1F3JB

Histocompatibility antigen i-ag7
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
187
Chain Sequence
ERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 187
sequence length 187
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f3jB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1f3jB01
3GDBA 4Y4KC 1T04A 4OQTH 1BAFL 4QHNA 4JFFE 4D0CA 2B2XL 4UOJA 5C0GA 1HSAA 1UJ3B 3L7EB 2DYPA 2HJLA 5JTWA 4CVUA 5GS1C 4QXUL 4KJYB 4PJFB 1PX3A 4UDTA 3RKPA 3VG0L 3O3AA 3S35L 1KT2A 4Z0XA 1RHFA 4S1RL 4QRQA 2ED8A 1E4XI 4PJ7B 5GSRA 4KKBD 2P7TA 3FO1A 2X4UB 3D3VB 5MENA 3QDJE 5ESVA 4KK5C 3VA2C 1CE6A 1V7NL 4OQ1A 4U7SA 2VLJD 1RZFL 3G5VA 1DQLH 2OTUA 3ZTJH 4F9PC 4J4PD 3C2AH 3MYJB 5EORH 3VWJA 5KOVC 1J8HD 1EJOL 5TQ0L 1U58B 5I75B 2R23A 3IAGC 4WTZG 4P2QE 4Z7VB 1G7MB 4JM2F 4ODUA 3ZE0E 3QFJB 4JZJB 4WHTA 3QI9D 4XVTL 4G5ZL 3C9NA 4L1HA 4LCUB 1B3JA 1KTDA 1W0VA 2WP3O 3FFCA 4HUUA 4BH7A 5JXEC 3QUMH 1S5HB 3EDEA 5I8CA 3VXUA 4HS6B 2QSCH 3U36A 5JW4M 43C9A 2FIRT 2Q3ZA 4I9WE 5J13B 3SJVA 3IXAA 2RQ8A 4YHLH 5GGSA 1VADB 2AV7B 1AXTH 3DWTA 2VXUL 4PG2A 5SWSA 3EYUL 2C5DC 4R4BB 4XCCH 3PP4L 2NXZB 4OIAA 3MJ7B 4JPVH 4IDLA 2Q8AL 5DVNA 3ZKSD 4NKOB 4Y4KA 3D69A 4ZUWB 5C1MB 1JN6A 2EE6A 4I4WA 4RMSA 1RJCA 2PUQT 1TQCC 5EU3B 4OFKA 2VLLB 4GKZA 5FA4A 4WI6A 4RA0C 1WZLA 2X42A 5INCA 4NWTL 1FDLH 4KMTH 3UEZA 2ARJB 3WFCL 4XGZB 1KB5H 4PRNB 3VFSB 4HAGA 2CK0L 2EECA 2J5LB 3OV6A 4MQ7B 3SDYL 1ERNA 4IOIA 2BOCA 3IDGB 2MFNA 3QUMB 3RUGA 2E8YA 3B2UD 2WM0A 5ACMA 2FZ3B 2KQNA 1ZA6B 4NQVA 3LV3B 4XC3L 4YXLH 4K8RH 3V5DA 5IQ7L 3HI1A 4MJ5B 5TQ2H 4PY7B 2Q8BL 3QZWB 4HFWB 4Y5VB 5JNYA 1UJTA 1IC7H 4K94L 1ZHKB 1I8KB 4PYGA 3QNZB 1S78C 1YYLH 5EN2A 5I66B 1T89C 3WFHA 1KACB 1P7HL 4K71C 1NGQL 4Z9KB 3K1KC 1EV2E 1ZT1A 2WBJA 1WBZA 5D7JD 3AB0B 3BP4A 3I9GH 2F5AL 3DMMA 4M93C 4PJ8D 4XAKD 5CINH 1QSVA 5FFLA 2OM5A 3ZO0A 4P9MH 4WGVB 5JXEA 4HXAH 1BOYA 5D93C 4F58H 4EDXA 2VQUA 1F58L 4POZD 5ILTL 1FIGL 2D7MA 4UU9A 1KB5B 1XGRA 4NP4H 5I0ZA 3TBSB 4ERSH 3HN3A 3G6DH 2Z8VC 5T3XH 4XNMA 1J0JA 1YC8A 4MNHA 5MEQA 1P7QB 5DMKB 4Q2ZA 4RGMC 4QRPD 1WK0A 5TPWH 1JNLH 1MCCA 1W72H 2AXJA 3HE6A 3MOBH 4HC1A 3RPIB 1Z9LA 4Y7MA 4ZUSA 1H8NA 4OB5H 5FB8B 3QCVH 2UWEA 1GIGH 1NAMH 1F8TL 4IRSC 4X6DF 1XCQB 2APXA 2EDNA 5L8LB 1FL6B 1PY4A 1JUFA 3V4PL 3JV6A 3K0WA 5ITFA 2BCKA 5GRJH 3VA6A 1M6OA 3PWNA 1NUFA 2DLHA 2AQ1A 4LARH 1FZJB 4PLKC 4P23C 5AUMA 1ZTXL 2C4FT 3VFMB 2HKHH 1OARL 1INDL 2P8PA 2NX5B 4LHUG 4JDZA 5IEHB 1OAYL 4HS3B 5F89B 5EBWB 4XH2A 4BQ9A 3G04B 1FLTX 1Z3GH 1WFUA 1MWAA 4JY6B 1AC6A 2Z31B 2GITB 4KTEL 4ZFOA 5C70A 4IRJA 1Z6JT 3SBWC 3ZYJA 1W72B 3D3VD 3BEVA 4NZJA 1CDBA 3VFNA 3LH2H 1CU4L 3GMQA 1PQZA 3AS1A 4Y16C 2AK4E 3MLXL 1AH1A 1NAMB 5DJXB 5KSUA 4PJFF 1M7XA 2IMMA 3BHBA 5EBLB 4UUJB 2JB5H 3TPUA 2LV4A 4YBQD 2FBOJ 3VXUE 2WQ8A 4M7KH 2A9ML 4PREB 5C0AE 4NPYA 5D7IA 5AZEL 5IMOA 4H8WH 3HNTL 1A3LL 4DCQB 3RWHA 5J1AA 4UMGA 1U8LA 4KI5F 3QFJD 3E0GA 2QBWA 4AEHL 3REWB 4OGYH 3AROA 4XPBH 3PV6A 1CK0L 2YOCA 3MTRA 3PDOB 4GW5B 4D9LH 3NAAL 1I7RB 4GRLA 1OCWH 1A6AA 3IKKA 1KJ2L 1LO4L 5I73C 4CVZA 4AENA 4OFYD 5FO7B 2JJVA 2YXMA 3EZ8A 4BZ2H 2OZ4L 1L0XA 4X5XA 1G7JA 4JFXA 2NXZD 3WL9B 3SGKA 5IK3B 4PRDB 3NFPA 5SX5K 4X80H 3F12A 3IETA 3OKNB 4NFBA 4PJHF 5HHVL 1FFOA 4AEIH 5DF0A 4S1SH 4LGRB 1HXYA 3PL6C 3RUGE 4JO2H 3V6FB 4W70A 1HH6A 1NGPH 1ADQL 4JZNB 4OD3L 4IRZH 25C8L 4P23A 2VXQL 2VDRH 1H8SA 5CBAA 4R96B 3VH8G 3MQIA 4NNYB 4KKCD 1N7MH 3L6FA 3CPLA 3VMOA 1AKJA 2P46B 2ZUQC 4RDQF 3UTSE 2OP4L 3SBWA 4J6RL 4L8BB 3SKJL 2OR9H 5JW3L 3NH7L 1ZT4A 3TYFA 4HX1A 1BFVH 2I07B 2X40A 4R26L 4FQPA 1JZ8A 5IJVB 2OK0L 1BQUA 4FTVB 3ZDZE 1EO5A 3HNSL 4MWFB 2VC2L 2Q87A 4NUJB 3LEXA 5J9PB 3MO1B 2ZUSA 4Y5XA 1TZIB 5HGHB 1S7VB 1X5XA 4KK6C 4JFPA 5HGAB 5E99H 3FO0H 4OLYL 5A2KH 2DQHL 3GI9L 5D6DC 3JWDC 1MREH 5A43C 3QIUC 2PTTB 3D0VA 4XPTH 3GFUA 1G9NL 3KS0H 2EDRA 2DM7A 2WINB 3GO1H 1FRGL 2UWEE 3NPSC 5C0CB 3WHE1 3UO1L 4R4ND 4KRPD 1S5IH 1YEFL 3O3UN 15C8L 1P7QD 1I9RH 4AH2A 1B4JL 5L2JB 1BQLH 4PTTB 4K8RD 2VDLH 3T77B 4PV9B 1UM4L 3LKRA 3WFBL 1GGIL 5IGXH 2CDEA 2RCSL 4TULL 3TNMA 1OY3B 1CXHA 4L4TA 3U30C 4BQBA 5D9SB 2CRZA 1S7RA 2ZJSL 4G8EA 1YYML 3PL6A 5BZWB 4F7MA 1J0HA 4H1LH 2YEZA 4KXZH 3CXHJ 1DBAH 3M1BB 5FGCE 3F7YA 1NCWH 5D8JL 3GMMA 4OLUH 4NNXB 4AG4H 3LQAL 3P4MA 3WS6A 1ZA3A 1MHEA 1AHWC 5SX4H 3LPWA 1AGFA 5CKAA 4ETYA 2NX5D 1NEZA 1K5NB 5IFHL 3NGBC 1EPFA 4GAGH 1T66D 4HT1H 4U0RC 4LDOB 4AIZB 5F71A 3HLAB 5T3XD 4JPWH 4U6XB 2Z31D 1XF4A 5GSVA 4KKNA 2V7HB 3FB8B 1K4CB 2V2WB 3LD8C 5TDOB 5IB5A 3OR6A 3E6HA 5JUEH 3UYPA 3V5HA 3MOAL 4G7YH 3NABL 4U3HA 3UJIH 2Z92A 2E7CA 2CH8A 4JQXC 1P4LB 2Z4QB 5FXCH 1CLOL 3O2WL 3OAZH 3U0PB 1AC0A 1J5OH 3P77A 4H1LB 3D2UB 3IF1B 4LHUA 3IDIA 4QY8B 2FR4A 3GNMH 4K9EL 5GRVK 1MCNA 1HHIB 1A9EB 3KAAA 4R9HA 4PGBB 1T04B 1MCWM 1XH3A 2BY1A 2BHUA 2HT3D 2C1PB 1K3IA 3MV8B 2LVEA 4RIRA 5CZXC 3WNKA 2IPKA 4GW1B 1AD9B 4YHMH 1DFBL 4PGCA 5B39B 1XF5B 3VRIB 1F4XH 4P48A 2CLVA 1XF3A 5GSRB 3WS3A 3Q5OA 2AEIT 2CUMA 4RGNB 5C6TL 4OT1L 2W0FA 3MRJB 3GHBH 4GRMB 4F57H 1K3ZA 3MZGB 3MLPA 5J8OA 1ND0B 4LCIH 3LB6D 1R5IA 1S3KH 3MRPA 1NMBL 5IR1A 4XMPL 