5CEXA

Crystal structure of fab 32h+109l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
207
Chain Sequence
TQPSQLSVAPGETARISCGGRSLGSRAVQWYQQKPGQAPVLVIYNNQDRPSGIPERFSGSPDTTATLTISRVEAGDEADYYCHMWDSRSAINWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 207
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cexA01
1AP2B 1G7PB 4IRSC 3HRZA 1KEGL 2AK4E 4PBXA 2X40A 1ND0B 5T3ZH 2UUDK 3DURA 5ALCL 1EJOH 1FO0H 4FFVC 3ULVF 3U4BH 1FGVL 4PRHA 1AJ7L 5CJ8A 3MRCB 4YDLB 5KOMC 1T5XA 1A6AB 4YDJB 3ZYJA 4NQEB 2DMCA 1CGYA 3G5VA 4KTYA 4Y4HB 1DQML 4R7NB 4M5ZH 4ZPVA 4HW6A 1PFCA 1UM5L 1VKXB 1QR1B 1D7FA 2ERJC 3KPQA 5BJTA 2ZPKH 3OWEA 3VFRB 1TJHL 1W72H 3KHQA 3LN9A 4LRIA 1ZA6B 2CDEA 3BH9B 1GXEA 4L9DA 2F5AH 2F54B 3IFNL 4LLQB 1RZ7H 2Z4QB 5CJQH 1MLBB 2IJ0C 4LSUH 1AO7E 4J2XA 4D9QE 4JVUA 3QEQE 4LGRB 3T3PF 4HGWA 2AEIT 2OJZL 4OLVH 5GS3A 4HV8A 1UJ3C 3B3IA 4FQQA 3NFSL 4X6FB 5JUEL 4WI9A 3S3PA 2CMRL 1UFUA 4EBQL 2EYSB 3KYMB 4DTGH 4EOWL 4Z7WF 3QJFA 2X1QA 2C4FU 1Q1JL 4NHUA 4YX2H 2EYRA 4B7IA 2FO4A 1MCNA 4PJCB 3JUYA 2W38A 4KKCC 1M71A 4NKMB 2BNQE 4RBPK 4CMHB 2ZSWB 3D2UA 3IAQA 4HWNA 5ID1A 4KDWA 3SEPA 4GW1B 3TV3L 2D9QB 1S7SA 1MQKH 4ORGA 1QFOA 2OSLA 1Z6JT 2OP4H 3VFMA 2JJTC 3VXTB 5DMIL 4OIAA 3RIFF 4DN4H 1CN4A 4RFOL 3NCJL 5FF6A 3GB7A 3BPLB 3O6FD 1CGSH 2ENYA 3TBVA 3TJEL 2BNQA 5CINH 4Y1AB 1EMTL 4Z6AT 1RAMA 5FUCE 1QPPA 2W65B 5GJTL 4G6JL 1HNFA 5D7IB 5HGDA 3MROB 3VFGL 4UNVA 1N0XL 5D1XC 3MZTA 2RJMA 4PJDE 2HFEB 2WIIA 4HWZA 4HS3A 2YN5A 1CGVA 3DTXA 1E6OL 1TNMA 4ONHB 4WV1B 3WKMH 1BP3B 4OBSA 5DJCA 1S5IL 3Q5TA 4Y5XC 3O3BA 2IAND 5TF1L 2NNAA 1BFVL 1EV2E 1YY9D 4LDLB 5C09B 5ELIA 1N5YH 3LMJH 3OHXA 2IG2L 1CLOH 3I02B 5F93C 3HE6A 2ITDB 3S7GA 2WBJB 1A4KA 3P77A 4MB4A 4ZNEA 1TTUA 5I16A 4QKXB 1F2QA 2Y6SD 4DKAA 4PJGA 5JPNB 1EFQA 4MAUL 5E00A 4PJDA 5AZ2H 2UV3A 3QEGH 2X9YA 3DX7A 2AEPH 1CICD 2J6EA 4AM0A 3I6KA 2ZUQC 5ERWB 4PGDB 2DQFB 4ZXBC 5JIKA 3UTOA 4X98B 1WCQA 5JDSB 1IC5L 1BIIB 3S97C 5A1AA 3PWJB 2JJSC 3SE9H 2O93L 3MYJA 5I6XB 1T21A 5J12C 4TUJB 2I26N 2IPUK 3WIFA 1QBLH 3HZKA 4O58L 4P9MH 4M8VA 3W0WB 4X99B 3CSBA 4XC3H 5EC1B 1OB1B 5BCAA 1BD2D 1REIA 4P4KB 4L8SC 2YA2A 2R56H 1NCBH 4MXQC 3P9LA 3A6OA 3O3AB 2MKLC 4PTUA 4JY6B 4O02H 2O61B 3TBSB 5E2UH 1GH7A 4GQ9H 4HFWA 1FNHA 2J7LA 4ODTL 4F3FB 3GSOA 1QKZH 1YEGL 4NWUL 2H9GA 1KNOB 3ARGA 1E27B 2EXYD 1MI5D 4DWHA 1PX4A 2X10A 5D5MA 4JFZL 4EUPA 3GSXA 3FTGA 3D3VE 5F7HA 5DWUH 3BPCB 1BQLH 3OSKA 1JGEA 3GJFA 4XPAH 5J13C 5F8RC 4XPTH 5E0QA 4H8WH 3OAYK 3HLAB 2AV1B 4FFYL 5F9WB 3S88H 4D3CL 4F7MA 1C12A 3WS6A 5DRZB 8FABA 1S9WB 3GMQA 4OFDA 1R3LB 2GIYA 4YE4L 4MLSA 3HAEG 3VH8G 3SGDH 3ULUE 3DO7A 1NANH 1MJ7L 5BO1H 3ESUF 2OR9L 4QWWC 3SQBA 4HPYH 5HGBB 1BJMA 1X5GA 5CZVL 1R3JA 5E5RB 5T5NG 1TTFA 3KPSD 4DEPC 5MERA 3CFKB 1JCKA 3D85A 3PE9A 2JIXD 1BOGA 2PTUA 5KSAC 3OXSB 5FDWB 4MWFB 1MH5B 3UZEA 4F33A 5J6GA 5GS1C 1TJGH 3OGCA 1NFDE 5I8CB 4YFLI 4NJAH 4U1SB 1RK1B 4PP2A 5FB8B 4XP4L 1ZHBA 4QRUA 4HS8L 1RPQA 2HYMA 5SWZA 1FIEA 1BZQK 1XCQB 3C8KB 3VXPB 5IROC 1F8TH 4Z7UF 4IMKC 4WW1A 3TJHD 4L9LA 5D7JA 3RQ3A 5I8KH 3WFBL 4DZ8A 3ZZ1A 1KCRH 4I0PD 3SDDC 4RISH 3HZVB 1R6VA 1AKJD 1H5BA 3AGVA 4WFHE 1UM4H 2JB5L 4RQQA 3X13B 5K9OA 3MRMB 3I75B 1K6QL 3TIEA 2Z91A 2H8PB 4E41A 4WEUD 4GAGH 3FFDB 3OKNA 4XHJC 4KK8C 4M7ZB 5I8EA 4JFHE 4M1DH 4JCLA 1G0YR 2R0WL 4Z7QF 5FK9B 5CMAB 1JI2A 4P99A 2VISB 2NW2B 3DV4A 3C5ZC 2PYEE 3V0WH 1PW3A 4HJ0C 3CGTA 2Q8BH 4K8RL 4XBEL 1VFOA 4FP8L 1XGPA 4MGXA 5JIPA 2CJUL 4TQEL 2GY7B 5D1ZD 2K7PA 4CU6A 3QXUA 3D1MC 3KPPB 5GS0L 4JFDB 3BN9D 2MPAH 3MV8A 2ZCKL 2W9DL 1BX2A 5DMJB 3A6BH 1WZLA 5EU5A 4JO2H 1VSCA 5E99L 4JKKA 3TWCL 3H9HA 3I9GH 1NAMH 4YXHL 1ZAGA 4R8WH 3UPAA 3IFOB 5ADOL 1FFNB 1UKTA 5C07E 1Q72H 2PYEA 2Z8RA 3EYQD 4NIKB 2AW2A 1XIWD 3FN9A 4WW2F 4PJBF 1KCSL 3T1WA 5CD5D 5KAQG 1NUNB 3DO3A 1U2HA 2A73A 3GSVA 3BKCH 4KKLD 2YC1B 2VXSL 4R9HA 4KK9C 4OCSH 5DJ6A 1PEWA 4K3DL 3CJJA 3SDCA 5BZWA 1YYML 1EGJH 3C6LB 3RVUC 4I13B 4CVUA 2Q86B 4PJEE 2YZ8A 1HQ4B 1YMMA 1CDIA 1MF2H 3LS4H 1HHJB 4PJAF 4KROC 4WWKA 4UT9H 5EG6C 1MFAL 1PAMA 2ID5A 4U1KA 3RWIA 3OR7B 4UINH 2GY5A 1NKOA 1QOKA 5EPMA 4C56A 3FFCB 1X5XA 5IW6B 4JG1L 4XNQB 4YBQC 5EOQH 3BIBX 1XR8B 2DQUH 3VWJB 4M5YL 2E8ZA 1R0AH 4MA3A 5LGJA 1CE6B 1HIML 1KENL 4WUUB 1MFBL 5GGQH 1T1YA 3M1BB 1WIOA 1G7IB 1UB5A 1R3IH 2HFGH 1QLEH 4PJEA 1NSNL 3S5LB 5H94B 3ARFC 3BSZL 2FCBA 1TQBC 3MXVL 4TN9A 1I7RB 5EB9A 3V7MA 3CU7A 2VLJE 2VUYA 2FX8L 1AIFB 1RZKH 2Y36L 3WL9A 2ICWB 2BVUA 4FZ8L 2W0LA 2CIKA 2FBOJ 2FHFA 4PB9L 4NT6B 4K23H 4HK3J 3T8XB 1QQDA 1WBZA 3DLQR 2BCKB 1RUAL 1K4CB 3O11A 1UZ8A 2J1KA 4LLYA 1JWUA 3LPWA 1G7MB 3UBXB 3GMMA 1ACYH 5IVZB 2YPLB 4NN6C 4Q7DA 4NJ9L 3QNYA 4WWID 1DE4A 3JTTA 2ZUSA 4HIEB 2FJFA 1FJ1A 2AGJH 3QAZC 2V2WB 4JPVH 2IQ9L 4YGVB 2P48B 1BOYA 5GZOD 4OF3A 4K8RC 5ANME 3LIZL 5CHNA 3O2DA 3MLVH 1VFAA 3HN3A 4GRMA 4MNQB 2H32A 5JW4R 1S9YA 3GNML 4Y4FC 1I9RH 2F5BL 3R0NA 5HHXL 1AXIB 4BZ1L 1INQB 4CDHA 3LSOA 5D96B 3RWDA 3RDTD 5I19H 4WIQA 1A3RH 5HHQB 1TCRB 5DUBB 3G04B 5KSUB 1PGRB 3GKWL 2VLME 4Z9KB 4PJHF 4KZEH 5ANMA 5I1JH 2F15A 3H7BA 4NZRH 2XN9D 5HSFA 5DD0L 5E94A 