5CEXA

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
207
Chain Sequence
TQPSQLSVAPGETARISCGGRSLGSRAVQWYQQKPGQAPVLVIYNNQDRPSGIPERFSGSPDTTATLTISRVEAGDEADYYCHMWDSRSAINWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody 9H+3L Fab light chain
total genus 43
structure length 207
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA01
1IFHL 4R0LB 4UTAH 4KI5E 5DLML 1UZ6E 3B9KA 3F7RA 1JWUB 5JIPA 2BVPA 3QIUB 4XMLH 5E8OA 1QYGL 3S5LG 4P2RB 4XCYB 3MRRB 2CKBA 1NGXB 2D3VA 3S4SA 1YN6B 2YPLB 3AAZA 4KROC 3TZVA 1N5YL 5EZOL 1YECH 3RUGB 2XZCH 3GRWA 5IHZA 4Z0BL 5D1ZA 4UIMA 3QXUA 2EDKA 1X4YA 1HZHH 3E3QC 3N1MC 4GRMA 1T03L 3QDJA 3RA7L 3MCLH 3BKYL 2EO1A 4L1DA 3U46A 1CVSC 4KZEH 4HIXL 1U6AH 5DO2C 1NDMA 1QOKA 1A47A 2H6PA 2QBWA 3MV7D 3SDXB 4PRAA 3CVHH 3QUMA 2L0DA 1OCWL 3UEZA 4ZFZB 4NHCL 1CLCA 2YSSB 1F02I 1NBZB 2VUYA 4OBSA 3QI9D 4U2ZA 3IAGC 1GIGL 5E2VH 1ZOXA 4HKBB 5F7MC 2LQRA 1C08B 5DJ6B 4F37K 4KKAD 1WCBB 1XGTA 3QXWA 4PRDA 1O5DT 1CBVH 5KTEL 1T1WB 4MB5A 4UIMB 3ARSA 1FZKA 4EDXB 1A3QA 3ZZ1A 2PETA 4PJ5E 4YGVA 1A02N 3S35H 1NSNH 1OGAD 1F4YH 2BY3A 2Y23A 3GGWB 4LRIA 1P1ZB 2APFA 2GY5A 3H6JA 5IK3B 5JLZB 2D7NA 3I75B 4XMKH 3SDXA 1ZLWH 3A6BL 5EBLA 1JRHH 4QHLB 2V2TB 1BBDL 1YEHH 2NX5E 3VXUD 2YXMA 2NY4D 3IDJA 3O45B 3QPXH 1WIUA 3O4OB 4XX1G 2UVFA 1B0RA 2NY1D 1OL0A 4R8WH 2PW1A 4NQDE 5B21A 4KI5D 4XTRC 1EAJA 1G9NL 2QHRH 4MAYC 3V6OA 3TV3L 1CD8A 3MGAA 4LVEA 1OAZH 3FQUB 2VXUH 5FYLD 4WHTA 3WV0A 2IJ0C 3O4LD 5F9JB 3L7EB 5TDNA 2BVEA 4YJZL 5EU5B 3BP5A 1F00I 1OSPH 4FRWA 1E4WL 4QHMB 4XPHH 4PJEB 2A6KA 5DMKA 1IGFL 5L7XL 3INUH 1Q72H 4R4BB 4UDTB 1QRNE 3HC0B 3AAZB 4GRLD 4PJBE 1MJ7L 3TZVB 1TXKA 2XV6B 3ARPA 3FT3A 1ZT7A 2VLME 1FH5H 1P69B 2PTUA 4NQUA 5FF6B 3GRWL 4TSAL 2Y07L 1AE6H 3ES6B 4QRQA 4HUVA 4GS7C 1FYTE 3TJEH 2APWA 4Y5XB 2EC8A 1A14H 1II4E 3ZKXC 2P43B 1MRCL 1ZLVH 4GOSA 2VXSH 2NW3A 5IM7B 2P46B 4PJDE 4U1SA 4JO3L 1XGRB 4V1DE 1DFBL 1IC7H 4M1GH 1ERNA 2XA3A 1RMFL 1C7SA 4NFBA 12E8L 3LEXB 4I48B 2F8OA 4MNGE 2NY6B 1KTLA 3NA4A 5ALCH 4HFWB 5DRXB 3QG6A 2XA8H 3STLA 1N6QH 4TQEL 4B50A 5FM8A 3FO0H 3Q6GL 5KTEH 4XVJH 1UACL 4IRJD 5FOBA 1A6TA 4U1MB 2ZSWB 1X5JA 5FUCC 3VXOB 2LAAA 3FT4B 3FHAA 4J23A 1FIGL 4KDWA 4N0YL 3OJVC 3IKCA 4KQ4L 5KG9B 4YDKL 5CKGA 3QUZA 4PRNA 5CJQL 5SV3A 5E9DB 1CIUA 1R3HA 1T4KA 3RGVD 4FQLH 1KLUA 2FJFA 1P5UA 3RPKA 3QDAA 1I85A 2M8XA 1HH6A 2LU3A 4HS8H 3RGVC 3MRDA 2XQYK 5D2NC 4GG6A 1OTTD 1TPXC 5TDOB 4X98B 4MJIB 4ZAKD 5IROA 5IV2B 5E6ZA 4JFQB 3DYMA 5T5NF 1D7FA 1FN4A 4DVBB 5HXMA 4WU7B 4EQ2A 4JG0L 4MS8C 5IHUL 3AM8C 1RUQL 4JZOB 1TPXB 4PRNB 2NY1B 1FV1B 3CC5A 3WDIA 2XQYG 2DLEA 4QHNB 1NCBL 5EU7E 1DVFA 4R2GB 5D71H 4R4BA 4F7PB 4N9GB 4Y7MA 4LQFH 5GGQL 3G6JB 3DVNB 4KHTL 4U6TA 1EERB 3V6FB 4DKEL 4DGVH 5F96L 3LCYA 1C5DB 1HHHB 3GRWH 3MR9B 5EBWB 2BNRB 2M1KA 3O6ML 5GZND 4R2GD 5HYSG 1ONQA 1CD0A 2JJUA 5LXGH 2CMRH 3D0VA 3FKUS 1RZ8B 4N68A 4E41B 1IGJB 1FFNB 3GMRA 2O26U 4YUEL 3OKKA 3OG6B 1DBBH 2BSRB 5IB5B 2FWOB 3HE7C 4TTGA 3QUMH 3OAYH 1SYVB 1BZ9A 3VD4A 5EUOA 2YRPA 3L3IB 1KCUH 4ZUVA 4TTDD 3MV11 3P30H 1PKOA 3SKOA 1QUNA 2UUDH 4K94H 1KN4H 1NAMH 2E6JA 3ARQA 3HMWH 4JY5L 2VZSA 3PDGA 5T1LB 1CICA 4M8VA 4YHYC 2H32B 5DSCA 3EW3B 3O0RL 3WKMH 3HPLA 3HZYB 1VFOA 4X7DC 4ZXBC 1A4JB 3X3FL 4OLVL 4PGDB 1QSFD 3BJLA 5KS9B 1J18A 2ZJSH 4MA8L 3VWKD 3OXSA 3M8OH 5J9PA 4J3SA 3TT1L 3MUZ1 5K59F 4WO4C 4GMSL 5DJYB 1XZ0B 4HWNA 1EO8H 5HI3D 1QA9B 3V79C 1OGAA 1BZ7B 1AJ7L 3L3OB 2HFEB 4Y16A 4RRPG 5EWIH 1KGCE 3EO0A 2DYPD 3OPZL 4C57C 4N90D 4PR5A 4JFQA 1EDQA 1YEFH 4JPIB 4IS6B 4U1JA 2WWKO 1WWAX 1LDPL 3BPOC 3UJJL 3ULUH 1DBAL 2A77L 1IM9B 2J8UB 1MIEL 3TBVA 2Z93A 3MOQA 4P46D 4XPBL 4LRNH 3P77B 1MJ8L 1KJ3H 3DUUA 3QCTL 2E5EA 2E8YA 2EO9A 4RA0C 1HHJA 2XN9D 5BS0A 2B2XL 1CCZA 5EZJA 3EO0B 2CUHA 4MJIE 5KAQF 4QCIA 5CHNA 3HR6A 3VDCA 3WIHH 5A3IC 4URTB 2EKSB 5LAXB 5CINH 4JQIH 3REWB 3VRLE 5SWZE 5L0QB 3GMPA 3CSGA 3MR9A 2WUBH 3NZ8A 2R4RH 1UM6H 3MRGA 1UACH 5SWSE 3MQIA 4OM0L 3V9FA 5E9DE 3U82B 3NGBB 4MQSB 3P73A 1A7OL 3I84A 3O2DL 4EUPA 3AVEA 3KPQB 5ID1B 1ZT4B 4HWBL 3TCLA 4GW4A 4F57H 2BC4B 4H5SB 3L3IA 3MZGB 1DZBA 2DTML 2NYYD 1VADB 5JIHA 4Y19A 1G9MC 3TBSA 1HQRA 1HWHB 2BDNH 3EOTH 4ZS6C 3REWA 4XP4H 2OI9C 3HLAA 4YXLL 4XPAH 4ODTH 4QXTB 3RZCB 2XRAL 5DD5H 4G6KH 2R0WL 3KGRA 3MUJA 5D5MB 5J12B 1JYNA 3V95A 4M7ZC 5C08B 2CR3A 3VXRA 1T22A 3FN0L 5E1AA 2GCYA 3UPRA 3V7AG 4D8PB 1W72B 5HYSA 2HFFB 1S7QB 5IF0B 1PSKL 5MENA 5DD6A 1J11A 4MNHB 3O6FA 1PG7L 4JO4L 5F97E 1YY9C 1M7DB 5DRNA 3BPNB 2KKQA 5FUOL 5HGDB 2XZQL 4MNGB 3SJVA 3ZE2E 5C07A 1JFQL 2CXGA 2QQQA 3ROLB 4ZQKA 3U2SA 1UB5A 4GBXC 3T4AA 1P7QB 1EFXA 1YPZE 3ZDZE 1XF3A 1YEJL 5T1KA 4FQXB 4G6AD 4XNZC 1G0XA 3QO0A 1EO5A 2P8LA 2XXCB 4K7PH 2DQEH 2D0HA 3DX7B 2FJHB 3CLFL 2AEQL 3OZ9H 5MENB 2WBWB 4QXGH 2O61A 3VXSE 4HJGA 3GHEH 1FAKT 2WBJA 3HTLX 5T3XE 43CAA 3GMNA 1JNNL 2BVOA 4Y2DA 2FNBA 1GOHA 2F54E 2HTKD 3PHQB 1TJGL 1YEEL 4X6CA 1QVOB 1ZS8A 4LF3A 5BJTB 4MQTB 2QKIB 5IFJA 3NCCB 4NC1C 5JXEA 5LAXA 4KUCF 3VE0A 4YWGH 1RZJH 2OL3B 5ECJE 3PQYD 4DZ8A 2AQ1A 5BXFA 3PWPD 4Z7UF 2QADB 4Q2ZA 2WUBL 3MJGX 4WFHE 5K9KB 4LLQA 3OAUL 3SE9H 2P24B 3FB5A 5EOTB 