1AHWA 4JVWA 2XT1B 1KIQB 4NQDB 2CSPA 5C0IB 5I1DB 5J7CC 3C6LD 5FGBC 4WI2A 3VG9C 5LWYL 2CQVA 1G7IA 5DK2A 1R3LA 4TN9A 3V0AC 4N0UE 4PD4J 1E4KC 1A7NH 3BPOC 3ZL4L 5C0JB 2AI0H 3MC0A 3MUHL 4FQCL 3HG1A 5DQJA 3WFEL 4BH7B 4TSBH 1IGFH 2Z8SA 3JUZA 2R69H 2Z35A 4Z77B 4ZXBA 4OTXH 5BV7H 1SBSL 3BIBX 3VXPB 2NZIA 4LPCA 4MJIA 3O6MH 1F45A 3VJ6B 2FIKA 4YGAB 2XV6B 3SDCA 5JW4Q 1HKLH 4JQXA 4FTVD 3RL2A 1X5AA 4D2NA 1JBJA 4H0HB 4YHIA 1MRDH 1FAKT 3QFDA 4F7EA 3MJGX 1I1AC 2AQ3A 5F9WB 2H26A 5ISZE 1KXQE 5HGGS 1BD2A 3TEUA 5FOBB 1JYXA 1G7LB 3C5ZB 2QKIB 3ET9F 4FNLL 3MBEA 3CX2A 1JN6B 1Q94A 1RMFH 5E08H 1KLFA 1QSEB 4I4WB 3IS0X 3CFIC 1MCPL 5KVGL 4QRUB 3B4NA 5FA4B 4P99A 4NZRL 1M7DA 4I18C 5F1IB 3Q5YA 4P5TB 5C0CD 5CD5C 4IOFD 1AFVH 4J7RA 3HMWL 3WIHL 3QXVA 1HE7A 1IJ9A 3ARGC 1UXWB 5D1ZC 2NW3B 1ETZB 1KJVB 3D85A 3PQYE 4YDIL 1KBGL 4LLDA 2V2TA 1MFBL 4GAJL 3C6SA 4NQVB 4LSVH 5BV7B 3SKMA 4DN3L 2QQKL 1MAML 1L0QA 1H3VA 2BNRB 3M8OH 1T03H 3KNBA 3MSPA 2F5BL 1H5BA 4Y4FA 43CAB 1U8IA 4OQTL 2FJFB 2QADB 2VLME 2E6JA 3L5WB 1JTOA 1T3FB 5GIRB 3ARFC 1BX2A 1KGCD 5EUOE 2WBJB 2YKLH 2X89D 4Y2DB 3ALWA 2QHLA 3THMH 2YD5A 2E7LC 5EB9A 2R9HD 5GGUB 2HLAB 5KS9A 5KSAA 2RFXA 4WDIB 1HHJA 2BNUA 3RY4A 5JHDA 1PBYA 3N1FC 3P4OB 5BJTB 4UU9B 4LKXA 1XGRB 4HWUA 4OAWB 3IJHB 4IIQC 2WUBH 1ES0B 1J7VR 4MNHB 2WSKA 4RNRA 1DQLL 3TJHC 4RFEB 3T04D 1F4AA 4Q2ZB 1XIWB 3C2AL 1X5KA 5EORL 2EDDA 1S9VA 1I1AA 3HE6B 1DLHA 2ATKB 3TPKA 2WUCL 5IB2B 1EUUA 4O00A 1MIEH 4DOHB 2XQYK 3RWIA 1FHGA 1H0DA 3D2UD 3U9UA 2WWMC 3N9GH 4OZHB 3DTXA 4U1HA 5TGBA 2HVKB 5JIHA 3UC0L 5A3IC 3QUML 5ICYA 5IBTH 1FL5B 3P73B 4Z7WF 4P3CH 1N6QH 4I18A 1WZKA 5IW1A 3FTGB 1P6FA 2Y6SC 2BXYA 3GRWH 3MV8D 2X4TA 3HC3H 4YHLL 3ARGA 4N90E 5D1ZA 5IWLA 3QDHA 1SJEB 1DSFH 4JFOB 1AXTL 3TA3C 4P57B 3J8F7 4XH2B 2OSLA 3DX6B 3MNWA 5L8JB 4XCCL 2DBJA 5F3BA 4BFEA 3ME0A 1C1EH 1KEGH 1TENA 4KJWD 3RL1A 4RGND 3T3PE 2GSIB 4LOUC 2VABB 4BJLA 1KPUA 4PG9A 1G0XA 3BEVB 4R7NA 4OM0H 1K4DA 3VFNB 5I15H 3G08A 1FG2B 4GBXB 3M45A 2DMCA 3FONA 4LCCC 3GMNB 1FDLL 4KMTL 3N50A 1KB5L 5CP3H 5MHSD 1HYRC 4NQDD 5C3TA 1X4XA 1YEEH 1LE5A 4YNYA 2YA2A 5L2KA 5LXGH 3B9KB 4KVCH 4MJIE 5IB3A 3RX7A 3AREC 4YXLL 1T22A 4K8RL 5J1AB 1OGAE 4JJHA 2ZCKH 5JMOC 2VDQH 2ZPKH 2W9LA 5TQ2L 5HGDA 5DVLA 1REIA 5ELIA 1IC7L 1FNAA 3O3EA 1MCBA 3PV6B 2ITDB 1YYLL 3GSNH 1UCBH 1F90H 3VI4F 3VFPA 3LEYH 4ETQA 2IPTH 3QB7C 3MLRH 1Q9LA 3I9GL 4NO2A 1HILA 3S3PA 5CINL 2P1YA 3TV3H 3V6ZA 4MXQD 4P9ML 2QHRH 3DGGA 5C0NC 1HQ4A 3L3GA 4HIJB 3WD5H 2LAAA 1LEKA 3NMEA 3P0GB 4HXAL 2EKSB 4F58L 3C5ZD 5JLZA 3F12B 3WE6A 3MRBB 5CFHA 4NP4L 4ERSL 3G6DL 5T3XL 1QSED 2DF3A 3NCCB 3KLSA 3OG4B 4LIQH 4UI2A 3TCXA 3IDUA 4MX7A 5TPWL 1ZGLA 1JNLL 4EZMA 4F15C 2H32H 4P5TD 2EEBA 3IGAB 3OX8A 3PWJA 3CH8A 4L5FH 3MOBL 3VI3E 5KTEH 1YY9D 4OB5L 1OF2A 3QCVL 3G6JE 3B6SB 5F6IB 1UM6H 3U79A 1GIGL 4XCEA 2DMBA 1NAML 1J05B 3G5YA 1FYTA 1O5DT 3GSNB 1WEJH 3BP6A 2EE3A 1VFOA 1MJ8H 2BNRD 5EZIH 1ZT4B 1TJGH 2ADFL 32C2A 3KLHC 2DWEB 4LCCA 5GRJL 3HR6A 2ZSWA 4N1CA 4M61A 5LAXA 1FC1A 1MPAH 1Q0XH 2QADD 4LARL 4PJIB 2NY3C 1JI2A 4ESKA 3E8UH 1FL3B 4MD5B 1UWGH 2HKHL 3BH8A 4CUCA 2PYEA 2NY2B 1BVLA 2WBJD 4RSVA 4Y2DD 3ULUF 2CO6B 4PJCE 3QDMA 5EU7C 2BC4B 3BPNB 1Z3GL 4R2GC 2ZG1A 4U6YB 5HDOA 3QULB 4W81A 3FB6B 1BEYL 1QFUL 1VPOH 4LSDA 4P5KB 4XP9H 3SDXB 2Y23A 3MREB 4MJ6B 5CP7A 3RIAF 4B7IA 1A4KB 4N8VB 3DX8B 5HXMA 4PP2B 2H32B 2BDNH 4ZS6D 1CS6A 2ZCHH 3BDBA 3V6OA 2HFFB 3LH2L 2VLKA 1VGKA 4EBQH 4QXWA 3HZVA 1TETL 1XIWD 3QEQE 1X4YA 2W9DH 2P24B 2LU3A 4M7KL 3HE6D 1M4KA 3NCYP 2JCCE 2EH7H 3DRQA 3EFFB 1DJSA 4H8WL 4OSUL 4LKCA 3PWVA 2V9QA 5DDHB 2VXVH 4KK9D 4MDJB 4OGYL 2R4RH 1SYSB 1WWCA 4P49A 2VKXA 4NQXA 3WUWG 4YHNA 1ZLUK 3GMMB 3WNNA 4UBDC 4XPBL 4YAQB 3CMOH 3WLBA 5CZVH 1U41A 2ILLA 4PV8A 4D9LL 1GOFA 4LNVA 5I9QB 1AGFB 1OCWL 3P30H 1BWWA 2FX7H 4O2FB 5IM7B 1W0WB 5IMKA 4BZ2L 3DO7A 5IG7B 4KJPC 1IZKA 2VH5H 3P9WB 4OZHF 3GGWA 3E1F1 2E9JA 1QYGH 3TZVA 4BFGA 3ZSTA 4X80L 4JM2C 1N6VA 3ZT7A 3CFKB 4AEIL 5H2BB 4S1SL 4BKLB 2NY0B 3WFZA 3HE7C 1XGTA 4JO2L 2UVEA 5GGTH 1NGPL 2R1WB 1HDMB 1JPTH 4IRZL 4LHQB 3OR6B 2VDRL 3GSXB 4GBXD 3B5GA 5F9OH 1P9MA 1NANH 4OZGA 1SY6A 1Q9KA 2J8OA 3ZKMC 3ISWA 3TBTA 3HPLA 2WBKA 3WLWD 3MLYH 1N7ML 4LPXA 4LHUB 1G7PA 2W60B 1HEZA 4NSKA 2FCBA 4JVPA 3B9KD 2DAVA 1NBYA 4UIMB 1IAIH 4U2ZA 1OAUH 3HCVB 4UIKH 2OR9L 3PDDA 4LLVB 1XH3B 5T1KB 1MCDA 5LGHH 5E8DL 2D7TL 1TVHB 4PJXB 1D5XA 1I85C 2NY1C 1HHHB 4NO0B 1VHPA 2B4CH 4CJ0A 1ZVHA 2E5EA 1B88A 4ZDHA 4WI3A 5D1QA 4KMQA 2H6PA 1XF3B 5DLMH 5E99L 3DRTB 3FO0L 3SCMA 4KDTA 5IVXF 4LSTH 5J11B 1CFQB 1MREL 2R39A 4PRPE 2C7UB 1U8MA 2A38A 4NWUH 4XPTL 4RBPH 3S4SB 4WFGE 1XAUA 1EAPA 3ARDB 3V52H 3JTTB 4R7DB 3GO1L 2CIIA 1P69B 1S5IL 2ZUUA 5E1AB 3OGOE 2P45B 2WNGA 4QOKB 1I9RL 4OI9A 2CLRB 2HRPH 4UINH 1NCBH 4F8TA 3GZKA 2K9UA 2VDLL 4UOW0 4JCMA 5EO0B 3OKDB 5I1LA 5IGXL 4KROC 3HG1B 3PNWA 4APQB 3RHWF 2EIDA 2VZ3A 3QUZB 1Q9OA 1QO3A 5E7FA 4KY1H 5C0FA 2PYEE 2XKNA 1DBAL 2VSDA 1NCWL 1KIRB 5JOFB 3QDME 4OLUL 4ZAKB 4XX1E 4AG4L 4ISVA 4Z7UB 1JTTA 1S9XB 5HJ3A 4DEPC 1UZ8B 4F7EB 4S1DC 5DFVC 3ARRA 3NFSH 1OP5K 1BPVA 3VH8B 2NY2D 2VLKE 5A2FA 2NY7H 