3QQXA

Reduced native intermediate of the multicopper oxidase cueo
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
494
structure length
474
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHDDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 140
structure length 474
sequence length 494
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qqxA03
4N4YB 1IBYA 1OOWA 1ET8A 1ASPA 3PCYA 2X87A 1AS8A 4G7QB 4BWWA 1AZUA 4F2EA 3NJJA 2XLLA 1OF0A 8PAZA 2JFCA 2FT7A 4G7RB 3BQVA 4JHUA 2AZAA 3QPKA 3X1FA 4DP6X 2R7EA 1JVOA 2OCCB 5AKRA 1PNCA 2BP8B 2GHZA 2W8CA 3T6ZA 1J9QA 2BP0B 1AG0A 1ASQA 1XB6A 1ILUA 1AS7A 1A4BA 1TEFA 4G71B 4YSOA 3RYMA 3CVDA 1JERA 4YSUA 3MBWB 1AZBA 4UF7C 3UAAA 3WKPA 3FQ1A 3QJQB 2VW7A 5TK2A 3FPYA 1TKWA 4HCGA 5B1JC 1OE2A 4DP1X 1E5YA 4W1TA 3H56A 1AACA 1J9TA 2Q9OA 3TBBA 2ZXWB 5D4JA 1KV7A 4UAHA 2CJ3A 1NIBA 3KW7A 1MG2C 3WKQA 3HB3B 1L9SA 1SF5A 3EH4B 1DYZA 4DP5X 1GS7A 2IDSA 3S8GB 1BAWA 2PPCA 2J57A 3FPXA 1A4AA 1BYPA 3FYIB 3FU7B 2GC7C 2VN3A 4E9QA 1W8EA 3NSFA 1HFUA 1PMYA 4UANA 1WA2X 2XX1A 1OV8A 1QLEB 4DP0X 1BYOA 5A7EA 2XU9A 1TU2A 3T6WA 3OM3B 1BXVA 4GXFA 4KO7A 5I26A 1SDDA 5I6PA 4HAKA 1GR7A 2E86A 5F7AA 2XXFA 2YAOA 1JZFA 1ZPUA 1JXFA 1KYAA 2AZUA 3H4FA 1GYCA 2EIJB 3OMNB 5F7BA 1WAEA 1JZIA 5PAZA 1E67A 2UX7A 2UXFA 2FNWA 1EZLA 2IAAC 2VW4A 4PCYA 1KCBA 4YSEA 1IBZA 2X88A 5B7EA 4BWUA 2HRGA 1ADWA 3KW8A 3UABA 4WKXA 4M3HA 1AG6A 2IWEA 4E9XA 5FC9A 1W6WA 1NWPA 1BXAA 2YXWA 3S3BB 4DPBX 4YSSA 2GBAA 1J5DA 1ASOA 3DTUB 3QJSB 5I5JA 1RZQA 3NP3A 4QLWA 1A65A 3NJNA 2LLNA 1B3IA 1UATA 1BQKA 2FT6A 3DKHA 1JXGA 4YL4A 4E9WA 2XWZA 4BXSV 3SBQA 2PP9A 5ANHA 1R1CA 3EF4A 1GW0A 1AZCA 4A2HA 2XYBA 2PPAA 4A68A 3NJLA 4MFHA 1KDJA 2GB2A 2MTAA 4ZK8A 3FT0A 1FA4A 3S8FB 1HAWA 1GY1A 4P5RA 4E9SA 1GS8A 2IDFA 1PLCA 3OMAB 4QKTA 2FQFA 3V9CA 1IUZA 3HEIB 4KO6A 7PAZA 3FSZA 1BQRA 2GI0A 1ZDSA 2IH9A 3IBOA 3X2QB 4YVUA 5B7FA 4JHVA 1KDIA 5E9NA 3FQ2A 2CBPA 2BO0A 5LDUA 1E5ZA 3V9EA 4BDVA 1IC0A 3N2JA 5B3SB 2PP8A 3UACA 5B1AB 5I6MA 4A2EA 2HXAA 3X1GA 1SDDB 4Q89A 4AKQA 4GYBA 2BZ7A 4BWTA 1ET7A 2H3XC 1JZJA 2HZHA 2IDUA 4FAAB 3NSYA 1AR1B 1NINA 5TK4A 3FU9A 4KO5A 3C75A 2GC4C 3CDZA 2Y1AA 3UAEA 2J56A 4DP4X 3CG8A 2N0MA 2GIMA 2EILB 3AG4B 1ZDQA 3NJFA 1XMEB 1F56A 2YAFA 2OV0A 4BDVB 4KOBA 1ETJA 3AG3B 1NDTA 1RKRA 3BVDB 3AG1B 2JXMA 4HZ1A 2BW5A 4A2FA 2W88A 4AX3A 2GSMB 2AANA 1PLBA 3AY2A 2BP8A 5I28A 1ET5A 1V55B 3EHBB 1NICA 1PCSA 1WA0X 3X1EA 1AQ8A 1L9RA 5I5IA 3IE9A 1PNDA 1GY2A 5IY5B 4A66A 4YSCA 4KNSA 3OQRA 1CURA 2BHFA 1PLAA 3ABKB 2B08A 2EIKB 1JZGA 2ZOOA 1X9RA 2XVBA 3CZUB 1SHWA 3UADA 1KBVA 2XV3A 3ERXA 1SF3A 2DYSB 1CYXA 1XB8A 3NJMA 1WS7A 4W9ZA 2YARA 1N70A 2J55A 9PCYA 1M9WA 3NP4A 2QDWA 2I7SA 4EF3A 2VM3A 3G5WA 4HCIA 3PAUA 3EH3B 2UXGA 3ABLB 3OMIB 3OD3A 1PF3A 4HCFA 1TEGA 3FU7A 2HLEB 3ZBMA 5AZUA 1EHKB 3ZIYA 1AOZA 4A2GA 1JXDA 1RCYA 1V54B 2PPEA 2TSBA 4YSRA 3SQRA 4YSTA 4N8UA 3ZDWA 4CSZA 1M57B 1KCWA 1IKOP 4G70B 3NSDA 3MX0B 3GXUB 5B1BB 5PCYA 5I6LA 3NJKA 4AKOA 5I6OA 3CVCA 3FU8A 3D12B 1J9RA 3S3DB 1JZEA 1E30A 4AI7A 4BXVA 1OCOB 1L9TA 3QJVB 3WI9A 1URIA 3X1NA 4FA7B 2FQGA 3PPSA 2IWFA 3ASOB 1ILSA 4KNUA 4G7SB 3T6VA 2YAPA 4YVNA 1MZZA 2QPDB 2DY2A 5I6KA 5EHFA 1NIDA 3IN0A 2XUWA 1OE3A 3WIAA 3ABGA 2I7OA 3AG2B 1L9QA 5I5MA 1OCRB 2YAMA 3TA4D 2UX6A 1NPNA 3SBPA 1QHQA 2UXVA 1SFHA 2BW4A 2ZWNA 1GSKA 1DZ0A 1OE1A 2IDQA 2P80D 1PZBA 4P5SA 2XXGA 1XB3A 2BZCA 1RZPA 3WNIA 1A3ZA 6PCYA 3QJTB 1GS6X 2FJSA 2WO2B 2VSKB 3JTBA 3SBRA 4AKPA 2EIMB 3H4HA 1E65A 2YAEA 4DP7X 4E9TA 2PCFA 4NAJA 1BXUA 2HX9A 3CDZB 4HHGA 4E9VA 1JZHA 1CC3A 2WSDA 1KGYE 2TSAA 3AZUA 2YXVA 1HAUA 3CVBA 4GY4A 2J5WA 4A2DA 2FT8A 1PAZA 2I85A 4DP2X 1NIEA 1M56B 4HALA 3PXLA 2YQBA 2CUAA 4KOCA 2XX0A 1ZIBA 3FSAA 5I6NA 2DV6A 1PY0A 3DIVA 4E9YA 4NB7A 4DPAX 4M4RB 1VLXA 1NZRA 2PP7A 1CUOA 2FWLB 2IDTA 2Y69B 2PLTA 1A8ZA 1AZRA 2BP0A 3FS9A 1J9SA 5D4IA 1FFTB 4DPCX 3ABMB 4A67A 1CYWA 1JOIA 4DP9X 1OCZB 3T71A 1OCCB 3QQXA 1I53A 1BEXA 4GP5B 2P80A 2DWSA 1W6LA 1WS8A 2R7EB 4ENZA 2CALA 2VMJA 3PLYA 1SHXA 1T5KA 4YSAA 4TXVB 5B1JA 2PPDA 4YSPA 3IEAA 4X4KA 1YLBB 2FQDA 2EINB 2PPFA 3T6XA 7PCYA 1MG3C 4AZUA 1AZNA 4F7KA 2H47C 1ID2A 3NSCA 1NIFA 2FTAA 2DYRB 3T9WA 1NWOA 2IH8A 3WG7B 2AVFA 4BK5C 1ZV2A 2IWKA 2OJ1A 2H5UA 1MDAA 1JVLA 3FSVA 2VW6A 3NJGA 4YSQA 2XV2A 4HIPA 2AFNA 3FQYA 1SJMA 4PAZA 4F2FA 1QNIA 4WTQA 4YSDA 2MRYA 5D4HA 2XV0A 3NT0A 3S3CB 1NIAA 1PZAA 1BQ5A 1V10A 2VSMB 2QT6A 1NPJA 3AW5A 4E9RA 3FSWA 1SNRA 3GDCA 3FYEB 3PAZA 1X9UA 2BWIA 4KO9A 4Q8BA 5AFAA 4G72B 3ZX1A 2PCYA 2Q5BA 1L9PA 2VM4A 2WO3B 2YAHA 3TASA 2HX8A 4KNTA 2FQEA 3PAVA 2CAKA 1L9OA 4K9JA 3X1BA 1A4CA 2YAQA 3N55A 4DP8X 3WNJA 1AANA 2ZONA 1FWXA 1ZIAA 3NJHA 4CSPA 6PAZA 1MZYA 1J5CA 5B1KA 4L0PB 3NYKA 2NRDA 3IN2A 2HRHA 2A3TA 2UXTA 2JKWA 4JKNA 1AS6A 1NTDA 2B3IA 3EH5B 3TU6A 4NERA 5B7MA 2QDVA 3GYRA 3JT2A 2QPEB 3NJIA 3QJRB 3UGEA 3ASNB 2CCWA 1AAJA 1SFDA 2HX7A 3TBCA 1N68A 3U25A 3L45A 2BWDA 3QJUB 1AIZA 1KBWA 2RACA 4HHWA 1WA1X 4RH4A 4GP4B 1PZCA 4GP8B 2DWTA
chains in the Genus database with same CATH superfamily
