1F3JB

Histocompatibility antigen i-ag7
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
187
Chain Sequence
ERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 187
sequence length 187
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f3jB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1f3jB01
3T0XA 5HPOA 4LVNC 3PXJA 1ZT4A 5CCKL 3VG0L 1T7YA 5JHDE 4PY8J 3LPGA 4O2FA 3K8KA 3WMSA 1TJIL 4LVOC 1NGQH 1G7QA 2O5ZH 5HJ3A 1LO0L 4IRZH 4PRBB 4U1IB 4V1DD 5I74B 4Q9QH 2CRMA 4YBQC 3TPUB 3AREC 4P5MA 2GTZB 1AO7B 5L88L 1IGIH 3T2QA 1ORQA 4BUHA 3GRWH 4XI5C 4ELMA 2GJ6B 5ADOL 5D8JL 1BWMA 2XZAH 4I8DA 2V9RA 1I9RL 3DX8A 1AGBA 3LQAL 4IDJL 3TGXA 2BK8A 4Y4FA 1BJ1J 3FKUS 3VXRE 2XKUA 3X14B 5CBAA 4KI5E 4S0TD 4F9PA 3DECA 2YXFA 5DFVC 3MV01 4KKCD 1KLUB 4NZDA 4JO1L 2WLYA 2C5DC 5ESQB 4KKBD 2IJ0C 4XMPH 5DC4B 5IB4A 4ONHA 4KJQD 3WNMA 5C2BL 2H2PC 3MROA 1I1RA 4ZAKC 2UUDK 3O4LB 3GI9H 3L3GB 4QT5B 4XCNB 1MFEL 3AS1A 4PJFE 3LHPH 2EIDA 4KPHL 5CEZL 5F7HA 2R56L 4MD4A 3O3DA 4PGCA 1IQDA 3OJVC 1FDLH 5D7SH 2SEBB 2HKHL 5CINH 3TO4D 4U1SA 4POZC 3KHOA 2ICCA 1EXUB 5F7DB 5EWIH 4PUBH 3IU3B 4ISVB 1CG9A 4P3CL 3HR5A 5F93C 5IMMB 2D3VA 4JREB 4M62H 3RVUD 1TZIA 3IYLW 4JFXA 4YHZH 1HOCA 2F19L 4DN4H 1H3VA 3CVHA 3UMTA 4GKOA 5DRWA 5DTFA 2D7NA 1HQ4B 2VLJA 4HWBA 4F33B 4N0UB 1CD0A 1I7TB 2DQTH 1JMXA 5HHPB 5SX5H 1UZ6F 4Y1AE 1J5OL 4AL8L 4YZFE 1SBBA 5GIRA 3RI5K 3QIBC 3FFCB 5BV7H 5I1HL 5F1IA 1G9NL 5C0AA 3TZVD 2AEQH 4KHXH 3OXSA 3QWRA 4JKPL 4EI6A 4IRSB 5ISZD 5FO8A 1BM3H 35C8H 3ARBC 4LCCA 4UUJA 4GW1A 1AXIB 1N6VA 2DQUH 4HX1B 3OG6B 5HDOA 1RD6A 3ARSA 3ULVC 4NNXB 4QOKD 2IQAB 5E6ID 4YNYA 4ZFFA 1H3XA 4KK5D 5CJQH 4UAOB 2X4TB 3BHBA 2F8VA 3SKJL 5T3ZD 4G6JL 5IESH 3L5WB 2PO6D 4Z7WA 2ZZUT 3D3VA 2HRLA 5EZJB 3QO1B 1I1AD 3NABH 3KDMA 3THML 5I1KL 1B6DA 1OAUH 1YDPB 5B3NA 1TQBB 1K3ZA 4PGDB 3IDYC 2VLLB 3GHBL 3QZWB 1L7IH 2BRQA 5CD3B 4M7ZC 3F8UB 3GMRA 4J3VA 1HHJB 3RDTA 3EGSA 3MZGB 5DD6A 5J89A 2YD9A 3MLXH 1JYNA 3T2OA 3CLFL 3BD5A 5IOPB 4P2QD 4FQ2H 1AJ7H 1BVLB 4PJDE 3D18A 5GJTL 4OBRA 2JLLA 3BPNC 1CLOH 4YE4L 3RAJH 4QXUL 4W70A 3D87B 5IROC 5IT2H 2BNQD 5SV4A 4M02A 2ED9A 3ILPB 4PBXA 1OSPL 4LLVB 4CJ1A 4LU5H 4AG4H 2NXYB 1BFVL 1CD1A 1F13A 4YIQB 5HYSA 4O2CB 2EYSA 1TENA 1ZOXA 4NCC2 4AIZB 3VWKB 4ZUUA 4HGMA 3TIDB 1X5ZA 3IXAA 3HZMB 4NUGL 3IXTB 1GGCL 1I1YB 1W8NA 1KCRH 3QI9D 4OKVA 4WEMB 1WBXA 4P9MH 2FIKB 4NJAH 4XPAH 3GMQA 1NGPH 2P8MA 3G5XB 3CD4A 3ARUA 3SGDH 3C6SB 3KGRA 1MAKA 3MRFA 4D3CH 4PRPB 2IH1A 1Z3GL 3H9HA 3SE4A 2CMRL 3CVHL 5FHAL 1LK3H 3L3HB 3VGEA 4BA8A 3SY0B 1EIBA 4R4BA 1NQBA 1Z9MA 2PN5A 4HWBL 4NRZA 4P2OD 4UIMA 1B6UA 4D9RD 1PG7L 1IGML 1LP9A 5HYEA 2CDEB 5KTEL 4PJAF 4GG6F 3D39E 3ZE0F 4LGPB 3OHXB 3O6MH 3G5ZA 4MAYD 4OGAD 1VHPA 1FNHA 3V0VB 2LAGB 1LO4L 3FFDB 4GUPA 5HHNB 4GAYA 2ICWJ 3A6CL 4Z7QE 5JOFA 2BSSA 2DBLH 5I8CB 4ZUSA 2D0HA 1AGFB 4P46D 4L8DB 1JNHB 5D93C 4XVUD 3E0GA 2MWCA 1UWGH 3IJYA 4R7DB 5IVOA 5C71A 3CFKB 2AJ3A 4QHNB 1F02I 2VTFA 1JZ7A 2WBJB 4NNPH 5T1MA 3L7FB 5DA4A 4G9FA 1PSKH 2E6PA 3C5SA 2PTVA 4LDOB 4KDTA 4DGVL 5LCVH 5EC1B 4RX4D 2DDQL 3SOBH 3U1SH 3L3KA 2OP4L 2IFFL 3D85D 1HHKB 4GQ9L 4L8SB 3RGVC 5GS1B 4LSRH 1RURL 1AGDA 3JVGA 3TN0D 5F97E 4Z7NE 4HUMB 3JTSB 2G2RB 2MHAB 2CKBB 2O5XL 1C5CH 1M7IA 3RVWD 2J4WL 2ORBL 3V9FA 4C58B 4K8RH 2V2XA 3U30B 2V17L 3DMMD 4HH9B 1I85C 2A0LC 1K4DA 3U2SA 3QFJD 4KZDH 1RZ7L 3KPPA 2DI7A 2F5BH 2XWBA 2DTML 4NHUA 3CFBB 2C1OA 1DE4B 4J8RA 1KPVB 2GTWA 2J6EA 2VLKA 3TCLA 3P4MA 1XEDA 5DJ2A 4LHUA 4M7JH 3JBG7 3QIWC 4XWOC 3U4EB 3S37X 3HA0A 5F96L 1W72H 2UVEA 4AEEA 5TE4L 2HVKA 1S78C 1FBIL 4GAGL 4HZLA 3FB8B 1N26A 2VLRE 4PJXF 5BVPL 1AD0A 1CLZL 3GEWB 2BX5A 3IFNH 3AS0A 5JW4Q 5KVMC 2F53B 4X5WA 1M4KA 5DEGB 3TJEH 3MFFA 1WC7A 1GPOH 3NIGE 4ENED 3KXFE 4D8PB 1RK0B 3RPIB 1CDJA 1JV5A 4P5TC 1G7PA 2BJMH 4ZUVA 4HWEL 4IHOB 4XNYL 4PTTB 4GXVL 1AXSB 5MP6L 3D69B 4IOIB 5DRXB 4F58H 1D5BA 1RUKH 4R90H 5F7KC 2VH5L 2VDKL 1F4HA 1OGAB 3UPCA 4EUPG 3CGTA 2P7TA 2E9WA 4DW2L 4X8JA 3NFNB 2VRAA 4F8QA 3FO9A 3QNYA 3SE9H 3VXPA 1DSFL 1W0VA 5GS0D 5FYKD 3IU4L 5DUBB 4XMLL 2AJXH 1XF5A 4D9QE 1X6NA 2X4SB 2E6JA 4BK5A 1A1MA 3IFPA 4CW1B 4UV7L 4WVRA 4JFDE 2ZCLL 2I07B 4YO0B 4M43L 5BOZG 3B9VA 1FFOA 2FB4L 3L7EA 5FFLA 4TTDD 2IAMC 1CE1H 2XG5A 4M7LH 4PR5A 5HDBE 3B5TA 4M6OH 4OV5A 1BIIB 2VDML 2OJEB 4HS6A 1AH1A 1Z0NA 2NR6D 1F3RB 2E27H 4PJAA 2YA2A 1U3JA 4CN4A 3P4NB 3S35L 2FECL 3TJHD 5TGBA 1YMHB 4WWKA 1KTLA 12E8H 2Z31A 5HHME 4FQCL 5TE7H 1UKTA 3B9KB 3UYOD 3CUPA 5SWSE 1OAZL 3HNTL 4QXTB 4WV1A 5KSAB 1BEYL 1JE6A 3I9GL 3LH2H 3MV7A 4YXKH 4PS4L 4YHLH 1T2QL 5EZLB 1CXHA 4XNMB 4FZ8L 1UB5B 3SDAB 1A6ZB 2ATPA 3I6LE 4XAWL 4K7PL 1J8HD 1NCAL 1KCUH 5C3LD 3MA7A 4Z76B 4K9EH 1WIPA 5DLMH 5L2KB 3H7BB 3OAZK 4G7YH 5FIEA 1FG2A 5E7BA 1U8OA 4TRPL 3BKCL 5JO5B 5L8KB 4R2GB 4PV8B 3MRQA 3O6KH 4G6KL 5HPMB 4AENA 1FHGA 4N1EA 1R5VB 3GSRA 4MQ7B 4ELME 3T1FB 5KSVA 2RCSL 1I7ZA 1EUUA 2IANA 3PGFH 1FCGA 1NJ9A 3MJ7B 4OI7A 4D9LH 4NJ9H 1IAKB 3MLVL 4C56B 2J6EL 2OJZL 3ULVH 3WBDA 3EHBD 1NGWB 1INEL 3IS1X 1B88A 3BIBX 3D2UA 3EAKA 1BGXL 4NHCH 4P9HC 1EMTL 1WBZA 1G0YR 1P5UA 4GRLA 1I3GH 4MCYA 3QIUB 