4GAGL 2Y7QB 4HT1L 4KHTH 1NCCH 3BKCH 2DLFH 1D5MB 4FXLA 4JPWL 5AAMA 1Q94B 3KPQB 1T5XA 4OKVB 5E5MB 5IHBA 3RVTC 5TH2A 3RWFA 5DRWB 2APTA 4PJIF 3ULVE 1YMHA 2YD8A 3QQ9C 1BBDH 4WEBH 1WUNT 5JUEL 5HHQA 1F4WL 2VERN 1IKFL 4OZ4B 3T0XA 4G7YL 1IL1B 5CHNA 3UJIL 5HGBB 3SO5A 1BIHA 4FS0A 1EEZB 1IAMA 3KVQA 2PETA 1F3DH 1S7SA 2FD6H 3PGFH 2VZVA 5GS3A 1RU9H 2VXTH 3W9EA 5C0BA 3T0EC 2FYYB 3GNML 2H41A 3BOVA 5E8EB 1F3RB 4L4TD 4CKVX 4Y4FB 4L3EA 4EN3A 1U8IB 1YPZA 5I71C 2DQJH 1QEWA 3U46B 1I3RB 5B8CC 5CGYC 1DZBA 4X4YB 4XMKH 2Y4SA 2H8PB 3O4LB 4YDLC 1CXLA 4WV1C 1KFAH 1FO0H 2YPLB 5DJCB 2YZ1A 4YHML 4ZUVA 3HHRB 3W0WA 1FP5A 5DC4B 1KJMB 3LKQA 1F4XL 5IESH 3QUXC 2G75A 1JWSA 4WHYG 3D39E 4DZBA 5I8EB 1QSZA 2XA3A 5I16B 3GHBL 5DEGB 3TVMB 4OZGE 2F54B 3ZDYF 4N0YH 2NZ9C 1G7QB 5EU7E 2IADA 3DJ9A 1S3KL 2BK8A 1KG0B 2NY0D 4UQ3A 5DT1H 4ONHA 4Q9QH 3BYYA 4HK0A 1I7TB 1A1MB 4OD2B 2NW2A 1HINH 1J10A 3X14A 2I9TA 3BSZH 1HQRA 3I02A 1A7NL 4TNVF 2AI0L 3SE9H 2AABL 4LHUD 4XNQB 3BQUA 4W6YB 2GQHA 1QLFA 1HHKB 1W8OA 2P5EB 4TSBL 5AYQA 5C9JB 4Y1AA 1IGFL 2R69L 3CIQA 1FO0B 2G5RA 4OTXL 3B2VH 5BV7L 4HIIB 3O41A 3O6ML 4JLRA 5T1KD 4MA7H 4OIBA 2EXYC 2X4TB 5ABDE 1HKLL 2NY5C 3QJFB 3BPLB 4TNWK 3REVB 4NQEB 5KSBE 1MRDL 3PABB 4NO0D 5F7HA 3U9PH 1OTSC 4XZUA 5F3BB 3H9YA 5DJZA 3NIDE 1OOAA 1JF1B 4HKJB 3W11D 4PB9H 5FYJE 3E3QC 4AYFA 1KC5H 1RMFL 1M05B 5E08L 4WNQB 1KPUB 3GMPA 3SY0A 5DJ0A 1IAOA 2F8OA 3OQ3B 1NFDB 5EO1B 4B5EA 5F93C 4RRPG 2VDMH 3O9WB 2HJFA 3G08B 4G80A 3ARDD 4WV1A 3FFDA 4M1CC 1AFVL 1EXUA 5FUOL 3GSOB 5F7UA 3UZVB 1DE4A 4ZPTA 2F58H 4QOKD 4G43B 2R2HA 3EYSH 4K7FB 1R24A 4LSVL 1ZHBB 2ESVE 4KWUA 5DJ6B 4D9QE 3A6BH 1T5WB 3RNQB 3X17A 1X6LA 3M8OL 1T03L 2ZOLA 5DD3H 3HG1D 4APQD 3LKPA 3QUZD 4WTWA 5IBLC 3C2SA 1AI1H 1G6RH 1IEBB 2WK2A 2X41A 1S7WB 4ZAKD 2AEPH 4KAQH 3RTQB 2YKLL 5JORA 4PGJA 2DQGL 2X4PB 3KJ4B 4BQ8A 1CQYA 4HV8A 4M7ZC 2C3XA 3VXSA 1LEIA 2E6PA 4JQIH 5A1AA 3BGMA 1UB5A 3L5XH 3WE6B 5E94B 2J88H 2ZP0T 4X7SH 4CVWA 4NQCA 3FO9B 1NFKA 2WUBL 2DMKA 5E5UB 3KPRE 4NBYB 2XIDA 3E2HB 4NKDB 4BYHA 1WZMA 4MNGB 4N0FB 2WBWB 1A7QH 4MVBD 1IEAA 3QO1B 4OI7A 4M6OH 3SKUD 1VKXA 4L3EE 4R90H 1YPZE 2XN9E 1J87A 1IGYA 2PTVA 1Y6NR 2X4OB 4QHLA 1MIEL 4LLQA 1KLUB 1XGUB 5HVWA 3B43A 4MMXC 1MCEA 2HVJA 4BZ1H 3N9GL 1G6RB 3R8QA 4NN6C 1ZGLP 1LO5A 1DCLA 5IBTL 4P46B 3VGGA 1CD8A 4P3CL 4Y4FD 1N6QL 4NKMB 3SKNA 4JFQA 3S6CA 3X11B 3WNPA 3GRWL 4OZFG 3KPPA 3RKDD 1W0YT 3HC3L 3SE3C 3HC0B 3O4LD 1DSFL 1N59B 3BN9D 3SGDI 2YPLD 5IMMA 1U36A 1WIOA 4X9BA 4HHAB 5BOZG 2D3VA 1C1EL 4WFFD 4YBLC 4JKKA 5ANMA 3FQUB 4O2EB 3CGTA 2X09A 3UDWA 5BS0B 3ARBC 2A83A 5BVJA 4KGLA 3RWEB 3TVMD 2DQTH 2F54D 4OM0L 2RHEA 3BT2L 2EC9U 2GK0A 5I15L 3UJJH 3K8LA 3QXAB 3PP3H 5K9OB 1J88A 1JGUH 5EBMA 4GS7B 1YEEL 4NC2B 3PHQB 1OW0A 2OL3H 4X6DE 3VFTA 1DBKH 5LXGL 4KVCL 1S7UA 2XQBH 4MQTB 4YE4H 2ZCKL 2GT9B 2VDQL 2ZPKL 1LMKA 1D5ZB 2X4RB 2X05A 2WLYA 3MRIA 2G5BA 2GUOA 5DJ8B 5F7FA 3UROR 2P5ED 3T0EE 5DD5H 4XCYB 3QWQB 4HUMB 5GGRB 1FN4A 3RJDA 3NTCH 3GSNL 4HCRH 5EH1A 4XXDB 2A0LC 1UCBL 1F90L 1I4FB 2XKUA 5B22A 3LEYL 2IPTL 3O0RL 5SV4A 4JFFB 5B3JF 4HGWA 4UDUB 4FQLH 3GSRB 4HG4J 3FOMA 4NQED 5HYIA 5D2LF 2X9YA 1NGYA 2QHRL 4HH9A 3WD5L 2P49B 4S11A 1UKTA 2QEJA 4OLXH 1D6VH 4G6AC 2XFXA 5MERA 1SEBA 3SDDC 1NGXB 4ODWA 3BISA 1D9KC 2OL3B 4LIQL 4QCIA 3OAUL 3O9WD 3R1GH 1I9JH 4F3FA 4HUVA 2I24N 4NRXB 3H8NA 3IFPA 2OLDA 1JHKH 2IANA 1OP3K 1UFUA 1NPUA 4L5FL 4EI5B 3FRPG 5HYSG 3U0WH 4S2SB 1Q9WA 5F6HI 1UM6L 3GMRB 4Z7OF 3EDDA 3VXMB 3ARBA 4Y4HB 1KLGA 3O6FA 1DUYA 1U93A 1WEJL 1NFDF 3OR7B 2DQFB 1NCDH 5EZIL 1W8NA 5DYOB 1P6AB 4HZLA 2DKSA 4ZQKA 1MFNA 5CSZA 4MD4B 1Q0XL 3KPSA 1EVTC 3E8UL 4M9OA 3VXSE 3MA7B 4RRPA 4YZFE 1UWGL 4X98B 5B38A 3LKSA 1JGVH 3HC4H 1UACH 3MRLA 3RTQD 1RZJH 2H6PB 4GUPA 1FSKC 1A7RH 3LKOA 1VPOL 4XP6H 4K3JH 4XP9L 1XEDA 3BRFA 2XWJA 2NLJB 2MJWA 1MHCB 4Y5YC 2YC1B 2BDNL 1TQBC 2ZCHL 3MCKA 3B3IB 1GZQB 3M07A 5IB4A 2A2QT 4EBQL 3E3QE 4EVNA 4LLUA 3FO2A 3UTZA 4YXHH 3HMXA 1LP9E 3GSUA 5BRZB 2W9DL 3HAEA 1T80A 1K2DB 2ERJB 1P4IH 2D9QB 4G42A 2Q7YA 1BZ7A 3MJ8B 3RDTA 1QFPA 4M8QA 4N0CD 2R2BA 5CSBA 5F7LB 3BGFC 3PNWB 5JW4R 2VXVL 4PJBB 1RHHB 2NTFA 3KGRA 1VACA 4R97C 2R4RL 2RAMA 1D9KA 5CIPH 1N3NB 4PP1C 4P46D 1PDKA 4J3OC 4ISVB 3CMOL 2DLEA 2Q20A 4RFOH 5CZVL 4FFWC 1MUJB 5I1AB 3C60B 1OSPL 2B5IC 1MJUH 3P30L 5AWNH 2FX7L 4FQQB 5AG9A 5HI3C 5H37G 2FSEA 1PLGH 2VH5L 4OF7A 1F6FB 1QKZH 1R3JA 3NOIA 2GJJA 1FNEA 2VDNH 5BS0D 3RFZC 1H15A 3MLZH 1XGPA 4G6MH 5GGTL 1JPTL 3UBXA 3TBVB 1FE8H 2AJYL 3HI6H 5E2WH 4Z7QF 2OCFD 5F9OL 3MRHB 3GSQA 1KCSH 1ODAA 2RGSA 1CI5A 1YJDH 3V5KB 1S9KC 3PWUB 4Q9RL 4JEGB 3MLYL 1A6UH 5JDSB 5CIPB 5C0BB 2VDKH 1Z0NA 2AEWA 2V7NA 1AO7E 2Q1EA 2ICEA 4F33A 1FZMA 5E70A 4ZYKA 2X70A 4UIKL 1QEWB 1G9EA 4YFEA 5IHLB 1JGEA 2FO4B 4M1GH 5I1CH 3ESVF 5LGHL 4RISH 4MCYA 4M9PA 3HZKA 4GXVH 4EXPX 1DVFA 3ILPB 3MXWH 5BOPA 4LRNH 4HIHB 5A2LH 4FQIH 3QDGA 5EUKA 2BJMH 5D6CB 1A5FL 4X6EB 2B4CL 3TN0C 5BMFH 4X6CA 4BK5A 5C0DB 5FAAA 2ZUXA 4JFFD 2G2RA 3O8XB 4WENB 3VXRA 1JWSB 5DLML 2YWYA 3TYGH 1YDPB 4GG6A 1OD7A 4MYWB 2X2YA 3OKLB 3F65A 4NWUL 1D5IL 1BFSA 5C08B 3VU2A 5KG9A 3V52L 