5CEXA

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
207
Chain Sequence
TQPSQLSVAPGETARISCGGRSLGSRAVQWYQQKPGQAPVLVIYNNQDRPSGIPERFSGSPDTTATLTISRVEAGDEADYYCHMWDSRSAINWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody 9H+3L Fab light chain
total genus 43
structure length 207
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA01
1CL7L 4OT1H 1MWAL 1KTKE 2PW2B 3IDXH 3MNWA 3FKUS 1R5IA 3DV4A 2EZ0C 1S78D 3RNKA 5C9JA 4FQHB 4GH7B 1DBJL 4LU5H 4U1LA 4ZOCA 3THMH 2D0FA 4PJ9D 4ODXA 3F58L 5AWNL 1MJJB 3LSOA 5LAXA 5CMAA 4WV1C 1TCRB 2EO9A 4KFZC 3C5JB 5DURD 3I50L 4P49A 1AD9B 3E6HA 1DQMH 4JFEE 1LE5B 4CMHB 3CX2A 3ARBB 4KJPD 2QR0A 1LDPL 1GIGL 1RZGB 4TUOA 4ZPVB 4RMQA 3C5ZA 3CK0L 1JBJA 3BPOC 4KROD 3FB6B 4LRNL 4NHCH 3BAEH 5D1XC 1UWXK 4HIXH 1IKNA 4CBPA 2XQYG 3RGVC 4ZQKA 3REWB 1MCDA 4ZS7L 1J0HA 1Z6JT 3ARRA 5EUKB 3BGMA 5J3HD 4K9EH 4FN0A 2C26A 4U1SB 5CP3H 3HA0A 5JPNB 1G1CA 3WEXB 5BV7L 2LAGB 1CLYH 4QXWA 3QDMB 5HHPA 2X70B 5DEGB 3RWFA 5JIHA 3H8NA 4AH2A 2V5SA 3U9PL 3LHPL 1N7ML 1HXYB 2XWTA 3NCBB 4OF0A 5C07D 5KSVA 1M7IA 3V5HA 3DO7B 1MIEL 3IDNA 5I1LA 4KMQA 1T0PB 2L4OA 3TESA 1INEH 5E2UH 2ATPB 5DI8A 1MF2L 1KXTB 3TGXA 1FC1A 4YFDB 2R2EB 1KXVC 4HMEA 5L9DL 3GSWA 4P5TA 4H8WL 1R3JB 2DAVA 4HWZB 4ORZC 3QT2A 2RJMA 4LLWA 4WO4D 2CMRH 1HZHL 5DJ6A 4Z95H 2XQBL 2R1WA 5EBMB 3TZVA 4LNRB 15C8H 5GRZA 4G8GE 3NZHL 4GAJL 2AEWA 3WIHA 1TVHA 2IG2L 3B8SA 1GOFA 3MRHB 1UZ6E 3BISA 4M5YL 3WS6A 1FV1A 5IP4A 4OIIL 4DGIH 5C1MB 3ZZ1A 3U0TA 3BDYL 3TO4B 1BX2B 3LB6C 3PWPA 1EUTA 5EA0H 5KVDL 1HILB 2KUTA 2UWEF 4RGOH 4OZGA 4O9HL 25C8H 1C5DB 2A9NH 2EC9U 4CVUA 2AV1B 3GSNA 3MOBH 1KT2A 1CXEA 2NY3B 5DK2B 2OTUB 5FOBA 1EFXB 3PG2A 3GSUA 1ZTXL 1U8NB 2VDML 1JGEA 3BH8B 1E6JL 3LZFH 1RJZA 1IT9L 4R26H 3H3BC 1ITCA 3SDAD 5HJ3B 4M6OH 3PXHA 1FGVL 4NBZB 2FO1A 4XBPA 1CTOA 5DA0B 1OAUH 2X42A 4RMWA 3CK0H 5GRXG 4HWBA 3IFOB 1S7RA 4JO3L 3GSOA 2FGWH 1U6AL 2AABH 4ZO6A 3MUHL 3N0PB 4P2OC 2BCKA 3ALXA 5FYJE 3X14A 1LEIA 1NLDH 5FYKL 5KS9E 1FIGH 5ISZB 4ALAL 1XMWA 2EDNA 4QF1A 4EQ3A 4AT6A 1YEIH 1OARH 3LEYL 4TUKL 3WXWL 4NN6C 1YN7B 3O4LB 1PQZA 4FS0A 4OLUL 4XPHH 1J8HA 1V3JA 4XNZC 5JHLH 3RIAK 5BRZA 2AJZB 2EE6A 3BSZH 4P9MH 1T1ZB 5TDPB 1A7OH 2VOTA 2JJUA 4J3TA 5J6HB 4HIHB 1X4XA 2PTUA 2Q8AH 3VE0B 4I0KA 4E0RB 1QLRB 1A8JH 3QI9C 5LQBH 4LL9A 1IARB 1HNGA 5FYJD 1DQML 2HWZL 5DRZA 4O2FA 2V2XA 1LP9A 5A3ID 4OM0L 3C6LC 2X4UA 3L1OL 4OAWA 1B6DA 1QTYT 3RFZC 4I3RH 3EYVA 4UNTA 5CBAA 4HIJB 3R4DA 4LAJH 4N8CH 3BYTA 5ICZA 4DZBB 4X80L 3O3BB 4NYLA 2JCCE 5DLML 3NCJL 2Q1EA 5I74C 4WW2F 5C7XL 2FEDC 4AYFA 4M7KH 43CAB 1CU4H 4ZUVB 3GGWB 2BVOA 1CBVH 1ADQA 3X13B 3BP5B 3Q48A 2FH8A 2X4SA 2B4CL 4Y7MA 4GW1A 1VADB 1QFWL 2IPTL 1JZ4A 4L4JA 3K1KC 1DQQB 2AI0H 3O8XC 1QBLH 2LU4A 4XVUD 4WHTA 4XXDB 4ZUWA 4LSRH 4MAYC 5CJXC 2KQNA 2G2RA 5DVNA 3QAZB 3LRSB 1T04A 1OD9A 2BVPB 2W0LA 5E8OA 5D96C 2VXQL 4G6FB 1N8ZB 2IALA 2E6QA 1WAAA 2R9HC 3TJEH 2WINA 4KUZL 3ULVL 2ZNXA 3D9AH 4GAGH 4JZOA 5EU6D 1T5XA 2Y7QB 1OAKL 5D1QD 4ZODA 4IDJH 1K2DB 5L88H 3DYMA 3OHXB 2LVCA 1ETZB 3KXFA 3X3GL 4OQ1A 2O5YL 4OB5L 3SDAA 2DQFB 1IAII 3OKLB 5DEFA 4HH8A 4MX7B 5D7LE 4WNQB 4F57L 3MJ9H 4FZ8L 4UAOC 4JQIH 5F7FA 1P9MA 4M6MH 3VMPA 2ZWLT 1N26A 2DJUA 2Z9TA 1ZA3A 2J6EA 2ZJSH 2VXTL 4LSTH 3OPZH 3BPNC 4AEIH 1G9NH 3H9HA 5JW4Q 2RHEA 5E6IB 1YDPB 4ERSL 2RFXB 2ICWB 1JFQH 2E7HA 2XFXA 4W6WB 1SJEB 4XGZA 2DRUA 4X6DF 4HHAB 1YEJL 4ZD3L 3QI9A 1CICA 4LPWA 4FZEH 4I0PA 2VISB 2LQRA 4LSQH 1J1XH 4XHJD 3O2DA 1RSFA 2H2SC 4M1GL 3MA9L 1A6UL 1NCBH 4OCXH 3UTZA 1CDJA 1WCBA 2YPKA 1U93B 3MREB 2VLJE 4JN1H 2FZ3B 1DVFD 3IKCA 2DQEL 3D0LB 5FUZH 5DWUL 1NSNL 1UKTA 4R90H 5DSCA 4F15C 2PYFA 3B5TA 4BSWA 3AS0A 4R6UA 2R0KL 4W4OA 1MVFA 4U1MB 4O4YL 2YPVH 3ROLB 2MSPA 3ARYA 4XNYH 1HKLH 3MRRB 2KDGA 1FQ9C 1FE8H 5F8RC 2ICWJ 1ZA6B 2Q20A 5J1AA 1F8TL 3U4AA 2ADGA 1MJ8H 1XF5A 3FT4A 3I02A 3MLWH 2MCG1 3DV6B 3O3EB 4LAQH 4K71C 3KPTA 2VIRA 5JUEL 4JVWA 3GMOA 1IAMA 1XCQA 3O4LE 3DIFB 2AV7A 1Z0NA 2OJEB 1JPTL 4X5WB 5EN2B 3OJDB 1CFQA 2QTEA 3ARDD 5BVPH 2AJVH 3V9FA 1TTFA 2APFA 3QULA 3AS3A 1BBJA 4TTDD 4OCSL 1DN0B 2R8SL 1HHKA 4YHOL 2OBGA 7FABL 3BP7A 2GJZA 2GTZB 1U2HA 1DL7H 3RWJA 1LDSA 4HQQH 3LKNA 2IAND 2P5ED 1AD0A 1OM3H 2NY0B 3PWNB 1O7SA 1F4WH 4F9PA 2G9HA 1Q38A 5H94A 1LD9B 2ENYA 4LFHG 4UAOB 1BQHA 3WS3A 1MVUB 2J8UA 1RJCA 4XNXL 4P2QD 4TVPH 3GMRA 3S4SA 2IQ9L 3IU4H 5F70A 4UQ2A 4NWTL 1A1OA 1T0MA 5F6IB 4H1LG 1FFNB 3WNOA 4LDLB 5FM8A 1JGVH 4PTTB 4J3SA 3OB8A 3HNTH 1WIUA 4HXAL 1Q0XL 2HFEA 4GG6B 1RI8A 2P49B 4TSBH 3BIKB 2BC4B 4LRIA 4N1EA 2GITA 3RWEA 4UV7H 4U33A 1AFVH 3U48A 1UEYA 2NZ9C 1I9RL 4RA0C 2OSLB 2PNDA 1A6AB 5MERB 4ZG1A 3HMWL 1C8PA 4Z7VB 4FRWA 1HSBA 5F9AC 2HWZH 2FYYB 5I6XB 3JV0A 4NQVA 1U3YA 1ZGLP 2R56L 3V8CA 3DTXB 5I30L 4P23D 5FYKU 2BNRB 1R3HB 1YPZE 4JZNA 5FUOH 1GXEA 3KJ6L 5C0BE 2A77H 3VGHA 3LEXB 2BSTB 3WIHH 2WM0A 4LU5L 1H0DB 1IQWL 3MLPA 3GJFK 1NKOA 1JZ3A 4P0DA 4R4NC 2YBRA 3K8MA 4TNWF 3SKUD 1NAMH 3VW3L 3QNXB 2YUXA 3QZWG 4NQEB 1MCRA 3LN9A 4XVTH 1E4XH 1IC4H 3M8OL 3ARUA 4I3SL 1SQ2N 1QRNB 3VU2A 1MHEA 4C56D 1JPFB 4X6FA 3QJHA 3OXSB 5MI0B 3E2HB 3OZ9L 5C0JB 1LHZA 3BEWA 3QI9D 5E4IA 