 1A6AB 1CGSL 1U41A 2DD8H 3STLA 3G9AB 1UWXK 2BHUA 4LKXA 2PTTA 2HTLD 2WLMA 3ZPDA 4HG4J 1S7SB 1IU1A 1IC5H 1XGPB 2QL1A 4MNHA 4DQOH 5DWUL 2D2CC 5KN5A 3ELQA 2VB5A 1AZCA 3FN3A 3HS0A 3NK4A 4F5CA 2JKIS 3C87A 3RNKB 3OC8A 1AE6L 1J18A 5CEXA 2E5EA 2FGZA 3SKOA 4PBDA 1NSNL 1HCVA 3C8HA 1T0NB 4Z7VE 1MFBL 1Z2KA 3BMVA 3BSZH 3HAEG 1FRGL 2APVA 1H6UA 2UZPA 1FF5A 1E2WA 4H8WC 1ANUA 1K4CA 3APDA 3EJZD 4YHPB 1MCOH 1N64H 3RTQB 5ACZB 5I17A 4NKDA 3P4OA 5E4OA 1JF1A 4P5TB 1VENA 5HGDB 3T8VA 1QSEB 5K39B 5F3BA 2ZX8A 2YRZA 4WI0B 3Q0HA 3KDPB 3D2TA 1EAQA 4GG6A 3UJJH 1KGYE 3QFJD 4NNYA 3WFHB 1HWWA 2HLAA 2LGNA 4BFNA 1QWNA 2J56A 2WK2A 5BV7B 4GKSB 4WF7A 4ZYKA 3H9HA 4MAZA 4UINH 4RGMB 4N87A 4YVUA 5HJ3A 1S9KC 2NRDA 1LQBC 2QJDA 1DBJL 2VDQH 4GG8A 1NGPL 1MWAL 5DZOA 3WXWH 4YLCA 1XVSA 4JFFE 4W1TA 4PJ7F 3VG9B 4G7YL 5HI3D 4QEGA 3ARBD 4LCCB 4LDEB 3MMEA 3ZL4H 1R3KA 4YHIB 2E27L 5FYJH 1DVFC 3RWCB 1KNOB 1U42A 3GIZL 3TBWA 1GZPB 2BP5M 3I2CL 1QRKA 4TTDD 1CICA 3AACA 1GCFA 2ADIA 2J8UE 3U2JA 4R4BB 5DUBA 2GY5A 3BVXA 4RFEA 1CURA 1UOVA 3ZMNA 3IFOA 5KS9E 2IBZY 1HWHB 3CJJA 4X6FB 1A3RH 1BZ9B 1FA4A 3G08B 3MNZB 3QJQB 3H3BC 4FL4C 2EDNA 4KVNH 4G5ZH 4N2AA 5GGVY 2QKIB 5AVZB 3PWPA 2Y1YA 1NCUA 3D7PA 1YN6A 4N90D 1ZVNA 2V3FA 3LXBA 1TVDA 1NDTA 5EIQA 2MQCA 4OIBA 3CN2A 3ET9F 2X1QA 4YSTA 1KWGA 9PCYA 5FFOA 2XPGB 4ACTA 1ET8A 2X9XA 1T03L 3F12A 1RJLA 4X99B 5DCCA 2QPFA 1ZGLM 5INCA 2I9LB 2GJZA 3KW8A 2B1OA 4L1TA 4WJKB 2JK5B 2CIKB 4XHQA 1OGTA 5DK2A 4AW4A 3GSNB 1WWBX 4HHAB 4HUXA 4QRFA 3SKJH 2WAQA 4A2HA 4YZWA 3WJMA 2VQ1B 1MVUA 3V5DB 4ODUB 1SOKA 2GT9B 3PHOB 5CGBA 4Z7OB 2YPKB 2P44B 5D1ZA 2BMKA 1UACH 3AFLA 4AQOA 4OKVA 1KIPA 2BS9A 5HHME 2W07A 2G4GA 1U92B 2NQDA 4NYLA 2F1EA 3CHRA 2DYPA 3K2UL 1S6NA 1L0QA 3FQYA 4GJTB 12E8L 1O5DT 2JCCE 1B3JA 4U6YA 2F0CA 5FYKL 5D4HA 4OCXH 2A74C 