1S5HB

Potassium channel kcsa-fab complex t75c mutant in k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.
pubmed doi rcsb
source organism Streptomyces coelicolor, streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hB02
4JQVA 1U6AH 3JWOC 4O2CB 3F7QA 4HFWA 1KCVL 3MRFB 1A02N 4WV1B 1FZMB 5HYJB 5BO1L 1FYHB 4DOHE 5HVFB 4OCRH 4CKVX 4KUCF 1IGIH 4OM1H 1ZK9A 4KTDL 2XPGA 3A0OA 4O2FA 4OF6A 3MUZ1 1OT1A 3ZO0A 1RK1A 2DBJA 1D5IL 3V8CA 3FQUB 4PRDA 5EO0A 4YDJB 3TZVA 1EMTH 2C5DC 3S37L 1G6VK 1LK2A 4TNWK 3ARYA 4W4OC 3QCUL 1LO2H 1ZXQA 3RGVC 3GSNB 3MGOA 3PGCA 3KJ6H 2P43B 3KPNB 1C08A 4QOKB 4M6ML 1QSEA 4P5TD 5KSUB 3KPPB 4LAJH 4PV8A 1X5YA 4M3KB 3D85D 3GSOA 4CVZA 1N8ZA 2CLRA 1TZGH 4JANA 5K9OA 1A3LL 3L3KB 1YEIH 4NIKB 1KG0A 2DQIL 2LVEA 2WIMA 5E08H 3C8HA 2MKWA 3KWWA 4UTBL 2AI0L 1LE5A 3TFKD 1C7SA 1FYTB 1TJIL 4HPOL 2YD8A 1XGUA 3H9YA 4GRWB 5FOJA 2ZSWB 3FO9A 4Z0XB 4OQTL 1RIUH 3LKPA 3EJYC 1MFEH 3BXNB 1WIOA 2DL2A 1XF5B 4UIMB 4X0KB 2D7MA 1S7TB 1TJGH 12E8L 1TCMA 3N50A 1N5YH 3LAFA 1LEIB 1ZTXH 4R8WH 1NAKH 2Y06L 1J1OH 3CSYB 5GGVY 3DIFA 4G43B 4YDIL 1I8KA 4JO2H 4QY8B 4CW1B 2R1XA 3VFRA 4PUBH 2PETA 5D1XB 3RY4A 4GO6B 4DGIH 3TT3L 3HB3D 1FZOA 1KGCE 2DBLH 1ND0A 4RGNC 1PEWA 5DQ9A 5D96B 4KUZL 5HI3D 3VXPB 2DLGA 5HDQH 4XC3L 3HC4H 5D7SH 1HQ4A 3ILQC 3CFBA 4FTVD 4I77H 1A7BA 1J7VR 1NL0H 3TBYA 4H8WC 43CAA 3LVEA 5HHMD 4NCC2 5CIPH 3TA3C 3RWFB 3ZDZE 1KB5B 2CD0A 4DW2H 5BOZG 4NQTA 3QNZB 3O9WC 5GGUA 2YWYA 4FOMA 5C0JA 4RAVA 1JK8B 1NJ9B 2B5IB 2AV1B 3HCVA 2LABA 1D5BA 1F42A 1ZGLM 3FQRB 2A6IA 3FQTB 4XTRD 2EC9T 1Q9WB 5TQ0H 1G7PB 1KIQA 2FR4B 3TO4B 4XWOC 4WU5A 2MHAA 5SWSB 1D9KC 2M2DA 1J8HA 3IGAB 4GAYA 2DTML 3VXSE 3IAQA 4O9HH 3STLA 1MCBA 3OAYH 1S9KC 4I3SL 2H32H 4PTTB 2YPVH 4YHZL 1YN7A 3X3GL 1XCQA 4HIHB 3DMMA 3SKUD 3DX7B 3WLBB 3KYNB 1I8IA 1P1ZB 2Q1EA 1HHJB 3EFDL 4C58B 1IC5L 2OI9B 4L4VB 3GSQA 4U3HA 1YUHA 5KOVC 2EKSA 3FB7A 5I2IA 4PRHB 4NNXA 4ZFFA 3RNQB 4BA8A 4YK4B 1NBYB 1IKFH 2EDYA 3MLWH 3V0AC 5FGCE 3WNLA 1DBKL 5C08E 4F7EA 2CK2A 3HZVA 5C2BL 4FQLL 4NNYB 5FHBL 2ARJB 5I8KL 3KXFB 3MXVL 1FG9C 3U7WH 4QTIH 3MREB 4GW5A 4FQQB 2BX5A 3D6GA 1UXWB 4PJ8D 3AS3A 3GK8H 2P4AB 3LMJH 4K9EL 5EORH 2HMID 1XGTB 4F7PA 3OZ9H 2A9NH 4AM0A 4GG8B 3SO3B 4PLKD 2MOVA 1VKXB 3P73B 1IEHA 1ZT1A 1UM4L 2EDDA 4MJ5B 3IJSB 3TP4A 5F8RC 2AJ3A 2R2HB 1WZ1L 2JJSA 5GZNC 3PABB 3FONB 4PJFE 4Y1AD 5IB2B 2DQJL 2P48B 5I1EL 1W72H 4FQHA 3BZ4B 3TYGH 3LPFA 4KZDL 3EO0B 1T03H 4NOFA 1SEBA 1JFQH 3V6ZB 3LRSA 2ZUQC 4Z76B 2APWA 1BOGA 2WV3A 4B5EA 2N1KA 3L1OH 4BQBA 2PTUA 3PWLB 3PWPE 2FLRT 4XNQB 1H3PL 4Z7UA 4YX2H 1S5HB 1RPQA 3EYFA 5IIEA 3OTTA 1X4YA 3MLRH 3VXSA 3VW3H 4YPGB 4XVSH 3MFFA 3WO4B 1JYWA 2K7QA 3PQYD 4JFXA 4LU5L 3RGHA 1G7IB 3BH8B 1T1XA 4TNWF 4JM2B 4EEEA 3T4YB 4NQXB 3WKNA 2DI8A 4PJIF 5E8DL 1IM3A 4QOKE 2QJDA 4K3DH 3STBA 3QDJD 4H0IA 2J88L 4UT9H 4JB9H 3WNOA 1EO7A 5ISZD 1HHHA 2BVOA 3TESA 3QIBB 4HLJA 2Y07L 1NGQH 3ZT5A 2NY0D 5J06A 1JRHI 1R5WB 4N9OB 4U1IA 1Y18B 3VXQA 1MLBB 4FP8L 4QRRD 4XPAL 1EH9A 1B0RA 4NGHL 5FXCH 5DMJB 2AJVL 2BHUA 3TBTA 3FO1A 2GCYB 3DVGA 4JG1H 1I7TA 5E00A 4NQVB 5BRZB 5ILTH 5CJBA 5BV7H 4LL9A 1CXKA 1W8NA 2QKIB 4YXKL 1CXEA 4N5UA 2AXJA 4MA8H 1TTFA 4XCEB 5C0EB 3FCTB 5D1ZB 5DMGC 4PJ5E 2A6KB 2I9LA 4RMWA 4N0UB 3O6ML 2OMBA 4PJFA 1HHIA 3AGVA 3BP4B 5EZLA 4LKXA 3D2UA 4HH8A 2JTDA 1ZLVK 3G6JB 3SPVB 1HOCA 1UVQA 2VDNH 2VLLA 2ORBH 3QUYC 1T83C 4KI1A 4YBLB 4AENA 1FQ9C 5BCAA 1QRNA 2B1AL 1TZHA 2NTFA 5C0AB 3PWPA 4YDKL 1S7VB 2JK5A 3QUZC 2Q7YA 2NY4C 2F19L 4Y8DC 3SDCD 1UWGH 4X6EA 3DRTB 1KN4L 2X9XA 4HJ0C 2VXUH 3QWOB 4HUXB 1HN1A 3VXNA 4D9RE 2MQ0A 4WCYL 4ZDHA 4WI4A 4NJ9H 4N0YH 2EDEA 1F97A 1OCWL 3NFNB 4OT1L 3KPRD 4IRZL 3MBED 4HMCA 5FYJE 2F5AL 3DLQR 1VA9A 5L0QB 1RUPL 4KKNA 5I19L 3QDHA 2OK0H 1U3HB 3THMH 1J5OL 1I85A 2B0SL 4P4KA 3OXSA 2OSLA 3NPSB 4OGXL 1X4ZA 4MCYA 5SV3A 5CZXC 5IROC 4NWUH 4UI2A 4OIAA 2NXZC 2VZVA 1AP2B 2VISA 4X8JA 5SWSE 4M7JH 1OAXL 3UYRH 3UTTB 3DO7A 1A3RH 3ME0A 3RWDB 4WRLA 3ZKXC 1HXMA 3PL6A 2WIIA 1PX4A 3ECBB 4I2XB 1UACH 1T20B 4G8GB 4PY7B 5JMRA 1YJDC 4NQED 3OF6A 4ZO8A 1GGUA 3BIKA 3WXVL 4WFEE 5IW3A 5FO9A 1GYAA 1M7IB 2BOBB 1INDL 4MNQD 3EAKA 3E3QE 5IQ9B 2DYPB 3KYMB 4YEFA 4PJ5A 4R4BA 1RZJL 1XR8A 4U6HA 5ERWB 3HNSL 4ONHB 2Z8WC 5HGDA 4IOIB 4JPWL 4Z8FH 4PTUA 5I76B 2H45A 2Z91B 3KXFE 2BVEA 4OCSH 1ZT7A 4RFOH 1K2DA 2X7LB 3IFPB 1OTSC 4LLMA 1MCOL 3WHXB 2HWZL 3KG5A 1NFDE 2C4XA 4JFQA 3T1FA 3WNMA 4HUVA 3DSFH 2X4RB 3CPLA 3MV9D 2HKHH 2X4PB 1N2RB 1KXVC 4HDIA 3AXLB 4JN2A 5DMKA 1F4HA 1MFBL 4RFEB 5DD0L 2AV7B 1IT9L 4I0KA 3QDMD 4NRZB 4JN1L 3INUL 2YPKB 3MA7A 4PY8J 1NCAH 5FKPB 5GS1B 4HS8L 3JUYA 1YEEH 3B2VH 2OTUA 3PF2A 5DHYA 4MNHA 3EHBC 1TMCB 4WFGE 4B0MM 1QLRA 4M1CC 3X11B 1OAKH 5KSBF 5E8OB 5JW3H 5DJ8A 5CJQL 4BH7A 5KN5B 5E4EC 1AGEB 1WFOA 5EOQL 5J12C 3O2WH 4WUKL 4ZUVB 5J0BA 4GS7C 3MR9B 2BSRA 3CAFA 3NA4A 5TE6L 4YEEA 5HPMA 3R06B 3O3DB 4QLRA 5CP3A 2XICA 5FM5O 1HSAB 1GRWA 1OQXA 2VWEE 3ZDXE 1P69B 5I1DB 4ZSOB 1HH9A 4H0HB 2NZ9D 1H5BC 1T22B 4MQXC 3RZWA 4M7ZB 4KQ3H 2P5WA 4U1MA 1IQWH 1OTUD 3BKCL 3U0PB 2FGWL 3MPCA 1E4XL 1AIFA 1J0KA 3HRZA 3IKCB 4X9GA 1BD2E 