2HTLC 5F88B 4JO3H 2MNUA 1JF6A 1V7NL 2YD3A 2GAZB 3E1F1 3CZFB 2OK0H 2IANE 2BHYA 5ILTL 4M93B 1JZ3A 4HEME 3T0XA 3O6FA 1FFRA 2W60B 3NAAL 3PWUB 1H15A 3QG6A 4LMQI 4P23D 3UTSB 3BDYH 4Z95H 1PKOA 1U91A 2XT1B 1RHHB 4EVNB 5EOCL 4I5BB 1FNGB 3GGWB 1NCAL 4BH8B 1I1AC 1T7WA 4J4PA 5KS9B 4MD0B 4L8CA 4HWEH 1ZHKB 5LGHH 2CK0H 3DARA 4UTBH 3RVXD 4WEBL 2IANA 3O2WL 3V0VA 5JHDB 4MCZB 4Y4HD 4WHTA 5HYIA 3TO2B 2BVPA 1NGWB 1NUGA 1P1ZB 4CL7A 4D0DA 4XCCH 3N1QC 4KKBC 3QIWB 4I2XA 1I8LC 3W9EA 2FR4B 1UCTA 4GAYB 3S37X 1GGCH 4K9EH 5J89A 2ZUTA 4D9RD 4QRTB 2F54D 1B4RA 4QCIA 1P4BL 3K8KA 1HH6A 5FDYA 4R2GB 4JM2C 4K3GA 5CP3H 3BEVA 3MBXL 3R06A 1XGYH 2XKNA 4RNRA 4TSAH 1CICA 5FYKE 4YDKH 1OP9A 5DQJA 1YEFL 5ETUB 1CR9H 3BPOC 4LLUA 1OLLA 4IHOA 4XVJH 1T0NA 5MEND 3FQNB 1ZTXL 4JKMA 5A16A 2P5WB 3LN4B 2XV6B 3S5LG 4JHZA 1M7IB 2F8VA 3L5XL 3K4ZA 4OGYL 4Y5VC 5HYSA 5JXED 3TM6A 1X5LA 1S9VB 1NLBL 3SDAD 1U8JB 1BD2A 1CU4H 1SYSA 3V4PH 4FABL 4JY4B 3CDYA 2DBLH 1S7QB 1JZ4A 1OTSC 4R7DB 3SDYL 1GZQA 2AABL 1ORSB 1N7ML 2Z8WC 1C08A 3E0GA 4WY7H 5HBBA 2E6JA 3AB0B 4U6YB 4YIQA 4LLVA 5DVNA 3CSYA 4CN1A 1RIUL 3B6SA 4I77H 1OAZH 2BSRA 1MI5A 5BV7H 3REWA 2DWDB 5IEHA 3TN0D 1QLFA 1JBJA 2NZ9D 4TUOB 4U31A 2ZP0T 4IRJB 2QSTA 4Y2DB 4NHCL 4Z7UA 3HFMH 3T65B 5T33H 3C8DA 4NDMA 4Y1AD 3MR9B 2G5BA 3P0VL 3ARWA 5FYLH 1KUMA 1A6TA 1NDGB 1JTPA 4OZGF 4NQCB 2HT4C 4D0BA 5A3IC 3F7PC 2HFFA 4GLRI 2VXQH 4FG6D 3MLWH 4PJCF 3HB3D 3RWJB 1X6LA 4ZAKB 3DGGA 5I75B 2J4WL 5T5NF 2HJKA 2X4RB 2HLFC 4OZIB 4U6XA 3MLRH 4UMGA 3KPSA 1D6VL 4R4NC 4RA0C 2JIXA 5IWLC 2YA0A 1FH5L 2BSSB 3HI1A 2CDFB 4RFEB 3UJIH 2F9BT 2JJVA 2DOCA 1YA5A 1D5IH 3G6DH 4PD4J 2WBJD 3QR2A 4M03A 2YHGA 5EUOB 1GIGL 3CCHB 2FL5A 3WFCH 3JWOL 2E5EA 3IFLL 1YC7A 2VKWA 1AXTH 1XAUA 4PRNB 4XVSL 4NCDA 3T08A 1D9KD 2EXWD 5E8DL 3VFNB 3VXQA 5TQ2L 4NYLA 2L7JA 5D2NE 1I9JL 3BRGC 4AIZA 1EFXB 1LDPH 5DRXB 3B9KC 5D7IF 2QQQA 1YY8B 1P7KA 3LD8C 5DD5H 4QHLB 1P7QB 5EBLB 1AKJA 3ARDC 5ESAB 3L95A 4ZD3L 5IMKA 3BZEB 1CZ8L 1UXSB 3X14A 2JTDA 2R0ZH 3ARXA 4F7CB 1DUYA 1JUFB 3PIQB 4JQXC 4OB5L 2XWBB 3OX8B 1KBGH 3BN3B 3CK0L 3L7EB 4P3CH 4BH7A 1K85A 3O6LH 4FFWD 2PXYB 2IALA 4PY8I 5FKPA 1LO3L 1F4AA 4O2CA 4IIQA 5E5MA 3BP5A 1MREL 5FYKU 3EHBD 4Y4KB 2W07A 1L9MA 1YNLL 2ILLA 5D1ZA 3PHQA 5F1NB 3L6FB 1NCNA 4X6CE 4KQ4L 4ZUVB 3BEWA 4GRLC 4MA1B 2Z35B 3FB8B 1JPGA 5KW9H 1QFPA 3TFKC 1DVFB 3S4SB 3DETD 3V6OE 5LCVH 3RX7A 4YZFE 5FUOH 1DBAH 1OF2B 4I0CC 2XZQL 2XXMB 3AS2A 1I4FB 2Z31D 2DQHH 4M7JL 4AEIL 2ZUVA 1T03L 3BOVA 4S1DC 5KVGL 1BGXH 4DCQB 4LCIH 3MBEB 1YDPB 1XIWA 4ZFFA 5HJ3A 2CXGA 3QDMB 3S96B 4PJFE 1EZVX 5KAQF 1EEUA 2P8LB 4LU5L 1ZLSL 2XQYK 3ZKQD 4OD3H 1DQJB 4PBWD 3PV7A 1NJ9B 4ODXA 1A7RL 1AD0A 5CD3A 3VFOA 2J12B 3I6GA 1KJ2L 4KWUA 5L9DL 3V6OA 5M94B 1Q0XL 5KSBE 1BLNB 3UPCA 2IH3A 5I1GH 3SKOA 4P4RB 2HJLB 3MCLH 4ZUTA 3FO9B 5TQ0H 2DDQH 2OL3L 1T5WA 2AAVA 2CGRL 3RTQC 5JTWA 1A9BB 3QCTH 4JY5H 1GJIA 3FT4B 2D4FA 4CU8A 5DEFB 4F7PB 4M7LL 1ZS8A 3KLHC 1WQVT 3N85H 4QRSB 4PGZA 3QXDA 4CN4A 5HYJB 1XGRB 4NP4L 2GJZA 4JPKL 4YHNA 2AK1H 5J3HD 5FCUL 1EEYA 3ZYIA 4NUGH 5KSBA 4ZQKB 2DLEA 2GUOA 2A6DB 3IU3A 1NMBL 4PJ9C 4KXZI 2A83A 7FABL 1Q38A 1HHHA 4PBVC 3JWOC 5IVXE 4FNLL 5E8NA 3DYPA 3OJMB 2XZZA 4XCFL 3ROLA 5IB2A 5I1IH 3BGFC 3X3GH 5HI5C 1IAKA 2APVA 4Y0GA 4ZFOB 1GGYA 1JNNL 1U41A 5CEZD 1XH3B 2BXYA 1RY7B 4GH7B 2FX9L 4ODBD 2JF1A 1MVUB 1IQDA 2YD7A 4PJHA 3OZ9L 3DHMA 3EYFB 3VMPA 4MA8L 3U30B 5D9SA 5GGTL 2C1PA 4UQ2B 2K7QA 4JFDD 2AKRB 4K94L 3QO0A 2P43B 4I48B 2DICA 2J5LC 2ZOLA 4OCYH 4P2CG 3DYOA 2LQRA 3K2UL 4TUKL 3SGJA 3OG4B 1R5IA 4IMLA 1RZFH 5DFWH 3TNNB 2XTJB 4HG4J 4OUUB 3X12B 3G6AA 5IFHL 5TDOA 2BY0A 5MP6H 1I3GL 4YHLH 1CGTA 3TNMB 4YHYB 4BQ8A 43C9A 2IQAA 1IJ9A 1CWVA 1EAPA 3D69B 3GMNB 1IQWL 2GTWB 3RDTA 4BA8A 1E4WH 4OLEA 5D2LF 4PY7B 4GAJL 4WI6A 4WUKH 4GW4A 1LHZA 1UACH 3B9EA 3EYVA 3NZHH 3O3EA 1HNGA 5C0EB 5E9DD 5J56B 2FZ3A 3SPVB 5AWNH 2XN9A 4XPBL 3RUGB 2HLAB 3WSQL 1KEGH 2VL5A 1IEBB 4UB0L 2VXUL 4LK4A 4QF1A 3VWKB 3CH8A 4P2YA 1FGVH 3F8UB 2D2OA 4K7PX 3MRPA 5C86A 1JYXA 3PV6B 5IMMB 1WSST 4WUUD 3VG9C 4PTTA 5LVEA 3UTZA 1G7PA 3V6FB 4HUXB 1DQLH 1UM5H 1ND0A 3GSNL 3STLB 2A6IB 4FZEL 3X11B 4GBXD 2WINB 2GSGB 1BZ7B 4M43H 1KTRL 9CGTA 4XMPL 5L0QC 1TJHH 2WK2A 3PHOB 4IM8A 4A6YH 2HT3C 1LILA 1A9EB 1PLGL 3VCLB 3IFNH 3MRCA 1JZ7A 1OW0A 2OBGA 3VRLF 4G6AC 1A6AA 4Y4HA 1URLA 4G8IB 1UKQA 4R7NA 5MENE 1KJMB 3P40A 3T0EB 1VKXA 4PLJC 1KJVB 5EU3B 2OJZH 4OI9A 2ZKHH 4OGAC 3VFRA 1QLRB 2ZCHL 2Z31C 5B3NA 2X4QB 3NFSH 3BH9A 3HE7B 2D7OA 2NY3C 4MNGB 2QQKL 2F54A 2CMRH 1NC4B 4OF6A 2Z4QA 3KDMA 1MLBA 3EO0B 5JMOC 3DX6B 3TYFB 4IOSD 1Q1JH 4U33A 3UZQA 1WLHA 4ZO7A 1FCCA 3SE8H 3RBGA 2QHRL 3WUZA 4Z0XB 5KTEL 1ORQB 3MO1B 4YUEL 2KKQA 4XRCB 5MENA 3IS0X 4X6FA 1BIHA 1AGEA 2VNCA 4HGKC 1X4XA 1NCWH 2EYSA 1WZMA 3KYKL 2DBJA 1YECL 2GJ6D 5JXEA 2G5RA 3HAEA 3SDAA 3VH8A 3S34L 1W0VA 3ILQC 4NUJB 4NNPH 4JGJA 3L3JB 3D0LA 1DN0B 1MWAH 1T0MB 3FRPG 5IESL 4RFOH 5C3TA 3NCJH 5ICZB 5IB3B 4GW1A 2VABA 4YQXH 3P4NB 2DM4A 4KDVA 2CIIB 3QUXC 4L29B 4RRPG 3OAZH 5GJTH 4G6JH 1KIQB 4QNPE 3U36A 1OLZA 3VXTA 3VFGH 1T04B 1LEKB 1N0XH 5LAXB 3TN0A 1MCLA 