4G6AC 1BVLA 4FTVB 4CDHA 3QJHA 4NUGH 2WBJB 5C86A 5DHYB 2YSSA 2EXYD 2YXFA 4H5SA 2AJYH 3BT2H 1N2RA 2X44D 3ISWA 4LDOB 1FFOA 1QLFA 4QTHB 4RAUB 4YX2L 1K4CB 1BREA 2UY7A 5D2NA 5HGGS 4C4KT 3CPLA 2GK2A 1A7NL 1J12A 5J13B 5ITFA 4MJ6A 3BRFA 4HC1L 4XP4L 3BPLC 2A6JA 4HH8A 1YYMH 4WEBH 1IKFH 4G6FB 3U9UA 3QA3B 4TSCL 2DM3A 4J6RH 1QYGH 1WT5A 4CGTA 3QWRA 4EI6B 2BFVH 35C8H 1TNMA 2V2TA 4P2OC 2IBZX 1HCVA 3FN0H 5I17B 1ZLUK 1DL7H 3PQYA 2V5SA 4M3KB 3SEPA 3SJVE 3O45A 3D0LA 4XMLL 1GAFL 1CLYH 5IBTL 3QIWB 3SGKA 1U8QB 4KK8C 2CRIA 4NQEA 1XEDA 4TVPD 3X13B 4ETQA 4L29B 5DUBB 3FONA 2OR9H 4Y5VB 2VZTA 3GK8H 1LO3L 3I6KB 4KJQC 4KKAC 5EU6A 4WFED 1W0YT 2Q86B 3JTSB 1VHPA 3LV3A 3QUXC 4CN6A 1Y6KR 1LD9B 2CIKA 4FG6C 1A7PL 3MRHB 3F12B 1A7OH 1IL1A 3FQTA 1XGTB 2CQVA 3EBAA 4NQCD 2Z9TA 3SDDA 3TIDA 3RJDA 2UZXB 4UDTA 3MLUH 4XVJL 4JFFB 2D0FA 1OSZA 1UZ6F 1KN2L 2R69H 1UA6L 3G6JE 4MJ4A 3KPSB 5ACMA 1U93A 3B83A 1WTLA 1CQKA 4NQEE 4L4TB 3DYOA 4HBCH 3W0WE 4JO3H 3IFLH 1JNJA 1JCKA 2BY1A 1FSKC 4N0YH 3OF6D 2Q76B 2VDLH 1YDPA 2XRAH 3B9KB 4P3DA 4P4KD 4DFIA 4GW5A 4U6VL 1JYVA 1UXWA 4FQHA 2MPAL 2WP3O 3L5WA 2Y06L 2XIDA 3HR5A 3PWUA 2P4AB 3EZJB 5D1QC 3RHWK 1FFOB 4TPRL 3WBDA 4PJ7A 2AXGA 2IBZY 3QPXL 5BZWB 1AY1H 2VXVL 4RNRB 5GXBB 2VQTA 4FTVD 25C8H 1C5CL 3U9UB 3KJ4C 4NRXA 5DD3L 5I1IL 1WISA 2JJVA 2OTUA 3GJEB 4GW5B 4OUUA 1LEKB 5GHWL 1LNUB 4AL8H 3RTQA 2NMSA 3N50A 3L5WB 4PJDB 1DN2A 1BBJB 5HGHB 4ZFFB 4N1CA 4FA8A 3ZTJG 3KLAB 4WIQA 2BSSA 3FT3B 5ICYB 3DRTB 2C26A 2HJLB 4Y4FD 4J3WA 3TN0D 5A43C 5E08H 4KKNA 5FV1L 4XPTL 1MREL 1BAFL 4WW2C 3ZMRA 5JXEC 5CBEB 2VDPL 3STZA 2DLFL 3T2NH 1Q0XL 2DQGL 2FHFA 4KTEH 4LL9A 3U0WH 1EMTL 1F6AB 5L9DH 2IAMC 2IGFH 3LKNA 1HCFX 3ALWA 3OQ3B 3GSWB 3GK8L 2PO6D 3BD4A 4R7NB 1U8OA 4MZ3A 3D69B 1XT5A 5JUEL 5C9JA 4FMKA 1C8PA 4ENED 3MRHA 5IIEA 2XA8L 3MV8D 5TE7H 5JQ6H 1S7VA 1DANT 3FO2B 1CLZL 1OSZB 3C5SA 4X5WB 2Q8BH 1MCOL 3B2UD 2P48B 3FO1A 4QOKD 4X9FA 3WFDL 2EIZA 4I0KA 2XWBA 1OP3H 1A7BA 1JZ8A 3QZWA 1C5DA 1HHHA 4Y4HA 3T65A 4JHBA 4K7FA 1U8HB 1LWRA 3BW9B 3DXAD 2W0FA 3VI3E 5D6DC 4FQLL 1IGJA 2RIKA 5BV7H 1NEZA 2AV7B 1OAXH 7CGTA 2FIKB 3B9VA 3FO2A 4BFGA 3NFSL 2P5EB 1IMHC 3N06B 5LKNA 4JGMA 4Y4HC 4B53A 3P30L 3DXAE 1EBAA 1EJ6A 4ZNCD 4M62L 1TQCC 1J05A 2HLFD 3HNTL 4JKLA 4TULL 2EXYC 3BP7A 4ZFGL 2ZKHL 1SJHA 2DQCH 1EHAA 2FATH 5I8EB 2WAHA 4ZTOL 3SPVB 2FIKA 1GGBH 2H9GB 3FL7A 3TCLB 1CU4L 1DQLH 3G6AA 4IDJH 4LU5H 1WVZA 1TTGA 2VLKB 4WY7H 1S5IL 1G9MH 3ZE1F 4EI5A 3QULA 4O58L 4MJID 4JRYA 3DROA 3UC0L 4LNRB 3PWVA 4MA1B 1FG9C 4JEGB 2DQHL 1I4FA 2HTKC 4CJ1A 4F7CB 1N3NB 4KJYA 5EWIL 4U6XA 3Q3GA 3H9SA 4KJWD 4F3FB 1EHLH 4ODHL 3O2WH 4MJ5B 1EMTH 1ACYH 3T8XA 4LIQH 1M4KA 2YN5A 5IW6A 3QUZB 2FX9L 2XACC 2XWTB 4M6OL 4J1UA 1OAYH 4HV8A 5C09B 2DBLH 3IDIB 5MEOB 2Z93B 5DWUL 5DD6B 3DIFB 3QWQB 1YYLH 3G9VA 1M05A 4OUOA 3SKOB 4K07A 5HY9A 1T66D 1HI6B 1QFWI 4JG1H 2APVA 5BS0B 4AIZB 5ANMA 4POZD 2QHLA 2XTJE 5I73C 2FBJL 5A2JH 3U2SB 5J1AA 2XXMB 1MFCL 1HHGB 1D5ZA 1QLEH 4UT9L 1IEBB 1CGXA 4HK3J 1ZMYA 4MAYD 3Q2CA 4FQXA 2XWTA 2X70B 3BW9A 3MRNB 1MLBB 3C8HA 3RWGA 1E28A 4NRYB 3G6DL 2BRRL 1CN4A 1ZT4A 1OGAB 1AHWB 5HY9B 1QG3A 4OJFH 3GMNB 5F7NC 3EYQD 3CFBA 2RBLA 5DI8B 1DN0A 1QBMH 4GKNA 1QVOA 3GIZL 3LRHA 3I6LE 4Z76B 1EPFA 1PAMA 3MBEB 5J1AB 4FQJH 2K7QA 2X1XR 1E4KC 1VENA 4X6DA 1ZT1A 1U41A 5C0RL 1X5ZA 3UCRA 1MLCB 5HYJE 4ORGB 4G6KL 2YHGA 1PJ9A 4NQDB 4FTVA 3GHBL 3IFNL 1TCRB 4GXUN 3E2HB 2VDQL 4NQSA 4PJAA 3UXFA 4ZMAT 2BVUA 1RIUL 3RWCB 4HIIA 3MBXH 3G6AB 4KKCD 5GGRY 3SOBL 4CNIA 4RGND 2OJEA 2BY0A 4PRPE 2JB5L 5IESH 5JHLH 1A1MA 4XPBH 4KQ3L 4LCCC 4DTGH 1MJ8H 5DRNB 1X5GA 4JM4H 3CDGA 2A73A 3BWAA 4Y4KB 2XKNB 2Q8BL 4KJYB 5AZEH 5EB9A 3RVVC 5HDBF 5A2IH 3OAUH 3SE9L 4PGDA 4EUPB 3KPTA 4CRPA 3V0VA 2W38A 1JK8B 2X2YA 1CFBA 4J1UB 1IC5H 5I17A 3U48A 4BQ8A 1GPOL 2Q8AL 2HVJB 4DGYL 5DJYA 5JHDA 1EO8L 4UAOC 3SO5A 1RZJL 5MEPB 3NIFE 3T04D 3C60D 3WIIL 5TFSL 3H9ZA 1P6FA 2K9UA 4ZO9A 1IAKA 1YEKH 5DHXB 4BH7A 2YD2A 4HDIA 1IGML 4LF3B 3B9EA 3QQ9C 4LEXH 5IJVB 1H8SA 1AHWC 3GUTB 4OKDA 1KLGB 4NC0B 1YEGL 3V0VB 5C08A 2RFXA 4YHIB 3IAQA 1RZGB 1G1CA 4KV5E 3DMMD 1PSKH 2ESVA 1MI5A 4LMQE 2CIKB 3MA9H 1E28B 4NRYA 3D1MC 2ZCHH 1A7QL 3ABZA 1IAMA 3MUGA 5GGRA 1RIHL 4MDIA 3W0WA 2MCPL 3I3EA 1HHIA 2AJSH 5HHVH 3TO4D 5K9JH 1UH2A 2VDML 5KN5A 2Y5TB 1LO4L 2MSPA 5ACZA 1IGYB 3D3VA 1KLGA 1PG7H 2WSKA 4MA7H 4BUGA 5HYJA 2R0LL 5CJBA 2ZG3A 5SWQA 4AT6A 5IEHA 4LAJH 3ULVC 4KKLC 5IQ7L 1MLCA 1N8ZB 1X6NA 3JUZA 1D5MA 5CD5D 1RHHA 1YA5A 5E2TL 1MAJA 1A3LL 3DETC 1Q9KB 1SY6A 3O6KH 3H3PH 4ZPVA 1ZHLB 2A6IB 2VR5A 2D9QB 3GZKA 1VADA 1DUYB 1G7PA 5DHVH 2X4PA 4PJ7B 3SCMD 5H94A 1IGYA 3KPMB 3OKMB 3W9DB 4JY4B 1UM4H 1CT8B 1FG2A 1HOCA 2VXTH 4KPHL 1X44A 3U7YH 1N26A 4PJBA 1U92A 4Y5VA 4LLDB 2PTTB 5E8OB 5EBMA 3L3KA 3TP4A 4FFYL 4XP1H 3UPRB 2VN4A 1MWAB 3PP3H 3IU3B 2JTDA 2IPUG 2VXQL 2RAMA 4Y2DD 4PJGE 3CPLB 4L3AA 3FQRA 1V7NL 4X4ZA 4WGVB 1TETL 5E6ID 5B3NA 3IGAB 2WV3A 4ZQKB 4BFIB 5M94B 1G7IB 1L6ZA 4GG6F 5I6XB 2W0PA 3FB7A 2X4RB 2WLZA 2H6PB 5D2LF 5T1KD 1IILE 3QHZH 2FH6A 4ZS7H 1TVHB 4K3EH 3AC0A 1NBZA 4LSSH 4G9FD 4K8RC 2DJ4A 3DX7A 4IIQA 3MOAL 4I77L 3WS6C 1AGCB 