1JCKA 1Z6JT 4P46A 1TQCC 5FAAA 3ULUL 2P5EB 5IW1A 3QSKB 2J8HA 5MEPB 4GKZB 1GAFL 1NFDA 3O8XC 4F80A 2FD6H 4OLWL 4P3CL 4OIIL 4F2MB 1TFHA 1JBJA 2BSTA 5H2BB 1RY7B 2NX5D 3BT2H 2E6QA 5ID1B 4FHBD 4LAQL 1K5NA 3RZCA 1CFSA 4LEOB 2NPLX 1SVZA 4PLOB 4OCWL 4Y16A 3ZKND 2HJFA 2UYLB 2Q8BL 5E9DE 4MA3B 2I5YL 4MHHI 1V7NL 5L2KE 1KJ2H 4IS6B 1AGDA 4P2OD 1AHWA 2BC4B 3QEQB 1J10A 2IH3A 1N6QH 1CLYL 1DEEB 3MO1A 2IWGA 5C0AE 4M7LT 5TH2B 1T1YA 1MEXL 4G9DB 4LOUD 2LTQC 1LDPH 2C3VA 1CD1A 1MFCH 4FABL 4IRJC 3GRWL 3HZKB 3NCBB 2X42A 2Z8RA 4ZAKC 2HFEA 2X41A 3LZFL 5TDNB 3QFDB 4GRLA 2Q20A 5CUSH 4U1GB 4RWHA 1B0GB 2X9YA 3KJ4C 3BE1H 1EFXB 3E6FB 5EUOF 4KROD 1KCLA 2DQCL 4KK6C 3RJQB 3LQAH 1RZ7H 2OM5A 2P1YA 2IJ0C 1N4XL 2VH5H 3KPSD 3VRIA 3TPUA 4P5KB 1O7SA 4QGYA 5JIKA 1PKQA 2W9DH 1R3IH 3BDBA 1XEDA 5C6TH 4I0CC 4O5LH 2AK1L 5E5UB 3VI3E 4JDZA 1I7ZA 1BD2A 5CJXC 5DJCA 2NR6C 3C09C 3ZHDA 3PV6B 4U6YA 2ID5A 2HLAA 3LN5A 4X6CB 3U79A 2AAVA 3W0WD 3DGGA 4U1JA 1NGPL 3U30C 1CU4H 5HHNB 3PGDB 2DLEA 4KMTH 1CBVL 4JPIA 3H7BA 2APFA 2FATH 3IU3A 5CEXB 5HXMA 2A73A 4ZTPL 1TITA 3DV4B 4KDWA 5HHVL 5IFJA 1KBGL 3O6FA 3JWDC 3H3PL 4MJ6B 5KSAD 4D9QE 2IFGA 1A6AA 4ZXBA 1DBMH 1JPST 4FQXB 2E27L 1NBQA 3M07A 2BCKB 1RK0A 5AWNL 5E9DA 5M7QA 1CGXA 4CMMB 5L2KA 1GGBH 1GSMA 15C8L 3MOBL 3SDYH 1ZHNA 3B9VA 2Y7QA 4O2EA 1JP5A 4YXHL 4X4XB 3SCMC 3MRDA 3T0EB 2GJ6D 3NN8B 5A2JH 3NA9L 1WUNT 1A6VL 3VG9C 4QHLA 5DJAB 4NKQB 3MJ7B 4NO0D 2ZCKL 1QSFD 1A6ZA 1HEZA 1QQDB 2CK0H 2HT2C 1NUDA 1OGAD 3WKML 1XR9B 4W81A 3QI9B 1BM3H 3QAZC 4MGXA 4X6DF 4LCYA 4AYFA 2C9AA 1OVZA 4JR9L 4ZOCA 4F9PA 2WINB 4LKCB 4YWGL 1RZFL 3IDXL 3OJDB 2NY2B 1JUFA 3UC0L 5DJ6A 2D3VA 4TSCH 3ET9F 5C3TA 2HYMA 1U8LB 1WF5A 3AM8A 3TCLB 1VFMA 5DHVB 4J1UA 1JF1B 3S5LA 5DWUL 3ARGC 5B4MD 2C4FT 3OAZH 5INCA 1LWRA 1XIWB 5DTFA 3OKNA 4LVEA 1R5IA 2FIKB 4BSWB 1MCHA 3V6OC 3HAEA 5HYQA 3PWNB 3S34H 5ALBL 3C5ZA 1SBSL 5JDSB 5KANG 5CP3H 3LB6D 4LSVH 5TJWK 5CEYB 4ZMAT 2I07B 1W0VA 4AT6B 1FL5B 1QHOA 4P5MA 1NQBA 1NDMA 1LO0L 4R6UA 2A77H 4I1NB 1KEML 1N6UA 3CZFB 4WUUD 4HKJA 5HI3C 4F9LA 1MRFH 1A5FH 3RVTC 1RZKH 3RQ3A 3QIUB 3GMPB 4BQ6A 4Y4HB 2YBRA 3D0LA 5ADOL 5AUMB 4OQ1A 1BFOA 1TZIB 4WWKB 3FQNB 3MRIA 4H26A 4RISL 4DUVA 3Q6FA 3QUXD 1DQDL 4PJ9B 3KPQA 3NH7H 3RI5F 4WHYH 2QV2A 5DLML 2WUCH 3B9KD 4TUKL 5J11B 1X5GA 3QA3B 4Z9KB 4YJZL 5DDHA 1OSPH 2NLJA 3NIDE 1HZHH 5H35A 4GBXD 5ESVA 3D18B 2XQBH 3FZUD 3IDIA 4Y2DC 4Y5XC 2OR9L 4F7CA 1LP9B 2BFVH 1PYWB 1RVFH 1FLRL 5I73B 4ODUB 2FJFA 1JV5A 3WO3B 3ARUA 2EEBA 5FK9B 5C6PB 3MRPA 3NABH 2Z31A 2EEDA 4XT1C 5E8PB 2OL3B 2R0LH 4J3TA 5DD6B 4LDOB 1T4KB 4UT7H 2MSPA 4M93B 3QEQE 3VWJC 4PJGB 4JRYB 5JW4Q 4Z7VF 3VFVB 3D1MC 1X5XA 1Q94A 5ECJE 1JHLH 4EVNA 1YEJH 5FV1L 3QO1B 3MRRA 1DEDA 1HHKB 3Q6GL 3CLEL 4JFPA 1YEGL 1UCBL 4NC1E 1FDLL 4EUPA 5DS8A 1OW0A 4BQCA 1FHGA 5I18H 1I3RB 1U8NB 4MAYC 3S88L 4NBZB 2DJSA 1UG9A 1B0WA 4Z7OE 1AQKH 5B3JE 5LGJA 5D7JD 2VIRB 5JW5B 1X5ZA 3UYOD 4K7PH 3PE9A 1AD0A 4D0CB 1QFWI 1S7QA 1M05A 4KMQA 3MMEB 2HFFA 3IYLW 4ODTH 3UBXI 3U4EB 4IMKA 4OLYH 2CUIA 4YGAB 1OWRM 1N0XH 3FKUS 1LK3L 2F15A 3RVWD 3QBTB 4NO5A 3QH3B 1G1CA 5DR5L 1TPXB 4X6CE 2F53D 4S2SA 3REVB 4UUJB 4NZDA 1I9EA 4PJBB 5L88L 2F54B 1H8OA 4G3YL 2KQNA 4YE4H 5ICZB 4X99A 4JDTH 5DUBB 2VXVH 3ZE2E 1IQDB 4POZD 3NACL 3SKJL 2VDRL 3CVIL 4JFYB 5DC4B 3PNWB 3QDGE 4DN4H 2E6PA 1GHFH 3AROA 1I1YA 1RHHA 3MRJA 1RJCA 3VXME 1WTGT 5JOPD 2OP4H 1WQVT 4KAQH 3DETD 4D3CH 4XHJD 2R0WL 1IC4L 1CDIA 3DROB 4I18C 1E28B 2F58L 5DMIH 3UTSB 3L3IA 4KI5C 3T0EE 2K3TA 3BPNB 4XCNB 2XN9B 2XRAL 1DN2A 1DVFA 4LCWD 4P9HC 4E0RB 4JPKL 3K2UL 1BEYH 1NANI 1CL7I 2XNAA 5FGRA 4P3DA 1H15A 5I17A 5DJXB 4F58L 1D6VL 1EGJA 1BAFL 4M02A 2WP3T 4G6JH 3O4LD 4ALAH 5I15H 1R3KB 2J8OA 4C56B 3GKWL 1F58H 2NY0C 5D2LF 1DL7H 1KIUA 3OMZA 1MWAA 3OR7B 4JGJA 4XNMA 4C4KO 4X7SL 1HINH 3DBXB 4ZO9A 4NQSA 5HDBE 4YHLH 5EBWB 1ZVSA 3QPXH 1Q8MA 4YHMH 3OXRA 1Q9OB 3MNWB 2ZPKH 3QQ9C 3RGVB 4NQUA 1DANT 1KSRA 2E7BA 4NKIL 1A22B 3GB7B 2EH8H 3HAEH 1VEOA 1RZ8B 4J7RA 3K7UA 5AD0A 3G9VA 3S9DB 1E4WL 1NGXB 5TGBB 4RMUA 2P44B 1IEBB 3ABZA 1DLHB 3J8F7 4WEMB 4ODVL 5GJTL 1HQRB 1UXSB 5CWSA 3QDGA 1FBIL 2A9ML 1OM3L 4DJMA 5LVEA 4N5ED 4ZODA 3B2UD 4FG6C 3P0GB 1IVLA 4OIBA 4M6AA 1NCNA 3VXMA 4EZMA 3MV01 5GSVA 2ZG1A 4E42A 3O2VH 1X4XA 3SGDH 5CJOH 4HHAA 3UPRB 4XXCC 4JDVA 5CGTA 5F3HA 2F8VA 4MDJB 4OLVL 3MLZH 4NM4H 3U9PL 2Y23A 1BBJB 1HWGB 1ZA6A 1XF3A 2AKRB 3KR3L 3SY0A 4AEEA 4XXDB 5MEOA 3QZWA 4HX1B 1DDHA 3BX7C 3P3YA 5DUMH 5F9DC 1YYML 5IFHL 1SEQL 4O4YL 3VH8A 4OF7A 4K7PY 1UA6H 1F8TH 3NAAH 2UY6A 1QNZH 3M45A 5A1AA 5CSBA 1YMHB 3W39A 4HIIA 3TLRA 4Z5RA 3ARXA 2P8LB 4CN6A 4JY4B 1EEZB 3ZE0F 1UYWL 3RKDD 4E41B 4XP4L 2IAND 1CK0H 1W0WB 4GRWF 3S6CA 1FCCA 4WW2A 1H3VA 5JIPA 1CD9B 1UEYA 3X14B 4PS4H 5KW9H 4XGZA 3TA3B 2DLIA 2OTWB 3C5JB 2AJYH 1CLCA 3X3FH 3QUKB 3O9WB 3GIVB 2EE6A 1DQLL 4U1HA 4EUPH 1OP5K 3FT4B 1PX3A 1AGFB 5IK3A 5C07A 4R7NA 2WUBH 5IWLC 5KS9B 2EO1A 5L8LB 4HIJA 4QNPE 2AXHA 2I25N 2R56H 4M48L 5DEFB 4ZS6D 4M7LL 1CICA 3UJJH 3VFGH 3L7FA 3TIDA 3PHSA 5IQ7H 4Y4KC 3BPOC 2E7MA 1CFNB 4GRMB 1Q72L 4JRXB 5HD8C 3MJ8B 3EO1B 5I74C 2YHGA 1D9KB 3MJ9L 