2E7LC 1I7ZB 4N9GA 1U8OB 4TVSa 2C3XA 1ZLWH 2DDQH 2NCMA 3G9VA 4TSAL 1BVLA 1KPVA 4CJ1A 3GK8H 2N1KA 2EICA 5IEKB 3VWKA 3DLQR 4K3DH 2RBLA 4U7KA 4PJIF 1MCNA 3NIFF 3CGTA 4GO6B 4MWFB 5IHUH 1EFXD 3H3KA 2O61B 2DQHH 1Z0MA 9CGTA 3GIZH 2ESVE 5D6CA 4WENB 3W9DB 3GMNA 1A7PL 3FO0L 4JPIA 4N0FB 5I1HH 5DUPL 2PXYC 5AG9A 1I8IA 5MP6L 1MREL 3RL2A 1JNNH 1P2CB 2I5YL 4O2CA 5KN5A 1S7VA 1EBAA 4EN3D 1KB9K 3VXSD 4JRYA 4U3CA 5MEND 2Y72A 1I8KA 3MLYL 5AWNH 3OTTA 1K6QH 1MRCH 4N1HB 3NMEA 3ULSA 3BP4B 4HZLB 3MLRH 4GBXB 5C70A 3F12A 4UBDD 2NQCA 5E70A 4U0RB 1FVCB 1YMHB 5BQ7A 2F19L 4K55A 1EFQA 5BMFH 1UQSA 3B9KC 5GRUL 5IFAL 4XPBL 1Q1JH 3ARDA 4O02L 4CN4A 4IRSB 3EFFA 3S35H 3ARZA 3VGDA 5MENE 3PWPD 5KOMC 3P0YL 5EZIH 1C7SA 4HKBA 3S35X 3W9EB 5HVHC 5T5FL 1MIML 3WHXA 5ICXB 1XR9A 4NZTH 3FMGL 5KVFL 1S9WB 4HWNA 3W0WB 2J5LB 2D4FA 3DYPA 4K94L 5GRJL 4K7PH 1B0RB 4NQCB 2KH2B 1ACZA 4MS8D 3PWPE 5DHYA 5E1AA 4LSPH 5J11C 3O8XB 3QO1A 3PWVB 2V5TA 3U1SL 3RPKA 3T1WA 1YEEL 3LVEA 4MAYB 3BPCA 3CSPA 1NCWH 2V7NA 3RZCA 3E2HC 5CJOH 2DLFH 2V5YA 5EIIB 3S3SA 3ULUL 5E99L 4PGJA 5F88B 4L3AA 1J18A 2M26A 3T3PF 4G8IA 2Q3AA 3LN5B 3CXDH 3S88H 4UDUB 2QADC 2R0LH 3GIZL 1CXKA 4JFZH 3TBSA 1YYMH 3V4VL 1H3VA 1OQXA 2F54A 5I1IH 3UTQA 4D2NA 5FHBH 3GRWH 4KHXH 5EO0B 4ODSH 3WN5B 5C92A 5GRVL 3QEQA 5INCB 1WSST 2EKSB 2VZOA 4I5BA 3D0VA 3WJJC 1CFSB 2ZCKH 1YEHL 2DWEB 2IFGA 4X7TA 2ZOKB 3WIIL 4JGJA 1QR1B 4PLOB 2ARJA 5GZNC 5JHDD 4J4PC 1OAXH 1AGFA 4PS4L 1G6RB 3ZYOA 1RJLB 3GMLA 3MLZL 4TSCL 1SBSL 3B9KA 2XYCA 5F1OB 1JYVA 4UINH 3QFDA 4KDTA 2Z31C 4PJ9B 1R5WA 2NW3A 1A1NA 3Q0HA 4Y4HD 1UH3A 3CDCA 5C2BL 5E8NB 2DLHA 5IIEB 2FECL 4KI1A 1W2KT 1CLCA 4YDJA 1NGYA 3CMOL 2GK0B 4ZOAA 3RVWC 3UCRA 1NMBH 3FOMA 3C6SB 1RPQA 8FABB 1QUNA 4NC0B 4OGYL 5E4EC 5J4MA 2OTWA 4KPHH 4OV5A 5F3BB 3I9GL 4YK4B 1VEPA 4Q6YA 1I7TA 5HVHB 1UCBH 1DL7L 4LEXH 4APQD 4FABL 3R8QA 4JQVC 3QDJE 2WIIA 5M95B 1QFWM 2JELL 3S96B 4BM7A 5GS0D 3VRLF 1S5HA 2D7MA 1XF3B 3HUJA 1YZZA 4PRBB 4C57C 1YNLL 4WW2B 3MRMB 1KCSL 3HNSH 3MOAH 3VCLA 2HVJB 2EDWA 1EH9A 4GOSA 2DMKA 5IJVA 3BVNA 1J5OH 3TT1L 4MDIA 2QSCL 3GIVA 2B0SH 2BNUA 3T2NL 1U8PB 1F11B 1F58H 2NLJB 3KXFD 5E94B 3T0ED 1S7UA 1XEDA 2W38A 4TUJA 3T77B 1R24B 5ALBH 1ZVHA 3KPLB 2J4WL 2UV3A 3D48R 4R7NA 5TE4L 3U46A 1IM3B 1ND0A 4ODHL 2XQYK 1NSNH 4JFFB 4Y4HB 3ZLQC 1P7QD 4FZ8H 2QV2A 4Z7WA 4L4TB 1P4IH 3LS5H 4CVZB 1TJIH 2YD5A 4MLSA 2DQCH 2HJFA 5BOZG 3FQUB 3SDXE 1N5YL 2FJFB 4Y2DB 3HZKB 5EBWA 1ITBB 3PHQB 5DJAB 2V6HA 2NY5L 4HPOL 1S7XA 4U1JB 4KV5E 4JFDB 5F6HJ 3UBXA 2CIKB 4M4RA 4L8CA 1A2YB 1LK3H 3BDXA 2DQIH 3TWCH 2BY2A 4M03A 4FA8A 1E6OH 1G7MB 3T2OA 3VFUB 2X44D 5IW1B 2NY6B 3SKNA 4LDOB 1G7LB 4I18C 3MRGB 2XWJB 5ABDE 5KJRH 3B2UD 5HHOB 4GFTB 4OZGE 4PRAB 3ALPA 3VFMB 1HNFA 2YOCA 2QEJA 3L6FA 4EIZC 3SDCC 1WVZA 1EBPA 3JWNC 1UXSB 4KC3B 1JP5A 1SJHB 2AW2A 4KPHL 4EOWL 2I26N 4FXGA 3P0VL 4G8EB 4O00A 3T1FB 3OR7A 5TF1L 3X3GH 4YBQD 4YDVA 2QQQA 1D9KD 1JNHA 3LKSB 1L7IL 1SBBA 1X4ZA 3VMOA 1PEWA 1R3IL 2DWDB 2ZJSL 5GS2D 3S37H 3DROA 1CR9L 1RFDL 4MNQD 3SDDB 3OGOE 2NX5A 5IHZB 4X6BB 4HX1B 5BW7C 3PXJA 3D1MC 4PP2A 3IT8D 3FCTA 1ZOXA 3OKKB 5L9DH 4PJFA 5DC0A 3WD5L 3U79A 4OI9A 1QHOA 4X6DA 2B39A 4PGCB 2HMID 1ORQA 4DOHE 1KV3A 4IRJC 3M1BB 2WAHA 5KSAD 3B4NA 3RNQA 1PGRB 5F44A 3SN6N 3T0XA 4GKOA 3WFBH 3BQUD 4EI5B 3ZHKA 5K93A 4YNYB 1YUHB 3TO2B 4I2XA 1IAOB 4AENA 1LE9A 2DQUL 4NPYB 3RZWA 4WUUB 3H9SA 4YX2H 2NY5H 4XZUA 3HE6B 3UXFA 5CSZA 3CVHB 3WJLC 1QLEH 1Q94B 4U2YA 5I8CA 4AG4L 4PD4K 4RFNB 4ZO9A 4K7PX 1I4FA 4CDHA 3FQTB 4PJ5E 5F93C 3UDWA 1UB5B 4NJAL 5LCVL 2R4RH 2IQAA 4KJWD 3SKOA 3TPUB 2DYPD 4NWTH 4JY5H 1N6VA 3ME0A 1AGBA 3IJYA 5DGQA 4MJ6B 1JNJA 1NCCH 4LSUH 1UJTA 4DKFL 1KCVH 5CGYD 1VGKA 3IAQA 3TM6A 1ONQA 2CGRL 4JPKH 1S9YA 1Y0LB 5HDBE 3TH3T 2HFGL 4Y19B 1UCBL 3ZDXE 5HD8C 1B0GA 3MJ8B 5BZWA 3DVIA 4HT1H 3RBGA 3VFNB 4PG9B 2ZP0T 5D9SA 5C0FB 3SJVA 4QTIH 5FOJA 1F00I 1NMAH 3QDGB 1CLYL 3RVVD 4M5YH 3BJ91 4BFEA 4S1RL 4ZFGL 4NWUH 5FM5O 1MUJB 4L3EB 3V5KB 4BQ8A 3JTTA 3OF6D 4ELMF 1VGEL 2OLDA 2Y25A 3WIHL 3FAWA 4IRSC 4L4VD 3KR3H 2R29L 3LPWA 4YHPB 4HLJA 5FO9B 3QUYB 4LIQL 3LIZL 1MRDL 4MNQB 3SDDD 2WMPA 4WGWB 1JI1A 2DQTL 5EPMA 2QQKL 2V7HB 2VLKB 3IETB 3KPRE 4EXKA 4PJBE 5EU7C 4C54A 1FG9C 1S7WB 1IJ9A 1QBBA 4XXCC 3ZSSA 2E6PA 3GKWL 4JO1H 3BGAA 4HFWA 2CDGB 1RURL 2B5IC 4X4YB 2YHGA 2FD6L 5B38A 2R9HD 5B3NA 4UV7L 3TH2T 1QRKA 4Y5VB 5FGBA 5DRWA 3VI4E 1JGVL 3ZTNH 1EGJL 1T03L 4BUHA 2X4TB 3ARGB 1F6LL 1NCDL 2R15A 4OJFH 4K94C 4QHUA 3FAXA 4RA3A 1CLOL 4KK9C 3VFOA 4X7SL 3WJLA 3ZE2F 4PGZA 1FLTX 4NKIH 1DANT 4RFEA 2YD3A 4RGOL 3MRJA 1DFBL 2EYTB 2CSPA 3KLDA 3RVWD 3VD4A 4XP9H 5DT1L 1VENA 2EC9T 4Q9CA 5I1GH 4IHOB 3PGFL 4WU7B 3JXAA 4U1KA 5TQ0H 2DOCA 4RISL 5DD6A 3M07A 1JGDB 5ITFA 3EYQC 5EFIA 1P84K 2J8OA 4OIAA 1I3GL 4LSUL 5GISH 3A6CH 3F7RA 5IBTH 2JB5L 5EZLA 5FYJH 2R23B 3TVMB 4HIEA 4KH2A 4E5XB 3GMMA 3KPMB 4JFXB 3UJTL 1G7PB 3IDIA 1N7MH 5CP7B 4TOYL 5D5MF 4LSPL 5E7FA 4OZHB 3QUZA 2UWEE 1BBDL 3HNVH 1NC2A 5BV7H 4PYHA 4LF3A 2D4DA 2OS7A 4JDVA 4EOWH 2IJ0C 4GT7A 3D18B 3HAEG 4WIQA 3F7VA 4ZAKC 4Y2OA 5DRXB 2GFBB 4Z7NE 4KMTL 4JDZA 1IEAA 4L8DA 3W39A 3G6JE 3NN8B 