5C07D 1U8KB 3QEQB 2ZCHL 3QI9C 3FQRB 3BZ4A 1RZKC 4BYHA 3MCLL 2ORBH 3FO1B 4M7LT 4C56A 4ZNEE 2GJ6B 2R9HD 5BQ7A 3DMMB 4H88L 3VXPA 4DZ8B 3N1GC 4M5ZL 2W07A 1DQDL 2YUWA 4DN3H 3N1FC 3EYFB 1XAUA 1FZJB 3CSYA 4GAFB 4PJCF 3BDBA 4G5ZL 4AK1A 3QI9A 4JZJB 3HC3H 5JOPE 5ETUB 3HKFA 2G75A 2KDGA 4ONHB 1KCKA 3OR7A 5C0IA 5GSVB 1DP0A 1GC1C 2A0LD 1WFOA 4H1LH 1G7PB 3LKQA 1CXIA 2A9MH 1NSNL 3BISA 1K4CA 3P4OA 4XNQB 2D03L 1OP9A 1FYHB 5D93C 3SJVD 3GIVB 2Y6SC 3CMOH 2DJUA 4XCNA 3R4DA 4I9WD 3MLUL 3QDJB 1BBDH 5ILTH 2JIXB 5DQ9B 5C0AE 1S9XA 4NO3B 5D93B 4LCUB 1F6AA 4Z9KB 3T4YA 4KTEL 3U0WL 2RQ8A 3IS1X 3IKKA 4HUXA 4NJAH 4QRPE 4JR9L 4HS6A 3GSXB 4MXQC 4DKDC 1ZHNA 3O9WB 1G9NH 2QHRL 5KSUA 1REIA 5IFHH 2VDRL 5HHXL 2FH8A 2EE3A 3MRPB 4NOBA 2CIIA 3QQ3A 4XCNB 3KLHD 4JCLA 3ORJA 5BRZD 1F4YL 5F88A 5L88L 3VD7A 1RVFL 4WI8A 4XMKL 1NCUA 3MLVH 3E0GA 3EO1B 25C8L 4YE4H 1AXSB 4Z7NF 4LLAA 5J0BA 1JL8A 1ROWA 3DIFA 2CJUL 3TA3C 4NC2B 3UBXG 1JTTA 3I9GL 1PG7X 3OX8A 3SCMA 3TA3D 2NTSP 4P59L 4AIZA 1GZQA 4Q74A 4B41A 5C3LD 3MXVH 1ZA6A 4PB9L 2XOTA 3DMMA 3D48R 3RVTD 4OZFG 2ZUTA 3OHXA 3BN9C 4LGPB 2YA1A 5E5MB 5JUEH 5ESAA 3K2MC 1MJUH 3VG9B 4BQCA 2W0KA 3B8YA 4KXZH 1P84K 2BCKA 1PKQE 4O58H 3K4AA 1CBVL 2B1HH 3AB0B 5LWYH 2VQ1A 1GGBL 5F3BB 4JAMB 2CLZA 2HT2D 4YDLB 3UTTD 2J6EL 3FB8A 3EYOA 3MNWB 4TUKL 1N59A 2P5ED 3BPCB 3CMOL 4TSAH 4PJAE 4QRPB 1DEEA 2KUTA 3BVNB 1S9XB 3ALXA 3UROR 2GAZA 3MYZA 2DQHH 3GJEA 3SDXF 4AQOA 1CL7H 2D7MA 4Z78A 5JA9A 3PUCA 4O5LL 5SWSA 3K8KA 2F15A 1GYAA 6FABL 2UZYB 1H5BA 3UMTA 4IM8A 1OLZA 4FFVD 4KUZL 4I3RL 1K5NA 4Q9RL 1FVDA 1LP9F 2KQNA 4I1NB 4R97B 3DVIA 3IU4H 2QADC 7FABH 4M48H 3BAEL 3HI5L 1OAKL 2OMNA 4FN0A 1A6WL 4MAUH 4MQ7B 5T3ZD 3MLXH 3V52L 3TESA 2WBJC 4XPHL 2PXYC 5K9QI 4UT7L 1MCPH 5E9DD 3TA3A 4NO5A 1NJ9B 1ULVA 4UU9B 5I8EA 5B4MD 1MRDL 3PWPE 4GRWH 2D0GA 1MFAH 1MLBA 1ZA3B 1RY7B 1T4KB 2FGWH 3KXFB 4LHUD 4PS4L 4X9HA 2C1OA 4GO6B 4AEEA 1NUDA 1RUML 1C5BH 5BOPA 1WIOA 1KTKE 3SDCB 3V6OE 1GHFH 5J1TC 3DECA 4G8FA 4PG2A 3GSOB 4U31A 3P9MB 1CDIA 3VRIA 3KS0J 4KMTH 1OF2B 3WMSA 1KGCD 4JB9L 2Q3AA 3Q5OA 5KVDL 2ZUQC 1FV1A 2ICWB 2W0FB 3NA9L 4PREB 1QFWH 1NAKL 3IDYB 3GI9L 4CAGA 2FO1A 3BZDA 1H3VA 1NCBH 1HI6A 1AQKH 3RPIA 3DXAB 4OGXH 2JLLA 3LMJL 4KKLD 4JANA 5DF0A 4JRYE 4M7JH 4WNQA 3G6JA 2V2WB 4AG4H 3CAFA 3PGFH 3QUZC 1MVUB 3AB0C 2C3VA 5I2IB 3L5XL 1I1YB 1HHGA 3C9NB 4ONGH 4M6MH 5D7SL 2GY7B 3IDGB 2AJXL 3SE8L 2R4SH 3Q1SH 3H9SD 3LAFA 1JWMB 1ED3B 2X4OA 4LPVA 4MA1C 5CJ8A 4RMRA 3CFIC 1RZ8A 3QUZD 4CJ0A 3BRDA 4PREA 5D70H 4UV7H 3IETA 5DDHB 1ZAGA 5T5NG 5KVGH 1LVEA 4RZCB 5C0GB 2RGSA 3BDXA 3HMXA 4HEPG 1TMCB 1YEFL 1OGTA 1F4AA 2OQJB 5J6GB 2JB6A 4UILL 4NQVB 3RVWC 5CGYD 1VEPA 1KPUA 3NCFB 4U6XB 3RP1A 3VFSB 3QIUC 1DQQA 3BKMH 2FEDD 1U92B 2H1PH 4D9QE 2KH2B 2PTTA 3EDEA 4FQJL 2B4CH 4BQBA 5AG8A 1TCRA 4GQ9H 4G8EB 3HPJB 1QR1A 1SMAA 1KIRA 1MWAA 5MEOA 1MNUH 1NC4D 3KXFA 3P9LA 4DTGL 3L95A 1FFPB 4ZOBA 3FQWB 3W0WB 1QSEE 3TBSB 4G3YH 4LCYB 3G08A 3QUYD 1QZ1A 5DK0A 4ORZC 5DJZA 4H20L 3VXSA 2DLIA 2XN9E 2CRMA 5J56B 4NSKA 3U7WH 4P4RB 5I0ZA 4DN4H 5DYOA 1LO4H 3O2DH 3SKJH 1WCQA 2M26A 3DO7B 1NMBH 4O2FB 1K3ZA 2NW2A 4HWBH 4I3SH 1UYWH 1HNGA 5GRWA 4L8CA 1MJJB 3HE7B 1D6VH 3BP4B 4PY8J 4IJ3C 4FXGB 4L3CB 2VZVA 4NRZB 4OJFL 1UM4L 1EJOH 3PF2A 3G08B 3EYUH 5DK0B 5D6DA 4XP6H 5CEXB 1QRND 1IAKB 3ZT6A 2GJZB 1FGVH 3O3BB 1TNNA 5I2IA 3WLWD 1AR1C 3WIHL 4EBQL 2NY6D 4EIZC 2CUIA 5E99H 4FP8L 5C0RH 3GSNA 2CD0A 4QTIH 4WWKA 3CH1B 4WHCA 1KJ2B 3PXJA 5I1LB 2V7NA 4HZLA 5D7IF 5GGRB 3MLRH 1VKXB 5FUOH 3MRJA 3TIEA 1DQMH 2IBBA 3NPZB 3EKCA 3ZT5A 5C0BB 1U3ZA 2ICWI 2G2RB 1LK2A 4L4VD 3IFOB 4F7MB 1E6JH 1XR9B 3ILPA 1NBVL 2NY3C 1AO7B 1GRWA 5FDWB 5EG6C 3BZEB 5GGUA 3CH8A 5E2TH 4NZJA 1OLLA 2R1YA 4LHQB 4XVSH 2AXJA 2EC9U 3B5GA 1MCLA 1JMXA 2BHUA 3ARED 1FNEA 3QR2A 3UZEA 2NNAB 1W72A 2WK2A 1IAII 4OIBA 3DMMC 4A6YA 5JOPD 2CPCA 4X7SH 5EIIB 2XZCL 4DOHE 3KPMA 3OKMA 1DEDA 2DDQL 4PRHE 3B4NA 5C6TH 2B2XH 5C0FA 3HCVB 4FFVC 4D2NA 1FGNL 3MGOA 1MCEA 1OM3H 1P7QA 4Y0GA 1ZEAH 4PB0L 4YH6A 4H25A 2DL2A 2B5IC 2NW2B 4JKKA 4GLRI 2VIRB 3EO1A 5FYLE 4GBXA 3RL2A 4LSRL 5F3HA 1DQDH 4DN3L 2X4UA 4MNQD 1B88A 2FLRT 2JJTC 3JWOC 3IF1B 2G75B 3MODL 1WWCA 4RMVA 3VXUE 4XXDB 3LZFH 3OX8B 3SCMB 1G7MA 1NGZA 5CIPH 2CDEB 2ZCKH 1F97A 3X13A 4ETQB 3KLSA 4N5ED 3O3BA 4G6MH 3B9KC 4YHOL 1HN1A 4O9HL 4GXVH 1DR9A 4W6XB 3NIDF 1M71B 3PIQB 5C0JB 3RNKA 4LDEB 5D7LE 1V7NH 2A77H 3TLRA 1CQYA 2H26B 4Q6YA 4XBEL 4OT1H 3CH1A 2WINB 4CL7A 1N8ZA 4OCYL 3TO4A 4DGIL 5EZIL 4QRSA 2GT9B 4Q6IB 4K71C 4HZLB 2C3HA 1T1WA 3V4VH 1BLNA 3I9GH 3PWNA 4L8BB 3D2UD 1U2CA 3VFRA 1G7MB 5L8LB 3EHBD 3MO1A 4JN2A 3L3DA 4KTDL 4U0RC 5DEZA 3VWKB 3OKYA 5FCUH 5DMGD 3MV7E 2I9LA 2A1WH 5BQ7B 2IWGA 5CLWA 2X4TB 4LDLB 1CFSA 4Y2DC 4NYLB 4QHLA 2DOCA 2ENYA 1A7NH 3W11D 4OLZH 4WJ5B 1XR9A 3ILPB 5GJTH 4LCCA 2J5LC 1CXHA 1EFQA 1NCCH 1HEZB 4PRIA 5EBMB 4NFDA 1JUFA 4NHCH 5GS1A 4H26B 1BIIB 3QPQC 1I1FB 2DTMH 4S1RH 1MCFA 2Y72A 2P47B 2VXQH 3K2UL 4CKVX 4EN3B 5BZWA 4WHTB 4DUXA 3PDDA 1P7QD 2V7HA 3VD9A 1Q1JL 4N8VB 1MQKH 3IGAA 5INCB 4OZIA 1SEQH 1WIPA 1ZA6B 1FO0L 1FGVL 1N5AB 1H3PH 1QRNA 3C6LC 1OM3L 3BPLB 3QHZL 3VH8A 