3BUTA 4NO3A 2WAHA 1UENA 2I9TA 1E6OH 5IHLB 3NMEA 1S5IH 2A6KA 3UTSD 3FQRB 4Y1AA 3U7AA 1YEJL 1UH4A 5TF1H 1RU9L 2W65A 5AYUL 5DMYA 5D7IA 3MROA 4LPTA 5HVFB 2ZJSH 1OWRM 2HFEA 2HFTA 1AC0A 1CK0L 1UB6B 3DVIA 4FQXB 1QSFB 4ONHA 4MAUH 5ECJE 3V0AC 1FC2D 3WV0A 5JHDD 1YUHB 3BDBA 5I74C 4J23A 1T1XA 3U9UB 2HH0L 3GBNL 2EEAA 4F9PA 4EKXA 1HI6A 2H45A 4PLNC 3F7YB 3LQAC 2NY5C 2WBJA 1CDBA 1IC5H 2P1YA 5JPNA 3UYRL 1KCKA 2EDLA 3QO1B 3SKJL 2ATKB 2GCYB 1MHCB 4R2GD 1RZIB 4O58H 5HGHB 1XF1A 3LPGA 2NX5B 4J3WA 4PGDA 2DQFA 1HSBB 5F7KC 4X9BA 4X98A 3QFDB 5JDSA 1BIIA 2IH1B 4KPHH 1V7MH 4N8PA 4APQB 4DZBB 2Q76B 1X9QA 1LE9B 4FXLA 3EJZC 2VZ1A 4G6KH 3RRQA 4W4NA 4MJIB 4X99A 3C8HA 4NGHL 5KS9F 1G6RB 1OAUH 2X4OA 1YEGH 3MACH 3RPKA 5C0JA 3JBG7 1OB1A 3RWCA 4ZOBA 3ECBB 5I0DA 4QXUH 3EOYG 5IIEB 2C3WA 3EO9H 1TZIB 5IB1A 3UJJH 4NNXB 5GGVL 1KCUL 3O3AA 4JY6A 5EFIB 3JV5A 4LSQL 1QFWI 3X3FH 2ZG2A 4P3DB 5GGSB 1YYLL 3TBSA 4F3FA 5DTFB 1T6WA 4FFYH 4OV6F 5EUKB 3LEVL 4D3CH 2N7BA 4OFPA 1KNOA 1OAYH 1IL1B 1QR4A 2FHCA 4R97B 5I9QB 4DVRL 4YE4H 2FJGB 1C16A 1MJ7H 5L2JB 3BPCA 3ZT7A 2OR9H 4IRJD 1F90H 4LSTL 3K1DA 5CZVH 4BZ2H 4XHQA 1MJUL 3Q3GA 3HLAA 1YEIL 3LRHA 4L9LC 3DIFB 5IOPB 5DRZA 3ARVA 3BISA 3ROOA 2CLZA 1S9WA 1EXUB 3RA7H 1R3LA 5FYKH 2F8XC 1S8DB 2MTPA 3LY6A 4WTXA 4HLZG 4Q0XL 35C8L 4D94A 2FJHB 5HGBA 3CLFL 2YD2A 4ZUUB 4HS8H 1A6VL 1CBVH 4LKCB 3TF7C 2Q20A 5FDWA 3GJFK 1IKFL 3JWDC 3I84A 4MWFA 1MH5A 2CR6A 4HCRL 5DD1L 4TSBL 1JE6A 3WFBH 4GG6E 4C54A 1S7RA 3O2DL 4G6MH 4BM7A 4U1SA 1RK1A 4KK5D 5CUSL 5FB8A 5ITBL 2RAMA 5CEZE 1QNZL 3HMXL 1XCQA 1JPSH 3VXPA 4EI5B 1F6FB 2R0WH 3LDBC 3RU8L 1F4YL 1I85A 2Y72A 5FGBA 3QA3B 1FO0B 2BY3A 3C08L 1WT5C 2WLYA 4OCWH 1JWSB 1ROWA 4P2RB 1P7QD 5CEYB 4DVBB 4K8RH 4XBEH 1FZKA 3X13A 3MRMA 1WEJL 1LMKA 4LMQE 3I75A 4TQEH 2WWKO 4GG6A 2H8PA 1ITCA 3FFDA 3ULVC 5E2WH 3SDXE 3FQUA 4JREB 3P0YL 2DIAA 1G0DA 2ZCKH 3HC3L 2PXYD 1IGYB 4OZIF 1FYTD 2DI7A 5CMAA 1TQCC 2VISA 1OTUC 2NW2A 3PQYB 1H3VA 1NFIB 1Q9KA 1Y6MR 1W72B 3TWCH 1G7HA 3QXVA 4YXHH 2FECI 4WFGE 1F4XH 4Y4KD 2OI9C 5ADOH 5EUOF 1O7SA 2FIKB 2EZ0D 1OP3H 4JFDA 4RMRA 4YO0B 1KCSH 2VIRB 4AG4L 4L3CA 3S37L 1DVFD 2C4FT 2YD8A 2VXSH 4TVPL 3ZKXB 2CO6B 2XYCA 4RWYL 4K3DH 5E9DE 1QRNE 1FFNA 5HI3D 1JV5B 2AJYH 3C09C 1YYMH 1N64L 4HUNB 1I3VA 3QDMD 3PP3H 4AY0A 2NY1B 5CJXA 1MVFA 3AAZB 2D0FA 3S35X 5FM5O 4C83A 4HIXH 2DWEA 5KSVB 1HXMB 2R1XB 2AJZA 2VRAA 2I9LB 5MEPB 4U3CA 2C1OB 3KPOB 2HJFA 1CI5A 1I1YB 4X80L 4NZDA 4ISVB 3WFEL 2Q86A 1HIMH 1HQ4A 4B7LA 2AI0H 4LCCC 2EICA 5E9DA 3TT1L 4CVWA 1MFBH 3CUPB 5TE4H 3QHZL 1A2YB 4JRXD 1GCFA 3BSZH 3MXVH 5DD6A 3FFCA 5FV2A 5IW6A 4XNQA 4OLZL 1S9XB 4S1QH 3L3DB 5HYJD 3ZE0E 1CE6A 4GRWE 2Y36H 2OZ4A 4WUUA 3UXFA 4H20L 3BFOA 5IMOB 2XFXB 4FZ8H 1G7IA 3BKYH 1CQYA 1WISA 4PB9H 1XGUB 4J3SA 3G08B 4GBXA 3S5LA 5H94A 5BRZB 3MUZ1 3MA7A 3HC0B 1I7RA 1MFCH 3DBXB 4CW1B 1RUAH 2RR3A 2PO6C 5IJKC 2BY1A 2XICA 2P49B 1A14H 2EDRA 5FGCE 4QHNB 2Z93B 2ICWA 3LEXB 3T0WA 2XXCB 5LXGL 3UZVB 4NT6A 3T8XA 1A1NB 2OMBA 3N50A 2BCKA 2IQ9H 5EORL 1OSZB 2GJ6E 3HUJE 4KJQC 1FN4B 1G7MA 3BKJH 3QUYB 3LIZH 1DR9A 4O2FB 4XGZB 1LO2L 2FGZA 4YC2B 2VE6A 3GNMH 4L8DA 4HIEA 1UG9A 3PP4L 4F7TA 3I50L 4JFFB 3WLWD 4BZ1H 2BZDA 1XF5B 4M7LT 5FM5M 4HFUL 4MDJA 3IB4A 3CMGA 5E8OB 4HUUB 2ZNWA 3ULVE 4NKOA 3GKWH 3SKMB 1CDCA 4CDGC 3HUJA 2GJ6A 2R4RH 3AY4C 3MPCA 5GGRA 2CLRA 4P46C 1BM3L 3BZDA 4V1DB 1INQA 4J4PC 1ZLVH 5JQHC 1KT2B 2E7MA 3U83A 5DJ2B 3VXUB 6FABL 5ILTH 1TCRA 4OTXH 2A0LC 5KSUA 4H0IA 2ZUYA 2NQCA 3MV01 4ZS6D 5F7NC 1N0LA 2R69H 3NAAH 5FXCH 5J0BA 4YJZL 1VA9A 4L4VE 4ODVL 3HI5L 4YDIL 2SEBB 5F88A 5HDQL 3T3PE 5FHBL 4PJ7B 1FLRL 3D9AL 2GAZA 4OGXL 4P5KB 4X4XB 1NCAH 3CZFA 5F9AC 2JCCB 3VWKD 3A6CH 4KK6C 5D1QC 1BMGA 3DUUB 4P5TC 1OGTB 1HH9B 2BSED 2K9UA 5CCKL 2W60A 3BE1L 3O8XC 3PWUA 3UTSA 3ARPA 4WEBH 1T1ZB 4JRYE 5F9JB 4RGNC 3TZVC 3OJDB 4N1HB 3H9ZA 2Z92B 4EVNA 4I5BA 1FNGA 3GGWA 2Q6WA 3IDNB 3SHSA 5EU7C 4BH8A 1KELL 3MRFB 4MD0A 4PPTA 1OM3L 1ZHKA 3SJVB 1G9NC 1EO8L 1NAKL 2HT2D 4OD1H 4HXBL 1KN2L 1P4BH 1P69B 4KC3B 5JHDA 4MCZA 4URTB 5C2BL 1MQ8A 2APBA 3T0ED 1YEFH 3ISWA 1NGWA 1P1ZA 3BT2L 2FR4A 2VDRL 4U6HB 1R5WB 5BVJB 3RUGF 4J3OC 4QRTA 4XNZB 1MHPL 3L5XH 3BMVA 3BUYB 5HHVH 3RWFA 3LN5B 4OGYH 2W0FB 2AEWA 2VJXA 3GMPA 4PLOB 4X6DE 4XI5D 3TYGH 4EN3B 5C0DB 1NLBH 1KTKE 3HNVL 2DYPD 3RWHB 1BFOB 4GKOA 4FABH 4ZUWB 3VG0L 2N7AA 3FQNA 4LAJH 4YWGH 3LN4A 3UCRA 2PCPB 4X9IA 1M7IA 3RY4A 3CU1A 1JK8A 4OI7A 3VXMD 2DRUA 5IQ7L 1D5MA 1S9VA 1U8JA 3D5OF 1RIUH 2X9XA 1TJIL 3MRBB 5ESVA 1ZGLP 4LPYA 1S7QA 3LKPB 3OKOB 4R7DA 1KPUB 4HH8A 3ESVF 3SGKC 1KJ3L 1WUNT 1ORSA 4LGSB 1IFHL 1X5FA 1U3ZA 3K0WA 3NCCB 4U6YA 4ZDHA 5BS0D 2NW3B 4NHCH 4MAYC 3P0VH 1IARB 1ZT7B 2QKIA 3T2PA 4JHAL 2RCSH 2AJ3B 1DLHB 2JE8A 2R8SH 5IFJB 5FO9B 1WWBX 4FQHB 3MJ9A 5HHOD 1BBDL 4BFIB 4TUOA 4IOIB 1MJ8L 1QSEE 1OAXL 5TDPB 2OJEB 4IRJA 1J05B 5BMFL 3KPLB 2EIZA 3T65A 4PJ8B 4ODSL 2J4WH 1H0DB 5I17B 3FZUC 1EHXA 4BQ6A 4CN6A 5M7QA 4HZLB 5DO2D 1VENA 5I1KL 3IJSB 3DPBA 3EYOB 4WW2C 3DXAE 2IGFL 3FONB 1XGQA 3B8YA 1MCIA 2F58H 4FQXD 1GIGH 5CWSA 5DURB 3JWOH 3CAFA 3RWJA 1NCUA 4OSUL 4LEOB 4N5EC 1S7UB 