1V5JA 3B6SB 4TPRH 4PJEA 2PTTA 4LMQE 2HT2D 5GGSB 4PBVC 3MCG1 3RUGE 5GS1B 3TV3H 2XTJB 5IM7B 3H7LA 1KJMA 5FAAA 2ZUQC 4ELMB 2GT9A 4H8WH 3L3HA 3OXRB 1KIRA 1FGNH 4JCLA 2LAAA 1B2WL 1CFNA 1W0YT 1JWSA 3HZVB 3S36L 4UTBH 4Y19D 4JZJC 2DQEH 2PYED 4M62L 3V0WH 4HGKC 1ZGLM 3QUXC 2D3VA 3IXAA 3V0VA 4QRPE 2A6JB 1YJDH 2E7CA 2Y5TB 1UB6A 1IC5H 4DWHA 3KPNA 4J8RA 3KPRB 4Z7NF 5KVDH 3EO1A 4X80H 1PG7H 3R1GH 1LGVA 4QRRA 4GJTB 2A74B 3HMXH 3O9WC 5E8DL 5EB9A 3KLHC 4BKLB 2AXHA 3TBVB 1EV2E 5FKPB 1CTNA 3DXAE 2VABA 2X4PA 1GGUA 5J12C 1LQSR 4GXVH 3FMGH 2VXTH 3NA4A 4QHKI 1NFDB 3RHWK 2R1XB 1AJ7H 5EOQL 3EYOB 1CCZA 1OGAE 3D3VB 4P2RB 5ENWA 3IDJA 3IYLW 2CH8A 4J3XA 5GSVB 5B39A 4UILH 2GTWA 3U6RB 2XY2A 2N4IA 3OKOB 1ZMYA 1FZOA 3I6LD 5MEQB 5HI5C 1CZ8H 1AO7B 2DI8A 3DARA 5ITBH 4NT6B 1G9ML 2P45B 6FABH 3EDEA 2D7OA 3IU3B 4W68A 4XMPL 3QDME 4LSVH 4UNUA 2RB8A 3DXAD 4O2EB 5ICYA 5KSBE 3F6LA 2HP4A 1GHFH 3O11A 5I16B 4P4KD 1A3LH 3GSRB 4YDKH 2XRAH 4Y88A 1FP5A 1FAIH 2YPLB 5FO8B 4LLDA 3V2AR 3PNWB 4Y8DC 4TVPL 1LO3L 5KSAA 4Y4FA 1QFHA 1AKJB 4EXPX 5I8OH 3LH2L 3C09B 5F7LB 1MY5A 4KGLA 3U30B 2XA8H 3MCKB 4RAUA 4MB3A 4Z7VF 4ODWB 3CLFH 1F3JA 1MQKL 1ZSDA 3TBTB 2UWEA 4U0QB 2DQTH 4EI5D 4NRXB 4X7SH 1CU4L 1A6PA 2HLAB 4GG6F 1IGMH 2HA1A 2LVEA 3EYSL 4FZEL 5HYSB 3MRPB 3GRWL 4CW1A 4P2YA 2A6KB 3MYZA 5B8CC 5TGBB 2AERT 1QLFA 4WUKL 3HE7A 1TQCC 2Z35B 3NFNB 4JN1L 4ONHA 4YLQT 4P3CL 1CD8A 2B2XH 3PP4H 4MA1B 2XZAH 5F9OL 3MRQA 4XX1E 5C0AB 1OGAB 4JFDD 2PR4L 1KCRL 4Q9BA 2DQJL 4Z76A 2VMFA 1KB5L 5C09E 5DJCA 1SY6L 3ZHDA 5EUOE 43C9B 3CX5J 1BJ1H 4ZUTA 2P5WA 2IBZX 1CDGA 2IMNA 4QRQB 2UVFA 4WW1A 1UCTA 4PBWD 5C8JA 4HPOH 2F74B 4QRRD 3HZYB 3VGBA 5IFJB 1UM6H 2PO6C 2XN9B 2A9ML 4GAGL 4QT5A 4JFDE 1VACB 4GW5B 1ORSB 4NBXB 1N64H 1QBML 3ZDYF 1Q0YH 3CJJA 4WTZA 3WUWG 3V52L 5ID1B 3HN3A 2CKNA 4WFGD 4LGSB 3FO1B 3WLWC 4JM2F 4LAQL 1KJVB 3B9AA 1ZWIA 4L4VA 1QFWI 2RR3A 2MWCA 2XN9E 4K07A 1IFHL 3TF7C 3T2QA 2QQKH 1KIQA 4OF6A 1Z5LA 1KTLB 4D9RE 5ESAA 5ALCH 4D0CB 3MGTB 5JXAH 3CZJA 1NBVL 2J7LA 4HPYL 1EJOL 5I17A 3VJ6A 2BSSB 1YNTA 5C2UB 3FB8A 4D0BB 1WFNA 4O9HH 3IAGC 3BXNA 4H1LB 5BXFB 1V7NL 1NGXB 4LARL 2NR6C 2XZQH 4TNVF 1YEKH 2XWBA 2NY6C 1FIEA 4E41B 4BSVB 4HS8H 3C8HA 4KTDH 3T0DA 1D5MA 1RIUH 2MNUA 4HXAH 1XGRA 1YA5A 4Y4KC 2Q76B 2VDKL 3WKMH 3KJ6H 1T4KA 3X3FL 1QSEA 3HCVB 3BZFB 1ZVSB 5ACMA 2EYSA 3CFBB 1V7MH 5DTFB 4YXKH 5FGSA 4XC3L 3LN4B 2Z93A 5IFHH 4EUPG 5JDSA 4NO2A 3GK8L 1G9MH 2PUQT 1UENA 2YZ1A 4MCYB 2X4NB 5J8OA 5CZXD 3QIBA 3E6HB 3EW3B 3RTQB 2DQDL 4G3YL 3UC0H 4Q58C 2UZXB 5IMMA 1T22B 4Y4FD 5CJBA 3TVMD 3GRWA 4XCEB 3EGSA 4JO3H 1NJ9A 3BD5A 2JJVA 1KFAL 2EH7H 4OI8A 3K2MC 3BE1L 1BZ7B 2DMBA 4BFIB 3BRDA 2FX7H 3C9NB 1U95B 4H20H 5IROC 3JTSB 2ORBL 4R0LA 5A2LH 4PJHB 3STLB 1NLDL 5EOCJ 5K33A 2VE6A 3BGMB 4IBLT 2QJDA 3VXTB 3HAEB 5JPNA 4KV5F 3H9SD 1MCFA 3EDKA 4JFYB 3UTPE 4P57A 2ED9A 2X2YA 4NBYB 4HUXB 1N6UA 1RUPH 1T0NB 4JCMA 1U36A 2DLIA 2W9EL 2W9LA 4MZ3A 3CXHK 3CCHA 3DHMA 1HXYA 2XWTB 1CDCA 4QXUH 5IHBA 3MXVL 1DR9A 3L7EB 4HEME 3OX8B 2YUWA 1D5IH 2QADD 5IOPB 5EO9A 5JXAL 2ICCA 4LVHB 2CK2A 5ETUB 1PX3A 4YUEH 1I9IH 3AU1A 1OP9A 4IS6B 5J57B 3V4UH 2WZPD 3RA7H 2JLLA 4CDGC 5F9JA 1CK0L 1YMME 4PJ7A 1KACB 1P4BH 5E2TL 3PWUB 1NQBA 5E8EB 2EECA 4ONFL 4UOW0 2AK4A 4JM2B 3CU1A 5JA9A 1RZKC 4J3OC 3SOBL 2A2QT 4ONGH 4BZ2H 1RUAL 3S9DB 3KYAA 1FN4B 1Q9LA 2OK0H 3C8KA 1PD6A 1PKQE 3ARPA 1HILA 4KKCC 4XPHL 4O5LH 3J8F7 4JG0L 5F3HB 5I8KH 4UU9B 2FWOA 2XA3A 2WBJC 2BRRL 2GYSA 4K7PL 2YA0A 4OUUB 5DUML 4F7CB 1GC1L 1TENA 1CE6B 1KIPB 2FSEA 4PGBA 5CEZH 2X4QA 3GI9L 4MNGE 1BD2B 3KLAB 3UAJD 5F9OH 4Z7UB 3D85D 3QUML 4GLRH 3MLTB 4PJGE 1KLUA 1IGJA 1CLZH 4KHXL 4KI5C 2FATL 3QQ3A 4M3KB 2BDNH 1OVZA 1XR8B 4LASH 2PCPB 12E8L 2X4OB 4OGZA 1BGXH 3CVHH 1YYML 3VFWB 3FO0H 4XAKD 1MFBH 3NABL 2UYLB 2FHBA 3QHZH 4PB9H 3P9LA 1E28B 1OP3K 4LCCA 3RGVA 2YRZA 3QUKA 5JIKA 3MRKA 2FGZA 5A16B 3RJQB 5BO1L 3ARFA 5F7DA 1U58A 1GCFA 3IDYB 1JTOA 3GJFA 2D31A 3FB7B 3BHBB 4KDWA 5E95B 3B5HA 5CEXA 3KYNA 1T21A 1U8IB 3AAZA 4FQXA 2GK2A 3VE0A 4GRMA 2WWMC 4PY8J 4E0RA 1XGPA 4OCXL 5E00B 2X1WL 5B39G 1SEBA 3UO1H 1UM5L 2MPAL 4EVNB 4QYOA 4ODSL 4NQDA 4DGYH 3W11C 3RUGB 2HT3C 3HB3C 3MNVA 2EIZB 4F9LC 4I77L 5IVZA 4FFWD 1KPRB 1UT9A 1IILE 4QRUB 4GRWH 1TTGA 4UT7H 1NCAL 4KTEH 2AJSL 5J89A 4L1HA 1UWXH 3RVUD 1MIMH 2ICES 2ZNWA 3HE6D 3PIQA 4LSTL 3CVIH 5D1ZB 1GIGH 3QXAB 5IWLA 4L29B 3BP5A 4JFEB 4JN2B 1UVQA 3QG6B 3FQXB 3HG1D 1INQA 1VADA 1A3RH 3SEPA 1JPSH 1YJDC 4PREA 4NRYB 1QSZA 4JHAL 4XXDA 4LSSL 4DVRL 2FL5B 1INDL 4JRXD 1T04B 1MSPA 4HFUL 1RZJC 4K3GA 4TOYH 3CC5B 3WLBB 3S5LB 5E2WH 2H6PB 2ILLA 5HSFA 3OAUL 3GHBL 1PBYA 5C0EA 1LEKB 5IB2A 4OZFH 1FZJB 1HH9B 1VPOH 2VQUA 2F8XC 3IJHB 5SV4A 1FRGL 4NKMA 1U92A 5CINH 4JAMB 4YR6B 3ZKXC 1KJ2H 3W2DL 1ETZA 1NAMB 4OUOA 1HQ4B 2E9JA 4QXTB 1QYGL 4OIIH 5EOCL 4DGIL 4Q6IB 1MWAB 4MLIA 3D85A 3OKLA 4TVPD 3F5WB 4YHLL 1LO5A 4WWKC 2ZG3A 1HI6A 2F53B 1R3LB 3BQUC 4YHIA 4H20L 3L3IB 1A4JB 3UEZA 3ARFC 3RAJL 2XQBH 4HCRH 5GJSL 3P3YA 3E8UL 5A2FA 5SWZD 2AJXH 4LLUB 2GY5A 2K7PA 3GEWB 1W8NA 4KK6D 3O3AB 4QTHA 4ZYKB 1AH1A 2ATKB 5GGTA 4PJCA 1IAKB 4I8DA 3HC3L 4JR9H 4XP1L 