3VMNA 4PTUB 3U0TA 3BPCB 2XI9A 3SOBL 2A6DB 2XTJE 3NCJH 1NH6A 3WUWB 1GC1C 5E8NB 3LQMA 1I1CA 2HRPL 4UINL 5EZLA 2OTPA 2ADJA 4ZUTA 1NCBL 3JVGC 1T1XA 4AIXA 2E7HA 2AJSH 3X14B 4TUKH 4EI5D 1OL0A 2AK4B 5FKAB 3BD3A 4HLZG 2H9GA 3DARA 3CSPA 4HK3N 3VFGH 3BQUB 3KPSE 3A0OA 3GHEL 1C5CH 1U3HB 1OAXH 3BXNB 1GVIA 3VXMD 3FT4B 1MVFA 4L9LC 3AXLA 1BJMA 4Y4HD 3IXTA 1BFOB 4E9LA 3G5ZA 3BH9A 1G1CA 1DQJA 3TBYB 3B9DA 2PCPA 5C2BL 2HTLD 3PWPA 2ORBH 4QYOB 3CX5K 1UWEH 1HOCA 4LMQE 3ZYZA 2Z0BA 1DEDA 4YO0A 4P4RA 5IV2B 5DSCA 4O5LH 5FYKU 2ADIB 1AE6L 3L3IB 2NY7L 4I9WD 1LO0H 1RUPH 4KHTL 1NCCL 5DJZB 3VE0B 3FRPA 3C08L 1I8IA 4UNUA 3TP4A 1I3UA 4JFYA 3ZE0F 3HB3C 4NYLA 2PXYA 1CL7I 2B0SH 4D0BB 5HI5C 1OPGH 2MQCA 1IKNC 2GHWB 4H5SB 2DQUH 4ODHH 2OMBA 3MGTB 4RZCB 5GS1B 3QO0A 1BBDL 1IM3A 4WEBL 4XHQA 5FDWB 1I3GH 1JHTB 3QCUL 1OWWA 3PGFL 3OAZK 5BRZD 5E8OA 1RU9L 2VXTL 3MRDB 4CMMA 3QJHA 3BE1H 4TTDC 4HDIB 5EZJA 2JF1A 3MODH 4PRIB 3QQ3A 4YR6A 4PGDA 5MEOB 5C2UB 4K7PH 3O6KH 3EYFB 3UTSB 4YEEA 4NRZB 4M3KB 3L95B 3BIKA 5EO9A 1GOHA 3IS1X 4ZO7A 3FCTB 5DHYA 1KFAL 3JVGA 3MRNA 2JJSA 4BZYA 1FO0L 1N2RA 2EZ0C 4V2BA 3C60D 4Y19E 4CADB 4J8RA 5KVDH 1NMAH 1F3JA 5IESL 3HZMB 3BKYH 3MRGB 3T0VA 4ZO9A 2MNUA 4X5WA 4JO3L 5HI4C 2FJHA 2VITA 3WXVH 1ZAGA 3QUKB 3MFGB 1DQQB 2QR0A 1CF8H 4U6TA 3CLFH 2H1PH 1WCBA 5DT1L 4RWYH 1OTTD 3SPVB 1T83C 4Q9QL 1O0VA 1IC4H 1CD1B 3N1QC 1HINL 4CNIA 2GEEA 3BSZL 3EW3B 2IH3A 1TQCB 2BP3A 4LDLB 5BQ7A 4K94C 4Y89A 5C0BD 1LDSA 4OGAC 4F7PA 3CDGA 4U1LA 3MCLH 4FA8A 3VXTA 3B2VL 3DX7A 3DIFA 4PJEB 3SKNB 1YEKH 4XRCB 3BJ91 3VXRE 5D96C 2J4WH 2MCPH 4MA7L 5K9JH 3FJTA 5C0EA 2CUHA 2GJ6B 4WHYH 2HFEB 3MV9E 1ZXQA 1PKOA 2VE6B 5IMMB 1RZKC 3PXHA 4XCFH 1PKQE 3U9PL 2QSVA 7CGTA 4OZIE 1WWBX 1NBZB 2OTWA 3O8XD 2ZUWA 5IBUG 1YNKH 2H2PC 4E41A 4CAGA 5CWSA 2E9WA 2W1NA 1KC5L 3L3HB 2KUTA 1PYWA 2VDML 2H2SD 4POUB 1MCLA 5C08D 3VRJB 5K9QI 3Q6GH 4M93B 1RK1B 2VYRE 4PJ9A 2ED9A 3S9DB 4RQQB 3FMGH 4MJ4A 3GSWA 4CBPA 1XMWA 1RD6A 1CE1H 3CZFA 3EYSL 4GRWE 2DDQH 1EEQA 3H9HB 5ICXA 1Z5LA 4XNYH 5ETUA 2AK4D 1ORQB 2IAMA 3A6BL 4LLAA 1L6ZA 3O3BB 4HGKC 4WW2C 3H42H 3KYOA 3BQUD 5DD3L 1U3HD 3UMTA 4I8DA 4RGMB 4AT6A 1BVKA 2HRLA 2VL5A 1ZLWH 1AI1L 4G8GA 1G6RL 2MTPA 3RZCA 1OB1B 1T83A 5KANI 5E2TH 2AEPL 1L0YA 4KAQL 5FKPA 4KK8C 3QXTA 3EOBB 4IRSB 2MCG1 4U1JA 5HDQH 1FNFA 5LGJA 1TPXC 1IRAY 4NZUH 1IVLA 2M2DA 5FHAH 3QP3A 4TSCH 5JQ6H 3AGVA 4LLWB 3SE4C 4JQIL 1T7XA 3AY4C 4LEOA 2BVYA 3L5XL 2W92A 3KPNA 2J88L 4X7SL 4P2RB 4JHZA 1EJ6A 1F00I 3K74B 1OTUC 4Z7NE 4ODWB 2VQTA 1KUMA 1ACYH 5DTFA 5F7DB 1CDIA 2JIXA 4PLJD 1FBIH 4LRIC 4EQ3A 4Z78B 4DTGH 3O3DA 4CJ1A 1DEEA 1T1WA 5E4EC 3RIFF 5JXAH 2CMRH 1U8HB 4M6OL 4YUEH 3IFLH 4YHKL 4NO3A 4YHYC 4C56B 5SWZA 3LKNB 3T2PA 3FB5B 1GGCH 3MXVH 4BZ1L 2L4OA 5ESQB 1U93B 3BIAX 3RAJH 4KZDH 2UY7A 4N0UB 4NKIH 4Y16B 3CXDH 3JUYA 4PRID 3VI4E 3RWDB 4X83A 3QXDB 5CSZB 3UTSD 3RUGF 1N0XL 2UZIH 3MRLB 1NDMB 3BVNB 3L9RB 4M8VA 1NLDH 2FGWH 4GUPB 1PJ9A 2LU4A 4HPYH 4WW2A 3LKOB 4WWKA 3KYNA 4HF5H 4LPTA 4Q6IC 1J18A 3IFOB 5ISZB 3BO8A 2DQTL 3GSVB 9CGTA 3S7GA 2AKRB 1UT9A 4PS4L 5I73B 2IC2A 3OKMA 3EYQD 3UJJL 4PGEA 3C5JA 1C5DA 5DD1H 1CGTA 4PJDA 3I3EA 3GSUB 4QO1A 1JGUL 2UZXB 4AL8H 5JPNA 2OL3L 3H9ZA 1DBKL 3D1MC 4DW2H 1P7KA 4L8DA 5HYJE 4NQSA 3SE4A 2CIKB 4WCYH 5DRNB 4TUJA 2XQBL 3T3ME 4YE4L 2VLRA 3D18B 4OZFH 4QRSB 3JWDH 1Z2KA 2EIBA 5C3LD 4U6HA 5B4MC 4LRIA 5DD5L 4JFDB 3ZHLA 4BSWA 5DJDA 1G0DA 1EBPA 3NTCL 4C54A 5FO9B 2UWEF 4TPRL 4E41E 4PJAA 1A7OH 3KXFB 4FQLL 4R4FH 2ZUQB 2GJ6D 1RUAH 2CKBH 1FVCA 4HMCA 5EUOB 2EICA 4KKBC 2D31B 5FEBA 4GAYB 4OLXL 4PJ5B 1D6VL 1LGVA 1ORSA 2CRMA 2RB8A 5ITBH 4ZOBA 1KXTB 1S78D 1KJ2A 2BFVH 4HMEA 3RGVB 1FV1A 3R1GL 2OZ4A 1I9JL 5EOCL 3IJSA 1JHKL 3NIGE 1UGNA 4OZFB 4R0LA 4XXCA 2ZSVA 2L7JA 4PRHB 2ATPB 3OL2A 1KTKE 1SJHA 3QIUB 1S8DA 1EFXA 4G8GE 3PGCB 1ZK9A 2CPCA 5JA9A 1ADQA 4Q6IA 4RX4D 4MSWA 1FGVH 4PJGA 1A2YB 2ICEB 3NPSB 4JFEA 2FLBT 5FYLE 5E9DE 4BQCA 2IALA 4JDVA 4OFVA 3ESUF 5KSVA 5EOTA 5CJOL 4XNUH 4QHMB 2CKBB 4FQXA 1CDHA 1G9MC 2HJKB 5A40E 2X4SA 3QDGB 3OJDA 2A77H 1NDGB 5C8JA 1JGVL 3HC4L 5TE4H 3WSQH 1CBVL 3MV7B 3U30B 3H0TB 1U91B 1AQDA 4V2CB 3TNNB 3RZWA 1RZJL 3H9SB 3IAQA 3MRFA 4IRSD 5BW7A 4KXZI 5I17B 1A7RL 4PR5A 5H35B 4G9FE 4YPGA 4XP6L 5HPMB 4K3JL 4B50A 1TZHA 5GGVH 2C1OA 4P2RD 1A4JB 3FOLB 3QPQC 1CICC 4HWZA 4PIRF 4L4VE 3UPRA 3NGBB 4YXHL 4NC0B 1VFBA 5DRZA 4U0RB 5DMJB 3RNKB 1JRHH 2IAND 3B2UC 1P4IL 3QNXA 1RZ8B 3H7BA 2H9GB 1RZGB 1ZT7B 3DI3B 4YDVB 1GHFH 4C56D 3OMZA 2NR6C 5ID1B 3QYCA 3LD8B 4G8FB 3AXLB 5D5MA 4U33A 3VDCA 4MDIB 5E8PB 1B0RB 4LSUH 2VLJA 2EDKA 3VFWA 5J4MA 3MGAA 4Y16D 4L8CA 2DBLL 1OGAB 4L3CB 4J4PA 2WIIA 4F37F 4HIEB 1J8HA 2YBRA 3CUPA 2MHAA 1MJUL 3IDNA 5AWNL 4FP8H 4XNXH 1X5FA 4PJ8C 2R15A 5DSCB 2XY1A 1PLGL 3QI9A 3WIFB 4RDQG 4BA8A 3F5WA 5HYSB 5JOPE 1JK8B 4LSSH 1I8IB 3ARQA 1QKZL 3AAZA 1OM3H 4LLYA 1A9BA 1MHHA 1IARB 3TIDA 2VWEE 4NYLB 3TT3H 4PJDE 1NQBA 1P84J 2VDNL 3MLZL 5ISZD 4OV5A 4QTHA 4G6ML 3DI2B 3EYOA 1UM5L 4JPIA 3TJEH 1FE8L 3HI6L 3ZLQC 4WU7A 5AD0B 3QH3A 3NCMA 4HKBB 2DJ4A 3H7LA 1ED3A 3DV6A 2FRGP 5GHWH 1YJDL 3QG6B 4AK1A 1A6UL 4CMMB 2VDKL 