5CEXA

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
207
Chain Sequence
b'TQPSQLSVAPGETARISCGGRSLGSRAVQWYQQKPGQAPVLVIYNNQDRPSGIPERFSGSPDTTATLTISRVEAGDEADYYCHMWDSRSAINWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
molecule tags Immune system
source organism Homo sapiens
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
total genus 43
structure length 207
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA01
5T3ZL 1I3GH 1AJ7H 5KVGL 15C8L 4XH2A 1CDYA 5CP7B 4OCRH 1BREA 2NY5C 1YQ2A 1BD2D 3IFNH 2CSPA 3PG2A 4C56B 5IM7A 3DUHA 2IBGA 5D2LF 4HDIA 4HHAA 1TFHA 2B4CH 5CEZL 5FUCC 4Y8AA 3VGAB 4TULL 3QI9C 2VDQL 4WCYH 4D0CB 5EUOA 1R5IB 3B9KC 4M93B 4GKNB 1MF2L 3C5ZB 3HC0B 3P11H 3CXDH 4LPXA 1M6OA 4LHQB 3P73B 3EJYC 2WBKA 3FQWA 2D7NA 5J13C 4PV8A 4NWTL 4NQCB 5FKPB 3SKOB 2QSQA 4UDUA 1WK0A 3TV3L 4NN6C 3MCKA 1B0GB 1YNLH 4PS4H 1JF5A 1H3WM 4IMLB 1T7YA 1FCGA 2IQ9L 5FO9B 4HFUL 4YGVA 1RZKC 3WUWA 5DC4B 3H9ZA 4QTHA 4HUNB 2E9BA 2BC4A 2IH3B 4ZXBC 1F90H 1G6VK 3D3VD 3JWNC 4HULB 2WINA 4MAYB 3CSGA 5DHYA 1XCTB 3D3VB 3MV7B 5B21A 3VFPB 2AXJA 2E7LA 3G5YB 2G5BB 2MPAL 3HNTH 5EB9A 3BJLA 1K4DA 2FIKB 4PRDB 1CXIA 4ZTOL 1U58B 1AHWB 1RK1A 1CTNA 5AWNH 1KPVA 1BEYL 1CGYA 3OKDA 4M62H 4KTDH 5GRUH 1TQBB 4OCSL 3WS6C 3MBXL 1NAMA 4PREA 1QBLH 2CMRH 4UZGA 2ED7A 4M5ZH 2R2HA 2PYFB 2Z4QA 3LEXA 5I1EH 5FOBB 1AD9A 1D5IL 2K1MA 4RAUA 1SJHA 1IC1A 2CK2A 5GRXG 2ENYA 2FCBA 3SKMA 3T0XA 4NKOB 1Z9MA 4H25A 4DN3H 4WCYL 4PGEB 1AQDA 4YDLB 2FYYA 3VRLE 2DLIA 2IMNA 3EYVB 3NIFE 3TFKC 3ZTNL 3P4MA 2X1PA 2VXQH 2GJ6E 5AUMA 2YSSA 3ARXA 4HKXA 3LH2H 1NAKL 4DGVL 2XZAH 1GL4B 4JRYA 1MCWW 3U7YL 4LRNH 3THMH 3MUGA 2E9WA 3PNWA 2C1PB 3O6LH 1K6QL 4RAVB 3PGFH 3FT3A 4EEEA 3D85D 3NFNA 1KELL 5F89A 4HK0B 1DBML 3LIZL 1VGKB 2J8UE 4Q9RH 3NVQA 4MAYC 1FL5A 1I75A 2BVOA 4JY4B 1L4IA 3AU1A 3GMRA 5I1GH 3L5WA 4D0DB 2OX5A 3ARZA 1BJ1J 4TVPH 3UCRA 2HH0L 4JDVA 1A7PH 5KANG 4JCMA 1H3UA 1T2JA 3UTZA 4OFKA 2PR4L 4H0IA 3PWNB 2C3VA 3SDDD 5IESH 3WKML 5BS0B 3ARPA 5E94A 3TO4D 4WUUD 3PDOA 1GOHA 2X1WL 5GGTL 4K8RL 1RQ5A 3MXVH 3IJSB 5HI3C 1RUPH 3LH2L 4Z7OE 2BNQD 4Z0BL 1B4JL 5D93C 3ZE2E 2QSCH 5EU6E 1YMHB 1MVUA 2E27L 5D8JH 4P5KA 4N0FA 4UB0L 5EOCL 3DBXB 3PABA 8FABA 4GKSA 3IDXL 3JTTB 2Z91A 5IB4B 3MV8B 2A0LC 2HLFC 1EBPA 3UTSB 1JZ5A 5DVLA 5FO8A 1T1XB 5E9DA 3VD3A 1I7UB 3QUKB 4S1RL 1E6JL 1IM9D 3PJSB 2CRYA 4JRYE 2BSTA 4OJFL 1J10A 1MREH 4RWYL 3LKSA 3BZ4A 1IM9B 2MKWA 3LN4B 4KUCD 5FYKL 4LAQL 3HI5L 4S1SL 5K93A 3VXSE 3DHMA 3U48A 2F19H 1ZEAH 3O3UN 2EDKA 1G7LB 4JM2C 3LSOA 5I73C 4R97B 4YHYB 3RGHA 3UJTL 2PO6D 4JANB 3MLVL 2R9HC 1XGUB 1OAXH 4OFIA 4Z7QF 5CEXB 1RD6A 3K74B 3QIWB 5IEHA 4F2MB 1PG7L 1CFVH 4YK4C 4BH8B 3BD4A 5GGSY 1TVBA 3B5HA 5I1IH 3REWA 3TNNA 3BMVA 1C5BL 1PQZA 4APQD 3BRGC 4JDVB 5F1OB 2P5EA 5DK0A 2ZSVB 1G1YA 1ETZB 1P4IH 2V9QA 4Z5RB 4QLRA 4UTBL 3T8XB 1MCJA 2XICA 1RIUL 2ZJSH 4LLMA 5DJXB 2R23B 1BQHG 3WEXA 1TJIL 1LO2L 2NXZC 5SX4I 4PP1D 4F7PA 5TF1H 3DUUB 4WJ5A 2A73B 2UVFA 1PX4A 1AO7D 3IFOA 1S7TA 2DD8H 1WCBA 1LD9A 4P46B 3QZWG 4MXQD 3SO3B 4UNVA 3ZTJH 5DJ8A 1MFBH 1VFAA 3F7YA 3TC9A 4CBPA 3BKCH 1KOAA 4XNXL 4HXAH 4AZ8A 1G7JA 4AEEA 3RAJL 1U8LB 4WI5A 5HHVL 3UJJL 4M7LH 1ZT4B 2A6DA 3L3GB 2X4PA 4S0TD 1BHGA 1CLZL 2NY3C 1P4BL 2IPTH 3LSOB 2NY0D 4Z18A 1SJXA 4J12A 4FTVE 1D5MB 3P0VH 4X6EB 4P2QB 5EUKB 1N2RA 3MNZB 2UWEF 4MA1B 1WTLA 1CE6B 1CDUA 1OGAB 3OKEB 1ZXQA 2GSIA 1JNHB 2DQEL 5DI8A 2HJKB 1U92B 3RJQB 4BQ8A 4EI6A 3QDJB 4F7TA 4GMTH 4H8WH 5F8RC 4OGAC 5T5NF 3SJVA 2AJXH 1JRHH 5FFLA 1A6TA 2EE2A 1FL3A 2GTWB 5L2KB 1OVZA 2BCKB 1TQCC 4NNYB 4B53A 1U8OA 5EORH 5JXED 4WTZA 2HG5B 5E5MB 5FECB 5IQ7H 1VERA 1AC0A 3VMNA 2OXHA 1SBSH 3WFHA 1U91B 5IFJA 3I85A 1ND0B 3EGSB 3EYOB 3MRMA 5I76A 1ZWIA 4M1GL 3F5WA 5D2NB 4HIIB 2J12B 2OLDA 2NY5H 4HKXB 4TSAH 3PWPE 3O3DA 4F8TA 4JDTL 3QXVA 1FL5B 1JPSL 3IU4H 5HYJB 5FHBL 2ICCA 2VITB 3I3BA 1ZT7B 2FEDC 1T03H 3O2DL 4N8VB 5DMYA 4OZIF 1EX0A 4PGCB 4HZLB 3K4ZA 1BIHA 4I77H 3MLUL 3PWNA 4UUJA 2AXGA 4LP4A 5I15H 5E08H 5GGSA 5B38G 2ICWJ 1BD2A 3MLSL 4PLJC 3VFVB 4QRUB 2FNBA 1W0WA 4JZJC 4PJ9C 4QRRE 3L1OL 3QCVL 3NMEA 4PJDF 4NN5B 3M8OL 4DVBA 1Z3GL 2ADJA 4OLWH 4QNPE 3QEQB 4HWNA 1CS6A 1IKFH 3SQOH 1XEDA 1Z2KA 1AXSA 4PJXF 1FFOB 1IGJB 4X5XB 2JJWA 4CMMB 3DSNA 3C08L 1E6JH 2OL3H 4I0PA 4CJ1A 3PWLB 4FQXD 4GG8A 3RPIB 3EOTH 4PY7A 2YHGA 5BMFH 4JHBA 3OG6B 5TDPA 2VLMD 4Y4HC 3MJ6A 3SDYH 1KTRL 3DX6A 5JOEA 4LCYA 2NY6C 3HAEB 1A7OH 2APXA 1KCLA 4WEBH 3DV4B 4HF5H 3P4MB 1J0JA 1X7QA 4TPRL 4QXUH 5C2BL 3BMWA 2DI7A 4PGEA 1UZ8B 2I26N 2ESVD 2DJUA 4I3GA 5C08B 4AYFA 2O26U 3Q6GL 3D9AH 2AJYH 5BQ7A 1JWSB 4HUUB 3UAJC 2PXYA 2BRRL 1HQRA 2Y06L 4PB9L 4TUOA 5CD5C 2OTWA 5IB2A 5LWYH 3I6LD 4NQXB 4WEMB 3CFCL 4U1IA 3ULVL 2GAZA 4J3TA 3WFCL 1FDLL 1CDGA 1QRNE 3FQWB 5IMLB 1EMTL 3GMPA 5FGBC 3OX8B 4JFFD 1RZGA 3ARSA 4QHNA 3BYYA 4XBEH 3GMNB 4ZUVA 1IGTB 2EDTA 1KXQE 5HVHC 5T5NG 3AFLA 1OAQH 1Q9WB 4JM2B 5EUOF 5GIRB 3BDXA 2VLRE 4PY7B 5FV2A 5KG9B 3RPIA 5IFAH 1MIMH 3VE0A 3RVXC 3NIDF 1Q94A 2EECA 1S7XA 1YY8B 3GHBL 2QTEA 1OLLA 4M00A 1GZQA 2V2XA 3ZO0A 1M6OB 5AG9A 1AIFB 3GBNL 4UINL 3PWJB 3U6RB 1MQKL 2HT2D 5TQ2H 1AR1D 3RJDA 