2J6EH 2W59A 2C3VA 2DQGL 3BWAA 1J7VR 1T83A 1NFDE 3O45B 4C58B 1JWUA 2IG2H 1EAPA 2DBLH 3PL6A 3GBMH 3LQAC 4GKNA 1ZS8B 3OKDA 5AG8A 3UPRA 4FQXD 2J88L 5I30H 3K0WA 5I74B 3S8WA 4UINL 4ELKA 2YXMA 1Z9OA 4PRIE 4LPYA 4ZS6C 3WV0A 3CD4A 1OPGH 1YY9C 5AZEL 1A9BB 2EE2A 3IFLL 4HWBH 4Q0XL 1AQKL 4YDLB 4HCRA 4HBQA 3VXUE 2WLYA 4L4TE 4Y5XA 5JW3L 4YPGB 1RV6X 3AVEA 4UNVA 4OQTH 4P99A 4X83A 5KSUA 4YHKH 1CD1A 4YHNB 4F8TA 2VZTA 3M8OH 2O26U 3EO9L 3QFJD 5CEZL 4OLYH 3JWOH 3RVVC 3GB7B 4EI6A 1AGCA 1RUPL 1FO0A 2F58H 2DD8H 3AXLA 4YO0A 5CJXA 1RUKL 3NACH 1N5AA 5IB4B 4R4BB 1K8DA 3WE6A 2IFFL 1LNUB 1VERA 3C2AH 3SY0A 4LCWB 1X4YA 1QO3B 1LO0L 2CPCA 3VXUD 4L4TD 1FVDA 5I1AA 1XGUB 5FYLD 1R0AH 4U1IA 5F89B 1E27B 5D2NA 4OZIB 3CH8A 1AP2A 4WWKA 1OAYL 1JUFB 3VD7A 5B8CB 3FQRB 3WKNA 4ISVB 4N90D 4LCIL 3I3EA 1AD0B 4HK0A 4LLQB 5HYJE 5EBLA 1J1XL 3D2UB 4Z6AT 3X12B 2DTMH 4NQXA 3RI5K 4I9WD 5DZLA 1LD9A 3WNKA 1F02I 2HFGH 3FQNA 3MRLA 1JTPA 4JLRA 2DLEA 5IB3B 3KWWA 3QB7C 3QZWA 4LIQE 5FB8B 4G8FB 5DQDL 3PDOB 1BOGB 5BRZD 3QRFM 1UWEH 3MGOB 1DZBA 2CIIB 3MRBA 4PJ8B 2FECI 5GISL 5IBTL 2FEEL 3BIKA 2DQGH 3CUPB 1T5WB 3MV9D 1C5BL 1CICC 1S9VB 3ZL4L 4NQCD 4X99A 1MCWM 1QBLL 1J11A 1F4YH 4Q9QL 2JJSA 5JHDA 1NFIB 1KNOA 4Y16D 2V5MA 1A6AA 4GQPH 5L2JB 4J23A 2D7TH 1WTGT 4BELD 2BXYA 4BZ1L 3CZFA 5F7MC 2V2TA 3UTOA 3ARSA 4NNXA 4ZDHB 2HLFC 1PY9A 1RK1B 3W0WE 2DYPB 1FPTH 1U8JA 1W0VB 4MD4A 2BOBB 1G84A 3NH7L 4G8GB 4KZEL 4PJAB 1WBZB 3DUSA 3MGAA 2AQ1A 2SEBB 5J9PB 4MB5A 3V5DB 2IGFL 2H3NB 2YBRB 4HUNB 2AKRA 1PYWA 2E7MA 1YEJH 2KBGA 5LQBL 1I9EA 4U6VL 1D7FA 5T1LB 4NFCA 4NO0D 1YY8A 3VRIB 2WQ8A 1U3HB 4XPFL 3QJHB 4CU7A 2J1KA 3R0MA 1W0WB 4DCQB 4AZ8A 5IHUL 3W0WD 3LKOA 3LKPA 5B38G 2DJ4A 4ZTOH 1IM9B 1L6XA 4M6ML 4BH7B 5TDNB 5I1EL 2ADJA 4GXUN 2R0KH 5IMLA 1OTTC 4HS8L 2VZSA 1H3PL 3DETC 4I3RL 3IXTB 1KENL 1BFVH 2BHZA 2BMKA 2V9RA 3MLVL 3RWIB 3ZHLA 3TN0C 2DB8A 3N9GL 2H9GB 4U49A 1A0QL 2DICA 3C5ZB 4GQ9L 4J3VA 3KDMA 4O2CB 4PRIB 3I3BA 4NFBA 5IB1A 3OG4B 4DGVH 4FQQA 4YHYC 1S8DA 4LBEA 2IAMD 2YUZA 5SWQA 4NKDA 2WWMD 5EDXA 1JWMB 2HJKA 4ZS7H 2W92A 2E9BA 4WI7A 3MC0A 4HZLA 1K4DB 2AQ3A 1UWGL 3SDYL 2KZWA 4NRZA 4AH2B 1OY3B 3WO4C 1PLGH 4J12A 4XPAL 4CADA 5CD3B 2JJSC 5HGDA 4Z8FH 5CJQH 5TH2A 1M7IB 1MJ8L 5MEPA 3BT2H 2VZ3A 3MLUL 4JO4L 1HH6B 1B3JA 3C87A 4FXLA 4B7IA 2KPNA 4PRHB 5I6XC 3S5LG 1AR1C 3SCMD 2ZKHL 1EA9C 5M94B 4UIMA 3DMMC 4EBQL 4XVJL 1T89C 3V7AG 2NY3D 1TVBA 2G5BA 5IV2B 2XG4A 2OL3H 1KC5H 1AC0A 5I0ZA 1JHKH 1DUYB 2VL4A 3BKJH 1KOAA 2V2WA 2NY0C 3N1QC 3NZ8B 4HS6B 3MOAL 1CD9B 2I24N 3WFEH 3BKCL 1J0YA 2DJSA 4GMSL 4F33A 1P7QB 4TQEH 5C0CA 5I8OL 1EMTL 2PXYD 4ETQA 5T3XL 5IR1B 2WNGA 5HHMB 2ZUQB 3QO1B 5BS0B 3EJYC 3EO9H 5IK3A 3OKYA 1C5DA 4JREC 5DMGC 3N1GC 5IGXL 4ZFOB 4PBXA 2I9LB 4PJAF 3SDXA 4G9FD 4PRPE 3UTSD 1TJHL 2BSRA 3EYFA 4WTWA 5EO1A 1CIDA 5HHVH 2JKXA 5SWSE 1II4E 3OGCA 5KW9L 1DBAH 5KZCB 3TN0A 3HI6H 2HFFB 1JHTA 3ISWA 1O7VA 2GCYB 2DBLL 5JOPD 2HTKD 5DHVA 2JB6B 5D1QA 1VHPA 1QVOB 4WY7L 4YQXH 1SY6H 1OSZA 2H32B 4FG6D 2A73A 4BH8B 1VA9A 1WV7T 3O6LL 2EKSA 5DQ9A 2VKWA 2P43B 3D0VB 5C09B 4JFFD 4XB8A 1FGVH 1BWMA 3L5IA 3I84A 2J8UE 5D8JL 3PHOB 4D3CL 1LE5A 3CDYA 3VXQB 3QEQE 2VSCA 2F8OA 1GOGA 5HHNB 1W72H 3MACH 3UPCA 4QLRA 2BX5A 3JV5A 2IAMA 1MHCA 1BFOA 4HV8A 1LK2A 4S1DD 1ZHBA 4HGWB 3FQWB 4FTVE 4G9DB 2BERA 4LLVB 1HOCA 3FO2A 3RL1B 4MAYD 2DQCL 5GRYA 4U6HB 1ZT1A 4P4RB 1P6AB 4BQCA 4RAHA 3QIUC 4HXBH 2GSIB 4YHLH 5FDWB 2CLZB 2XPGB 3BW9A 1F6AA 3CLFL 4O2FB 4WI4A 8FABA 1M1SA 5GZND 1TZGH 5BO1H 1EMTH 4OAWB 4Q2ZA 1MLBA 2DBJA 4WHDA 4P9ML 3DI3B 1I7TB 1PG7W 4K3DL 5FHAH 3NAAH 4H8WC 4K8RH 5IFAH 3NABH 2MCPH 1U8HB 3KAAA 4FTVD 3JUYA 5D1XA 2PXYB 3HUJB 1ZKAA 3BZDA 1W72B 2AJYL 5DA4A 2NXYC 4YIQA 5GIRA 2X89D 1MCBA 3BPOB 4QOKB 4UQ3B 1ZK9A 5DJDA 4HG4J 4Z7QE 3GSWB 1Y18B 5DJ2B 3H2WA 4XP1H 1QQDA 1M71A 4N0CD 4FOMA 3I3DA 5EU5A 1CD0A 2XICA 1D5ZA 1MHHB 4PV9A 1FJ1B 3L7FB 2XKSA 4ZUWB 1KB5A 4JREB 4WY7H 2YD6A 1IZJA 3ARQA 4U6XB 3RVXC 4G7YL 4DKFH 4ESKA 3CH1B 3EOBA 4GAJH 1URLA 3HI6L 1XH3A 1MI5D 2YPLE 4CVZA 3DVGB 3U0WH 5ANME 2NW2B 5SWZA 3FQUA 3AB0B 4N0RA 3SO3C 3H0TA 5ILTL 3ARWA 5DS8A 3MOQA 1RUMH 2IANE 1E0OB 5GS3A 5IVXF 5DK2A 4RMVA 2GW5A 5BZDB 3B2UC 3TYGL 1CGSL 3O2DH 3VXSA 4NM4H 3TNNB 1XGYL 5E5MA 1AE6L 3NH7H 4YXHL 3VFTA 4LHJB 2OTPA 1MH5B 5D2NE 1OL0A 2XG5A 1WEJL 1UA6H 3N1FC 1JN6B 3O81A 3DX6A 2QKIA 4QRPB 4ZMAT 1IL1A 2VDPL 1UWGH 1A9EA 4EDXA 1NDMA 3MRDA 4JDTL 3OAZK 1EJ6A 1EEQA 2H26B 4FP8H 4X5XB 2AEQH 1DBMH 4GSDL 4UB0L 4WCYH 3IF1B 4CVXB 5I1IL 5K9KA 2ZSWB 3QIUA 4F3FB 1WFUA 3LKSA 1Q9OA 4OCLC 1I3RA 4MD0B 1P7KB 1A14L 4MD5A 3MV8D 4KRLB 4RMRA 5EUOF 2J3SA 5CEYA 3F7YB 5EU6A 2P24A 5IQ9A 4KKCD 3GNMH 2CQVA 4I18B 2GJ6D 5HHVL 5DSCB 1AQDB 4K8RD 4RIRA 5JW5B 3B83A 5F1SA 2OZ4H 1VSCA 5LBSL 3L3OA 3VXMB 5JPMB 4JPKL 1PAMA 3CFEB 1IAIL 1KELL 1Z3GL 3RX7A 2A83A 4NJ9H 4PJIB 3VXRD 1MAJA 1BIIB 5CWSA 1BJ8A 2W9DH 3OKNB 3BAEL 5I9QB 4G8GD 1MCOH 3DBXB 4GS7C 4C56E 3RDTA 3P11L 4NO3A 3G08B 2HJLA 1NBYB 3HPJB 4J3UA 3BZEB 4KKBC 1OAUL 3MJ9L 3O3BA 3WUWA 3HE6A 1FBIL 1U8LA 2Q7YA 5JIPA 4Y1AE 4NQED 1Q94A 4XNZB 1IGYA 1CGXA 4KJWC 3V6BR 2R29H 4PJIE 4S1SL 3TIDB 