3OR7A 2B2XL 4WFHD 2BY3A 3VGGA 3PL6C 5DJYB 2R29H 4CN6A 3X11A 5GGTA 4PJXA 4ZDHB 3BZFB 1X5LA 1TTGA 3UTSB 4EXKA 5ERWB 3GSVA 2VMFA 4HUXB 5C0ND 43C9B 3RNQB 4Y4KA 2GFBA 4EQ3A 1DTUA 4MJIA 1WT5C 4JHWL 4MDJB 5GSRA 3G6DH 2EDLA 3FOMA 5AZ2H 2HVJA 3DRQA 3PGCA 1IAII 1IGFH 1Q9KA 3TBVA 4APQA 4JFEA 1P53A 1FJ1A 1YC8A 2ICWA 4X7EC 3VXMD 4NO5A 1RIVH 1JWMB 3STLB 4GRWH 1LWRA 3EDDA 3O2VL 2VLJE 3LRGA 4E5XB 1KT2A 4I2XA 15C8H 4I77L 4MA1B 3BE1L 1NUNB 1A3LH 2FZ3B 1UYWL 5IB1B 4GAFB 4KVCH 4QLRA 3VXUE 4FA8A 4IIQA 1OVZA 1WF5A 4WIQA 1OQOA 5EOCH 4OM1L 2J5LB 3TLRA 2OMNA 1LVEA 1SYVB 4LRIA 1D9KB 2NTFB 5I17B 1NL0L 1J7VR 4H26B 4LAJH 4M6NL 4QNPE 4NFDA 3H3BC 1RMFL 4Z7VF 3HCVB 3LQZB 3KYNA 4N1HB 3ULSB 1UXSB 4AEIH 5BMFH 4NN5C 4KMTH 3MV9D 2VL5A 1FNGA 5DI8A 3H3PL 5J11C 4Y0GA 1E4WL 1WZLA 5FA4A 1JNJA 2R2EA 1NC4A 4YFLI 3ZHDA 4EN3C 1FYTD 2X4PB 5EOQL 1R24A 4Z7WE 3T3PF 4YHPA 2ZCHH 4LKCB 3P30L 1YEGH 5FYLD 3T8XA 3N1GC 1SJEB 4HULB 5C8JB 1KFAH 4N5UA 1RAMA 4AIXA 4WDIA 4L4VB 4DZBB 3E2HB 3AB0C 4R8WL 1IMHC 3GNMH 2VITA 4P5MB 4Q58C 1F5WA 5CZXC 2R1WB 5BJTA 3TBWA 2PW1A 5E2VH 2ZSWB 3SDYL 1S9WB 3MRGB 3QEQA 3IFOA 4QWWC 3Q6GH 1F6AA 3RHWF 2P5ED 5C3TA 1MCOH 4WI8A 2NY5C 1DQDL 4NOFA 4Y2DD 5IB4B 2P42B 2ZPKH 3MLWL 1C7TA 3MROB 4WY7H 3CX5J 1BD2A 1SVCP 2NZ9D 1DFBL 4GBXA 1MIEH 4U0RB 1NEUA 3IDXH 1UCBL 4S11A 2JELH 1FLRH 3O3DB 5TH2A 1I1FA 1RJYB 3NFPB 5GGTL 1H3TA 4LMQI 2F74A 4U4BA 1RZJC 4JQIL 5IK3A 3QULB 1FSKC 3BP5B 4PB9L 1SEQL 5D9SB 3QP3A 2ADFL 4LSPH 3EFDL 5I8OL 5JA9A 1X4XA 4WGVB 1EHLL 5BO1H 3HR5B 3QIBB 4H20L 1QSFA 4HK0B 5IFJA 4LP5A 2AEWA 4NYLA 5I30H 1IAOA 3OJDA 1A5FL 3DV4A 1FRGH 3I50H 4WU7A 5T3ZH 3EDKA 3KPRE 2DLFH 5DRWB 5I9QC 4RDQF 1T21B 3GMLA 4OLXL 5CGYD 3GI8H 5AYUL 3W0WD 5I71B 3HC0A 1ZLUK 4G3YH 3L3OB 5GRJH 3NTCL 4GW5A 4PRHD 5ENWA 5CJXA 1HXYB 4JO3H 3MBEB 3RX7A 1XGQB 4HKBB 2W60B 2XG4A 2XKNA 3DXAD 1ACYL 3UZQA 5C0AB 3BGAA 5E2UL 4DQOL 2VJXA 1ZA3A 4EI6B 4I13B 1Z9LA 4H1LH 2QQKH 5HI5C 1YEIH 1UZ6E 3NCYP 4Q0XH 4L3EA 3KS0H 3SDDD 5C09D 4FQJL 3EOAA 5GHWH 4OZIA 1YC7A 4PJ5A 1NMAL 3U6RA 4I3SL 4HMCA 1DLHA 3VRIA 4C55A 5TDPA 3L1OH 1H5BC 3RVVD 4IS6B 3D3VB 3UPRA 3LDBC 4ODWA 5FB8A 3DLQR 4QHLB 4GKSB 4JM2F 4YXLL 4XPFH 4BKLA 3VGDA 1QOKA 4K71B 4Z7VA 1QKZH 4ZG1A 2VAJA 5LQBL 3MODL 2HN7A 3V4UH 2AQ2A 5I75B 1ZWIA 4JO2L 4NQCA 2H8PA 3GRWA 2D4FA 3C6LC 3TBYA 4X99A 4P3DB 5D7LA 5AUMB 1T1WB 3EYOA 3VRJA 1MJ8L 1IE5A 4FXLA 5DD6B 3RA7L 2YWYA 1J0HA 5AG9A 1ZS8A 1IGTA 4J3WA 3HE6D 2VLKE 4R9HA 4X98B 3ZDZF 3PJSA 3FT2A 1GGIH 4ODXB 2V2WA 3PG2A 1Q9LB 1Z9SA 3C8KA 3U0PB 1ZLVK 4RFEA 5F71A 4NKQB 5CP7A 4WI9A 5E8NB 4FFVD 1RZGA 4PJBF 4DVRL 3NCEB 2CUIA 1CD1B 1UB6A 5HYSB 3QQ3B 4WI2A 3WNNA 4O5LL 4Z6AT 2R0KH 4ORGA 3IDUA 4M5YL 4I5BA 4DKDC 3B2UC 5T1LA 1JYWA 3N1MC 4KJWD 5I1DA 1A7RH 1X5IA 2DYPA 5MEND 4KUCF 3ULUD 2HG5A 5FEBA 1WBXB 2QKIB 2EE3A 1BIHA 5B39A 3V6OA 3GMQB 3WHE0 2AGJH 2A6IA 4NZUL 1CFVH 3QDJA 4TNWK 3S88L 3TO2A 1D5ZB 3KG5A 5D93B 1MFDL 3DROB 1VPOH 4P9HH 1F6LL 5FKAB 4J1UB 3S3JA 1BVZA 4UIMB 1A22B 1GC1L 3W2DH 4ODSH 5C6WH 3PQYB 1LP9B 4WJ5A 3WLBA 5KG9B 5K9JL 5FF6B 3V6FA 1MAML 4L8CA 4ZNEA 4M1CC 4LARH 3UX9B 5CMAB 4X4ME 1IM9A 4PV9A 2HWZL 2BSSB 1DQML 1J86A 2NLJA 3B8YA 1JPSL 3FB5B 4CVXA 5CJ5A 3HI1A 3GMMA 4JGUA 2EKJA 1BF2A 1WCBA 3QQ4A 2BVPA 4PJAE 3I02A 5E8EA 4GG6E 4IBLT 2R0LH 3LKNB 3ILQC 3G6AA 3ZE0E 5DQDL 5HI4D 2IBGA 2ADJA 2IBZX 3ME0A 4M7KL 3OAUH 1MCKA 3PHOA 4G9FB 5FA3B 4WRLA 3E6FA 4PLNC 1YN7A 4DKEL 4IRJA 1U8MA 5GRUL 4MXWH 4OF3A 3X12A 4JB9L 1T7ZA 1J1OL 3JUYA 1EO8H 5MEPA 3MV7E 2AK1H 1EJ6A 2P43B 4F3FB 4P23C 3CVIH 3QIWB 2BNRB 3P4OB 1FG9C 3B3IB 4IRZL 3K74B 3NZ8A 4OZGB 1NFIB 2XFXB 3QB7C 4BFIB 4OF5A 3AU1B 3L95B 1IGIL 3L3JB 4P4RA 4C4KT 3GRWL 1KPRA 3EZJB 1HHGB 1CVRA 3KPPB 2XZAL 2YSSB 1B2WL 3LKSA 1G9MC 4JM2A 1BZ7A 5BW7A 5C08E 1HKLH 2D7QA 1H3UA 5EU6B 2G60H 2VZTA 5J1TC 3T4YA 1EFQA 1EHXA 2JK5A 3BP7A 3IF1A 1QACA 5C9JA 5DD0H 2Q6WA 2Y72A 1G1CA 1OAQH 1KTKE 3HE7A 3PWPA 1AHWB 4RWHA 1FGVH 1OD7A 1FV1A 1GZQB 1HDMA 1NDMA 5EDXA 2R1XA 4H8WC 2DQDL 1NCDH 1MHCA 2DKUA 4XXCA 2VXTH 4UNTA 2NY2B 4JZNB 2AI0H 3OX8A 3C60C 4X5WB 3LHPL 4BUGA 1S7UA 1WC7B 4KUZH 4NFCA 1EEZA 2NY3D 1OTSD 1JV5B 5HVHB 3BQUA 2LU4A 1FDLL 5FYJU 5D7SL 1F58H 3HS0B 5CINL 4ZUVB 1VACB 5EWIL 4PUBL 4PJBA 4GMSH 3C5ZC 3BMVA 3S4SA 5F7LB 5C0JA 3BH9B 3NAAH 4M62L 2IAMB 2FJFA 3OKKB 4WO4D 4X8JB 1DANT 4MJIE 5I2IA 1YYLH 1PY4A 4YHZL 4DN4L 2NY5H 4YBLC 3MREA 4JFEE 2DQTL 4LRNH 1AO7E 1TVDA 4WFGD 4LSQH 5CD5D 3QDHA 1XF5B 3HAEB 1T1XA 2WQ8A 5D6DC 3HZVA 2D03H 3N1QC 2UYLA 4WHTA 2EE6A 3QEUA 1HILA 4FXGA 1MPAH 1RZJH 4XPBH 3PWLA 5BV7L 3ZMRA 3VFMA 4PR5B 4A6YB 4U1HB 4LIQE 2AEQL 3MUGA 4KHXL 2Q3AA 3EO0A 4FQXC 4KK9C 4HS6B 2W0PA 3QJFB 1BM3L 3ARYA 4OI9A 5JW4M 5AAWA 35C8L 2D31B 2ENYA 5L2JB 1SYSB 3CK0L 1A14H 1F4XL 1KTLB 2DQUL 1FZMA 1HN1A 2VN4A 4LEOA 5EOCJ 2YHGA 3M1BB 4WHCA 4Y5YA 5CWSA 3CUPB 5CJQL 1JWSB 5L9DH 4U7KA 3O3BA 4YDVA 5ESAB 4XNXH 5IESL 4JDVA 5GGRY 1YNTA 3NIFF 3ARDD 4K23H 1KIPA 1EZVY 3MBXL 3NABL 1JI1A 3QG6B 4CJ0A 2ESVD 2D9CA 1OAUL 4RGNC 2FYYB 1RK1B 3O6FB 3EOYG 3ULVF 3MA7B 2J7LA 1I8MA 1L7IL 5I8EB 3RWIA 4JFFA 4H0GA 2AV7A 4CU8A 5IIEA 3V5KA 