5IEKB 3LD8C 2VLRB 5ESQA 5EUOA 1NPUA 2IAMA 1U8PB 1ZA3B 5SV4A 1YY9D 4MDIA 5SX5K 1IAOA 4HLZH 4EXPX 5JLZA 2EZ0D 3FMGL 1KXTB 3A67L 3SDDC 3MX0A 3C5SA 5HHXL 1BJMA 4OTXL 4PRNB 4QRPA 3L3HA 1N7ML 4ODSL 2W0LA 4HD9A 4PJBE 4OCYH 2AGJL 3VA2C 2X70A 4MJIB 1JGEB 3NIGF 3DUHA 3I2CL 1JZ3A 2BSSA 4ZOAA 3FT3B 1LNUA 2XWBB 4XPBH 5EC2A 2KZ1B 5B39B 3F62A 1BQLH 3B5GA 4QF1B 4XRCA 3I02B 4PBVC 4UQ2B 4X4MA 2BOCB 3PP4H 4KGLA 4JE4B 5KTEL 3QUMA 3HI6H 5CGYC 1A0QH 4GSDL 3TNMA 5IT2L 2W65A 4WIQA 3V5HA 3AB0C 5ANME 1E4KA 4WI5A 4L4TD 2OZ4L 5DYOB 1C16B 3UTSE 4MXQC 2VQ1A 1S7RB 5T5NF 1H8NA 2XN9E 2VL4A 3BPLC 4TN9A 4L8BA 2YXFA 3FFDB 4EDWH 4JG0H 4AL8H 2DD8L 2DF3A 5F70A 2FECI 4L9LB 3U2SA 4PY8I 4U1SB 2KQMA 1IM9D 1X7QB 2OS7A 2P47B 2NW2A 4AIOA 1N3NB 2UUDK 3K46A 4YC2C 5IUSA 2Z8VC 4GT7A 4P9MH 1ZGLA 4GQ9L 4S10A 2FEEL 5DRNA 5H37G 4C56E 5F9AC 5C9JA 1K3IA 4R2GC 1E27A 2PW2A 5F7UA 3OKKA 3F12A 1X5KA 1MWAH 1XGYH 4L29A 4KTEL 5TDOB 4UTAH 4G7YL 5FF6A 1MCLA 2VO5A 3GJFK 3FN0L 3HI5L 2J6EH 3SGKA 3N9GL 1A6UL 3ALPA 3LKSB 4HQQH 4NZUH 4PLJD 3M17B 4OI7A 1NCUA 4NO3A 2DQFA 3V4PL 4Q9CA 5IMMB 1EZVX 4IOFC 5DJZB 3STZA 1CDBA 3ARSA 2C7UA 1CT8B 4OB5H 5T1MA 3ROOB 4K8RH 2BNQB 4NKDA 3GUTA 3V8OA 4RCAA 4Y89A 3MUY1 5C7XL 1TCRB 5JPNB 3L7EA 1FFQA 3DX9A 1FNSL 3U7YH 4DVRL 1BIIA 1KCUH 2PXYA 1KPUB 5FUZL 3ZHLA 2XWJB 2WBJD 3MXWH 4PRPA 5I16A 5E2VL 4UB0L 3SE8H 3VU2A 1JNLL 3RHWF 1NUFA 2AXGA 2FHCA 4K2UH 5ANMA 1T04B 3UBXG 4QWWC 4PP1D 2DQDH 3FJTA 3HE6B 1ORQB 4F33B 4TOYH 3TBWA 1U8OA 4DK3A 1IBGL 3EYOA 4UDUB 7FABH 1ZHLA 1B4JL 5JXAH 1WZLA 4KHXH 3BN9D 4J23A 3S35H 5IMKA 1I8MA 3CCHA 4OZFB 4MCZB 3HPJA 1NANH 5C08D 3UTOA 2ZOKB 3BP6B 4JY5H 4DUWA 3RVXC 4RGNE 2A0LC 4CN1A 3D39B 1K4DB 3LRGA 5IGXL 1VEMA 2QQLL 4KDTA 5K9QI 4C57C 3CDCA 5TE7H 4MZ2A 4LASH 3QUYB 2IADB 3IRPX 2EEAA 1R3JB 3MRBB 4RIRB 3FAWA 4XWGL 1YMMD 1BFTA 1RU9H 5FB8A 5L2JA 3QT2A 3QUZB 2NY4B 1ZLVH 1BZ7A 3GSWB 5HGHA 1QLFB 4Z7VA 3X13B 1FN4B 5IEHA 5MEQA 2GHWB 5KSVA 2ADIB 4P2YA 4OCXL 1TJHL 3FRUA 4V2BA 5T3ZL 3D2UD 1AGCA 1R24B 3CH1A 3GMLA 4U1NB 5B3NA 5KS9E 2EDOA 2FWOB 3F6LA 5JA9A 1DJSA 3BQUC 2VDLH 3FN9A 4PJXB 5TF1L 3HZYB 3PWPD 1Y6KR 5GIRB 4KY1L 1MI5E 4OQTA 3QIWB 4JRXE 4RRPG 4X5XA 2NXZB 4ACPA 4LSDA 3VXOA 1FVEB 3P30L 3FO0L 5E1AB 4OI9A 3G6JF 4P2QB 1GZQA 2HJKA 1KFAH 3LQZB 5CINL 1WBZB 4HK0B 5EO9A 3LKRB 1I3GL 1HIMH 1ZGLP 1OL0A 4HZAA 4QOKD 5MENB 3TO2B 3E6HB 2CLVA 4F57L 2R2BB 2R1WA 3RDTA 5FYKL 1G84A 5EZIH 1AXTL 4OZ4A 1PVHA 3CDFA 5A40E 1A9EA 4TQEH 4UT6H 4MMZC 1FYTD 3V5DA 3OHXB 3ZTNL 4L9DA 2M26A 4M61A 3VI4E 4S1RH 3HFMH 5B8CC 3GIZL 3QFJB 5A2FA 1AE6L 1FVCB 5A16B 1FVDA 5TQ2L 4CU7A 2BVQA 5JOFB 5C09B 3FN3A 4GUPB 2VZ3A 1LO4H 1BLNA 2NY5L 3T0WA 3U1SL 4UILH 3KDMB 1IGML 4G9FE 3ZTJH 4B41A 3C2AH 3Q3GB 5F1IB 1NAMH 4ZUSB 3CVHB 3TVMC 3H0TB 3ULVL 4W6WB 1V3LA 4YHNA 5D1XD 3IDMB 2X4QB 2LAGB 4GXVL 1A7RH 5TFSL 1EFQA 3BIAX 1NGWA 2X9WA 4I13B 3D9AL 4Y5YC 1FG2A 5HGAB 3DX6B 1IGIL 4OM1L 1LO3H 1MFAH 2ZSVB 4HUMB 1AI1H 1NC4B 1RUML 1SYVA 3P4OA 3UXFA 3MRGA 3QJFA 4KKAC 3BZEA 3HE7C 4LSRH 1OGTA 1S7WA 3MUGB 1CWVA 1ZT4A 4D9RD 4U31A 1VACB 4Z77B 5E4EB 1DQQB 3RAJH 3OKDB 3L9RB 5J12B 3VXRE 2GK0A 4IRSC 2AJUH 4AMKL 3RIFK 4GS7B 4YHYC 3QHZH 4Z78A 1CDJA 3LH2H 3TN0A 2XZAH 3GBNL 4WJ5A 3ZTJG 1TZGL 1FNGA 1Z0MA 1LDSA 1IILE 2VE6B 4NUGH 1MH5B 3MRHA 1MJJA 1MLCA 4LRNL 1JHTA 1H5BB 5CEZL 3B8YA 2BNQE 5MP6L 3LV3B 4NT6B 5SWSD 1BVZA 3W2DL 2EDFA 2R0ZH 1FC1A 1MHHB 3JUZA 4JGUA 1IEAA 3ZT7A 1Z5LA 4R7DB 3SQOL 1TQCB 2DM3A 1N5YL 3ZL4L 2A6JA 2H1PL 1ZTXL 4ZPTA 4F7TA 1JL8A 5DI8B 2BY3A 4TNVF 3T2NH 3V95A 1INEH 4L4VD 3X17A 4JO2L 4P23C 4FFVD 3QJHB 3JVGA 4L3EE 4OUUB 5EU5A 1G6RH 2I9TA 3MNVB 4G9FA 4JJ5A 4JZJC 4KQ4H 4GG6B 5C0ND 4GMTH 4LMQI 1BGXH 3FQUA 3DXAA 4TTDC 1KCVH 1E0OB 3ARFB 3OBAA 1FJ1B 3HC4L 5BO1H 4QT5A 4AQ1B 1L0XA 1FO0B 3KXFD 1FNEA 4KTDH 2V5YA 4OKDA 1HDMA 4BK5A 4H20H 3IF1A 4FFWC 2LTQB 1INQB 5JXEA 3S37H 1M6OA 4QHNB 3VXUB 3QCUH 1KPVB 2Y5EA 5D72L 3RZCD 1CDUA 4EI6A 3OKOB 5K93A 2ERJC 3VXRA 1NEZG 4RDQG 1WCQA 3KLHD 4Y16D 2V2TA 3BH9A 2FEDD 4M6MH 4P0DA 5KAQF 5DK0A 3I3DA 4I48B 1A3LH 4J4PC 3KJ4B 2DQIH 4J8RB 1S7TA 4LLUB 1RJYA 3IVKB 2AI0H 1ZE3C 4XNUL 1JNJA 4YO0B 5TQ0L 1LEIA 4PJXE 4OD2B 3GI9L 1TJIH 4PJDB 4JFOB 4PYHA 4WFGD 3UTPE 2GUOA 4K7PX 5GRXG 4H88H 3SGEI 4O9HL 4N0CD 4QY8A 3FB5B 4LSPL 5GGRB 4NCDA 2IQAA 1BVKB 2IBZX 1T2XA 4BM7A 4GKSB 1CDCA 1YEDA 4KJQD 3C09B 3RL1B 12E8H 4P2QE 1S8DB 3HG1A 4G8IA 4JM2D 3VFSB 2Y06H 3U30B 5EBMA 5D6CA 1U3ZA 4YDIH 5IB4A 5I8EB 3UTQA 5MENE 2EICA 3KLAB 5ACZB 4KU1A 3Q1SH 3IDJB 4L3EA 3FAXA 2GTWB 4KC3B 3HR5A 1RJZB 1P4IL 3CC5B 3PHOA 4UV4L 4H5SB 3TT3H 35C8L 3ZHKA 1P2CA 4ELKB 3GSRA 2YEZA 3QIBD 5B38B 3EFFA 5K9KB 1G0DA 3ES6B 3BWAB 4RAHA 5TDPB 4XC3H 1KTLA 5F1KC 4Y5VC 4I4WB 4KKLD 3CGTA 5BXFB 3MJGX 1WK0A 5E24E 1BREA 1PQZB 1NJ9A 3QFJE 4UDTA 3I6GA 2CLZB 1T83A 1BVLB 1U8QA 3ARRA 4P2RE 4HUUA 2A9NL 5CHNA 2A83B 3SCMB 2WMPA 4JO4H 3OQ3B 5J89A 1NUGA 3VG9B 1QKZH 3ILPB 2AABL 3I75B 3SJVE 3WXWL 1PLGL 4JQVC 4P5TB 3TO4A 5D1ZD 4QXWA 1QR4A 4X6CF 5E6YA 3IGAA 5I1AB 4RX4D 5GGSY 1K8DA 1W72L 5DRXA 2VLJB 5E9DD 3QAZB 3MACH 4PTTA 4LBEB 5EO1B 2PYEB 1JFQL 2FL5A 4BUGA 