4HT1L 5EIQA 4ONFH 2HYMA 3QZWG 4XCFH 4F9LA 3LV3B 1GOFA 1Z9LA 2VYRE 3SDYL 1R3LB 1PQZB 1YMHA 1X5XA 4LPTA 2ADJB 2NPLX 1KJVA 5ICYA 1BD2D 1HILB 3QUXB 4NJAL 3DX6B 3QQ3B 5EU4B 2L4OA 5GISL 3HE6A 4FQXC 1U93B 4NBXB 1KC5H 3TO4C 1R3IH 5HHXH 4ZPTA 3UTSE 5FYKL 4M8QA 3O4OC 1ZGLP 1JHLH 1ZE3C 4QRPA 3ULVE 4RMSA 5DMIL 3I3DA 1VFBB 4XZUA 5IMKA 3LOWA 3K4ZA 3QXDB 4UOJA 4YE4L 3KNBB 1YEIL 4HUUB 1NLDL 4I0PD 3NCJH 1QSEA 5I1CH 1PLGH 1F8TH 1GAFH 2JE8A 3HG1A 1HILA 4Q58C 5ADPL 3MLVL 1KF9B 3WLBA 1PZ5A 3IDNB 3MXVL 2X4NA 3EDDA 4P5KB 2X4TA 2XWBB 4YHLH 3T1FB 5LG1A 5TE6L 4U4BA 3T65B 3UPAA 4PJEE 3W9EB 3QEQE 4NNYA 2AK4B 2YWYA 4D0CB 4QYOA 4APQA 1G9EA 4FFWD 2NX5B 1HXMB 2XI9A 2BCKB 4EVNB 1I3RA 2AV7A 1NAML 1RUMH 3HG1B 1LO0L 3H0TB 4L5FL 5F9AC 1L7IL 2NY4C 5JIIA 4XH2B 4Y19D 3WUWA 3WNOA 1FRGL 2AS5M 2Q7YB 4LSUH 4L9LB 4TVPL 1PEWA 4POYA 4P23A 3VU2A 4U1NB 3NGBC 3LZFL 3SDCA 5D1ZC 5LWYL 4LVHC 5CBEA 3X12A 5F9WC 2R69L 3V6BR 2J8UE 5EC1A 4WEUD 3AREC 2DIAA 3IDXH 2W9LA 1H3PL 1I3RB 4HKJB 4Y8AA 4MQXD 1P5VA 3QHFH 1OWWA 2OK0L 5C9JB 3UAJD 5LQBL 1AXSA 1D9KB 2X1WL 2CLRA 3S3SA 4QT5A 2HJFA 2AJXH 3DROB 3H3KA 5M7QA 5L2JB 2HP4A 1OTUC 1CLZH 3MX0A 3AY4A 2PW2A 2PYFA 4QRTA 5EA0H 2V5RA 4FQPA 3W2DH 3C9NA 5KSBB 2EXWC 3GMRB 1CD1A 3TA3B 2B4CL 5IVXB 3MUY1 3V4PL 4WFFE 4UU9A 3AXLA 1RIVL 2R4SL 1I1CA 4J7RA 4JFEA 1NFDA 1S7UA 1BFOA 2FGWL 4UDUB 2ADIB 5DD3H 4ZG1A 5I1IH 3WIFA 5DJDB 4YQXH 2B1HL 5GHWH 4KK9D 1D5BB 4KMQA 4PJAF 3IETB 5DDHA 5AD0A 1F8TL 5TF0A 3BKJL 4LSVH 2H32A 3K4DA 4L8DA 5J12C 5DSCB 1BX2A 4PJ9B 5F6IC 1PZ5B 5TDPA 1PY4A 4HMEA 1I7ZB 5T1DL 3MNWA 1U3HA 3H3BC 1CD1B 2EDHA 1C5BL 3EOAA 5IEKB 1NFKA 4QOKB 2D9CA 3LKSA 2AQ2A 4YFDB 1LP9E 5ERWA 3TYFB 2DBLL 1EUUA 5IB4A 2WZPD 2WQRA 4OFYA 1RUPL 3LMJH 5KANG 3MV8A 5GS1C 2N4IA 3VI4E 4P99A 1AKJA 5FHAL 3ARFB 4KGJA 3P9LB 4J2XA 4XPGL 1KB5B 2CDGB 3T77B 4GKZA 3NA9H 2AJVH 1OPGH 2WWKT 1I1YA 3L9RA 1NAKH 1OAKH 5E1HB 1OT2A 2X9XA 5IEKA 2O5YL 4HIHA 1PKQB 3SY0A 4IIQC 4E41E 3UTPD 5HGBB 4OM0H 3Q1SL 3MNZA 3QH3B 3GMLA 1BQHG 4OB5L 4NKIH 3S7GA 4UT7H 1EEYB 4K7PY 2QSCL 3V5HA 2IH1A 3NFNB 4LLYA 4S1DD 2B7DT 4I0PA 3EJZC 3MV8B 4PJIA 4HV8B 2B0SH 5C09A 4QRPD 1IVLA 3EHBC 4U1KA 4L3CA 1JF1B 5T33L 1HXYB 5I9QC 3K8MA 4NQVA 3GMPB 2R2EA 2UV3A 4FQIH 2A73B 3BWAB 1N0XL 2XKNA 3FFCD 4XP6L 4OSUL 1IAIH 3D2UA 4D9LH 3GSOA 4DK3A 2DQCL 1Q94B 5HPMB 2A74B 3UTSA 4NQED 3KPQA 4ALAH 4AM0A 5ID1A 5C8JB 3MLRL 4LCWB 4AY0A 3T0BA 3RVXC 1H3TA 2ICWA 5KOMC 4PJIB 5JDJA 3MLTA 4NM8H 2EH8H 5AYUH 1QFWL 3B5TA 3RZWA 4ELKB 1IRAY 3FQWA 1E27B 3B9AA 2EDTA 4LCYA 3NIGF 1MEXL 5B39B 3BIBX 5HHOD 3VI3F 1DN0B 4L8DB 3D85A 1UKTA 2VH5H 3O4LB 1UWGH 2X89D 2ITCA 2FZ3B 1MCCA 3IB4A 3SE8H 3VXRB 1ETZA 1XIWA 3LDBC 4R7DA 5C0CB 1KJMA 4AYFA 3I2CL 5T3ZH 1SYSB 5CGMA 5FIEA 3VXMD 4XB8A 2AEQH 3OZ9L 5D70L 1OB1B 1JTPA 2Y1VA 4XHJD 4ELKA 3BH9A 3ZDYE 4JG1L 3NAAH 4R26H 2DWEB 2QLVB 3AUVA 2OMBA 4OF8A 4F9PC 5DQJA 3KPLB 1KB5A 4OI9A 5FYJE 1ZLVK 4LEXL 1EFXB 2ITCB 1J0JA 2CSPA 4CMMB 5BCAA 3F7PC 1OW0A 2Q7NA 2CLVB 3CDCA 3CCHB 1A2YA 3GKWL 4AT6B 5IEHB 3TFKD 1MFEL 3MPCA 2ZPKH 3CXHJ 1SJXA 5KSAC 1C12B 1CR9H 3T2OA 5J7CC 3O41B 4K3DL 2FX7L 4M02A 1UWXK 1GJIA 2EE2A 5IBLC 2PXYD 3ESUF 3B9DA 3C8KA 1VKXA 4IDJL 2K1MA 3FO9A 3LN5B 2GHWB 1S7XA 4U1HB 4NZUL 4X6EB 3T0AA 1MCWM 1F45A 1RUAH 3MJ7A 2QKIA 5IFJB 1FFPA 2ZNXA 1U0QA 1SM3L 3KYNA 4A2LA 3MROA 3RQ3A 2L7UA 4JY4A 4BSWA 1RU9L 3HUJF 5E5RB 5IJKC 4HGWB 4DOHB 2V7HB 1IKFL 4FQIL 1U8IB 4NSKB 4NT6B 2PF6A 4P4RA 4M61B 1CLOL 5FDWA 5IVNA 1Q94A 3SKJL 5DUPL 3K74B 1U3HC 4EXKA 3L3KB 3V4VL 4QRRE 1QRKA 2XFXB 2F53E 1B0WA 5D1ZD 4QHKI 1TZIB 4U0QB 1N0LA 1RUKH 4HX1A 2NLJB 5GRUL 1WLHA 3KYNB 1G7LB 5KZCD 4MQXC 1DBKL 1RJZB 5C0FB 1LO5A 3MBXL 2YKLL 4U3HA 2DM4A 4GAGH 5D9SB 1FAIH 5KVFL 2DQJL 2I24N 3RWHA 3FRPG 2OZ4A 2X6MA 2BK8A 1JRHI 4LASL 3HG1E 4QHUB 4BA8A 4O4YL 3S88H 1AXIB 2AABH 3OKNA 3EDKA 4LVHB 4WWKB 6CGTA 4PRHA 1EK3A 1RZ7H 2GQHA 1CDGA 1FJ1B 4MWFA 5HYIA 5TE7L 5DFTA 3QIWA 5CKAA 4WI6A 1Q0YH 5CILL 2P42B 1MQKL 2OP4L 1MHPL 2AP2A 4PRPA 4L4VA 2AKRB 2ZSVB 4FHBD 5JO5A 4AL8L 3D9AH 5JLZA 1OT1A 3SBWA 1H3XA 2Q3ZA 1AGDA 4ZS7L 3ROOA 2X5PA 2VDLL 1YEKL 1WZ1L 4PJBB 4ENEC 5D7JA 1AIFB 5I1JL 3LN9A 2F8XC 4TUOA 5BVPH 1QRNB 4YHOH 1JF5A 5BW7A 3WYRA 2VL5B 4JZJA 4WI9A 3SDDB 3TVMD 5E08L 3BQUC 2BX5A 5ETUA 3RVWD 3S37H 1I8KA 1ES0A 4UB0L 4ONHA 4QXWA 3RUGE 4P46A 1I8LC 2OZ4H 3CXHK 1BWMA 1G7QB 4H8WH 1FZOB 1WQVT 2G5BB 1A6ZB 3GIVA 3SE4A 1JGDA 1YC7A 3V7MA 3UTTE 1CFSB 5GSRA 3LS4H 5IW1B 5IMLA 4BH8A 1JNHA 1P9MC 2R56L 3U30B 4QEGA 2F53A 2BHZA 1PEZA 2C3WA 3FB7B 4F33B 5JPNB 3F7YA 4XNMB 5SWZD 3NIFF 1HEZA 1HYRC 3ALPA 3WJLC 3IFPA 5GRVK 3GSQA 4X7EC 4ZFOL 3F65A 4OGZA 1JHTB 5FUZL 5C08E 3F7QA 3GSXA 3MV7A 4L5FH 4P23C 1A1NA 3OKEA 4XZUB 3L3JB 5IMKB 3HI1A 4U6HA 2VR4A 3JWOH 4HIJA 3Q5YA 4UZGA 2FO4A 5DMYA 5IQ7H 5C0BE 1MJ7H 4HX1B 4JVPA 2Q6WB 2RHEA 1GL4B 4EN3A 5TE6H 3H3PL 2ZCKL 5ITBH 3AREB 1S7WA 4U49A 1JYXA 2E27H 3QBTB 1EAPB 2I07B 3T3PF 4MMZC 4N90E 4LEOA 5I74B 2GTZB 1QPPA 3GSQB 1A9EB 1T83A 3PWLA 2C4FT 1EZVY 3MLPA 4XBEH 3IDYC 5ENWA 5I30H 1RMFH 1CDHA 5HVGB 1JPST 2VNCA 3X11B 1A9BB 5JZ7C 4M7KH 4BZ2L 2X89A 4YO0B 4FOMA 1ORQA 