5JPMA 4CW1A 3G5XA 4P4KC 4L8SA 3BUTA 5ADPH 3LDBC 3FAXA 4S0TD 4M5YH 2XOTA 1ZLVK 3G6JB 4F80A 4M1GL 2Y25A 1A02N 5I1CL 3L5IA 4RISL 4DZ8A 1IGTB 3VG9B 5H37H 3BIKB 4LSQH 4JFDD 3U6RA 2X1PA 4WUUE 4FQIL 1U8OB 2DIBA 5EIIB 2BJML 2F53E 5IMLB 5TFSH 1I3VA 2DLGA 5BMFL 5DHVH 1P53A 2VLMD 3KXFD 1UC6A 4IMLA 3KS0J 1VERA 5DD6A 1A0QH 1KOAA 2J1KA 5HDBE 3TYGL 3IFNH 2OYPA 1EEYB 1E4XH 3BZFB 4PJCB 4PJ5D 4U1SA 4CN4A 5I8KH 2HG5B 5IROA 2HLFC 3STZB 4WU5A 4TRPH 1P1ZB 1T20B 4RA3A 1D6EB 3NCJL 3RGVD 3RRQA 1L4IA 5D7JA 3BW9B 1GYAA 2XRAH 5M94B 5KVEL 2C3WA 4EIZC 4GW4A 3X12A 1U92B 4KK6D 4XBGA 2ZWLT 5I75C 3RWCB 2AJSL 4TUKL 3CAFA 2JTDA 4PRHD 3ARPA 3VFGL 3DUSB 3QEQB 3QIUD 1C5CL 3QEHA 5TDNB 1OAXL 1U2CA 2WQRA 2JCCB 5FGRA 4U1LB 3I6LE 1KPVB 3DX7B 4X5LA 2EYRA 1EGJA 4GO6B 5DHVB 1MFDH 5DJAB 4QRPA 4W68A 3HZYA 3V2AR 3ZYIA 1NKRA 4ELMA 1T2QH 2R29H 2ORBL 3KYMA 4OFPA 1S7TA 3MRKA 3WHE0 1UWEL 5ESAA 4W6XB 4JR9H 2N56A 3QDGD 4Y8DC 4MCZA 4BFBD 1IGIL 5L9DH 1SJXA 4O5LL 3L3JB 5TF1H 3MV7D 1EIBA 1LO0L 1RUPL 3H3PH 5CBEA 1GGTA 1XF2A 3H9SD 5F96H 2ITCA 2YPVH 2NXZC 4GJTB 2GJZB 3PG2A 1U8QA 3BP5B 2B0SL 1OPGL 3ARFB 3I6KB 2VKWA 1X3DA 2DQUL 3TO2B 4F7TB 4G7VH 1BQHG 3VXQA 3V9FA 5IKCB 1NUNB 1UJ3A 3L7EA 4CDGC 5T5FL 2X4NB 5AEAA 3GSWB 4KJYA 4PJFA 2VLJE 4WRLA 2C4FU 5ALCH 1ZV5A 3CVIH 1ONQB 5ETUB 2VDPL 3BE1L 1OGTB 4NN7B 3CSGA 1J8HE 2X4UA 5AZ2H 3WIHA 1MCKA 4AT6B 1BVKB 5HDLA 4Y5VC 4Z76B 1N64H 3S37X 3T3PF 4K7PL 4L9DA 3O6KL 1G84A 1XCTA 2G60H 1OGAD 3GBMH 3MYJA 1CVSC 3F7VB 3JV5A 1U58A 2BSED 3X3GH 4Z7VA 1G7MA 5JQHC 4G6JH 3KG5A 5KVDL 1NMAL 3INUH 1AXSB 3QFJA 4OQTA 1I1FB 3MR9B 4JZJA 3WMSA 3LRGA 3WJJC 5CILH 3LPGA 4LCUA 4LEOB 3WJLC 2QQQA 2E7MA 1CFVH 4GFTB 3OXSB 1GSMA 4HS6A 3WXVL 4OF3A 1PSKH 5CZXD 2R1YB 3LSOB 1CF8L 3DYMA 3CLFL 4JDTH 4KRPC 4O4YH 2H1PL 4PRPB 3I2CL 5L88L 4RWYL 2GSGB 1CFNB 4LFHG 3L3KB 4JG1H 4OFYA 3T2OA 1VADA 2AV7A 4FFVC 3T4AB 1DR9A 1IC4L 1VB9A 2HWZH 1G7HB 3N06B 4P2OC 2VQ1B 4R4BA 1C08B 4ODXB 1BJ1H 2VB5A 3O11B 1AR1D 4XVJH 3MJ7A 3MLWH 5D2NB 4NKOA 4Z5RB 2N7BA 4YHPB 1BWMA 5EU3A 3MCLL 1U8PB 2VLLA 4XNZB 2J8UB 1NUDA 5EU4B 1HIMH 4GLRI 5AG8A 1YEKL 1HI6B 2CR3A 5K9JL 2MCPL 4AM0B 4XHJC 4XGZA 4PRNA 3VFSA 1KYOJ 4M48H 3EO1B 2X9WA 3OHXB 3AREB 4MQ7A 5HHOB 4XCFL 4H0GA 3IDGA 3QUMA 1BIIB 4DWHA 1XZ0B 2FZ3A 2CD0A 1ZA6A 1RJZB 1T66C 3VI3F 2AAVA 3LV3A 5EBGA 1I7UB 4KJQD 3VFOB 1YNKL 1AIFB 3G6JF 3DLQR 4MJ5A 3NCEB 4P3DB 4XAKE 4PY7A 3QZWA 5GJTH 4HFWA 3UX9B 3NACH 5EG6C 1CLYH 1I8KA 5I1JH 3QNZA 3Q6GL 5DZOA 5I66A 2F8VA 2CRIA 3MA9H 3GJEB 1EBAA 4UTAH 2DWDB 3S37H 1CE1L 1MELA 4ZPVB 1R3HB 2DDQL 3WJJA 4QRPE 4XNYL 4YIQA 4HMDA 4ELME 1GXEA 4PJCF 3ZE1E 3H42L 4Z18A 5GZOD 3QEQD 1KB5A 5DRXB 3TBSA 2Y9RT 2HT3C 4F15B 1Y6MR 5CD5D 2YUWA 1P7QA 5DMKA 4K3DH 3HUJB 5F7WC 1FG9C 3X13B 1IGJB 3MUJA 3VXNB 2H45A 5FB8A 3Q0HA 5HDQL 1NBVH 5I1KH 3OKKB 4NZUL 1DQTA 4JRYB 5E6YA 5FHAL 4X9GA 5JQ6L 1XCQA 4I48A 5C07B 2JCCF 5KW9H 4YWGH 1FL6A 4UT6H 3WN5C 4HXBH 1U9KA 4M43H 2XWBB 2NY3B 3MJ9H 5A16B 1YEHH 2Y06H 1ACYL 1IGMH 3ARFD 3D39B 3OKOA 1WIUA 5FIEA 1FBIL 4PJ7E 1JE6A 1FZJA 3C6LC 3GJFH 2DOCA 5FM4A 3VFMA 2NX5A 3D3VE 5IVZB 5JXAL 1QBLH 3CNKA 2CMRL 5IEHA 3IFLL 4WO4C 5C7XH 4LK4A 4HS3A 5D4QA 1I8LC 4IHOB 5F89A 5FYJH 5EBWA 3G04A 1ZS8B 4JY6A 3O2VH 2HT4D 2Z31A 1Q0YH 2GITA 1GGCL 3MXVL 4NC1C 4KZDL 1ZSDB 3MNVB 2UYLA 4NHCH 4NKIL 1W72A 5IBUB 3CXDL 2IALB 1K85A 4Z7VE 3ARTA 4JDVB 5J1SC 4OV6F 3P40A 1VCAA 1NAMA 2QSTA 5EBLA 3BZ4B 4UUJA 1VEOA 3MUZ1 1X4ZA 2UZIL 1KELH 2NXYC 2R56L 2HKFH 3MLVH 1NLDL 3DHMA 4QHUB 2FGWL 1I8MB 5FCUH 4PR5B 4HPYL 4JN1H 5KSBB 4DCQA 5A3ID 4HF5L 1S7XB 1BVZA 1OQOA 1QSFE 2FEEL 3W2DH 3GJFB 3REWA 1FFPB 3S96B 4GH7B 2Y6SD 2FJGB 3BD4A 3H2WA 4D9RE 3BEWA 1LE9A 4ODVH 3I75B 4GW5A 1MH5B 1I7RA 3W39B 1IQWL 5DD1L 4PRPD 4OLWL 3CXHK 2CLZB 3PP3K 4AL8L 4WFGD 5F1KC 2BY3A 5C09B 3QNXB 5FO7A 4DW2L 3ARWA 4JM2B 3D5OF 4WCYL 3QIWB 2UVFA 3WL9A 4LOUD 3HE7B 4PRDA 1LHZA 5IK3A 5IQ9B 3IDYC 1KCUH 4MAYB 3LN5B 3PDGA 3OKNA 2IGFH 2BHZA 1NGWB 2D0HA 3JWDL 4V1DE 5GXBB 2ESVB 5CCKH 8FABA 1NANI 4RMVA 3V6FA 4TTGA 4X99B 4JZNA 3ZT5A 3SE8L 3GIZH 1CZ8H 4R96A 4QGYA 5E00B 1A7OL 3LHPH 4R4FL 5K9KB 4WI4A 3FHAA 3B9AA 1RUAL 3ARED 1BREA 2CKBL 4YGVB 3RVWC 5HHOD 3BAEH 5CJQH 3TIDB 1FFNB 2V17H 1YZZA 5ITBL 3KDMB 1JYVA 2NY1B 4DGVH 3I3DA 3KPLB 4UNVA 2I07A 3DVNA 4PBXA 2BFVL 4ZTPH 2AVGA 4FTVA 2DM4A 4MWFA 4WU7B 2KQMA 1A3RH 5J9PA 2XY2A 1BZ9A 3MO1A 1ED3B 1RIHH 5HGHA 4I5BB 1S7VA 4LQ1A 4ZSOE 3KPRB 4WHCA 5C0ND 1YEIH 4Q58C 4KUCF 5HGAA 4W4OC 5EFIB 2P44B 1WF5A 4M62L 4X6BA 2XN9B 3ZDXE 5JMRA 3WEXB 1YEDB 4LSRL 2P5WE 4UB0H 1JF6A 3EOTL 2DQIH 4S0SD 2WINA 5C0CA 3DX9B 2A6JB 4XNUL 1QP1A 3VCLA 1C12B 1AXIB 3ULVF 3QDAA 4KTYA 2A77L 4MXVE 2DLIA 2F19H 5I0DA 5TE4L 3WSQL 4PTTA 1KB9K 2P47B 3SO3B 3T77A 4PV9A 3FQTB 1MF2H 1R0AH 1EHLH 3CFBA 3VDBA 4JRYD 3R8BB 5HHPA 1NJ9B 5D9SA 1CYGA 4RGNC 2NX5E 3KLHD 5C07D 5BZWA 5GGVL 2OS7A 3M1BA 4PD4K 4O2CB 1YQVH 4PRBB 2NY3D 2QSQA 4CGTA 5HYEA 4NNXA 5T3XE 4JN2A 1KJ3H 2O5YH 2X89A 3D39D 1BFTA 5DR5L 2A1WL 5J3HC 3V0VB 4MS8C 3V79C 3QRGH 1F6AA 2VNCA 3VWJC 1EEUA 5JR1H 1K5NA 2W65B 1T2JA 1YN6A 1QA9B 1UQSB 2EDOA 1GHFL 3AFLA 4AIZA 