1F4WH 2CGZA 4HPOH 3PJLA 4XI5D 2WNXA 3MX0A 5E00B 2CXGA 4UBDC 1WFIA 1Q9KB 4GSRA 2EP6A 5ESVA 5CBEA 4G7QB 5EOQH 3ETBJ 2P24A 1LO5B 4HC1L 4CNIA 3CPLB 4ZTOH 2ZUTA 2F1BA 5BOZG 2XZAH 5C0CE 1JPTL 3G04B 4HAFA 2GT9A 4QAMB 3HHMA 32C2B 1R5WB 3GHPA 2YD5A 1AC6A 2BP0B 4AEIL 1ASQA 3K2MC 4LNRB 4EN2A 2W95A 2WJ7A 3QG7H 2FWOA 2XN9D 5FM5O 4J3OG 1MPAL 4BZ1A 3CNKA 4U1KB 3X13A 1MI5D 4FFVC 3MV8A 4JPQA 5TK2A 1AFVL 2VAAB 3FW6A 5AW3B 1TKWA 3BUBA 2VL5B 5DURB 3UJJL 2GEEA 4OU3A 2HN7A 1FFOB 3E2HB 3IJHA 4Y5YA 1LO2H 1S8DA 4ZXBD 5C8JA 5EEYA 4OZFG 1IJ9A 1FFPB 3MRRA 1YNKH 4PJ7E 2AJUH 4JDTH 1YMHB 5CGTA 1P4IH 1S7WB 12E8H 1DN0B 1O9VA 2VDNH 4JPWH 1KNOB 2FX8H 3HG1A 5IVXF 1KELL 3ALXA 1FFNB 1DQLH 3GRWL 1N5YL 1FRGL 5FYLE 1QFPA 4BFBD 3QORD 3ARFD 1MCCA 1J87A 2DMBA 2Y6SC 5GZNC 3ARBC 4G8EB 2GIXA 2VC2H 4OBSA 3VXNB 4Y7OC 1OWRM 3L1OL 1BYOA 2ZG1A 1G9MH 4C83A 3CFNA 3OM3B 4MSWB 1KXVA 2XA3A 2HRPL 3A3YB 1AGDB 1P84K 3DOSB 1X7SA 5DJ8B 5CJOL 2AW2A 3DRQB 2EIJB 5E2TH 1V8HA 4ANXA 1KTRL 2R2HB 3GZPA 3QWOB 3OPUA 4NQXA 4G80B 4JFEB 5AD0A 1QQDB 4Z95H 2K6YA 5JW3H 1U8NB 4P4KD 5B38B 3WEOA 1EFXA 3D6GA 1PCXA 4RGOH 4NBXB 3SEPA 1UM5L 2YXWA 2R2EA 3IE4A 2RD0A 3IB4A 4X42A 1DBKH 2VDQB 1RZQA 7CGTA 4XNAA 1MRDH 3N0AA 2RFXA 1B3IA 4ANKA 4MA7L 4E5XA 4P46D 2XWZA 3OKNA 1DLHA 1QBML 3BDXA 1EJ6A 3AXLA 1M6OB 5ESAA 1FO0B 1BF8A 1V7MH 3TA3C 3LSOB 2PPAA 4DZBB 3JV0A 2B0SL 3S5LB 4JY6A 1YDPB 3PWPD 1KJVA 3ZDXB 2QZQA 4L9LA 1Y7VA 4U1HB 1CDJA 2HG5B 2KBGA 2BVPB 1GY1A 2AJ3B 2AI0L 3O3EA 2FQFA 4NDMB 5FYLH 5FPIA 1D5XB 3TL5A 3RIAF 3GBEA 3TJEL 1WFJA 3F7QA 2ZP8A 4OGQC 5C08A 3OV6A 1LO4L 1JF1A 1E4JA 2J6EL 3QQ3B 4D0DA 4GUOA 3IBOA 1EQWA 5JIHA 2PW2A 4YVUA 1GZHA 1WRFA 1Z5LB 3HC4H 1UVQA 2G3NA 1A0QH 3O6ML 3WNNA 2G3MA 1JZ8A 4UT7L 1TT6A 5IG7A 2UZXA 1X44A 3N91A 3QJXA 1LK2A 3K4ZA 4YGVB 5HDWA 5CNHA 3C08H 3ECUA 3W9DA 2C4XA 3F62A 3TPKA 5HJBA 3QHTC 3AREB 5CHNA 1T1YB 4K23H 3BDBA 4P04A 2MTPA 4JFXB 3SDAB 5JIMA 4HUWA 3QCUH 1UXWA 3G6AA 5E2VL 1JZJA 3ULUL 1AR1B 2GFBA 3H53A 3LN9A 2ICES 2N59A 3P0YL 2XDHA 3LS5L 4JO4L 4NQXB 2Y2YA 3TTYA 2PABA 1GRWA 2J56A 4YMPA 1T20B 2GIMA 1VCBC 1QFUL 4G8GB 4KJPD 3D0LA 4ZPTB 3U48A 4C59B 4XVSH 4PJHF 4N0RA 1AGDA 3WLBB 4G5ZH 5BVPH 3VGGA 1NANH 4AVKA 2NY0B 2XTJB 1YEGL 3MNZA 3HFMH 5EZPA 5LG6A 1O75A 4XZUA 5GGQL 2BW5A 1IEBB 1TVHA 2CKBL 5CMAA 4A2FA 5A6MA 4U6XB 4QIRA 3CVHH 4JQXA 3DYMA 1KYUA 1OL0A 1MCSA 4HKXA 1KXQA 1L9RA 1TO5A 3EOBA 5E5UB 5C92A 5C0CB 3GTNA 2C9XA 3PQYA 4FZ8L 4JFPA 2BVTA 3HN5A 5ICYB 5JA8B 1OKEA 5E08H 2XWCA 3T04D 5E8PA 3C6LC 1ZGLP 1ZE3C 3ESNA 5A6IA 1DQQB 4PS7A 2JB6B 1I7TB 1TQWA 2Z3FA 3GBMH 4XX5A 5CP7A 4OJAA 1YC8A 1RUQH 5J1AB 4X4YA 3L4ZA 5GS2D 3R8QA 1KBVA 2APWA 5I1IH 1VFAA 1MREL 1NMBH 2C5DC 1ETA1 4TTGA 4CMMA 9PCYA 3QG7L 3MV01 2PXYC 3I6LD 4FQCL 4NIYE 4RDBA 3MCYA 3EH3B 4H44C 2AQPA 1WK0A 4I0PB 3FU0A 3KJ4C 4MAYC 1WP6A 4ZJ9A 3ARWA 3DV6A 1CD0A 1DVSA 2LGNA 2CIKB 1PF3A 3IJSB 1TEGA 4HCFA 1T83C 3JVFC 4YE4H 3ZBMA 2PO6C 3ILDA 3T6QC 4O02B 1D2PA 2VRQA 4YSTA 1RJZB 1QWNA 3FQTB 4LPTA 3G6JB 4OCRH 1M57B 3L3DA 5AWNH 3RPKA 3NSDA 2H6UA 4MZ3A 4NHCL 5A2BA 2DH2A 1VFOA 2AKRB 3FQUB 2YFNA 4OQTL 2X1PA 5E6YA 1NCUA 3KZ8A 1URIA 1WZKA 4BCZA 2NQDA 1P5VB 2GY5A 3FOMA 5J1AA 1MXGA 1M3IA 1OB1B 4KDTC 5GGTL 1EHXA 2D7OA 4YFEA 4HMDA 3VXTB 1QVOB 3SGKA 3V55A 5DZPA 2MPAL 1JTPA 3CFKB 5I0YA 2G9HA 2K78A 3QNXB 4UM9A 1M7DA 4FQJH 4JLRB 3UTSD 3EOBB 1CYGA 1N3NB 4XAKD 3L2NA 3VX0A 1MHHA 2JJTC 3TEWA 1SFHA 5I18H 2YSSB 1RI8A 4PRNB 3MR9A 1E90A 4Q56A 5HP5A 2EIDA 1DP0A 5T5NG 1JUFB 2FZ3B 3I6GB 4OGYH 2X4UB 1CFSA 2SEBA 3I75B 2JCCB 3ES6B 1PIFA 3LNGA 3V0VA 2VSKB 3NIFE 3SBRA 1ZV5A 4OQ1A 4R26L 3WLBA 4KPHH 1MRFL 3GNMH 1JAEA 3H4HA 3SDXF 3MA9L 2R29L 1EZVY 4HFUL 4FQ1L 1HILB 2EC8A 2JELL 1A3QA 3VAEA 4ICWA 1EHLL 5BRZB 1H6TA 2D3NA 4IW4C 4A2LA 4DGYH 3AZUA 3VFMB 3T0EA 3PL6C 2X0WA 1AXIB 3RB5A 4FJYA 1HHKA 3RI5F 3EO1A 1EMTH 1UEMA 1NIEA 3FZUD 2ITEA 1SDYA 4HUXB 4IBZA 4JFXA 1BREA 1VGEL 2D7PA 5HD8C 4PP1D 4F9PA 1Z9PA 3MYZA 1E6OL 4Z7WF 1KPRB 5I6NA 5HYJA 3VI4F 4E9YA 5H94A 4M4RB 2ZUQC 4WGVB 4H25B 5HVHC 4HC1H 3E8VA 2PLTA 1A8ZA 2OJEB 4JW3A 2C7UB 4M6ML 4N87A 1JOIA 1HCZA 4LHJB 1UVQB 4OUUB 2XTLA 3FCUB 1W0WB 3RIFK 4J8RA 5DUMH 1B2WL 3BXNB 3OJMB 2R4SH 1KJMA 3F12A 5TDOA 2PTTB 4TVPD 1IM9D 2ZF8A 1SHXA 1FZOA 1CFMA 3GSXA 3MNVB 1BFOB 1H3VA 5IJVA 4UM8A 4KUZL 3G3LA 1JV5A 2PO6D 3GXMA 4I3GA 2IANA 4FMKA 2PPFA 3D4ZA 1MNNA 1DE4A 2VSCA 1U93A 5T1KB 4YHML 4F7KA 4N85A 2VABA 3OBAA 1FHGA 1W0YT 3OKYA 3T9WA 1KYDA 1GGIL 2P42B 5TF0A 4ISVA 3O0RL 4RZCB 1RAMA 2UY6A 2A6DA 5T3ZE 3DECA 1M6OA 1WFUA 3EDJA 3CFBB 5G55A 5E8NB 2JCWA 3ZZLA 5E5MB 4YSQA 2XV2A 4HIPA 4PRIA 1SJMA 5E9DA 3WMQA 4QF1A 1JNNL 2N56A 2WOBA 1ONQA 3Q7JA 5HPMA 5I8KH 3X14B 3HG2A 1PZAA 4F33A 3HG4A 5LBSA 4ZFOB 4AM0B 2J6EA 3U6XS 1K8DB 2PCPB 2NR6A 1PG7W 2WVVA 5EUOE 2PN5A 2CM5A 1BPLB 4BFKA 2EUZA 2JMRA 1YEHL 2JVUA 2YRZA 4KUZH 2H8PB 3UTQB 1X9UA 4M8QA 5ALCH 4NM4L 5C9JB 1E2ZA 1RVFH 5IWLC 1NFDE 4EI0A 5TFSL 1EEUA 2XZCH 3CU1A 2RAMA 4FQXB 3V0IA 2VM4A 4MZIA 4P5MA 4URTB 5FYJH 2DWEB 4ZMTA 2J5LB 1N4XL 2XWJA 4ZMYA 2WJ5A 3LB6D 2CAKA 4OLZL 2OX5A 3MRPB 5KSAB 1AHWA 4HOZA 3CX5K 4FJZA 1I3RA 2VTFA 3ISWA 3QUYB 1W0WA 4BZYA 1CDYA 1X3DA 4KK8D 4PRPA 4YZWA 4EI6A 4WU7A 4I18C 4U1SB 3UP1A 