2X4RA 4OZIA 5E8DH 5C0ND 3FHAA 3WNKA 2QBWA 4XPHL 3WMSA 4AENB 2BSSA 2CDFA 3RAJL 3E6HB 4LCYB 1BVLB 2XA3A 3D6GA 5IJVA 5ITFB 1V3KA 1I7TA 4X5WB 3DVGA 5EUOA 3CCHA 4F37K 5ALBH 4ZO8A 3EDJA 3T09A 4TYUA 2P45B 1AY1L 2R4SH 4ZD3H 3O0RH 3L7FA 1KG0A 1CZ8H 3SO3B 2EDNA 4RZCB 3VFNA 4RGNE 1FYTE 1NCCH 2NX5D 4OB5H 2ED7A 1NMCC 3MMEA 4W6WB 3P11L 1NGYB 1RJLB 3CK0H 3TO4B 3L3KA 2W59A 5A2KH 1J0YA 2NXYC 4CJ1A 2YWYA 4PG9B 1J8HB 4M48L 1U3HC 3MOAL 5EZOH 4LSSL 2EECA 1LO3H 4K7PL 4XTRC 2IMMA 1YY8A 5C6TH 3MRIB 1KLFA 1P7QA 5ESAA 2BOBB 3DRQB 3HMWL 4NOFA 5IHZB 1WAAA 1UXSA 3O9WB 4FHBD 1EHLL 1YNLH 4Y2OA 1JUFA 1F13A 1JPTL 3GO1L 3PIQA 4LIQE 2XWBA 5B8CC 1RZ8A 3PJSB 3ZE2E 4EEEA 2PXYA 1ZT1B 1FAIL 1AGDA 3RVWD 5I66B 4UT6L 4BZYA 3PDOA 1HHIA 3VA2C 3NVQA 3U6RA 4PP1D 1OP3K 1GGBL 1UCBL 1CD1A 4QRQA 4M7JH 2AXGB 1C5BL 4AEIH 3QPXL 4Y4KA 1T03H 2G60L 2FECL 2VAAB 5KVGH 3VFUA 2ZUWA 3F6IA 4ELKB 3N1MC 5F1NA 5F96L 5ACLA 2Z9TA 1P2CB 3N1GC 1IC7L 1SBSL 4NRYB 4WENB 3TVMB 1DVFA 3WIIL 4LU5H 2QADD 4X8XA 1ZLSH 5CSBA 1QFUH 3T2NH 4AL8H 1OF2A 1UWGL 4XPFL 3O6KL 1I4FA 1RZGB 5DC4B 1IGCL 2CUHA 4UU9A 5AG8A 2V2XB 3QDJE 1KJ2H 5DFTA 4N0CD 1Q0XH 3NGBB 4XNMB 1YDPA 3DROB 4JRXE 4PV8B 3QQ3A 1QFWM 3WYRA 3QDMA 3MRQA 3UTTD 2P8LA 3OL2A 2XZCL 2OL3H 2CGRH 3F58H 4OI8A 5DVOA 4WU7A 1CXKA 2B5IC 1AE6L 4ALAL 1QA9B 2ESVE 4GXUN 2GK2A 2P46B 1NJ9A 1PQZB 2DTML 4Z78B 1NBYB 4PJIE 1FL3B 4BKLA 4JFPB 4NFCA 4P4RA 2HJLA 3M8OH 4JPKH 5JPMB 1RK0B 1RZJC 2LU4A 3CVHA 4BJLA 1ZLWK 1J87A 1A9BA 3BAEL 4JRXA 1NMBH 5GRVK 1PSKL 4OCRL 4ONOA 5DEFA 4JFEE 7FABH 3BRDA 1VEMA 1G9MC 1XZ0B 4QRSA 4NOBA 5FOJA 5HGGS 1DBJL 3DVNA 4JAMB 4J8RB 5HYJA 2HRPL 4YHOH 4XCFH 3RKDD 5AUMB 4JZJB 1CL7I 4AT6B 3MCG1 3Q6FA 4PJBE 2A6DA 4YNYB 2FYYB 5T3ZD 2GT9B 1UGNA 3BYYA 3RVTC 4LGPB 3L3HB 4HS6B 4M1CD 5J4MA 3FO1B 1KTLB 5DQ9A 5JOEA 4XB8A 4MD4B 3VE0B 2X4SB 1WFUA 3HZYB 3MRDB 4NQVB 4MA8H 4P2QD 1VFUA 5GGTH 3QIUC 4OBRA 4H1LB 1T7ZA 2VZSA 5AZEH 2XQYG 4ZFOA 3FRPA 3WFHB 4OCXL 5HHMB 4E0RB 3P4OB 4KTEL 3VD9A 4HJGB 2XWTA 3K2UH 4TUKH 4LLMB 3VFTB 1MVUA 4I9WD 4CKVX 3VFPA 1CE1L 4GG8B 4N1CA 1CDUA 3EYFA 1ZGLB 4MJ5A 3W11D 3QIBB 4RRPA 3MV7B 4NKDB 4JVWA 1TENA 2WUCL 1KIPA 2AKRA 4XWOD 5EO0B 3KLAB 4EQ3A 4A2MA 4I48A 4N8CL 3ZDYE 1KC5H 1IM9D 1IQWH 1HZHH 2EE9A 2L4OA 3BW9A 5HI4D 4R96A 2BVYA 4OUUA 4AMKH 4ZS7L 5CGYC 5HXMA 1NUDA 1VEPA 3OB0H 1UH3A 4ZPVB 3TNMA 5JOPD 5H37H 3BWUC 5BJTB 4XPBH 2NPLX 1IM3B 1VERA 3T0AA 1PKQB 3D69A 3WSQH 1Y18B 3GMNA 4HG4K 1EVTC 2ZWLT 2VXUH 2AK4B 3BVNB 2CDEB 2FD6L 4PY7A 5CSGA 4NKIL 4HUMB 1DDHB 4S10A 4L1HA 3FT2A 1EBPA 1QP1A 4LASL 4MDIA 4DOHE 1QACA 4HJJL 2H26A 1RI8A 3RVVD 3RUGA 3G9VA 5C6WH 4DUVA 1UA6L 3Q0HA 4HV8B 3IF1B 3GSNH 4FQQB 5BV7B 3T2QA 1T66C 4FZEH 1MPAL 4HXAH 3RGVC 3RI5K 3LQAH 2NY5H 3LRSA 1KGCE 2R29L 4KJPC 4XMPH 3SY0A 3VWKA 3WHE1 4JPWL 4BSJA 4X7EC 3PV6A 3CDGB 5IMMA 3RZCD 4LFHG 4FQPA 5DGRA 3H3KA 2XZAL 1FRGL 3SBWC 3MUHL 4YHPA 4NHUB 4HUXA 1F4WL 2EYRB 5DMGC 2W0KA 4Q6IB 2VAJA 3QDGE 3STLA 3X11A 5CBAA 4KJWD 3I3EA 1AO7B 2DLFL 1BZ7A 1M71B 3QEQB 5SX5H 5CJBA 3MJ8A 2ZCHH 3D2UB 3TIDB 3KS0J 1KB5A 2QQKH 2G9HB 1A9EA 2B4CL 3LZFL 3VCLA 1I8IB 4GXUM 3C60B 3ZO0A 2NY4B 4JR9L 2XY2A 1S7SB 3QULB 4G8IA 4KMTL 3T0EA 1KJVA 5EU3A 2WM0A 1NLDL 4TOYL 5K59F 4OQ1A 1S78C 1ZMYA 3UDWC 3TA3C 5FF6B 4MNGA 4QT5B 5CLTA 3VXME 3V4UL 5T1MB 3TBVB 5EO1A 3WNLA 4TULH 2BNQB 3KYKH 3MRLA 2I25N 1ZK9A 1FG2B 3DX6A 5A40E 4XXCA 4JJ5A 4MD5A 1JIBA 5HGDB 1MEXL 1CGUA 2ZUXA 2DYPA 3QQ9D 3IETA 4JZNB 3MO1A 2WIIB 4HWZB 1MCOH 4JB9L 4XRCA 4HS3B 5BS0E 1QBML 2R2BA 4FXGA 4LSDA 1E28A 4GMSL 1E4XI 3QQ4B 2NNAB 3U4EA 4EIGB 4ZPTB 2BSTA 2UYLB 5HHOE 3WJLA 2FIRT 3OHXB 4WI7A 3QXAB 4H1LG 4V1DD 3VI3F 5I1EL 3HE6B 3P77B 1A4KB 1T0MA 3FO0L 1OCWL 4WV1C 1A64A 2BRRL 4YEEA 3UO1L 5E00B 4PJDB 4EXKA 5IB3A 5IB4B 3VXRE 5BS0A 1OWWA 1BWWA 3P4NA 5C71A 2CIIA 1YEJH 3CXHJ 1RU9H 3MRRB 5AYUH 1KIQA 4HUVA 3JWDH 1LEKA 1G7JA 5LAXA 1WIPA 4Z18A 3W2DL 3L3OA 2YMXH 4GLRH 1T21B 4U0RB 1HDMB 3AREC 5ID0B 1JPST 2VXTL 3TT3L 3F6LA 1AGFB 5E2TL 2XPGB 1CLYL 1KXQE 2NR6C 4NC0B 3GBNH 4Z8FL 5CGTA 3VI4F 1J0ZA 5I6XC 2V5MA 2WWMC 3DRTB 3P9LB 1UB6A 1YEDB 4BQBA 4FQXA 3ZDXF 4KAQH 1DQQB 3SJVD 3SKNB 5CEXB 2V17L 4WI2A 1CCZA 2PNDA 4HH9A 4PIRF 1IAOB 3MXWL 4TNVK 5D8JH 3GSOB 3S35L 1YUHA 3PXJA 4P4KC 1CXHA 5DK2A 3O81A 3ULVH 3U9UA 2ERJB 3A67H 4NPYA 3F7YA 2VR9A 2E8YA 4OM1L 3L5JA 3NABL 4ZTOH 4RDQF 5JQ6L 1JGEB 2AV7A 1BJ1J 4IJ3C 4UBDC 3GJFB 3QO1A 1BECA 2ATKA 5IP4A 4F80A 1UWEL 4FQLH 1RZIA 5HGHA 3MCKA 4BUGA 4O5LL 4NGHH 2NX5A 1C12B 4EN3D 4F7MB 3R8BB 3S6CA 3BZFA 8FABB 1BEYL 4CU7A 4R3SB 1MNUL 1HSBA 3GMQB 5INDB 3QFDA 4OZGE 5IBLD 1UJ3B 3N06B 3DO7B 2IH1A 2YD5A 4L3AA 4LRNH 4DZBA 2O5XL 2Q76A 1KCUH 1MCEA 1I7UA 2COQA 2E9BA 4Q97A 1LE9A 5F9WC 3NIGF 1R3JB 4LSQH 3U9PL 3D3VB 4MJIA 4WU5B 5MERB 1G6RA 1U3YA 4XP5H 4MQSB 4NCC1 5JOFA 2PTTA 1PEZA 3ECBA 5E4EB 2DD8L 4F33B 5IIEA 1TZIA 3OGCB 3HC4H 2NY0B 1L0QA 5EFIA 1ZHBB 3H9SD 4QRUB 2ITCB 3UTTE 3K74B 5DTFA 3S3JA 1MJUH 4OZHE 3NCEB 4X9HA 2B2XL 5EUKA 4X6BA 1TNNA 4DFIA 4OLUH 4G7YL 3O4LE 1IL1A 4ENED 1ZXQA 5L7XH 4HPOL 3P9MB 4MNHB 1U8OB 4M3KB 3FQTB 5I15L 1JHLL 3L5HA 