4YHPA 2R69L 5IM7A 1T21B 2P49B 3WLBA 2ICWB 3MV8B 4PPTA 3V0VA 5GJSL 1A6TA 3TZVC 2BVPB 5C0AD 2DTMH 2VDPH 5IROA 4OZHB 1SHMA 1U8HA 4JRWA 5F7DA 4I3SH 3ARGB 1ULVA 4YHZH 3RVUC 1D3CA 3OPZH 3WE6B 4S11A 1ADQL 2CKBB 3EFDH 1IC5H 5BJTB 4NNYA 2X05A 2X4TA 5ESAB 2DMBA 5DJ0B 4LCUB 3JV6A 1TVBB 5IBTL 3G04B 3QNXA 1UXWA 2F74B 4G6AD 3MLSL 3WHE1 2DAVA 1YN6A 4UZGA 3U6RA 5EOCL 1VKXA 2VAAA 4FQLH 3CZJA 5FHBH 1A7QL 2GJZB 4M03A 3ULUE 4FTVB 5I8KH 3UTTD 4XB8A 2IH1B 2FO4A 4E9LA 2AQ3A 5BV7C 4BSJA 5IVXF 2YSSB 3HMWL 2FBOJ 1NGYB 3CFJA 4P2RA 5D7IE 3VGGA 3W11D 5GS0D 4GW4B 5T3XE 5T1LA 1QBLL 4PR5A 3SJVA 1JNHB 1UM4H 3H6JA 1DUYA 3SOBL 1WZ1H 4Y2DB 4RGMC 1A21A 1MNUL 2QR0A 3CXHJ 3SBWA 2DYPD 5I1EH 3SDAC 2XA8L 2AEWA 2H41A 2BMKB 3BH8A 1YPZA 2VXSH 1XT5A 2YPLB 3ZDYF 3VWJB 3FOLB 1QOKA 5HI5D 1YY8B 1UWGL 3WUWG 3W9DB 3MODL 4LU5H 5C92A 1KTDB 1VFAB 3MLTB 2AJZA 1CYGA 5L9DL 3VCLB 4K55A 4Q58C 4GW1A 3F58L 4MAYB 3QDAA 4GRWH 4P3WA 3ZYIA 2YD3A 4TUJA 3THML 5JORB 2MWCA 2ITDB 5J3HC 3SKOB 3NFPB 2KKQA 4XVUC 1J12A 1FGVL 4K3HA 2ZZUT 4NWUL 2Y07H 3HS0A 1LP9F 4XVJH 5HVHC 3QEUB 1KB9K 3UYRL 1A3RL 1T5WB 4OD3H 4FP8H 3HNTH 4LRIA 1NFIA 3DMMC 5ETUB 4XPAH 2AJVH 2VZTA 3MRQA 1EK3A 4PJGF 1AO7A 3CXHK 3RWGB 4NDMB 3D25B 4X7TA 5D7LB 5D7IA 1UH2A 1U95B 2FDBP 4YXKH 4GOSA 2GIYA 3O8XA 1MJUL 1F00I 2QSVA 4PRBA 3S98A 5J6GB 4HKBB 1CFBA 4RSVA 4Z7QF 2IQ9L 2FIRT 4HKXB 3WJJA 3O6MH 3HZMB 3B3IA 1YEHL 1OAQL 1YC7A 4U6VL 5BQ7B 5IOPB 2ZUVA 4MVBD 3EDJA 1GGYA 1QZ1A 4KDVA 3RUGE 4C83B 3HTLX 3KNBA 5E4IA 2B1AH 2VQTA 1HHGA 4YDKH 2P5ED 3U0WL 4R0LA 3QXTA 4I18B 3DSFL 5EU6A 5D8JL 3GRWA 1KN4H 3AY4C 2FB4L 2JJSC 3TWCH 1H3WM 4WCYH 4JFFB 2GY5A 5E2TL 2C1OB 1R3LA 5FYLE 4IRZH 2R23B 4ZAKA 4XPGL 2F5AH 3EYSL 5J57B 1L9MA 1RUPH 4RMRA 4OFVA 5I19H 2Y6SD 3HR6A 5CLWA 1YEEL 2EIZA 1J5OH 2CIKB 2VLJE 1KYOJ 4LVOC 3V5KA 4OGXH 5F97E 3QEQD 5DMYA 5E6IA 2NY0B 2ZWLT 2CKBL 3MV8E 4G8GA 4D8PB 2RBLA 3B4NA 2IALB 5EBLB 1OTTC 5C0RL 1P7QB 1VPOH 5FOBB 1JN6B 1OAXH 2GQHA 3KYOA 3SGEH 1KT2A 4M1GL 5I66A 3BEVA 2Z4QB 4KJPD 1M7IA 5GS2D 3MLYL 4LPYA 2B4CL 1FPTL 5LJYH 1OF2A 3O0RL 4PJCE 2N7AA 4N8VB 1HKFA 3D69B 3KS0J 1P9MC 3IDYB 4ETQB 2EE2A 3WXVH 3QRFM 5ITFB 3H9SB 3GJFA 1EFXD 4OBRA 3R4DA 1INDH 1PG7L 4DVBA 3RVVD 4LSSH 4PJAB 1OOAA 5BS0E 1IQWL 1S7XA 1RZJH 2PYFB 3HUJE 5T5NG 1YNTB 3P9LB 4YPJA 2YN3A 1HWHB 3PHQB 2AXFB 2X4RA 2AW2A 1FV1A 4JPWH 4NP4L 4JZNB 1CTOA 1T0PB 3AXLA 5AG9A 1KULA 2YD6A 1BOYA 2AV7A 4RGOL 1DN0A 3D3VE 4N90E 4X9IA 4EBQL 2PTVA 4F15C 3H9HB 1MCOH 2Y36L 3O41A 4N1HB 2HWZH 3BGMB 5EU4A 1ZSDA 1FRGL 2ATPA 3DRQB 4ZPVA 1S9XA 1YEFL 4IHOB 2ZOLA 5JNYB 1YECL 4L4JA 1VADA 1T66C 1MQKL 3GMNB 1VGKA 4PRIB 1GGIL 2NNAB 4MS8C 1V3KA 3I6KA 5DD3L 5DD0H 1IT9H 1T5XB 1AXSA 4NN7C 1XCTA 4JN1H 3INUH 3QDGD 4Y19B 3RRQA 2OR8A 4HS8H 5EUKB 3VXMD 1KJ2L 4HKZA 4M1DH 3U36B 2CDGB 3CK0L 2V5RA 4HS3B 5T1KB 1ZLWK 2YPLE 1BJ8A 3MROB 3LHPL 5AEAA 3ARBA 4ZUUA 2V7HB 5FECB 1F3RB 4ZD3L 1MFCL 5D9SA 3T0ED 1DQMH 5E5MA 1UB6B 4L1HA 5EOQH 5E8EA 4WUKH 2J1KA 1NKRA 3VMOA 5CUSL 5TE6H 2YD2A 3LDBB 4PJEB 8FABA 1I85C 3LQAC 5IKCA 4P4KC 4PJCA 1BZ9A 3QI9D 4H25B 1I4FB 2VSCA 2EYSA 3RTQD 3BE1L 3DUSB 3V9FA 2P42B 4MX7A 4Y4KB 3BPOB 1ZANL 1FZJA 1RZ7L 1UKTA 1F2QA 4EOWL 1XFPA 3BKCH 5BS0A 3OB0K 1OP5H 3HUJA 1R3IL 3IAPA 4MAUL 1LEGB 5HDOA 5I74B 3LD8B 3VFWB 5IV2B 1F6FB 5JHDB 3MRCA 4O5LL 3VFUB 4I5BB 1JRHL 4WO4A 3VJ6B 3PL6C 4GMSL 5IB3A 3O3AB 3S4SA 5FA3B 1XIWD 3D3VA 3ZE1F 3SDDB 1CU4L 1GAFH 1NSNH 2DQTL 4E5XA 4KMTL 2V2WA 4OLWH 5JPMB 4OIIH 3MV9B 1U91B 4BK4A 4ODXB 3REWA 5D7LE 1IAKB 3QDMB 4LAQH 1A7PL 2BDNL 3V4UL 4LSQH 2QHRL 4TRPH 2CJUL 1HCFX 4Y5XA 3WBDA 1EEUA 5GRYA 2IAMD 4HJGA 2YUZA 2Q8BH 4JVWA 1V7NH 3FQWA 4JHBA 3WFHA 2F8OA 4Y4HD 3P40A 1GGBL 1C8PA 2O61B 5IJVA 4WWKD 1IGYB 1KUMA 3AB0B 3K8MA 4PJ9D 5GPRA 3MRKB 1NC2A 2J4WL 1MEXH 4D94A 2Z92A 5DEGA 3WIFB 4FABH 4X4YA 4HWZB 3L6FB 3GRWH 1CE6B 1WEJH 4KI5E 2WNGA 4RNRA 1B4RA 4J6RL 1EAPB 2P8MA 1QG3A 3BPLB 3P4NA 3LZFH 4YQXL 4LHUA 2AEQH 1H9VA 4HZLA 4WDIB 3VD4A 4ZUTA 3CLFH 2ITCB 3KPMA 2DQCH 5ICYB 4WY7L 4EDXA 4YC2B 2VJXA 1I7UB 4HWBL 1AR1D 1N4XH 4QHMB 5HHNA 4JRYD 4XP6H 5EN2A 1AKJD 3T8XA 4S1DC 5GS0H 2AK1H 4NZRH 2WK2A 4MD0B 3G5YA 1AFVL 4MJ6A 2EYTA 2UUDH 1AQDB 2Z35A 1NGPH 3BO8B 2W0FB 3RWCB 3PIQA 3WEXB 3S34L 1CBVH 3VFNA 1QBML 3O11A 1PFCA 4CMMA 4ZTPH 1V3MA 4PB9H 1I1AA 3EOBB 4TTGA 1MUJB 5HHVH 3E3QC 1RZKC 3H9SE 4AH2A 3GJFH 3H3PH 1M7DA 1VFBA 1BQHB 5JW4M 5HDLA 1FSKC 3C8KB 5HJ3B 5IB5B 1RZKL 4P46C 1DUZB 4OUOA 1SBBA 3LQMA 5IG7B 3TBVA 4NN5C 5C0FA 15C8H 5E8NA 1YC8A 1HKLL 1Q38A 2H2SD 3ULVF 1FORL 3NH7L 3BPCB 2BK8A 4YXHH 2VN4A 2HVJB 1ZHBB 2X4UA 3NA9H 2R1YA 1FNHA 3BKYL 5IVXA 4UAOC 2XQBL 3GBLA 4DKFL 4PRIE 3CH8A 4Y16C 3IXTB 3PGFL 5SX4I 4MD4B 3VRJA 3WKMH 2ARJQ 2VLKB 1RVFL 4NQDE 5DO2C 4KKCC 4Y19E 1AHWC 2COQA 2EC9U 1KC5L 3KLSA 4KROB 3VWKD 4KKBC 3KGRA 4DEPC 5D93C 3IDXH 3HMXH 4LNRB 4NFCA 2FIKA 43C9A 2DJUA 3KPSB 3QPQC 4PREA 1HYSC 3HA0A 4ZYKA 4K94C 2VL5A 5FCUL 1WSST 2SEBA 5DSCB 4LSUL 5DWUH 4UNVA 4KJQC 2AK4B 3UTSD 3L5XL 3HPLB 5ENWB 4PJHE 1FL5A 4GRLC 2XN9D 2IPTL 3CFDB 3DJ9A 3X12B 3S37X 3DARA 4J3SA 5I18L 3FQXA 2ZNXA 5DRWA 3MCKA 2CH8A 