1CDHA 4BSVA 1HKLL 1K4DA 1LJMA 2Y36L 1J5CA 1AO7A 4JQVC 2YGPA 2HRHA 5ISZE 1BM3H 4JR9L 4KITB 3WXWH 4M61B 2UZPA 3OAYH 5BOPA 5FXCH 3DMMB 4YHLL 4ZXBA 2JWYA 2ICEC 5I0WA 4E2OA 1TSHA 3WD5L 3H9SE 3WAKA 3U79A 2QPEB 3D50A 1MHEA 2A77L 4WK4B 5MEOA 5DMKA 2FEJA 3LKQB 2XZCL 2GTZA 4LPCA 3SQOH 3TIEB 3U9UA 4BEIA 4R7LA 2VAJA 1JPFA 1TPXC 2IBGA 4RNRB 3WIIH 4NQEA 4LSUH 1BYNA 1KT2A 2BIQA 3GC3A 3IU3A 4UM9D 5I18L 2F5AH 4FEMA 4MNHB 5EOCH 5IB5A 2DJ4A 3I6GA 4L8CB 4MJIE 3K6NA 5K1NA 5F21B 1ZSDB 5AB2A 1MCJA 2FR4A 1X7QB 4F37F 4YLBA 2I5YL 2FT7A 3DX9B 5D7KE 3S34H 3ZZ1A 2Q8BL 1N7ML 1NANI 1A7RL 4LDCA 4JLRA 3W11D 3BQUB 3DVNA 1G7HA 5SX5H 1OQOA 5EB9A 4ZO6A 1R3KB 5GS1B 3UTPE 1ZAGA 1LD9A 4RGNB 4G71B 4YSOA 1D2OA 1COBA 3A67H 4X6FB 3BYYA 3NSXA 4TVPH 4F8TA 3B9KD 4QRTB 2B20A 1S7RB 3EGXA 4FXTA 4TSCH 3S4SA 3AY4C 4YHPA 5HHOA 2QL1A 1IAII 5DMGC 1WZLA 4K0OA 3OB0H 3WGVB 1SJEB 4C4KO 1HH6A 3ROOB 5FECA 2MKWA 1FAKT 1X7TA 3HVNA 3V7AG 4DK5A 4YDVA 3SN6N 3HE7A 4H4NA 3EH4B 4GAAA 4Y89A 5B4MC 1LNUB 1LGVA 2YEZA 2WKOA 3FXIC 5ANMA 3RGVA 1BYPA 4JO2H 4KQ4L 2WWOA 3RIKA 1F6LL 4FN0A 4K4KA 5CP3H 1W8EA 4Y8DC 4M02A 3SE8H 5JIQA 3VXQA 4DT2A 2AJZA 4PCSA 3WFBH 3CHQA 4GMSH 3RZWA 1JK8A 5E2WH 2RQ8A 2IVFC 1TJGL 3HZKB 5JHDB 4X4YB 1TU2A 2NCMA 2WVTA 3H42L 2R1WA 3WHXB 4BE5A 5KW9H 3GFUA 5E08L 2VISB 4Y2OA 1H15A 3IDMB 4LRNL 3ARFA 5ADOL 4GINA 1WAEA 2X3CA 4XNXL 4UDUA 3K2KA 3MBED 3ABZA 4URKA 4JN1L 5FF6A 4HSAC 1VB9A 2BSRB 3SGJA 1UEYA 1S78C 5MI0C 3MFFB 3HI1A 2VC2L 1KPVB 3ZKQD 1UGNA 4GAJL 4E9XA 5FC9A 4UQEA 3ROLB 2EDHA 4R3SA 4AYEC 5IR1A 4MDIA 3WE1A 1YO4A 1IAOA 3NJNA 4GW5B 5EBWB 1MJJA 2DM7A 2WCPA 4HWEL 4LVHC 1FO0H 3DA0A 1Q72H 5EBMB 1UD6A 3QORA 4GBXB 5FO8B 4KHTH 4ZDHB 2EXWD 1OAJA 1UXLA 4FDWA 4G11A 3WIFB 3W5NA 3UYRH 1AZCA 1UH2A 5IHZA 1YZZA 4OI9A 2KDGA 2UZIH 4W9KC 1BAGA 5IIEB 1RVFL 5FCUL 4RFNB 3AABA 2NY6B 4X9BA 5ITBL 5CZVL 1RZIA 2X2IA 3FCGA 3G5ZB 2BNRB 3QO1B 2A83A 4MGXA 4E9SA 5MHSE 3OMAB 5HVWA 3MU3A 2CRYA 2NLJA 2X3BA 1MNUL 3F6LA 3QUXB 2OMZB 1E8ZA 3ZK0A 4X5LA 5JXEA 1Q1JH 1UFUA 2LLGA 3C2SA 4BJLA 1FGNH 3FSZA 5K9OB 2MCPL 5D7JB 1VEMA 5C08D 3QJOA 3ARSA 1K8IA 4WJG3 2HTLD 1EK3A 3UPRB 1NCIA 4UU9A 3S35H 1XV8A 1KDIA 4XO5A 2JTYA 3ZE0F 4E42A 1R9FA 5I1CH 3M7OA 3VB9A 2Q76B 3FQ2A 1Q1PA 1T22B 1PU0A 2GJ6D 4D0DB 1MLCB 2WQUA 3SKMB 1W15A 3GXTA 1AXTH 2J8UE 4Q6IA 4ZMQA 1CXKA 3NA4A 3K5SA 4V2BA 4UQ9A 3INOA 2ZJSL 4BUQA 4P46A 1MFBH 1RFDL 3ILEA 4G43A 3QPQD 4MWFA 4N20A 4OZ4A 2D9QB 1TJHH 2R23B 4L9LB 2OYKA 4GMTL 4BZ2L 4NXSA 3RWJA 4CMHC 1EVTC 4XPGH 4ECNA 3IVKA 3G08A 4HZLA 1ZRUA 2P1YA 3UTOA 3U1SH 3UPCA 2HFEA 5SV3A 4N0UA 4PRDA 4OZFB 5C0AB 1E9PB 4XH2A 3HMXH 3QIBC 4DEWA 5LN4A 1RIVL 2J1WA 2M8XA 4J3BA 4M7ZB 3M17A 1YEEL 1A5FL 2QV2A 2J4WL 2Z0BA 4BCXA 4OZIE 4H8PA 3VXRA 1OK8A 4U7MA 1VGEH 3V9FA 2XT1B 3ZL4H 5LLIC 1ODAA 1HHIB 1ZS8B 2WXGA 4LHUA 4TUUA 3PYCA 2M26A 2ZF9A 2D7NA 1A14L 3ZTNL 4QXGH 4LVOB 4XMLH 1NCCL 3QUKA 4IHOA 4BRJA 3W0WE 1J0JA 1NAKL 3QFDB 4OD2B 1DDTA 5ICZB 1IO4C 3HUJA 1C5CH 3R18A 1P9MA 3I9GH 4MNQE 5IQMA 3GSVB 3ILQC 1AHKA 4BFIA 1ZJAA 4HLEA 1SHSA 1CXEA 1TYEB 2CQVA 4IU2B 5DD1H 4YWGL 1M1SA 4N0UB 4AEHL 5I15H 1AGCA 1P5UB 1QSZA 3ZYZA 3WKNA 3UP6A 5DT1L 2WTOA 4BIKA 4FQHA 1GOHA 2QZ5A 1WS7A 1QLRB 1GGBL 1ZTMA 5EU6D 3WLWC 1YNLH 3MRBA 4OLYH 3RAJH 1CDBA 3ECWA 1L9MA 2HJFB 4K8RL 1MIML 4E41E 1EBAA 2OFQA 1DBJH 3U0WH 4XCNB 4PVNA 2AJUL 4WFEE 4FYSA 4U1SA 4ONGH 5FM5M 5AVQB 4MYWB 1KELH 5FO7A 1CQKA 1XGYL 3QCVL 1MF2L 1S7WA 2PPEA 2VMDA 5DHDA 1T5WA 1NBYB 4Y5XB 1IKOP 2LV4A 2Q76A 1VF5C 4NS0A 3TO4C 3CN2A 4FLQA 4XMKL 2YGQA 3SDCA 1OAYH 3PHOA 1F8TL 2E7DA 4A6YB 4YWGH 3RWHA 5D7JA 5SWSD 2XWTB 3REVB 3OB0K 4YOKA 4Z7QE 4H2CA 4POUB 1CGSL 4KBPA 5IVXA 1BDYA 3AADB 5EIQA 5FCSH 3VH8A 5A2KH 4Q6IC 4R0LC 2C3WA 4XB8A 2WUBL 4Y0GA 3HLAA 2DY2A 4PJ8A 3UAJC 4GKSA 1YPZA 1OSPL 4N2CA 4RDQF 3ZYJA 1E4XL 5E5MA 4FQ2L 2PWHA 3C60C 2YK1H 1NPNA 3A6CL 3WTXA 1JPTH 1I8MB 3ZDZF 4LASH 1F6AB 5SWZE 3DK0A 2BOCB 2FCBA 1CR9L 4C58B 5DMIH 2K8QA 4OZGB 1NL0L 1Y07A 5C86A 2EUVA 2VMCA 4GH7B 1ZA6B 1P7KB 5CCHE 4EPSA 1ZMYA 3CFCL 3MOQA 4QR7A 3NESA 2ZUWA 4MQTB 4I9WD 2OA9A 3IYLW 2YAEA 1U8JB 4ADJA 2BSRA 2ZKXA 3OR6A 1F3JB 4BYHA 2A0LC 1OWWA 1XXDC 1MCPL 1WBXA 3KVDD 4CDHA 2V3DA 2HX9A 3D09A 3DYOA 4KY2A 3CQQA 4HJJH 1A2YA 1FP5A 2X9YA 4KWUA 3BSZL 5A2LH 1KIUB 1PIGA 2VR6A 3EJYD 3TBVB 2WQXA 5GGVL 2G2NA 3IGFA 2XBTA 4ZSOE 3DIVA 4Z0BL 3HCVB 2XZQH 2Y69B 1CLOL 4M7KL 3QQ4A 3ZE0E 2VO8A 4CVUA 2WGXA 3P77A 1VZIA 4P5KB 4TVUA 3RE0A 1CYWA 3SE9H 1LEGA 4L2YA 2A7BA 5DD6A 1R3LA 4JN2A 2BNUA 1BEXA 2XWEA 3RX9A 4X8JB 4BUGA 3T8VA 3VU1A 2ADGB 4JKLA 4MDJB 5BS0B 2ZCHL 2EDYA 5D8JH 4B97A 4YSAA 3Q9QA 3QA3A 5SWQA 1JYVA 4QKXB 5KVDH 4JDEA 4YSPA 3DROB 2EUWA 4PRHE 5LUMA 1SLWA 3MRIA 3FONA 1XR9B 1BSIA 3E6FA 2H47C 2FZ3A 2DQIL 3V6FA 4YDKL 4OZGF 5HJGA 2JQAA 2OTUA 2EIEA 5DHYB 1TITA 2Y7NA 3GD1C 1UM5H 1ZV2A 2OJ1A 1CE1L 1EHAA 3N43B 4PJ5E 4H2AA 1W80A 4DFIA 1BP3B 2X41A 2BPBA 1V7NL 1Q0YH 2MNUA 4F2FA 1IGYB 3N85L 3KLLA 4JFUA 3K72A 1L0XA 4OTXL 5EUKA 5EFIB 3D0VB 5HYJD 1EO7A 3DVNB 3LV3A 1A1MB 2NZ9C 5DRWB 1T83A 2Y3NA 2NTFA 4GIOA 3P9WB 4M29A 4KK9C 4G9FE 4Y16A 3FYEB 5FYKL 2Z64C 3P11L 3D06A 1FCCA 