2UVEA 1R3IL 1NGYA 1ZHBA 5I66B 1YZZA 4P2RD 5F93C 3FQXA 2EKJA 2NTFA 4LPXA 1C7TA 4EJ1C 1NH6A 2D03H 1IQDA 1R3JB 4PRBB 2GTZA 4WTXA 3A67H 1I9JL 3D3VD 3MREA 4IRZL 3IVKA 5IMMB 1CU4H 2RCSH 4QGYA 4UQ2B 5DZLA 2HLAB 3H9HA 4ZSOE 4NO3A 5DTFA 4OBRA 5DGRA 1BJ8A 1A0QH 1DVFC 3GEWB 4PRIB 4QWWC 1WCBA 2FJFB 3VRLF 2J7LA 1PLGL 2VL5A 5ISZD 1FPTH 2X40A 1RULH 2QEJA 4XNYH 3RKPA 4LKCA 1ADQH 4HSQA 1CFTB 3TO2A 4HFUL 1OP5K 4P57B 4Y1AA 3SKNB 5C1MB 3ARFA 3GGWA 2CLRB 4MSWA 4XXCC 3FQXB 1ACYL 5KSAD 5JQHC 4HHAA 3BPCA 3NPSB 1R5IB 4F15C 4E9LA 3MNZB 3CDFA 5TQ2H 1CICD 5JR1H 3P0GB 3IFPB 5I18L 1NEZB 1XF5B 4OCSL 3QJFA 4LIQE 4YXHH 3INUL 3ARFD 3R8QA 4YAQB 4GG6E 4BUHA 2WM0A 4M5ZH 1P7KB 5GGQH 4ELMA 2BVTA 2GFBB 2XY1A 5IG7A 4NQXA 3L1OH 2FSEB 3BWUC 3ULVF 2ICCA 4MB3A 3WN5C 1NFIA 2ATPB 3AM8A 5I1DA 4HHAB 3RU8H 5I71B 1FHGA 1T2XA 5E2WH 1ONQB 4XCCH 4PJEA 2HKHH 3QFJE 5CFHA 1JHLL 1G6RB 5DURD 3OKKB 3PL6C 5IB5A 4K3EL 1M7XA 5ILTL 4BKLA 4LK4A 4PJ8A 3JTTA 4X7CC 1H0DB 4ODVL 3SQOL 3B2VH 4JRYB 1KELH 4X4MA 5GGTA 5CSZA 1FNFA 1RSFA 4JGUA 4ODUA 4PJCE 4KZDH 5IWLA 1NPUA 5E4EC 5CEZH 3JWNC 4KDTA 3WKML 3CVHB 3ZKQD 3T8XB 1AXTL 2B8OT 5IW6B 4RA3A 4JRYD 1I9JH 4UIKH 3ARDD 4R96A 4X8JA 2ARJQ 5DTFB 1DQTA 3BYTA 4HFWA 1T0NA 1NC2B 2YA2A 5I1EL 4IRSB 3MNVB 5I8CA 4OTXH 4WV1C 3GJFK 2MCPH 1Q9WB 3DARA 4X6FA 4MD4A 4Y16B 3KVQA 4LVOC 2X9WA 3H2WA 3NVQA 1F3DJ 4K3HA 3EFDL 1QBML 1K5NB 3CFJA 3WUWB 4DCQB 4X5LA 4MB4A 5AWNL 4OZHA 5ANME 4AMKH 5LBSL 3UC0H 1IEBA 5C2BH 2JELL 3BKJH 3ARBB 1IM9A 1NCWL 5E8NA 1ZV5A 4XTRD 3PJSB 3PWJB 3WLWC 3AFLA 2PNDA 1I7TA 3D25B 2A83A 2R0ZH 2QQNL 3GHBH 5BZDB 5INDB 3WIIH 1U58B 1GGIH 2IPTL 2F5AH 4RZCA 3S35X 3V7AE 3VA6A 4YAQA 4KY1H 1NGPH 3FO9B 3LN5A 5D5ME 1XGUA 1YYLL 1JGVH 2C1OB 5DRZA 2A0LC 4ODSH 1JHKL 5CSBA 4MD0A 4QGTA 5DHVB 5JW3H 1RUPH 1BIHA 2DIBA 1FZMB 2NZ9D 4XAWL 4OB5H 1XF1A 2HKFH 3ZYJA 1DSFL 4UT9H 2IH1B 2HKHL 4NQSB 4PJAB 1WICA 5FK9B 5KVDH 3DVNA 1J1OH 5B3JE 1XGUB 2Z92B 1CL7L 4YBLB 3I02B 3QDJE 1T20A 4FZEH 5DRZB 5AD0B 5F1OB 1KN4L 3NTCH 3V0WH 2BNRA 4ODXA 4C56D 1X9QA 4WNQB 3LH2L 1LO5B 1BX2B 4PJ9A 5EBGA 4YFLF 2H3NB 3CVHA 1IM3A 1DE4B 2FEDC 4HCRH 3BSZL 4M7LL 1SJEB 4LVOB 3T0VA 3VI4F 5HVFB 3GSVA 3LD8C 4KWUA 3UO1H 3F6IA 1HIMH 1ZLUH 4L3EB 1N4XH 1SYVA 1JV5B 4I0CC 3NFPB 4ZUVB 4KMLB 2EH8L 4MXWH 4UNTA 1J1PH 5J6HB 4H1LG 3Q6FA 1KULA 3V6OC 1MCPL 1JZ5A 2DLGA 4NRZA 3C8KB 3RGVB 4TNVF 4W4OC 5T1LA 3BKYH 5B39A 3SGJC 3SDXE 1S7SA 2P8PB 3DV4B 1AKJB 1IZKA 4DKEH 2EH7L 3KWWB 2GITA 1IGTA 3SO3C 4BSWB 5CINL 3UJJH 4QRUA 3GSVB 3S88L 4MNQB 3ZKXB 1UT9A 4QHKJ 5B38G 1FCGA 2UYLB 4QRRD 3T0EC 4LRNL 4RAVB 4O5LH 4PLOB 3DURA 2R0ZL 3WFHB 4G42B 4G43A 5CZXD 4FXLA 4RCAA 4HK0A 4KI5F 2ILLA 3PHQA 3TZVC 3GMMB 3HMXH 4WWID 4G8GD 4KAQL 4JLRB 3K1DA 4PR5B 4YBQD 5DA0B 2OTPA 4M9PA 3IU4L 3C6LA 4ZO7A 3OB0K 2VRAA 4QF1B 3EYSH 4HG4J 5SWQB 4W6WB 4XGZA 3RBSA 2P5WA 4P46C 4BH8B 1ZVHA 1E6OL 5FKAA 3IJYB 5B4MC 4GAGL 1F4HA 1PX3A 5CEZL 5IGXH 3L6FB 3NIGE 1KACB 1L4IA 4YHNB 3HFML 3KHOA 5JW4N 2P44B 2APXA 8FABA 2CKBB 5I8OH 3A0OA 1Z9SA 5SV4A 5DS8B 2AJYL 3VFNB 3HE7A 3BT2L 4NUJB 2X4PB 3G5XB 4OGYH 4WO4A 4YBHA 4CVZB 5D1ZB 1ORSB 1J8HD 1WBXA 2AJZB 2YPVH 3GJFA 4X4ME 3TWCL 3G9AB 1YNTA 4WFHD 3KYMA 4TRPL 2LTQC 4PD4K 2GJZA 3E3QE 2GKIA 5ADOL 4WRLA 1S7WB 4JKWA 2FZ3A 5DD1H 1LK3H 4HXBH 5CUSH 3D39A 1NCAL 2OXHA 1BVKB 3O3AA 4KHXL 4O02H 2FEEL 3ROOB 4OIIH 2NCMA 1L9NA 3JV5A 3X17A 1L0XA 1VB9A 3D0LB 4LCIL 3GHEL 1G9NC 1U8QA 2OYPA 3GI8H 4U3XA 3KYMB 1CGTA 1ORQB 4QXTA 1FAIL 4JFDB 5AUMB 1NCTA 1FZOA 2G5BA 3HA0A 1RUKL 1G7JB 5AZ2L 2G2RA 1WWBX 1M71A 1Q38A 5EBLB 3ARVA 4MNQA 4P9HC 3U1SL 3X3GL 1J87A 1BJMA 3LIZH 2I5YL 1NGWB 3AS1A 3H9HB 4O00A 1RZ7L 3BZEA 5IQ9B 1NUNB 4CADA 4TQEH 4ELMF 1FJ1A 3H42H 43C9B 4LARL 3QUKA 3TBTA 3VH8G 2PW1B 1GC1H 4YC2C 3JVGC 3L3JA 2NNAA 1U8LA 1SBBA 5C0CD 4TSCH 3ROLA 3FCTB 5DJAA 1FLTX 4JPKH 4ZDHA 3S96A 2UZIH 2AKRA 1U8PA 2J6EH 2VDKH 5KJRH 1NUFA 4PY7B 2GSGA 3S4SG 2XG4A 4IRZH 1RFDL 4WJ5A 1U8IA 4NT6A 5DD5L 3TT3L 2R15A 4LCCB 4I3GA 4PYGA 5F9DC 2I07A 3JXAA 4QHMA 3S3JA 1JN6B 32C2B 3ESVF 4HS8L 2G60L 3QUKB 4M00A 4UINH 4BZ2H 1WJ3A 5LCVL 2Y06H 2I60L 3BN3B 1UKQA 4C58B 1ZS8B 2AXGB 4Q97A 4PJDF 5BJTA 5JDSA 3AMKA 1IEAB 5HD8D 1Q9OB 3WFCH 4K8RH 4YDJA 1HNFA 4GQPH 1E6JL 2FGZA 1VESA 5I1KL 4MAUL 4TRPH 2R56H 2PXYB 3PQYE 2O5ZL 4HUNB 1R0AH 1BVLB 1PYWA 2EDFA 2LTQB 3QISA 5E8EB 3RIFK 4HS6B 4W6YB 1YPZB 4Y4FC 1NGXA 4PJDA 4XBGA 4NDMB 4PD4J 1J8HB 4UBDC 3CLFH 4HZAA 1N64H 3TO4B 4V2CB 4RAUA 2DYPB 5IHZB 3DRTA 4FMFA 4YHPB 1J5OL 2HJLA 2NXYB 1G0YR 5BMFL 4V2BA 3MO1B 4JN2B 5ITBL 1QKZH 2A6JB 4YBQC 4X0KA 2X4SB 4JO1L 4L4VB 1JBJA 2GJ6E 3D9AL 4DZBA 4EIGB 2YN3A 4I0PC 1FLRH 3I6LD 4OF5A 2VLLB 4M8QB 2MQCA 4HGKC 3RUGF 4RAHA 1RHFA 2PR4H 4ZYKA 3CXDL 4X6BA 2DQIH 2NQCA 3U0PA 1RQ5A 3UTSD 5DJ6A 4OQTL 3UYRH 2VLRE 1QSEB 2DKUA 3HMWL 2CO6B 1F4WL 2LE9A 2LABA 3C5SB 4K9EC 3KYOB 3MMEB 1KEGH 2JK5B 2X7LB 1X5LA 4U1GB 4QKXB 3S96B 4LPWA 4WI3A 2X4NB 3QUYA 1UJ3B 3HNVL 4WU7A 4NC1E 4FQQB 2PYED 3HE7D 3CX2A 1IQDB 1R3JA 4P2QE 1MHHB 4DUVA 1F4XH 1PFCA 3VXRE 3RRQA 1F3RB 3FAXA 1YYML 1IFHH 1RFDH 2VZ3A 5E56A 1EHXA 3F7YB 4XNMA 1DLHA 4M5YH 4GXVL 4QHNA 