3ESVF 1FO0A 2Y4SA 2XFXA 2FO4B 5GS0L 4YWGL 3V9FA 3BPCB 4E41B 2A9NL 3IT8D 3I75A 2X41A 3C60A 4PRHB 4UT7H 5D70L 1J1XL 1QZ1A 1S7XB 5DJ6B 4PB9H 3MRPA 3U30C 3MGTA 2X05A 4PRPB 2JLLA 3G5ZA 3NCFB 5D1XD 4BSJA 1M71A 1FFNA 3JWOL 5KW9H 1QFWL 5KG9A 4BM7A 3T77A 1UG9A 4ZG1A 1MJUH 4JM2A 4HJJH 5D7LB 4EVNB 4FOMA 3Q3GB 2DQCL 4MZ2A 1YJDH 3P4OB 3QXUA 1EXUA 3L3HB 1ND0A 3UBXB 5KANI 3HE6D 2EDQA 3LRHA 3L95B 5HYEA 3W2DL 5HY9B 1A7PL 1SJVA 1YEDA 4OZIB 3RTQB 2C7UA 4P3CL 2NMSA 3MLYL 4DW2H 1KPRB 3ZT5A 3VFUB 1N0XL 1T1WA 1XF4A 1IAKB 4QHUB 4JRXA 4KK6D 1NUFA 3VG0H 3L5XH 2VWEC 5KJRL 4L9LC 1S9VB 1PLGL 2PF6A 3ARUA 2R0KH 5ETUA 5CP3A 3OKKB 2GK0B 2AK1H 1OGAE 2ZCLH 3TPKA 1XGQB 4FG6C 1I8IB 3P9LA 4MJ4A 2IAMA 1WZ1H 1RIVL 3QG6A 1J0IA 4M02A 4JEGB 1MJUL 1FO0L 4X0KB 3CU7A 3G6DH 3FL7A 3KS0H 5A2IH 3DV4A 3AUVA 4Y5VC 2C3GA 1N64H 4DTGH 4HJ0C 1BF2A 1EVTC 5JW3H 2DJ4A 5HGAA 5I73B 4UT7L 5DR5L 4YBQC 5TDPB 2AEPH 2NZ9C 3P77B 4PB0L 5C6WH 4GG6B 4MLIA 3GBLA 1RJCA 1R5VA 3REVA 5F3HB 2B4CC 2VQTA 1DBJL 1OTSC 4XI5C 1AGCA 1MFEH 2FLRT 1J1PH 2CK0L 2UUDK 4JVWA 5EOQL 2IQ9H 5ID0B 3CFKB 4Y1AB 2V2WA 4IRJA 1YY9C 3WHXA 1BBJB 3GSRA 4FQ1H 1ED3B 2IPUG 1QFWI 4HGMA 3WFEH 2BP3A 2FIRT 2PXYD 1JZ2A 3L6FA 4UTBH 3S6CA 4MQTB 4U1KA 1D5ZA 1K3ZA 4XMKH 5KSBE 1WAAF 3QUXC 4NUJB 4HJ0D 2DLGA 2GUOA 2C4XA 3PGDB 4PJHB 4OZFA 1EO7A 3GSWA 5SWQB 1I1YA 2WWKT 4QWWD 2VLKA 1HZHL 5F9OH 1UYWH 4CW1B 3MRMB 5I76B 4GRWB 3ZHKA 1AXTL 3AM8A 3MRJB 5FHAL 5KSVA 1J0KA 4OKVB 1RJZA 1HNFA 4Y4HA 1ZA3A 1QTYT 3C2AL 3HTLX 5ISZE 4WEBL 3FB8B 1Y18A 3ZKSD 2Z93B 1K8IB 4BELD 4XMLL 1N26A 3KPNA 5F72S 5HHVH 4X99B 4NCC1 5A2KH 5HI5C 2Y72A 1X6LA 1I9RL 1FZJA 3QUMA 4BUGA 4MJIA 4Y8DC 3SDAC 4IOFD 5F96L 4O2EA 1IQDA 1KCSL 1NFKA 2H3NA 3VXNA 5BS0D 1R3KB 1XIWA 4XMKL 4EIZC 3EBAA 4M6NH 4R0LA 5ABDE 4DEPC 3HZYA 3PP4L 1CQYA 3CFCH 3KHOA 2HLAB 1CLYL 3S36X 2X70B 5T3ZH 2VLKB 4PJXA 1HHGB 4MNGE 4OZHF 3BIAX 3PGDA 2FZ3B 4FQ1L 4MXVE 1GHFH 4UQ2B 1KCVH 3H9SA 4OD3H 4RFOH 1QLFB 4OGXH 1MCIA 4HBCH 4O2CB 4Y4KA 5IF0A 1KENL 4YHLH 4LSQL 3T4YA 3MV8D 1C16A 3MA7B 2ZSVA 1Q1JL 3T1WA 3VGAC 2VUOA 3QI9B 4YXLH 4FZ8L 3TBWB 1ZVSA 5ELIA 1S7QB 1UWGH 2H26A 4I8DA 4L9LB 5B4MC 2PR4H 1OGTA 2Z8RA 5GS1A 3HZMB 4U3XA 3AVEA 1KN4H 3PQYE 3OR6A 4IHOB 4AJ0A 3CSYA 3FQTB 4OLXH 1A6TB 4JQVC 4U2YA 2FJFA 4JO2H 1QFOA 3BQUD 3OJDA 5BXFA 3T0EE 5CWSB 1DDHB 1FAIL 4D0BA 1IFHL 1MAMH 3CLFH 1LO4H 4XCNB 3TGXA 4KI5E 1KULA 1N3NA 3W0WD 4K7PX 1AXIB 4PJCA 1MUJB 1FV1B 3UJIH 4EOWL 3WFBH 1A6VL 4RIRB 3SGJC 1WT5C 5BV7B 1P84J 4MJIE 3MRHB 3QO1B 2AK1L 4LPCA 3B9AA 3LKQA 1IJ9A 5JHDA 3DI3B 1YPZA 5IF0B 3U9PL 3MFFB 5DO2D 3QIBD 3SE4C 2NY6D 1I9JL 1KENH 4PTUB 3BDYH 4E5XA 1X5YA 1T22A 2A6KA 4NT6A 3OKMA 5D2LA 4PJXB 2GK0A 2X70A 4QRPB 1HHIA 1I7TA 3P4NA 2XRAL 4J1UA 2RHEA 3G6AA 2UWEA 1DLFL 3FFCA 1KCUL 4WFED 2XA8L 4NNPH 1KJ2B 3SEPA 4PJEA 4APQC 1QBLL 4NC2B 3TJEH 1BFOB 3L9RA 4IMKA 4WI9A 3T0AA 2AV7A 4D9RE 3FQTA 3X11A 4L3ED 1A1OB 2BNRB 3U9UB 5D6CA 5IMKA 4R2GB 3S96A 3X3GL 3PV6A 5DK3A 2WLZA 5E8OB 3K2MC 3T3PE 4L3CB 4QT5A 4QY8A 4HS3A 3IAGC 2CKBA 1KTDB 5JUEH 4PJAB 4ZYKB 3MV7E 4A2MA 1FZKA 2RJMA 4ODUB 3SN6N 4WFFE 4J6RL 4U0QB 3TNNB 3KPOA 4NJ9H 4OFYD 3DMMC 4Y4KD 2JJTC 2VIRA 3MRQA 5EULV 4Z8FL 4G42B 2VXVH 2VDQH 1JYXA 2C1PA 4M7KH 4YXHL 1I3RA 1F6FB 4MMXC 5J12B 4PJHA 3V52H 2P43B 3WFBL 2NTSP 5F9OL 2FO4A 3TA3A 1WFUA 2W0LA 1T66C 1EVUA 5I74C 2AV1A 4OQTL 1F4YL 3DJ9A 3IJYB 1CK0L 2IG2L 1JN6A 2DQFA 3FRPA 1U8NA 3HS0B 5DHXB 4NC0B 3HI1A 5ECJE 4M8QA 1JYNA 3HG1B 3QFDA 1S3KL 4QGTA 1LO3L 5B38B 3VI3F 2ZP0T 2G75A 4FABL 2HT4C 5D2LE 4W4OC 3UYOD 3QEHB 1OOAA 4HK0A 2B8OT 2Z93A 1MFCL 1NC2B 2B20A 3F58H 5HJ3B 3GJFH 4X4ZA 1JZ8A 1RULL 1O0VA 2R29H 2G60L 2W0FB 1BZQK 3MSPA 3C09B 1LGVA 5I19H 5CEZE 1OAKL 3S88L 1XR8B 3I9GH 2ZUXA 1QRKA 5GGQH 5CCKL 1NKRA 4MZ3A 5EOCJ 4X7SL 1HWHB 2VE6B 5KVMC 4MQXD 3V7AG 5IJKA 3D1MC 4YHIA 2HA1A 5F1SA 5IFHL 5I16B 5DJCA 1IGTA 3ARDB 3H8NA 4NO2A 1A1MB 1U93A 1H3XA 5K9OA 4NM8H 4S2SB 1HDMA 3F7VB 4OKDA 3TO2B 3MV7A 5HGDB 2CRMA 4TUJB 1SBSL 1QR1B 4OIBA 2D31B 1X5HA 3RWJB 3TCXA 1NPUA 1SBBA 1YN6A 3VFOA 1AHWA 1RK1B 1JJUA 5HD8D 2OTWB 5D7KD 3V6BR 4HZAA 5IKCB 2X10A 3N1GC 3KPLB 1R3IL 2MTPA 4KK8C 3O45A 4LARH 3CCHA 3IDYC 4RMVA 2DQDH 4IRSA 2HFGL 2IALA 2BVUA 5CJQH 3DUSA 4LU5H 4XXCA 3O6FD 4RMQA 1YPZF 2AXFA 5FYKD 3TVMD 5CFHA 3MXWH 1MHEA 3VA6A 1G9MH 1G9NH 3DVGA 5C08E 2DTMH 2OI9B 4CNIB 5E2VL 1GSMA 2F53A 2ZUUA 2YUZA 5I15L 3QAZC 3CLFL 1B90A 1WWCA 4NO5B 5E5UB 1G7HB 4A2LA 1A02N 3BT2H 3O8XC 1UCTA 4G6FD 2E7BA 4JN1L 4GKZB 1ODAA 3ARFD 2AJUH 1IKFL 4PJIF 4OCMC 3NCYP 1M71B 2JIXD 3MJ7A 2I60L 4OFVA 2Y07H 3SDXF 3TN0D 4ODSL 4ZS7L 2YD7A 4KV5F 1UXSA 4NN5C 4LSQH 1GGIH 1DR9A 4FZEL 4Y4FD 4RA3A 2D7QA 4IOSD 4LIQL 4UILH 4EBQH 3LKRB 1T1WB 4XXDA 4NZTL 4GW5A 3GI8H 5DTFA 2OQJA 3QAZB 3K80A 4WIQA 1ADQL 4M62L 5FKAA 2EO1A 5CJBA 2Z35B 2EDLA 4Z7VF 4HDIB 1YY9D 5GS3A 2RFXB 1YMME 3HE6A 1HIML 5BZWB 5KBNC 3AS3A 1ORSA 3U46A 4IIQC 5HHMB 4NQCD 4JDZB 3O41A 2DLHA 1A7RH 2A6IB 4Y19E 4RA0C 2D2OA 4MA3B 3V4VH 1KB9K 4GW5B 3STBA 4GKZA 2I60H 4V1DD 5I2IB 1CG9B 2W9DH 2W1NA 3S35H 2IPUK 1ZTXL 4MWFB 4KU1A 2O5ZL 3GK8H 4N90E 3WIHA 4N0CC 4JFYA 1N5AB 5I17B 4M4RA 