1U91B 4EI5C 3G5YA 4WUKH 3ZRFC 1OP3H 3ZX1A 1XGRB 2KZ1B 5DC0A 3AS0A 2XY2A 3POHA 5I74B 1Z3RA 3VD2A 4LPVA 2WWMC 1GYVA 4DTGL 2FQEA 4L0ZA 5M94B 5EF3A 4XPHL 5CD3B 2VSDA 1DCLA 4JFHD 4OB5H 5JLZA 4C8XA 3HPLB 1TVBA 3V4UL 3PDOA 3BZEB 4M7LL 3J07A 5KSAD 5CSGA 1CI5A 4YDZA 1WDAA 5AG8A 3O3AA 1OEZW 2W60A 1XIWB 1NEZB 4XHQA 1YEKH 4OD3H 2NDFA 4WHTB 3GMLB 2W65B 3EW3B 4PRID 3LEVH 3HVDA 2J43A 1T5XB 1HTYA 3JWNE 4Q6KA 1XWVA 1AXSA 3EH5B 4PJGE 3TU6A 5KVGL 2FO8A 2O5YH 2YUWA 4AXWB 3C8KA 4HCRL 2GTWA 5DZJA 3P4NB 2NQ3A 2D0FA 4PWEA 3T65B 5H37A 2ZX8A 4K3DL 1MEXH 1F42A 1BGXL 3QC5X 5J57B 3IMTA 1MJ8L 1WFMA 4XRCB 2Y36H 4F80A 1EUUA 5L2KA 4EVNB 2EYSA 4ETQB 1V05A 3BFQG 3RWEA 1OOWA 2YD9A 1JZ3A 2NXYD 3M1BB 1A6AB 2BY2A 7FABH 1WAAA 3PGDA 5TE6H 3V6OA 4X0NA 1J5HA 3AU0A 2VYRE 3S36L 4GKLA 1TTGA 3ILPA 4GO9A 3NFPB 1MW1A 4LSPL 4G7RB 5FUOL 1TUPA 2F8OA 2R4RH 4JANB 4Z7UE 1YC7A 4FYTA 3VRIB 1U3ZA 4ERSH 2OCCB 2BFVL 4O9HH 3WN6A 1NC2B 3IRCA 2JI2A 2YR3A 3LKNB 2E75C 5I1IL 3T6ZA 3CFJB 3VWKB 1BD2A 1XB6A 5DFWH 2Z8WC 3D85D 1N5AA 4IRJA 4JFYB 4PM1A 5DJ0B 4XBEH 3L4CA 1TEYA 3V4VH 6TAAA 2HG0A 2E27H 5CN1A 4XI5C 4I5BA 4JFQB 4RGND 3FQNB 2FE0A 4JR9H 2F8IA 2OULB 2R29H 1ORQA 3H56A 1A9EB 1J5OH 1F90H 4JFEE 4PGBA 4LLMA 3D9AH 1AIFB 4HMCA 5F9WB 3D4GA 3VXUD 3DSNB 4UAHA 1OARL 1YMMA 4OZHA 5C6TH 2YGOA 4A6YA 4YK4B 7FABL 2IV8A 1IC1A 3JWOL 4Q0XH 4QNPE 2PUQT 3WKQA 3TF4A 1OW0A 1DR9A 3H0TB 4I48B 4YXHL 5JOFB 3VFWB 4ANUA 5T5FH 3HE7D 4L3EE 1DYZA 2YWZA 4W9CC 1QSFA 5LCVL 5GHWH 4NQCD 4AVHA 2MQ0A 3OGCB 4PJCE 1FNGB 2FJFB 3FH7A 2X9XA 3A4EA 2NYYC 4Z7WA 3UC2A 1RQ5A 5DUML 1MLBA 1UWEH 4P2QA 5C0BB 4OZHF 4N26A 1JK9A 2NR6C 2Q6WB 4LLAA 4WWKC 1N7MH 4EKJA 5AVUB 1YECH 5D2NA 1BXVA 1QATA 2VN6A 3C5XA 3DX0A 2XFGB 2XI9A 3LSOA 4Z7WE 4DZBA 2O6FA 4I4WB 4I5BB 4U2ZA 2Q3ZA 3AXLB 5ESAB 4AQAB 1JZFA 1I1AD 3TBYA 1C7TA 2FYVA 1RUMH 2OPCA 3OMNB 4KJQC 4XPBL 3VG9B 1QW9A 4YFLF 5CSBA 2ZXEB 4PWKA 5DJAA 2RFXB 2VE6A 4LKCA 4YR6B 2VXUH 1A7BA 4PCYA 2H32H 1BZQK 4X98B 2CNYA 2WLZA 4Y5YC 2N1KA 1U3HA 2V4LA 4B9PA 1MVUB 4M93B 5IMMB 5AENA 4ZT1A 1ACXA 5SWZD 3MUZ1 4HJGA 3OZKA 4Y1AE 2ITDB 3AAZB 1ASOA 5B38A 2WXNA 4GRWE 4P2RA 1B2YA 5AQ0A 4QTFA 1ETZA 1FG2B 2F8VA 1UATA 2CR0A 5EZLB 3WO4C 1F11B 3BVNB 5T1LB 4GSXA 2DEXX 5D71H 3EGDA 1YEDB 2IDCA 3AMLA 4HBCL 5K9KA 2JE8A 4A2HA 1LILA 1M7DB 2P5WA 1IFHL 2AABL 2VLJB 9CGTA 4YHYB 3OKMB 4JNXA 2MTAA 1C12A 3B37A 4BQBA 5MEQA 4ZQTA 1QPPA 2V3FA 1N0LA 1KB5L 1PLCA 3O3DA 4MXQD 1TENA 4JE0A 1OGSA 1YEKL 4NKOB 4XNYL 5AOLA 3V9CA 4BFFA 4Q58C 4FXKA 4XPHH 4L48A 3QEQE 4CC4C 1RV6X 1VCAA 1Q9OA 4H13C 4PVLA 5TE7L 1CBVL 4LBEB 4JHVA 1W8NA 1TCRA 2W60B 1FV1A 2JSFA 1G7IA 3EYFA 4HCRH 2IXQB 2GJPA 4TSAL 1BBJB 5KWYC 3O3BB 1DVFB 4LSDA 3GIZH 3GS7A 4FXLA 2LT9A 4PRIE 3N2JA 5CINL 5EEVA 2ETWA 4P57B 4OBRA 1K6QL 2WZAA 4BK4A 4KGLA 1JGVH 4HX1A 2GBTA 2ADYA 2IO5A 3KJ6L 1KLGA 3BESR 3TVMD 4HJ1A 8CGTA 3AS2A 1LO3L 1WD8A 5HI5D 1MW3A 1XZ0B 2ZUVA 4UZUA 1UXMA 2FBRA 2K7QA 1MJ7L 3EJUA 4NM8L 1NBZB 2QGBA 4N1EA 3WEXA 3M8OL 2NXYC 4OCYL 3CN1A 3HJ0A 3MRCB 1ZDQA 4H5SB 1GGCH 1DVFA 4I8DA 3VD1A 4YXKH 4GKZB 2HUHA 2JB6A 1I3VA 1RUAL 2MH4A 2JF1A 5DRWA 5FB8B 4MB1A 3LNIA 3RIFF 3TX4A 2XG5B 3Q1SH 3VSTA 1T21B 3AMKA 2G75A 2H45A 4RGOL 3G6JE 1NFKA 4JHZA 5TFSH 3HG0A 2NOYA 4ZUWA 2I26N 1FPTH 2AF2A 2KLSA 1YN6B 5EO9A 1AVAA 3UBXI 2CE6A 1IEBA 1TVHB 3VG0L 5A2IH 1HEHC 1YEHH 3KPMA 3SE9L 3H3PH 2FJGB 4MJ6B 1PFOA 2TRHA 1LEKB 2VERN 2W92A 3NABH 3RDTD 1HL5A 5EEWA 4PJHA 3OKLB 4ZFGH 4NBYB 2AJXH 1SY6H 1I1YA 1MI5E 4LHUD 3KL5A 3QFJA 1H15B 5E8OA 5TPWL 4XXCC 3FQ4A 2CO6B 4UT9L 4OFYD 5L4FA 1FH5L 3MBXH 4K7PX 1MUJA 4HCIA 5IVZB 4J3OF 3K71A 3NH7L 3IRPX 2YLHA 2J88H 3BSZA 3Q1EA 4AIZB 1AYRA 3NRQA 4AIEA 1EJOL 2F6AA 1CIDA 3CCHB 3OMIB 3DURA 4LDLB 3OLGA 2EDJA 4GRLB 2Q86B 2HLEB 5FV1L 1F45A 1RHHA 5EWIH 4KPHL 3MRMB 1CGVA 2GSIA 2D73A 4JRYE 3SQRA 1LK2B 4FQPA 3B7RL 4LLQA 4YBLC 1JG9A 5DJAB 5K39A 3RTQD 5BUAA 3C60D 1GH7A 2ICWB 3WELA 4H8HA 2PTUA 5T5FA 4D0BA 3CFUA 4G8GD 3SGEH 2BY1A 5A2CA 5C0EB 5EORL 2WC7A 4U1IA 4N0CD 4J6RH 4BZ1L 3B8YA 2PXYD 2DQMA 3LZNA 2NNXA 5B21A 5C0BE 5J89A 1TJIH 4H7VA 4MB5A 3DBXB 4KTYA 1MHPL 5EA0H 3BRDA 1S3KH 3FTZA 3MRDB 3MBXL 4U6HB 3NZHL 4U1HA 5I0ZA 4QD2E 3PDDA 4EN3B 4NRYB 5I1KH 1FNGA 1RJCA 2FJFA 2C3XA 5FHBH 2I7OA 1L9QA 4IKLA 4N2GA 2OSLA 2F5BL 3NCFB 3L3OC 3TIDB 1GZHC 5GS2H 4O2CA 5FYKE 1S9WB 1CK0L 3DSFL 3CIQA 1RZ8B 5JOFA 1OE1A 3KWXA 4RRPA 1DZBA 3BWSA 1E5AA 1LHZA 3IDNA 5BNXD 3NG5A 5KVMC 4BRVA 4N3TA 1T6VN 2NX5E 1MHCA 4ZYKA 5KG9A 5JOPD 4O51B 3SE6A 4AYDC 2YHGA 3K74B 2AC0A 3NBNA 1MAJA 2DL9A 3CAFA 4IKJA 3VRLF 4HIHA 4HJTA 1I4FB 2V17L 4M7JH 1A3LH 3CFEB 4FI8A 4FNQA 1Y18A 3B2UD 3QDGA 1TO4A 3RDJA 1IGCH 4LSSH 3TV3L 2Q0ZX 2ZSWA 2LVCA 3CDZB 3LQZB 4HHGA 3TO4A 2WSDA 2EIZA 2QQKH 4N2DA 1KJ2L 2NY3C 3MRGB 2ENYA 4PJBA 1KXHA 3D1MC 1JXKA 2OSXA 4TNWK 3GPEA 4DP2X 2YQBA 2APTA 1B0WA 2X38A 3VRIA 2XRAH 5INDA 2I32A 3PQYE 2BIMA 3QI9B 3MOBH 1O7DC 3S0PA 3VXNA 3QS3A 1KXQE 2MJWA 4E41D 2EO1A 3QWRA 3ML8A 3MLUL 2H1LM 2HRPH 5D1XB 5FAAA 3RKDD 1QRKA 4KZ0A 2IADB 3SJVD 3QEHA 2N7BA 1QR1B 4NOFA 5DR5L 3ZL2A 2YK1L 1Y6KR 4XMWA 5JUEH 3UC0H 3ZSSA 5AWNL 1NMAL 4YUEH 4ZOCA 2XN0A 