5E4IA 3UYRH 1C16B 4X6DB 4U6XA 1QACA 2V7HA 4LSUL 2ZNWA 3IU3B 4ORZC 1CD9B 2XWTA 2V2WA 1CGYA 4X9FA 1QPPA 4OZGF 2MWCA 4Y8AA 4NDMB 3HZYB 1MHPL 5L6YL 3Q1SH 5FUCC 3T0EB 5BZDA 1P4LA 2Z4QA 4LQFH 4FP8L 2GIYA 4XNXL 4MCZB 4W4OA 3U0PA 4MXQC 4H1LA 3D2UA 3IF1A 5F9WC 4PG2C 4QY8A 4LSSL 2EIZB 1IM9B 2ITCB 4DK3A 3VRLE 1R6VA 1OM3L 1A9EA 1MCSA 5B8CB 3C5ZC 1FVDB 3MLSH 4PGBA 2ZKHL 3D25B 4YDLB 2C1PA 4YHZH 3MV8A 1DTUA 1D5BB 3TJEL 1U42A 3VXQB 1INQB 3RI5K 4GW1A 1AD9A 5F1NB 5FYJD 1K6QH 4P5TC 3DVGB 5FOJA 2NY5H 4NN5C 4N9GB 4WFHD 5JHLH 1D7FA 5GHWL 5B39A 4MD0B 4K3HA 4KJPD 5DJYB 2AJXH 5I2IB 1XF5A 3VRIA 5KSBF 5C09D 3VGAB 3RX8A 3QISA 3BUYB 4EQ2A 3QXUA 4JM2D 5ADPL 1ZHNB 4FQJH 3QIWD 5C71A 3MRJA 4MQXD 1IFHH 4GRMA 5D7LE 3HE7D 3LMJH 2FX8H 3TESA 3NIDF 4MAYD 1ND0A 4KKLC 4EJ1C 2ESVD 3UZEA 1XCTB 4LSQL 1R5VB 4D9QD 1KIQA 2QADC 4JO1H 4NQDA 5C0IA 5I1DA 4NC1E 3ZKMD 1KIUA 5DC9B 1UZ6E 1EO7A 1KPRB 5TFSL 3HPJB 1GAFH 4UAOC 2WBJC 2D0GA 4Y2DC 4GSDL 3DMMC 4OGXH 1LNUB 4FTVE 2YRPA 5C0JA 3BKJH 5KAQF 4MZ2A 3T09A 5J6GB 3IFNL 5C9KA 3RBGA 1E4XL 1XR9B 4ONFH 5F70A 1U8NB 1UXSB 1JPST 4Z77A 4PJHB 5I8KL 1N5AA 4J3WA 3VXPA 2XA8H 2NY1D 4TRPL 3VJ6A 3N1PC 5EC1B 2VZOA 4S1QH 4ELKB 8CGTA 3C5SB 1HK6A 3ULSB 4NZDA 3HE6C 2Q86B 3TBWB 1EHAA 3KPRD 4HIXH 5FOBA 2LU7A 1XGYH 5HHNB 1G7LA 3C5ZA 1LP9B 2QKIA 4ZS7H 4C4KT 3IKCB 4X7DC 3IRPX 1QSEA 3VFVA 5BVPH 2XN9D 4QRUA 2NYYC 3O6LH 5F21B 2LABA 1MFDL 3JWOC 5T1DH 3NZ8B 3CFCL 5F1IA 4P5TA 4ODTL 2R29L 1H3XA 4Q9BA 4LL9A 3EDJA 2VN4A 4M7LT 1UXWA 4HSQA 4JR9L 4JHAL 2NW3A 1ETZA 2ZOKB 1KJVA 3EJJX 1UYWH 3ZMRA 3LS5H 5L9DL 5H94A 1KEMH 4FQHB 3LN4B 5TF1L 4XPFH 1KGCE 1PEWA 4WTXA 4N8VG 3H3PL 2MPAH 4U1MB 1YECH 1YPZF 5F96L 1FNGB 2YPVL 3FAWA 1YY8B 1WSST 2BNRA 2B39A 5D7KE 4JRXA 43CAA 4IRJC 1JNHB 2FJFA 3L5WA 1PZ5B 1T3FA 1F3DJ 4G7VL 2AEQH 5GIRA 1KN2H 4GBXC 2VR4A 1RZ7L 4RMUA 1ZVYA 4S1DD 5DFVD 4Y2DA 4HBQA 1HNGA 4M7ZB 1H3WM 4OKDA 1UVQB 2YSSB 5ALCL 5D7KD 5EU6B 3CVIL 5GGUA 2HLAA 4YIQB 3IDJB 3FN0H 4WDIA 3NN8B 4YFLI 2HT2C 4U1IB 3P4OA 4NCC2 5AZ2L 3RVTD 1MQ8A 5BJTA 3S36L 4QLRA 4LVOB 4OAWA 3IJHA 2XKSA 4AY0A 4WI9A 3QQ9D 4QHKJ 1ES0A 4RAHA 1N64L 3S88H 5EWIH 4HKXB 4RFEA 2G60L 2YA1A 1XIWA 3GBML 5DURB 4UT7H 1JI1A 5DK0B 5HVHC 2ATKA 4X7TA 2LFGA 4GRLC 5IB2A 3X3GL 4C59B 3T0ED 4G6JL 1Z9OA 1B0WA 4HBCH 4XCNB 5BO1H 4NN6B 4ALAH 2CUIA 4H26B 3INUL 4TYUA 4XAWH 4ORGB 4I48B 1FGNH 1P4BL 1NMCC 5CILL 5J56B 4OZHA 3DPBA 1IM9D 2HVKA 3SGKC 1CFVL 4U3XA 4XWOC 1FL5A 2VZSA 3P73A 1PSKL 4P0DA 1RIVH 5C0RH 5DS8B 4B41A 3OKOB 1JHLH 5I1GH 3FTGA 4JDTL 3ZYOA 4O4YL 35C8H 4RGNE 3D48R 5MENE 1SJEA 4JG1L 5A2JH 4JFOA 4YBLB 2HWZL 4JG0H 4P57A 3PGDB 1P5VA 4JY4B 2AK1H 4ONOA 3DX6A 1WBYB 1NC2B 3UTOA 4XVJL 4NBZB 3DROB 1I1YB 3MLWL 2NZ9D 2PTUA 3VDAA 2UYLB 2GSIA 3OF6D 3OJVC 1WTGT 4FFZH 2VABA 4LPWA 5LQBH 1WAAA 2XNAB 3GMLB 4KI5D 2ZUVA 1JPGA 3P0VH 2V9TA 4TOYH 1HIML 4GBXA 1FG2A 5E6IA 5IW6B 3GMNA 3TO4A 3GIVA 1WFOA 2VSCA 2AJ3B 3FFCE 3I6GA 3RWJB 2P42B 4M48L 1OHQA 1QNZH 1BQHB 4ZFZB 1AY1H 4Y5XC 1EVUA 2V5YA 5I6XC 4M6NH 2I26N 3B9KA 3LVEA 2W38A 5HHXH 5FUCE 2BVQB 3EJZC 3S4SG 3SJVE 3TWCH 3GRWA 5EIVA 2RJMA 5GJTL 3MMEB 3NACL 4U1GC 5SWSE 2EXYD 5I1JL 1M71B 2ITDA 2XZZA 2W9EH 5JW4N 1HN1A 3MLTB 3BEWB 1LE9B 4IS6B 7FABH 4M00A 3MA9L 2Y5TB 4X9IA 4GKOA 3PIQB 4RMTA 4DVBB 1E4WH 4UTAL 1QSEE 1OTSD 1X7QB 1Y6KR 3S37L 4YZFF 1A6ZB 4DFHA 3OKEB 4HIJA 4NT6B 4WTZA 3SDDB 3VFRB 3QWOB 1RJLB 2GAZB 2EKSA 2JK5B 4MAUH 4E0RB 3MRBA 4FXGB 5CP3A 2VOTA 8FABB 1XGQB 5K59E 2P48B 5BXFB 1QRNB 3CD4A 1VSCA 1OSZB 5DEFA 4K3DL 3D6GA 5HD8D 3WS6C 2BNRE 3IGAA 4XP4H 1E6JH 3GEWB 1B0GB 2XYCA 1MRFH 2HTKC 3V0WH 4O9HH 2ED7A 5I1KL 3B6SA 1LP9F 2NY6C 2BERA 1J05A 4Y19B 5KW9L 4DUWA 5JA8B 3GSNA 4YWGL 4UT6L 4HXBL 2FDBP 4DGYH 4M43L 5IBLD 2XPGB 3MJ9L 3DVNB 2DWEA 1WC7B 2Y06L 1IGML 4P5MB 4K2UH 3DURB 2NY0C 4EUPH 1ZVSA 4PJIA 5KOMC 1RPQA 4JKLA 1FL3A 5DWUH 2VAJA 4MD5A 1BZ9B 3ZZ1A 1QBLL 1LK2B 3EYVB 1ZHLB 3CU7A 1JWUB 3S3JA 1K8IB 5FYJL 4GG8B 3G9AB 2BC4A 3PHSA 1M7IA 1JWMB 2IBZX 3P0YH 4U6YA 4Y5YB 2I27N 4LLMB 3QULA 3O2VL 3FB6A 4LAJH 4P5KA 1Q0YL 1FPTL 1TQBB 1I7ZB 3SDXA 5EU6D 3MREA 4MJ6A 4X6BB 2B1HL 1JIBA 2OMNA 1A4KA 4N8VA 3DX8A 4NHCL 5DQ9B 4PP2A 1H3PH 2H32A 3S35X 5KJRH 2HFFA 4DOHE 3W5MA 3VCLB 1KF9B 3DGCR 1CDUA 4F2MB 2DS4A 5GGRY 5DURD 2P24A 1KELL 2VZTA 5DHXB 2HKFL 3MLVL 3QIBA 4PB0H 3W5NA 4YEFA 2DIAA 4UQ2B 5E2JA 5FCUL 3W82A 3EFFA 4LVEA 4R97B 4JN1L 3CFBB 3MV9B 5JIKA 5HHPB 4EUPB 1EHXA 5DDHA 3PUCA 3C09B 3W2DL 2A9NL 4MDJA 2FGZA 3C8KB 1SYSA 4I77H 5F7KC 1A6VH 5GISH 3VGDA 2B5IB 4YAQA 2D7PA 4JN2B 3V7AE 4AIOA 1E6OH 4ODVL 3OBAA 3E6FB 4IMKA 1TJHH 1F6AB 1LWRA 1A1NA 4O2FA 5IM7A 2FWOB 3BKMH 1BBJB 1WAAE 1W0WA 2EO1A 5ICZB 1YN6B 5IG7A 3Q3GB 5I74C 1NC2D 4R6UA 3WO3B 1KCUL 3NVQA 2IGFL 3CFKA 4N8CH 5H2BA 2X1QA 3AS3A 3EZJB 2XWTB 3GMOB 4BKLA 3QUZC 3RU8L 5CCKL 2IPUG 5D7IE 4ZXBC 4Z7WB 2D7NA 1HDMA 2R1WA 2B4CC 5JOEA 4AMKL 3BP7B 3RVUC 3GSXA 1E0OB 3GIZL 1CZ8L 4OBSA 3SDCC 4ODSH 4GXUN 5BZDB 3LHPL 4HWBH 3KYKH 4QXTB 4U05A 5DO2C 3KLAB 2W60A 3T8XB 5DJ2B 2FL5B 3VGEA 3BAEL 1J1PH 3U82B 5CJQL 1RULH 5CJ5A 2V17L 4UIMA 3MV11 1YN7B 3HCVA 4LLVA 3A67H 1VEMA 