1W0YT 2HG5A 4ELMF 4TULH 5DMKB 2RFXA 1F11B 4LF3A 5DTFB 5EIQA 3LHPH 2FB4L 5J7CC 1DUZB 5J56B 3U46B 1HXYA 2ZG1A 4X6BB 4WW2B 4Q58C 1T0NB 5FKAB 5EU7E 3T3ME 2WIIA 4Q9RL 3QFJE 4Y16C 2OQJB 1UXSB 3EUUA 4D8PA 3JVGA 1DQLH 3BEWA 3IDMB 1IAIH 4M9OA 3GMNA 7FABL 4HWBH 4NRXA 4PJ8D 1T20A 2R1YA 4N0RA 3MGOA 4IS6B 1UH3A 4PR5B 3MOAH 2D0GA 4DEPB 4DVBB 1GH7A 2IH1B 3T2QA 2VC2H 2XG5A 1YNKL 4Y1AD 3EZJB 3KYMB 3JUYA 3Q5YA 2ATKB 1R5WA 1FL6A 4WWID 1WC7B 2C1OA 3LB6D 4C56D 5KS9B 5CLWA 1UKTA 3CDGA 4N0UE 3ZYZA 2NX5E 5DD6A 5DJZA 3S3SA 4BSWB 4HPOL 1UWEL 5HDBE 4OZ4A 4HXAL 3TZVB 1QPXA 4GXVL 3FN0H 4CN4A 1OTTD 3RWEB 3DV6B 2P46B 4LMQI 5C0BD 2WM0A 3G5VB 4CVUA 4MNHB 1C8PA 3IKKA 2ADJB 5HYQB 2VLLB 1KPUB 3VGBA 4J3UA 2DDQL 5DYOA 1GRWA 5ICYA 2ED9A 4H1LG 1PSKH 3DYOA 4QYOA 4YAQB 5CINH 4WENB 1OPGH 1BVKA 2JJSA 3WDHA 1ZEAL 3RGVA 1X7QB 1IL1B 3OB8A 1QSZA 5HHOD 4M7ZB 1A22B 2KBGA 1KC5L 4PJ5E 1D6VH 4LCYB 3S3PA 3FOMA 4DUVA 2XPGA 3WIIH 3Q6GH 1FAIH 1YEEH 4WUUB 5FYJU 12E8L 2YD3A 2XQYG 4K3JL 5DD1H 4ZXBB 1LWRA 1U8NB 3HS0A 3AMLA 15C8H 5IBUB 4PJAA 1WBYA 2IANA 4FQXA 1A64A 1A7QL 4M1GH 4MHHI 2ARWA 3TH4T 5D7LD 2BOCB 3RUGB 3E2HB 3IU3A 1T7VA 1FFPB 1BQSA 2LFGA 2YBRA 4TTDC 2UWEE 4Z7VA 5MI0C 3O4OC 4JFHE 4TN9A 4POUB 1NFIA 5ADPL 2OMBA 5K9KA 3GSNL 4XWOC 1EHNA 3RL2A 5C0JA 1MHCA 4G3YH 1QRNB 3FT2B 1P6AB 5FK9A 2YPKA 1N8ZA 1UQSB 3PGFL 4HEPG 3HKFA 4O5LL 5TJWK 3SE8H 4X7DC 5B8CB 5GXBB 3WFHB 5SWZE 4ZUSA 1JZ3A 1RK0A 3HLAA 2J8HA 5C2UB 2FL5A 3FB7A 2VITA 1MCOL 1NGYA 4YDLC 1RFDL 2VDNH 2XQBL 3GNMH 1CLZH 3LDBC 4O02H 5DQDH 2BOBA 1C7SA 5AD0B 5E9DD 1CLOL 3H9HA 5CSZB 3QQ9D 3D85B 5LVEA 1L6XA 4RIRA 2OL3L 3MA9H 4J1UB 2ZG3A 4GW4A 4U05A 3L5IA 5E6YA 2W65B 3MLZL 4YQXL 2MCPL 3FT4B 4NRYA 3IGAA 2DQEH 3I2CL 3PWPA 4GAJH 5EO9A 4GMTL 4JVUA 3T65B 5IBUG 2CGRH 4JO3L 5D6CB 4LIQH 2A6DB 2VB5A 1DFBL 4AG4H 1HQ4A 3PXJA 3MRNA 4C55A 2HKFL 5DJXA 2NY1B 5FF6B 1BFVL 2IBZX 5TPWL 2WW8A 3X12B 4JRWA 4OFDA 3U0PB 5JW5B 1OAUH 5E2JA 4LNVA 3VGFA 3K7UA 3EDEA 3WBDA 4F7EB 5D4QA 2OXGA 1VACA 3T0DA 2X4QA 5KSAD 3ZLQC 2AP2A 4P5KB 3DXAA 1QLRB 5JHDD 1YNKH 1YEGL 5IQ9B 1DLHA 1CXEA 2NY0B 4M48L 5KSAB 3CLEL 4IIQA 3KYNB 5D7JB 2YRLA 2Z31B 3D85A 1GVIA 3O8XA 2WAHA 5AZEH 3O0RL 5AZ2L 3TT1H 1WSST 4LCWE 3GK8L 5I8CB 4UNUA 5IK3B 2ICEA 3QHTC 2GJ6A 1IQDB 3SDAD 3W0WB 2HVJB 2R15A 1ZLVK 2BK8A 3KPSA 3SCMA 5FO8B 2FHBA 1OF2B 2YXMA 3RA7H 1TLKA 4Y5VA 5DHYB 2BJMH 4S0SD 4XCNA 3BZFA 3RDTB 1BOGA 3NAAL 3GMOB 4IHOA 5D1ZC 2Z31A 3QWOA 3UXFA 4HS8L 4BUHA 1NCCH 3WFZA 2X4QB 1CLCA 1U3HA 1JZ7A 2J88L 4P2OA 4PJDA 3VFSA 5EU4A 3ARFC 3BUTA 4K23H 5CEXA 1Q0YH 5B22A 3KLDA 1JNLH 3UTSA 1RZIA 4JM2F 4NQCE 5JW5A 1B4JH 5DHVB 4R96B 2VKWA 1YDPB 2FJHA 3LN4A 1IC7H 3MRDB 4BZ2H 1NC4B 5C0AE 4ODWA 5D1QA 2H1PH 3IYLW 2AEWA 2X4RB 4J3WA 2D3VA 1UWEH 2IJ0C 5DLML 4Z76A 2WMPA 1AJ7L 1T21B 4X6CF 1CVSC 3DX9B 4O2FA 2UZIH 3BKML 3P0YH 4MX7A 4G6AC 1YYMH 3QQNA 1IILE 1AGBA 3MYZA 5EZOL 4ODSH 5K9QG 4HKBB 3O9WD 3FONB 4S1QH 3GSNH 3VXRD 3QP3A 4WTXA 5DA0B 3W2DH 4M7JH 4NQDE 4FQXB 5F7EL 4P9HL 4OQTA 3C60D 4BZYA 3C8KB 5DO2C 3WDJA 5T3ZE 4HUVA 5I8OH 1C12A 1X44A 3NACL 3U83A 4XMPH 2HT2C 1NH6A 2APVA 3CX5K 3C09C 1IAIM 4BKLA 3BD3A 1K4CB 1NGZB 4JFZH 1U8KA 2C3VB 1MQKH 1FORL 1ADQH 3VG0L 4XHQA 4NWUH 3TZVA 1F4AA 4KI5C 5BW7C 3RGVD 3PXHA 3OKYA 4UTAH 3K8KA 4MYWB 2DB8A 5FB8A 5DD6B 4PGBA 4KZEL 4FA8A 4OF7A 2XV6B 5E5RB 3OXSA 3UTTE 2X4SB 3B43A 4K23L 2R69L 3ZHDA 2CH8A 3MREB 1S7UB 3LRSA 4YC2B 4YFDB 4A6YA 2ERJB 1VKXB 2WSKA 4MCZB 3QXDA 4U1SB 2HFEB 3VXSB 2A38A 1OSPH 1YJDL 4UV7H 5HDQH 5C07B 3IS1X 1CFBA 3GMQB 1XH3B 4YHKH 4GFTB 4OV5A 1UCBH 4YHOH 5INDB 4Z95H 3RX5A 2BNRD 1GOGA 2FX8H 1P9MA 5F6HJ 4PP1C 5JOFB 4JHWL 5FUOL 5I1KH 4ISVA 3LKOB 5DF0A 1UVQB 5BV7C 5F7DA 5LJYH 4OM0H 1AY1H 5C9KA 4M5ZL 5IWLC 4JQVA 4HJJL 4HIJB 4AM0B 2QQLH 1GC1C 4G9FD 3VRLF 5FGCE 1ZLWK 1N5AA 5I17A 1UM5L 5J6HA 2R2HB 1Z9SA 5L9DH 2XWBA 4P2QD 4H0HB 2E8ZA 4NZUL 2JF1A 1MJ7L 3DX8A 2NX5A 5JA8B 1PZUB 3L7FA 4BQBA 1ZT1B 2NXZB 1JUFA 2DS4A 2D03H 2NZIA 1WZMA 5IMOB 4P5TC 4FTVA 4NBXB 1RI8A 3V7MA 4YIQA 4HIHB 4I3RL 3ZYIA 1GCFA 1P5UA 3OAZH 2VKXA 5BVJB 4GRMB 4WW2A 3P9WB 4LLWA 2AJYL 3L95A 3GI9L 2AK4E 2W9LA 5HYSB 1OM3H 4PV8B 2DL2A 2BRRH 1HSAB 1I9IH 5I1HH 3P73A 4OLUL 5I1JL 4WGWB 4OGAD 4K8RD 2RCSH 3MJ8A 4FNLL 3F12B 3O6FC 1HKLL 4UIMA 5IMOA 1I9RH 5FYLL 3PIQB 2QQLL 3G9VA 4LRIC 4NN7B 5EO0B 4B50A 3MGTB 3O3EA 5CJQL 3I75B 3H0TA 5CINL 2JELL 2VXUH 4NDMA 3WS3B 4D9RD 2C4FU 4IS6A 1ZANH 3NBNA 4NKIH 4P23D 4LLYB 5EU6A 2BSSB 3C5ZA 3EJYD 4W6WB 4WUUE 1JGUH 2F9BT 1XF2B 3MXVL 4WTWA 4ONFH 2LU7A 4U1IB 4ZO8A 1G0DA 4PRIB 4HH9B 1II4E 3B5GA 1MCCA 4YO0B 1LO5B 2IBZY 4OCRL 4C54A 1Z3GH 2OR8A 4ZUVB 3WUZA 4GRMA 4JKKA 4LGPB 1ZT1A 4UB0H 5EOCH 1R6VA 1IC4H 2KH2B 3U1SL 4JKWA 5DVNA 3KXFD 4JJHA 4FQ2L 5CEZH 5BRZA 2O93L 3V6OA 1I4FA 3A6BH 5BVJA 1ONQA 2JB5H 5L6YL 5F7KC 3LZFL 4NGHL 3BGFC 1HH6A 4R7DA 2V5RA 4JO2L 3D25B 1FVDA 3LS4L 3QIUD 4UQ3B 1TPXC 1P7HL 3QSKB 3G04A 4UOJA 3R0MA 3VG9C 3RVTD 3LQAC 1DVFC 3QUYA 4IDJL 2ZCHL 3HA0A 5JIHA 1NMCC 2H8PB 4S2SA 4CMMA 5H2BA 1WBZA 5JPMB 1RV6X 1BLNA 3N9GH 4ZD3L 4ZUWB 2QBWA 3NTCH 1U2CA 1JYWA 2VL4A 4ZUTB 1C12B 5T1LA 5ESAB 1NCDH 1JNNL 