35C8H 3IFPB 5K9OB 3VW3L 1N6VA 1GOHA 3TIEB 2Z91B 3CLFH 4PJ8D 4WI3A 1NFDB 2D0GA 3CVIL 3D25B 4GSDL 5EC2B 3DIFA 2ADFL 1A6VH 5IOPA 2K1MA 4NBZB 3UTTA 4OZHA 3W82A 3DV4B 4HCRH 4FTVE 1WWWX 3EKCA 2FJHA 4Q9BA 1G7QB 2BVQA 3GK8H 4M7ZC 4MVBC 5CUSH 5B21A 4R26L 5T3ZE 2XKUA 4JZOA 4ZUUA 3GSRA 4ELME 5ITBH 1QNZH 3HMXH 1SM3L 5EWIL 1BX2B 1P84J 1ED3A 4Z7OE 5EU5B 3FQXB 1IKNC 4P2QE 3FRUA 2NY6B 3C08H 2UZIL 5DHYA 1SY6H 2PYEB 1N8ZB 1WEJH 4QOKE 3U0WH 2E9JA 4FFZH 1KCVL 3IKCB 2YPKB 1Q9LB 5ISZD 4G7VH 2DQTH 3TBYB 3TO4D 4ODWA 43CAA 1UXWA 2B1HH 2VERN 3HC3H 3GHBL 1J8HD 1O0VA 5EZJB 4YBLC 5F72S 3IDIB 3QA3A 1FO0A 1XCTA 3GKZA 4JO1H 4LSVL 5DJ6B 1JWSA 4A6YB 5CEYA 5BZWB 1JGLH 5FO8B 3O9WD 3INUL 5C0RH 4P2QA 5CJ5A 4DGYH 3BGAA 1I1FB 4Y5YA 5C07B 4ZO9A 4HIJB 5IG7A 3OV6A 1IGYA 3S37H 2FSEB 2EC9T 1BFSA 1W72A 4JLRA 3C6LC 2GI7A 1ZEAL 4P57B 4FOMA 4TVPH 5E2VH 5T1LB 5F89B 3WO4C 1QTYT 4RWYH 5JOPE 4GKZA 4MA3B 1Z9LA 2FEDC 2FIKA 3R0MA 4TVSa 1N64H 1T1YB 4YO0A 2VIRA 3EJYD 1UYWL 2Q87A 3Q5YA 3ZT6A 1IAMA 4PJEB 3TVMD 4YHZL 4N0FB 2HWZL 4L4JA 1T7YA 4HBCL 4HT1L 1H3PL 1IM9A 3T0BA 5EIIB 4EDXB 5EO9B 3VWJC 3OR6B 4HMCA 4IRZL 2LU3A 4M02A 4N0YL 1JV5A 3KXFD 3PUCA 4X80H 5J13B 3WL9B 3AU1B 3MLSL 3G6JF 3IYLW 2HMID 3TT1H 4HKXB 3LKSB 4XP6H 3AAZA 3IKKA 2C3HA 5TH2A 1QQDB 1XMWA 1WBZB 3VMNA 1JZ8A 1MWAB 4TNWK 2R1XA 1AHWC 1OARL 5SV4A 2I9LA 1UZ8B 4OT1L 4LLYB 2C1OA 5E2JA 5LG1A 1I75A 3GFUA 3GMMB 4OLZH 5F7UA 1G9NH 4ISVA 2VLJB 3QXWA 1Z9MA 1Z5LB 1RUQL 1DE4B 2APTA 4DEPB 3P3YA 2FJFB 1FJ1B 3DMMC 3CUPA 1MCCA 1CS6A 1LP9E 3CC5B 2P24B 1AGBB 5BW7A 2PR4L 3GJEB 3K80A 4I18A 5GJSH 3ZTJH 1CFBA 2LFGA 3ORJA 2FLBT 3L3DA 3O2VL 3RZCA 3ZKSD 4KKNA 4GRMB 2H32B 1EO5A 4RCAA 1GGTA 5GIRA 5I8OH 2VZVA 5IMOA 2XFXA 3QHTC 1CF8H 5LXGH 1XGUA 2X4UA 3G08A 3LSOB 2O26U 3DBXA 4CW1A 5EORH 3SDDB 4ZTPL 1HCVA 5D2LE 3FB7A 2BX5A 3LEXA 5ANMB 3H7BB 3NBNA 4RMSA 5KBNC 1D6EA 3S98A 2YD4A 5C7XL 3PP4H 5HHMD 3I50H 1A6UL 5E08H 1UQSB 1A1NA 3O45B 4I3SL 1OSZA 5JR1L 4J6RL 3AMLA 3MV7D 4O2FA 3WLBB 3QG6B 4XGZA 2G2RA 2GTZA 2H41A 3V4VH 1AC6A 4PRPE 1LNUB 2APWA 1A6WL 4KHTL 1U91B 1WICA 3RGHA 1FC1A 4JFFA 1BM3H 3K8MA 4M93C 2EH8L 4FQ2H 5DRNA 3GSQB 5FFLA 3F12B 3ARBD 5E8OA 3ZKNC 3SOBL 6FABH 4GO6B 4HUUA 1DSFL 2BHUA 4WFFE 2MWCA 2A74A 3G5YB 2IANB 3V0VB 4WHTB 4KZDL 4YXKL 1N6QH 4KI1A 4ODVH 4D0DB 5K9KB 3HI5H 2GQHA 4V1DA 4YDIH 4LEXH 5HDQH 5KOVC 4MXWL 2VH5H 1KT2A 1FLRH 3STZA 2AK4D 3QRGL 3D9AH 5DJ2A 4MS8C 3ILPB 4HKZB 5GRYA 1X5KA 2Q7YB 1HH6B 5L2KD 4U7KA 5CCKH 3BEVB 3R06B 2F53E 2XKNB 4KI5F 3LS5L 5I18H 4AEHH 3QIWC 2WANA 2SEBA 4PJ7A 2DJSA 1LE5A 5IHBA 2JCCA 4POUB 1Q0YL 2WNGA 3VFSA 1Q9OA 2A9NH 3QUZC 3DUUA 5ICXB 1OM3H 4LKXA 1KN2H 1J9CT 1RMFL 5FYLD 1T1ZA 2VDKL 1KF9B 5CIPH 5F9JA 2H6PB 5C2BH 1Z2KA 3OJDA 2DL2A 2Z92A 1AO7D 1XF4B 3QEQD 3ARFB 1TQBB 2HG5B 5DSCB 5DJXB 2MSPA 4N0RA 1C08B 3SJVA 2H2SC 2XI9A 4N9OB 3CSYB 3C60D 1MHPH 5CLWA 2NY4D 4WDIA 4MZ2A 2PN5A 1ZT4B 4HC1H 3HNVH 3REWB 3SCMC 5IEHB 4U6HA 5DGQA 3VG0H 5BVJA 5E6ID 1YEHL 2FDBP 2VXVL 3KS0H 4NDMB 5IT2L 3WXWL 1LQSR 2G5BB 3BUYA 4NN6B 2W0FA 1IGIH 3F65A 5T1DH 4EN3A 5C0DA 4NQDD 2Q8AL 2E6PA 3L3IB 1OD7A 4U1NB 3RWHA 2EIBA 4QTIH 1E4KA 4D0BB 1B88A 4ZUWA 2EDEA 2CDGA 3QAZB 1IC4L 2HFFB 3H9SE 1MIML 4Y2DC 5IK3B 2PCPA 1IFHH 4Z7VE 4JVPA 5GRJL 3QDHA 1RJCA 2DQEL 1RFDL 1LO5B 1OTTD 1H3TA 2JIXB 1RUPL 3RPIA 4JHAH 5CILH 2ARJQ 3MRBA 5HHPB 1JTTA 4Y4FB 1MSPA 3QXTA 2VDQL 1KPUA 2DL9A 1BBDH 2C9AA 3MLZL 4ZAKC 3U2SA 1N3NA 2VLRE 1UM6L 5I75C 1IILE 1T7VA 1MJ8H 5F1SA 1OAXH 3GEWB 3H9SA 1MCPL 3VXQB 3ABZA 1ZT7A 4U3XA 5DHVH 4S0TD 3VRJB 4MLIA 3VU2A 2AJ3A 1RZJH 5I1KH 2Y7QB 3GRWL 4FQHA 4N5UA 2IGFH 4I0PB 2YUVA 4IOIA 1NAMA 4G42A 1AKJB 4FQCL 3L95B 3CLEL 5TDPA 1G9MH 2OJEA 1CTNA 3OXRB 3KPLA 1GGUA 4PJ8A 1H0DA 4MMXC 3V95A 4ZFOL 5T3XL 4LPWA 4HZLA 3FOLB 4XPHH 4BH7B 3QWRD 4IRSD 3RFZC 3IJSA 1IZKA 4KVNL 3FAWA 2IALB 1NMAL 5E5MB 5D2NB 4GAFB 1MCQA 1LO0L 1I1CA 5DJDB 4FFVD 1V3MA 5TF0A 1I1AB 1LD9A 1TIUA 5ISZE 4UZGA 1ZGLM 1EGJA 4DN3L 1A0QL 5D1ZB 4M00A 3PHQB 1S7UA 3CX5J 3H9YA 1RUMH 4PJGF 4PJDF 2O5YL 3E3QC 4MB5A 1JPGB 4PJXE 4PG2C 3P11H 5TPWL 5HDLA 3OKKB 4LCYA 1BVLA 4M48H 3ZDZF 3MOAH 4LSSH 4X5WA 4K7PH 1DLFH 3CFCH 3ARSA 4XVUC 2UZXB 3KAAA 3HMWH 5T5FL 5D93B 5FA4B 3MNZA 4RZCA 3FJTA 3QI9C 4ZFFB 1EHLH 2Z8SA 3WN5A 4JM2B 5ISZA 4LARH 1U8MB 4XXDA 1RJLA 3TO4A 1M4KA 5JZ7C 3UYPA 1GGIL 1TMCB 3MYZA 4X6CB 1J8HA 4U6VL 3BQUC 4YFDB 5J6HB 1LEIB 4UT6H 3N1PC 4H88L 4NBXB 1H3XA 1GGBH 4JGUA 4ODXB 1ONQB 2BOBA 3MBEC 3I6GB 5IHZA 5AG9A 3C87A 1C5BH 3FCTB 1JF1A 2H3NB 3O9WA 3QPXH 2G60H 3D3VD 1BJ1H 4F58L 3NA4A 3PXHA 1B4JL 5F96H 3TCLA 1IC7H 1SBSH 3CSPA 1T5WB 3WKNA 5HYQB 1ZT1A 1CT8A 5DLMH 5I66A 2A9ML 4PJFB 3KXFE 5DC0A 1ZS8B 4KKCD 4XC1H 4XPFH 3QUKB 1T83A 3O6KH 1U2CA 1JNHA 1IGCH 5D5MF 1YPZE 2Q7NA 2MHAB 1P2CA 1NL0L 4YHNB 1QUNA 2PW2B 1MIEL 4ETQB 3Q1SL 5KSBB 3H6JA 2MCPL 3IU3B 3TVMA 4BFBD 2A83B 1H3GA 1DZBA 4K7FB 2H2PC 1AE6H 4ALAH 4GMTL 3D39E 1RZGA 4XX1E 1J88A 5E8NB 2AVGA 2V2XA 3WD5H 3CFJA 2XRAL 3H2WA 3ROLB 4UOJA 1W0YT 4XNYL 4C58B 1L7IL 3DROA 4PV8A 1I9EA 4UNUA 4UV4L 2YD1A 3EDKA 3GSUA 3MQIA 4WGVB 4QRPD 5D1XD 4LSPH 4LVHC 