1ZLSL 3SO3B 3TFKC 3C09C 4N0UE 4OZ4B 1JPGA 2AJSL 3JV4B 5DJDB 1IQWH 1CK0H 2DLEA 1I7ZB 4UT7H 5GGQL 5EZOH 3ZZ1A 4FQ2L 5GZNC 1CE6A 3T0VA 3O3EA 4Y16D 3O8XC 1KLGA 1R3HA 2PW2A 1CLOL 3OB0H 2R2BA 3RAJL 1W72A 1BZ9B 2HMIC 3G5YA 1F97A 4LASH 1CGUA 4S1QH 2EDKA 3T0EC 5I66A 3GUTA 4AG4L 1IBGH 2CK0H 2EKSB 2R9HD 1LEKA 1T20B 2VLME 5ANMA 2XY1A 5HD8C 4UBDC 4DK3A 2YD1A 3AY4C 5K59F 3I3DA 4Z8FH 4Y5XC 4PY7A 3QUXD 5JHDD 4S1DD 2A9NH 1KCRL 4YUEH 3VFVB 4P9ML 4MNQA 4XPAL 3VA2C 3KPNB 1NGPL 4GRWF 2EYRA 4Z5RA 4E0RB 3MRBB 4HQQH 3VFPA 3ECBA 2BVUA 3WHE1 1I3RA 1DLFL 3BGFB 4D3CL 4F37K 4OCLC 5GSRB 3Q48A 3BOVA 5T5NF 2HVJB 5D1ZC 2CIIA 5E9DB 1Q9KB 1LK3L 5F88A 5D1XD 4BK4A 1GH7A 4ZAKA 4NO5B 1U8IA 4MJ5A 3VXRD 5C7XH 4KI5D 4KXZH 1X5JA 5SWZB 2Y4SA 1MJUL 2DIBA 3DX6A 2WIMA 5FYLH 4YFLF 1FZOA 1RHHB 4PJHF 4X6CA 3UTPE 3BT2H 3HNSH 3OF6D 2DQFB 5J11B 4R4NC 2DBLL 5F7MC 4RNRB 4HLJA 1ROWA 4KXZI 4KROB 3ARFB 1UWGL 3SQBA 1U3HC 1UM5H 2VQ1A 4U6TA 1JP5A 3IETA 3V79C 1H15B 3MMEB 1XGYH 4OUUB 4NNPL 2CXGA 2XWTA 1P4BH 1PSKL 3M45A 5DJ8B 1NAMH 5LCVL 3NPSC 4PLKD 4P4KB 3SOBL 3U1SL 1FNGB 4F7EA 5DI8B 1M7XA 4XWGH 1PKQB 2XTJB 1CFBA 3BN3B 4NWUH 1IL1A 4LSRL 3LKRA 4N5ED 4M4RA 3KS0J 1FLTX 2OL3B 2WANA 5JIKA 3PIQB 1C5CL 2KZ1B 4Z7VE 3HFMH 2IADA 4OCRH 4WDIB 3GO1H 2WP3T 4XB8A 2ADGA 4NQCE 2YRPA 4OCSL 1K4CA 4M4PA 1A7BA 3OKLB 4S1SH 2F5BL 1QG3A 3ARBA 2OXGA 5D7LE 2CRIA 1XIWC 3T3PE 5ICXA 2PW1B 2IPTH 3MV8A 4QGTA 3W11D 3MYJA 3WFBH 3QUZA 4GW4A 1FL3A 3BZ4B 2UWEF 3O3UN 3S37H 4M7JL 1Z0MA 3OZ9H 2EZ0D 3QEQB 4XVTL 5DK2B 2MQ0A 4XP4L 1W72L 1F6AB 4XRCB 2H1PH 1FE8H 4OLWH 4LFHD 2I9TA 1YYMH 5JZ7D 3IFNL 4Q9RH 3SHSA 1FZKA 1E6JH 4QRPB 3UTTD 3RBGA 3TJEL 1GPOL 1CDCA 4JGJA 2XZCH 3NCJH 2W0FA 2M8XA 3FO0H 2BJML 5I9QB 1BWWA 5TH2B 1I1FB 1TCRB 5JXEA 1L0QA 2ITDB 4FOMA 4L1HA 1G9MH 2GAZA 3SJVB 3BEVB 4YEFA 2DM7A 5E99L 3V6OE 1VEMA 1Y6MR 4LNRA 5ID0A 4QRTB 3H42H 4LPXA 2E9JA 2X89A 3SE9L 4E41E 2AJYH 1P4LB 3QDJE 5IVNA 1QSFB 4RWYH 5GRXG 4XPGH 2PYEA 4NYLB 4LCUB 3CSBA 4JN2B 3DV4B 4MZ2A 2NPLX 3PUCA 4H8WH 4MSWB 2AJXL 3MRMA 3GGWA 5D4QA 4X4YA 4M6AA 3GMLB 1NCBH 4LCWB 4MCZB 5IKCB 3LKPA 3KJ6H 1QD0A 2RAMA 5T1KD 2JJWA 4V1DA 4G8EA 4WW2F 5GS3A 1QRKA 3DVGA 2Q7YB 1CE1L 1FL5A 2DJSA 4EVNB 3RJDA 3V8CA 1MHHA 4M6OL 4RA3A 2XNAA 1U8HA 2XKNB 5CEXA 1JTOA 5DS8B 3TIEB 5JA8B 1KN4H 2E27L 2XQYK 1XF1A 2HT2C 4NPYA 1M71B 4PJHA 4FN0A 2HAZA 2AERT 2GK0A 5C0IB 2GW5A 4R96B 5LGKA 12E8L 1YEEH 1YNLH 5F7UA 3EOAB 2EC8A 4HUVA 2MNUA 5CBEB 4OZIB 1KPUA 3LEXA 4PJ5B 3N0PB 3LH2L 3DO7B 1EGJH 4YXKL 1NLBH 3G04B 1ADQH 4YHLL 2EEAA 1Z2KA 4Z7UB 5JXAH 4QCIA 1KJVA 1I4FA 1JJUA 4ODUA 1L6XA 4F15B 4OAWA 3MJGX 4D0BA 5DJCA 2Y1VA 3RPKA 1CXLA 1OGAE 1KCUL 1A1NA 4FQIH 4K9EL 5DLML 4G7YL 5FCUH 2HN7B 5EUKB 2RJMA 3VWJC 4ELKA 2HP4A 3MZTA 4N9OB 3TVMC 3D39D 2P8PA 1T0NB 3RGHA 3ELAT 1MVUA 4PGJA 5D7JC 4X99B 1RSFA 2QSCH 2C3XA 4ERSH 3WJLA 1LD9A 5FM5O 4D9LL 4NJ9L 1NBQA 1C12B 4EKXA 4XMKH 4FHBD 4YXHH 1HWHB 3ULVL 1QO3B 1CFSB 1ZS8B 1KJMB 3AXLA 2FX8H 2YPLB 3FT2B 4LGRB 2VZSA 4HJ0D 4NHCL 3RGVA 3WUWB 1I8KB 3QZWG 4KZEH 3BP6A 3LD8C 3PWPE 1I3GL 1BOGA 3RTQD 1IEAA 4OM0H 3K8LA 3KYMA 4RRPA 1RZ8A 5GS2H 1KB9K 1WZKA 3F7QA 1IAIM 4OLUH 4ZS6C 2VXSL 4DZ8A 3VXNA 4HLZG 4JZJB 4PJ9D 4XCFH 3JWDL 4ORGB 3ZDZE 1I85A 2NQCA 2R29L 3A0OA 1NDGA 5D71H 1LEIB 3NMEA 5T1LB 2YZ8A 4FNLL 3O6LH 3MJ8A 4HIHA 5ISZA 2HG5B 2R2CA 3FT3A 4L29A 1F3JB 4QHKJ 5IMKA 3B83A 4PJBE 1BECA 3IKCA 5BZWA 3G6DL 5AZ2L 1KIRB 2FGWH 3EFFA 5E6IA 5DD1H 2AJVH 2DLGA 5I6XC 1DVFA 1IGFL 1REIA 3FRPG 2W65B 3VXQB 5L2KE 1CICD 4K3JH 4RIRA 1RIVL 1NBYA 3I75A 4URTB 1A6UH 1Y18A 3ZHLA 3OKNB 1I1AA 1TETH 2CLRA 1CFQA 4PD4K 15C8L 3S6CA 3TZVC 4ONGH 4TNVF 3WIFA 3BJLA 5FOBA 1NGXB 1A3LL 4NQDB 4P5TA 5DEFB 2VLRD 4KVCL 4LBEB 4V2CB 4E9LA 3OWEA 4C56E 1YEDB 1G0DA 5EOCL 5BV7B 3VH8A 3KXFD 2CQVA 4JAMA 2R0WH 4H1LA 2KL6A 4JPKH 3IRZA 2UZYB 4WW2A 5A16A 5JDJA 4LGSB 4U1NA 2HH0H 4MHHG 1CGTA 1GGUA 4KMTL 3FQTA 3TA3D 2YWZA 3U83A 4OKDA 3KWWA 4NC1C 2CD0A 4XZUA 4ZQKB 3I6KA 5HYQA 4P2RA 5F8QC 1X5HA 4Y4HD 1QSEA 3AMLA 4N0RA 5F72S 4OFDA 2ZCHL 1GAFH 2DS4A 1YEGL 2CIKB 2YUZA 1S7XB 4MDIB 4XTRD 5D7KE 4ZFGH 5H35B 4BQ8A 4O58L 3HG1B 4UB0H 4D9QD 3F7YB 4LLUA 2M2DA 4HW6A 4RFOH 3GNML 5IM7A 1UFUA 1SBSL 2OTWB 3PF2A 4J6RH 2R1YB 5E2VL 1CGSH 1XF4B 1TLKA 4NQSA 3SCMD 4LVHB 3ZKND 1ND0B 4ZODA 3Q6GL 3QDMD 3T4YB 3IF1B 4ZXBC 2YK1H 3RY5A 2AQ1A 1ZHNB 3NPZB 3D9AH 2Q6WB 1MCOL 5E24E 2EDXA 3V95A 5HY9A 1UH4A 4KQ4H 2ZPKL 4FP8H 4Y7MA 5HHMD 1JVKA 1X5AA 2GSGB 4XBGA 1HDMB 3FQNA 4WY7L 3R8BB 1J1PH 2C4FT 2BSRA 2W0LA 5SWSD 1MIEL 4NO0B 5ANME 3IDXL 5IG7A 1G6RH 3U9UA 4JVWA 1DEEA 1NC2D 2JELL 1QLRA 4KK8C 1FLRL 2R23B 4CVWA 3V5DB 1JZ8A 1CQKA 3BO8A 4P46A 1UWXK 3F7VA 5KSBF 4H5SB 5E8DH 2VISB 1U0QA 3I6LD 4LSDA 4MNGB 1R5WA 4LSPL 4MNQE 3IGAB 3OKDB 4HMEA 3QH3B 1T7XA 2DQHH 1NCNA 2IG2L 1U8PA 3GKWH 2BNUA 2EECA 4ZNCD 1HXMA 1U95B 5TF1H 5KZCD 5CZVL 3IDNA 4JPIA 4RX4A 5I30L 5GGSA 3I50L 3GIVB 5T3ZL 2DLFL 2DMCA 2HLFC 2J3SA 3FQXB 5EU3A 5JQHC 3HHRB 4XGZB 4Y4FD 3TN0A 2BVEA 1U92A 1GYAA 5HI3D 1U8QA 3GI8L 1VSCA 3IT8D 4P59H 2BHYA 4R0LA 1T1XB 4U1MA 4G3YL 1HQRB 3PL6A 5GRJL 3U46B 1DR9A 4L8BA 