1DBJH 1IL1B 3FQTB 3NCJL 4K2UL 3KG5A 4WW1A 4CVXA 3VWJA 1EEUA 4O02L 1JIBA 3U4BH 3WJJC 3BH8A 3CX5K 5GRJH 3KPSA 4XX1E 1MCQA 4G7YH 4W4OA 4Z7UA 4Z77B 3V6FA 1JVKA 4DGIH 4QO1A 1UM5L 3MGTA 3AS2A 3ARBD 1CICC 1NANH 3CSPA 1FPTL 3EAKA 4FQQA 1OAZL 4LMQI 4OCRL 4PJGB 4JREC 2NYYC 1NGQH 4K7PX 5C09E 4TULH 4FXKA 2FJGB 2Y5EA 4N1HB 1ZGLB 2JJSA 1OOAA 4WW2B 5AZ2H 3VRJA 5D7LA 4X9GA 4GQ9L 1DLFH 3QFJB 1BZ9B 3L5HA 1KIPB 5TPWL 1TJIH 4YBLC 5HYEA 4CUCA 3OB0H 5IG7B 3GB7B 4QWWD 5LBSH 2WBKA 4KV5F 4Z8FL 5I1CL 3ZKMD 2XYCA 4MD4B 4Y8DC 1NFIB 2HAZA 5I1DB 4JFOB 1WAAE 3DUHA 5GS2H 4O2CB 5EIVA 1BEYL 4NRXB 4O9HH 3IDNA 3BOVA 3OSKA 4LLVA 2VDNH 3ZYOA 3BFOA 3AS3A 1D5XA 3PGDB 4WW2A 1Z0NA 3ZE0E 1B9ZA 4ERSL 2EDEA 1IC7L 4NKDA 5DVNA 4NO0B 1JZ7A 4OCYH 1PG7W 5INDA 5CJOH 4GAJL 1ADQL 4XI5D 3VXTA 3NTCL 5CSZB 4LLWA 4ODBD 3RY5A 5J57B 5CJXA 2P5EE 2EDWA 2FLBT 1INEH 4TOYH 3P9WB 5A1AA 3U36B 2VL4A 4S1QL 1UCBH 2WQ8A 1TZGH 2R29L 4NN5B 5FYKE 1FIGH 2ZG1A 1T89A 4R7NA 3IRZA 2XNAB 3W39B 4PGEA 4XAKD 2AEIT 2COQA 4OZGA 5FO8B 4OZIE 1K4DA 3VFOB 5BO1L 1FNAA 1HDMA 4NZRH 4Y4FB 5I18H 5IB4B 1J1PL 4HW6A 2BNRE 1HYSC 4LCWE 5I1EH 4PJXE 1WFUA 2BNUA 4NWTH 3DXAA 4Q9QL 3P0YH 1T5XB 3BDYL 4JJ5A 5IOPB 5GRVL 1YEIH 4PJHA 4X4XB 3CZFB 4MCZB 3VFPA 3WDHA 4PRID 2FX9H 4WI7A 1UGNA 1CFVH 1VPOH 4HIHB 3V0WL 4F7EA 3CX5J 3CFEA 3BKML 4HKZB 3GBML 4QNPF 3IJYA 4UTBH 3QYCA 1AI1H 3SDAB 1SJEA 3FZUC 4HWBA 2J4WL 4XVSL 4I0PB 2P7TA 3AXLB 4MHHI 4XI5C 1L7TH 1D3CA 1DLFL 1BFOB 4UDUA 4R3SB 5DS8A 2PO6A 1G9ML 2QL1A 4YHKL 3PABA 4FP8H 2DWDA 1I1RA 2PUQT 2HT4D 1LQSR 4IHOB 3QPQD 4M7JL 1T7XA 3HLAB 4HG4K 4LKXB 1GSMA 1QD0A 1VA9A 1I7ZA 2D2OA 1JGVL 2BRRH 5ELIA 4L1HA 4NN7B 1T22B 3BHBB 4OLEA 3WD5H 5CP3A 5LVEA 1OAYL 1UYWL 4BM7A 2EDYA 4PG9A 4ZO6A 5FYJD 1JPTL 1MCWW 2P5WE 1DBJL 3LEVL 3ARDB 4G43B 4G42A 3UTTB 5HTSA 4C56E 3DJ9A 4I9WE 3VXSB 1DQJA 2XQBL 5D2NE 4X7TB 1NC2D 1NCDH 1KUMA 2DQDL 2RB8A 1MSPA 3QQ4A 2VO5A 1JMZA 5LQBH 4IRJB 5AUMA 3Q3GB 1YNLL 1UM5H 2HRPL 4FZEL 3QXVA 4V1DB 4N5EC 3OXSB 5FV2A 5D5MF 4OD1H 1CDBA 4OZGB 5EO9A 5FO8A 5DJ0A 1XZ0A 2FR4A 1VGKA 4YNYB 2ERJB 5I1HH 1ZTXL 2ICEA 4P4KA 4Y1AD 1R3KB 3T2QA 4POZC 3RGVA 5JXED 5E00A 4WI4A 4ZUSB 1C1EH 5MEQA 4JDTL 1H15B 1H8OA 2MHAB 2UY6A 4JE4B 5EOCJ 4DGVL 1BFVH 1KFAH 4V1DA 4J12A 3NMEA 4JM4L 4M1DH 4IRSD 2KZWA 2F53D 3QFDA 5E8DL 4OAWB 4N0FA 1YJDH 1Z9OA 1QACA 5HPMA 1E4KA 1NCCL 4FQ2H 3N9GL 1NBYB 1P53A 4FFZH 1WF5A 2YMXH 4P2RA 4J8RA 4OFKA 5FGBC 2Z91B 3BUTA 2OK0H 3K81A 1CGUA 4NM4L 2V17H 5CHNB 4QTHA 2Z92A 4NNPH 5E8PA 1T1YA 2MWCA 4AENA 5EPMA 4H0IA 5TE4H 1MY5A 1HQ4B 5ITFB 3IFOA 4F7MA 5HYQA 4QF1A 3O6FD 4AEFA 4NCC2 4ODXB 2HWZL 3BQUB 3V8CA 3IXAA 5LJYH 4XGZB 1N7MH 3QFDB 5DFVD 1OY3B 3TBWB 2ZOLA 2V9QA 3RVTC 5GIRA 2FHBA 5DEGA 4S1QH 4LARH 3TJHD 1A6VL 3LKPB 1BM3L 4UINL 2PTVA 3UTZB 2YRLA 2VWEC 1G0DA 1KT2B 3GO1L 3GNMH 3LIZL 4WFFD 2XPGA 1C08A 5MI0B 1R5VB 3F6LA 3F7VB 3EOYG 3DV6A 1T1YB 4I4WB 1NFDF 4RMUA 4OKVB 4EKXA 4OLZL 1WBXB 2AJZA 3GJFB 4KRNA 5GJTL 4L4TD 4Z6AT 4E0RA 3IXAB 1J0KA 4X7TA 1I9RH 3C2SA 4MGXA 4GAYA 5CJXC 5KAQG 1X7QB 3KWWA 3LEYL 3I75A 1QLRA 5DEGB 5KJRL 3OR6A 3VXME 3LKPA 2YS4A 1A6UH 3C2AH 5LGKA 3PDOB 4M93B 4ZODA 5MEND 2ARJB 4OT1L 2UYLA 4GKSB 3JUYA 4L9DA 5EZOH 1V3LA 1JN6A 1IKNC 4OFPA 2FR4B 1AP2B 4I77H 4WI5A 1ZSDB 3MOAH 4LOUC 1U8KA 4NKOB 5I8KH 2ZNWA 5CUSL 5HVHB 1K6QL 1BAFH 5BMFH 5E00B 2E9WA 4JLRA 1OAUH 5FHAH 1U6AL 1LMKA 3VWJD 4PTTB 4HIXH 1TZHA 3VXUA 1RZIA 3FQUA 3BIKA 3N85H 1EA9C 1FC1A 5ACLA 3WFEL 2R0LH 2A6DB 3L7EA 1U36A 2P5WB 4KI1A 1FL3A 3OAZK 2OTWA 4XCEA 2WBJD 5CSGA 3BE1L 3ZL4H 3SO3B 1I1AD 5DUPH 3ULUD 5C0ND 4PJ7E 3OR7B 3U1SH 3X3GH 3TVMC 3S35L 4JPKL 1Q72L 1LE5B 2BVQA 1QSFB 4NOFA 3KS0H 1URLA 1L0YA 3T0EE 2NLJA 1N64L 2DD8H 4WO4B 5T3XH 2YUZA 4JHWL 4LSUL 4RNRA 4NYLA 2R0KL 4HUVB 4YPGB 2CXKA 4K23L 3MFFB 4R0LA 4OZGE 5K9KA 3V6ZA 3TBWA 4D9LL 4LLQB 5FO9A 4JO1H 3HS0B 3RY6A 2BVPB 3QIUA 1JUFB 3VGEA 1A6VH 1KEGL 3DX9A 1BBJA 5HGHA 3HAEG 4OD1L 4XC1H 3KPRD 1DUYA 3CIQA 4RDQF 1DJSA 2J5LB 4B0MM 5FECB 4NN5C 2CIIB 1Q9OA 1PBYA 4U7MA 3LS4L 4YPGA 4FQCH 1OSPL 1BD2E 1NDMB 3RZCD 4YFEA 4ZOAA 5HI4C 5FOJA 1R3LA 1VACA 3NACL 1NKRA 1K8DA 4X83A 2CRZA 4NKOA 4H8WC 2QSQA 3HNSH 4X9IA 1A9BA 5C71A 1G1YA 2IMMA 3CU1A 4GUPA 3WKNA 3TJEL 4NQEB 5C3TA 5DVMA 1BMGA 4L29A 5DUBA 1A14L 2VE6A 4BFIA 1CE6A 4KK9C 5D8JL 4X4YB 2GTWB 3U36A 5CGTA 1AO7D 1JRHL 4PJGA 1J5OH 1J0ZA 3SGKC 1EXUB 4Y19E 5IMLB 1MCJA 3WFZA 1MHCB 5C0DB 3RX7A 4R2GC 3UTOA 1XGPB 3UBXI 1HHKA 3DRQB 3HI6H 5CILH 4PJ8D 2V9TA 1DFBH 4HPYL 4F7PA 4CN1A 1X5IA 4JO2L 5LCVH 3WXVL 5HGAB 4NJ9H 4HIJB 1V8HA 1XF4B 1T5XA 3QXAB 3OKOB 5IOPA 5J3HD 1RVFH 4OF3A 3QDGE 2QR0B 3PE9A 1MHHA 1HH9B 5K9OA 3UYOD 1CGWA 5F9JA 3NCMA 1YDPB 4M5YL 3EYFA 1SBSL 4GS7B 4O51B 1MHCA 5C0DA 1I8LA 1PYWB 1R5WB 1JNLH 4G8GB 5E8EA 1UQSA 5SWSB 4GAJH 5H2BA 4DUWA 4RIRB 4PGJA 5L7XH 1F4XL 1QBAA 5F8RC 5L6YL 3OWEA 4WGWB 4XH2A 3HRPA 5B38A 1U95B 4S1DC 5DEFB 3P4OB 1FVDB 4XNQA 5T1DH 3C6SA 4I3RH 4Z95L 4Q9RH 2R29H 5D1QD 1YQ2A 3VXTB 1Z3GL 2AK1L 1LILA 4ZAKA 2ORBL 1I4FB 5IUSA 4IMKC 3V52H 3CLEH 1SMOA 4P4KC 4PRBA 1TFHA 5CEZE 2PR4L 4ONOA 4RIRA 4C59B 1OQXA 4PGEB 5AAMA 2Z35B 1K2DA 