5C0BE 1X6NA 5DJYB 4R4FH 1SBSH 3WDJA 1ZHKA 4PGJA 1IGJB 5F88A 5I71B 5AUMA 1U92B 4OF8A 1P7KB 4XBGB 1JGVL 3BQUB 4NSKA 3GM8A 1G7JB 3TV3L 1LO0H 4PD4K 4C56D 1KEMH 4QHKJ 3PWVB 2BY0A 5DC9B 4MSWA 5IW6A 4NBYB 3KYAA 4ODTL 2AJXH 3ELAT 3V7AE 4Q2ZB 4ZTOH 5JHDE 1N0XL 1XGRB 1MHCA 4JFDA 1Q0XL 1T3FB 4RISH 3NCMA 3GDBA 5F96H 5ACLA 1CVSC 3RGVD 3C60A 2IG2L 5DLMH 4CUCA 3L5JA 3S96A 4TUKH 4NO0B 3U48A 4JEGB 3OKMB 1OQOA 4JDTL 2G2RA 3O6FC 5DD6A 4ZXBC 2BVYA 2D31A 1MOEA 1U93A 4HMDA 4XNXH 4PJGA 1H3GA 2XFXB 3IDGB 5SWZE 5DFVC 3B83A 4I3RH 4DN4L 4UIKL 2O26U 4NQDA 5C70A 2RCSL 3RNKA 3ZSSA 1E6OL 1F3JA 3TYFA 3ZKMC 1ES0A 3QG6B 3DURB 5B8CB 3EJYD 2JIXD 5KAQG 1X9QA 4HBQA 2E7HA 4ZFOB 3JV4A 1K4CA 4MWFB 2OJZL 3L3DB 4K71C 2WM0A 3EYQC 3OGCA 4PGEB 1TVHA 3GFUA 3OJVC 2EDRA 3K74B 3LIZH 5LGKA 2LU4A 3T3ME 1OLZA 2IPKB 2YZ1A 3MLVL 1EO5A 1EX0A 4URTB 5C0DA 3Q6GH 3CLEH 2J8UB 2ICWJ 1YEGH 1FL6B 1UCBH 3TNNA 4BH8B 1YA5A 5EC1B 3PJSA 4HXAL 3T0BA 5JW5A 1JWMB 3TVMB 4D0CA 1B9ZA 5J13C 4QRQB 4BSVA 3SKNB 3D48R 1JZ5A 5FM5M 1ED3A 3BHBA 5C0BA 4F9PC 4IBLT 4RGND 4F3FB 4QRSA 3OJ2C 4ALAL 5I15L 1TVDA 5CP7A 5HYSA 2C3GA 2ICES 3DGCR 3SKMB 4DZ8B 4G80A 3ILQD 4Y5YB 3I50H 5F71A 3AM8C 3MJ9A 1DL7L 1T2QL 3DHMA 1QRKA 4YBQC 3HC0A 4M00A 2F54A 2X4NB 3HE7B 4E41D 4G7VL 4XCYA 5EZJA 1FFPB 3LS4L 3VXTB 4YHLL 2CGRL 2E8YA 3DTXA 3TA3D 2ZUYA 1LK3H 2E7LA 1N59B 2ZPKL 5DR5H 3O9WD 3V52H 1CE1H 4IRSB 3C5ZC 3MGTA 5IBUB 3LKQB 4P99A 2EH8L 3M1BB 4FRWA 5L88H 3MOAL 5DZOA 4G3YH 1IKNA 1F4WH 4FA8A 2H2PC 5DK2A 3NACH 3H3KA 4F9LC 2MPAL 3SKJH 1F90H 2XXCB 3CVIH 4OGZA 3T3PE 3CFEB 1MI5D 2JCCB 3DROA 4JRXD 3FT2A 2A6DB 5SWZA 5KZCB 4XWOD 1VFUA 5FGBA 3ULSB 4HPYL 4PB0L 1D9KD 2FBJL 2HVKB 5EU7C 4Z95L 3U82B 3RWHA 1KLUB 2BNUB 1WCBB 4DKAA 2R0WH 1MHEB 1IC4H 2OZ4A 2B39A 4UNTA 2JLLA 2F58H 5AAMA 5F9JB 2DWEB 2GSIA 4P23B 2XRAH 1G9ML 4GLRI 4MJID 3FO2A 3K2UH 4XBPA 2NW3B 5BZWB 1LMKA 5EOTA 2VLKE 2Z31C 4KPHL 4F58H 3WFBL 1UA6L 1F8TL 3T2PA 1QSZA 3NAAL 5DHVH 5CD3B 1QNZL 2E6JA 3P9MB 4NZJA 3QHTC 3LSOB 3MNWA 3GKWH 5BZDA 5CIPB 1JYNA 4BKLB 4V1DB 4G5ZH 5GXBB 3QZWG 1T0MB 3RWJA 2VDOL 4X7SH 2HG5B 1SJVA 1OW0C 3O4OC 3I85A 1J05A 2AJYL 5DQDL 3IJYB 4PP2A 5CMAB 3X3FL 2D9QB 5FDWB 1DLHA 3NCJL 1D5XB 2NYYC 2ERJB 1VCAA 5TE4L 1QA9B 1RUAH 5EPMA 5GZND 4DN3L 1IAIL 3DVFA 4L3CA 3BGFC 1PZ5A 2R56L 3UJJL 1LEKB 1E4WH 4R3SB 3T65A 3UPRA 2OTPA 4JAMA 2H32B 4KRNA 3O3EA 4IMKC 4LLVB 5HVGB 2K1MA 5EG6C 4GG6F 2Y1VA 4NUJB 1FBIH 1OM3H 1CG9B 1MY7A 2YC1A 1DQJA 2ADGA 1BX2A 2ICCA 2P8PA 2EXWC 4NKMB 3RA7L 1WAAF 5C0CB 3VXRD 4CVXA 5J6HB 3OKYA 4Z7NF 4NYLA 1LE9A 2RAMA 3OKEB 2NCMA 5FYKE 1R0AL 2HLFC 1SYSB 2G9HB 1WZKA 1UEMA 2R29H 3U9PH 4LCWB 2XY2A 4F8TA 4OCYL 1YMHA 3KR3H 3IJHB 4GKNB 4U1LB 3F7VB 5I1GH 4Y4FA 4NQCE 2BNQD 4PGDA 1EEZA 5SX4H 1YYMH 5IFHH 1SEQH 3EDEA 1AD9B 3WMSA 4QTHB 5I8CB 3GSXB 3K0WA 1B6DA 3HI6L 4WI3A 1U8IA 2RB8A 2C26A 4K3JL 1UYWH 2A74B 4PJDF 4XP4H 1DVFC 5FO7B 1LILA 1QVOB 3UJIL 4F7MA 2Q76A 5EU3B 3MV7B 4M8QA 2VAJA 1NMBL 1DQLH 3F7YB 2DQUL 3V4VL 1FCGA 4EDWL 5IHUH 1UM5H 1TNMA 4M6NL 4HFWB 3SE9H 5DMGD 3UCRA 2P24A 3I9GL 5GGTL 2VLRA 5I0ZA 1R6VA 4AL8L 5I1JH 4YUEL 2V6HA 3C6SA 4O2FB 1UM6H 3L3OA 1RK1B 1Q72H 3QUYD 4I3GA 4PRDB 5EO0B 3FB8A 1YNLL 5D4QA 1UWXK 3TZVB 1QFWL 3JV0A 1RFDH 5FUCC 1LK2B 1MVUA 1Q9KA 4WENB 3QUZD 2NY4D 1CGWA 2BERA 5IHBA 3U9UA 3PGCB 4HJ0D 2JE8A 2YK1H 1C08B 3FMGH 2J6EL 1QSEB 3GMQA 4NZUL 4HQQL 3A67H 4PV8B 3GSOB 4CVZB 2MTPA 1N8ZB 2CLRB 5HHXH 4JANB 5K9OB 3I02A 1X5AA 4K8RC 4OTXH 1F3DH 3U7AA 3V6FB 1N7MH 4ODSH 1KG0B 1I8LA 1HH6A 3EZJB 1LE5B 3KWWB 2AGJH 3ESVF 3QQ4A 2Q3ZA 3I2CH 1XGUB 1IGCH 1PW3A 2JJWA 4NQCA 1S7SA 4AJ0A 5HHOA 3A6BL 5CZXD 3NVQA 3LKPB 3K4AA 3GNML 2NXZD 3MCLL 1KCUL 1WWAX 3MXWL 4I0PA 2IBGA 1ZLUK 1U58A 5KTEH 1PEZA 1VSCA 4P2QD 3SE8L 5F6HJ 4D0BA 3QEGL 3WD5L 2YOCA 3DIFB 2IANB 5DQJB 1I8KB 1VHPA 2R1XB 3VFRB 1PBYA 5GRVK 5MEND 3JWOH 1RIHL 4OZHF 4TOYL 1FZOB 3SDXB 3QULB 3P4LA 1ND0B 3QNYA 4RGMB 5DQ9B 3RY6A 3W82A 4DZBA 1DBBL 4G6KL 1F4YL 4OCLC 4TVPD 1NEZB 1CL7L 1HQ4B 4JY5L 1CTNA 3CFBB 2E8ZA 4MNGE 1Q1JL 5TE7L 3GMOA 43CAB 4HWUA 4OKVA 3QFJD 2PW1A 3OAUL 4WW2C 4EN3A 5K59E 1OTSD 1ZS8A 1RU9L 4V1DE 4TUOA 4WI8A 4HH9A 4KTEH 5GGUB 4A6YL 1MCPH 3BZFA 3ARQA 5C0JB 4RAVB 1WWWX 1IAIM 4KJYA 3TIEA 3HI5H 1A6UH 4DTGL 4K7FA 3HCVB 2Q86A 1D5BB 1TCRA 1RMFL 5EFIA 1PJ9A 5D1QA 1CICC 4BFEA 2A6IB 3DO3A 1HI6A 3DWTA 2CRMA 3PDDA 5DK3A 1KIQB 1GGCL 4Q6YA 4WU5B 1DSFL 3EHBD 1XMWA 4GAYB 5C7XH 1QUNA 2DICA 3STLB 3BN3B 1U2HA 5E1HB 1JGUL 4APQC 5DJDA 4KMLB 5F3BA 3HE6A 5HVHB 5DC0A 1YN7B 1RI8A 1XCQB 4HCRL 1KJ3L 5FUZH 3QRGL 4U0RC 4M1CD 3C6LA 3DMMB 2ADJA 2VR9A 1I8IB 2A1WL 1P6FA 2EDWA 1JNLH 1KCSL 3GSQB 2EKSB 5IMLA 1ROWA 5FM8A 2OBGA 2BP3A 3FB7B 5I2IB 1AJ7L 1GXEA 4NNXB 3GMMA 4ZFFB 3D39A 1RAMA 4OFYA 3LEYL 2IFFL 1IRAY 5EZIL 1OPGL 3N1QC 2UZXB 1IBGH 3MFGB 4HG4K 1B4JH 4GLRH 4UT6L 5JIHA 4F7EB 2YXMA 3HZVB 4MLSA 4MQXD 4LHQB 4R9HA 4JZJA 3G5VA 3VRLF 5IR1A 1P84J 4PG9A 5IGXH 4FZ8L 4MNGA 4U1KA 5D70H 4ZFGH 4PRAA 4GW5B 2V9QA 3UO1L 3L3JA 1E4KC 4NWTL 2VDKL 4F7PB 1YYLL 3S36L 4AM0B 2GT9A 4KH2A 4YFLF 5HYFA 1FFNA 4XWGH 1Z3GH 1EJOH 3QXDA 4FXGA 4YDVA 3JTTA 