3T09A 1K8DA 4RMRA 5IBLD 1HILB 4JO3L 5J57B 4FMFA 3PDOA 3GSXA 3VFMB 2IALA 1DZBA 5ALBH 4GRMA 3MNZB 1JGEB 3MUGB 4PP1D 1WT5A 1WFOA 4GS7B 4KK6C 2QQKL 1M05A 4GLRI 3RIAF 2NY1C 1YEIL 2Q8BH 4Q0XL 5A2JH 3UROR 4D0CB 2FHFA 1ITBB 5GHWL 4I0PB 2M26A 3S3SA 4YDJB 1PG7W 2GT9A 4LEOB 5DVKA 2YD4A 1N6QH 2DTSA 4Z7OF 2WUBL 4PG9B 4ZPVA 4DK6A 3C09B 1IC5H 5F70A 3L1OL 2GITA 3BKYH 1ZVSA 1NGYB 4NRXB 1KIPB 4JKKA 4XPFL 4IDLA 3DOSA 1QKZL 5E4IA 3D6GA 3OKMA 4HIJB 2VLJD 1A8JH 3C9NA 1S7TB 2VDPL 2WWKT 3RWIB 3AM8C 1JPST 4KJPD 3O45A 3NIFE 1EO7A 2W9EL 5A1AA 1MCDA 1FAIH 4FG6D 4OQTH 4X7SH 1OTTD 1R3LA 5IQ9B 1U58B 1XGUB 3ULVE 1KLGB 4X0KA 1N7MH 1GGIL 2WSKA 2Y6SD 2J8UB 3QWRD 3C08H 2X4RA 3DYOA 3NGBC 4PJGB 1FCCA 3L3DB 3QNZA 2I27N 4JY6B 3SDCB 2G9HB 5DJ6A 2FLRT 3KLAA 1LEKB 2HJKA 5GGVL 2EDHA 3EOBB 3FT4B 5EIVA 1YPZF 2R0KL 1NFDB 3SGEH 4G43B 4ZSOA 7FABH 4G8FB 3KPSA 1WBYB 1A7RL 4DAGH 3MNWA 1CT8B 3WN5A 5GS0C 3CH1B 5FGBC 5I8KH 2AGJL 5E7FA 2D0FA 4PJ8B 4Z5RB 4PRDA 2BDNH 1GXEA 3ECBB 1CFVL 1BHGA 1MCIA 1S9YA 1BLNB 4MD0A 5C0BE 3SGEI 2DKSA 1Y6NR 5K59E 2AK4E 5KSBA 2IMNA 1VPOL 4P9HL 3MRIA 5EBMA 4N9GB 1L4IA 3RDTD 1U8LA 1YEFH 1R3JB 4A2MA 1I3UA 2QL1A 3W2DL 4GRWE 4PJIF 4E42B 1RUMH 2ZCKH 3BDXA 4XHQA 5J3HC 3WFCH 4DKFH 1J8HA 1MF2L 1VCAA 1F45A 1M6OA 3MGTA 4LARL 3W9EA 4J3UA 4DFHA 1P6AB 2B39A 3C2AH 3AS3A 3BRFA 4HWZB 3U7YL 3I6GA 5EU4A 1QLFA 1TZHB 4I18A 2YEZB 1WWCA 3VCLA 1BFOB 1IKFH 5HXMA 5A3ID 4PFEA 3DETC 2P24A 3S8WA 3S97C 1NFKA 2R0LL 3LV3A 4ZFOB 3V4PL 4R97C 4PJHE 2FEEI 2XWTB 3H9SB 1VEOA 3O9WC 3EO1A 4EUPH 1P69B 3SKMB 4HXAH 5GSVA 1K6QH 1T1ZB 2DQIL 5IEHA 2HFFB 1XIWB 1G7MB 2AABH 1EO8L 3UDWC 2AK1L 2BVYA 1SMOA 2NXZB 3V7AG 5DVMA 3VE0B 3WSQH 5ETUB 3CVIL 3P0YH 5EFIB 5F9DC 3GBLA 1QFWI 2ICES 5D5MF 3MV11 1CXFA 1AP2A 3KPRD 4MXQD 1XGPB 3S98A 1GIGH 5EPMA 1HSAA 2IADB 1AQDB 3EUUA 4JG1H 2FDBP 1CXKA 4HJGA 4MX7A 4QTIH 3U7WL 2R0ZL 1FIGH 5BZDA 2ZOLB 5LAXB 2JB6B 4G6FB 1HKLL 4JFPA 2NY6C 3MV8B 3SGJC 2X4OA 3FOLA 1UJTA 2G60L 3E6HB 3QUZB 1G84A 3P11H 5B8CC 5EU5B 4LDEB 2X1OA 3VXMA 3ZE2F 1W0WA 5EBLA 3BDBA 1OAQL 1H5BA 4X5XA 3PWVB 3CJJA 1WWBX 1EAPA 1FGVL 3N50A 4X6DF 1BX2A 3REWA 3K2MC 5MEOB 1IEBA 3CU7A 1O7VA 3FRUB 2FH6A 4TTGA 3WS6A 2HTLD 2E9IA 5DF0A 3BKMH 2AI0L 3BX7C 4FTVB 5FYJH 4IEFB 5T33H 4XC1H 5EIIA 4KUZL 3LZFH 2GEEA 3BN9D 3RZWA 2UWEE 4N0YH 1A1OB 1OWRM 5H37H 3V0WH 1D5MA 2VABA 1F58L 3C6LA 3H9YA 4K3GA 4XPTH 3JV6B 2G5RA 4WW1B 3OJMB 1P4IH 2GAZB 1KIQA 3G6JA 3GBNH 4GMSL 4HGWA 4L9DA 3WDHA 3BH8B 3HPJA 2PCPA 3NAAL 4RGMB 3EDJA 5BRZE 1YPZA 2ARWA 4YFDB 1YYLL 2PNDA 3V5HA 2BZDA 2NY5L 4ZFZA 2CDFB 3MX0A 1UM6H 1LK2A 1MRFH 1MFBH 2PYEB 4OZGE 4PB0H 4M93C 2WWMD 1FYTA 2AKRA 5I73C 2Q86A 4LRNL 1A7OL 2HTKD 5HYIA 4LSQL 3DRTA 1FIEA 2VLKD 4PJ7B 4LHUD 5IVZA 5E08H 4EEEA 2HT4C 3EYUH 2D03L 3H9ZA 4V1DB 1MPAL 3R8QA 1KXVC 1RZJL 4XPBL 5EU6E 1EVTC 4BSWB 2UUDH 4IMKA 1VENA 4OT1L 1ZHKB 2VDRH 1MHHB 1SJHA 2PTUA 4MJ2A 2XNAB 4LSSH 4PJIA 3QEGH 5E5MB 3REVA 1XZ0A 3CFEB 4JHAL 4Y2OA 2VNCA 1B3JA 4M00A 4CVZA 1A14L 5JW5B 1KULA 4Q74A 5LGJA 1FFPA 3EYQD 5GISL 4HUVB 1NAMA 3WE6A 1T7WA 3MLYH 2F54A 4MQSB 1Q94A 5L9DL 1YEHH 4Y2DA 3E8UH 1ZAGA 4XNXL 3IDJB 2VWEC 2YRLA 2C3VA 4K23L 3BZDA 4P2RE 1KLFA 1KJVB 1WWWX 3MOAL 4ODUB 4OAWB 1KXTB 4D0BB 5DJCB 4KH2A 5BXFA 3GJFB 3HC3H 3TO4B 3LD8B 4PP2B 4ELKB 4EQ2A 5D2NC 3DARA 1J1XH 5F9JA 5JLZB 2FEDC 1R3KA 1A64A 1E27A 1IQWL 1CK0L 4UT7L 1TVHB 2PYFB 5D5MA 5EZOL 1OAXH 1L7TL 5FDWB 1GHFH 4MZ3A 5I1JH 5JUEH 4WU5A 4PRIA 2E7LC 1P6FA 3WUZA 3MRLB 4UDUB 2Q76B 1T66D 4X4XB 4HWUA 4R26L 3NN8B 1C5BH 4S1QL 4FABH 3T0BA 5EH1A 4U3XA 5F21B 5D1QA 2N7BA 3PP3H 3SDXF 3BP6B 1IBGL 2CK0L 4QF1A 5DGQA 2Z31D 4UINH 1YUHA 1D5XB 3KYMB 1WTGT 2OCFD 3KYOA 4B0MM 4EI5C 3MC0A 5DSCB 1MHPH 4Z8FL 4MYWB 2W0KA 5EUOF 3MV7D 2A9NL 2VE6A 4YUEL 4X6DA 4N8VA 2UV3A 3TZVB 5E5RB 1QFOA 4HIHB 5ISZB 1A7PL 3UO1H 3FN3A 3LN5A 2OI9B 3HZKB 2X70A 3QWOA 4HQQL 3VFWA 1ZTXL 3ZDYF 5IMKB 5C09A 3FO2A 1WUNT 4HDIA 5CGYC 1T0PB 5CZKA 5CKGA 1XCQA 3X17A 4PGBA 3G5VB 4QOKB 5E6IB 4NUJA 2QLVB 5HYSG 4Z0XA 5C08D 1VA9A 1UJ3A 1YJDC 2PO6B 5DJAB 2IAND 5C7XL 3C60A 3OR6A 5DFTA 3O81A 2DQGH 1I1AB 2AVGA 2CLRB 5FYLL 1FZJB 1WQVT 1VADA 3EYVB 2DICA 3BT2L 3HNSL 4CBPA 4TVPE 4YAQA 1S5IH 3WEXA 3D2UD 5T3XH 4CDHA 1JHKH 4O51B 3CFJA 4GRLD 1OT1A 3KPMA 1MIMH 4KGLA 5C0FA 2EDDA 1I7RA 1UM5L 2VERN 4XCEA 1NSNH 1V7NH 5F89B 1JGLL 4MWFA 3RVVC 1XGYL 4P2QB 43CAB 1PEWA 1SM3H 3T3MF 4HUNB 3HE6A 1P4BL 3BYTA 2F9BT 2XTLA 5CHNB 4LEXH 4UQ2A 1K2DB 3LRHA 1NAML 1UCTA 1CL7H 1R0AH 3MJ6A 2BNQB 1U8NA 3FQTB 5E94A 5EBGA 1EGJA 1J0YA 2H26B 1A4KA 3S3PA 4XWGL 1ADQA 4Y4KD 1QSZA 4OJFH 3GMPA 4MJID 5HYQB 3HTLX 1HH9A 4NRYA 2C4XA 3NFSH 2WV3A 4NNYA 5HYJE 4APQD 1N5AB 1AD9A 4JFED 1CL7I 3HFML 5HHOB 4OCRL 1HSBA 3OKEB 1AKJA 3GO1L 1PFCA 1G7JB 3QI9B 5DVLA 2C7UA 4NN7B 1Z5LB 5H2BB 4LLUB 3S96A 1F42A 4FQXA 3BYYA 1H0DA 4S1SL 4TSAL 3F5WA 3RL2A 5CAYB 2FWOB 4O4YL 4X9BA 3VXTB 2IPTL 3MACH 3LKOB 3RIFK 2NY0C 3WFBL 4KHTH 4NSKA 2X10A 1JBJA 4ONFH 4FFVC 4AT6B 5C0RH 3S37L 1DN2A 4KRPC 3T65B 3OZ9L 2H1PL 1FE8L 2PTTA 4OLWL 1VFBA 4P2OB 3WCYA 1JPTH 5B38A 4Q9RL 4MVBD 2HA1A 4UDTA 1ZGLA 1DQQB 3ULUC 