3CK0H 4LDLB 4KKAD 4E41D 4HEME 3NPSC 4R3SB 5L2JB 4PRHD 1BAFH 4FQQA 4XX1E 2R2BB 4CDHA 5ICXB 5IKCA 2J4WL 4YR6B 3OXSB 2EDYA 3ES6A 5K9OB 1DE4A 1UZ6E 1MLCB 1QYGH 4YHML 4S1QL 1NLDH 3NGBC 2YC1A 3MLTB 3FO9A 2ICWB 1BEYH 3OF6D 4Z95L 4Z0XB 5FCUL 2DICA 4KROC 3AM8C 1CICA 4LQ1A 4EI5A 4MJ6A 3OMZA 1DQLL 1D9KA 1O5DT 5E99L 3PHSA 4GS7B 3EW3B 4FFVC 1EAPB 3RY6A 4O51A 1A4KB 1MI5A 4FFWC 1U93B 4HC1L 5F7HA 1UJ3A 4NQVA 5DJDB 4NUGH 2DF3A 4I0CC 1T6WA 3VDAA 1JHLH 4FMFA 2CIKB 3FB6A 4HLZH 1FYHB 4UT9L 2QKIA 4YPGA 5EZJA 1UXWA 4PJFA 1MCFA 4LCWA 4DGIL 4P99A 1CGTA 4DOHB 2NTFB 4YHZL 5HHOB 2M2DA 4Z7WF 1RIHL 4OBRA 2J2ZA 4Z7OF 3IDNB 4PJ8C 4AH2B 2ZCHH 3MRBB 1QBML 1OQOA 1QBBA 3VXRA 4KRLB 4HWZA 1U91A 5IFJB 1I1FA 3DVFA 5GS0H 4TUKL 1FZMB 1ACYL 2BVTA 2Q6WB 4Y7MA 2VSCA 3FFCE 2AV1B 3TPUB 5ENWA 1JGEA 1MRCL 2EYSB 3GSUA 2VDPL 3ORJA 3R8QA 5D1QB 4PJEE 3HI1B 1NC4A 1OARH 5FGBA 4YEEA 4JPWL 5KZCD 1J0ZA 2YD8A 1L0YA 5B8CC 1FAKT 1KLFA 5GSVA 2VZ1A 3BKJH 4G42A 3WFDL 4DZ8B 1C08A 4KXZH 4OQ1A 3EYOA 3RVXD 5JO5A 2CUHA 4MQ7B 4MAUL 3QNXB 3ROLA 3IS0X 4GAYA 3KPQA 4R4FL 1T5XB 1KCUH 4JM4H 4KRPC 2GTWA 3MBEA 2CJUL 3TNMB 1NMCB 1IGMH 1CFSB 1RIHH 4K3EH 4Z7QE 1EZVX 5A43C 2EDWA 3LKQB 1MRFL 4NQSB 5DD1L 3U0PA 3TV3H 4YXHH 2E8YA 2HVJA 4Y5VB 3FJTA 5C9JB 4JE4B 5C09A 2ARJA 1U0QA 3U30B 2YA1A 1LILA 2IQAA 4KDTC 1U8QA 1RSFA 5F7YC 5DEZA 3R0NA 3RDTA 2FX9L 1RPQA 2HP4A 3UTPD 5TE7H 2DLFH 2EKSB 1OGAD 3TWCH 1F5WA 25C8H 4FQPA 1ZSDA 5ADPH 1T22B 2EIDA 1GXEA 1MREL 3HRPA 5T5FL 3WN5C 1MHHA 4LVNC 4N9OB 4LLMB 1N0LA 1TJHH 3JTSB 1BJMA 1R3HA 4LAJH 3AGVA 2I07B 3VMPA 2LV4A 1MHPL 1YPZB 2RB8A 2OSLB 3V52L 1QOKA 2QR0B 4XGZA 4NHUA 1G7JB 3NZHL 3SDDB 1OAXL 4YHNA 2VLJB 2EXYC 2ZOKB 4BFEA 1YEHH 4MD0A 2VXUL 3MFFA 4G8EB 1WBXA 1WIPA 2AW2A 2HT3D 5IJVA 3F7YB 2YPLD 4E0RB 4BQ9A 3QQ4B 4L4VB 5KS9F 2MWCA 3KPRE 4HCRL 3RTQC 3GJEA 1DCLA 4RGNB 4TSBL 4ZMAT 1KIRA 4PJHF 3RWGB 4OZHB 3VWKB 3NCMA 2HLAA 1CDHA 2C4FT 5FF6A 4RGND 8FABB 1E6OH 3PDDA 4NRYB 1UEYA 2R0LL 1WZLA 1M7IB 3X12A 3VH8G 3ZKMC 1YMHA 2N1KA 3HRZB 4WI8A 1U6AH 1GJIA 4QRRD 4FRWA 5J9PA 2GFBA 2B5IB 4JN2A 4Z77A 4ORZC 4X7SH 2NW3B 5ANMA 4JFDA 3MRNB 1C16B 4JO4L 4E0RA 2X9WA 1HHGA 4NZTH 3W9EA 4Q6IC 5EG6C 3PDOB 1ZVSB 1LE5B 1WUNT 5JTWA 1EMTH 4LCUA 5IT2H 1ZAGA 5L6YH 3FN0L 3EKCA 3O9WB 3DVNA 4G7VL 4X4ME 5JXEC 4F33A 4F2MA 1OTSD 1FNEB 4PJIE 3U9PH 5IV2A 2YXFA 4JO1H 4LSSH 1OW0A 4UQ2A 3NZ8B 3QNYB 5H94B 1NANH 2PW1B 3QIWD 3FB5A 5J11C 2NYYD 4IDJH 2ILLA 3VWKC 1S7VB 2CO6B 3IETB 1XGUA 2DMKA 1KACB 3GSQA 3CSYB 5C0RL 5FM5M 1ERNA 3NTCL 1FNGB 4PUBH 2YPVH 5FA4A 3Q0HA 4EN3C 3QWQB 4NO3B 4UV4H 4J4PA 2P4AB 4BH7A 5DYOB 4NM4H 5E2VH 1V05A 2F54E 4Z7VB 2CLVB 1WQVT 2YPKB 5I75B 2CIKA 5C0CA 5ALCL 4F7MB 5JXAL 2VLKD 2JB6B 4LKCA 1UJ3B 1EEYA 1WBYB 1QG3A 4LCWB 1J7VR 4OCYH 4OM1L 3NCJL 2IAMC 3NFNB 4OQTH 4NBZB 3BHBA 2YBRB 4K8RC 3WHE0 3G6JB 2BY0A 3B83A 3GSWB 4HBCL 4JO1L 4LSSL 4U7SA 3V6OC 5MEPA 4AENB 4PJXE 4S1RH 4PRPE 1VSCA 3MUGB 1XGYH 2YK1H 1W72L 1FIEA 4K07A 4L3EB 3DYMA 3FQNA 1R3KA 3FT2A 5IROC 4OLEA 5E1AB 1YEFL 4PJ9B 5DFVD 5ACZA 1G7MA 5C8JB 1OB1B 2AKRA 2VXSL 3GRWL 1HSBA 4NN6B 3MYJB 1KN4L 4IM8A 4NUJA 1SVZA 1VGEL 3ARGD 4ELME 4HWEH 1I7ZB 4F80A 3JWDL 2X4UB 1WITA 3QXAB 5FIEA 4NJAL 1NMAH 4KHTL 2JCCB 4DGIH 2CUIA 2FGWH 1R24A 4IOIA 1AI1H 3R1GH 1KG0B 4YR6A 1WEJH 1BWWA 1MIEL 1ZA3B 2DN7A 4K3DL 3KPMB 4NP4H 4G8GA 3U4EA 1F02I 4JFQA 1LQSR 3SPVB 5D7IF 1MFAH 4QHKI 5EBWB 1AP2A 1QNZL 4OLVL 3RBGA 1PLGH 3MLTA 3WUWB 4BSWA 5IHZA 4P2YA 1PJ9A 3MCKB 1F90L 1KB5A 2XZCH 5CS7A 1JZ4A 2A6JB 4ZQKA 1NGXB 1IKNA 5CCKH 3QUYD 5HGAB 3QEGH 4OTXH 4HUKB 2B0SL 5BMFL 2H9GA 4K9EL 4MAYA 4QOKA 4EI5B 4JY5H 3WKMH 4WO4A 1KN2H 3AY4A 1R3LB 4MCYB 4G5ZL 2DWEB 5KOMC 3B4NA 4HXBL 3FO9B 3LPFA 4I3SH 2GIYA 4Y1AA 5HDBF 2VR9A 3SE3C 4QXUL 1J9CT 1GAFL 5MHSE 3H9YA 4KJPD 4Y2DA 4YO0A 3AREA 1F3RB 1FCCA 5CKGA 5D5MF 3LKNB 3T09A 4JPVL 1KJ3H 3UTTD 2BVPB 2D7MA 1A3RH 3NIDE 1FNFA 4EJ1C 5DQJA 1DUZA 4U1GB 5D1ZB 2IGFL 4QRTB 3L7EA 3PWJA 2D9QB 3RIFF 3CVHL 4I4WA 5KSBF 3QUXD 5I2IA 4XAKE 3ZDYF 5DJ6A 3CFJA 4P57A 1SJEA 4FQCH 1HNGA 4MNQD 4JQXA 4OCNC 4DGVH 2EE3A 5EU3B 1IQWL 2W0PA 3BPNC 3V95A 1MEXL 4M43L 4LLYA 1N7MH 1UCBL 5DUPL 4UDUB 5IT2L 1J8HB 3C2SA 4JDZA 3UTQB 1Q8MA 2BY2A 4YGVB 3CFDA 4R7DB 3ULUL 1UADC 3LIZH 4S10A 1G9MC 2P5WE 4LLDB 3SDDC 4K7PH 5D1XC 4EKXA 1RZJH 3FQUB 2E9IA 4LLVA 4PLKC 1NDGA 1AKJB 1ZS8B 3UEZA 5F7UA 5D7IB 5EA0H 3QG7H 5IW1A 4C59B 2VISB 4HFUH 1AD0A 3OAZK 2DIBA 4C57C 1R5IA 3E3QE 1RULH 4I2XE 3VG9B 3RVWD 1E6OL 2WANA 2OK0L 3AS1A 4H26A 2I27N 4PGJA 3W5NA 4Y1AE 5A2LH 1QSFE 2DYPB 1PW3A 1CR9L 4UIMB 3L7EB 2OL3A 5J6GA 4PJ7A 4ETQB 4HKZA 2FHCA 3GKWL 3TBSB 4TUOB 4F8QA 2NX5D 3I3EA 5IFHH 1RZGB 3O4OB 4Y4FA 4KI1A 5CJOH 2EZ0D 1MCQA 3MNVA 3H9SE 4LVOB 4NPYA 5L8KB 2NX5B 3HC3H 3RNQB 3MRCB 4P3DB 2FGZA 4AIOA 3VXTA 4NFCA 4RRPA 5SWZA 3WN5A 5CMAB 4I4WB 1QFWH 1YYML 4OD3L 3EYUL 3ALWA 4F15B 5K33A 4HG4K 4GW1A 1P4BH 4KGLA 2XY2A 4XVTL 4BYHA 1IC5L 4QHNB 4CN6A 3MRIA 5ISZD 4H1LA 3TCLA 2X44D 1U9KA 1OW0C 1TVHA 3MUZ1 1H8SA 2KZ1B 1Q0XL 4L8SA 2QQNH 4PJ5D 1I1AC 4KTDL 4U6YB 2PTTB 3C6LA 2YEZA 4NQEA 2W0KA 1IM3A 1S7WA 4KMTH 1GC1H 2MQ0A 3QDGA 3U4EB 1JHKH 4G9DA 