1D6VL 3AQYA 4G42B 4HEPA 4O4YL 5B1JA 4ZW3A 3J2PA 3SIKA 4X4XA 3CGTA 4M48H 2EINB 4FG0A 1MG3C 3IXTA 5CR1A 2VXSH 1PLGH 5DJZA 4FFWC 3ZSTA 3LH2L 5CEZH 1UXSA 3GMQA 3NEOA 3VFVA 4KX9A 3ZIMA 4PD4J 3CE1A 2YPLA 1JDDA 4XO3A 4RLDA 2OSYA 5JIKA 3DPDA 3MV8B 2NSQA 4R7VA 3EJZD 3QULB 2AMUA 5FFGA 3QZWB 1FFQA 1NUDA 2X5PA 1H19A 1IE4A 1YQ2A 4G9FA 2AXGA 4FG6C 3U4KA 3V7AE 2HT4C 4N2NA 2Q8AH 3SBWC 3ETTA 2QQLL 3L5HA 3LXBA 4Z7OB 3G6JF 5GGSY 4MMYB 3ZTJH 4JHAH 3LQZA 1ZHNA 3RWCA 2XFXB 5F7EH 5EZOL 3X12B 3TS8A 2HT2C 1BVZA 2YGNA 1NCCH 4E9RA 1K2DB 5E4EB 3VVVA 1AFVH 2HLAB 4N0YH 3DX6A 2JKLA 3FCTB 5JNYA 4PJAB 3BH4A 4HV8A 5I1GL 4WEBL 1L9PA 1U8OA 2YAHA 2WBJD 3QSKB 4EIZC 2P49B 4Y16B 4WENB 5FLVA 5L88H 4K9JA 4NGHH 1P1VA 1T04A 3ETSA 4ZXBB 3AS1A 2CA3A 2VDNL 4YHOL 5BMFH 1W91A 5D72L 2HVBA 5IW6B 2Y6SD 4EZKA 5IBTL 1CICD 4ZFGL 3UBHA 2J3SA 3RWGB 1MZYA 1HOCB 4ETYA 1MNUH 2J25A 4DVRL 2EEBA 5FFLA 4ODWB 5LNEA 3EG9A 3GEFA 2GITA 3C9NA 3DGGB 4R90L 1Z9NA 3EADA 3DPBA 5D7IF 4ZUTA 4WZ9A 1A6ZB 2FNBA 4NAQA 3GBNH 1S7QB 4XVUD 1OGAD 5FKAB 3N40F 3DX8B 3FN9A 3IJYB 4Y5VA 5IHHA 4UTBA 1IM3D 1M4KA 4X6BA 4Z9KB 4XOBA 5JMOC 4QHMA 5AW4B 2XWBA 3MAWA 5DVKA 3OR7A 3QXAA 1CG9B 1Z9SA 4WTXA 3L5WB 5HSFA 4JCLA 1ET8A 3PQYD 4NN5B 4RGNC 2CR3A 3HB3C 3P9LA 4NKDA 2X4SB 3QNFA 2FL5A 2H2SC 4F2MA 4GAGH 3BWUC 2NUPB 5E6RB 1EHNA 1L6PA 1A02N 4UOW0 3ET9F 4NLHA 1JRHL 2DLIA 3X1FA 4X80L 5JO5A 3S35X 2Z0UA 4LKXA 4NNYB 5GISL 3KD4A 3DGGA 4PY7B 4RMSA 3T08A 3UJTH 4B9JA 5KBMA 4QXGL 5FYJE 4PHZA 2GHZA 2VDLB 2W8CA 2LLLA 4MYPA 1G7LA 1UFGA 2G9KA 3O45A 4QTHA 3BISA 2R2BB 3O4OB 5DHXB 1UGKA 1SMAA 3LKSB 1HI6B 1BLNB 1N18A 2ZXAA 5JOPE 3UAAA 2OKMA 4H20H 4HJUA 4P2OA 3VXTA 3C6LD 4GUQA 4H5SA 2OMXA 1AACA 4HUMB 1KFGA 4F8PA 3GSRB 4I1NB 1D5MB 3FO1A 1JK8B 4I85A 1X5LA 3QZMA 1MDTA 1ZT4A 1UYWL 4DKEH 5BXFB 4HKJA 2EE2A 3I6KA 3L7EB 1VFMA 2XBZA 3KXFB 2ZUSA 3CLFL 5ETUA 4Z95L 3TWYA 5IKCA 4N2LA 3DI3B 5FB8A 1EO8H 3BPNB 1EV2E 1JD9A 3F04A 3D18A 4ODUB 3RU8L 43C9A 3HE7B 2RCSL 3PREA 4H1LG 2YWYA 4M5YH 3BKMH 1P69B 1Q0XH 1A7OH 3LAFA 1FIEA 3QDGE 5DFAA 5IMOA 4KJPC 3BN3B 3PHQA 4XHJC 2JB5L 4GAJH 3CLEL 1UA3A 1R5VA 3HS9A 4GEIA 4WW2B 3FRPG 4FXKC 4DNLA 4WW1B 4E0RB 1E27A 4K94C 1DLFH 1GR7A 3P3YA 3LS4H 3MMEA 3F65A 3DTXB 3UZEA 2VDOH 4H8WL 2WLYA 5D7LD 4LU5H 1JZIA 2A6IA 2UX7A 2UXFA 4HYTB 4GBXC 4OF5A 4JG0H 2BVQB 1GOFA 5DHVA 4M3HA 1OLLA 5CJQH 5EOCL 4HA1A 3V7MA 3ARDD 3U2JA 4WWKA 2BJMH 1LDPL 1U8PB 3CJJA 3H3KA 3M88A 3IDJB 1FQ9C 1G9MC 4OM0H 4ZQKB 4W9DC 4Y19D 5I1EH 3PWNA 1YJDL 5I17B 1EHLH 3DKHA 5C0CD 3MNZB 1JXGA 2R1YA 4UV7L 4GG6E 4HJGB 3NUKA 4MXWH 1UACH 2AQNA 2A9AA 4YDJB 1QD0A 4TQPA 2K6WA 3GHBH 3WAJA 3GSNB 2YJLA 2H0JA 1FH2A 1EIBA 1DVTA 4AT6A 2L3BA 1WC7A 4YR6A 1OAUH 2ZOLB 2X4NA 2FGWH 2Z7YA 4Q9QL 5IROA 5CBAA 4PTUA 2ZQKA 2HVJB 4TSCL 2DICA 3ATAA 3R06A 1TQTA 4KO6A 4S1DC 3G6AB 5IOKA 2BOLA 3LEYL 1IFGA 5LWYH 5F7KC 4JQVA 5EIIA 3BRGC 3X2QB 3G5XB 3P4OB 2XKUA 4O2FB 2VDMB 3E1ZA 1MWAB 2RH0A 3R4DA 4O2EB 1DL7L 4PGEA 2XPGA 5HDOA 2H26A 2HFGL 2V5TA 3TT3H 4TUKL 4RFEA 5C09A 5I30L 3V9EA 1P4BH 3DDGA 2DYPB 1E9PA 3UEQA 5DU7A 1DQKA 1UZ8B 1OGAA 4ELMB 4Z7VF 2P9RA 2Z31C 3KPLA 2OSLB 4NENB 3Q2CA 4DAGL 5J1SC 1QSFB 2HXAA 3IKCB 2VZOA 2E7BA 1BZEA 4MMXC 4BWTA 1VACB 2IG2H 1CLOH 5HHMD 3QJHB 3VXSB 2W81C 1D5XA 1CE6A 3FU9A 3MRLB 4U6HA 2WXOA 5DUJA 2AJ3A 4DUVA 5CJXA 1VESA 4JM4H 1BGXH 5C0AD 3L5IA 3P4MA 4Z3JA 5I8EB 1ORQB 4L2LA 1OCWL 5KSBB 5I75C 1FORL 2ZP9A 3V5KB 4P06A 3BWZA 3BAWA 5JHLH 1G5AA 4TVSa 4AM0A 3KPLB 4ZFOA 4JDVA 5FX3A 1CICA 1NLDL 4NHUA 5L2JA 5H4YA 2DYPA 3Q5OA 4GRMB 1XAKA 3H0TA 4I48A 1GA2A 4QF1B 5HPMB 3TT3L 4BGLA 2X6UA 4RFEB 1GAFL 3E8UL 3CQPA 2AANA 5LN8A 4HOWA 1D5IH 2A6DB 4I9WE 4Y4HD 1B0RB 2XWXA 3GJFA 3HZYB 4A66A 4F27A 4KRPB 5BXFA 5LBSL 2GJZA 2NYZA 5IVZA 3QWOA 3O9WC 4FP8L 1CF8L 4TKWA 3OKDA 4R4ND 1LEIB 2X4NB 1YUKB 2ZOOA 3BOVA 5BVJA 2IBBA 3P2TA 1L5GB 2IBZY 4JK0D 4LP5A 5FOBA 1J0IA 1K5NA 1T0PB 5CKAA 2ESVE 3WNPA 5FYKU 3W56A 1SF3A 1WZ1H 4CA4A 1S2EA 2CPUA 5I1AB 1S7TA 5CKGA 4P23C 2VXTL 1K85A 3P2BA 1MY5A 1HCFX 3II3A 3KPMB 5DD3L 4FFZH 4XTRD 3VW3L 3OF6D 3KPQA 5GHWL 4Q4IA 1FFNA 1ZE3H 3HRZC 4OGZA 2NUPA 2P8MB 1ND0A 4JB9L 4WK2B 3ZOAA 3EDEA 3HNSH 3EO1B 3EXLA 4BCYA 2X2JA 1CD1A 4WUUD 1DO6A 1TQSA 2YBGA 2C9VA 4PGDA 5D5ME 2ESVB 3P4NA 1HSAA 1OF2B 4KQ3L 4BA0A 1FL6B 2HWZL 4BXVA 1KFAL 4DN3H 1D9KC 3V52H 3MRKA 4AWJC 3X1NA 3EO9L 3ZDYF 3WENA 5K69A 5DZOA 2VDOL 4H8WH 4APQA 3CZJA 2JB5H 4XN5A 1Z9MA 1MY7A 2WK2A 5B3JE 1MZZA 4O5LH 3N42B 1ECYA 3COOA 3JZYA 2VO5A 3O3AB 5IFAL 5K93A 5IMOB 3AG2B 1KZYA 3D33A 3OXRA 4LE8A 1AO7D 4UINL 3UBFA 4FA8A 4IDLA 3ZE0B 4L4TA 3Q43A 2C4FU 3SBPA 1RPUA 2VMFA 2C9SA 5F7LB 4B9CA 2UZYB 3OHMB 5D5MB 3TNNA 3LZOA 2EDXA 1G7IB 3EYFB 3AACA 3OXSB 4OI7A 1MAKA 5TE6L 1A6TA 3A47A 4L5FE 4MS8D 4P5SA 1GOGA 5F9JA 3NRFA 3V0JA 4Y5VC 5E2UL 3MLRH 2NZIA 4MXVF 4MS6A 1T04B 1OAXH 1T4KA 1UCBL 2ILLA 3FT2B 4YE4L 4Z0BH 4TQHA 2FB4L 4R96B 4KK8C 5HDLA 3W3BA 3HW7A 1KBGH 1OSZB 1Z3GL 4L1LA 2VDLL 4NAJA 1DO5A 3CZNA 1N64L 3OC5A 3FCTA 4OCXL 1OVZA 3HMXL 3LV3B 2JQZA 3AJ7A 5E94B 2NXZB 3FTUA 4R4BA 1QA9A 4A2DA 5ES4B 4MJ5B 1KUMA 2ED9A 5D8JL 4CSTA 4LVEA 3QA3B 5C6PB 5HYSG 4I0KA 