3BAEH 1AR1C 2DQGL 4OCRH 3ZKMC 4JPIA 1DCLA 1T2XA 4G3YL 5J1TC 5D9SB 2ATPB 4Z78A 1DBJH 4JHBA 3E2HC 2HRPH 5IVXB 4WFHD 5A2LH 4KV5E 5C3LD 5JPMA 1RK0A 3ULUF 1UWXH 2HTKC 2I5YL 4JFHD 1R5IB 4IMLB 3U30C 5E8EB 2J8UE 4GFTB 1KEML 2IFFL 3CSGA 2YUZA 4D2NA 3WFZA 3G6AB 3K1KC 3RY6C 5TDOB 2IPKB 4JAMA 4J8RA 4LLWB 4MQ7A 4Y16C 2W0PA 4K3HA 2D03L 1T89A 3CD4A 5DJYB 4AT6A 3OBAA 2IQAB 3BP7B 4YNYA 1UT9A 4U1HB 4UV7L 4P2OC 4YDVB 4ZXBD 4HS6A 4OCXH 2XTJC 4EDWH 3L9RA 3FO1A 3OTTA 2VUOA 2XQBL 1X4ZA 3B9KB 3VE0A 2E7LA 2X4SA 3HZYA 5CBEA 4U6TA 4NQVA 1OGAE 3EYVB 4K07A 4KMLB 4YHYC 4NCC2 4KHXL 2BDNL 4H1LA 4C59B 2PW1B 2VLKE 3WJJC 5C07D 1EZVY 2A38A 4LQFL 1U8PA 3QWOA 4TPRH 3DSFL 3IAGC 3WFHA 4P9HL 1F4HA 3P4OA 4HJGA 3MZGB 3VFTA 2VC2L 1WFOA 4QF1B 4MXQD 4OZFH 3IU4L 5T1LD 1ZGLA 4OF5A 3MV7A 4JQVC 4ZS7H 5GISH 1JGUL 2ED9A 4P23B 5CP3A 1JNLL 3EZ8A 5EO0A 3KLAA 2DLTA 4GRLB 3LKOB 4WI8A 5JW4Q 2DI8A 4HUKB 5L2KE 5DXWA 3ZMRA 2V9QA 3ARBA 2FD6H 3QISA 4G5ZH 5DA0B 1HINH 2NY7L 5KVFL 4Q2ZB 1YN6A 1JGDA 1N59B 4NKIH 2BRQA 1P9MA 5DRWA 1FE8L 1FZJB 4C55A 3QFJD 4LASH 1FFPB 1E4JA 2KPNA 5KANI 1CIDA 1IM3A 1PKQA 1FDLH 4YXLH 3T2OA 1Y18A 1OP5H 1M6OA 2BFVH 4UI2A 5BVPL 4UIKH 4JKPL 1Q9WB 2AK4A 3BVNA 4MQXC 5FYLE 4QWWD 4WHCA 1DDHA 2P8MA 3KDMB 3WDHA 2VLJD 5L2KA 1OAQH 3BKML 1YQVH 3H3PL 1FRGH 3BD4A 1AFVL 3FN3A 5KSAD 3IF1A 2EDDA 3HE7C 3GIZL 4IOFC 4HK3N 5MENB 3B9DA 1MRCL 2DLFH 1AGEB 4PJEF 5GHWH 3OB8A 1CLZH 4RX4D 2FATH 4JHWL 1HXYA 1G6RL 3CDGA 3LZFH 4NQUA 3CH1A 4G8FB 4Q9QH 1A21A 1FNSH 4JR9H 3QG7L 4F9LC 1U8NB 4KMTH 3HAEB 3SDAB 3VH8B 2QTEA 4DUXA 1W0VB 4Q6IA 5IQ9B 5B22A 3D0LB 1NLDH 3BPNC 1AO7A 4TOYH 3QEQA 4PJ9B 3M17A 4KQ3L 4WFEE 3SDDD 3TIDA 3ETBF 3KPMB 3C2SA 4HKBA 4NFBA 2G9HA 3AS0A 3V4UH 1I8IA 4NQDE 2VABB 3C60A 3QULA 3BGFB 4XHJD 3O3DA 4KK8D 1FV1B 2RBLA 3U36B 3UTQA 4DGVL 3PWPE 1JRHL 4OJFL 3TN0B 3C5ZD 4R0LA 4NO3B 4JB9H 5E6IA 4HJ0D 4RFNC 2I9TB 4QT5A 4P59L 5T1MA 1HEZA 4EXPX 2A6KB 2YS4A 1B0GB 1FG2A 3PWVB 2VR5A 2VLMD 4NQDA 5I1HH 2DM7A 4JDVA 5L88L 4JZNA 3W39A 2J5LB 4P9HC 5FM8A 1X5HA 1OCWH 4LL9A 2WWKT 4NZUH 1KV3A 5JIHA 4K7PY 3C2AL 3UO1H 3AROA 3QQ4A 3WHXA 3REVB 2EEDA 3QT2A 1KN4L 4ZPTA 1A6ZB 2UYLA 1T1XB 4KDTC 4YHKL 3QXAA 4YHML 1HI6B 2NY2C 5LJYH 3UAJC 1F11A 1T2QL 4PGEB 4G9FD 3HI6H 4KK9D 5HVHB 3MLPA 5EU6D 2FEEL 3W2DH 4UT7H 5IB4A 1D9KB 3RVUD 1MCRA 2VXTH 3TT3H 5E2TH 5TE6L 1CLYH 3WUWG 3MRRA 3U0TA 1FO0L 2XWJB 4KROD 1LK2B 1MJJA 5FYJL 4XVTL 4ESKA 3QPQC 4ORZC 1TVBB 4MA7L 4YBQD 4LNRB 4AIOA 2CRYA 2ZZUT 3CXHK 1HDMA 4BSWB 1B3JA 5ID0A 2V17H 4RSVA 1AGFA 4F8TA 2XPGA 3MXWH 2EDHA 2ZPKL 3S35H 2X4OB 1FNLA 5C0JB 4U7MA 3RWCB 3QWRA 4IRSA 4JM4H 4APQC 1W72L 5FYKD 3B5TA 5DD3H 5IB1B 3ARFD 3V7AG 3DRTA 1YEDA 4XZUA 1DQQA 4KRPC 3SKNA 4D0CA 3NABH 1ULVA 2V5SA 5JQ6H 1X4YA 2OLDA 5CEXA 4LSUL 1IAOA 3U7YL 2E7BA 5B4MC 5EULV 2IWGA 2EDJA 4JDTH 4OLVL 4DK6A 2LVEA 2BC4A 1BEYH 4HK0A 1IGJB 2A6JB 1NGPL 3MRGB 1C16B 4DTGL 2Z31B 1DBBL 2NZIA 1J0HA 3LV3B 2NY3B 1JI1A 1U36A 1YJDL 5SWSE 1IAIL 3Q3GB 3GMLB 1NUFA 3EYSL 4X5LA 1K8IA 3ROOB 4R97C 2CLZB 4R3SA 4PRID 5INDA 1J7VR 2V5YA 1UJ3A 2LE9A 4L4TD 4TSCH 2Y5EA 3A0OA 1T3FA 4K8RD 3Q6GL 5L8JB 3GI8H 3PDDA 4HKJB 3D48R 3TESA 3D3VA 4RIRA 4WU5A 4WTZG 2B2XH 4MXVF 4Y4FD 4G7YH 4HPOH 1AI1H 5IB5A 4XMKL 1CGSL 1S7RB 4AIXA 5I15H 1JHLH 4WRLA 5CINL 3VW3H 3Q48A 3SE3C 2ITCA 1ZSDB 1U8LA 4QRPE 3CVIH 4GSDH 2AJUH 5FGSA 2JJTA 1ITBB 4PS4L 3BO8A 4XCEB 1MCWW 3MNWB 2HTLD 4KRMB 3P9MA 4MNHA 5DA4A 4F37F 1U8OA 4HX1A 4TTGA 3PG2A 4ZSOE 3FQTA 5FAAA 1FZKB 3IFPA 2X2YA 3V6ZB 4NQXB 4U2YA 1N6UA 2UWEE 3DVFA 1YEKL 2IBZX 1DTUA 2RGSA 4GG6B 4EI5C 1NFDA 2EE3A 4Q9RL 3D25A 3FQUB 1CLOL 4OLWL 5EC2A 5JLZA 4X4ME 4YBHA 3W5MA 2R1YA 4QRPA 1WTGT 5D1XA 1Q9KB 1A1OB 1G7HB 4WO4C 3GBLA 3QEGL 1I1AD 1JPFB 1PD6A 2D31B 4OLXH 4Z0BH 1AGCB 1G7QA 2R0KL 2UZIH 3EGSB 4LLDB 1UWXK 4JREC 3T3ME 4Y5XA 4J3UA 1KCVH 2F19L 1KIRA 2UWEA 3HG1D 1CL7H 4L3CB 5FEBA 3GSNB 3BIAX 4BELD 3SDXB 3FQXA 3SE9L 4KKBD 1EO7A 1G1YA 1MCHA 2WIMA 4LSVH 1I3RA 5MEQB 4P9ML 3C5JA 5DK0A 5DJZA 4YPGA 3QUMH 3P4MA 4Y8DC 1N8ZA 3HPJB 5KJRH 3INUH 2Q3ZA 4JM2D 1R24B 3IKCA 2YPKA 1Q9LA 3MRHB 4M7KL 3TBYA 4D9LH 4ZFGL 2R56L 1NCBL 1CFTB 2H1PH 5EZJA 2CRZA 4C83B 1TFHA 2R1WA 4ZXBA 4UDUB 3IDIA 2DWEB 4ZO6A 2AJZB 2VLLB 3JV0A 3WS3B 4A6YA 2JJSA 4NRZB 4GQ9L 1JFQH 1ZEAH 2HJFB 5E2UL 4F15C 1YJDC 5FO8A 3HS0A 2NY1C 1I1FA 5E9DB 1QRNB 2F74B 3MOBL 5C07A 1S7XA 1UYWH 2VKXA 4HIJA 5F7EL 4QY8B 3LB6C 2FSEA 4PGJA 4YHZH 2Z8VC 1BQLL 2EIEA 1OTSD 4HBCH 4HT1H 4L8SA 5DD6B 1H3PH 3QFJE 4P57A 5T1LA 2WMPA 5F89A 4TTDC 5I1AA 5LWYL 4N0YH 2V2TA 2J2ZA 2Y5TA 3L1OL 1WJ3A 2NXZC 3JV6A 4IDLA 3MLSH 3KVQA 5F7YC 5BO1L 4GBXB 4N0FA 2ZG1A 3IXTB 3MA7B 1FVEB 1Z0NA 4OKDA 4EDXA 4NZJA 5EO9A 5EIIA 1OARH 3OR6A 1DBKH 4KKAC 4R4BB 4OT1H 1QVOA 4X6CF 4DKEL 5LKNA 3UP1A 1OP5K 1A7BA 2P7TB 1U58B 3QFJA 4QXTA 3AU1A 4OLYL 4MHHG 3RL1A 1RUQH 4YZFF 1ZLUH 1FGNL 3QNZB 4HKXA 3LKSA 4JFXB 1OAKL 1QYGL 4POZC 5TDNB 1TJGL 3UROR 4GRWB 4XAWH 5FUZH 2D0HA 4W81A 5TE7L 2HT4D 3HNSL 1MWAA 4UDTB 4JKWA 4MHHI 5A3ID 4K3JH 3AM8C 1TZGH 4WHDA 1GC1L 5F7FA 2PR4H 1G7LB 5ABDE 2VLJA 3EOAB 3G5XB 2HLFD 1Z5LA 4R4ND 2VE6B 