3RWDA 5DEGA 4O9HH 3R8BB 3VW3H 3MREA 1G7MB 4HPOH 4YFLF 2VR5A 4LVEA 2PUQT 4KZDH 2E7MA 3WN5B 4U0RC 1K4CA 1NGZA 1HHKB 3S97C 4M03A 4ACPA 2HFEA 2UZXB 1QSFA 2NY3B 3BD5A 3CU1A 3DUSB 1BQHA 2HT3C 3GSOB 4Y4FB 3BVNA 4NO2B 3LN5A 3STZA 2BDNH 2H32B 3BGFB 3O2DH 4OB5L 4JFOB 4MA7H 1LP9B 3O11B 5CIPH 4P59H 4Y5XC 3DXAE 2QQNL 4HX1A 3VJ6B 3D0VA 3KPRA 2D31A 4KJWC 1BM3L 1CE1H 1DL7L 5JDSA 5IEKA 1IAOB 5IWLA 4K3HA 2DLTA 3PP3K 4HC1A 3VXUE 4ZAKD 3QI9D 4XXCC 4GQ9L 3TT3H 2Y23A 4Q9CA 3GKZA 4XVTH 5H8DA 3R1GL 3HAEA 4QHMB 3L9RB 3X3GH 4LBEA 4JFDE 5I66A 4XP5L 1IGFL 1RZIB 1EBAA 4ZO7A 1FYTD 3CPLB 2G5RA 5TQ2L 5J89A 4W68A 5FA4B 3L3DA 1CZ8H 4I3RH 1YEKL 2AJZA 1SVCP 4KROD 4O2FB 2NPLX 3EYFA 4HUMB 1LNUB 3BZDA 4RRPG 1XAUA 4S1SH 1HINL 4XCYA 3G5XB 2EIBA 5I1CH 4N0YL 3W9DA 2FB4H 2ZUTA 5E7FA 4FS0A 1OSZA 4U0RB 1CE6A 2VH5L 4G8IA 2XKUA 4P4KA 4RGMB 3OZ9L 3UTSE 4QRTA 4LPWA 3TBYA 3CMGA 1FV1A 1FN4A 1PG7W 1U8HA 1M05B 5F9WB 3QDJA 4F7TB 3NCEB 5J3HD 3TA3B 5I9QC 4NUGL 4ZDHA 4YDVB 1NEZG 1CXHA 4IIQB 5IBLD 1KGCE 4QXTA 5BZDB 2DBLH 1ZHNB 4N8VA 4ZXBD 3V4PH 2C26A 4Q9BA 3B9DA 1I1AB 3T0VA 1UEMA 3E6FB 4Y2DC 1XGPB 1G7PA 2WNGA 3IRZA 3LQAH 3SDCC 1FH5H 2BNQB 2MJWA 4HMDA 3VWKD 3BKYH 4PUBL 3WFCH 2XZZA 5DGQA 3P0YL 5JHDB 3F5WB 5D2NA 2J8OA 3VXUA 1QHOA 1QFUL 2DWDA 1UKQA 1MCOH 5FGSA 1F6AB 3IFOB 1FFRA 1I7TB 1PQZB 5BOPA 3KWWA 2FSEA 4IRZL 4LHUA 1NGXA 3KYAA 3L1OH 3NA9L 1ES0B 2VH5H 2VDML 3BP4B 1LD9B 1JYVA 1YEJL 3CX5J 2NW2A 3QIBC 3HUJA 3HR5A 2J8UB 3RVTC 1RMFH 1UM4H 1WV7T 5CJ8A 3OXRB 5E70A 1GGBH 5JORA 2WIMA 4MSWB 1UM6L 4GRLB 1CN4A 3S7GA 3VRJA 1UB5B 3O6KH 5I0DA 2PO6B 1B6DA 2BY3A 1OSZB 3WL9A 3HG1E 3QDAA 4CMHC 3MRGB 4ZFGL 4KUCF 1A7NL 1JZ6A 4Z7WA 1QFUH 4YH6A 5EOQH 1M7XA 1YEEL 3CXHK 4YDJB 3QHFL 2X2YA 5C0EA 4K2UH 3VFGL 2ENSA 2Y6SC 5GS2D 4RQQB 1E4KA 1XGPA 5H37H 5ITBL 5KVFH 3VGHA 3BUYB 2DLFL 1J05B 3H9SD 2GW5A 3HR5B 3MODL 4KY1H 2Z91B 1HKLH 4JANA 1ZV5A 4I18A 3LEVH 3PWPB 3E6HB 5IVZA 4PJCF 5A3IC 3EYUH 1TCMA 2KUTA 5C0CB 3QT2A 3HNSL 4MD0B 1J0YA 3LKSB 1HZHH 3FRPG 1H5BA 2VQ1B 4OZIE 4JG0H 3B8YA 5DJ2B 2BNRE 1CXFA 1OP3K 3MLWL 1T1XA 3JV4B 1LE9B 3VWJB 1BM3H 2RAMA 4DCQB 3WHE1 4P5TD 4KRNA 2JJSC 1WISA 5FYKE 1W8OA 3DGGB 3FMGL 2Z31D 1RMFL 1UM4L 1KJMA 2BY1A 3PDGA 3FZUD 3FB6B 3FFDB 1AQKL 3CPLA 2ICES 1FNSH 3BGMB 5I30L 3HR6A 3MRJA 1MELA 3M1BA 3RGVB 5IV2B 4OLWL 5L9DL 1XR9A 4JZJA 1KNOB 1UB6A 1XZ0A 2P7TA 3NGBB 4JFED 2JE8A 3V79C 1D5ZB 3GUTB 4XAKD 1LO0H 4NC1E 3TPUA 2OR9L 4CW1A 1RK0B 2PN5A 4HQQL 4JREB 1J11A 4OZFB 4OF3A 2P5WA 5KN5A 4DKAA 2GFBB 1YECH 2MSPA 4LCCC 5EZLA 4JPWH 4U1KB 3D39A 3QDMA 4OZGB 2ZUWA 5CILH 4GRWF 1A6ZA 1KLUA 3T0EB 3TN0B 4MQ7A 4TPRH 4I9WE 3MOBH 5F89B 3X13A 1MQ8A 1RHHB 1YQVL 2UUDH 5C0BA 1I1YB 3KYOA 5SWZD 1J86A 3H7LA 4QRSB 4ZUTA 5T1LB 3IU3B 4HMEA 5MENB 2EDBA 2VLJE 3HMXA 4NZDA 4OZIA 4ZFOB 5E4EB 3VFPA 3CFBB 2BFVH 2PYEA 3OKLB 1YMMD 3CFIC 4LVOC 2R1YB 5GHWH 3DO3A 4U49A 1QYGL 4JFZL 1MWAA 4EXPX 2OR9H 3R06B 5HGBB 3QG6B 4XTRD 3DETC 3UPRA 5SX4H 3RVWC 3DV6A 1U42A 3TBTB 1GGCL 5M95B 5EUOE 3LS4H 3OWEA 1GGTA 1KB5L 1J87A 2I25N 5CILL 1DVFD 3MPCA 1AD0B 5DHVH 5ICXA 4F9LC 2FBJH 2OS7A 4RAHA 4CRPA 4LLUA 4ODVH 1HHKA 5EIIA 2BVQB 3SDXE 1A4KA 1MI5B 1KPVB 1XF4B 3MUHL 4QTHB 3BYTA 5C9JA 4ZAKA 2CR6A 5IFAL 4DN4L 2VLRD 3MRFA 4LLDA 1S9VA 4UT9H 4LCIL 3GJFA 4LARL 2WINB 1LDSA 3VWJC 5TH2A 1JNJA 2HFGH 2AQ2A 2APTA 4Z0XA 1CD1A 2A6IA 4M1CC 4XWGL 1YEHL 3OKOB 1JPFA 4L8DA 4XNMB 5EU6B 3RVUD 3ILQC 1SEBB 5CSGA 3HNVL 4TSBH 3WSQH 1DBJH 1ORSB 1VFUA 1F8TL 4TQEH 3RNQA 3WIIL 5D7JC 2N7AA 3RWCA 1QSFD 1TENA 3ARGC 5EO0A 4BZ1L 1IMHC 5E7BA 2DQUL 5JW4R 1KYOK 5DLMH 1F11A 3J7HA 3BPCA 3I02B 5IW1B 5D1ZD 3TESA 3N1MC 2ORBL 2MMXA 1CFNA 4HCRA 4WI3A 4HKJA 3MRPB 4R4ND 5BV7H 2F8XC 4UINH 1G0YR 4CUCA 2V7NA 3PHOA 1EK3A 3UDWA 3TYGL 3P4OA 2R0ZL 4WU7A 1BBDL 2VABB 5E8NB 4UMGA 2EDEA 4LP5A 3UZEA 3V0VB 4XWGH 4R2GC 1HQRB 4I5BB 1GAFH 1S9WA 5IMMA 3RFZC 1WFOA 5JIPA 4ZS6C 5GGRB 2F54B 1U3JA 1TZGH 3IXAB 4L8BB 3N1QC 1QR4A 3SOBH 3VRIA 4G9FE 2NY4C 5BO1L 5EU3A 3DROA 5IR1B 3QDGB 1NJ9B 3DX6B 3GHEL 3WXVH 1OQXA 3S4SB 1F6LL 2I5YH 1ZGLP 4RGOH 3DWTA 2CLRA 4XVJH 2ORBH 5DK2B 5IOPA 2PTTA 3ULVH 1G7HA 4TVSa 1YYLH 3UTTA 1TTUA 3V5HA 1CFNB 1CGVA 4HIJA 4AM0A 2XKNA 3CVIL 4HIHA 3IDGB 5E2WL 4Q2ZA 4POYA 5TQ0H 2ZUVA 5EOTB 5T1KA 1SJEB 1ZHKB 1JWSA 4HUUA 3LEYH 5GRVL 4NQXA 4OF0A 2Q87A 3ARRA 4LKXA 2ED8A 2FECL 1H5BC 3RU8L 3OAUH 1CICC 5T33H 5C8JA 3VXOA 1Z0MA 5SWSB 4R6UA 2EEAA 4I0KA 3LAFA 4PY8J 1MFEL 1BFTA 1S7RA 2ESVA 3BO8A 4O00A 3ULVF 1FC1A 1NCDL 3BHBB 3TZVC 1U8IB 3GHBH 3TBVA 4LK4A 3D0LA 4XPAL 3QNZB 5IMMB 4LL9A 1F4WL 1ZLUK 5GJTL 1WWWX 3GSVA 4H0GA 1YEGH 4JO4H 4XNUH 4HKZB 2VTFA 4QRSA 5E9DE 1U8PB 3CH8A 2BERA 4MNQA 3MACL 4YX2L 4XHJD 1GIGH 4D9QD 5JQ6H 4EOWH 2E5EA 3VDCA 4KVCH 3F7QA 4ZFOA 5T3XH 3QIUB 2I9TA 2W60A 1FPTH 1O7SA 3HFMH 4JPIB 5CZVH 4H88H 3SY0B 3A0OA 1DN2A 1G84A 1CU4H 1DQDH 5IB3A 3UPRB 1YEJH 1BIIB 3QEQA 4F15C 4Y5YB 3QCTH 1FSKB 4ODHL 4HH9A 3QNYA 5DC0A 1NCBH 4R4BA 4PJ8B 1RZ7L 2UV3A 3TA3D 1SEBA 1F97A 5EN2A 4RX4D 5I8EB 3IFPB 3M1BB 2X9XA 4ODBD 1SHMA 2EXYD 1ZA6A 4ERSH 1TZIB 3CFJB 5FECA 4P2RE 4CVWA 5C0AA 2KDGA 5CUSH 4QTIL 2QSCL 1BQLL 2F74B 3O2WH 