1SYSB 3WS6A 4N68A 3DX9A 4KTDL 3O0LA 2K6ZA 3K8LA 1WBYA 3GKWL 3MNDA 4DPAX 1CUOA 2P52A 3H6AA 4UT6L 2ATPB 5JO5B 1YAIA 4W9FC 3MLPA 1NGYB 1FGVL 1HXYA 3PWVB 4A67A 1RLBA 5GSVA 4E41B 4M5TA 3QZWA 2PYEA 3HCVA 3GJFK 3PV6B 4ZOAA 4DO6A 1W6LA 2R15A 5EDSA 1GTFA 3CTTA 2WXJA 4GUPB 3V4PL 5BRQA 3LPGA 1CG9A 1Z9SB 2E8ZA 1TQBC 4ZW6A 2DN7A 1S9XA 4TXVB 3IFPB 3UTPD 5CZXD 4ZUUA 1BD2E 1AQKH 5TDPA 1Q9LA 2VE6B 1LL1A 5HI3C 1ZLWK 1YLBB 5IESH 3D87B 4ODVL 3WNKA 1G87A 3HMWH 3EUUA 1L0YA 3NIGB 5DD6B 1TLMA 5JQ6L 4K55A 5IB3B 4NT6A 4R6UA 4XVSL 4X7TA 2EUXA 3WG7B 4JQXC 2OJZH 2CIIB 2DLTA 4UB0H 3B8SA 3S6CA 1G7JA 1QR1A 1CIUA 1PS3A 1KF9B 2AJSL 2AV1B 2IWKA 3CIAA 4AGQA 5B38G 2VQTA 3BGMA 5CAYB 4CU6A 3FSVA 5T5NF 3U7WH 4GQ9L 2QSQA 4OW6A 3KYOA 3FO0H 2QSCL 1KGCE 4JPIB 2OXHB 4M9PA 4S1QL 1TYJA 2VUKA 1DBML 2YQ3A 1ZANH 3A24A 4XP4H 1CPUA 4J3VA 5IUSA 1TTRA 3NGBB 5HYFA 2ZT9C 4R4NC 4Q9CA 1J1XH 4NYLA 3VM7A 4F58H 5I1DA 2WTRA 3CFDA 4BQ9A 2X4RB 2H9GB 5I73B 1RK7A 4HSCX 3O8XA 4Q8BA 1M71A 3ARQA 4G72B 4ATWA 4PJGA 4QRQA 3HMWL 4Z78B 3CBRA 1T1ZA 1UWXH 4W4NA 1SN2A 4NC2B 4FYQA 1IAMA 5HHQA 4PJFB 4NN7C 4A7GA 1QBBA 3HZYA 4H8UA 4OV5B 2DQDL 3MZGB 3LNEA 4P23D 3RLSA 1SN5A 1K2DA 4PJBF 4QHNA 4HIXH 3K46A 5F7EL 1I8MA 3TPUA 4AGPA 1MW0A 3EYVB 3WHE1 2QGDA 5E7BA 1A7QL 3HZMB 5EO0A 4MMYA 4E9LA 4PRIB 4WGWB 6PAZA 5IHUH 2BWQA 2E4FA 3LDBB 4PY8I 3FTSA 4KI5E 1CICB 2GHWB 1JZ7A 5GZOA 3HB3D 4FL4B 5CUSH 3CN3A 3QPXH 4V1DD 5KSBA 3NFPA 3F6JA 3L1OH 4PJFA 3RI5K 3HUJF 4PJAE 1EEZB 2ZCKH 5D1ZC 4F58L 1G9NH 5TF1L 1F4HA 5IV2B 2IFFL 1MQ8A 3BJ91 2B15A 2BVPA 3EFDH 1G5GA 3VGDA 2AV1A 4KMTL 4UQCA 3JWNC 35C8H 1YNKL 5CM1A 1TZ8A 2A9ML 2CIIA 1IL1A 3NCYS 3RNQB 3GSXB 1N6UA 3QR0A 4MJ2A 3VTMA 3GDBA 4P5TC 3BKJL 4U1LB 1NH6A 2NNFA 3QRFM 4ZNEA 1PX3A 5E0QA 4ZMNA 5HGHA 2B4CC 5MP6L 2IPTL 2QBWA 2ZUUA 4P59H 1BFVL 4F2EA 3BH9A 3HAEH 3ML9A 4K3JL 1IVTA 1N10A 4MD4B 1ROCA 5C08E 4ONFL 2JJWA 5C2BL 1KEMH 1JYXA 3VWKD 4PP2A 2GI7A 4YO0A 5I1LA 2X2UA 3GZQA 1M7UA 4ZUSA 1M7IA 3IKKA 5ICXB 4BV1A 1LE5B 1VSCA 1HJCA 1A3RL 3GSVA 4TQ8A 2R0KH 2W0FB 3MCKA 4BH7B 3CVHB 4TNWF 1N12A 1PX8A 2PYFB 1NGXB 5KTEL 4N2KA 2BRRL 4KXCA 2V17H 2BOBA 5KSUB 3CFEA 3GHEL 2JI1A 2XQYK 4NC0B 4B7IA 3GBNL 2ZXWB 4IGBB 5B39A 3FFCE 1DBKL 4D7PA 4OAWA 2GKIA 1EA9C 1OSZA 3PU7A 3JWDC 1K9TA 4P49A 3RBSA 1SYSA 4OR1A 3GMPB 2J57A 1BX2A 3FO2A 3LIUA 4PRDB 2LFGA 2IGFL 4MJ5A 2ENPA 1QA9B 4FNSA 4HUKB 4E42B 2H0FA 1NCDL 1CJYA 1A3RH 2VLJE 2WBKA 3NZHH 1KGJA 3Q3GB 4Y5YB 3NCXA 4C47A 5FYJU 4MQXD 1KJ2A 4WEUD 3UH8A 3BT2H 1OD7A 3DBXA 4GXFA 4KO7A 4QHPA 1X4YA 1URLA 1R75A 4OIAA 2NLJB 1S3KL 2DB8A 2Z93B 4YNYB 3SKMA 2BNRA 5EPMB 1A6TB 5KYUB 1FJ1A 4UAOC 1WBZB 3BAKA 2E9JA 5IB2A 1B6UA 2DIEA 4J6RL 2OMVA 4P57A 5K39B 1PW3A 2Z6FA 3WY2A 4QHLA 3TO2A 4D8PB 3AM8A 4IBVA 4Q9RH 2EYTA 3LKOB 3ZKXB 5BZDB 2IWEA 5EU6E 4Q74A 3D18B 1U3YA 1AD0A 3L3HB 4JM2D 3SKJL 4YHYC 3UPRA 2P8LB 4UIMB 3NRPA 5DD0L 1G7QA 3SDXA 3SZ6A 4NM4H 3U46B 3QDMB 4HIJA 1Z0MA 3O41A 4MNGB 4GG6A 2LLNA 4P9MH 4Y19A 1LWRA 1Q9OB 3UPAA 5AKTA 4K7PL 3ZHNA 3M8OH 4OCYH 1QLFB 3KPQB 4KKCC 5C07D 4G7YH 1JCKA 4RIRA 5GPRA 3GSQB 4G9FD 1DJZA 1JNNH 1TMCB 4IOSA 4S0SD 5CP7B 5E8EA 5GIRB 5L8KB 4PJIE 2NYKA 5AOIA 1NQBA 3PGCB 3BD3A 3BW9A 5MENE 2X2HA 2VCOA 1OALA 1WLHA 3AXHA 3GSWB 1HI6A 4KKQA 2EH8H 1MJ7H 4NM8H 5IF0A 1IT9L 5C0CA 5E23A 3A6OA 3MYJA 1BVNT 1XDTT 1PG7H 4AL8H 2PKDA 3WUWB 5ELIA 1ZDSA 3S8WA 2BS8A 4HIXL 3NTCL 4CC4A 3P54A 2EECA 4OH2A 5E4IA 2B4CL 3BIKA 3CHSA 4PLOB 4XZUB 3CC5A 5I9QB 5E9NA 4J39A 5HGDB 1T3FA 2VZTA 2BO0A 2ITDA 3AAZA 4GG6B 2VR4A 4LO9A 1G7PB 2X4SA 2YA0A 4GXUN 5F6IB 3ARFB 3TH3T 2NNCA 1RUAH 3I85A 2X6AA 2DI8A 4NCC2 5I6MA 1L7TL 3HC3H 4TM9A 4IRSA 3ME0B 4KQ3H 1E40A 1T20A 2OMVB 3NCJL 4AQEA 3O8XD 1NINA 5A16A 1WBZA 4KO5A 3W0WA 1UWEL 5ITBH 2Z4TA 4IOIB 4XWOD 5F3HA 5EZJA 2DQUH 1KCRH 3FTWA 2N0MA 4Y4HC 5CD5D 1KN4H 2WLJA 4J3WA 4MXVE 3GJFB 3VXSD 3LRMA 1TETL 2J2ZA 3NJFA 3VCLA 3I3DA 4LQ1A 1TTCA 3AREA 3HLKA 5CHNB 3IGKA 4OCSH 3P3UA 2JNZA 4MMZC 4DGYL 1E4HA 2A4ZA 1RPQA 1ADQA 4AH2A 1U3HC 2DLEA 1KGXA 5DFVD 3VFPA 3AG3B 4MD5A 3RB7A 1TVDA 1VACA 2B39A 1SMOA 2DH3A 4FZEH 2HSIA 3TVMC 1ZLEA 3DHMA 5I0XA 3TFKD 2A0LD 3NOIA 1PZ3A 4DIXA 1AQMA 2PMZA 4J4PD 4A2MA 3I9PA 4IU3A 4UIKH 3N41B 4ACPA 1QRND 3UO1H 1UD8A 3SDDD 4OAWB 1KTKE 4KHXH 4O2EA 4P2YA 3H2WA 2EIKB 4PW4A 1FF5A 3C5JA 2IIJA 4KRPD 3NSJA 3LXCA 3CU7A 4H88L 1C12B 3RUGA 1JGDB 2Y23A 2VLJA 1MAML 3VB8A 2BS9A 2DYSB 3F7YB 1MWAL 2HVKB 1ZHNB 3CVHA 1XCQB 1YEJH 6FABH 1HT6A 3LPOA 5ID1A 3T0BA 3RUGE 3SE8L 1ZVNA 3IXAA 3GGWB 4U6VL 1GYWA 5E1QA 2IPKB 2KQNA 4FE9A 1A6VL 3AWFA 3AB0B 3DXAB 4PWHA 4IMKA 3JSSA 2NX5B 3RP1A 5J12B 3BO8B 3A6BH 4RQQB 2XY1A 1YHPA 2Z34A 4K7FA 4PV1C 3WKML 4HLZH 4AQOA 4RNRA 1EZVX 2C1OA 4NZDA 2PETA 4PI2A 1I8LC 2IV9A 5PCYA 5DJZB 3KS0H 1XCQA 4Z77A 3BUDA 3CVCA 2APXA 1J9RA 3SOBH 3POCA 1IGTA 3V0HA 3MBEC 2CDGA 3WN5B 5MERA 2GUOB 2KT6A 3G08B 5I71C 3N44B 3VD0A 4LFHG 4DWHA 2DD8H 3L3JB 4FQXA 3O4LE 2DTSA 5ILTH 3T6VA 1YNTB 2NZ9D 5AYQA 4X2UA 4HK3J 4J1UA 4BSVB 1WV7T 3VA6A 4KKLD 4LHUG 1O9WA 3W38A 1DQDH 3V0AC 1T5XA 3JT0A 3SYPA 3QNZA 3D34A 5CD5C 1AR1C 2WB7A 4XMTA 1K8DA 2PCPA 5LCVA 1I9RL 2YOCA 2VXQH 