4G9DA 5FGCB 4L8DB 3IDJA 4F7TB 5I8KL 5KSAA 3CC5A 1T80A 3OKEA 2P24A 5K9QI 4MDJB 5KSBF 3QUYC 1AGBA 2OX5A 5GS1A 3GJEA 3QEHB 4ZTPH 3RWGB 4RX4A 5EBWA 4NKOB 3LH2H 4YC2C 4HZAA 2X70B 4B41A 3FAXA 2GJ6B 3HUJB 4M1DL 5GS0C 2WZPD 5GGRB 1VCAA 2IAMC 5EU4B 2CLRB 3K46A 5FYJE 5IROA 3V0WL 2ZG3A 2Q8BL 4IMKA 3LDBB 1LWRA 3LAFA 5H37G 1A6UH 1II4E 1FQ9C 3B9KD 3SDDA 2C7UA 3LEYL 5JR1H 3ARDD 3ALXA 5I73C 4J6RH 4NO0D 5DHXB 1MLCB 2P5ED 3MJGX 4S0SD 1EEZB 3A6BL 4M6ML 3GSWA 1QO3A 4KHTH 1JHKL 5IVXF 2E6QA 1J0IA 5D71L 3I9GL 1WV7T 3EDFA 1UQSA 3O45A 2D7NA 3C5ZA 2EH8H 1Q72L 1LO4H 25C8L 2X1WL 3SOBH 1KPVA 1JHTB 1DSFH 1XR9A 2OI9B 5C0BD 3WLBA 3RNQA 1E4XH 5D6DC 1LNUA 2X1OA 3UEZA 4KZDH 5HYFA 1SEBA 4GRLD 4G9FE 3AS1A 4I4WA 3IDMB 4NN5C 5EU6E 4M8QB 3RI5F 5HPMA 3EFDH 3TFKD 1GPOL 4AH2A 2AQ3A 2Q6WB 5MI0B 5E4IA 4MX7A 4L4VB 4MXWH 3GSQA 3F12A 3QRGH 1MAKA 4N0UE 4S1DD 5I0ZA 3G5YA 3C09B 1RJZB 4XNUH 4O51B 2YKLL 5K9KA 2VSDA 5KN5A 4JRYB 4G9FA 5BXFA 2DQUL 3ILPA 4HKZA 5EU6A 3PGFH 2Q7YA 1T20B 6CGTA 1MHHB 3RWFB 2NYYC 1NGQH 4N0UA 2HVJA 3GMPB 4LHJB 1UZ6F 2VDKH 4LCCB 3VDAA 4UQ3B 1ACZA 3F5WA 4OQTL 2A2QT 3RTQD 5E1HB 3M45A 4LSRL 1CFVL 3P30L 1MFDL 1GC1C 3KLHD 1SEQL 5ICXA 5FGRA 1TDQA 3EZJB 3WIHH 1SJHB 2D7PA 1JK8B 4ONGH 1A7OL 1D5MB 2H6PA 5ESVB 3NIDF 3THML 3VGAC 4PR5B 5HY9B 4NN7C 4X7DC 2VOTA 4X6DB 1EUUA 1XF4A 5ENWB 4PJ9D 3ARFA 3NFPA 5DSCA 2HG5A 1UADC 1YMHA 1BREA 5DJXA 2AEQL 3NH7L 4O9HL 1YEHH 3MV11 4PREB 4ZDHB 4U1LB 4GKNA 3G5ZA 5TGBB 4PRIE 2NTFB 1TVHB 4KRLB 2KQMA 5IT2H 2QKIB 2EYTB 2AGJL 5HI5D 1ZT4A 4L4TE 3UPRA 2VTFA 3SGEI 2YOCA 5D7LE 3QB7C 3IVKB 2A1WL 1DN2A 1IC4H 2YUXA 1MIMH 1MY5A 4AEEA 5F7MC 5GPRA 1JWMB 2EIZB 4IBLT 1I9RL 5FYJU 4FQJL 5GRJH 4K2UL 1RFDH 1E6JL 1B0RB 4NRXB 1RUPH 2DF3A 4X5XB 3L3IA 4HIIB 4U1NA 4M9PA 5F1IB 4IS6B 4PRIA 5DS8A 3NOIA 4OD2B 1A3RL 2VDQH 1XGQB 4L4TA 5IW1A 5CWSB 5C0CD 5IK3A 1NBZB 4KY1L 2VDPH 5DI8B 1YNTB 3ZDXE 4XWGH 5I1JL 4KZEL 4LCWE 3N0PB 1MCPH 1QSEB 5C0AD 1LO5A 2WBWB 1CDJA 1EUTA 5C08E 5HHPA 5DC9B 4Y4FA 4RMVA 4LHUB 5IJVB 3GRWH 2BK8A 1I7TB 3P73B 3DVGB 4PRHD 1T1WA 2R0LH 1YNKL 2UUDH 3RHWF 3FN0H 4FQCH 3DXAB 3TCXA 3L7FB 3CLEH 1KG0B 4TNVF 1ZKAA 4LAQL 1J5OH 3WEXA 2X7LA 1KACB 3V52L 3MMEB 5T3XH 3VRJA 1KXVC 3U0PB 3L3KB 1I7ZB 2Y7QA 2OS7A 2FH8A 1LVEA 3DWTA 1NMAH 4I0PA 1ZHNA 1C5CH 2B1AH 2CK0L 1LO0H 5LGHL 3MSPA 4HUWA 4UTBL 4P5TB 3OXRA 2CKBL 3HG1E 4DN3H 1A0QH 1CLCA 4QNPF 4X7SH 4WGWB 3O8XB 4AK1A 4OM0L 4XCCL 3FOLA 1RZ8B 2O5YH 1AQDB 4RGNB 1FYTB 5TPWH 3TZVB 1XT5A 1AGDB 4PV9B 3DV6A 5F7LB 1GGCL 4K9EL 3PDOB 1HHIB 5D2NA 3U6RB 3EIFA 3VD5A 4FQIH 5DJDA 1X7QB 1CD1B 4QRQB 1FL5A 1I1AA 1XGYL 2HT3D 2BNRE 1MRFL 4YDKL 3RZWA 3VFUB 4G6AD 3V2AR 1VGKA 4L3ED 3QCVL 4QRRE 3HG1A 3KPRE 4XVJL 3OKKA 4QGTA 4PLJD 3TC9A 1GGIH 4U6VH 4XCNB 4OGAD 1HKLL 1I8LA 4H88H 3CX5K 4DK3A 2NY3D 4UU9B 1U8IB 4X4ZA 5FA4A 4RBPH 1AD9A 3BIKB 4NQSB 4F58H 4JM2A 1CU4L 2QV2A 3QQ3B 1B4JH 3MRQB 1U8MA 1YEEL 1J0JA 5L6YH 4NWTL 4X6CA 1Z9OA 4WU7B 5J6HA 1C8PA 4NC1C 1LEIA 2A9MH 4BK5A 4DGIH 4ZUSA 3B8SA 1ONQA 2DQCL 3NGBC 3SE4C 1TXKA 4PRBA 3FCTA 4BKLB 2C26A 2H3NA 1U9KA 1YQ2A 1BQSA 1QSVA 1NEUA 2CD0A 3MNVB 1OAZL 4ERSL 4S1SL 1NL0H 3QDJB 4Y5VA 5BV7L 2R39A 3CVHB 1ZOXA 3ZT5A 1B9ZA 5HYQA 3ILQD 4JRXB 4XCYB 1O5DT 4PJFA 5F6IC 4GMTH 3QUKA 3HFML 1MAMH 3DVNB 5D7KE 2ESVB 4XNYH 4MJ6B 2MHAA 2X89D 4QYOB 1L7IH 2PW2A 4MAYB 1OQOA 3Q6FB 4JEGB 4UV4H 3QUXD 4PJIB 2AQ1A 4PJ5D 1DANU 4UILH 4ETQA 4JGMA 1G84A 4S2SB 4LVOB 3L5WB 2JELH 5DQ9B 4K7FA 2DQGH 1NDMB 1K2DA 3MLRL 4JZJC 4G3YH 4MJ2A 4JFEB 5FO7A 4LCUA 3UJIL 2YBRB 4OZ4B 1EERB 3G6DL 1A02N 3WFCL 2ORBL 5CZXC 5E8PB 2I5YH 2XWTB 4WW2B 4PJBB 3VFPB 4LHUG 4MJ5B 2ATPA 5JXAH 3L5IA 1KIPB 5IVXA 2D03H 4YR6B 2YZ1A 2EIDA 1ADQH 4KJYA 1PZ5B 4QXGH 5AD0B 5IWLA 3PL6C 1C1EL 4KI5C 5DD5L 4UV7H 1JNJA 4MCYB 4WJ5B 1RSFA 3QIBC 5E8EA 5HDOA 1ODAA 3BW9B 4R96B 2XQBH 2P5EE 3BH8A 3M07A 3EDDA 3DUSA 3GHEL 2QSCL 2IPKA 1QG3A 4LLWA 5ICYA 4KHXH 5GRXG 3NIFE 4WFGD 3O6LL 5DJYA 1Q94B 1R3KB 2O5ZL 2WQ8A 5CIPB 4LQFH 4ODHH 5EOCJ 3G6JE 4GG6F 3BP7A 3PWNA 4U1HA 4YDVA 4P9HH 4Y19E 2GITB 4U1JB 2HRLA 5C0BE 4WTWA 3KYOA 1BWMA 3B9KA 3OMZA 1FPTH 3EJZD 1FSKC 2J6EL 4R90H 4PGBB 3FT2B 4MDIB 2PW1A 1JGUH 2P5EA 1QRND 2H26B 4JQXA 3VD4A 1DBAL 4LRIC 5J11B 4TNWF 3SQOL 4G8GD 1VACB 5ALCH 3LRSB 5GZNC 2X9WA 3SY0B 4J7RA 1ZWIA 4LCIL 5KVFH 1AJ7H 3C6SB 3V5DA 3V7AE 3WUWA 1INDL 4FXKA 1DP0A 4PRAA 4P23A 3VXSE 3FMGL 5GS2H 3ZTJG 1ZANL 1RV6X 1DQMH 4YHPB 3SO5A 4X7FC 3U1SL 4GRLA 4UUJB 3LKOA 1R5VA 2OQJB 5CBAB 3VDBA 4DOHB 3MGOB 1N2RB 2C3GA 3MJ8B 5BVPH 1Z3GL 4JKPH 5F8QC 4CUCA 3P9WB 4GT7A 4KFZC 1KB5B 2X44D 4Q2ZA 1N59A 3MCLL 1FZJA 2XG4A 5TQ0L 3BKMH 5IKCB 1FFPA 3H3PH 3QCTL 5EZIL 5H8DA 5KZCD 4U1GC 1AFVH 2X42A 1NBQA 3N85L 3GIZH 1Q9WA 4LOUC 1MRCH 4LLAA 5JUEH 3ALWA 2VZ3A 3QDGB 4EBQH 3FB6B 4E41D 5EO1B 4JHWH 4Q6YA 2RIKA 3MRLB 4EOWH 1CGXA 4JJ5B 4MD5B 3QG7H 4PLKC 2DYPB 3IETB 3MUGB 3RTQA 2DI9A 2GSIB 4LVNC 1X3DA 2R2BB 4FXGB 5CZKA 5GRUL 2NLJA 4BUHA 2I60L 1E28B 3X3GL 4LPVA 4G8FA 1M1SA 1UH2A 2QQNL 4FRWA 3TV3H 3K4AA 1XEDA 3U4EB 4K94C 2BSTB 3VXMB 1U8NA 1S3KL 4U0QB 2CLVB 1TPXC 5DF0A 1K5NA 5IQ9A 4WNQB 4DGVH 