2MFNA 4OSUH 2VIRB 2PYED 1J0HA 2J6EL 1QHPA 3MLRH 1QLEH 4ZAKB 3TN0A 3E8UL 2IF7A 2FATL 1D5XA 3PV6B 3I6GA 4F7MA 5E6IC 4AMKL 2EH8L 1SY6A 1U92A 2C5DC 3ABZA 3QH3A 4R96A 3ET9F 1GGCH 1WF5A 4POZC 3EGSA 3BH9B 5FYJH 2AV7B 3T0BA 2OJZL 4F57H 1T80A 3FQXA 1AO7E 5HYSA 1WGOA 2HWZH 3MLPA 1JMXA 1MCPH 3QHZL 5IMKB 5EU5B 3D39D 4Q7DA 1FNLA 2R0ZH 5DURB 4CN1A 3LQMA 2ZCKL 4X8XA 4MS8D 5EWIL 1TIUA 3SJVB 4G7YH 5GS2H 3O6ML 5LBSH 1FRGH 3O6FA 3UPCA 3BIBX 1ZHBB 1NBVH 3MLVH 1JGVH 4J8RB 3IF1B 1NEZA 3MV11 1CK0H 3NFPB 4MDIA 3X14B 1R3HB 3QA3B 4NM4L 5L7XH 1RJLA 4YXKL 3BN9D 3H7BB 5JPNA 3RX7A 1Q9LA 4AT6A 4V2CB 5DT1H 1PAMA 3GEWB 5J9PB 4HIXH 5ALBH 4DOHE 3I50H 1J05A 4POZD 5HHPA 2NY1C 3SPVA 3WEXB 3GMOA 2UWEB 1H3PL 1NAML 1R3JA 1H5BB 1CBVH 4OT1L 4F9PC 3UC0H 3BJ91 2MCPH 4KJQD 4NO0D 1R24B 1TJIH 1XH3A 3TIDB 4MVBC 1KJ2H 2X9YA 1W2KT 4XP6H 4ENED 3D39E 4DGYH 3LB6C 2J6EH 4RMSA 4D2NA 5I0ZA 2FATH 3VFNB 4MB5A 2HKFH 1HEZA 4F7CB 1QRND 3MRHA 3QO1A 5HPMB 4LEXL 2R23A 3QDHA 3JXAA 4CU6A 4YHKL 3GMMB 3WNOA 3EFFA 3X14A 4JVPA 2IBBA 4NJAH 4WDIB 1R3JB 3MJ9L 2VXTH 3IF1A 5GRYA 2A6KB 1FLTX 1JF1A 3QXWA 1FG9C 3BGMA 4APQA 3D18A 2XY1A 5I1KL 5HGHA 2BOBB 2FJGB 4G8GE 1XF5A 4N9GB 2HH0H 5HYJE 1JWUB 4ALAH 1NANI 4JFEA 2VXSH 1I8LC 3BISA 4ONGL 3GO1L 1B9ZA 1H3PH 2FZ3A 2LU3A 1SMAA 5E9DB 4XPGH 2GQHA 1TJGL 4H1LH 1FJ1A 1T2XA 2YD1A 3DETD 4FXKA 5CZXC 3KPNB 4HPYL 4MSWA 4Q0XH 1NMAL 4KHTH 4D0DA 5EBGA 1UQSA 1JRHL 5L2KE 1ZLVH 1EGJH 2V5TA 5JQ6L 2O5XL 1KN2L 1CF8H 4TVPE 3BT2L 4LHUG 5HYSG 1Q38A 3DLQR 3GSQB 5DFWH 3IGAB 3EDFA 3BIKB 3MRLB 3QUMB 4GXUN 4LPYA 2VZSA 5MEQB 2NY1D 4PJGB 5HHQA 4GXUM 4RX4A 4YNYA 1T1YA 4X6CE 1JF1B 3V4UH 4GBXD 4MNGA 3BKJL 3WFDH 2FR4B 2EYTA 4GKSB 4OJFH 5DWUH 5I8EA 2OMNA 1XIWB 3VGEA 1JMZA 3VXSD 3EDJA 4JLRB 4LHUD 4ALAL 1I8KA 5EBMA 5FYLH 4XB8A 2XTJD 1HEZB 3DPBA 2DQCH 3EYVA 5DUML 3SO3C 2IGFH 3MNWB 2NR6C 1LK2A 3CC5A 5MERB 3WE6A 3VDBA 1UJ3C 2HFTA 4U1HA 1SMOA 1EA9C 4M9PA 1BIIA 3VXUD 4BQ6A 2WUBH 1LEGB 3I9GL 3MRLA 1Z5LB 5JIKA 3EYFB 4N8CH 3P0GB 3P30H 4AK1A 2W38A 2GJZA 1AD9B 1J18A 4OSUL 3GNML 4NCDA 1A14H 3PNWB 3SKJL 1K6QH 1QRNA 2NTFA 3WSQL 4DQOL 4G9FB 5B3JF 1KELH 1G6RB 4JFEE 2R8SH 3PWVB 2F74A 2QKIB 4U6VH 1JI2A 1VFMA 1V8HA 1LEKA 1ZA6B 3TFKD 3CXHJ 4OV6F 2BHYA 1K85A 4JFXA 4NQUA 4RSVA 4YQXH 1XGYL 2E7LC 2DDQH 5HVFB 1T1ZB 3ARBA 4ZPTA 4Y19B 3D0LB 4J7RA 4Q74A 4RMWA 3OPZL 3MV9B 1P7QD 3PHQA 1YPZE 4NKDB 1RZ8A 5DUBB 4X4YB 5B8CA 3MC0A 4AIZA 2Z8WC 3DIFA 2VERN 3A6BL 3BO8B 1A5FH 1EJOL 1CGUA 1D6VL 1Z6JT 1KF9B 3UROR 1FBIH 4X5WA 4U6YA 5DS8B 5BRZD 3RAJH 1RUMH 5DEFB 1NFIB 4L8SB 3ARYA 2JCCF 3MUY1 1A4JB 3GMLB 1ZHNA 2CMRL 2N56A 2R4SH 1Q9OB 5DMGD 3T0ED 2Q8BL 2WUCH 1H3GA 4K3DH 4HIXL 1DBBH 5ALBL 1K4DB 4X6FA 5HHXL 3TIDA 1IAKA 2R1XB 1DE4B 4KV5E 5C3LD 1VGEH 4JKMA 4XP9L 3T2NH 3L3JA 3C9NB 4XNYL 3IFLL 1AGDB 2NR6D 2WK2A 1BVLA 4KDTA 1JTPA 4XP6L 4LAQH 3GKWH 2D0FA 2AJXL 1KCRH 1UC6A 4NHCL 4I1NB 1A5FL 1EJOH 3MJGX 2PTVA 1NLDL 5ETUB 4WNQB 4CVXA 1BVKB 4KRMB 4I48A 3D3VA 1G7QB 1IEBA 1MI5E 4XPTL 1R5WB 3ULUC 1AGFB 1HCFX 3H3PL 3B9KA 3PIQA 1X4ZA 1LO3H 2WBWB 4MA8L 1H3TA 2VL5A 3EJJX 3RY5A 3IDIB 3EO1B 1FHGA 2DMCA 2C3XA 4FXGA 2G5BA 2KZWA 1CICD 5F93C 4FQLH 4CMHB 1A7RL 3CVHA 3VGDA 1FFQA 4A6YH 4G5ZH 1UACL 1BF8A 2X1OA 4M1DL 4PRIA 4N1HB 2GK2A 3KLSA 1NJ9A 4MDJA 3I6GB 5HHOA 5HPOA 4EDXA 2Q8BH 5IM7B 4URTB 3VXMD 2YUWA 5GGRY 4P46C 5DMKA 4OUOA 4OD1L 3RDTC 4H26B 5ITBH 3MACH 4YX2H 2XXMB 1KIPA 1L7TL 5CP7A 2F54A 4OZFG 4E41A 1EJ6A 4R8WL 1FE8L 4K94C 5KW9L 1CG9A 1ZKAA 4F58H 4EDWL 5EZOH 4LGSB 5ESQB 5CZVL 4JY6B 1ORQA 3C5SA 4WRLA 1FIGH 3KJ4C 1IQWH 1E28A 1KLGA 4DZBA 4Y16A 1DSFH 3LKNA 4PRPA 3MOAL 1IEHA 2VSDA 1JFQH 1IBGH 1RZKH 2LABA 3LDBB 1RZ7H 4NO5A 4Y16D 4TSCL 3UJTH 3GIVA 2DQTL 2DTML 4ONFL 1TJGH 1NMBH 1N0XH 2FEEI 5T1DL 5HVWA 3MCG1 1F8TH 2Y1VA 3LV3B 3EYQC 3QULA 4TQEL 3WD5L 3FCTA 5I1DB 2ZKHH 4ERSL 5BQ7B 3CCHB 3L7FB 4QOKB 2IAMD 2F54D 1UZ8A 5CHNB 1IGIH 2N4IA 3KPTA 3KDMA 4ZUWA 1FZOB 6CGTA 4MAYD 1BECA 1P4IL 1OAYH 1P7QA 4HV8A 4NRZB 3DIFB 1W0VB 4RGMC 2AXFB 5DQ9A 3HPLB 5JZ7D 2OP4H 4BFIB 1PYWB 1VFOA 4N5EC 2XZAL 4Y2OA 3T2PA 5ILTL 2BZDA 5DWUL 1UZ6F 3CDGB 1QSEE 5DD0H 1QO3B 4GJTB 1W72A 2P8PB 1OTTC 5IVXF 2C3HA 1CFQB 5D1ZA 3S34L 3HMWH 4YHIB 3C8KA 2HTLD 4LSPH 5C0FB 1M7DB 3X13B 3PWVA 4G8GD 3HCVA 1CDJA 4X5LA 5D9SB 1YUHB 3LV3A 4G8GB 3QXDB 2HFFB 4U6XA 1Q9OA 3BN3B 2LTQC 4K3JH 4P49A 2C9AA 1ZVYA 2H1PL 2XNAA 4RFNB 4JPVH 3LN9A 1ITBB 1S7UA 3LRSB 2VWEE 1XF1A 1SEQH 2QADB 1W72B 2P8PA 3RY4A 1A8JH 5LCVH 5ANME 2CXGA 1JK8A 2VN7A 4U6VL 4L5FH 4W6YB 4OD2A 2DAVA 2H9GB 3KR3L 3PWUB 4N5UA 4OAWA 5LQBL 1QKZH 2AXGB 1AFVL 4ZOBA 1DQJA 1ZGLA 3O0RH 2EYTB 2MQCA 2A6JA 1MHEB 5C07A 4PG9B 5DDHA 1S9YA 5F8QC 3PGCB 1I9IL 3WLBA 4MCZA 3BPOC 4WI2A 2VUYA 5DURD 3BW9B 3SGKC 1VKXA 4XPTH 5DJ0A 2CXKA 2IADA 3F8UB 1NCWH 4Q6YA 3VWJA 3MJ9A 4M5YL 2F5AL 3PQYB 1CDCA 3ULSB 4G80A 3RWJA 4IRSC 4P9ML 3L3OB 2VDLL 3P9MA 4PJCE 2X09A 4JG1L 3O6KL 2APWA 3KPPB 2YOCA 4EI6B 2R0WL 4P2RD 3DGGA 2YWZA 3W11C 4L8CB 4XP5H 2AEQH 1PX3A 4BA8A 5JHDE 4LKCB 3HE6C 5GGVL 1FL3B 5L2KA 1INEH 4KHXL 1JGUL 1BFOA 2X4PB 2XG4A 1UB6B 1XZ0B 1EHXA 4XXDB 2BNQE 1FZKB 2WP3O 3TO4B 1XT5A 4L4VD 