5KSVB 2YD1A 4FQ1H 1MRDH 4WUUA 4IOIA 1O7SA 1AO7E 1XH3B 2ARWA 2F9BT 5I6XC 1A7PH 1A5FL 4PG9B 1KIUA 5CP7B 1M05B 1Z9MA 4QT5B 1F4WH 4F15B 4P5TC 4P2QB 1S8DB 5FOBB 4TVPE 4I2XE 4X5XB 4D9RE 1A6TB 1DQJB 3STZB 2F74A 4EUPH 3C5ZD 3MRMA 3MA7A 3BDYH 5MP6L 5D7IE 2NY5L 1F5WA 5I75C 2QTEA 2A9NL 3LKOB 2NY0B 1UG9A 2CDFA 1FQ9C 3ECBA 2WWMD 4XP9L 4EI5C 5MERA 1HINL 1R3HB 3BKCH 3IDXL 5E9DA 3NPSC 2DL9A 4AIXA 1F42A 3C5ZB 3DUUB 3B5HA 4RGNB 3QQ9D 1HHJB 1V7MH 4OF6A 3MV01 2MCG1 5KVEL 1FP5A 1U42A 4DWHA 3QCVL 4L4VE 3BGFB 4Y4KC 4JCMA 4NQXB 2Z8RA 3X3FH 2C4XA 1UCBL 2KZ1B 2F54B 2HRPH 1JGEA 7FABL 3NZ8B 4TTDC 4JQVA 3TFKC 3TNNB 4EDWL 1KCRL 3P4LA 4UI2A 1VFUA 1EVUA 1G7HB 3OKLB 1HDMB 1T21B 3CFDB 3QIBB 5DJ8B 1WAAF 1Y18B 3EO9L 4YXKL 1RK0B 3BXNA 2BNUB 2GUOB 1NEUA 3FAWA 1INQA 3JTTB 3C08H 4HH9A 3S5LA 3QNXB 2JB6B 2ZUQB 4M48L 3ZE0F 1VFAB 5SWZA 1KFAL 4PTUA 3REVB 4Q9QH 5HGBA 4UUJA 5EBWA 1J05B 2NX5D 1AI1L 4LLVB 2VDPH 5JW4M 4UTBL 2AJUH 5GZOD 4E41A 3F8UB 4HLJA 3NFNA 3CLEL 4PJIE 3SDCC 4K3GA 4IMLA 3O6KL 4CMHB 2YMXL 2VN7A 4G8EA 2X1PA 3KPSD 4G80B 4I5BB 1GGIL 2H9GA 2GCYB 1H5BB 1P84J 4WUUB 2EC9T 4YHKH 5EUOB 5C0EA 4K94C 2QQLL 3NIDE 3WS3B 2XPGB 3VFTA 3FN9A 5C0NC 5H35B 5EFIA 1E0OB 1FYTA 1BFVL 1JF1A 2WNGA 3KYAA 4FABH 1VFAA 1KJ3L 3QCTH 5SWZB 5F7EH 4P2YA 2J4WH 3SE4C 3ZYIA 3ZSTA 1AGEA 3WJJA 3C87A 5DVKA 1T04B 1A4JA 1FL6A 4PPTA 2A74A 2R9HC 4KMTL 3HC4L 4HXAH 3DGCR 4KK6C 1H3UA 4L8SA 2W91A 3PWJA 2ESVE 2NXYD 3DUSA 2DQUL 3ET9F 4FXGA 1MFDH 3HZKB 3MCG1 2LVCA 5GGTL 2YK1L 3EDJA 5E5UB 2R2HA 4HPOH 4P9HL 5L6YH 3GBNH 4G8FB 4PJHB 3QDJD 2R0WH 4X4XA 4XP5L 5ALBH 4PIRF 4NM4H 2FL5B 1X5AA 5EPMB 1MHEB 1KXTB 1W72L 1T80A 1BQLL 5IB1B 1RZKH 5KW9H 2C4FU 4Q2ZB 3AS0A 1KB9K 4FZ8H 4HKZA 2HH0H 4G8IA 5DQDH 5BV7B 1KJ2A 4UV7L 4RQQB 5J06A 4TUJB 5CIPB 3WFHA 4P4KB 4NZDA 4OGAC 1KEML 1JFQH 4JANB 2DS4A 5F70A 3U9PL 3PHSA 4LQ1A 5MEQB 1T5WB 1T20B 3IYLW 4IOFC 2I9TA 2MHAA 1IE5A 2B39A 2Z8VC 4CMMA 1CG9B 1EVTC 3C6LB 5IB1A 3ZHDA 5LGJB 3ARGC 4H20H 2G9HA 1R24A 4K7PL 2H3NA 3RBGA 1P4BL 4KKBC 4RGOL 4HC1A 4LLDA 2VR9A 4NQDA 3CJJA 5HYJD 1GGTA 4MVBD 3BEWA 4PJHF 2MQ3A 5FA3A 4JPVL 5CIPA 3IFNH 5EU6E 5F7YC 1U8JB 4GW4B 8FABB 4CU7A 1JV5A 1JGLL 1OAUL 5IHBA 1XCQB 3S34L 1JPFB 4NZTL 5KSBE 1KSRA 3ILQD 3OF6A 1KELL 4OF0A 4G3YL 4OZFH 1RD6A 1M7IB 2R0KH 2SEBA 4LLMA 4P5TA 2HRLA 2JCCF 4Y4KA 5HYQB 1WV7T 4KI5C 1NGPL 3QQ4B 3TYGL 3FMGL 5A2KH 1QEWB 4N0CD 4YR6B 3O8XC 1IGTB 2AK4D 3QDMD 4JM2B 3WO3B 2A6DA 3HPJA 3IJHA 3NH7L 4G7VL 2H45A 1F58H 4NGHH 5HDLA 4UNVA 1IC1A 2DKMA 2BRQA 4D8PA 1MOEA 3LQZB 1XCTA 4Z7QF 3C60A 3F7VA 3BYYA 4I18C 1EEZB 4OCMC 3IF1A 4DW2H 1KPRA 4PJEF 5BOZG 3ULVH 4NUGL 4MNGA 3SJVB 4P5TB 4M7KL 1T66C 4XC3H 4BH7B 1AFVL 2YD7A 4ZNEA 2D7OA 1WFNA 1MUJB 3BD3A 3U7AA 5FUZH 3VXPB 3BI9X 2CK2A 1W8OA 1WGOA 3ARTA 3QO0B 1NGWA 5FKAB 3ARXA 5KZCB 1CGSH 4KJWC 2R2BA 4MNQE 2H2PD 2ED7A 3JBG7 4IRSC 5IGXL 2W0LA 1KPRB 4XNYL 3H9SE 1MH5B 3MRCB 4LBEA 3PWUB 1YY8B 3QEUA 1S7RA 3QXAA 2OR9L 1T5WA 4OLXH 3WUZA 2N7AA 5TE4L 5FECA 1KCVH 4ZD3H 3DBXB 1HSBB 2GSGB 2IG2L 4X6DF 1HSAB 2YKLH 3GSNB 2JIXA 5KVMC 4OQTA 2OSLA 1ZKAA 2HT4C 4WVRA 1D5MB 3DHJA 3O9WC 3CFKB 3N85L 3E8UL 4YXHL 3RTQB 3MLWH 1I1FA 1A7RH 4XCYA 5IBLD 1N2RB 3O2VL 2DD8L 5T3XL 1FSKB 4HBCL 4L4JA 3RUGA 4TUKH 5E70A 4GUPB 1P7HL 1HSBA 5J11B 4MJ6B 1OTSC 3MOBH 5I16A 4P2CG 1LEIA 5ISZE 1AO7A 1NMAH 3LEYH 1FO0H 2FECI 4JHWH 1ZANH 4MDJA 2Z4QB 2IQAB 3IFLL 4MHHG 1F13A 2E7MA 3OKEB 1A1NB 5HHME 2Y9RT 1RJLA 1U9KA 4A6YB 3KDMA 2HH0L 1E6OH 5J89A 4Y88A 4OFYD 4OD2B 5EZIH 4JDZB 3MODH 1ITBB 3U4AA 5IVZB 4UB0H 1EFXD 1DTUA 2YD3A 1FVCA 4OZ4A 3RWFB 5EU4A 4EDXA 1NAMA 4KC3B 2X05A 3MRMB 1JPSL 3MLZH 3ARGB 2X4RA 4DZBB 3O8XD 1CDYA 3B3IB 4PJ7F 2IALB 5EU3A 3O3DA 2PO6C 3ECBB 4IIQB 3VXSD 1MRFL 1K8DB 32C2A 1UQSB 3X11A 3RAJH 3T08A 4J4PD 2CRYA 1ZWIB 3MMEA 4X7SL 3NFSH 2YC1B 4P5KA 5MP6H 2IGFL 1CS6A 1YECL 5JOFB 3QEHA 4Z7VE 4JB9H 5BW7C 4ZD3L 5EU3B 3MREB 3IVKB 4WWKD 1BFTA 3GJFH 4DKFL 3V6ZB 1B2WH 5EU5A 4D3CL 2OSLB 1GVIA 1X3DA 3SQOH 3KAAA 1YMMA 1JE6A 3SPVA 2IH3A 4JZNA 1K85A 4WW1B 4CVXB 4JM2C 3HR5B 5H37H 5E94B 3W5MA 1MCOH 3LKQB 2R23A 3QCUH 2DYPA 4OV5A 4WY7L 4POUB 1SJVA 4DK6A 1JHKH 3MGTB 2QR0A 3QEHB 2X4QB 3J8F7 5D96B 4PJFF 3RU8L 1C5CH 4WUKL 1QFPA 4XP9H 1S7TA 5D72L 5DO2D 1JNLL 3T4YB 3HZMB 1YC8A 3ARRA 3MLYH 3LHPH 2Z4QA 4OTXL 2VXSL 1NJ9A 2NY5H 4EEEA 1CZ8H 3VRJB 4R8WL 4AEIH 2VDOH 5FM4A 1P6AB 1MWAH 5KVEH 1AGFB 1OQOA 4AH2A 3L5IA 1MF2L 3KLAA 3PG2A 4JDZA 4J3TA 4J3OC 4OV5B 4JFFE 2FX8H 5DRXA 3BUYB 5FYKU 1N6QL 2YEZA 1T03H 1S9YA 4PJ5D 2EZ0C 5MI0C 3DX8B 1F6LL 4BFBD 3QWOA 1NL0L 3VXOA 3ULUE 4U1MA 2ZKHH 3QCVH 2XTJC 2AJUL 3LKNB 1F3JB 5L88H 3W5NA 3MRBB 4KY1L 4AH2B 4JVWA 1DLHB 2O5ZH 1R0AL 3HG1D 5D7JC 2NY2D 3QUXA 5JW3L 3QDGB 4Z7VA 1ODAA 3JVGA 2J12B 3BXNB 3MBED 2YEZB 1ZWIA 2J3SA 4B7LA 4X5WA 5TDOA 3S98A 1XF4A 4GG6B 4MJIA 1I9IH 1I3GH 2EIZB 4Z76A 1FLRL 1S5IH 2FL5A 4ZPTB 1P1ZA 1XF2B 1A64A 1RJCA 2Q87A 1ND0B 3LKOA 3R8BB 3I3BA 3CK0H 5FGBA 3WEXB 1FNSL 2N56A 1U8HA 4R96B 4X8JB 2VC2H 2XTJB 4G8IB 4OQTH 2IEPA 1TJHL 4KRPB 2C9AA 2VLJB 1KCSH 5IJKA 2NZIA 3LPGA 3Q6GH 4ZUWA 2VQ1B 3HMXL 4N9GA 2QV2A 2F19H 5ALCL 3MJ6A 