4N8VA 3KYMB 1MFEH 2NY3C 3LPFA 3MRNB 3DUUB 1IEHA 4OD3H 3ZMRA 3KNBA 3GSVA 1EVUA 3F8UB 3LRSA 3VXUA 1XT5A 5E8OB 3Q6GL 5EC1B 3EOAA 1AE6H 1TZHB 4YK4C 3OB0K 3NA9H 1H3UA 1BFSA 2VRAA 3VXSE 1QZ1A 5GHWL 3RWDA 4A2LA 1J1OH 2FJHB 3RU8H 5H94B 1NFKA 4NQEE 4PG2A 1BQHB 3WS3B 1KJ2A 1HCVA 2YKLL 3LY6A 2ED7A 5KVEL 4A2MA 2D03L 4OTXL 5I1DB 3NZHH 4JFOB 1PKOA 3D87B 3N06B 4IOFC 1A1OB 4GRWE 2VZ1A 1FZKB 5I19H 3ECBA 2VSDA 4IRJD 4HJGB 5IEHA 1KCSH 4WO4A 4GMTH 5D2LB 3BD4A 3HR5A 2CR3A 3SGKA 1I85C 3Q1SH 4HKXA 5T3XE 3T4AA 3JTTB 3DVNB 4XWOD 1JV5B 5H37H 2ORBH 3QIBD 1TJHH 4H5SB 2OK0L 3JV6B 4NQSB 1IAIH 1BWWA 4NC2B 5I2IA 3U4EB 3VGAB 5KG9B 4MB4A 2UUDK 4KKAD 2ICWA 2EYRA 3UYRH 1RZFH 2R69L 2X40A 2FYYA 3E1F1 4OF3A 4XRCB 5T1KD 3V6ZA 4F7MB 2EC8A 4HJJL 3QDHA 4R4FL 4I0CC 1QA9B 1UWEL 5MEOA 1M6OB 4OZHE 3MLWL 2BNRA 1QSED 5JXED 2JK5A 4G6JH 3I6KB 1X5HA 2DTSA 3VDBA 3LD8C 1LO2H 3MA7A 3RDTC 5B21A 1G7QA 1DEDA 4Z9KB 4KDVA 4IRZH 1RIHH 1FFOB 3HE6C 4TRPL 1G6VK 2OM5A 2BJMH 1F4WL 3G5VA 4X6FB 3K4ZA 3P30L 2DKMA 3BEWB 4KUCD 5F7KC 4YEFA 3RNKB 1D5XB 1JF5A 4JKLA 3LS4H 4ODXB 2Z4QA 1JGDA 4P5MB 5L2KB 4PJHE 3TYGH 3QO0B 3HLAA 4MJ2A 3AY4C 3S36H 3UDWC 1INDH 2MQ0A 5EFIB 1LO3H 5LGJB 3HNTL 4WHCA 3S36X 5I73C 3KPMA 3LRHA 3C5SB 2F5AL 1JK8B 1ZHNA 3INUH 1N3NA 4K3EL 4XBGA 1CFQB 4Q9RL 2C3WA 1G6RH 2YWZA 4OD1H 4PJ5B 3QULB 4LHUA 3SGEH 2FJGA 1H9VA 1R5VB 5DGRA 5BJTA 3WYRA 4YC2B 1F58L 4RRPG 5DEZA 3QUMH 1NC4A 2IWGA 5HGBB 1Z3GH 3BP4A 3MCLH 3ZDZE 2P8LA 4XP5L 4IEFB 3FTGA 4HS3B 5BQ7B 4Z78B 4PJEB 1H5BC 1TITA 3L95A 2FNBA 2V9QA 4NJAH 1AO7E 1YN6B 1J1PH 1X5ZA 3GMRB 1J8HD 4KJYA 4L3CB 1T0MB 4IMKC 2V9TA 4X8XA 4KQ3L 4GKSB 1G0DA 4V1DB 5IG7B 4DN3H 3VGGA 1JZ7A 3KPQB 2QSQA 3HI5H 1KG0A 1HDMA 2CO6B 4IIQC 2B2XL 4P5TB 4ZAKD 3BIBX 5JUEH 4LLWB 3SOBH 5DT1H 1KLGA 4YFLI 2FBJH 1A6WH 4XCCH 5EBMA 2XZCH 3FFCA 3RGVD 3TZVB 5I18H 4NZUH 1CT8A 1X5IA 1AGDA 1NL0H 4MA3B 1NCAH 4KTEL 5K59F 3GI8H 1G7IA 3UTTA 1FL3B 2D7QA 1FVEB 5TE6L 4HDIA 3VFRB 1DTUA 1HXMB 2IBGA 1WIOA 1FL6A 5MI0C 3QQ4A 3KPOA 4D0DB 1DN2A 5KANI 2AI0L 1CLZL 3JWOL 1IQDB 1R3HA 1YNKL 5IVNA 2BVTA 4ZSOB 3QUXD 4LRIC 3ILQD 4JM2C 4NNPL 4X4ZA 5FOBB 3GM8A 1QBMH 1H0DA 1QEWB 4W6XB 3QXUA 5GSVA 2IPKB 1RJYB 5C0GB 2Y1VA 4RGMC 3QG7L 1NUFA 3O4LD 3OSKA 3RWCA 2PYEA 3GO1L 1RVFL 3MODL 5H8DA 3VFSA 4Z5RA 2GIYA 1OP5H 3IU3A 4HUKB 4QRSA 4QGTA 5F6HI 5GGUA 3VI4F 5C0RL 2PW2A 5T1MB 2R2BA 4IJ3C 1R5IB 2A6IB 4G6JL 4ZFZA 1V8HA 4LKCB 2V5RA 1NMAL 1ZLUK 2EDRA 2G75B 3MLRL 1BVLB 1P53A 1LEIB 5I71B 2FR4A 2JCCA 5ISZA 4P2QA 4EN3C 3GMNB 1H5BA 4JPIB 4N0FA 1HHJA 4POZD 1JZ8A 1OP3H 3B9KB 1AXIB 5DLMH 2NY2B 4WJ5A 1DQTA 5HI4D 5C3TA 4P2QE 3VXOB 3KYKH 3EJZD 3PV6A 3VH8B 1S7VB 1A1NB 5EIQA 1ZLWK 3WHE1 4LRNH 3QIWB 3V6OE 3OKEA 5IW6B 1NEUA 5EU3B 5FEBA 1FC2D 32C2A 4MJ5A 5LCVH 1BHGA 2BOCB 1D5BB 1ZHKB 4GBXA 3GMPA 1CICD 4MGXA 1LP9B 5IF0A 2AK1H 3TYFB 3X11A 3MV8B 5FO7B 1UQSB 1W8OA 2VDQL 4HIJA 2IF7A 4LLMB 3Q6FB 1EO8L 3VWKD 1TLKA 4NKIL 5GGTL 3PP3K 5GGVY 4M7LL 2F58L 4YDLC 4OF7A 3QNYA 3HNSL 3ZTJH 1OTTD 4PJAE 4KKNA 4MXQC 3BVNB 2VITB 5DJCB 2R2EA 5C0BD 1T1YB 2XOTA 3T0EC 1R3JA 1G7HB 3WIFA 5LVEA 2DQHL 1NPUA 3EFDH 3H3PH 5A2KH 2YWYA 2AXFB 3MUY1 3DSFL 2EXWD 4H25A 3V7MA 2LTQC 1NCUA 1YYLH 4HWUA 4BA8A 1WZKA 4HXBL 3MLXH 3ULUF 3HC0A 1EDQA 2V17H 4WDIB 3DURB 3CDGB 4P46C 1QHPA 3LB6D 3C08H 4MA1C 4PJBA 5DHYB 2HJFB 5E03A 4Q9RH 2YA2A 5CZKA 1T5XB 3PWVA 4RMSA 1D3CA 4DW2L 1P4LA 2NMSA 3RKDC 2FJFA 4Y2DA 1T1XA 1T03H 4G9FA 1A6TA 4XP4L 4JFDA 5INDB 2BXZA 4KROB 1FNEB 2FX9H 4M48L 1JPST 1UXWB 5I1EH 3M17B 4XI5C 4P2OB 3K81A 1JGEB 4JGMA 3QEHA 1C08B 3MX0A 1ED3B 2FX8H 2IMMA 4UDUA 5DHVH 4L1DA 1L0XA 3NFPB 4JKMA 4LLYB 1WZLA 2HMIC 2APXA 2BSSA 3PGFH 1YJDL 3C60A 3U30C 5KSAC 1MNUL 5L7XH 1WK0A 1YDPA 5C08A 4ONFH 5EO0A 3WN5A 4JY6B 1ROWA 5ESVB 1F45A 4JFQB 4TRPH 1TZIA 1MFEL 2ESVA 4M1DH 2IGFH 4BSVA 5GSRA 4HH9B 3MR9B 4ZSOE 1T2XA 1DQJB 4I0PB 4OGAC 1GGIL 5MHSE 4E42A 4GBXC 2AEPL 1XGRB 4A6YL 1A6ZB 3I6GA 1TETL 5I8EA 4OCSH 3DROB 3Q5OA 1WZMA 1ZVSA 1NGWA 3JVGA 2VLME 2MOVA 2MHAA 2EXYD 2OCFD 4OLXH 5GGTH 5BRZB 2AXJA 2FO4A 2NY7L 4RGND 5E8NA 1NEZA 1XCTB 2X1QA 1N4XH 4YXLH 1S7TB 3QR2A 3IFPB 3ROLA 3WHE0 1DP0A 2BSED 4POYA 4AQ1B 5CAYB 3O2VL 4APQC 5ACZB 5F7NC 3SKMB 1KC5L 3ELAT 3UZVB 2VLMD 2Z31A 1LE9B 3QCUH 3O2WL 2HG5B 4TPRL 4CRPA 5CBEB 4FTVA 4R8WL 2C4XA 1S5HB 4XP5H 4LVNB 1MJ7H 4RGNE 4NUJA 3JBG7 3WL9A 5FV2A 4NNPH 5DC9B 4FNLH 4ZUVA 3JSSA 4QHKJ 1SVCP 5I8CB 2C1OA 3B3IA 4ZOEA 5D7LB 4GAYB 1AFVL 3MBEC 4LCWD 1S7UB 2E8ZA 4MNGB 1RQ5A 4NQDE 5F7HA 2APVA 3C8DA 1UJ3B 3HAEH 2MJWA 4PPTA 4P4KA 4KRPD 1YPZB 2L7UA 5T1DH 1FSKC 1MI5A 3MUGA 4XNMA 4KJQD 3L5WB 5E9DB 5GGSY 4MYWB 1MQKH 2FBJL 4FFVD 5L2KD 3DX8B 4ODUA 5T1KB 2YD2A 1QD0A 4U6TA 1WF5A 3WN5C 1U91B 1FZMA 5C0BA 1DSFL 1XAUA 1FG2A 3HKFA 4I48B 3HTLX 5E8EA 4KAQL 3BKYH 1A2YA 3SJVB 2AJUL 2XNAB 5CZXC 4OLXL 4OB5H 4M02A 3AREA 1LVEA 3QDGA 4WNQA 3PL6D 4DTGH 1V3MA 1YNKH 2XKUA 3F62A 4GG6E 2PTVA 2P8PA 3L3DB 4JB9H 1OSPH 4IDJL 3NFSH 4XX1G 2AXGB 2CJUH 4MJIB 4PJDB 3P0VH 3B9EA 4CU6A 4ZXBA 4A6YB 1JF6A 1KB5H 3FT3B 4BQBA 1SJEA 3TA3B 1T1WB 3ES6B 1WAAE 4RNRA 1LMKA 2ZCLL 4TQEL 4U1NB 4HHAA 5GRVK 4P59H 