2PW2B 3ILQC 3MBEC 5EOCJ 4DGVL 5T1KA 2B2XH 1MIMH 3NA9H 4ZTPL 5CUSL 2A0LD 3TN0B 1TVHA 5EPMB 4PJXA 4LPYA 3DV4A 1HHHA 1A3RL 4MVBC 3T4YB 4NO0A 2OX5A 4S1RH 5I8OH 1YEIL 2FATH 3CFEB 3V95A 1I75A 1X5JA 2LTQC 3AMKA 4EOWH 1QLRB 4WUKH 5GGTA 3DRTA 4PY8J 1J1OH 3SDDD 1CFQA 4CN6A 2AJZB 4PYHA 2C7UA 3S34H 3S4SA 4UB0L 4F7CB 3ARDA 1H5BC 4Y4FC 4XTRC 4JHWH 1KB9J 3JTTA 4R7DA 4HWEH 1J12A 4X7CC 3RKDC 4XP1H 5E1AA 1BECA 3AM8A 1QRND 4XC1H 4QOKA 5EZOH 2Q76B 2CLRA 1EGJL 2F19L 3MUGB 4N8PA 4NGHH 3U7AA 3K4DA 4I3RH 5EO0A 3P9MA 3EAKA 4L9LB 3OKDA 1MF2L 1R0AL 4LFHD 1EHLL 3K4AA 3PJSB 2CXKA 1CIDA 5JIIA 4APQA 3ARSA 5KSAC 3K2MC 3QUZA 3LCYA 4LCWB 4KUZL 4YPJA 3ULUH 1N5AB 1QR4A 4WI8A 1YQVL 1KIRA 5JOFA 2MOVA 4ZAKA 4Z7UA 2AW2A 1S9XA 1KJ3L 5KVMC 4N1EA 3SDXE 4XBPB 1Q8MA 1UZ8A 4WI7A 5FK9B 1NKOA 3QRGL 2VXUH 1CXFA 2C3GA 3UPCA 1A14H 2OJEB 3WXWH 4NRYA 3VH8A 2Y7QA 4PUBH 2AXFB 5K9QG 2BVUA 5BCAA 2X7LB 5ECJE 1J1XL 3UYRL 1D5MA 2GYSA 4HEME 4JJ5B 4MMZC 5FM8A 3L7FB 3VFVB 3KPQA 5IFAH 4OKVA 5E5MA 4O51B 4D3CL 5EIQA 3NCFB 2RIKA 4KGJA 5DRWA 2O5XH 4MA1C 1NC4B 3UPAA 1T0NB 4L4TE 3Q1SL 4OIIH 1DDHB 4OZ4A 1IL1A 1WICA 5HGBA 3K8KA 4XVSH 4LQFL 5IWLC 3QR2A 3BPLC 1EEZA 3TF7C 5H94B 5FYLH 3LQZB 4UNTA 3WIIH 2FYYA 5IHUH 5E8EA 1RY7B 1P2CB 3MV9D 3DSFH 4JRXB 4PP1D 1CXIA 1U3JA 3U46A 1I3RA 2YXFA 4D8PB 4YHZL 4X4YA 4FFWD 4YDKH 2H8PA 3O9WC 4X6CF 3O4LA 2F5AH 5L0QC 1K6QL 1S7QB 2YPLA 5DJCA 3N1MC 2NY5L 5HI3D 1RI8A 4GKSB 5JHLL 2BSTA 4IJ3C 5E2UH 1KJMA 1LD9B 1RZKH 1V8HA 3ZT6A 1R3KB 5CZKA 5I8EA 2X44D 5I16A 1IFHL 5DEGA 3TVMA 3G9VA 2F54A 4OZIF 4BK4A 3LMJL 1U6AH 1G7QA 4YK4C 2ZG2A 5INDB 1A6WH 3UTTB 3BMVA 4CMHC 3ALXA 3OKYA 1KG0A 4JO1L 5E9DB 3OAYH 4E42A 1I7TA 1A1MA 4OD2A 4X7TB 4WFEE 1GAFL 2J12B 3ECBB 2YK1H 3FQWB 4PLNC 1F8TH 3A6CH 4OGXL 2GFBB 3KJ4C 2FNBA 4JKPH 4PJXE 3BKJL 4XNQA 3G6AB 3Q2CA 5ID0B 4GRWF 1HHKA 2NY4C 2APVA 2P5EA 1B4RA 5C9JA 4ONFL 4WWID 3LPFA 5FUZH 3BX7C 1FO0A 3HRZB 4JKWA 5KN5B 2NPLX 4G9FB 2QSCL 5IVNA 2QJDA 2BVOB 4HIIA 2XA8L 1ZTXH 2WMPA 1QR1B 1OARH 3TN0D 3E2HC 4HW6A 4S1QL 3QJFA 3REVA 4NQEA 4G6FB 3PABA 4XP5H 5E03A 5HY9B 5JDJA 4L4VB 4HIXL 2I25N 1CT8B 3MPCA 1XGYL 1J0YA 1Q72H 1HXMA 4N0CC 1RQ5A 1AGBB 4JPVL 1JF1A 4ZS7L 4HKJA 1CN4A 4QRRB 1FVEB 1GGUA 4QOKE 1M05A 5GS2H 4WNQA 1MJJB 5BVPL 2KKQA 1NFDA 4NM8H 5EO1A 3O6LL 1JPGB 5MP6H 3O9WA 1AD0B 1UA6H 5T1DL 2EYSB 5E6IB 1E27B 4EI6B 2Z9TA 3TO4B 3GIVB 4Z7NF 3GSOA 2N7AA 3HG1E 3I6GB 2IBBA 4LASH 2A9MH 4KKAD 5ENWB 4BSJA 2ICCA 4G43A 3KHOA 5DUPH 1UYWL 3MNZB 3LS5L 4K7FA 1KEML 4XPFL 3LN9A 1ZHBA 5DJ6A 2MPAL 4HUWB 1T5WA 1YECL 3RNQA 1ZLUH 1EUTA 4POYA 5MI0C 5IVXB 1E28B 4NFDA 4HGMA 1CK0H 4LCWD 1BD2E 1JTPA 1BMGA 3V6OC 2BSSB 1IEBA 2AEQL 3JXAA 1S7WA 1FZOB 3KPOB 3RTQA 4K23H 3R06B 3NFNB 2X4PA 4WVRA 3T65B 2VMFA 2P8LA 3ULVC 4HD9A 3HB3D 4D0DB 3FN0L 5HI5D 3T2NH 2FO1A 4JFHE 5E94A 4LMQI 4HG4K 3BI9X 3FO9A 2OI9B 3I85A 4K7PY 4IBLT 1KTRL 5CJ8A 3H3BC 3S88L 5EWIL 4NKDA 5DEFB 4ODBD 4MNGA 1NFIB 4N0FA 4UT7L 1W72L 3L5JA 3QO1A 5IOPB 4NHUB 4TTDD 3OWEA 5BO1L 2X4OA 3GB7B 4J1UB 1KLUA 1XGUA 2F53B 5IUSA 2EYTB 3SKJH 1FGNL 3ULUD 5FF6B 1G6RA 3OZ9H 1YMMB 1CG9B 2YPLE 2OXGA 4FFYH 3TZVC 5CEZH 2X4QB 4P46A 1YNTB 3T3MF 2XACC 1A6TB 2Q6WA 1EFQA 1RIVL 5C0RL 4JRXD 2D03H 2VZUA 4NKMA 4WFFE 4FZEH 1JHLL 3RP1A 5I1GL 4RMQA 3X11A 1ZVSB 2N4IA 5KS9E 5T33H 1U95B 3K80A 2K7QA 35C8L 5D7SH 2EZ0D 5JHDE 1GGYA 3HC0A 2F54E 1TDQA 1N59A 5CD3B 1P9MC 5KVFH 4JG0L 2FEEI 2AK1L 1M7IB 4HHAA 4G6KH 1TCMA 3FQUA 4O2EA 4WJ5A 5BS0A 1DN0B 1HYSC 3MCG1 4FFZL 4LVHB 4OJFH 5LQBL 5T1LA 2F9BT 3RWEA 2WWKT 4I3SH 5ALBH 1MI5B 4OFDA 3QAZC 4QF1B 4UV4H 2MMXA 3UTTD 3UBXI 3QXAA 2HTLC 3FT2B 1RZIB 3UAJC 4W4NA 5K9OA 2JB5L 5FYLD 3FKUS 5E9DD 3PHQA 1AY1L 1UM4H 3QIBB 2DN7A 4MXWH 3BWAB 4LEXH 4M6NL 4EIGB 1UCTA 1IAKB 1VESA 1XT5A 4MLSA 2AV1B 3ROLB 4OGAD 3NIGF 5D1QC 5HHXL 1QZ1A 1RVFH 1CFBA 1IILE 5DZLA 2KDGA 3FQRB 3TWCL 2GT9A 3JTSB 1A64A 3SCMC 1D5ZA 2X4RA 4KDTC 4A6YH 5DJ8A 4XCYA 5GGRA 4OCSH 2W9EL 1Y0LB 4G9FD 2A6KB 2D4FA 4ENED 1EH9A 4XXDA 7FABL 1I4FA 2Z93B 3GBLA 1G9MH 1N8ZB 4JFFA 1A1OB 1E4WL 1FZKA 1A1NB 4UDUA 2ZUYA 3GSRA 1BQSA 1FCGA 1JF5A 3DYPA 4G6FD 2APFA 3MRQB 2H2PD 1OAQH 5I76B 4L4VD 5LVEA 1FORH 3PWLB 2BMKB 1OT1A 4MAUL 4TUOB 1EMTH 1H8OA 1U8JA 4QRRD 5L2KE 1NGXA 2WP3T 2OL3A 3OB0K 3RVVC 3CFDB 1KTLB 1CLOH 2EIEA 1Y18B 4KV5E 4NRXA 5E6ID 3R0MA 1RZJC 3WKNA 3TO4D 5TJWK 5D72H 4XP4L 3C60C 3V6BR 4EI5A 5IT2H 2CDFB 3V0WL 4S2SA 4O9HL 4A6YB 2Z91B 1YNLH 3GMRA 2AS5M 3VXMA 2EDHA 5CKGA 4Y4HA 1JVKA 4P2QA 3M17B 5DD0H 4HCRA 1FH5H 3OR7A 2L7UA 4ZO6A 2DQFA 5DYOA 1BFVL 3QUYA 4HJ0C 3NIFE 4MD4A 3DV4B 4NM4H 1INEH 3QEUB 3QNYB 4U31A 4OUUB 5DWUL 4KK8D 3MA7A 4X0KB 2FEDC 4X98A 1S9WB 3GJFK 4WW2F 3CCHB 3LRHA 4ZFGH 1Q38A 3PHOB 4MB5A 3GM8A 5GS0C 5D1XA 3P0YL 3DETC 4HUNB 4CVXB 4R3SB 3QA3B 4OD1H 3U2SA 2NLJA 1CICB 2O5ZH 1QVOA 1MHCA 2YC1A 1H3PL 5I19H 3BJLA 4G9DB 5KJRL 4EN3C 3U7WH 3B3IA 4PJDF 1GZQA 3RWGB 3VGHA 1FYTE 3P9LA 3HI5H 3S5LB 3DXAB 2XICA 5BRZA 2B7DT 1NL0H 1BQLL 4ONGH 4PRAB 4X4XB 3UTQB 1K2DA 3QQNA 4PB0L 3P9MB 3MJ8A 1QUNA 5F97E 5MEPB 4DJMA 5TDPB 3FRUB 4JB9H 3O8XC 3FT3B 2F53D 4PJBA 1SBSH 1RHHA 2IMNA 