2C4FU 2LE9A 1TETH 1ZT1B 4MD5B 3JTSA 3O8XD 4LGSB 5T3XD 1CCZA 3RPIA 4LQFL 2JB5L 3CIQA 1NAML 4WTZG 4G8EA 3MV7E 3IU4H 5GIRA 4UU9A 2ZJSL 5T3ZH 1A7RL 3UPCA 4G6MH 2LFGA 2YKLL 2JELL 3LRSB 1BOGB 1U8JA 2BNRE 5IVNA 3QEHA 5GSRA 1I9JH 4LVOB 1QFWM 2OJEA 2EXYC 3CMGA 2ESVA 1UKSA 2DQHL 4Z7UB 1RV6X 5TF1H 1LO3L 3EYFB 5IIEB 4U4BA 3NGBC 1HILA 4KY1H 3VXSB 4LLQA 2HJLA 3MFFB 2PO6C 4LSRL 4OFDA 4JFXB 2EYRA 3SGKC 5F9OH 1T1XB 4RFNB 3OB8A 2IPUG 2MCG1 3WCYA 3MBXL 4HFUL 2R2CA 4IRJD 1KJMA 4R97C 3VXUD 2AJUL 1IM3B 4ZAKD 1ITBB 2AEPL 3LN4A 1QSEE 2BHYA 1S5IL 1MJ8H 1DLFL 4KK8C 5IHZA 2BVOB 2DLFH 1RZIA 5J8OA 4CNIA 5FYKH 5FEBA 5E99L 1CXHA 5E6ID 5FGCB 2W38A 1CQYA 4KK6D 3ARDA 2EDHA 2PXYC 5C08B 4X83A 5C09A 4U1IB 3VXQB 3N0PB 4ELME 1B0RB 1WTLA 1Z0NA 2H3NA 3TBTB 3FO1B 1ODAA 3DVGB 4OV5A 2UWEE 1I7TB 4WHCA 5E00B 4ZUSA 3GIZH 4Y5VA 4CL7A 2NR6D 5TQ2H 4F15B 4EQ2A 2NY5H 4R4NC 3U1SH 4XMLH 4B7IA 1CFQB 2WWKT 1G6RL 4NRYA 2OX5A 3F7RA 2I9LB 3ULVH 4PJFB 3VFPA 1HHIB 1EHAA 5B39G 1K3ZA 1O5DT 3D2UB 4G42A 4LKXB 1NC4A 4NN7B 4GMTL 1W72A 4OZIE 4KDTC 2X1PA 5TFSH 2ZUUA 1HOCB 1DR9A 1UVQB 2VLLB 3MUJA 4YIQA 4AENB 2FECL 1QRNB 1TZHB 2NTFB 2BNRA 4WGVB 2D2OA 3D9AH 4MA7L 3GHBL 3PWPB 3WJLA 2JK5B 3CFCL 4GAGL 2HRPL 2Q7YB 1RUMH 4PJAF 3I6LE 4X6EB 3LEVH 4H20L 5KJRL 2YWZA 4ZDHB 1UZ8A 1G7MA 2P46B 2VE6A 2F8XC 4XZUA 5EBGA 3SCMD 1NGZB 1RJLA 1ADQA 4PGBA 3WFCL 4XX1G 4JKKA 3FFCE 4AMKH 5FYLD 5C0GA 2HT2D 2EDKA 3R8BB 1J9CT 1I1CA 1R3HA 1ZLWH 2IC2A 5CBEA 2ZUWA 3GBNH 1IAMA 4P4KB 3TBSA 3OXSB 2OSLB 4AIXA 2VLJD 4MCYB 5J9PA 3WLWD 3AREA 3RL2A 2PYED 4LRNH 1Q9LA 1G0XA 1NBVL 5CEZH 1A1MA 1T7ZA 3KS0H 4OZGE 5MP6H 2VISB 2AQ2A 4X8JB 3KPLA 1J8HE 3MV8D 3DO7B 4I9WE 2M1KA 4QHKI 4H88L 3B9AA 3T0VA 3W2DH 3QJHA 4ELMA 3NIFF 1HXMB 1FGNL 1A1OA 3PL6B 2EIEA 2WIIB 3ARGD 2UWEA 2W9LA 3SQOH 3MNZA 1QEWA 1QFHA 3ZL4H 2H1PH 4X98A 1J0YA 4EI5A 3WIIL 3RDTC 1WFTA 3BIKB 1ZVYA 3OB0H 3ARFA 5FO9B 1JTPA 4MXVE 2V17L 3Q1SL 2YR3A 3CFIC 4PJ5B 2VKXA 4U6HB 5HYEA 1A2YA 1EBPA 3VFMA 3PDOA 5CD5C 4OZIA 5HGDB 4PTUB 4PJEF 3RVTD 2OXHA 3SDAA 1ZT7B 1K2DB 3H42L 4LLMB 2VUOA 4PFEA 3QWRA 3D3VD 5HI4C 4JFQB 3T1FB 2I60L 2VITA 4ZNCD 4HUVB 3O2DL 3CPLB 5AAWA 4I48A 2NY1C 3CDGB 4FQ1H 4HDIB 2Q3AA 4JO4L 4JN2B 1K8IA 1QKZL 2YA0A 1DANU 3VGAB 4LLUA 1RULH 5D72H 3TEUA 4FQIL 3QQ3A 3ZMRA 2ICWI 3MA7B 5I75C 4OZFG 4A2MA 1EEYA 1OSZA 4X6FA 3FFCA 4Y2DD 2OTUB 1LD9A 5DHYB 4MNHB 1ZMYA 3MACL 4UOW1 1AXIB 4XNUH 4EIGB 3GI9H 4Z7UE 1QLRB 2YPLD 1MELA 1T1WA 4OZGA 4X80H 3VWJD 3NFSL 4LIQH 1RD6A 2VDPL 5DJ8B 3D0VA 3BUYA 3OG4B 4BH7B 1A4KB 4LSPH 1YJDH 3UTZA 2N7BA 3B5TA 3IB4A 5M94B 2BSRB 3OPZL 2HKFL 5HPMB 3TN0C 3WS6A 2O5XH 4LHUD 4ONGL 4TVPH 3SQBA 1HH9B 2RHEA 4MAYD 3K4ZA 4BFIA 3EJZC 2GW5A 2FJHA 2P5WB 1P4IH 4UV4H 35C8H 3WNNA 4F8QA 4XAWL 2DWDB 1AIFB 3MRNA 5JZ7C 2C3XA 1FSKB 2HN7A 3HRZB 1I3VA 2APXA 4P46B 5LCVH 1JWUA 4K9EC 5D71L 1KJVA 5CBAA 3DOSA 5IW1B 4NN5B 4P5TA 3QR2A 1NFDB 3D85A 3NCCB 4WV1C 5D5MA 3VDAA 2BSTB 1EXUA 3JVGC 1CFTA 2WW8A 3JBG7 1CQKA 1CLZL 1GC1L 2VXTH 1K5NB 2FYYB 2AABH 5D7LD 3RZCB 1CFSB 4UAOB 2CIIA 2QQQA 3AY4A 3WXWH 1PLGH 5KVFL 4Y16B 1GIGL 2HJFB 4PJ7E 1CI5A 1LHZA 1MRDH 1AGDB 1AHWB 5KG9A 1F4XL 3RX7A 4UNUA 2A2QT 4NM8L 3VMNA 1MREH 5DJ2A 3NBNA 2VXQH 1QRNE 2VXSL 4DEPB 2R69H 3BRGC 3MO1B 3CFKA 3L3GA 2YRLA 1FFOA 3GSNL 1T1YB 5BJTA 3K8LA 5GJSH 3BEWA 3WNPA 1MIEL 3CD4A 5JXEC 2C3VB 3VDBA 1CD1B 4FXKA 1WT5A 1X5HA 5F6IB 4NNPH 2HFEB 4KI5D 1P6AB 2DLTA 3UZEA 3WN5A 4GRLB 2D4DA 5CKGA 4YFLI 4JFFD 5DRZA 1NUNB 2R2EA 1YQ2A 1ADQH 4Z0BL 1IE5A 1A9BA 1RQ5A 2X4OA 2Y25A 2JJUA 3MLXL 1T7WA 4ODHL 4FTVA 3RFZC 5IBTH 3VRIB 1P9MA 3TPUB 3GGWA 2GTZA 3AC0A 3MLSH 1XF1A 5CJ8A 5EOCH 4XVJL 4JDZB 4ORGA 1I7ZB 1BD2B 5DJCB 4FS0A 1A7QH 1P7QD 4OD3L 4U6YB 3HNTL 4U2ZA 3QXAA 1XGQA 3LN5B 2HLAB 5I1KL 4Y1AE 4KV5F 3DGGB 3J7HA 1MPAL 3HMWH 1URLA 4JPIB 3H7BB 3IU3B 3QQ9D 4LCIL 2A73B 3UJTL 3PWJB 4XMPH 4GQPH 5IFJB 4LEXL 2BMKA 2GAZA 2NY6C 1QBLH 4OAWA 4ZXBB 1A6AB 2FLBT 1FO0H 4YZFF 3H9SD 3SOBH 1MNUH 1AC6A 1RK0B 4PJ7A 3RBGA 5E9DB 5ITBH 5L2KB 1KJ2A 3PQYE 2XA8H 4YAQA 2AERT 4YBHA 4FG6D 1Q0YL 5GZOC 2B5IC 1KB5L 1ZHNB 4DGVH 1MCIA 2DDQL 2Y7QB 5KBNC 1UKQA 4O2EB 4HAFA 2YUXA 3NZ8A 3MRDB 2XV6B 4K71B 4PBXA 1JTOA 1A6ZB 1HEZB 3MLUL 4J3XA 1ITCA 3KPOA 4C54A 5KANI 1T89A 3TWCL 2ITDA 3MODH 2M8XA 4Z7WE 3TO4C 3GSUA 4AIZA 4PRID 5L9DH 5J13B 3OKLA 1NCCL 4QCIA 3F58H 4NQDD 4TVSa 4QRRE 2ENSA 4Y19D 4H1LG 4S0SD 4LP4A 1JUFB 2OI9C 5DJ6B 2O93L 4PJ8A 1FGVH 4HJJL 5CSZA 3L95A 3H3BC 2AVGA 5T1KD 3S5LB 1VPOL 5INCB 1U8MA 1JI1A 5DTFB 3OKNB 4U6XA 1R5IB 2Q87A 1ONQA 3DECA 2BSED 2XZQL 4Y1AA 2E7CA 3IDUA 3OG6B 1EA9C 5HYQB 4XCFH 2JB6A 3C5ZB 2GY7B 4RA3A 3ARWA 5C0BD 3U0TA 1B2WL 3RIAK 3EGSA 4NPYA 5IF0A 1W0VB 4HWEL 4P5MB 4LVNC 1MJUH 1RZJC 1BQSA 1BZQK 2J8UF 3C9NA 4HKJB 1KV3A 2HT4C 1JGDA 2IQ9H 2P5WE 1CGYA 4LSSL 4Y4KD 3PP3K 1T1ZA 2YBRB 3TM6A 5HD8D 3D0LB 3FOMA 1YEHH 1OAQH 4U6VH 4XB7A 3PQYA 2L7JA 4BFGA 1BFOB 5JHDD 3MRIB 2X5PA 4H26B 3Q6FB 3KPRE 3KPQB 2DOCA 4QRUA 5MHSE 1QP1A 2R23A 3AU1B 5IMOA 5F6HI 3U0WH 3SDDD 3QDJA 5DDHB 2NLJB 4XPTL 4DAGH 5H35B 5ESVB 1ACYH 4UBDC 5D8JH 5ISZA 2FB4H 3IDIB 1F5WA 2OQJB 4F7CB 