5HHQB 2YXFA 4XPAH 3QI9B 3U4BH 3G6DH 2J4WH 2ADFL 4APQA 1ZGLB 2DWDA 1ULVA 5JHLL 3SGJC 5JW4N 4GUPB 1MRDH 3AUVA 1GGCL 3GM0A 4NKOA 2EO1A 5DMKB 1C12A 2Q6WB 1TVDA 4Y5VA 3N85H 3VG0L 4PJFB 3SDCA 4DVBB 2PCPA 4KTDL 4KRNA 5EUOA 4DUVA 1HHIB 4H0HB 3QUMA 4HJJH 1QRNA 1QNZL 4ZTOL 3RQ3A 4LVEA 5IROA 2OR7A 3QWOA 5BVJA 5TE7H 3TJEL 3MBEA 3N50A 4KHTL 5GJSH 3RNQB 3WFHB 4MAUH 3MNWB 4U05A 5KBNC 3DV4B 5T33L 3TNMA 3QCTH 1CQYA 4PP1C 4DKEH 5K9JL 3UMTA 1XIWC 3RA7L 5D6DC 3I6LE 2XZQL 2X7LB 4M61B 4P48A 2R2CA 4LCYA 4BFGA 4HWEH 3QYCA 5L8LB 5CMAB 2CGRH 1OLLA 1MJUL 2B1HH 2R23A 5TE6H 3KYNB 2D7PA 3MMEA 3HS0B 4XPBH 1FYTE 4DK6A 4C56A 1UACL 3SPVA 4OFDA 3GUTB 1EXUA 1G9NL 4OZHA 1GJIA 4NQDB 2CR6A 2L0DA 2P44B 3MNVB 4M43H 4IRJB 5GXBB 4JQIL 5EULV 4JVUA 1DE4A 2IPTH 1BAFL 2VDLH 3ULSB 3ROOB 3MV9A 2FGWL 3R06A 3GSNH 2H8PA 5IT2L 4JO1L 5C07A 2BY3A 3NBNA 3HNVL 4U1HA 5J3HC 2N7BA 3NN8A 4FFZL 1KCUL 1A6UH 1NCBL 3EYUH 4Y5YA 1S9YB 1Y0LA 1AY1L 4KI5D 3NGBB 4JN2A 4X98B 2LE9A 3GFUA 3QEGL 4TN9A 5IM7A 2YMXH 1HEZB 5D7IA 1J05A 3CSGA 3L3HB 4JFZL 3V4VH 5IBUG 3ULVE 5E8PA 1BZ9B 5JO5B 1DBKH 3D25A 4MXQD 2I25N 1UC6A 2D0HA 4JO2L 4PV8A 3ULUH 1A1MA 1C16B 2OQJA 3WFZA 1MUJA 3SDDC 3BRGC 4OBSA 5HXMA 3TBYB 1KJ3L 1N2RB 2K9UA 1P4BL 1U8QA 3UTSA 5J1TC 5HGHA 1EHNA 1OAYH 4R8WH 3OAZH 3ZKSD 1B0RA 4M62H 1WICA 3A6BH 3BKMH 1HQ4A 5AYQA 5DD1H 1CYGA 2AJYH 5EORL 3KYOB 3TIEB 3ARTA 2GAZB 2Z91A 5E1AB 5CCKL 2OI9B 1UM4H 4QRRE 1HI6B 2DN7A 3BX7C 5D7JC 1KSRA 4I4WA 3O2WH 5DK0B 5FHAL 4M8QA 1QFUH 4S2SA 3ULVF 5CJ8A 3L3IA 5IBUB 1JYNA 5DWUH 4YWGL 5FUOL 1KT2B 3A0OA 5D6DA 3BFOA 3IJSA 3LEXA 2LTQB 3GKWH 4W4NA 1U8MB 4KAQH 2BNRE 3LOWA 1U3ZA 5F88A 3G5YB 3T09A 4OLYL 1KBGL 1NGZB 4FQPA 3BH8A 4H88L 3BDBA 1TNMA 4TSCH 4WEBH 5FGRA 4ODTL 5FCUL 2R2HA 2EDQA 2VLLA 2X9WA 2F54B 4OZIF 1X5YA 5HJ3A 5I1GL 1OHQA 4XXCA 2H1PH 2OR9H 1BLNB 3RTQD 4FMKA 1QSFA 2P5WE 2BVQA 3HZMA 4PJDF 3STZB 5I16A 2WUCH 4UDTB 3DPBA 1A3LL 4WTZG 4YDKL 4I5BB 4ORGA 4X6CA 1JZ5A 5HYJB 4F9LA 3QDJA 1KFAH 2EH7L 4NCC2 2C3HA 4ELKB 1F4AA 3LQZB 4CMMB 2Y07H 4ZNEA 5GZOC 5HTSA 4XBEL 5D7IF 1YN7A 5DRNA 3BO8A 4FQJL 1X6NA 4RGNB 2IEPA 2EXYC 3QFDB 2JIXB 3ARGC 2WBKA 4GRLB 1J8HB 4NO5B 4XH2B 4PJ9A 2VLRA 2UVEA 3O3UN 1FRGH 2EDKA 4IOFD 2W65B 4HAGA 4XT1C 1T20A 3AS2A 4YAQB 5DMIH 1K85A 1T1ZA 4QKXB 3HMXL 2VWEE 1AXSA 2CK0H 1HE7A 1SYVA 4X9BA 5I66B 4UUJB 4YHOH 7FABH 1DQDH 2XY1A 3GMQA 3BESR 5DRXA 3UBXI 1GAFL 1IAIM 4HKJA 3BUYB 2CDEA 4LEOB 1FNGA 3MOBL 2K7QA 1OP5K 3O3DA 4RWHA 3RPIB 5SV3A 4UT6H 1GZQA 3MROA 5E6ID 1MFAH 1IRAY 3V5HB 4H26A 5ISZE 3BDYH 3OWEA 1GVIA 5JOFA 1UYWH 3P4NB 3S35L 2HT4D 2CLVA 2ZSVB 2IH3B 2HVJA 1JWSB 3UBXG 1N6QH 1PJ9A 1SEQH 1IE5A 2MKLC 5D7JA 3L5XH 2BNUB 4R2GC 5DD0L 1U8PA 3NVQA 1FH5H 4NQXB 4XNYL 1MPAH 1OT1A 4X6DE 2H1PL 2F74A 4R26L 1NMCC 4N5EC 1CGYA 4PLNC 1IM3A 1ND0B 4JG1L 1DUZA 4OLVH 3EO1B 3UTPD 1J87A 1RHHA 4CNIA 4OKVA 4QRRB 4HAFA 5A2JH 4KQ4H 3SQOH 4U7SA 4G7VH 2WINB 4XC1L 2DI9A 5EC2B 4GKZB 4HUMB 5IUSA 3QUXA 4J4PD 1SYSB 3UJJH 3FO9A 2A9MH 4XCYB 5JZ7D 3OHXA 4YJZL 5FF6B 2CIKA 3IDJB 1XF4A 4X6EA 5HYEA 2HRPL 3PWLB 4X9FA 1MFCH 3GHEH 2YD9A 4XPTH 5EOTA 5IESH 1AC6A 1RMFH 3O9WA 1WFOA 4LDEB 3MRGA 1AR2A 4Y89A 2ZOLA 1U42A 3FB8B 3ZKXB 2VR4A 3GNML 3VG9B 5TQ2L 4EKXA 3VXPB 4OD1L 3G5XA 3BH9B 1RUQH 4CN6A 1S7RB 5HDBF 2SEBA 4DAGL 1BF8A 1A14H 4AEHL 4C4KT 1IGTA 1XIWD 2HTLC 2FHCA 2HYMA 3BQUB 4XGZB 2H3NA 1NKRA 2P48B 1BREA 3NPSC 4Y1AA 1IVLA 1CICB 2E27L 1KN2L 5KSAB 3K74B 3OBAA 1YPZF 1MCWW 4ODVH 4BZYA 3BMWA 3VFGL 2ITDB 3CFBA 3RUGF 3OKKA 3QHFL 1ZSDB 2AQ2A 2A6DA 2BNQB 1BVKB 4IOIB 5JW3H 1DQLL 5TDPA 2GSGB 4JVPA 5C07E 5J6HA 4Z0XA 2EDXA 1S5IH 4YDJB 1HINH 1RZIB 4HWBL 4M00A 4OSUL 4Y4FC 1GL4B 2QL1A 4X8JA 4HUVA 1RZ7L 3U36A 1JHKL 3O6ML 4M93B 4NUGH 3ZKNC 4YNYA 3TO2A 2ADGB 3I02B 3T0WA 4P5KA 5F1IA 5FA4B 1AIFB 1CLOH 1D6EA 2FX7L 5JNYA 2W0KA 4NPYA 2VIRB 4PJEE 1RULL 3P73B 4HF5L 4NYLB 1GH7A 3MJ7A 4G3YH 5J11B 2HLFD 2BVOB 3RP1A 4EJ1C 3X13A 4HUXA 3MV7A 3ILQC 4JM2D 4NDMB 3RWGA 1HHKB 3S6CA 3MO1B 3MLSH 5DZOA 3QQ9D 2NX5E 3L7EA 4WHTB 3BP7B 5JXEA 4ENED 4PFEA 3BWUC 1H15A 8CGTA 2GTZA 5IFJA 2I27N 3QCUL 1AGBB 5C08D 3ZKMC 4JO2H 2VLJA 3LKNB 4Y4HA 4GRWB 3U1SH 4QOKD 4GW5A 1VACA 1WC7B 2VDKH 3WKML 5FIEA 5GGRA 3SGDH 4MQ7A 1SBSH 4JZOB 3MRFB 2ITCA 1BFTA 3DECA 2Y4SA 3SBWA 1L9NA 4G42A 1K2DA 3FFDA 3DRTB 4MXWH 3MUZ1 3DX7A 5DQJA 4U1JA 3KXFB 2YSSA 1DANU 2WANA 4R4FH 2EDEA 2K1MA 3DETD 5ANMA 3WDJA 2PO6A 4KWUA 1WBXB 3LPGA 4AIZB 5IW1A 2WWKO 3WSQH 4POZC 3SKNB 3SQOL 5L88L 1OF2B 5HHOA 4D0BA 4J1UA 1XGQA 3VFMA 3QUYA 2FIRT 4IMLA 4OFYA 3GI8L 4RMUA 5HHOE 4AK1A 2YD4A 1FL5A 4HIIA 2A0LC 1E6JH 3LZFL 3IETA 2VLKA 3EYFB 1IM9D 1I8MA 1CE6A 1UH4A 1YNLH 3U2SB 1WZ1H 2HTKC 2X9XA 3PABB 1WAAF 3NIDE 3D6GA 4OSUH 3H42H 1Q9WA 3TN0B 3OR6A 3FN3A 4YXHH 3BP6A 1ZEAH 4YGVA 2YA1A 3UX9B 5DHVB 4BQ6A 1KLUB 3MREA 1GZPB 2CRMA 4X6BA 4QY8B 3EZJB 4Q9QH 4ZUSB 1OSZB 2H32A 3MBXH 3IVKB 5HDOA 4U3HA 4NQEA 3LN4A 4RAVA 2X1XR 3MA9H 4K94H 5GRJH 1R3IH 1N0LA 5IFHL 1L0YA 1MHEB 4Z0BL 2UYLA 5IQ7L 3PDGA 4PTUA 3PWJA 4CUCA 3R8BB 4HK3N 3KHQA 4OLUH 4LKXB 3IDUA 1PW3A 2VLRD 3D69A 1GGCH 3P4OA 1K5NB 2AGJH 2FEEI 1XF5B 1U8KA 2ZUYA 