4NKOA 3AAZB 1E6JL 3FQNB 4OD3H 2DWDB 3K1DA 3PABB 4MAYB 3NCJL 1JRHL 5IG7B 3FO0L 4DUXA 3JTTA 4WGWB 1OWWA 3DIFB 1NC4D 2Z4QB 1KC5H 4BELD 4P46B 3T2NH 4ZSOE 1MCPL 3ZSSA 3V8OA 3WDIA 1G9ML 3KPSE 3SDXA 4JY5H 2P5WE 4LKXA 3CCHB 2PXYD 2VOTA 3UP1A 1KG0A 2Y5EA 4JJ5B 3TNNB 3FZUD 1A2YA 3O8XA 3RWCB 1KCSH 5DJXA 3M17A 1A6PA 2A73A 3H42L 1OAKH 3OXRB 1DBKH 2AJYL 5J13B 3IDNB 4RWYL 4JPIB 4XPGL 4IM8A 1ES0A 4DGIL 3K80A 3T0EA 3WLWC 1QFPA 5DT1H 3DTXA 3D85B 2NY1B 5E8PA 3VDCA 1YY8A 5EU3B 4KVNH 3TN0B 1GZPB 3KJ6L 3TWCH 4JDTH 2UVFA 2B1HH 3AY4A 4Y5XA 4U1MB 4HH8A 1K8DB 3BZEA 3KR3H 3ROOA 3UPAA 3DMMB 3O11A 3H2WA 2VLMD 3QFJB 1BQLH 4OV6F 3GSXB 2IALB 4M9OA 5E1AA 1KN4L 4HKZA 4GBXD 4KRLB 1B0RB 4UIKH 1CFNA 3MRDA 1RZKC 1YEEL 1YNLL 4RGOH 2FX9H 3VFSA 3HAEG 2A6KA 1QEWB 3UZEA 3QHFL 3E3QC 1EGJL 3KNBA 1NLBL 1ADQL 1HHIA 1A3RH 3BDYH 2EH7H 1ZVSB 5C1MB 1UEYA 2IPKB 2Y06H 1OTUC 3SJVE 4IMLB 3O4OB 3NA4A 5DD5H 5EO9B 2IEPA 4PJEB 2OTUA 2XIDA 4RSVA 1AR1D 4FQIL 3RNKA 4CAGA 5FCUL 2FRGP 1Y6KR 3NGBB 3CDGA 4QEGA 4OD2A 1TVBB 2EH8H 1U3HA 2FHCA 5DZOA 5DK0A 4Z7OE 3QPXH 3DSFH 3RVTC 3B9AA 4X80H 3TBSA 4LSUH 3UTPD 2QSCL 4ERSL 1NANH 3RL1A 1Z9OA 1T1YB 3BWAA 1JNLH 3O0RH 5D6CA 1R3LB 4YXHL 2IWGA 4QRUB 1RHFA 2FX8L 3MR9A 4FQ1H 2ICEB 5DHVH 3SGKA 1CR9H 3QBTB 4KZEL 1ERNA 3N85H 2NY4D 2OR7A 5DJZA 3IDGB 3IDIA 4ZUTA 4OM0L 5IMLA 4X7TA 5DJ6B 3KLAB 1CDIA 4NDMB 2DWEB 1G6RA 4JFYA 5I74C 3CX5K 1FPTH 1P5VA 2BOCA 1KXQE 1G7IA 3HI5L 4XCFL 4LLDA 4WO4C 5D71L 2B4CH 4JKLA 2P44B 4FQHA 4U1GB 1QHPA 4QXGH 3O6LL 3KPOB 1S9VA 1WZ1H 3WN5B 3RWJA 4HHAB 2EYTB 4F57H 4EIZC 1S5HA 1XR9B 3MGAA 3QXDA 4PRDB 1DP0A 1IJ9A 1FNEB 4NQCD 2FGWL 5E5UB 3MLRH 1J0JA 1YPZE 2AJVL 2CKNA 3CNKA 3MRIB 1C1EH 1XGRA 5D7LD 4K3JL 2K7QA 3GSWA 3BIKB 1A6UL 3KPQA 5K9KA 2WBKA 1MLBA 4ZUWB 3STZA 3FHAA 1ED3B 4Q6IB 3VFOB 3VFUB 1TETL 4WHYG 5D7IF 3IAPA 4ONGL 4TUJB 4DUWA 4BZYA 1P7KA 4PPTA 4D0DB 4LLYA 4OGXL 3VU2A 1XH3B 1FC1A 2FJGB 4HS3A 2AXFA 1I9JH 1X6LA 1BFTA 3WJJC 5DWUH 4AH2B 5JOEA 5FK9B 3QEHA 4I18B 2EE2A 1JN6A 1T83A 1XMWA 1PYWA 1MCCA 4DCQA 4B53A 4PJIE 2R0WL 4JPKL 3DUUB 4JREC 1EUTA 5I76A 2JTDA 3LV3B 3WO4C 4ZO9A 1DUZA 3MRRA 5DURD 2VXVH 1XF2A 2HH0L 1DANU 1WK0A 2DYPD 1RV6X 1SY6L 2YKLH 3QUYD 5C0EB 5K9OB 3EO1B 4XX1E 2NW2B 1YJDH 1V3LA 3WIIH 4HG4J 1GOFA 4BH7A 2FBOJ 4OZHB 3DPBA 5L8JB 4E41D 4U6XB 3QDJD 5DMYA 1GAFL 1IGYA 4ZFGL 4XBPB 5ACMA 1VFAA 1OL0A 5DO2D 3SKNB 4FRWA 1IKNA 3G08A 4KKNA 5C6TL 4GAJH 1CGVA 4Y19A 2NNAA 4UB0L 2QQQA 3GB7B 1JK8A 4XC3L 4RFOL 1NLDH 3K0WA 1QR1B 5HDQH 2MQCA 1WIUA 4IRSC 1DQJB 2D2OA 4U6HB 4J6RL 3VMPA 1AXTH 1CGSL 4OQTA 4L1DA 4YDLB 4JY4B 5CIPB 4HPOH 1JZ2A 5D5ME 1INDH 3FOLB 2RGSA 4Z18A 1IZKA 1ZT7B 2YK1L 3DGGA 4PRIE 3QHTC 3VXMB 3D9AL 1T04A 4HV8B 1YA5A 2P49B 1IARB 2B5IB 3D25B 4KQ4L 5F3BB 4FP8L 1PG7X 3QCTH 2L0DA 1J1PL 2OK0H 2VXQH 3HMWH 1TQBC 3VD3A 4W4NA 3KJ4C 5MERB 3UAJC 3VWJA 5TFSH 4IRJD 1V8HA 5KVEL 3TVMA 3R1GH 1MCQA 2EDOA 2VABB 3ZE2E 1A7NH 1CXIA 5E8DL 5D7JA 2AP2A 2DLIA 3U36B 4X6DE 4QRSB 3EDEA 3G6JB 4WNQA 4HGWB 5DRNA 2DQHL 1RFDH 1SEBB 2EC9T 1MNUH 2FATH 3GKWL 2A6JA 1C16B 5TF1L 1A6TB 2JCCF 1OB1A 4F9LC 4MNHB 5GRYA 4AZ8A 1HINH 1J12A 3MV9B 4K3HA 3VFRB 1RZIA 4RMQA 1PQZB 4HCRL 3GSNB 4JM2D 2DI9A 4JE4B 5BVJA 4XNQA 2QADD 2UY7A 2NXYC 5SX4H 2WZPD 1GL4B 2BRRH 3VXSA 4P59L 3SKOA 5CEYA 4X4ZA 1G7HB 4B50A 3BFOA 3VWKC 4YGVA 2LV4A 4G8GB 3MUZ1 1I8IA 2A74B 3L3IB 5TPWH 5J6GA 2BOBB 3HE7D 3PWPD 2IH3A 1KF9B 3JWOC 4Y1AA 2Y25A 5DVNA 5SX4I 2DAVA 5ALBL 1SJHB 1JWUB 2ITCA 3FTGB 1EFXA 3REVB 1U2CA 1XZ0B 3ARGD 2HLAB 3V2AR 3IDMB 1CFTA 2GI7A 3MRKB 1DQLH 4N5EC 2HT3C 1F3DH 3BQUD 1UG9A 1NCWL 4PJCB 5IHZB 4EUPA 1S3KH 5ACZA 4YDIH 3FO1A 3L9RA 3MOBH 1N6QL 5EIQA 1JGDA 2P5EB 2NW3A 3AROA 1IC5L 4L4JA 2Y07H 4G6AD 1K8IA 1N5YL 1AI1H 3NVQA 1LNUB 4C54A 1YMMA 2MCPH 2V7HB 3EYFB 2Z91A 4KUCD 5C9KA 1CS6A 32C2B 4KJYB 4I4WA 5DR5H 3WKMH 3OV6A 5IV2A 1N0XH 5DGRA 4PRAB 2BSTB 5GZOD 5IB3B 5F9JB 1RZKH 5JZ7C 4OQTL 1QRNB 2WBJC 1UH2A 4X7SL 1NBZB 4ETQB 2GHWB 3LQMA 3QO0B 2Y7QA 1F90H 1J0KA 4GSDH 1TQCB 5FO7A 1NPUA 3K7UA 1FL6B 5CSZB 2RFXB 1N7ML 3WL9B 3WFEH 4NC2B 5BS0E 3HRZA 4L8SC 1E4XI 2Z35A 3NCMA 3MRPA 1DDHA 2APTA 3QA3A 3W0WB 1FN4B 2VSDA 4QF1B 3LKQB 4RGNE 4HGKC 3B9EA 3T0AA 5BQ7B 2VKXA 2A83A 1ZHLA 3U30C 4PRHB 4YC2C 4X8XA 2FD6H 7FABL 3VD5A 3QPQD 1ZHBB 3DXAB 4DAGL 4X83A 3HNVH 1QR4A 4ZPTB 5D7KD 4ETYA 2W92A 2VL4A 4H0IA 5I8KL 4WUUE 3SDXE 1R5IA 5HGDA 2CUHA 3GMNA 4HFWB 3RUGF 4M1GH 4G9DB 3QWOB 2X70B 4K8RD 3VFWB 3WUWG 2EDQA 3SDDB 4DTGH 3FO2B 4QRRB 3HLAA 4M61A 4JFFD 5I1EH 5IJVB 4PGBB 5EUOE 2ZUYA 3MCKA 2FX7H 1IZJA 1YEFL 5HGAA 3T0EE 1UJ3B 2OTPA 5F9WB 1RUML 1S7WB 2ZCKL 3WFCL 3SPVA 4DKFL 3N9GH 4DOHE 5BOPA 3CZJA 4IJ3B 5B39G 3QJHB 4JANB 3TM6A 5F6HI 2J8HA 3PHQA 2FEEL 1Q72H 2VYRE 4MMXC 4P99A 4JLRA 2NX5E 3WHXA 5E1HB 4MB4A 1IKFL 5T1DH 1ZANH 4XCEB 1QFWM 4QTHB 4YBQD 4XXDA 3CZFA 3RU8H 3BAEH 3ARED 4LIQH 3S5LB 3T0DA 2AV1A 4XI5D 3U4BH 4MNQD 1CLCA 4UQ2B 4EDWL 4HXAL 1K6QL 1RVFH 2QR0B 1S7QA 3ZKXB 2AABL 1A4KB 3RTQA 5I1AA 3GMPB 3WSQL 5E2WH 3BUYB 3OKYA 1QQDB 1G1YA 1QA9B 5DFVD 3P0YL 1KJ3H 5E6ZA 3D1MC 1UC6A 1QBBA 3MUY1 3T3ME 4OGYH 5I15H 2H9GA 3MCLH 