5H35A 3RZCC 4H1LA 4UV4H 2F54A 2XTJD 4JRXA 1CDUA 4DFHA 2ZG2A 5FHBL 3UTQB 4KU1A 5HHMD 2GAZB 1KPVB 2QSTA 3D0VB 4HUMB 4DJMA 1SJHB 1XIWD 4MLIA 3R06A 1HXMA 4HK3N 1CVRA 1MFCH 3HNVH 4S11A 4BSVB 2YK1H 2ED9A 5EO0A 2V6HA 4PV8A 3GDBA 4ZXBA 4MYWB 1RIVH 4NO0A 3J7HA 4OV6F 1OD9A 3GM8A 2Q7YA 3O9WD 4O2EB 5F7FA 1HXYA 5A16B 5FF6A 4F37F 1NQBA 4OCRH 2NY7L 2LVEA 3REVA 4UMGA 3JV4A 1MRCH 4LGSB 3HZYA 5B8CC 1X5KA 1SHMA 5EC1B 3VMNA 1MHEA 2B4CC 4YR6A 2WANA 3C5JB 4K3JH 5IW3A 2UWEA 4IMLB 1OGAE 5C8JA 1KB5L 2RJMA 5BRZB 4KHXH 4M1GL 1G6VK 4O2FA 1V05A 2DQIL 1HKLL 1L7TL 2QQLH 3M8OL 4DQOH 1I8IB 1ZA3A 3DGGA 4WFEE 5DJCB 2IBGA 2AJVL 1NKOA 2R8SL 3P4NA 4RQQA 4Z8FH 2IPTH 4OCLC 5GQBA 1MIML 3L3OA 4M6NH 2EIDA 3GSRA 5JORA 5EUOE 3DSNA 5ANMB 1KBGL 2PW2B 1FVEB 3CZFA 5EO1A 4IRJA 1IM3B 1DE4A 5TQ0H 4OI8A 1UXSA 3MCKB 3FT4A 3OXRA 2UWEB 5C0CA 4HF5H 5LGJA 5BRZA 4XAWH 1GPOH 5F7DB 1IC5L 5KBNC 2DQUH 3MRNA 2ADIA 3F5WB 2YD9A 4KDVA 5LXGL 5DJDA 3BPOB 3CDYA 4WUUD 3DOSA 1ADQA 3P77A 5F21B 3DVGA 1U8JA 3EFFA 1ZLWK 3VXQB 3VGBA 4OSUH 1YY8A 3QQNA 5FGRA 1KCUL 5ALBL 1T7ZA 2Y36L 1LK3L 4AZ8A 4UNUA 3HB3D 5CD3B 1FBIH 3LDBB 5D4QA 1TVDA 5C70A 3VGDA 1FN4B 3VCLA 2E8ZA 3PGCA 5T33H 1JWSA 4Y5YA 4JJHA 1HOCB 5D1QA 4NM8L 4YIQB 1KPVA 2HFTA 3TYFA 3B43A 2W59A 4NO0D 1PGRB 2VDQH 5I15H 1OTTC 4GLRH 4ZXBB 4OLYH 4YDIL 3EFFB 2PYEB 5TPWH 4PJ8C 4KH2A 4HIIB 4KHTH 2E7HA 2BOBB 5JNYA 3SCMC 2OJEB 4CW1B 1A1MB 1ZGLM 1A7QH 5C0AD 3MV9D 2O5XL 1KEMH 3BQUA 1TLKA 2CMRL 2AAVA 1LEIB 5CZKA 3WE6B 4P2OA 5D5MA 3V5HB 1O0VA 4LLYB 1FFNA 2CKNA 4YHNA 1JK8A 1IAIM 2XZAL 1A7RL 4L8SB 2XWJB 4NZTH 1KIRB 1MQ8A 2HFFA 4KGLA 1T89C 4GMTH 4OD2A 2GW5A 2VITB 5IKCA 4LLUA 3O6FB 4CVZA 2Z31A 4ZOCA 2R8SH 2BXZA 3GSRB 3H8NA 4U1GC 4TOYL 2FD6H 3T2PA 4J4PA 3C6LD 1RZJC 1B6DA 1L9MA 5EO1B 2NY5C 2W9DH 1UXSB 2YR3A 1X7QA 3AGVA 3GUTA 3RNKB 1QLRB 1AQDB 4JM2A 4X80H 1H8NA 4PRPD 3OV6A 2ATKA 4HF5L 5FYJU 2EZ0D 5I9QB 4NZUH 2MNUA 3VJ6A 1GIGH 5FYKD 3WXWL 2FJHA 1XCTB 3QI9B 4IOSD 1YJDC 4LPCA 3VGFA 4WENB 4W70A 5DGQA 5CEXA 4X6CB 5D7LD 3O4LA 4PV9B 2Y5TA 1YNLH 4JFFD 4KVNL 5DUMH 2AGJH 4AEHH 5DMIH 4F2MA 4A2MA 2ZUUA 5E6IC 1UADC 5I1JH 4M6AA 5FM5M 1EO7A 1RHHB 1YMMB 2EEBA 2K7PA 4MDJB 2BJML 43C9A 4JPVH 3ZDXF 1BIIA 3RAJL 1LGVA 1JZ2A 2KBGA 3T0EA 3TIEB 3ZKND 1XCQA 3ULUC 4OLXL 1QLFB 3HB3C 4H8WL 2QJDA 3AY4C 1BQHA 2EKSA 3LKRA 1HSAA 1IJ9A 2EIEA 1DBKH 1CI5A 2VH5L 1FO0A 1LP9A 5GJSL 4LAQH 2IANE 3QEGH 1C12A 2PCPB 4QXGL 2IALA 2E9IA 1PW3A 1JHTA 4H88H 2VLJE 2IG2H 2MMXA 3NH7H 4G7VH 5IFAH 3O3DB 3HE6D 2XZZA 2EEAA 1NMCB 4N0CC 3ZYZA 3LQZA 3NZHL 4D0BA 3JWOL 3C60B 1D6VL 2Q6WA 4G5ZH 5B8CB 4LLUB 1IZJA 4YWGL 5GGVY 4YDJB 1BQHB 3U4EA 4CDGC 5CMAA 3OGCB 1S9KC 4CBPA 4IJ3B 5C6TL 4M61A 1ZLSL 4LEOB 4MAYB 3I6KA 4NKMB 1LE9B 4LASH 1U91A 1YPZA 2IQAA 1DUZB 2XFXA 3LY6A 1CXFA 1I1AB 1TQBB 3VJ6B 1RJLB 5DVOA 1GGYA 5F3HB 4BFEA 5I30L 2G60H 1MF2H 4KRLB 1AGCA 4YHPA 1ZANL 4XPFH 2BVYA 1X6LA 2HA1A 1T7VA 4JFFA 1TITA 1K3IA 3LQAL 1KCLA 4M43H 3WO4C 1QSFE 3SHSA 1WZKA 3FB8B 5FAAA 4S1SL 5SX4H 2IPUK 2YUXA 2HFGH 4QY8B 4U6YB 2GYSA 5HHQA 2Q76A 1MRFH 1CE1H 3BP5B 5EH1A 1MY7A 4U1LA 1LDSA 2BNQA 5IBTH 2ERJC 2R1WA 3H0TA 2BJMH 4MMXC 43CAB 1ZXQA 1WZLA 1YEEH 3KYOA 3P0YL 4RGMC 3MRQB 4P0DA 4NNPL 5DC0A 5D8JH 4RMQA 5JO5B 4Z7WE 3WFEH 5C0BD 3W11C 1QBBA 3DNKA 5KVFH 3WO4B 1CK0H 5D7JB 5DQ9A 1JGUL 4N0RA 4NPYA 3ARDC 4NP4L 4JR9H 3MRBA 1I8KB 4R90L 5IMOB 3VFWB 4X8XA 3VDBA 1YY9D 4XNZB 1KV3A 3O9WA 4NNXB 4D0BB 1G7QA 1KTLB 2N1KA 4Q0XH 4PJCB 1WZMA 3QHTC 3P4MA 3FO0L 3K2UH 5SX4I 3ELAT 4GJTB 4KRPC 2NY2C 3VFVA 5GS2D 2GTWA 1EEQA 3KPNB 4MAYA 5L8KB 1G6RA 5FO7A 1ND0A 4C4KO 5EZLB 4HAGA 1PY9A 4C54A 3F58L 4QRRB 5L9DL 3A67L 2OI9B 5EDXA 4HWZB 1J0IA 3D3VE 3QUML 2Z35A 4PJFA 4N8VG 2NY3D 4M1CD 1YMHB 3DGGB 1ZK9A 4S0SD 4NNXA 4GXUM 3P4NB 5IIEB 1XR8A 1A0QL 4NQTA 1A22B 2YPKA 4M7ZB 3B2VL 1TQBC 3P40A 2C5DC 4JFOA 1S9YB 4LPYA 4MXVF 3SGEI 2J88H 5FYJH 3AREA 2VLKE 4X98A 1FVEA 1EAPA 2F19L 1I7UA 2F58H 4JRXB 2VLRD 2ZUVA 1U3HB 3PGDA 1D5XB 3IDGA 4QXUL 1JJUA 1CFQB 4ESKA 4LSPH 3BESR 5EU6B 1J0HA 4U6YA 2Q86A 3D5OF 4OCWH 4JZOA 2MKLC 4HUUA 3T0WA 5ISZA 3AROA 1B0GB 4MD5B 2NR6C 1NLDH 4R0LC 5H2BB 2YPKB 1Y6MR 2EDJA 4PJFE 1D5IH 2AEPH 2LAGB 1BECA 4NN6C 4EI5D 3QP3A 1F3DH 4YDVB 3TN0C 2VUOA 5F3BA 3WNPA 4JVUA 5E7FA 1NGYB 1KOAA 3DETD 3RVUD 4GKZB 5D2LB 1HK6A 5F7LB 2EIBA 1XF2A 2FB4L 5KOVC 3RDTC 5MENE 1CFQA 5HI3C 4BZ1H 1HKLH 3TNNA 4HUKB 4NNYB 1KPUB 2VQUA 1DVFD 5IR1B 4QYOB 4APQB 1MIEH 1SEQL 3MLYL 2VLMD 2A83B 3LEVH 1CIDA 1P9MA 2H1PL 3QIBA 4NPYB 1B0GA 4MD5A 4OCSH 1CZ8L 4OCNC 1NC4B 1T3FB 2VLJA 3HI6L 2VABB 5DMKB 4ERSH 3PP4L 1D9KD 3MV9E 3TO2B 3SKUD 2HG5A 2H41A 1IBGL 3PGFL 2VZUA 3TC9A 4AG4L 2ZOKB 5JPMA 4F80A 5JNYB 2CK0L 3HAEH 1ZT7B 3T0DA 3SGDI 1CFNB 1RZFL 3RFZC 4EN3C 4F7CA 3FT2B 4HMCA 4Y1AE 3MA7B 4JKMA 3WE6A 3SE3A 3FJTA 4JFYB 4ZXBD 3GSUB 5IM7A 3KPOB 4BSVA 5I15L 1IQWH 4WHDA 5MERB 5AWNH 5GZNC 3IDIA 4GRWB 3IAPA 5EFIB 4JRXE 3I50L 4JFED 3P11L 4HUWB 1KIQB 2O5XH 5T1MA 4XPAL 2NY1C 4L4TE 4ELME 1NLBH 1LHZA 3UDWC 1X5HA 5F7HA 3PGCB 3QFJD 3P9MA 1GZPB 4UT6H 1XIWB 4R7DB 3G5ZA 1JWSB 4Y5YB 1KJMB 2VXUL 3OJMB 4JFEB 3HHRB 4BELD 2LU4A 2J8UA