2DIAA 3CDFA 1LK2B 5KVGH 5E2UL 1F97A 4KK8D 4KKLC 4R97B 4AEIL 5AEAA 1U3HC 3K7UA 2ARWA 4BZ2L 1ZLVH 4XZUB 4Z7UF 2HVKA 2CDFA 1EEZB 1NLBL 1FNAA 5TE7L 1I8IB 5AAMA 1SEBB 3SBWC 3RL2B 3RX5A 3S3JA 4KY1L 1LK3L 4OGXL 4P2CG 4Z7OE 1NC2B 4M7JL 2UZYB 5IVZB 4MSWB 1MLBB 4ZUUA 2JJWA 1ZHLB 3WFCL 4OZFB 3TEUA 1WWCA 4D9RD 5DURB 2E27H 4NM4L 3UP1A 1RULH 4N0YH 2R1YA 4WEBL 3PIQB 2HKHL 1D5IL 2DM3A 4YIQB 3QWQB 5FGCE 4KRMB 4WFED 1J0JA 2ZCHH 3O6MH 3V6FA 4BQ9A 1IEBA 4WEUD 3HRZA 4NSKB 4X4XA 5E6IC 1IKNC 3QUYC 1MCOL 2NYYD 3QFJE 5GS1A 3ARDB 4OLVL 4YBLB 1B0GB 4YC2C 1FAKT 2ICEB 3ARVA 4PRPA 5DDHB 4HLZG 3PQYE 3GSXB 1CFNB 1ZXQA 4WCYL 4MCZA 1A6VH 3O6FC 3WO4B 1UM4L 5H35B 3FJTA 1OQOA 4S1RH 4ZFGH 2CKBA 4IRSD 4ONGL 4OM0H 3U0PA 4N5ED 4QNPF 5DS8B 4H0GA 2P8MA 4LVHC 4JAMA 2DQJH 5F9DC 4FHBD 5LKNA 1X5FA 4MHHI 2XKNB 2F9BT 3UAJC 5HYJD 1FNLA 2OL3B 4RWYL 3KPSD 4P5TC 3LH2H 4I9WE 3L5JA 4MXVF 3SGDI 2HT2C 1M7DB 3VDAA 1MREH 4ACPA 3TZVC 5EWIH 5DFTA 4Z7UA 2VZVA 3MJ6A 1K4CA 3CFKA 4LPTA 4OV6F 4P3DB 1RVFH 5E7BA 3D3VA 3V4PH 1IGJB 3REVA 4MQSB 5IVOA 3QQ3B 4JY5L 1IL1B 1VFAB 3WFDH 5J6GB 1A9EB 3O3AA 2VTFA 4RX4D 4OFYD 2BDNL 1CFVH 3CFJA 2LU7A 4EUPA 4GG8A 4R97C 3IF1A 4CVXA 4YBHA 5K9KB 4WUKH 3MJGX 5ECJE 2A38A 2EIDA 2PN5A 4RFEB 4LCCB 3SE4A 4F7EB 2AEPH 4D9LL 1BQHG 1I7ZA 3QEQB 5INCA 3OV6A 3GSRA 4OD2B 3WFEL 1E4XL 1IC4L 1N5YH 1MRFH 1NCDH 4KMLB 2BK8A 1YQVL 5E2JA 1MJJA 3LSOB 3QRGL 3PNWA 3C5JA 4PJEF 4XCNA 1I7UB 4PJBF 1H8SA 5E9DE 3ZYZA 5EUKA 4WU5A 3W11D 1T21B 3HB3D 5GPRA 1RZGA 1CI5A 1F3RB 1CXFA 1RZKL 4ZPVA 1F3JB 2P5EE 4YQXL 2R0ZL 4L5FH 1KBGH 5C6TL 3CXHJ 4R96A 3CFDA 1S9KC 4GAFB 3MRCB 2B4CH 4OQTL 1X7QA 4LHQB 1MLCA 3O6FA 1NBYA 4Z8FL 4R7DB 1VKXA 3KR3L 3HUJE 4LSQL 1X5AA 3VI3F 5HVWA 4JDZB 5HHPB 3Q3GA 3HHRB 4NN7B 4XAWL 5K9QG 4Y16A 3VFVB 1P5UA 2COQA 2IC2A 2PKDA 2HN7A 1LNUA 4MQTB 4ONHB 1QO3A 3KLSA 3MJ9A 4JKPH 2AJ3B 2FLBT 4QTIL 1YYLL 1WT5A 3MRQB 2IANA 4DOHB 5I1AB 1TMCB 4AIOA 2R0WL 1E27A 3C08L 2FL5A 5F9WC 5DXWA 3H3PL 4WWKB 1QOKA 2R4SL 2ED8A 4LK4A 1UEMA 1A7OL 4NM8H 5I9QC 3DSFH 2HKHH 3IXAB 1A7NH 1AHWA 4QHNA 2NLJA 4GS7B 3RWDB 3V0VB 4F7PA 1F3DH 1G7JB 3T4YB 5C8JB 5C0EB 1A7QL 5IB2B 4OFPA 4E41E 1WQVT 1QSFD 1NCTA 4XNQA 2VXUH 2MCPL 3PJSB 2EKJA 5FHBL 5KW9H 4KZDL 3KG5A 2WV3A 4NHUB 3PDOA 4DQOL 3G6AA 5DUBA 3T0EB 5HYIA 1MWAA 4HCRL 7CGTA 3O8XA 3L5XL 1LEGA 2W0PA 1ZWIB 1XGYH 1NDGB 5T3ZE 5F1NA 2BRQA 4MAYA 1A6WL 2V7NB 4XCCL 4IOSD 3JV6A 4KK6C 4NHCL 3UBXB 1AJ7L 5EOQH 4P2RA 2VDOH 1ES0A 4WFHD 2VR9A 4Z77A 2EIBA 1I1CA 4PRDB 3T04D 1FO0L 1CS6A 1S7QB 5JORB 3X17A 2NTFA 3P77A 1Q1JL 1XZ0A 4O02H 4X0KB 4XB7A 3UPAA 2ZG1A 2XTLA 1IAKA 1YNTB 5E08L 1M05B 2R8SH 3RDTD 3MPCA 4X6CF 3ZE2E 1LILA 2BOBA 1NGXA 1T7XA 4AT6B 2FATH 5D93C 4PJAA 3DUSB 1XGTB 4XWOC 1HYRC 2J6EL 1BQUA 3QP3A 3UC0L 4B53A 2JTDA 4KVCL 5FA3B 1CGSH 5HPMB 1KEGL 1CWVA 2I07B 1PG7X 2IH1A 3VWJB 1NGPH 5I15L 3JWDL 1CFVL 3SE3A 1AGFB 5I76A 2F5BL 5AYUL 3HC4L 3ARBD 3HG1E 5IHZA 2EYSB 1TPXB 4DCQA 3MNZA 4I1NB 2X4UB 1T83C 2M8XA 1JPGB 3LRGA 3O2VH 4I0PC 2BHYA 5TDNA 4JRXE 1B9ZA 1NH6A 1P1ZB 2NY4B 4JANB 4JZJB 2X4NA 3G04B 2CJUL 3TN0D 4ZFFA 1RZJH 4C55A 1UM5H 2VNCA 2V2XB 3C5SA 4JRYD 3WSQL 4K2UH 4X9GA 4M5ZL 4F2MB 5GGRY 1OGTB 2YS4A 3WS6C 3IDGA 2NY6D 4JFFE 1OB1A 2CO7B 2EDFA 5C3LD 1IGFH 2LFGA 1P4IL 3QHFH 2CRIA 1CIUA 3I75A 3VD3A 4DZBA 3P2TA 5E5UB 5C0AA 5C0ND 1HK6A 4HUUA 2YEZA 2VE6B 3NCCB 3MRMA 4L8SB 1NC4B 1CDIA 1BQLH 3VXTA 2B20A 5HHXL 3ZSTA 2DF3A 5GS0L 1I4FB 1AGEA 4JFPB 5J12B 1T0NA 5CHNA 4EEEA 4TNWK 3D2UA 4JRYE 1A3RL 3CCHB 4DGVL 2I9TA 1FNFA 3SKOB 3MFGB 1HN1A 3TPUA 2R39A 2PO6D 5I1CL 1QG3A 2AK4E 4JO4H 2BVPA 2VZUA 4HGMA 5DJXA 5BCAA 1CN4A 2NR6D 3SKJH 4DKDC 3DNKA 5TDOA 5FB8A 1N64L 2NY4D 2IALB 4V1DA 3PGDA 3AM8A 1SMAA 3IGAA 3ZDZF 1GPOH 3AU1B 4TUKH 3QUYD 1FCCA 4MJIE 4L4VB 3L3KA 3GDBA 1UJ3C 3CUPA 4Y4KD 5CIPH 3OAYK 1F5WA 3VFNA 2FHFA 1T3FB 2NY1C 1KIQB 1S3KH 5JHDB 1HHHB 3NTCH 1KNOB 2AK4B 1S7SA 4XPGL 4RFOL 4CU8A 4F9PC 2VH5L 2RIKA 4QWWD 3UYRL 4PJCF 2V17L 5GZOD 5DMIL 5A2IH 3VXNB 3OG6B 3T65B 5DJYA 1IZKA 1YECH 5BS0A 3H9HB 1S9XA 5JHDE 3PP4L 2PW1B 5HI3D 2VDLL 4XWGL 4M7ZC 1H3PH 1UXSA 4F7CA 1U41A 3PQYA 5MENB 1YC7A 4K7FB 1KIPA 2YK1L 5D5MB 3PGCB 3EYUL 2PYFB 5ACLA 3HPLA 5IQ7H 3K2UH 2F53D 2X09A 4EDWL 1NGQL 4U7MA 5IKCB 3VGAC 2Q3ZA 3C6LB 4Z5RB 5IGXH 1ODAA 2VXVL 1WCBB 2QSTA 1KJ3H 2XXCB 2OR9L 3ET9F 1ZE3C 5DFVD 3OF6A 4PP2B 1EO8H 3IKCB 1FO0H 3TA3C 2IADB 4C4KO 1VFUA 1JRHI 4UV4L 4LKCA 5FYLE 3T0AA 4PB0H 4ODTH 1CVSC 3JZ7A 4QHUB 4BSWB 3LKQB 1G9NC 5D5ME 3BI9X 4QHMB 1PLGL 2OJZH 4KUCF 3V52H 1RK0B 3GZKA 1KEMH 3H9YA 4UI2A 3HRPA 4O58L 5I1JH 2VQ1A 3KS0J 4YE4H 5ADOL 4X5WA 1YEEH 4YWGH 1MJUH 2B1HL 4WU7A 5DJZB 5CFHA 1U58B 2NXZB 3NCEB 3GJFB 4OZ4B 1UFUA 3VH8A 1HQRA 2FIKA 5ITFB 3OMZA 4HGWA 5CCKH 1DN0A 3MBXL 1YEGL 4L8BB 3HG1B 1L4IA 3T8XB 1C5CL 4NQTA 5CEXB 2NY5C 3DIFA 5SWQB 5D1ZD 5CSZB 2Y07L 1QACA 4ZOBA 1JWMA 1ZT1B 2HJKB 4P4RA 2E5EA 4WV1B 3V8OA 3OJDA 2P1YA 4XC1H 1F6AB 4IMKA 2WW8A 5KSBB 3GMPB 5FECB 3TCXA 4PIRF 1EEYB 5CSGA 1UG9A 1RIHL 3SCMB 2E6JA 4NN5C 3EO0A 3F7QA 1KUMA 1X5GA 2J8UB 4PRHD 2IQAB 5F1KC 4OCRH 5IMKA 4R3SB 4BK4A 1DBKL 1OPGL 1IGIL 2QQNH 5E6ZA 