4NNYB 4Z78A 2H2PD 1GIGL 3MRNA 4PREA 4ZAKD 1C7SA 1G7LA 5MENB 3SKUD 1HNGA 2AXGA 2C7UB 1LHZA 4UTAH 1UENA 3CFCH 4QTIL 4JRXB 3PDGA 2Y5TA 4OIIH 3B9KC 4POZD 3TBTA 2H3NA 2D7OA 3P11L 3WFHB 5KS9B 5SWQB 5JNYA 5JW4R 4G42B 4EDXB 1QYGH 4XH2B 3GJFK 1CICA 2RB8A 2CLZB 3PDDA 3X13B 5FUZH 2PTTB 1VFBB 4BSVB 5B38B 1P84J 4UQ3A 1E0OB 1D6EA 3SDAC 2VIRB 5INCB 3MRCA 4JPVH 5DRZB 1JPFA 4ESKA 5T33L 4XC1L 3PP4H 3VFNB 5FO9B 3LZFL 3C5JB 4N0YL 3T4AA 1CTNA 3V0WL 4N68A 3B6SA 4R2GC 2AJZA 4S2SB 5LBSH 2V9TA 4KAQH 5GRVL 4XPTL 5HGBA 3EO9H 2Z8WC 5IEKA 4JZOA 1P4IL 1KTDA 3GBNL 3MXWH 5JDSA 3NACL 4KKLC 2Q87A 1E28A 1XR8B 4WCYH 4OLVH 1VKXB 1FFNA 2APBA 2QQNL 1UM6L 3R0MA 1MFBL 1MRFL 3P4LA 1TFHA 1ES0B 2PETA 3ARBD 3GSQA 4Y4HA 5B21A 3RUGA 5DVOA 5E8PB 3QIUC 2Z92A 3ULVD 5E08L 4W4OC 1N64L 3EYUL 4TUOA 2YC1B 1BBJA 3CPLB 1C5DA 1T5WA 1U9KA 2O93L 4CNIB 3FQRA 3FONB 2VDRL 4HLZH 5E8OB 2JB5H 4JFDA 4NKIL 3TA3C 3QEGL 4ONOA 1KCKA 1N2RA 1OP3H 5E1AB 3HN3A 4HKZB 4YPGA 3SCMA 5T5FH 3KPLB 1WGOA 4OSUH 1U93A 1ZLWH 5TDNB 3VFSB 2P46B 4YH6A 3MLYL 1WAAF 3MLZH 5CJOH 2A6KB 2CK2A 3E8UL 2GSIA 2OLDA 2G75A 4TN9A 1NUGA 2HRPH 4NM4H 5C0BD 4NCC1 2X4NA 2AK4D 2X89D 1U91A 2FL5A 3OBAA 3JZ7A 2OTUB 3KLHC 3I3EA 4X6FA 2NY3B 3JWOH 3RZCA 2GKIA 3RNKB 5F1KC 4AM0A 5J1AB 2J5LC 3HC3L 1QPPA 2Z8SA 4I48B 3WNPA 4Y19E 4R7NA 1D9KC 1UZ8A 1E4JA 3P77A 3EW3B 1G9NC 2IQ9L 4X7FC 1KB5H 3QNXB 1J1XL 4LPTA 1KSRA 5DJ0A 2OX5A 1OAXL 3RL1B 2GY5A 1GHFL 5EC2A 4WO4B 5I1JL 5JUEL 3L6FA 1QBLH 1LEGA 4WI7A 4PJCF 4L4TA 5DMKA 1C5BL 3K46A 1X7QA 2YPKA 4FABL 4HEME 1N4XL 1WFTA 1TNNA 5MHSE 3R06A 1B4RA 3VW3H 3WD5H 3JUZA 4F7MB 4WFEE 5DJZB 3IDIB 4UINL 2EDWA 5IMLB 2Q8AH 1IGJA 2QEJA 1MI5A 1A6WH 1MHPL 3HPLA 4NKMB 3IFLH 3D5OF 3E2HC 4XAKE 4MHHI 4WENB 5IF0A 1U41A 5C0CA 1KUMA 1LE5A 1AIFB 4F7TA 1I1CA 1OGTA 1NCCH 2V5TA 5IVXB 3UO1L 3UCRA 1YEKH 4YX2H 3SGJA 3GSUB 1S5HB 1UQSB 3B5GA 1MLCA 3QXDB 5LWYH 4M8QA 1LE9A 4PBVC 1LO5B 1CZ8H 4K94L 3D0VA 3MPCA 4LCYA 4RAUA 1T4KB 1S8DA 4NWTH 1PX4A 3HUJF 2QQLH 1MLBB 1MUJB 1PY9A 3ARDB 5FGCB 3T77A 2DQGL 5DQJA 3WO4B 3VXOA 2ESVB 2YN5A 1OF2A 3VXSE 4UT9H 1HHHA 2C4FU 2ZSVA 3DUSA 4PP1C 4U0RC 4R6UA 2H2SC 4XPHH 4JRYE 3ZKMC 3FQUB 3DBXA 3BEWB 1S5IL 4K7PY 4N0FA 3AC0A 3RGVD 5T3XL 3GBMH 1JHKL 5ICYA 2OQJA 1MIML 5EO0A 1II4E 4IOSD 1NSNL 1V7NL 2P8LA 3VXUA 2GY7B 2Z93A 1PYWB 4EXPX 2EDEA 5D7IE 4DCQB 5DXWA 2V7NA 2BVOB 3SO5A 1JZ6A 1SM3L 3S36X 5AYQA 2X4QB 3QFDB 2A0LD 3ALPA 4Y16B 2EXYC 5I76B 2LU3A 1RJZB 4LEXL 4X6BA 1X3DA 2WM0A 1XF2B 3RRQA 1R0AL 3OQ3B 3LSOB 1K5NA 1VFUA 4J2XA 5ELIA 2HFEB 5BRZD 1NH6A 4OJFL 1T7VA 3JWNC 3DV6B 1XT5A 4P3WA 5I71C 2HYMA 4YHYC 1F3DJ 3NFSL 3VFTB 1YMME 3V6ZB 9CGTA 1S78D 3BUTA 4WI5A 1DVFD 1A6AA 4WTZG 3QUKA 3VMOA 3VJ6B 1WAAA 3DX7A 3MBEC 3QUXB 5JHDB 3CFDB 1P1ZB 2NNAB 1CQYA 2ZUTA 1FVEA 1P7QA 2C9AA 3O3AA 2QJDA 3IRPX 3KJ4B 4P5TD 5DDHA 4CADA 3C8DA 3MACL 2H41A 1JGUL 4KHTL 3TT1H 3MRHA 4ONFL 5C0RL 2GCYA 1EEYA 8FABA 1IM3B 4WTWA 5IP4A 5F7NC 3Q6FA 1P2CB 5JHLH 4Y88A 5D1XB 4ZYKA 5DHVA 4NC1E 3MUHL 3NOIA 3VXRB 1JPTL 3STBA 3ZSTA 3QXUA 4K71C 4LF3B 4OD3L 4N0CC 2X09A 3WO3B 2YBRA 5EOTB 5FYJE 2A77L 1NMBL 4LLWA 5I75C 3I85A 1HNFA 4HT1H 3MGOB 4XCCH 5H94A 3HC4H 5D2NA 1KC5L 5C0DB 3T2NL 1JF1B 4P2RD 3TYFA 1QSED 4PJFB 4XP6H 4JY5L 2BNQE 1CWVA 1TCMA 1KCVH 5DRNB 2FJHB 4MAUL 1KCSL 4X9IA 4I1NB 4XVSH 2QSVA 1OAKL 5IMOA 1DBKL 2I24N 1AGCA 4N90E 4KDVA 5DHXB 4GKNB 3WFDH 1IGCH 5HHOE 1BQSA 3P9LB 1DUYB 2F5AH 3QR2A 5KN5A 5DT1L 1RZIB 3VG0H 2BSED 1RPQA 2YN3A 3BPLB 5D2LF 4RAHA 5BVJB 2VQUA 5DUPH 4KVNL 1TJIH 2I26N 3BXNB 4POUB 4MS8C 3SKOB 3KPRA 4JDTL 3TWCL 2B1HL 4YR6B 4QRQB 3BMWA 2JCCE 5F6HJ 3IAGC 1I8IB 3QXAA 4P57A 4PRNB 3FB6A 1BQLL 1GGBH 1ETZA 1PZ5B 1OSZA 3BSZL 4IDJH 5J12C 1U8KB 2FO4A 1VDGA 4HUWB 3DWTA 3OGCB 4UIKL 4OQ1A 4U1KA 5IW1A 2V2TA 4RGOL 2FX9L 1J05B 5IR1B 4JO1H 5EBWB 3R4DA 2W9LA 3SE4C 1UXWB 5ACZB 5FECB 3BP4B 1N8ZA 1TITA 3BDYL 2EH7L 3GMOB 1YN6A 4DVBA 3UTTB 2VR4A 5CEZH 2EDFA 5DD5L 2ZUWA 3PV6B 4HPYH 2Z91B 1NAKH 3NCFB 4PGEA 4BM7A 2EH8L 4W68A 2VAAB 2R2HB 5C07A 5J6HA 3QPXL 1TTUA 3DSFL 1WFNA 3EOTL 4P3CH 4H0HB 1VEPA 4X80L 3U0TA 3PL6D 2OM5A 2FSEA 3RFZC 4YC2B 5DYOB 1JNLL 3O0RL 4RZCA 5CKAA 3QG7H 2A6DA 2E7MA 5MEQA 4UV4H 1FVCA 3B4NA 4J23A 3FCTB 2WNGA 1CR9L 1AGEA 2HJLB 4PJDB 4XCYA 5IB5B 4NO2B 3N85L 2WAHA 3MLSH 5C86A 2Z35B 2EEBA 5AD0A 4FXKB 3QA3B 3JVGC 3ZT7A 2I5YH 5T1KB 1RJCA 1EX0A 1MY5A 1FPTL 3WNOA 5I18H 2A83B 2B4CL 3INUH 3OB0K 2VSCA 4QXGL 4LQFH 5IB2B 1WZ1L 1YQVH 4MQXC 1S9KC 5HYJD 2GJZB 2WWMC 4MA7H 5HGDB 3ZT6A 4XBEH 2O61A 3ARRA 1INQA 2UZIH 3MLRL 1JF6A 4RRPG 1MH5B 2XN9B 1AHWC 1YY9C 2ARJQ 5I1LA 1X5XA 4KTEH 1R3IL 4PBWD 2R15A 1D6VH 4UOJA 4MD5B 2NY2C 3RUGE 2ARJB 5F1OB 5HVHC 4EN3D 2ZWLT 1I9JL 2W07A 2IMMA 4NP4H 5DWUL 3TH3T 4JKMA 1J0ZA 3D39B 2Z0BA 5T3XE 5D2LA 3MNVA 4X4MA 4JFQB 3CLFH 3PWNA 4TNWF 1P9MA 4YHOL 1RIUH 4KI1A 3MXVH 2DQCH 1UVQB 2XPGA 2NYYD 1JUFA 2CO6B 5F3HB 2VXVL 4QXUH 1CBVH 5F7YC 4XP5L 1FNSH 3KPSD 1HYRC 2AV1B 1TJGH 4Y5VA 2P5WD 5CZXD 2YKLL 3F7RA 3BKJH 1DN0A 1OW0A 4LPCA 1YJDL 1YZZA 3WIIL 4GG6A 4L3CA 5EORL 5EZIH 1S7QB 2DL9A 4YK4B 3MSPA 3RTQB 4L9LB 5I1AB 4FFWC 1QFHA 1NMCB 