2E9BA 4Z7WA 5E2TH 3SBWC 1UENA 3VG0H 5B38G 2FJFB 1JV5B 3IXAA 1F13A 4XPGH 3UROR 3EYSH 3WO4C 2IALA 3MRPB 2Z31B 3HRPA 4QRRA 3QB7C 3QCVL 5D7KE 2Z4QA 1DQTA 1S78C 4YHIB 4M1DL 2ATKA 4HWBA 1DE4A 1GZPB 1Q94B 1FL3A 3OWEA 4NQEE 4ODWA 2ZCHL 1MFDH 2CKBH 5CGYD 3QHFL 4XVTL 3MRRB 2JCCF 5C0RH 4JFPB 4HULB 2G5RA 4EUPB 5DS8B 1DQML 5T33L 4M1GH 4MNQE 4N9GA 4HWNA 3F65A 4MXQD 2LU7A 3MLYH 4HS6A 5ALCH 4M43L 2B4CH 4U6TA 1FPTH 5GHWH 4QYOA 3BP5A 3O0RH 1GVIA 4WFFE 4F37K 1OB1A 1LO5A 1D6EA 4CADA 5LGJB 3O45A 2BRQA 3U83A 4JCLA 3BGFB 4ZO7A 1AD0B 1S7QB 4JLRA 1PG7H 3ZYZA 1M05B 2HFFB 2E5EA 1PKQE 3MA9L 3SDCA 4LRIC 3ULUC 4FMFA 4R2GD 4WWID 1H8SA 3GMNA 4EQ3A 5DHXB 4NP4H 2WLYA 2ZG3A 3KPRA 4EBQH 2UVEA 3MBEA 4RGOH 3RI5K 4S2SB 4R90H 4Q0XL 2Y36H 1UJTA 4W4NA 2J5LC 1QACA 4RAUA 1FRGH 1NSNL 2JJTA 4X99B 4XP9H 2H6PA 4S1QL 1BQUA 1YEFH 3EKCA 1YECH 2VZ1A 3O6LH 4IOFD 1MQKH 3T1WA 3WJJC 1A1NB 1GGIH 3BKJL 2EDBA 5DD3H 4LSQL 5F72S 4IIQB 4N0FA 3OL2A 4TRPL 2FSEA 3BYTA 5ID0A 5HHQA 1L7TL 1QO3A 5A2IH 2K7PA 3JZ7A 3BWUC 1UZ6F 3CK0H 3UX9B 2CDFA 4R0LC 1I75A 3CXDL 3P11H 4LQ1A 1U3HC 3LHPH 4NQEA 5FGSA 3L3IB 4OF3A 2EE9A 1NCDL 4GXUN 4ZD3H 1DVFB 5GISH 1FIGL 4QWWD 1XF4A 3G6DL 1IL1A 5EWIL 4L8SA 5FKAA 4FFZL 1WEJL 4MNQA 5FDYA 2XNAB 8CGTA 1H15B 5I17B 3LN9A 3IFOA 1TQBC 3CMOL 2VLKD 4OGYL 2G75A 2AEQL 1C5BL 3VJ6A 3RVXD 1CIDA 1X5LA 2A0LD 3CLFL 5E6IC 4UQ3A 4BQ9A 1EHXA 5EIIB 2CSPA 2O5YH 1ZANH 1MWAB 1G7QA 4XNMB 4EOWH 4U7KA 1AR2A 1FE8H 2NX5E 2HFGH 4U7MA 4XP6L 4X6BA 4MAUH 4NQSB 4MA1C 3G6AA 1ZVSB 4ODXA 2IMMA 3OXRB 5GS0L 1JRHH 4NZRL 1QSVA 4GMSH 4LHUG 2AK4D 1E6JL 2GI7A 3WS3A 1JPGA 3AUVA 4HGKC 4WI7A 1OY3B 4AY0A 4XP1L 4CAGA 5C8JB 2QEJA 2DQTH 5AD0B 1UWXH 3BOVA 4HGWA 2G5BA 3RIAF 4PB9L 4P4RA 2H26A 4QRTA 5HY9A 1A7PH 4HV8A 1Y6MR 2BDNH 3DVNA 3V4UH 4D0DA 5CWSB 3QDGB 2QHRH 3BQUD 25C8L 2CJUH 1T0NA 3VXMB 4GAFB 2NY3C 3EDKA 5MI0C 5GSVB 3B8SA 4HHAB 3QWQB 2Y4SA 2DTSA 4NFDA 5EU7E 4XP5H 4JDVB 5F3HB 1KACB 1EZVY 2J4WH 1G9NL 1ZA6B 1XF3B 2YD1A 3SY0B 4WHTA 2DQGL 5MEOB 3QZWB 2X89D 2I24N 1DDHB 4YNYA 1NCWH 4J6RH 1T80A 1I7UA 1ZLUH 1V3JA 2NY7L 4NQCD 3VH8B 4YQXH 5CCKL 1BPVA 1BHGA 32C2A 4QHUA 3RTQB 5MERA 3NPZB 3WLWC 3W39B 4HIIB 3B6SA 3W0WE 4Z5RB 2IF7A 2R9HC 4LDLB 2DI7A 4KRPC 4WY7H 1KLGA 4G8FA 2CUMA 3HMXL 3ARBC 2R39A 5CAYB 4XMKH 1RUQH 4HWBH 1A7OL 3BO8A 1KCRL 3E8UL 4WW2B 1UQSA 1TLKA 5GQBA 4XGZB 2NX5A 4MJ4A 2Z93A 1I1FA 3EIFA 1AFVH 4N8PA 1TENA 3TVMD 5C07B 1IAII 4R7NB 2D0HA 3RPKA 1EEQA 3UYPA 4HIJB 3T2QA 2Q6WA 1P4LA 4R4FL 4RQQA 1CICB 1QBMH 4P2OA 3L7FB 3TIDB 2R4RL 4F37F 1A6PA 2VKWA 1Z9LA 4EIZC 4DCQA 3SDXF 4PJIA 1CF8H 5ESQB 5EUOB 1GOHA 3BPCA 2IAMB 4PBWD 4WO4C 1OAZL 4MDIB 1QSFE 2AJXL 4KKAD 4RDQF 1IAOB 4Q9BA 3HE7D 4ZTOL 5JLZB 1I7RA 4U0RB 5FYJU 5I6XC 1HKLH 3C5SB 4ZQKA 1FORH 5F96L 4QRPB 3L3HB 1CXLA 4N8VG 4JVUA 1JTTA 3ZYOA 4RMQA 4IRSD 4LPXA 1WBXA 2W1NA 2X70B 2ZCLL 3BKYH 3WIHL 2BSSB 2D7QA 4BZ1L 4DKFH 1LNUB 4XNXL 5EC2B 3GHEH 3KPSA 3N1PC 3PGFH 4XRCB 4J12A 4XCCL 3GO1L 5FFLA 5LQBH 4I3RL 1ZWIA 2ZUSA 5JUEL 5KZCD 1KC5H 4O51A 3QUMB 3ROLA 3W0WA 3TNMB 5CZVL 2W65B 2UY7A 3NCYS 3V5HB 2E9WA 3BP7A 4JPVL 1AKJB 4FQ2L 4U3CA 4JY6A 5LBSL 5FCUH 4IMLB 2VQ1B 3LIZL 1KENL 4LSUH 4TYUA 3L5XH 4L8BB 4OCMC 1S7UA 4P23D 4WUUE 1K6QH 2IPTH 5KSAA 3G5ZA 2OXGA 1QR1A 4O58H 4S0TD 4LLYA 4X7FC 5LGHL 3U2SB 2P7TA 2NW2B 1UCTA 1HXYA 3BKML 3RWEA 2YRZA 4TTDD 1ZGLB 5DRNB 5C9JB 1JGVH 3I50L 3TV3H 2PW2B 4KJWC 3OKKB 1MCKA 3F12B 4Q6IA 3NGBB 5JO5A 2GJ6A 1FLTX 4L29B 2PCPA 4IDLA 1CD8A 4V1DD 2H8PA 2ZKHH 3S97C 5FF6B 1QSFA 4FFWD 5FUCE 1OGAA 3NCEB 1Q0XH 4FQXC 5F1NA 3V6BR 5J1AA 5FIEA 4NO3B 4R97B 3STZB 3V52L 1CE1L 4ZG1A 5KSBE 2C7UB 2R0KH 2IG2H 3RWIB 1I1AC 5T1MB 2BXZA 2V2XA 1V8HA 5GGSB 1F4WL 4LLDA 1UJ3A 3ZDZF 1XGPA 3LKOA 4K23L 4J4PD 5JIIA 4OD1L 3L7EB 1F90L 3DX9B 3V7AG 1BIIB 2PXYB 3TCXA 2XI9A 4UIKH 5A2LH 1QYGH 4PRPB 2RCSH 3VWKB 1E6OH 5I16B 1EJ6A 3BAEL 2J8UA 1DZBA 1FL6A 1FIEA 1EERB 2AXGB 4FQPA 5LAXA 4WU7A 5ANMB 1C12A 2V5TA 4HW6A 5C0CD 2OJZH 2FCBA 3TBWB 2NY2C 1NLBL 1U8OB 3MLVH 1FH5L 3EYOB 4LARL 1PSKH 1ZHLB 3SKMA 5I9QC 2PKDA 4HXAH 3BW9A 4WUUA 2QHLA 5IMKB 1I8MB 3CCHB 3N06B 3HPJB 2EH7L 5GGTA 3HI1A 2X4NA 4YR6B 4M7KL 1A4JA 1D5ZA 3QUXA 1DFBL 4ZFZA 2W91A 5L2JB 3DYPA 4DKDC 3B9KA 2APBA 1T2QH 2XA3A 5IFAL 4G5ZL 2AQ1A 1OAYH 1BZ7B 3UBXA 5HGHB 4GBXA 4Z7VB 4G7VH 1N26A 1R5VA 5MEQB 3LS4H 2CGRH 4ZUWA 2J6EA 4NO2A 5KSVB 1S9VA 2VZUA 4JKPL 3FRUB 3MV7D 4KK9D 3G5XA 1AGCB 3QIUC 2JCCA 5IVZA 5ICXA 1J1XL 3GMLB 2WP3O 1RUAL 5JOPE 5KSBA 5C07E 5LKNA 4ONFL 3MOAH 5BVJA 1XAUA 2F9BT 4M5ZL 4YFDB 2FJGA 1PD6A 1A3QA 2MPAH 4X5XB 2BNUA 1N0LA 4PJFF 4N0RA 5EUOE 4HPYH 4PB0H 3TZVD 2WWMC 2FBJH 2QSTA 1OT2A 1GZQB 2JIXB 1RHFA 2HJKB 1T2JA 2FHFA 4Z95H 3RHWK 5EO9B 3C60C 5C2UB 3RVUD 1QSED 1YNKL 1PGRB 4QRPE 4Q9QH 2CLVB 3RDTB 3JV5A 3OR6A 1WWCA 5EDXA 1MSPA 2R29L 3VGBA 4OZ4B 5D7JA 2L7UA 2PR4L 1G9MH 3VE0A 1A9EB 3O3BA 5I1GL 2OL3L 5CZKA 1BQHG 3V5DB 2AJSH 1G7LA 5F7MC 1YDPA 7CGTA 3OX8A 1RIVL 4M61B 1U36A 4R26L 4KPHH 4RGNB 3WFBH 2HG5A 4X4ME 3T77A 3UAJC 5IHLB 2IBZY 1FAKT 4KK5C 1SJHA 1FVDB 2BVQB 2F53A 1BLNB 1KIPA 1XH3A 2BRRL 2ICEA 2VDOH 4A6YA 2NY1B 3AS0A 