5J6GB 2F68X 3L7EB 4JVUA 3HE7B 2AEQH 1W0WA 4PWEA 3QDJB 1H5BB 3P73B 1LO3H 4KO7A 4EO5A 1FN4A 4C56D 2IBZX 3MBED 3EYVB 3OKEA 4PJHA 3VCLB 2F5BL 4DFHA 5T3XD 4Y4KC 1CFVH 1QSVA 4O51A 3EJUA 1OP3H 1D6EB 3OJVC 5KBLA 3GRWH 3SN6N 2GSMB 2JXMA 2R1XB 4TSAH 2UWEE 4PS7A 4Y4KD 2AZAA 1DQLL 4MD0B 4Z3IA 3TO2B 3R4DA 1KWKA 3B8SA 5I8OL 1A7NH 1SJMA 3MLYH 4FC3E 5I23A 1MELA 5JZ7C 1CDUA 4M93C 2B8OT 5DJ0A 3BZEA 5EBWA 1J0JA 3QPQC 4Z3JA 4OGAD 1TXKA 1MJJA 3QEQE 3TVMB 3QYMA 3ARVA 3IKKA 4XP6H 2IWEA 5BJTA 4N0UE 1L9RA 2GTWA 3K8LA 3DRTA 3FN0L 3GTNA 3RAJH 1K2DA 3OB8A 5D7IF 5KVEE 3GUFA 1XH1A 2BM3A 1AQDB 2CAKA 4AV4A 3QUYC 1V7MH 1ES0B 2IALA 5CCGE 5IKCA 4BSJA 1S9XB 4DN4H 3CSTA 3BKJL 1BYPA 1OD7A 4K94H 5E1HB 2IFFL 5GS1A 4MWFA 5JNYB 2AF2A 3UO1L 1OGAB 4N1CA 1TZAA 3QUYD 3BIKA 2EE0A 2BHYA 1A1NA 2WBWB 2X53A 4N1EA 1JUFA 1L9SA 3US1A 3KYMA 1LK3H 4TNWF 2HJKB 3V4PA 3VW3L 5IQNA 4FXKA 3GXDA 4R26H 1ODUA 2JI2A 4PJBF 5MEQA 3NPZB 4XMPH 4CNIA 2VW6A 4HBQA 4IOIB 4U1LA 4IGBC 3H0TB 2AXWA 3TBBA 5I66B 4MCYA 2ZX5A 4JHBA 2Q86A 4FF9A 2DQJH 4PJ9B 5D70L 1PZCA 3HI5L 2F61A 1KACB 3REWA 5LNGA 4JQXA 1GW0A 2J55A 4CC0A 3ULVH 1FC2D 1W15A 2Y1ZA 1A2YB 4WKZB 5AW5B 1QW9A 2Z64C 5I15H 3IU4L 4GKZA 4G5AA 3ESNA 2V7HB 3LPFA 1DDHB 3M1BA 4BGDA 3B7UX 1HC1A 3ZQWA 4NM8L 1ZPLA 4DP0X 1E28A 4M4RB 4C4UA 4IRSD 2QQKL 4FFYH 2IG2H 4HT1H 4NM4L 4U7MA 2UY6A 1PZSA 2DDQL 2ICWJ 5DRWA 3E8VA 1U8JA 2FECL 4G9FE 4HJUA 4NKQB 1AOZA 3O9WC 2ZP9A 4JHZA 4NN7B 1KZYA 3FSWA 1HIMH 3NCFB 2C9SA 2QKSA 2JI1A 2C1OB 3WV0A 2GTZA 3ASOB 3O9WD 5F6IB 3KVQA 4HPOH 5DO2C 3MRKB 3X1FA 3TN0C 2ILLA 4JFDD 3FTVA 3DTDA 2YZ1A 2Z7WA 4Y2OB 1PX3A 1FNHA 3BP4B 4UM8A 1HOCB 1YNKL 2C3HA 4HC1H 3A4FA 2KI6A 5KYXB 5FM5O 3AVEA 3HNSH 3TXAA 2ENYA 4XNMB 1MFEL 1NDMB 2ZCKL 4MDIB 4TQIA 4X5XB 1AIZA 1IARB 4JJ5B 2D3LA 2YPLE 3BDYH 1CFQA 2J20A 4LSPH