2HKFH 4G6MH 4MJ6B 1T0MB 1ZT1B 4U1JB 4JFOB 4OCNC 3BVNB 4MA8H 4PJ9B 1MCHA 5FKPB 1U3YA 4GAJL 1F11B 3MRNB 3MRJB 4PLJC 3QXWA 5HDQL 3NCBB 5A2FA 1AXTL 1XGTA 1PD6A 4WWKC 2EEDA 4GO6B 4HPOL 1XF3B 1D3CA 1INDL 5J9PA 1A9EB 2BY2A 4H25A 5JNYB 2DMBA 4OZFB 3Q2CA 4YDKH 5C08A 1IT9L 1CICB 3IB4A 1EVUA 1PG7H 4L4TE 3PWUB 3QSKB 2OXHA 2BC4B 1Q9OA 4NZTL 1ZA6A 5I1IL 3QCTL 3UJTH 1D6EB 1FGNH 3O41A 2OK0L 3MRCB 2VXQL 4TUKH 3HMWL 2IPUK 2FBJH 2VLRB 3O6FC 3P73A 4Z77A 3VGAB 2BMKA 1V3JA 3UTQB 4R3SA 4U6YB 3R1GL 1MI5E 3B8SA 1A7NL 3B6SB 4Q2ZA 5TDOB 4LPUA 3UBXA 3KXFB 5C0CE 1A6VL 1T22B 3SO3C 4HAFA 4M9PA 5IEKB 1JZ4A 2OYPA 3DX9A 1RFDL 4NO3B 1MNUL 2FATL 2ZG1A 1E28B 1IAIH 1FVDA 2DKMA 3DVNB 2VUYA 4J4PC 1FFNB 1N59B 1HINL 3TA3B 3TC9A 1C08B 4P2CG 3F12A 5FM8A 5HI5D 3LPWA 4Y4HB 5HYFA 5KAQG 3BPOB 2V5MA 4PRBA 5ICZB 2O5XH 4NGHH 2ORBH 2Z92B 5KOMC 3TPUA 4HXBH 1OARH 1S7RB 2GTZA 1Y0LA 1AO7A 5AG8A 4OLEA 5K93A 4L3AA 4KMQA 3D0LB 1ONQB 4Y4KC 4YPGB 3SCMB 4Z0BH 1WCQA 3BGFC 1KYOJ 1DQLL 1NEZB 1KLUA 5IJKA 5L7XH 3LB6C 3QDMB 3C6LD 5ESQA 1S3KL 4M6MH 3IJHB 1U93B 4LPVA 4YDIL 3MOBL 4APQC 2JIXD 3EIFA 2XQBH 3O4LA 2EXWC 2C26A 2V9QA 3L3GA 4OCXH 4QT5A 4ZO7A 4XCNA 5HHMB 5DD3H 1AI1L 2QV2A 3OGOE 5SWSB 3BW9B 3SBWA 4OCWH 1U91B 2FL5B 4GH7B 4NBYB 1NC2B 4GXVH 4X6FB 4IIQC 3DVIA 1EXUA 4AM0B 5F7DA 1WAAE 3IU3A 4ISVA 5CLTA 3WKML 1ZT4B 1CLYH 4KROC 3ARFC 4F80A 4O2FB 2PXYA 2AJUH 4WFFD 1N0XL 4YQXH 1X5YA 5IMMA 3KPTA 4NT6A 1G7QB 5HJ3B 2VB5A 1RZKL 3ARWA 5KZCB 3AUVA 4UOW0 5EC2B 1F90L 1E6OH 3L5XH 4I3GA 3IU4H 4GSDL 2X40A 1ORQB 4F33A 2Y23A 5B3JF 4N0UA 4ELMB 1I7TA 4G8GE 3WDJA 1WEJH 4NN6B 1QSVA 4P4KC 3WFEL 4RMVA 3DX8B 1AGBB 5HHPA 2VWEE 2XTJC 5L6YH 4Y4FB 5CBAB 3Q5TA 2YD5A 3LN4A 4P5KA 2JF1A 1CDBA 4HBQA 3ORJA 5E03A 5HGGS 3CXDH 1BAFL 3FZUC 2F54D 4XB7A 2FD6L 4ONHB 2VDMH 4PJCE 3HNVL 1DCLA 5D2NE 1LE5B 2P5EE 4M1CD 4X5LA 4RFNB 4M1GL 4HX1A 4FQCH 4MD4B 4PGCB 1IQDB 4R4FH 4DTGL 2XZQH 4NNXA 2IQAA 4OTXL 5IFHH 2AQ3A 4I9WE 4POYA 4U1SB 1KJ2H 5I1EL 2X4TA 3L5WA 2VR9A 5EZJA 1CG9B 2DQEH 3ILQD 1OHQA 2P47B 4KY1H 4BSJA 1YDPA 1ZVYA 4PGDA 1TZIB 4XAWH 3T77B 4PRID 3ARXA 4JFXB 3VXOB 3NBNA 4FQPA 3N9GL 1HOCB 4YBHA 1OOAA 3CVHB 5CD3A 1QRNE 5DTFB 2VLJB 1Q72L 4NQEE 1HHJA 5D1QD 4P23D 3FAXA 2EIBA 5ICYB 2Z8VC 4YHYB 2LAAA 5IOPA 5T1DL 1BVLA 3HUJE 1ZANL 1CF8H 2P8LB 5GIRB 3RU8L 3BAEL 4F9LA 4LIQL 3ROLA 3FHQA 3U4BL 5F1IB 4LAQH 4UI2A 1BGXH 3ILPA 3SQOH 3OXSB 3F7PC 1RVFL 1QNZL 4LLVA 5FO8B 3FRPA 4YIQA 4LCCB 2OR8A 4O2CA 1GC1C 4UUJB 4GW1B 5E2WL 4AIZA 1MSPA 3VWKA 3TIDA 1AC0A 3HZMA 4OGYL 3IXTA 4YNYB 4ZFFB 3MCLL 1I1YA 2E8YA 5I15L 1T6WA 3BHBB 4QRRE 5CJXC 1X4YA 1EZVX 4Z7WB 3G5XA 2C3HA 2VUOA 3C60D 4UTAL 1KB5A 3CFCL 3KDMB 5C07E 3ZYIA 3C6SA 2CR3A 4U49A 2E3VA 2NY4C 4PRPA 1VFOA 4OIIL 3MRHB 3L3HA 5CJ8A 3SY0A 4TVSa 3GMRB 5GXBB 1QYGL 1OPGH 4IOFC 1QUNA 3C5ZD 3Q6FB 3RDTB 3EGSB 4GG8A 3H8NA 2WUCH 3HAEH 2EDTA 1YECL 2CDEA 3F58H 2NMSA 1BOYA 3BE1H 3H0TA 3D18B 3OHXA 4F15C 3KYKH 4JPVL 2YD3A 3V0VA 3FFDA 3PP4L 4Y8DC 5I8CA 1EAJA 2DJ4A 1AGFA 1AC6A 4A6YH 4L8DA 4B7LA 1JNHA 5LBSL 1KNOA 2N1KA 4R7DA 4KAQL 5HHVH 3CFKA 3UTOA 2W38A 3EO9L 4QHNA 1XCTA 2WBJA 3MXWL 1J10A 2EYSB 5C0GA 1M1SA 3L7FA 3QQ9C 4ZUUB 2JJUA 5GJSH 1PBYA 4DN3H 2FHBA 3IXAB 1AKJD 3LEYL 5EC1A 1H3PL 4QXWA 3QUYA 4OLVL 4J3SA 4OKVB 3P0GB 2WINA 4FQXD 3OAYH 4KK9D 5IQ7H 1JNNH 1HHKA 1WZMA 3OKOA 5J12B 2P8MB 3AMKA 3QAZB 5GS1A 5EOQH 2ED8A 4G8IA 2DL2A 2HFGH 4E41A 3JTSA 3ULUE 2MHAA 3WS3A 3L5IA 3MRFB 4CMHB 4ODHH 2IH1B 1KGCE 4JRXE 3KPRB 3H9HB 1FNLA 4HH9A 4JZJC 5BS0D 3W5MA 3NCCB 4R4BB 3GZKA 4NRZB 2F8OA 4RBPH 1Q1JH 4P57B 4HIEA 3FB6B 4RGND 1UM4H 2JB5L 1ETZB 1LDPH 4TVPH 3OL2A 1KPVA 5D2LE 5GS2D 3SDYH 4S1RH 4OLZL 6FABH 1BQHA 3G5ZB 3OG4B 2YD8A 3U4EA 3HB3D 4GUPB 5CS7A 1GVIA 2LU7A 4GAYB 5JOFB 4U1KB 4ZUSB 4OSUL 1ZVHA 3GIZH 3OPZL 5E2TL 4WUUD 3IJYB 5CJOL 3P0VL 3QUMH 4M48H 2ATKA 1O0VA 5GZND 2AJ3B 3HR6A 1NUDA 1MFCH 3GFUA 2HRPL 4NM4L 1JMZA 3O8XD 1AE6H 3RY6C 4DVBB 5T1MB 1RK0A 3RPIA 2HMID 3C5SB 4IHOA 4JGMA 4WHYH 2D9QB 3JWOL 3T0ED 4IOIA 3L3KB 5BV7C 3RKDC 1SEQH 2L7UA 4A2LA 5HD8D 3EFDH 4QHMA 3RVXD 4UBDD 1KB5L 1AGDB 1OGAA 1WJ3A 5C2UB 1NGQL 2O5ZL 4LSTH 1F4WH 3O2WH 2WWKO 1I7UA 1M7IB 4Q9QL 3U0TB 4CGTA 2V2XB 1QBLL 2NX5D 5DUBA 1K4DB 2A6DB 3U2SB 4TSBH 4UOW1 4IRJC 3VDAA 2VDOH 4HS8H 2XWBB 3E3QE 2X4SA 4NHUB 2C1OB 4OLXH 1AGEB 3DSNA 4J8RB 4CW1A 2EICA 3FJTA 2GTWB 3TCLB 2VLKB 1GSMA 3P4MB 5DJ2B 5AD0B 4LHUB 5D1ZD 4YO0A 1J9CT 2CJUH 3NTCH 4WEUD 2Q8AL 1NGZA 1RIHH 1A6WL 2HVKB 4XMPL 1QBMH 3IFLL 4HZLB 1BIIA 3QDGE 1AD0B 2OJEA 3QISA 4Z95H 3GI9L 2AEPH 4BQ6A 3CU1A 2AEIT 3P4NA 3MFFB 1NCCL 1YMHA 3ARGA 1YEKL 4YX2L 8CGTA 2ERJB 4JCLA 3B9KA 1DBMH 4R4ND 1F00I 4LVHC 5LWYL 1G7PB 1JHTA 4QXTA 5KSAA 3NCYS 3TEUA 3NIDF 1U3HD 1MJ7H 1CZ8L 4NOBA 1D5BB 2A9MH 5EZLA 4XNMA 3EJZC 1UB5A 3SDAA 1A6ZA 5M94B 2P7TB 2QQLL 2OL3H 4PLOB 4OD1H 4XXCC 3FO9B 3QNYB 4UT9L 4Z76A 4TPRH 5L2KA 3H7BA 3GM0A 3VXPB 4XPHL 1W0VB 5JO5A 4PV8A 5EU7C 5HPMA 2VO5A 4GKZA 1I9IH 1R5VA 4MQ7A 2GJ6E 3T1FA 3TYGH 2VQTA 1A1MB 3IFPB 1NCUA 1IAKA 4WEBH 4C56A 4DJMA 2DIJA 3S36H 3PWNB 4GQPH 1GCFA 1MCSA 3L7EB 1FFOB 5IHUH 1NGWA 5I1CH 2XPGB 