3ARED 1AFVH 4P9HC 1JHTA 1U8LA 1JNHA 1T5WA 5TF1L 6FABL 3THML 2J5LB 5MEPB 3RX8A 4WFHD 3GMMA 2P49B 5KVGH 1Z0NA 4NNYA 3MLWH 3UBXI 4JHWH 4XC3H 5FUOH 3QDMD 1CU4L 1ZLWH 3UDWC 3WNNA 3RZCA 1A2YA 4MD4B 4Z7UB 5I1AA 2GSIB 3QPQD 1HOCA 2GCYA 32C2B 4Y5XB 4OZGA 2YRPA 4FXKB 4OZHA 1MY5A 4WHYG 5ACMA 5C07E 1R0AL 3HRZA 1X5ZA 1JFQL 1URLA 3GJEB 2LQRA 2JCCA 4M61B 4K9EC 2Q7YB 4JZOA 1U8OB 4TRPH 1L7IH 3WXWL 2F58H 3AREC 3BH8A 2NW2B 5TDOB 1G6RH 3UTOA 4JFDB 4L4TD 1PG7X 4WV1A 4W70A 4XAWH 2GJ6D 3FMGH 1IEBB 1CXKA 1K2DB 3S4SG 4KROB 4P9MH 1FNEA 4PJHE 4OGYL 4YJZL 4OIIL 3REWB 3MRKA 2P5ED 5I8CA 3NA9H 4K7PY 5F71A 1CI5A 5M94B 2EKJA 1L7TH 3ZE1E 4P46A 5IVXA 1I9JH 5JR1H 1E27A 4PV9A 2P5EB 3KYNA 4KKAC 2W9EL 1EO8L 1HDMB 3TO2A 4GAFB 3W9EB 1U2HA 5AYQA 1IZKA 4G8FA 2OZ4A 3U2SA 1DQMH 3S5LG 5C0BE 5C0NC 2QHRH 1QD0A 4FFVD 2AJ3B 4LASH 5J06A 1NCTA 4JN2B 4NYLB 1L0QA 4FFWD 5D72H 3ZSSA 4HSQA 4WFGD 3S36L 4U1JA 2XWJA 2VE6A 4KWUA 3TYFB 3KVQA 3AXLA 2ICWI 3G6AB 5MI0B 4XPHH 1PEWA 2F58L 3RZCB 2Y5EA 5D2LB 3MBXH 3V5DA 3H42L 4G8IB 4LSRL 5DVKA 5JPNB 3NABL 1A47A 5ID1A 4HAGA 4G8FB 4PJ9D 5CGMA 4GLRI 3QNXA 4NZRH 1BFSA 4YDVA 1DBBL 3C87A 4LNRB 4KUZL 3W82A 4PGDB 2O61B 1NEUA 4XPBL 3PABB 3DBXA 4ZODA 1FYTA 3T4YB 3CDFA 3ZDYE 2P7TB 5EPMA 4JZJB 1Q0YL 5B39B 1QLFA 1BGXH 3ARWA 4HUXA 1Q72L 5DVOA 4JQIL 2VAJA 1HQ4B 1WZKA 35C8H 3GIZH 3GGWA 4N8PA 3QR2A 1GIGL 2DIAA 4WTZG 3QIWA 3FFCD 3QFJB 3QJFA 3T65A 1CFSA 4HAFA 1J1OH 3O4LB 2XWTB 1IE5A 3AMKA 3ARDC 1CL7I 4ZTOH 4RNRA 3ILQD 3TIEB 4FFZL 5J4MA 1IEAA 3SQOL 3AXLB 3BPLC 3PV7A 3LEVL 5I66B 5C2BH 3L5HA 3W5MA 4JFPB 5HDLA 4HX1B 3PJSA 1A0QL 4NYLA 2IEPA 4RFEA 1JIBA 1RHFA 3INUL 2XXCB 4LHUB 4JHZA 3W0WA 4PTTB 1MRDL 5DZLA 1NKOA 4UT6H 4LQFL 5IK3A 2P45B 5GGVH 2W91A 2IAND 2O61A 1DN0A 1XF3B 1YMMB 4NKIL 1T83A 4NQVB 2OSLA 3V6ZA 1DANU 1LK3L 1TPXB 3RVVC 4E41E 1QKZL 1QSVA 4NT6B 3CFKA 5MEOA 4QHMA 4OCXL 4QXTB 2VR4A 2E7HA 5C0DA 4PR5A 5GGVY 4QKXB 4ZFZB 3VXRB 3DMMB 3CD4A 3GSRB 4LPUA 1A9EB 4Y5XA 3HUJE 2Q1EA 2XTLA 3QNZA 4MXWL 5HHPB 2K7PA 3KNBB 4JG1H 2VLRB 4TNVK 1CFTA 4YBLB 3NCCB 3NA4A 1F45A 1ZK9A 3HI6L 4XX1G 1Q9LB 4XVUD 4WWKA 2GUOB 4JKPH 1TETL 3IJHA 2IH3A 4I77L 5HI4C 4LFHG 3SKJH 3SDCA 1C7TA 2OJEA 3K1DA 5FO9A 2R4RH 3RKDD 2GYSA 5D5ME 5KAQG 5CBEA 1ZHBA 4F9PA 4LOUC 4FQQB 4UBDD 2A9NH 3IKCA 4NQCA 3U7WL 2Y25A 2JIXB 1B2WH 5ESVA 1DJSA 1OAZL 3EYQD 4PRDA 5D8JL 4KY1L 1QSEA 3MGOB 5CGYD 1NBYB 2H8PA 1SYVA 2V7NB 3U36A 4UIKH 1ZHLA 4Y4KC 3ULSA 5ILTH 1AR1C 2Y7QB 2PW2B 3CVIH 4G7VH 2B1AH 3A6OA 3ARQA 5DXWA 3TBSA 3ARGB 1KB5H 2V5SA 2BSSA 2X5PA 4XMPL 2CDFB 3BW9A 4O5LH 1MLBA 2YA0A 3QPXL 3WS3A 2LE9A 3KPPA 3C5ZD 1J5OL 4FP8L 4P3DA 1A6VH 2BOCA 2ITDB 2V5MA 5ISZB 4AMKH 1IGYB 1A3RL 3D5OF 3RHWK 1JHTB 4NPYB 1FO0B 3PL6B 2R9HD 5A2JH 4YE4L 3L3DB 1VENA 3P0VL 3H0TB 5IG7A 1XIWC 4XPAH 4ZFFB 4PJ5B 4MWFA 4FQCL 5EU5A 5L2KD 3U1SH 1A6PA 1MWAL 3K4DA 4XCEA 3WKNA 1WT5A 3QEQE 3RWFB 5HGGS 3QULB 3BP6B 3ARFB 2CKBH 3O6MH 5LBSL 4MB4A 4XVSL 1INDL 1DQQA 4MGXA 5D5MA 1MSPA 3NZHH 4IRSD 4JFFE 4U6XB 3OKNB 4EI5D 1A7BA 4XH2B 1DEDA 3RZCC 1P1ZA 1PY9A 3ZZ1A 1XCQA 2VL5B 5TE4L 4IRSB 5TGBB 4J3VA 3UBXA 3JZ7A 4YXKH 1MNUL 3UZQA 2E3VA 4H88L 4PJ5A 4KTEL 2QHLA 7FABH 2BHZA 1D5IH 1NBQA 2A74B 2HRPL 3FQRA 5KVEL 4U6TA 4L29A 2BVPA 1MIML 3C6SA 2XRAH 2FLBT 3UJJH 4OAWB 5JNYA 4Z7UE 2L7UA 4DTGL 2XI9A 1NFDF 5D2NE 2XWBB 4KUZH 4PJAE 3G04B 4KK8D 2WBJB 4HFWB 3HAEG 3I3DA 1MCPL 3VXOB 3D69A 2PYEE 4MCYA 3FN3A 3QEQD 1SY6L 1JGDA 1UVQA 2X4OB 5GISH 1TZGL 3DVGB 4QWWC 3OX8A 5JIIA 1MFAL 1P1ZB 2BRQA 3D48R 3C8HA 2G9HA 5F7NC 1S8DB 4M7ZC 1A4JA 1TZHA 2B1HH 3ALXA 2B2XH 5I1JH 5LXGL 1QBAA 5T33L 4X9BA 4YHYC 5F21B 1GOFA 4YIQB 2H2SD 5AYUH 4PPTA 2VDOL 2WWMC 4HC1H 5KOVC 5C0RH 5HI5D 4TOYL 1T04A 4TNWF 1INDH 2YWYA 1INQB 3SDXA 5J1AA 4X7EC 3PQYD 4Z7WE 4M3JA 1Q0XH 3IU4L 4QF1A 1GPOH 4TTDD 2XYCA 1T1ZA 1U3ZA 1A7OL 4JFYB 4XNUL 3D2UA 4OCWH 3ZE0F 5GGRA 3QQ9C 2OZ4L 3LOWA 2SEBB 4KMTL 4HUVB 1AP2B 1ZT7A 3MNVB 3MYJA 5HHME 1KEGH 4MA3A 5CBAA 1XR8A 1BD2B 3BEVB 1C5CL 3PWLA 4LPTA 4I0PB 4PRHE 4IOIB 2W9DL 1ZHLB 1OT1A 2FECI 2NCMA 4XBPA 4Y5YC 5E0QA 1PKOA 1QP1A 5E8EB 3SE4A 3BFOA 5E2TL 1CL7H 1NBYA 2FHFA 3F7VA 2BNRA 5F1IB 4P4RA 4UNTA 5EZIH 3V0AC 4A6YB 4E9LA 3EO1A 3ARDA 1T3FB 3RIFK 2Q86A 4I18B 2NYYC 4JLRA 5DFTA 5D72L 4WHTA 3OR7A 4OLXL 1ZGLM 1CE1L 1IGYA 1GGUA 4KVCL 2M1KA 4OZGF 2Q3ZA 1CD8A 4ZNEE 3ILPB 3QPXH 4Q0XL 4XPHL 4U7KA 5EUKA 1JI1A 5B4MD 5IBTL 3MJ9H 3BP5B 2LAAA 5EU4B 4F33B 4WI6A 3GDBA 5J3HC 5I18H 3QCTL 4FTVD 1RUKH 2YRZA 5F9WC 1K9TA 3U0WL 1LE5A 1KEML 2AI0L 4DCQA 3IETA 2DRUA 4JFDD 4L4TB 4KDWA 1K3IA 4GLRH 4P2OD 1UT9A 2A83B 1LEKB 1YZZA 3L3GA 3UO1L 4XNZC 3AS0A 4ZYKA 5L8JB 3MV7D 1GPOL 3OKEA 4BH7B 1G9ML 5IJKC 3KR3H 2DQFB 4J3OC 3ARGA 4NN7C 4G9FA 5I1LB 1LVEA 3VH8A 3VRJB 4CU7A 3MZGB 1D5MA 1YYLL 1FNGA 4ZFZA 3F65A 5DHVA 3EOYG 5EBLA 3I02A 3HE7C 2BCKA 4ODXB 3QDME 3DX9A 5DMJB 5D1XB 1I3RB 4L3CA 4QT5B 4GBXA 1KIRB 3ISWA 5K59F 1NBZB 2WP3T 1UYWL 4GRWE 3LEYL 5DS8A 3DARA 5B3JE 2FSEB 5FYJL 1MCEA 3IAQA 4AY0A 1HXMB 1BZ9A 1X5KA 1MY7A 25C8L 2VLJA 4LDOB 4WWKB 3DTXA 4DUXA 1RUKL 1VADA 3IDJB 1X9QA 1Y6NR 1O7VA 3G6JA 4LNRA 3WJLA 1YQVH 3VWKA 4WWKD 3F6IA 2FBOJ 