1YUHB 1YC7A 1YMMD 4I77L 2Z8RA 1A6VL 1N3NA 5GISL 1DL7H 1G6VK 2H2SC 2SEBB 2ID5A 3EUUA 4PJ8B 2GTZB 3O2DH 3FHQA 1E6OL 5DFTA 1MUJA 5CS7A 5I1AA 2IQ9H 3C60A 4JPKH 1TJHL 4QGTA 4FQQA 3BKML 4JANB 4YLQT 3V6OE 2IH1B 4NRYB 3VD5A 5CLWA 1C7TA 3GUTB 1ZWIB 5DXWA 1NCAH 1V3LA 4U1NA 5HVGB 1VFAB 2ICES 4MA8H 5T3ZE 1RK0B 4B0MM 3BQUC 1LO3H 3IDMB 5HDBF 4N8CL 2XG4A 3IJYB 2J6EH 5DGRA 1MI5D 4RAVB 3TBVA 3WYRA 1B2WH 3V7AG 3EGSA 3MRHA 4ODSL 3AU1B 5EOQH 1CFSB 2EDXA 5FO8A 5HYQB 4I0PA 4P4KB 4HWBL 3V5KA 3B8SA 3PWUA 3KYKL 4PJGF 1J5OL 5JDSA 3OPZH 5CIPA 3QIBD 4JRWA 4MNQB 4MA3B 5CEZD 1J1PL 2F5BH 1RULL 1UADC 4KPHH 5B4MD 2ICWB 3Q48A 1WT5C 3A67L 3VXOB 2HMIC 1AGEB 2FO4A 3CSYB 3MLUH 1MIML 1CL7H 3NA9L 4PLJC 4JKMA 3ILPA 3RY5A 2BY2A 3TC9A 4HIHA 1JYNA 3CK0H 2YPKB 1GZPB 5D6CA 4X6EA 5DMGC 4TQEH 1JZ4A 2M1KA 5C0DA 5I8OL 5T5NF 2BSTB 2EE2A 2FATL 4X8JA 3O8XA 4X6FB 1MLCB 4M4RA 4EOWL 1FJ1B 1BOGA 4WUKL 1YDPA 4LCYB 1J1OL 4F57L 5K93A 3OKLA 3S34L 5C08A 4LCIL 3OXRB 5B3NA 4JHWL 4PTUA 3BPCA 5DFWH 4HWEL 3ORJA 4FG6D 2A6DA 3VXME 1MFAH 4XP1L 3WUWA 5E8NA 2WUCH 4E42B 4XC1L 3SDAB 5EZOL 4GQ9H 4ZNCD 2JJTA 4NGHL 1DANU 4I3RL 3T0AA 2AK4A 5ERWB 5FDYA 5FKAA 5D5MF 5D2LB 1EA9C 2K1MA 3F58H 4MHHG 5T1MB 3F7QA 2GTWB 2R0LH 3UC0H 3EOAB 1F97A 1U3HA 3BXNA 3FT4A 5C0AA 4QT5B 1RUMH 3MRRB 1ZE3C 1TTUA 3DO3A 5GGVY 1BFOA 1Q1JH 2HN7B 5E6ZA 3ULUL 5CMAB 5J12C 3TBYA 2I9LB 1QSFB 1KCLA 3EYQC 4LNRB 5I18H 1EZVX 3LAFA 4QYOA 2GI7A 2W0KA 3HR5B 2A6IB 4LU5H 1WIPA 2A73B 5IV2A 4F9LA 1A14L 1DN2A 3UJTH 3WXWL 2KBGA 3VWKA 4JFZH 2ADIA 2OQJA 3L3IA 3VE0A 1DUZA 1HXMB 4PUBL 4L29B 1OAZH 3V7MA 1WT5A 3HS0B 4BM7A 2IQAB 4BFIB 1T1YB 5H8DA 4D0BA 5IFAL 3QPQD 5BRZE 4RWHA 2GK2A 1CICD 4H5SA 4CN1A 4MGXA 2O5XL 2CKNA 3KPMB 3MGTA 4RZCA 4J3VA 5GS1A 1J0IA 4RFNC 4U1KB 1WBXB 2R2CA 4OF6A 5FDWA 4OIIL 4KFZC 4V1DB 1JHTA 4PJBE 5JW5B 4XVSL 3BN3B 3DXAD 2YN3A 1MCIA 3PE9A 5E1HB 3DYOA 3MRDA 5FYLL 4E5XB 2NR6D 1MVUB 3WIIL 4M6MH 4HDIA 3IT8D 5DVMA 4YDJB 5IHUL 5D71H 3NBNA 4PRIA 1IT9H 3DSFL 1BLNB 3UDWC 4H25B 1T1ZB 4F9PA 5MEOA 3EYFA 3UTSA 4NRZA 2I60H 3L95A 4YDKL 3FCTA 4ZFFB 3QEGH 2FECL 1SM3H 4YHOH 2DQCH 3MRCB 1YEGH 3THML 3EJYC 5JO5B 1DBMH 4CADA 1OW0C 5E2UL 1RZKL 2P8LB 1D3CA 3L3DB 3HZMA 4ZSOB 2OXHA 3MRGA 1F11B 4KRPB 4DGIH 3DUHA 3LY6A 1U6AL 4I2XB 1A47A 3QUKA 1DQQA 1A6WL 1MFEH 1B6DA 2DM3A 1NEZG 1BP3B 5C0BE 1OP3H 1UB6B 3SPVA 1PZUB 1A7PH 3B5TA 4FMFA 2P5WB 4P2OB 3V8OA 4GOSA 1CD1A 2YK1L 3P4NB 3A6CL 3HA0A 4P4KD 2JLLA 4JKPL 3GM0A 3MROB 4MNQD 2F8XC 1T6WA 2ADFH 3WKMH 3ROOB 2VISB 2C3VB 3CDFA 3W0WE 5FUZL 4ELMF 1FAIH 2EDYA 2Q6WB 4UILH 1FC2D 4M1DH 3ZE1F 5HBBA 4PJEA 4XRCA 4TVPH 1AP2B 1RFDH 1BM3H 1MCWW 1NCNA 3ZKQD 2YD9A 2GJ6A 2HFEA 4XP5L 2VE6A 2L0DA 5C08E 5HHME 1BEYH 1QFUH 3K3QA 4TNWF 4Z0BH 1KEGL 1NBZA 1Q72L 4EEEA 1T4KB 2XTJC 1HNFA 4HH8A 4WJ5B 5DA0B 3L3HA 1T89A 3O6FC 5T1LB 2HLFD 3IRZA 4QNPF 4NM8L 2VIRB 5MP6L 4H20H 3WNOA 4LF3B 1UA6L 2Y72A 3O4OB 3VRJA 3MFFB 2Y1VA 2BNQB 1RK1A 1TETH 4GXUM 4RAUA 4RQQA 2BVPB 3J7HA 4LASL 4XI5D 4Y1AE 4PJ7F 2XZCH 5FA3A 2RBLA 1JV5B 2F74B 3JV4B 4YBHA 2O26U 3SDAD 5DUPL 4OSUH 4RX4A 3H9HA 4NKQB 3VD3A 1ORQA 4DKEH 1KULA 4FXKB 3RVXC 3O3BA 5J6HB 4N5EC 5I1EH 4LBEA 1TVBA 1T21A 2VDOH 5EC2B 1MCFA 3FN9A 4KDWA 4LVNB 1OB1A 4Z7VF 5ADOH 3CVHH 2J8HA 2RR3A 1QSFD 4K23L 3MLRL 1FZKB 4P2YA 3EOBA 4IRSA 2BVTA 3TV3L 4MJ2A 3QQ4B 1JGDB 3WN5B 5IFJB 2PO6B 3UTPE 3VGFA 4D9RD 1IQDB 1HH9B 3RDTC 4LLWA 3MRMB 4JZOB 3T2NL 5CSGA 2GW5A 4P2RA 1UG9A 1U8JB 5EA0H 3C6LB 5CEYB 1R5WB 5EU5A 5F7DA 1AGDB 5DZNA 1MLBB 3QDJB 4WO4B 5D7LB 4Z78A 4DN4H 1K8DB 4PRIE 1U8HA 5KTEL 4V1DD 1V7MH 3VD9A 4UZGA 1U3YA 4TSAH 4C56A 3LS4H 2G9HB 1EK3A 3LKNA 1PW3A 3FB5A 4P2QB 5ESQA 3OZ9L 3ZKNC 2CJUH 1F13A 4S10A 2FBJH 5IIEB 3CVHB 4NCC1 4N0UA 4FFYL 5E8DH 1MJ8L 4Y16A 3TIEB 5CEZL 1TJGL 2D7TH 3D0LB 3QUYB 1HSBB 1X6NA 5GZNC 2DD8H 3S97C 2D03L 4FZEL 3RWDA 3CC5B 1Z9SA 3QXDA 1CGWA 3ZSSA 1MPAL 4C58B 1BZQK 2NXYB 3RGVC 1LEGB 5T33L 1A22B 5D7SL 2R1XB 5K33A 1BJ1J 4KDVA 1NLBH 4NQCE 4R8WH 5KVFL 2DICA 1NDMA 3BVNA 3L9RA 4KTDH 5D1XB 4G6KL 2ZCLH 1JCKA 3U2SB 1QVOB 3IFOA 5ISZA 4BUHA 4OJFL 1YA5A 2H3NB 5IF0B 4I3SL 5ALBL 3GSVA 1JFQH 4XPHH 2A74B 2AKRA 1HCFX 4UV4L 5IEKB 3KPTA 1CDYA 4QEGA 3P9LB 4FFVD 4C83B 1DVFC 5DUBA 2P5WD 1CCZA 1SYVB 4P2OD 5GQBA 1X5LA 5IHZB 2EH7L 4MXWL 4LEXL 4YC2C 3DBXA 1XR8B 3IDYB 2YD6A 4PJEE 2CIKA 5DRNA 5F3HB 3VFUB 1RVFL 3CH1B 1ITCA 2NMSA 2IG2H 4WW1B 2EDBA 3D18A 2X5PA 3PQYA 4QRSA 2GJ6E 2W07A 2ENYA 2MKLC 4A6YL 2W59A 2BZDA 2ADGB 4JFDA 3ZDXF 5C86A 5GRUH 5TE7H 4OCSL 4XHJD 3ES6B 4B53A 4ACPA 2XTLA 1QFWH 5FO9A 4FN0A 2ZZUT 5ANME 3X3FH 3W9DB 1G9ML 5D70H 3KXFA 4QRTB 1J0KA 3CDYA 2D7OA 2W0LA 4MXVF 4NO5B 1QBAA 1DQMH 5EUOA 2E3VA 1NGZB 2KZ1B 1OAQL 4P59H 4U1NB 5J0BA 2D31A 1FORL 4GAYA 1QYGL 4PJ5A 4RGOH 1MJ7H 1EMTL 1CGUA 2DI9A 4GQPH 3ZKXB 3KWWB 3STBA 1F4WH 5T1LD 3RGVA 3V4VH 1IKFH 5SWQB 2PYFB 1KNOB 3EGSB 2BNQD 1P84K 5D72L 1PVHA 5FO8B 4OZFA 4I0PB 5IT2L 4PRHA 5D6DA 2ATPA 2HA1A 3I84A 3QIUA 1YNLL 3PGCA 4G8IB 2BSRB 4P9HC 2WV3A 1A2YA 1IAIL 5DD0L 1OAUL 5LBSH 1FH5L 5AYUH 4QHNB 4D0CB 3K46A 4TVPD 2PXYC 2GKIA 2W0PA 3T0DA 5C0GB 1HSAB 2DYPB 2HJLB 4OLEA