4GOSA 4OV5B 3QYCA 5AZEH 1JFQH 2YS4A 4OBSA 1F6FB 4PJAB 1ZK9A 1T5XA 5TF0A 1BJMA 3O4LE 4DVRH 5TGBB 3T0WA 4WWKB 4W4OA 5GPRA 2Z31B 4O5LH 1NCTA 1A0QH 3BRDA 2BY0A 1QLEH 4WV1B 4ZDHA 3BZFA 3CX2A 3MV7B 3UTSA 5ERWA 4HUXA 3S5LG 43C9A 2MFNA 3RNQA 4NQVA 2ATPB 4MDJA 4GS7C 3UJJH 1A4JA 5E70A 1UT9A 4TQEH 3CLEH 3TT1L 1FG2B 1U8OB 4I0PC 2ESVE 3HZYA 3MRQB 5B4MD 1JWMA 3STLA 5JHLL 4AENB 4E5XA 3GSRB 3MLXL 5C08B 5KSVB 2BFVH 3ARQA 2IANB 1AJ7L 1NJ9B 2FZ3A 1URLA 5IB1A 3O41B 3GK8H 4EZMA 4C57C 5IT2L 4OFYD 2HWZH 4KDWA 5GGUA 3FFCE 3D2UB 4HT1L 4KKAC 1DQMH 1SYVA 1EHNA 4XCCL 1D9KA 4ACPA 3HC4L 1WBZB 5I17A 4LU5L 1V3MA 4WTXA 4GRLB 2CSPA 1OAYH 5HVWA 2O26U 4XP6L 4MCYB 5ABDE 4MQTB 5KJRH 3CSYA 3A67H 5KANG 3AREA 3HCVA 1HI6A 4ODVH 1KCVL 5DQDH 1UXSA 3ULSA 3OR7B 2EIEA 4RMTA 4Y19D 3X11B 2E7HA 3WNLA 5B38G 4PJXB 3CH8A 4BQBA 4NJAL 2LTQB 3WFDL 1IGCL 2X4PA 3GSVB 2HT2D 3IVKA 2F5AL 3F12B 4ZTPH 4Y4KB 2GFBB 4LKCA 5GRVK 2VXUH 3SDCC 4MJIB 5C8JA 5DUPL 1SJEA 2PKDA 1T89C 3FOMB 1EA9C 3PGCB 3DRQB 4L4VA 4DZBA 3TBVB 4APQB 1CTOA 4JFEB 1FJ1B 2ICWB 5MHSD 1Y0LB 4NKDA 4K3DH 2R1WA 4P0DA 4X7CC 1HCVA 4WFED 1KT2B 4JQVC 4I2XB 3ISWA 1B2WH 1GGBL 2ZSWA 5E6YA 1S9WA 4PJ8C 3O6ML 3MRGA 3PWJA 1QP1A 2X6MA 3VWJD 4XAKD 3DI3B 1KELH 4YWGH 4IIQB 3TVMD 1Q0YH 5D7JD 3EJYC 4GFTB 3LCYA 1UACH 1U2HA 5FYKU 5I16A 1MRDH 2DQDH 4HG4K 1RJLA 3KYNB 1RJYA 3NFPA 4HPYL 1UWEH 2CDGA 3X3GH 2XXMB 1NAKL 2VL5B 5EULV 3QULA 3BP5A 5E95B 5FA4B 5D9SA 2R2EB 5FCSH 1NC4B 3HMXH 2QSQA 1R24B 3VXSD 3VI4F 1FP5A 4YHPB 2PXYB 4JRYD 3QIBA 4ZS6D 4RA0C 1LP9F 4AQOA 1NBVH 3T8XB 5IHBA 4K8RL 4NT6B 4F2MA 4HK0A 1W0YT 5ALCH 4PRPE 2XKSA 3QG7L 4Y1AD 4KZDL 5J56B 2VITB 2Q1EA 4UV4L 1T21A 5BJTB 3TBWB 2OMBA 1EFXD 3TH2T 2NXZC 3MLSL 4LQ1A 5A2IH 3L3OA 2I5YL 3IFOB 5D96B 3LN4B 4CRPA 4P5KB 1HXYA 2XOTA 3MBEA 1XGQA 4K9EC 4HKBA 2W60A 5B22A 5I18L 1FAKT 5B3JE 3INUL 2A1WH 2VZOA 3TPKA 2V5RA 4OI8A 4LQFL 3JV0A 1BD2B 4OFIA 1F4AA 1YQVL 1YMMD 4GBXB 4MA7L 3CK0H 4LVEA 3PP3K 1F4XH 4AIOA 4XBEL 3QUZC 3UTTE 4OZGF 2UZIL 1WITA 4LHJB 2F74B 4AQ1B 5IK3B 5F6IB 4J3OC 4F58L 1RUKL 4R90L 4IS6A 5DMIH 2VDNH 4QHLA 4GKSA 2N7AA 4RMSA 3QXTA 5C0BA 4KTEL 1VESA 3MBXH 4YPJA 1D6VL 2AK4A 5IROA 1V05A 2D0GA 5IFJB 4QKXB 1IAOB 3OJDB 4WU7B 4D94A 1TPXC 1RUQH 1FH5H 4QYOA 3JWDC 4NP4L 4P3DA 4XHJC 1ZLSH 5AUMA 4DEPB 5JXEC 1T1WA 1HKFA 1UH3A 2AJSH 2LVEA 4NBZB 3HC0B 1CGYA 5FYJD 5GGQH 4RGMC 3I2CH 1RIUL 3MXVL 4X98A 4GW5B 3MA9H 2DQCL 4M7LL 3QWQB 4M03A 5ENWB 1B90A 4U33A 3UTZA 4ODXA 3ROLB 1CBVL 1Q9LA 1FNSL 4JKWA 1TJGL 2EDBA 4LK4A 3U0PA 5ADPH 3BKJL 1ZA3B 5E8NA 5EZIL 2NY4B 3DUHA 2F53E 4L3EB 3QQ3A 5TE7L 2DI8A 4MJ4A 4ZXBD 2HKFL 4G6ML 3TP4A 4N90D 3U6RB 4RMUA 5HHOD 1DLHB 3VRIB 5GGVY 3IS0X 4MA8L 5FXCH 2XV6B 5TDPB 2QKIA 2R69H 5TQ2H 3UPRB 4U6VH 4ODWB 5FB8B 2YMXH 4GT7A 5IWLC 1KB5B 2XN9E 2YUWA 4BKLB 4Z7VB 4KK8D 1DLFH 1D5ZA 2YZ1A 1ZWIB 2OR9H 4NQCB 3DROA 2XICA 3BD4A 2H8PB 3TT3H 5FKAA 3O6KL 4J1UA 4KKCC 5JORA 3TBYB 4KKBC 1SMAA 2GIYA 3EJJX 4YDKL 5D7LB 3U82B 2YR3A 4KJQC 5GGSY 3R0NA 3EYOB 3PGFL 3PQYA 4GG8B 3SGDI 3VRJB 5KG9A 1MCFA 1MJUH 5FF6A 3UJTL 3H0TB 1FGNL 5CMAA 1IGTB 4TUKL 3PJSB 1EHAA 1H8SA 2FBJL 1JGVH 2HLFD 2V2WB 2WIIA 1MQ8A 4U31A 3C8KB 2CUMA 3TO4C 4MLSA 4RFEB 1JZ5A 4ODTH 3FB5A 3DO3A 1KNOB 4PYHA 5CP7B 2F8XC 1RZGB 1JYVA 3DHMA 2UWEA 5C70A 5AWNH 1UB6B 3LKNA 1XCTB 2D7MA 5FUCC 3WJLC 5C0GB 3RVUC 2MJWA 5FA3A 2YD6A 1I8LC 3OB8A 4I5BB 1IAIL 5DURB 3U0WH 5I1DB 2DYPB 1KJ2A 1D7FA 3QUYB 1JIBA 2WINB 5HHXH 3P9MA 5B39B 4KK6D 5ITBH 1OP5K 3OKOB 4F3FA 2NY1D 5BRZA 3P40A 4QHUA 4ZD3H 4OF7A 2FGZA 2A6IB 4XNZB 3QT2A 3QIWA 3VGBA 4G8IB 2BNRA 4E41B 3P4OA 3QDJB 3B3IA 2EIZA 4NGHL 3WS3B 3TO2B 4HKJA 1AQKH 4OZGA 1NFIA 2XFXA 2KQMA 4LPWA 4HXBL 3BISA 4BFIA 5FUOH 1OARL 3AU1A 3QDAA 3L95A 3L3JA 25C8H 4OCSH 1HHGA 2X5PA 2R39A 2YSSA 4HUUA 4HIEB 1YNKH 4WJ5B 3WLBB 4W6YB 3V6FB 2OI9C 5EU6A 4L8CB 1EBAA 2O5YH 1BQHB 3SEPA 4Z0BL 4WI3A 1LGVA 3V0AC 1IM9B 4PV9B 4XVTH 1OLLA 5L7XL 4XP4H 4JR9H 4ORZC 2NLJB 5E6IC 3RWDA 4M6ML 4FFZH 1AHWA 1DVFC 4KK5C 2ZOKA 1GZQA 1FNFA 2XQBL 3BJ91 4CVXB 3HI1B 2PO6C 1HYSD 3GMMB 1OT2A 2ATKB 1A47A 4OCXL 1WCBB 1WFUA 4NZJA 3QQ4B 4JZNA 2BVPB 3I02B 5E8EB 1I1AC 4UU9A 5DD3L 3G6AB 3W39A 4AEIL 5BMFL 2ADJB 4UTBH 3PHOB 5CEZE 3E6FB 4OCWL 1YN7B 4IRJB 3HS0A 1U8MB 1VACA 1A7QH 3MO1A 3X12B 1BZQK 1T2JA 2VC2H 3VD4A 2J2ZA 5MEPB 3UTSE 1EK3A 1CLYL 2VZVA 5E99H 2AJUL 2QBWA 4QHMB 3BH9A 4YQXL 1PEZA 1KFAL 4Q6YA 2IAMA 4CU7A 3VD9A 3OKKA 5LXGH 2DB8A 3NZ8B 4LFHG 1I7UB 4WW2C 4OFVA 4TSCH 5DUMH 5EO1A 1UGNA 5T3XD 1E6OL 3L5XL 3ZTNH 4P4RB 5KVDH 1F2QA 1KPRB 4BH8A 4TOYH 1WEJL 4JFDD 1JHLH 1ITCA 3LKSB 1J88A 4JM2B 3HAEA 1BZ7B 2NZIA 4HFUH 4MLIA 2QADB 5L6YL 3B9DA 2E5EA 1RUPH 2VDQH 3K3QA 3BWUC 2JK5B 3BP7B 2F58H 1OP9A 1CDYA 5ILTH 5C9JB 1P84K 4J3TA 5JMRA 3CXDL 1NGZB 4A6YA 3V7AE 4U1HA 3HE7B 3PWPB 3QI9C 4NN7C 1B0GA 1FV1B 2Z8RA 3QDME 3K1KC 4N8PA 1NDMB 4G7VH 1ZKAA 5J3HD 2R1XB 3QJFA 1MHCB 4GXUM 2D31A 3OX8B 5L2JA 1SYSA 1S7UB 3ARGB 1AY1H 1L9NA 4BZ2H 1H8NA 1EEZB 1H8OA 3MQIA 4R4FL 3RZCD 3M1BA 2XZQL 3BQUB 4JFHE 1SVZA 4OFPA 4OGZA 1JHTB 1OM3H 5IFHL 1JWSA 1KJ2L 4W6WB 5ESAA 3I3BA 4L5FH 1CCZA 2R8SH 3DETD