4HUWA 2XTJC 4WNQA 1A6WL 5DFWH 1LEKA 3NTCL 5DQDH 3RX5A 3TJHC 2FNBA 1ERNA 4YHNB 3MQIA 2HAZA 5HHPB 3NCJH 1SJEA 1U41A 5I75B 5TE4H 1UM5L 5IHUL 4U3XA 2KDGA 3SE9L 1NGWB 5DD5H 4DN3H 1IAIH 5AZEL 1H3XA 5I1JL 4OSUH 3MYJA 3SDAD 3I3EA 1FG2B 3LEXA 4YHOL 2XZZA 3E2HC 1UM6L 4BQ8A 1SYVB 4DGYL 4KVNL 3MRGB 3QJFB 1MI5B 5J6HA 1OGTB 4X6DE 3I6LD 2QADC 4POYA 1ZT4B 3U4AA 1RFDL 1SYSA 2X6MA 2E7LC 3PXHA 4APQA 2GK0B 3RA7H 2ARWA 2XG4A 2YK1L 4Z78B 4U49A 3TN0B 4NRXA 5GRUH 4WJ5B 1O0VA 1IKNC 1FNGB 1KXQE 1S9YA 3F7PC 3O4LA 1R0AH 1WJ3A 4CVUA 3MRHB 1MJJB 1MLCB 5I8CA 1JHTB 2WLZA 3JWNC 2IMNA 2ZP0T 1IGCL 5J3HD 5FGBC 2O5ZH 4XVUD 1LGVA 5EIVA 4IDJH 1J8HD 3BPNC 4I9WD 3ETBF 1RURL 5H37H 4X5WA 4P57A 4MXWL 1IEAB 2VR5A 1Z5LB 4PRPE 4R96A 1QFUH 1UADC 2A6JB 4YGVA 4ZPTB 3DMMD 4F7TB 3LS5L 4ISVA 4K3JH 4NBXB 3GBML 3H9ZA 5ELIA 1Z9OA 1OHQA 5EU5B 2I9TB 3DV6A 5T5FL 1F6AA 3JWOL 4G9FB 1NAMA 4JJ5B 3UJIH 1WWBX 3AAZA 3BD5A 3G9AB 4L5FL 1NMBH 2R8SL 4J3VA 2DQUH 1KGCD 3V4VH 3DXAB 4M6NH 2ADFH 3MRLA 3I9GH 5GGTH 1MCWM 5AYUL 4YUEH 4QT5B 1N5AA 3PWUB 2RIKA 3D87B 1FNEB 2ILLA 2BVUA 2ZUQB 3DUUB 1HDMB 3IF1B 3C8DA 3CX2A 1ORSA 1YNLH 2GSGB 3V6FA 4X8XA 4X6DA 1QFWH 2V5MA 1M6OB 1T7VA 4LGPB 3UPAA 1WICA 1MCPL 2W9EH 1KNOA 2PO6A 4Z7VE 4EI6B 4TSBL 1SM3L 2H9GA 3VXRB 4HIXL 2V2TB 3BH9B 3CNKA 5DK0B 5EH1A 4AEIL 1NFDF 3GSVB 4QXTB 4JZOA 1RJYB 4JHZA 3QO0A 2GEEA 3SE3A 2EKJA 2DKSA 1X44A 1VGEH 1WBYA 4NZTL 2PUQT 3IETA 4L4TE 2GUOB 1QHPA 4RZCA 5FO8B 2IANA 5DQJA 1CR9H 3LKNA 3A6BH 5D2NA 4JFEE 2EDXA 2QLVB 2IQAB 5E94A 1PG7X 3VXSD 3GNMH 3F5WA 3MCLH 3FL7A 1YEDB 1OTTD 1S9WA 1KPRA 4MZ3A 3BRFA 4LF3A 1J87A 3T4AA 5F93C 3HG1B 3SDXA 4G8IB 3QULA 2HA1A 3NZHL 5IBUG 1D5MA 4TNVK 5EBMB 5D6CB 2NXYC 3QEGH 2G60L 3WD5H 1NEZA 5IB4B 3UTQB 1C5DA 5E6ZA 5FA4A 5IJKA 4L3EB 1G6RA 3EYVA 1MHPH 4Y4FC 1MAML 1RIHH 3HR5B 3PHOB 1CFVL 2NY6B 1ETZB 5INDB 1P2CB 2DIBA 1U8KB 5CILH 3GSRB 2YEZB 5L8JB 3EFFB 5DGRA 4JM2F 1DBBH 4G6KH 1H0DA 1F4YH 1KTLB 1CL7H 4H0GA 4H8WL 4C59B 3G08A 3ZDXF 2YZ8A 5D70L 4ZFGL 4PGCA 1Q1JH 2VABA 2X4SA 4UDTB 4JFHE 2PF6A 3I6GB 4ENEC 2EECA 1U8QB 1JZ8A 4HUUB 5CHNB 3FRPA 3OAUH 1OAUH 2XKNA 1Z3GL 1EJOL 5JA8B 1KTRL 4NHCL 3TGXA 1TETL 4L1DA 4A6YH 1T66D 5JTWA 3WHE0 3IU4L 5LWYL 4DTGH 1VB9A 4MS8D 1K8DB 5DRXB 3TH4T 1RMFH 4L8CA 1U2CA 4G6ML 3RX8A 2DI9A 1HSBA 2FL5B 4YHPB 5IM7B 2V7NA 1I9JL 1GGCH 1T6VN 2XWTA 1QRND 3V0VB 1JZ6A 4XNZC 1A6TB 1DSFH 1NH6A 1PG7W 4AK1A 4L8DB 4L4TA 4LLWA 4M6OL 1P7HL 1U8HB 1JGUH 1XZ0A 5F7DB 1CLOH 2CDEA 4JFEA 5H94A 4HCRH 1KJ3H 4M5YH 3QRGH 4CMHC 5F9OL 2CXKA 5D2LE 2B8OT 1JMZA 1Y0LA 3N1MC 4NJAH 3ZKXB 2A1WH 1CVRA 1NMCC 4XHQA 1SY6H 3ISWA 3MRMA 1KCSH 4LCCA 1DTUA 5FUOL 1RZGA 1I8LC 4XI5C 1AJ7H 2X4TB 1MJ8L 4O02L 2VERN 1IM9A 5EZOL 3JV6B 2GFBA 2VN7A 3ZKQD 2DLFL 4P4KD 2IEPA 3LEYH 4LVNB 3QNXB 2XY1A 2FX8L 2IFFH 1OPGH 1IC1A 1YMME 1YN6B 3U6RB 1BWWA 1M71A 3V0WH 2VAAB 4M4PA 1Z9SA 2XT1B 4I0PC 4MD5A 1A8JH 2FO4B 1NBZB 1GOFA 4FZ8H 1WISA 4DQOL 2QQKL 3UO1H 2DIJA 5I30L 2NY5C 3PL6D 4NWTH 2VDKH 3CFJB 1YYLH 3S36H 4L9LC 2BJMH 4P2RB 4XBEL 3O2DA 5A3IC 2R15A 1F11A 3PP3H 1WC7A 3ULVC 3OF6D 5T1LB 5SWQA 1KELL 4PR5B 5HYJE 2ZG2A 3SJVB 2FZ3A 2GITB 4XMLL 3VI3F 3ZYJA 3EOYG 4OLZL 1DUYB 2PTTA 3HLAA 4LQFH 2JB5H 3RY6C 5HGBA 2QR0B 2W59A 4WI9A 2MKLC 4PJ5D 3PXJA 2ZJSH 3GMRB 3DXAE 1JE6A 3TH2T 2YKLH 2JELH 2WBJA 4V2CB 4OGAC 1YPZB 4MQ7A 4A2LA 4L3AA 1P5UA 4EN3C 2DQHH 4NFBA 2DB8A 3LEVL 3T04D 1AGBB 3NCFB 3VFOA 3WNKA 5DXWA 2AJZB 3P2TA 3VFTA 2HTKC 3P77A 3ZE0E 1FYTE 2FGZA 3FTGA 3KPTA 3MBXH 4HFUH 1BIHA 5D2LA 4GW1B 3BVNA 4M9PA 4GRWE 5D1QC 5F89A 2AEPH 1MY5A 1G7HA 4KXZI 5C08A 3W9EA 5I8OL 5FYJD 1S5IH 3T0DA 4TUJB 4QXGL 1DLFH 4PV9A 1JPFB 1C1EL 4HSQA 3HC3L 3TJEH 5HGGS 5E99H 2EC8A 3HS0B 4NKOA 1YMMA 1FZKA 3HE6C 3U46A 3P4MA 5AZ2L 3C6LC 5JDJA 1NFIB 2D9CA 1UB5A 2Y5TA 1IGTA 2C1PA 3D5OF 1CFQA 5IB1A 4KUCD 3WL9B 2HT3D 2L4OA 4S1DD 3WUWA 1FC2D 3MRQB 3HG1E 4RA0C 1AO7B 2XG5A 2J5LB 4X7TB 5D7IB 4O2CA 3O8XB 1QTYT 4JFZL 3MRFA 4EKXA 4RBPK 4WV1A 1FZMA 1J0HA 4PRBB 5HYJA 4HF5L 1JNNH 4WFED 1N64L 3AMLA 1P4BL 2P5WD 3B3IB 4LMQE 1OARL 5IBLC 1GOGA 4Z6AT 3QXVA 4YDJA 1QPXA 3NIGE 4H1LB 3KNBB 4P46D 4TSAL 1NGZA 2EDJA 4UINL 5CKAA 4MA7H 3GHBH 1HHGB 2YN5A 3GSNA 2X1XR 5MHSD 3CFCH 5DVLA 2W0PA 4R0LB 3KPNA 4GAGH 2HRPH 4QOKA 5ADPH 5KSUA 5EU6B 3WFEL 1MIML 3KPPA 4LPTA 1JZ4A 1TTGA 5KJRH 4HMEA 4FQ1L 3L3KA 4XPFL 4BUHA 4LPWA 4FQJL 4OM0L 1R3LB 4IRJB 1RULL 3QIWC 3WFCH 4ZAKB 2J2ZA 1FYTA 5I1HL 4HXBL 1MCDA 3BJLA 1TQBB 2ZSWA 2EIZB 1KIRB 4JM4H 4GAJL 4Z0XA 5HPOA 5DO2D 3BXNA 2DKMA 4DKEL 4KKCD 3V5KB 1OLLA 4U05A 5D7KD 1XF5A 3NIDF 4UIMA 4W68A 4X0KA 5E6IB 4KKBD 4KVCL 1NBVH 2IGFH 2UZIL 4L4VE 4BZ2H 4JGMA 4X80L 3QPQD 4UV7L 3CSYA 3KYOB 4LIQL 1KT2B 4X4ZA 1HYSD 4PRHE 4G43A 5I66B 4MA1B 3BEVB 4CW1A 1YJDL 1QPPA 1FGNH 4WGWB 4YH6A 1OF2B 5D1XA 4FN0A 2CO7B 4GRLD 2KUTA 1MF2H 2O5XL 4ERSL 4TVPL 3WIIH 4WFFD 4AQOA 5BW7A 1GGTA 3VXPA 4LPCA 1RUKH 3GJFB 3DNKA 2B20A 2V17H 1U9KA 4DVBB 3MZTA 3ARDC 1AY1H 1S7XB 1JWSB 2XKUA 2QSCL 1OD7A 4M62L 1EHLL 1A7NL 1FV1B 3CDGA 4Z7OF 3RWFA 2NY3B 3RUGB 1NKOA 2VDQL 5LCVL 1KB5A 1BD2D 1DN0B 5C0IB 5MI0B 4B50A 5B3JF 3QNZA 3H42H