1IJNA 1UD3A 3CXDL 5CEZE 1C9SA 1HHHA 1MRCH 4XO9A 2IDQA 3MUHL 1QSED 2YIHA 4KKBD 1SMDA 3UTSB 4Y1SA 3VFWA 2AGJL 5GS3A 4LOEA 4N2MA 4ZNEE 2VN5A 4FHJA 4QRUB 5FW6A 1KULA 1KGUA 1KB5B 3C8HA 1ACZA 3TO4B 3FCSA 4S2SA 3O6KH 1MFAH 3P30H 1YMMB 2D9CA 3BHBA 2EIMB 2NY0C 2X7LA 4AKPA 5KYXB 3TEYA 1SJVA 1P6WA 2WWNA 5IKCB 2ORBL 4C56B 5HVFB 4JB9H 1N0XL 5FDYA 4MNQD 3N0PB 3GI8H 5E0FA 4OCWH 5A3IC 1RZIB 3CH1A 2YPLE 1KZQA 4XBEL 2CD0A 3KBEA 2J5WA 4WJKB 4TS6A 3T1WA 2L7UA 1B4TA 2QELA 5MENB 2KZBA 2I85A 3NZ8A 4MX7B 3UTSE 4IRSB 4ZI8A 4LOFA 3CSPA 4RCAA 1MI5B 4DVBB 1RMFH 1GJWA 2R51A 1BZOA 1I85A 1I1CA 3C60B 5IGXH 4JDZB 2NY2B 1DANT 4QTHB 5J9PB 1T3FB 2WQSA 5DZ9A 1OCCB 3CZLA 1QLEH 1I53A 3SGDH 3LRGA 3SE3C 3BGMB 2EXSA 1LE9A 5CCKL 1JPSL 2OZ4H 2VMJA 3A6CH 4M6OL 4TL4A 2ZICA 2K9UA 4HWBL 3SDXE 4XWOC 5LQBL 4KV5F 2DQCH 3WEBA 2WQAA 4BELD 1CFNA 2ADIB 1UJ3B 3IEAA 5FGBC 5IB3A 5SX5K 1HHKB 3OQ3B 1BLNA 3MI6A 4WEBH 3F8UB 4FG2A 4DERA 2G5RA 1AZNA 1A6WL 4AZUA 4R9HA 5SWQB 2PO6B 3ECVA 1FE8H 3QIBD 1KV3A 4DGIL 2C7UA 4XP1H 1NWOA 5J06A 4M4RA 1CTOA 5CIPB 1KPRA 2CG9X 2DBJA 3WSQL 1MDAA 3J7HA 3OC8A 1FL5B 3CCHA 5F7DA 2JTDA 3ES6A 2VNCA 5H4ZA 4Z7IA 4TNVK 1HXYB 3PWVA 4JZOA 1H3WM 3SDXB 3PXHA 1OP5H 3U46A 2Y06L 4LLDA 1RZGB 3KNBB 1UWYA 3LEVL 4MJHA 4JQIL 4TOYL 2IWGA 4IQHA 1LNUA 4NZTL 3AW5A 3C5SB 1KCLA 1SNRA 3APDA 4WO4B 3BUTA 3EF7A 3MLXL 2BRRH 4LMQE 4BQCA 5JW5B 2K0RA 2KI6A 2D0GA 4OLYL 3RAJL 1RUKH 1WBXB 1R24A 5BRPA 1RSYA 2QQQA 3TTSA 1J0ZA 1I1FB 1S7QA 2YMXL 3I75A 3OLEA 1RIHL 4NXKA 2CK2A 2DRUA 4G2AA 5HHOB 4P99A 4N8CH 3QI9D 1OTUC 2HFGH 2B5IB 1NFIB 2NW2A 3VXUB 3X1BA 3FOMB 1TMQA 4WU5B 1TQVA 5FV2A 4LGPB 4LOUD 1IMHC 2AJVH 2R0LL 2JIXA 3DJZA 3T3MB 4X6FA 1FWXA 4HPYL 1ZA6A 5ITFB 1ZLSL 3RWIA 1E4KA 2AI0H 5FYKH 3LPFA 5B1KA 3D39B 3QDGD 4F20A 1H6UA 4XNZB 2NRDA 1H8NA 3UEZA 3FQTA 4YHIA 2NY4B 2DEYX 2DLFL 5ABAA 1KIPB 4XP6H 4TL5A 1HHJB 4JRYD 4MAYA 1XTLA 2B3IA 2WBJC 4L4TB 4N2BA 3RJQB 1IM3B 1URZA 1EJ8A 1M7XA 1JWSA 3Q2WA 3NDYE 5BVPL 4EIGB 2Y6TE 5KVEE 1TF4A 3V6FB 3QDME 3FOLA 4DZ8A 3FQUA 3KLKA 3U25A 5B8CC 4HUCA 2E27L 1XD1A 1H0DA 3FONB 3REVA 4FYRA 4PU2A 3SDYL 5HVHB 3KLAB 1BJ1J 4K9EH 4OFVA 1OAYL 1LO2L 5F89B 4HGKC 1J1OL 4OV6F 4PEEA 2XQBH 3QFJE 1RP9A 2FJHB 4HS6B 3W2DL 4YDLC 1T1WB 3ZY7A 5HYSB 4BWWA 2BNUB 3GS0A 5DZAA 3GMOA 3IS0X 4N5UA 1TCRB 4WW2F 2AXGB 4U7KA 4UOW1 4KTGA 2XTSA 4L4TE 5F0PB 3RZCC 1XIWC 5DMGD 2IAMD 3VX1A 3GIVB 4HH9A 5CEXA 3EBIA 4HD5A 2WBXA 2A9CA 2X4OB 1JPGA 2VUYA 1DLFL 3U0PB 4XCNA 4XMZA 2VQUA 3BH9B 1UWGL 5D1XA 4LSVH 5AVWB 3MRBB 3EOYG 3PWPE 2ZXCA 4ALAL 4HGWA 5HGHB 4WIQA 4M48L 2FBOJ 1I3RB 1VERA 2VW7A 4WSJA 4PHXA 5B1JC 1F3JA 4ORGB 3EGDB 3TBBA 1E5UI 2Y5QA 4PJIF 2KZKA 1UG9A 5T1LA 3PGFL 2B59A 4MJID 5ESQB 4AG4L 4MVBC 5DVOA 3QXTA 3RPIB 3T8XA 4AQ1C 1IKNC 4L8SA 4Y1TA 3ZHKA 3GTTA 3CUPB 2EEAA 3VE0A 2AHIA 2IDSA 5GQBA 2Q8AL 3SDAA 1UA6H 5TE4L 2NCEA 5ALBL 1LMKA 2IPKA 4QRRD 1P84J 4L4VE 1MHCB 1QHPA 1XBDA 3CVIL 5KG9B 3VDCA 2WLHA 2Z91B 1OM3L 1YQVH 2I9LA 4FI7A 4DGVL 1AQHA 5EO0B 1PMYA 5AUMA 3U0TB 3BZ4A 4PJ8B 4G6KL 5ENWA 5JORB 1S9WA 3QUYC 1PY4A 1Y18B 5IBUB 1QUNA 3WGUB 1LWHA 2EDOA 3VGEA 1QBLH 4YJZL 1LXMA 2D3VA 3MJ9H 1SDDA 5EBLB 5GJSL 2ZX5A 4EN3A 2VABB 4OFYA 4D7BA 1UM6L 4L8SC 2R23A 1T1ZB 1NFAA 3MRDA 1M2VA 3KYAA 5KEZA 4AG4H 5G4NA 3O8XB 2IANB 3TWCL 5DK3A 2VW4A 3FHEA 1OK0A 4XB7A 5I1DB 3D3VA 4UM8B 5F70A 1T2QH 5CP3A 2JJVA 1F4WL 4XN9A 4Z3HA 3STLB 5J13C 4AGMA 2B8OT 2K45A 1B9KA 4HDIA 4LPYA 2DIBA 2BINA 3DTUB 4JPIA 4Y4FC 4ZX3A 3IRZA 3NCBB 4WY7L 1USQA 2XN9B 4ELME 1I7UB 2E59A 1C5DA 5C09B 1NGZB 3BZFA 4HD9A 1IGCL 4LSSL 2FATL 3QJFA 1WD9A 3MV7E 1KBBA 1EXGA 3DSNA 2HG5A 4XT1C 2DMHA 2D7TL 2WHVA 4TNEA 1FL3A 3ZGIA 4GBXD 1Z3GH 4Y1AA 1OAQH 1NM9A 4MFHA 4BHUA 3ZKSD 4P4KC 5EORH 3FT0A 1U92B 2MCAA 1FA4A 5HGBA 2ICWA 1LP9A 4P5RA 4R7NB 4BFIB 3S5YA 3QIBA 1WCBB 3QCUL 3F3HA 3QFDA 4ELDA 4X5WB 3TN0B 1MWOA 3QORB 3VXUE 2FAUA 5EBMA 2CLZA 3C6EA 1T89A 2OMYA 2VZ3A 1HS6A 1NAKH 3FO9A 5IR1B 4KJWC 1PZ2A 2Y5TB 5JIPA 4TNFA 3K4DA 5LDUA 1CXLA 4LRIA 3IDJA 4AEIH 4BA8A 4BDVA 2ZOKB 4MVBD 3MJ7A 5EH1A 4QCIA 1X5AA 3MFFA 3IFLH 3MYJB 1FIGH 2C1PB 3X11A 2NUTB 2XG5A 4L8DA 4NLAA 4LCWD 3GSWA 2ATKB 2NX5D 3EDFA 5DHEA 1BWWA 4JFED 4NN6B 4XP9L 3W2DH 2EVGA 1EX0A 1JPEA 1S8DB 3UAEA 1U95B 5C8JB 2DMKA 5I8CB 1W9XA 3DTXA 3PJSB 3SDYH 1KJ3L 4TQEL 1CFQB 1JPGB 3SPCA 1S9VA 4E0RA 2UZIL 3WDJA 3WFZA 1N2RB 2NPLX 2IAMC 4EKXA 1VHPA 2Z31D 1ZOXA 2E6PA 4AQ8A 3IWVA 3BVDB 4XPFH 3O11A 15C8H 3TXAA 3DHJA 4RAHA 5J0BA 5L9DH 3LXUX 4NCDA 5AYTA 3SYAA 4FG6D 3FH5A 4PI0A 5F89A 4QXVA 3BZEA 1PCSA 1WA0X 2F7IA 4OLVH 1KFAH 4D8PA 1GVIA 3FFDA 1HH6B 3ROOA 3ZU8A 4HVBA 5FECB 3L1EA 3WFCH 2NY3D 3HN3A 3IF1A 4G8FB 4LEOA 1BAFH 4YXLH 3SJVE 1KN2H 3OVUB 2EYRB 1KSRA 5DK2B 5DVPA 3ZHFA 3HMXA 1IBBA 1JGUL 1A7QH 1H6EA 2WKOF 4GG6F 4Z7UF 1G0YR 3PWUA 1S7RA 4UINH 2NY5H 5EZOH 3UADA 4A7VA 3AT0A 4MQSB 4DKTA 4F7TA 1LLAA 4KV5E 4XBGA 3SE4A 1SJXA 5IHZB 5F7YC 4B3VA 1HSAB 1NM4A 2KL6A 1DQQA 2ESVA 3IETB 1H8LA 4EZJA 2KDYA 4X6CA 2CLVB 3HTLX 2O5XH 1KCSH 5JPNC 1RZFH 1YEIH 2ROYA 1PX4A 4DEPC 1D9KB 2NYYD 1X5XA 2VLME 4K73A 4KMTH 5TQ0L 4DW2L 5AZUA 5DHYA 4YSRA 2FR4B 3GSNH 5CCKH 1KPVA 