5KTEL 2X4RB 4LQ1A 3WXWH 1HH6A 2GFBA 2WBJD 2NXYD 4O51B 3SJVD 1OAXL 4PTTA 3LDBC 1BQLL 1TDQA 2DTML 3W2DH 1QR4A 4JFEA 4RCAA 5CP3A 3MXVH 1MVUA 5D71H 4X4ME 1VFOA 3D39A 5I15H 3OXRA 3LEVH 2ZUUA 3VFGH 5C0FA 1AKJD 1HHGB 4AEEA 4PGEA 4H25B 2YPVL 4B41A 4N8CL 3F6IA 4EDWH 3NGBC 2B5IB 1OAKH 1GC1C 4TYUA 5F7YC 2A6JA 4XP4H 4R90L 1Q9LB 4HC1H 3A6BL 3CXDL 5HI4C 4ODVL 4F58L 3MZGB 3DMMA 5I1JL 2CK0L 1MCIA 4XI5D 1T89A 5F3HA 4F15B 5MERA 2WBWB 4PJ7E 1I9JL 2EDBA 3JUZA 3MTRA 1UXWA 2CUMA 5EO1B 1MNUH 3D85B 3QNXA 4Z7VE 2MTPA 1DEEA 2VL5A 3CNKA 5I71C 3AMLA 2X5PA 5EU4B 4LSDA 5IESL 1PSKL 4S1QL 2CDGA 2B0SL 4C83A 4FG6C 3VGFA 4Z7QF 2GCYA 1JFQL 3EZ8A 5C0IB 3C60B 5LWYH 1KCVL 4K3JH 4Z7WE 1PFCA 2EE9A 2EE3A 2A73B 4BH8A 5JLZB 2HT3D 3RY6C 3IFLH 3W5MA 5DQ9B 4QCIA 4JHWH 2P4AB 1OT2A 4MWFA 1IGIH 2VXQH 3ILPA 4E42B 4KGJA 1BEYH 1A6ZA 5ERWB 2G5RA 3QEUA 3SE8H 3BWAB 3RVUC 1DDHB 1YEDA 1JCKA 1DVFA 1CFTA 1WBYA 3RVTC 4LCUA 1U2CA 4PJXF 3QNZA 3MZTA 1ZS8A 3OKDB 2C1PB 4KQ4L 2MHAB 5FUCC 4U31A 4LLDB 1I1AC 1DLFL 5F7WC 1HKLL 1WITA 5EZLB 4QEGA 1KENH 3RIFK 5ALCL 3FO2B 3RL1A 3WFBL 3IFPA 4GRMB 3OKMA 2GSIA 5K9OB 4JPWH 3WJJA 4G6AC 35C8H 4O4YH 4D9LH 4N0UA 3QQNA 4Y5XB 1OLZA 1CD1B 2VDQH 3DBXA 3FHAA 1A5FH 1TJIL 4HG4K 4M1CD 1MCPL 1JF1B 4N8PA 1TPXC 15C8L 4RGNC 5TE4H 1FVCA 1YMHA 5CEZD 1CG9A 1IGYB 3D2UD 5D1ZA 5IB5B 4HKBB 1WTLA 2AEIT 2JJTA 3KPPB 4HBCH 1Y18A 2X1PA 3LKRB 1I1YB 2CLRA 4XCFL 1XF2B 4CN1A 4JGUA 4G9FE 4PRPD 5E4EB 3VD5A 5T1DL 3W0WA 1NGQH 4U1IB 3U9UB 3EKCA 4Q6IC 2Y36L 3WO3B 3QFJA 2DLGA 4CVWA 2OMNA 4KKAC 1WLHA 5FYKH 3TPKA 3VXUB 4ISVA 3ARED 2WWKT 2ADFH 4HMCA 4U4BA 5DD5H 5EBGA 1TZHA 3NOIA 3W9EA 2YRLA 4JKWA 1HSAA 4JQVA 5LWYL 5CEZE 3FRUA 1S9WA 3QXDA 3ZO0A 1U91A 1T7ZA 4J8RB 2XN9A 5F9WB 3RY6A 5C0BB 3AGVA 2C5DC 4ZPTB 2UY6A 1A47A 4DUXA 4D8PA 4NKQB 1R6VA 4G8FA 1U8NA 2BZDA 2ZPKH 4R2GB 3PE9A 3EUUA 5ID1A 4UT9H 3F5WA 1RJZB 5DUMH 3TBSB 1KJVA 2MPAH 3L3DA 4ZS6D 1T5WA 4ZTPL 1YY9D 12E8H 4HC1L 4OLWL 2N7AA 4OBRA 4XBPB 4KMTH 3IFNL 3MODH 4HWEL 2OXGA 2NYYC 1FYTB 4P46B 2QKIB 5B4MD 1I1AA 5DYOA 5D7IE 1NDMB 3JVGC 3MRDB 2GJ6B 4RZCB 1FZOB 2QQLL 3DI2B 1T1WA 1AO7A 5I17B 3WFCH 5LAXB 4NT6A 3N9GH 3MBED 5GGQL 2H2PC 2BNQD 5D71L 3B2VL 1MCQA 5A1AA 5ICYB 5AAWA 4QF1B 4KROC 1CXIA 3O11B 5D1XD 1PQZB 2O5ZL 2YRPA 4PJFF 1MAMH 2A77L 5DD1L 2QLVB 3LQAH 4N0UE 4I18A 1PYWB 5GRWA 2AJZA 5IIEA 3QWRD 1YY8B 4JRXB 4HIHA 4X7CC 2HH0H 4FQ2L 1G6RA 4L3EE 5F96L 2VLJD 3E3QE 5D1ZC 4XVSL 2JJTC 3V7AE 3WEXA 2AVGA 3OJMB 3FOMB 5DFVC 3WFHA 3AROA 3RWFB 3QJFA 5AUMB 1D5XA 2AJSH 5EZOL 3TBTA 1L0QA 4NJ9L 5JDSB 2FX8L 5E2WL 5KSVB 3CX5K 1VB9A 4NWUL 2BRRH 2W0FB 4I77H 5FXCH 3S96A 5LG1A 2DM4A 3QHTC 5D4QA 5BW7A 4WW2A 4CW1B 5TF1H 4G80A 4HK3J 3VCLB 3U7WH 5KS9A 4P4KC 4L3ED 1YC8A 5J56B 1AXTL 4PJGB 1NJ9B 2DKSA 4NC1E 2PYEE 3KDMB 4I3SH 1E4XI 3ESVF 1ZANH 4N8VB 3NCFB 5IB1B 5IBLC 4KRPB 4LLAA 5FK9A 1NGPL 3R0NA 4WHYG 5J1SC 3CMGA 1DE4B 5DJ0B 1TETH 4K71B 2DLTA 2JF1A 4Z76B 3MRHA 5ADPL 3CFCH 4L9LA 4PYGA 5C0CE 2E9WA 1OD7A 1RIVH 1Q0XH 5HGDB 4NFDA 5I19L 4OJFL 3FQNB 2VR5A 1Z9LA 4R7NB 2AV1A 5IOPA 3BN9C 5HY9B 4AG4H 2GKIA 1UYWL 1ORSA 3EAKA 3SDAB 2W07A 4WO4B 3KPQA 1KG0B 4CL7A 4JRWA 3VXRB 1UM6L 1T2JA 2OQJB 3BZ4B 1GGBH 1BBDH 3PHQA 1S7XB 4U3XA 4RSVA 3IAPA 2BJML 3L6FB 1DLHB 1V3LA 1Y6KR 5HGHB 2APTA 4HS6A 4MDJB 3UJTH 1X44A 2YC1A 3MGTA 5FYJU 3CLEL 2I60H 3VFUA 1QFUL 4KDTC 4YHML 2QBWA 3MRIB 5D72H 3B8YA 2MQ3A 1A7RL 4HSQA 3G6JB 4AL8H 3EIFA 4KTYA 1ZT4B 4IM8A 3O6LH 5L8JB 4K3JL 1T2QL 3VXRE 3L3GB 4RISH 5B22A 5DK0A 5HGAB 2JK5B 3B43A 4ZFOA 1RY7B 4GW4B 4HX1A 1CGVA 2FZ3A 3BPNB 3FCTB 2P7TB 4NP4H 1NUGA 3D0LA 5EG6C 3NTCL 3IDMA 2RAMA 3EJZC 1QFOA 1J8KA 2KL6A 5E56A 3RTQC 1FFPB 4QXGL 1JNHB 1KTDA 4PJ8D 2R0WH 3EOTH 2Q76A 5CKGA 2VUOA 3G5VB 1IBGL 3P4MA 1TQCB 1BLNA 2AS5M 1MQ8A 1BMGA 5LGKA 4XWGH 5L0QB 2X4OA 2PETA 4NZJA 4PRNA 4BK5A 5C09A 3SGEI 1K8IA 3GO1H 3R1GL 5K59E 3BUTA 1IAOA 4AENB 1OTSD 2ADJB 5IMLB 1BM3H 2IPUG 3JWDC 1LDPH 5FKAB 2DLFL 3QDJB 3U4BL 2BFVH 3EJYD 1UZ8B 2PF6A 3LQZA 4CMMA 5LGJA 2JCCB 3S34H 3DUHA 3MXWL 4JE4B 2FRGP 1T66D 5FGBC 4DQOH 4EI5A 3GGWA 1HHJB 4CJ0A 1JRHH 3I50H 2RGSA 1BBJB 1TIUA 1CQKA 4BFIA 2IPUK 2VLRB 4PRIA 3KYKL 2FJGB 5CS7A 1ZTXH 2VDMH 4Y5YC 2ESVD 3H9SB 1T20B 4HMDA 4LBEB 1X9QA 1Q72L 1U8IA 4ZNEE 3AY4A 4S10A 2HFTA 4FQIH 1C5BH 2A1WL 5ESQB 4PUBH 3HI1A 1VGKB 2Q7NA 2XPGA 3BW9B 3TC9A 3PWNA 2IQ9H 2WK2A 2P8LB 3IU4L 5T3XD 3U7AA 4N68A 1RZ7H 3KJ4B 2W60A 3A67L 4MVBC 1DSFH 5HHME 3MV8A 5FO7A 3MROB 5FFLA 1WIPA 1IGCH 1INEL 4DN3L 3FT2A 4XPTL 5K9QI 4YHMH 4PRHA 4GRLC 2CLVB 4XAWH 4QRTA 2DQFA 1Q8MA 3QDAA 1C7TA 2BVYA 4UIMB 1AY1H 2CXGA 2HFEB 1GC1H 1HDMB 4IS6A 4GG6A 4X4MA 1H8NA 4PR5B 3KHOA 2AJVL 4YHPA 1C5CH 5ITBL 4DKAA 1BAFH 4JY4B 2ZUXA 1R3KB 5EPMB 1RZKH 4XHJC 3EOBB 4KXZH 3CDGA 1S7WA 4LOUC 4UILL 4M43L 5LXGH 4NNYA 1RUKH 2EH8L 4GBXD 2AEQL 4IIQA 4UB0H 3G5ZB 3UROR 2FWOB 3UTZB 4I0PD 4MNQA 1IGML 2ERJB 3DXAA 4Y0GA 2MMXA 4LMQI 3NCJH 1XF4B 4CAGA 5DRWB 2IPKA 3ZDXF 5GGQH 1UH2A 3VXSB 1LO5B 4AMKH 3QEHB 1J1OL 3RU8L 3RWCB 5IMOA 1MCPH 3RWHA 5T3ZH 2NY2C 1XF1A 2XACC 1JMXA 3MRRA 1OOAA 3VXPA 4NCC1 5C7XH 4WI6A 1UGNA 3DO3A 2A6IA 3P11H 1XR8A