1OD9A 5KSAA 2I07A 3EJZD 3IJHB 3BIKA 3DXAB 1AGDA 2H45A 5D96C 5F96H 2PO6A 5GJTH 2X4TB 1N6QH 2KKQA 4CDGC 2VLRA 4BFGA 4UAOB 2E9JA 2B39A 5F88B 1JTOA 3V5KB 4LPVA 3SGDI 3SE9L 1RJYB 1JV5A 3SDAB 5TF0A 2DBJA 3RWGA 2EYRB 3Q48A 1AC6A 4U2ZA 3OKMB 1KCKA 1ZLSL 4XNZB 1UKSA 5INCA 3QJFB 4MNQE 3FOLA 4OT1H 4JPKH 3NAAH 4OI9A 2PW1A 4X99A 1ZT4A 5JW4N 2BSRA 3IDJA 2WUCL 2VDRH 5AD0A 2J6EA 1IEAB 4Z8FH 2VZTA 3MRKB 3R4DA 3MTRA 5EC1A 3WS6A 2QV2A 4M6ML 4U1NB 3MO1A 5E8DL 4R4FH 5IIEB 4IEFB 1DN0B 2V7HA 2Z9TA 2FL5B 5EC2B 1LEGA 3FO2B 1FBIL 3FQXB 3JWDC 1EDQA 1NLBL 4XAWL 3RKDC 1KIQB 2FX7L 1HILA 1BQLH 2XQBH 1J88A 4P3CH 3ROLB 1IAMA 3QDMB 3HNVH 3VFMB 4QXWA 1EEQA 5A2FA 5CSZA 2YD5A 1NUGA 1JTTA 5JR1L 5KJRH 1I7UA 3QUKA 3D3VE 4FXLA 4QCIA 3BWAA 1RZFL 4U1HB 3JV6A 1QFHA 1X4YA 2V7HB 4O2CA 4Y4KB 3EO0B 5ID1B 5C6PB 3BVNB 5EO9B 1NGYB 3KYKH 4ONHA 1MPAL 2BMKA 1K5NB 3EOTL 4YPGB 5EZJB 1QFPA 3IB4A 4EUPA 3UAJD 3U4BL 2W65A 5HGHB 4JG0L 5IVXB 4X80L 2XACC 4AG4L 1AO7A 3TEUA 5DJDA 1OGAA 2V5YA 3MRBA 1Q9KB 3H3KA 3NACH 3U7AA 3NCJH 3RBSA 2WUBL 2Q86B 3SY0A 2QADC 4YDJA 2CKNA 1HCVA 3LPGA 1F4XL 5D7IE 2V9TA 5C09D 5HI3D 2AXHA 1VACB 3GSUB 5F1KC 1YNLL 4P4KD 4PS4L 1A14L 3MGAA 3QBTB 3O8XD 1IGIL 5I30H 4DQOH 4KZEH 1YEFH 3EAKA 3E0GA 4ZO9A 4XPBH 4YBQD 1NUNB 5JUEL 3UO1H 3LQAL 1IL1A 5J57B 3ZT7A 3BKYL 3IDNA 4R8WH 4AH2A 1KBGL 5HYQA 3MBED 4JY4A 2EICA 1M7IA 4M7LT 4LU5L 2GCYB 4X83A 4ZXBA 1ZLUH 5ID0A 2NNAB 1KIQA 5AZEL 3WCYA 4PJFB 5DZNA 6FABH 1X5LA 3MV01 4IRJD 4HK3J 2J4WH 4BK5A 2FJGA 3I6LE 4XTRC 3REVB 5CAYB 3DUUA 2B4CL 1HI6A 1XIWD 5ICZA 1WEJL 5JW4M 3H7BA 4EBQL 1MJJA 4P46D 4NIKB 1J12A 3VI4E 4WHCA 2EDXA 3VH8B 1X5FA 1OY3B 5GS0C 5AUMB 4JGUA 4GQ9H 2HLFD 4LKXB 1HWGB 3B6SB 5L2JA 1BZ9B 1AR2A 5BCAA 5D1XA 4HS8H 4X4MA 2RQ8A 1TTFA 8CGTA 3ULVE 2YEZB 4FZ8H 1FFNB 1K2DA 3TJHC 4IMLA 2Q7YA 4O4YH 3Q5TA 5GRJH 3BH8B 1TVHB 1VEOA 2NXZD 2D7TL 4MVBD 2DTSA 3SKNB 4JRXB 5F6IB 4HIEA 1A3LL 2H3NB 3VXNB 5I1IL 1KPUA 1WWAX 5F70A 3ETBF 1MCLA 3FQUA 5FGCB 2C7UB 3QIBB 2FIKA 4WU5A 2HTLC 2Q7NA 3CZFB 2WZPD 3S34H 3VXMB 3ZKND 3B2VL 3QDGD 1CVRA 1QVOB 5C0CE 1F6AA 2XN9A 4QRPD 3OR7B 4DKFH 1RVFL 4H5SA 5JHLH 1YNTB 4X7FC 2YK1L 2B2XL 3BE1L 5FOBA 1EHLL 5IUSA 2IADB 4PJ7B 5D7KE 1NAMB 4PREB 3DURA 1KCRL 2YMXL 1Q9WA 3TF7C 1MJ8L 2D9CA 4X6CA 1LMKA 3B3IA 4ZOEA 4IMKC 2YC1B 1TZIA 4MB3A 4MXQC 4RBPK 1EUUA 4MA1C 4P2RA 1QQDB 1XCQB 3HMWL 3B8SA 3O41B 1P69B 4G80B 1MLCA 2GHWB 2VRAA 2YKLL 4JREC 3IFPA 5T3XE 5I8KH 1CR9H 4X4XA 5ENWB 4R97C 4X7CC 3S3JA 5T1MB 2D7PA 1A3LH 4OCSH 1OHQA 1NDGB 5HXMA 4L9DA 4YAQA 3UTTB 3M45A 2XTJC 1RZJC 5F3BA 3DO7A 5MP6H 1RFDH 2VDNL 3GMRB 4LSUH 3IDXH 2ZPKL 4KI5D 1MFDL 1MFNA 1XGRB 5ITFB 3U79A 4QEGA 4KRPB 2VNCA 1Q72H 3SKUD 4KKNA 1AIFA 2Q20A 4J6RH 2CRZA 3FT3B 1PDKA 4C4KT 1S8DA 5ISZA 5L0QB 5ADOL 2P1YA 3HPLA 4RWYH 5E4EC 4Q6IB 5KSUA 5GZND 5I1GL 2YUXA 5D9SA 3U4BH 1FZOA 1CT8A 1X5AA 2NXYC 2P8LB 3QISA 2IPKB 1FGVH 5SX5H 3IVKA 2FEDD 4ISVB 5EIIB 1S7SB 3DX8B 5T1KB 3OB0K 3N06B 3GSNA 1AY1L 3BP7A 4OIIH 3F7PC 4CJ0A 2OM5A 4U7MA 3IDMA 1I8MB 1CGSH 3OKKA 3MJ7B 3WNKA 3KPRD 2AEIT 4P2QE 1I1CA 4F3FA 3GSVB 2IALB 1R3LA 4HBQA 4CAGA 3CH1A 3IVKB 2QHRL 4R3SA 4L1DA 2QQKL 4U4BA 3VFUA 4C4KO 4QXGL 3KG5A 3QRGH 2CKBL 3X3FL 2PXYB 2A9ML 4P9HH 5D5MB 2ADIB 2AGJL 1RUAL 3MZTA 5GJSH 1I7RB 4L8DB 4XNMA 3KJ6L 4ODTH 3LQZA 3BAEH 4TTGA 3BOVA 1S7SA 3KXFB 1U8KB 1OTUD 1I9EA 3T0EA 4WFEE 1G6RL 4MDJB 1REIA 2OL3B 4J4PD 4NOFA 4WY7L 1NC2A 1MCRA 3C6LD 5D96B 3VRIB 5KN5B 1U3HC 5FB8B 3QUZB 4MXWH 3OGCB 4WO4D 1CTOA 2BDNL 5CJXC 4FQJL 4N8VG 1F4WH 3OQ3B 5ERWB 3GIVB 1KCSH 2ZUQB 2Q3AA 4WU5B 3PF2A 2VAAB 3ARBD 2R29L 1V3MA 3HPJB 4PBXA 2PW2A 1YEIH 1CFVL 3ROOB 5C0IB 1JWMB 3HAEH 4JAMB 4C56E 4M8QB 2DOCA 4KKBC 4HGWA 1FNAA 3BQUC 4NNXA 1EGJL 4H20L 4PRAB 1MLBB 2GSGB 5E03A 2A77H 3CMOL 3KXFE 1C5DA 5DVMA 5GGUA 4XPFL 4NQTA 3IDIA 1WZ1L 4U1LA 3BX7C 1C1EL 3JV6B 3VXMA 1U3HD 1HYRC 5C0GB 2X42A 5DRNA 3BDBA 3MV8E 3OHXB 3SE3A 2YD4A 5SWSE 4CNIA 5DR5H 3V0WL 5TE6H 1GZPB 4H5SB 5GS1C 4FXGB 1X3DA 3CXDL 1FVCA 5F44A 5IHLB 1IGCH 1JPFB 3ARFA 1BFVH 1LK3H 1CD9B 3BKCL 3U36B 2C3WA 1KSRA 5HHMD 5IBLC 4WVRA 2BNUA 3OTTA 1T89C 3FB5B 4NWUL 3BQUB 3S98A 1G0XA 1UA6H 3T4AA 1UWXH 2NXYB 4JR9H 3O3DB 1PKQB 2ADGA 1OP9A 5BS0E 3B5TA 4P5TA 2IPTL 2X6MA 4XC3L 4JN1H 5DJAB 5C08A 5E95B 3B2VH 3MV9A 4M8VA 4TVPD 4QY8B 3QDGE 1VFBA 1NGWB 3MRGA 1U3YA 1AGEB 3CLEH 4YK4B 2EE9A 1MHHB 2CPCA 4I0PC 3DHJA 3LPWA 3SQBA 4HJGB 4K9EH 3B6SA 5IP4A 1G7LA 3I6KB 4HW6A 3P3YA 1WIOA 5IBTH 5HJ3A 4P2OC 5IQ9A 3UX9B 5TDNA 2AJSH 5SX5K 5DEFA 1X5IA 3WLWD 1FFOA 1IGJA 2DQJL 4X5XA 3U2SB 3M17B 4OM0L 3EO0A 5K9QI 4TSAL 4I2XB 4IJ3B 1RAMA 3KYOB 4XP1H 4KK6C 2ICEB 3TBWA 1NSNH 2QADD 5DQDL 1ITCA 5CBEB 5DUBA 1UM5H 3C8DA 4QRUA 1A6ZB 1KLUB 4PJ9A 4RQQA 5D7JA 5GRVK 3DNKA 1E4KC 4N68A 4L9LA 2VQUA 3QRGL 4RMRA 4HZLA 1NAKH 5DJ8B 1HH9A 3STLA 3DSFH 5KVDL 1H15B 3C5JA 4HK3N 4LRNL 4D3CL 5IHZB 2CQVA 4OBSA 4X98A 5E6ZA 1A9BA 3L5XL 5L0QC 3OJDB 4WFHE 1IC7L 5BXFB 4JFPA 4WJ5B 3V7AE 4N0YH 2PCPA 4OGYH 4PTTA 1J8HE 3ULUD 4P3WA 2EC8A 4KJWD 4NOBA 1KCVL 5DUPH 3X17A 3CSBA 4NZJA 1P9MC 2Q6WA 1EZVY 1F3JB 4R90L 2HRLA 1MUJA 4Z5RA 1FORH 2HVKB 3V6FB 1R3IH 32C2A