5I1HL 5GRWA 2G0LA 3BWUF 2ZCKL 1YYMH 1I9IH 2CJTA 5J6HB 3HIZA 2NR6D 5CU5A 5ISZB 3RTLA 5FW7A 3BAXA 4AKOA 2OS7A 5CF3A 4N8VB 5CXPA 3TNMB 1SQMA 1A21A 3B3IB 1JTTA 1MVUA 1OAXL 1UCBH 5I76B 1JZEA 3EOAB 1MFBL 5TDNB 5HY9B 4WO4A 5BS0A 3VXOA 1JPFB 4Y2OB 3C5SA 4AEEA 1A6VH 2BSSB 2ZXGA 4NKIL 3ASOB 1TG8A 1SRDA 2Z65C 1ETZB 1FG2A 2UYLB 3GO1L 1EBPA 4YHZH 4JHWH 1A1NA 1VAHA 4RSVA 3DX8A 4TUOB 3OKEB 4YO0B 1SBBA 2OCFD 2XN2A 1I3GH 1Q94B 2Q6WA 4ACTA 4R83A 3HS8A 1B4RA 3PNRB 1MAMH 4HXBL 4YDIL 5CIPA 1UD5A 2CO1A 1U6AL 5I16B 2QR0B 3GSNL 3U36A 1R19A 3FQWA 5F7FA 4QJ3B 1XB3A 3S96B 5I24A 3BI9X 2XN9E 2F8XC 2A1WH 2C3VA 1P4UA 1G0DA 2W07A 1G7MA 2NW3B 1JDCA 4DP7X 4UOZA 1NJ9A 4N8CL 3VH8G 1JHKH 2W59A 4WRLA 3VJ6B 5DS2A 3EGXB 1T7WA 3O3EB 3W39A 4PRHD 3VD3A 4CU7A 1GIGL 3V0WH 1U8OB 1FNAA 3QEQB 4B9GA 2YXVA 1HAUA 4MBOA 1ZWIB 3QS2A 2H2SD 1ULVA 3ARBB 2WVVB 5AOMA 3TOPA 1QUNB 4G3YL 1TQBB 2IQAB 4KI5D 1Z2KA 3OX8A 3O6KL 4IOSD 4PYGA 2CO3A 4XVUC 3EYUL 4P2CG 5FYLD 3CC1A 4NC1C 3HNVL 4E5XB 2G2RB 4XP6L 2IDTA 1RJYB 2XG4B 4GKNA 4QXTA 3GSOA 1G6RH 1R3IH 3C87A 1OW0C 1DTUA 3M6DA 4XVJL 1OCZB 2BC4B 1NOLA 2B2XH 3DVGB 2E3VA 3LRSB 3NEEA 2MWCA 4FCHA 4M5ZL 4TQIA 1QPXA 2NY2D 1F3RB 3CH1B 2CO7A 4ZFOL 1W2KT 2E7LA 2FHFA 1K72A 3DHPA 1ZTXE 3R19A 4KTEL 4H1LH 2IMNA 2K9FB 4L3AA 2GIYA 1VPOH 2XKNB 1QQDA 3LNDA 4XHJD 4NQDE 1FC1A 4PS3A 5DDHA 2WXRA 2EO7A 5DUBA 3F01A 1NMBL 4RFOH 5DJ0A 3FT4A 3IDYC 3FJTA 4Y4FA 3FNKA 4K71C 5IROC 1MH5B 4PGJA 2H3NB 2DWXA 5FYJL 3IGAB 1RZKL 5E99L 4NUPA 1SYVA 3ZRCC 5IB4B 2YD7A 4NZFA 5FUZL 5EZIH 2P5EA 1QFWH 4JO5A 2OXGA 4KXDA 4U4IA 2LW3A 2NY1B 2J1ZA 2R4RL 2R1YB 2VLRA 4CC1A 4MLIA 3WBDA 3TA3B 1GKOA 1X5HA 2VW6A 3CDGA 3EJQA 2CRZA 4G8EA 5A7BA 3FQYA 3MLTB 4X7SH 4BSJA 2VJ0A 2CHNA 4BINA 2HJFA 1M05B 1Z5HA 4PVMA 3FT3B 4FZEL 1U3NA 2ENSA 1HHGB 4NN7B 4IMKC 5HI3D 3HKFA 4EI6B 1Y1DA 1C08B 4QXUL 5KUMA 4F91B 3QUYA 3MO1B 4IJTA 4LLUB 4R4FL 4ZRGA 5SWZA 4GI9A 4Z3TA 3TVMA 3RHWF 4Z76B 5BJTB 5BRZA 4F92B 4NJAH 3C6LB 1RULH 2CBOA 3L3GA 5TDPB 5KS9B 1PY9A 4YGAB 3RY6C 3VMPA 1FYTA 3ZMNA 2WXPA 4KKAC 1FPTL 4DKEL 2KKQA 2FLRT 2VL5A 1T1XB 3ULSB 1W8OA 5D1ZI 4M8QB 3FKUS 4PJDF 1BVNP 5C9JA 1C1EH 3B5GA 1GW6A 2OI9C 3AREC 4F9PC 2FWOB 1SHMA 4JZJB 2B3RA 1INQA 4GSDH 3G5YB 2OYMA 3QBTB 4ZMOA 5IOPB 3HZVB 2C3HA 4UV4H 1W72L 3GMMA 3KJ4B 4MAYB 4CDGC 4XNDA 1LQSR 2OL3L 1N3NA 2HVKA 3KE0A 3QQ9D 2Y5EA 3DOHA 3LVTA 2O1AA 3D07A 3QDJA 4KI5C 5DI8A 5CZRA 3RZCD 2BSED 3GYRA 4ZX6A 1ZWIA 1XF5A 5BS0D 4PGCA 4PLKD 2CJUH 3INUH 3D2TA 4MZ2A 4R96A 3ZQWA 2IJ0C 4JFHE 4RH4A 2DQEH 4Y16C 4H8VA 2X70A 1E2WA 1PZ5B 2A9DA 3SKNB 5T3XH 1BFOA 2UUDK 2RB8A 4TRPL 3UTTA 4MCYB 4CUCA 5IJVB 1IBYA 2ZWKA 3PL6A 4Q6IB 2X0UA 3QXDA 4KROC 4HKBB 4APXB 4AW4A 2NMSA 3D0VA 3QH3B 2AEIT 3MRIB 4R2GB 1ZVSB 2X87A 1BIIA 3MZTA 1YUHA 43CAA 2W38A 3MN8A 4PRPD 1UZ6F 2D4DA 4KMLB 3VFPB 4HIIA 3FBQA 3HN8A 4AM0Q 2A1WL 1MRDL 4H25A 2K1MA 4JHUA 4FP8H 1E50A 3D7PA 4OB5L 1MW2A 5JDJA 4P3DA 4YDIH 1E43A 1NCOA 5J6GA 5HYJB 5H37H 1PNCA 1NC4A 2ZAGA 2BP8B 2FHCA 3CLWA 4YZFE 5G5DA 1EUTA 3FB7B 3P77B 4P5KA 4PJCF 1CD9B 1J9QA 2ZCHH 3US0A 4P5TD 2X1WL 3UJIL 2PWGA 4WNQA 4B9FA 1TEFA 5C0JA 3W0WB 4RSYA 2JJTA 3OR7B 3QXAB 5DWPA 5H2BA 4DQAA 4I89A 2ZSVB 2A9NL 4UUJA 3U9WA 1E5YA 2X3AA 2IEPA 4LSPH 4MD0B 5EO1B 5GGTA 3SQBB 1N6QH 1KLFB 1R3JB 1X5ZA 4NJ9L 4ODTL 3EOAA 5J5EA 1LEGB 4KHXL 1OY3B 3P73A 5ICYA 3DK2A 3WIHA 2Y07L 1G7PA 4XVJH 3Q8CA 4GFXA 3C5ZB 5D7IB 1HXKA 1ND0B 2AITA 1IAIM 3HB3B 4MAZA 5GRXG 1L9SA 2F19H 2CA4A 2AQ3A 4IBYA 1J0YA 5J6HA 4DP5X 2XA8H 3MLSL 2PPCA 1UOKA 1SOKA 4X99A 2GITB 3C9NB 4QRSB 2WPGA 2C9QA 1PPIA 3AQDA 1X6NA 3N6YA 4OF7A 4OI8A 2ZUQB 5JZ7C 4G5AA 2G75B 4QRRB 2ADFL 3S88H 1YJDH 4UAOB 5JHLA 2ZYHA 1BQHG 2G9HB 1PLGL 4AIOA 5F1NA 3SKJH 1RZKH 5E99H 1G84A 3SQBA 4R7DB 1SUHA 3BUPA 3H2PA 2ARWA 1U9KA 4O4YH 4MA8L 5FHAH 1FHNA 5F7AA 2LOEA 4TQEH 2PXYA 1U8IB 1NFDF 4CN1A 3JV4B 5DWUH 3T4AC 3T2LA 3MGTA 4B96A 3S98A 4TF4A 3VXQB 2MKLC 3E0GA 5CGYC 4HUWB 2KC0A 5E95B 1LQBC 3VQLA 1OSPH 1MFEL 2X88A 3RILA 3ZR6A 3KW8A 1PEZA 5F7UA 2CKBH 3G6JA 2H1PH 5IQ9A 1C16A 4NRZA 3G7TA 4MQXC 5I5JA 4N0YL 1BBJA 5IB2B 43CAB 2E9GA 2WVUA 1YEWA 1WFNA 2PW2B 1KEML 4Y7MA 1MCPH 1O7DE 3BLKA 1SJEA 3SYQA 5D7EA 3AT9A 4QRAA 1ZXQA 2KERA 1JF1B 2CBQA 4GJTB 4OZGE 2HJLA 4S0TD 4WI9A 1ZEAH 2BCMA 1JP5A 2ZIDA 2QHLA 5IB1B 2WY3B 3ZHDA 3MV9A 4JFDA 2YPLB 3K6OA 2KQMA 1HESA 3D25A 3NJLA 4DOHE 4QRTA 1FZKB 3M7FB 5DVLA 4JO1L 3MRLA 3SDCB 2EE0A 2ZUYA 3BAEL 5I66B 4R84A 5LGHL 4JM2C 1QX1A 4KQ0A 2CKBB 3HR5B 1I85C 1QWHA 4JRXE 1JYNA 1U4EA 2AK4A 2VLKE 4I0CC 3PFQA 4K3GA 2WZ0A 1F02I 5HI5C 3LD8B 1DCEA 3F5WA 1EANA 4DUXA 1PDKB 4DW2H 4A39A 4K94L 2J20A 3LQAH 5EZLA 4X8CA 4FQJL 3MV7B 5BQDA 3WL9B 1ZSDA 3N9GH 1UB6A 1Y6MR 3LIZL 1E5ZA 1FZMB 4IEFB 1E6JH 4MRBA 1IC0A 5KVGE 4MNHA 2BY3A 4KKRA 1U58B 5HHXL 1TFPA 3ZW3A 1LM8V 4RGMB 4ZTPL 3ARGB 4PLKC 4MAUH 3VXRB 4NP4H 1T1XA 5FKPA 3UFIA 4X5WA 4PH8A 3TN0A 2HZHA 1JS4A 2YN5A 1ZA3A 3DRQA 3N40P 1J18A 3LRHA 1LP9B 4GAGL 4AT6B 4AYGA 3UYPB 4N1CA 1FE8L 3PL6D 2EILB 1JGDA 1T7XA 4HCRA 3JWOC 3V8CA 5TGBA 2OV0A 5HD8D 4OKVB 1KXTB 4AV4A 3FHQA 1OHZA 1AO7B 1E7VA 2AEQL 1IKNA 4CN6A 4ZMWA 3IJEB 2E7MA 3CDGB