2YUWA 1BPVA 4PJ9A 4X0KB 5DMIH 4LNVA 3ZE0F 3KPMA 4GRWF 3ULUL 4X4YB 4WTZA 4HF5L 4P59H 5BS0B 3TJEH 3RIAK 3QIUB 1XF3B 1EMTH 3KYAA 3ULVD 3HE6C 1VHPA 5FUCC 1FV1A 3FO2B 4NFDA 5C0CE 4HUVB 3VMOA 4CGTA 2GEEA 1RZFL 1TVDA 5HHOB 1FAKT 1G7JB 1OTUD 5MP6L 3L3OB 3KJ4C 5C0AE 4YHLL 5F7WC 3GM8A 1UVQB 3C2AH 3MGTB 1B0GA 3PWVA 2WSKA 1KN4H 1BFVH 4PRHE 2LAAA 4O00A 4HBQA 3VXRB 3HUJF 2IG2H 1E4WL 4OKVB 4YHKH 4YHMH 2EDTA 1ZHLB 4L4VD 4XMLL 2CUIA 1M7DB 2J8OA 4U0RC 1UACL 3TH2T 4WHYG 4DAGL 1G9EA 4HH9B 4OFIA 3F7VB 2M8XA 5AWNL 3REVA 4GS7C 5A2IH 1A6ZA 5C0AA 5DK2B 5J57B 1BBJA 5TE6H 3P2TA 5KVEL 4NZTL 3T4YB 2OR7A 3RL2B 1IT9L 4NPYB 4L5FL 4JRYD 4HGMA 4PGEA 2JJUA 1A7QL 5FYJH 4XVTH 2AV7B 5C6PB 1WGOA 4MZ3A 4MA7H 2HVKA 2R15A 1D9KA 3U7WL 4RAHA 1OY3B 3MCKB 3ARGC 1DQLL 2PYFB 3BZFB 2R9HC 3PGCA 4M43L 4JN2A 4UTAL 2XWJA 1SVCP 4Q9CA 5IGXL 1LK2A 4A6YL 3ZE1E 4F2MB 4U3HA 3RGVB 1I7UB 3B2UC 1TVBA 4K55A 3D18B 4LNRA 4U1MA 1TETL 4L3EE 1KJ2A 3KR3L 4BSWA 3WS6C 1XF2B 4ODTH 1A5FL 3U7YH 5DFVC 2BXZA 2ZKHL 1N26A 4NWUH 5JOFB 2PTTB 4DKFL 2OL3A 2A77L 4MMZC 4NO2A 5ESQB 2E9IA 5E5UB 3S36X 1NGPH 4JFZH 4M4PA 5ACZB 2X41A 3BWAA 1DBBH 2PO6D 3N1FC 4OZGB 1QSZA 1YJDH 2VN7A 1X5AA 1CDYA 1RIHL 1IAIH 2HP4A 3SE8L 3QP3A 5E4EC 4X6BB 4L3EA 3EYSH 3K2MC 2E27L 2NY0C 4X83A 3VGGA 1FVDB 2QADB 4LVEA 1IGJA 1HOCA 2A6JA 4XP1L 3MRGA 1NCWL 2Z31A 3ULUC 1J8KA 1F58L 3LV3A 4KJQD 3TA3B 3Q6GH 3KPTA 3NFNB 3GMLA 4NNPL 1RVFL 5D7JC 3V9FA 2VSCA 1MWAL 3UTTB 1B90A 4OZHB 1H5BC 5I71B 3EFFB 4XMKH 3O4LB 4YQXL 4X6DF 2BVQB 4HKJA 1D5XA 1X5ZA 4PJ5E 4XP4H 4XB7A 5GGTA 5HDBE 2YXFA 1QSED 3GSRB 4JZOB 4ZNEE 3P0GB 4CBPA 1IGTB 4PJGE 3BP6B 1ED3B 4LHUD 1D3CA 4PS4H 4P46D 4J4PD 1JP5A 2VZUA 3FRUB 4H25B 1V3JA 3EAKA 3ZDZE 5E24E 4TVPD 4OZFB 2P42B 5DHYB 3DXAD 2JB5H 1L0XA 1X5JA 1BQUA 2A0LD 4FTVB 1K6QH 1YEKH 1ZSDA 1IEAB 4Z76B 2X89A 2BNUA 4Q9RH 3QUXA 4OLWH 4ODWB 1F3DJ 4PJ5A 2ZJSL 1UXWB 43CAB 4I3GA 4XCEA 2NY6C 4ELMB 3MNWA 3FQWB 3PABB 1XCTB 1QBBA 2EO9A 5HGAB 1SJEA 4KK6D 5D1QD 4FP8H 1CXLA 3V6ZA 4NQXA 4P5TD 2HN7B 2CJUH 1I8KA 4P2QB 2R0KH 2WUBL 3AREB 2WW8A 3O8XD 4Y5YB 5GS0H 3KPNA 1MCDA 4E9LA 2F19H 4QOKB 5DUPL 2VDNL 5IG7B 2W9DH 4DW2L 4RGND 2AXJA 4I3RL 2GKIA 3TZVD 3QEUB 3UJTL 2CQVA 4P0DA 3KNBB 3SDCC 1HYSC 5D6CA 4JLRB 5E99H 1A1OA 1MUJB 5J9PB 1JPFA 2ZCLL 5EA0L 2D31A 1AGCA 4LLDA 1U95B 3EGSA 4GKZB 3BJLA 1W0WB 5D5ME 4HWBA 4WWKC 2E7HA 4M7KH 4ZFGH 4KPHL 1V7ML 3GSNA 3RX5A 5HD8C 1CFSB 3SDXA 1IM9B 3CX2A 3IGAB 5I1DB 5LGKA 5MEQA 4G6KL 1FZOA 4QXWA 4IJ3B 5A2JH 3VRIB 3EO1B 3HPJA 1OAUL 3EYUL 1U92A 3MACL 1R24A 1WAAF 4G8GE 3BZ4A 4FMKA 3MRHA 5GXBB 4M1GL 3MOBH 4QXUL 3FOMB 3EO9L 4LPUA 3UJJL 1P4LB 1EJ6A 4B50A 3WHE0 1CFTA 5F7EH 5TH2B 5BZDA 3V5KA 1MFAH 4UDUA 4M6NL 2ZUUA 1KLGB 3MODL 2VLLA 5H35B 3WS3A 3X3FL 4NRZA 4JG1H 5DEGB 1U6AL 5LWYH 4M5YH 5GGSY 2YK1L 1KENH 2W9EL 3L1OH 5F1OB 1CG9A 3IRPX 1QRNA 3QDJD 2F74A 1OAYL 2QQLL 3KG5A 4QY8A 3MV9D 1NSNH 4G8GA 3ARRA 5SWZE 5JHLL 1MHEB 5MHSD 1F90L 4BZ2L 4I18B 5F3BA 4RMTA 2FX8H 2AERT 4MJ4A 3RZCB 4DKEH 3ZE2F 2ESVD 4N1EA 5GIRB 4MAYD 4OLYH 3RA7L 5TFSL 5FYKL 4HDIB 3BDXA 1FGNH 1WC7A 3VXOB 1OAKH 1QYGH 2X4UB 3IJHB 4W6YB 1FNAA 4U1IB 3IXTA 1FVEA 4E41E 5FOBA 5TE7H 3HNSH 3NCYP 5JW5A 4YK4B 4R4BA 1JGVL 4CNIA 1LP9B 1GC1H 5IF0A 3FB7B 4JFED 1PY4A 1HSAB 1U93B 1CBVL 2P7TA 4QO1A 1U58A 4UNTA 1HQRB 4NJ9H 3FZUD 5SWQB 1OPGL 1D6EB 4QTHB 3QNZA 4JFXA 5TDNA 2Y25A 4G6ML 5C9KA 3GM0A 4ODUB 4UDTA 4MB3A 3MV8E 3EOBB 2ZOKA 3WDJA 1D5ZA 1G7LA 2EDBA 3KJ6L 4M6AA 2G2RB 2GTZB 1JPSL 3EOAA 1S7VB 3G5XA 4N5ED 4OZFG 1QBAA 3WDIA 5D2LB 1F02I 5E70A 2F5BH 5GSRA 4FQ1L 1IZJA 5HHXH 4OCWL 3AC0A 5DRNB 4PJIF 3O6FC 3D0VA 2LVCA 1FP5A 3QEHA 3LKRB 5AEAA 3RWGA 3LEYH 3LKQB 5E2WL 2A74B 2GFBA 2X70A 1JTOA 3MLUL 5BQ7A 1T22A 5EOTA 1CXFA 5EU4A 5CKGA 4M6MH 3ULSA 5DD0H 1RIVL 2L7UA 1CQKA 3KWWB 1JHKH 1WBXB 2JB6B 2NXYD 4PRPB 5D71H 1U3HD 1V7NH 4YBLB 5H2BA 1YMME 3STZB 2E3VA 4XTRD 1F4XL 4K71C 1SYVA 1RQ5A 1WT5A 2EH7L 3OAZK 4YEFA 4R4FL 25C8H 1L9NA 3CPLB 1YY9C 1MLCA 4HEPG 1C7TA 3I85A 1U8HA 4C56E 1MELA 1K3IA 1EEZA 3C9NB 4MYWB 3DI3B 4GUPB 1WF5A 4P5MB 1MFNA 2Y6SC 5F21B 1LE5B 5EOCH 1NBVL 1GPOH 2XNAB 3VFSB 1MCSA 1Q9OB 2AJYL 1OHQA 1PX3A 1CICC 3WO4B 1JHTA 2I07A 4LKXB 3CNKA 3O2WH 2LV4A 4Z7WE 2D7QA 3IJYB 2CK2A 4HIXL 3T1FA 2VDLL 3IDMA 2YKLH 2F53B 3NTCL 4M8QA 4L4VA 2EE2A 1A1MB 5IV2B 4I8DA 3BRFA 3DOSA 1QRKA 3R8QA 2MQ0A 2AI0L 3WNMA 2CUMA 4HQQL 4YPJA 5FKAB 1KGCD 2FB4L 1RJZA 4WDIB 3ZDYF 4ZFZB 4HD9A 3MBXH 2XKSA 4O51A 5TE4L 1C5DA 3GIVB 4Q74A 1OT1A 3VFWA 4P3WA 4NM8L 4OQTH 1L7TL 3MJ6A 4Z7WA 4JRYA 4P49A 3ELAT 1ZTXH 4S1QL 1AHWB 3QDGD 4LSRH 1CFVH 3P30H 5GRVL 1MFDH 3CFBB 1SEQH 1T20A 1MHHA 5EBGA 3BKYL 3IDYC 5C0FA 2EXYC 5DMKB 1A7OH 3JV4A 4LCCA 3ZHKA 4UQ3A 3FB5A 1A3QA 3DMMB 1MFCL 5DZNA 3THMH 2CDGB 3SDYH 5BOZG 2AABH 1NCDL 1A14L 1RUKL 2DQIL 1N7MH 2AEQH 1GOFA 3QZWB 3NH7H 4O9HH 2BP3A 1SJHA 1NEZB 2KZ1B 1HWGB 2Q1EA 1W2KT 2R2HA 3RPIB 1B2WL 4CAGA 2VWEC 2P47B 2V5TA 4PR5A 5HY9A 4X6DA 4HCRA 5ENWA 1FORL 3RVTD 4GXVL 2DAVA 3BKJL 2A1WH 2IPTL 4BQCA 1N3NB 3U2SB 4R6UA 3LQMA 2PO6A 5IJKA 1FL6B 2EDFA 4PREA 3H9SB 2VYRE 1TZHA 4UAOB 5C92A 4U1LA 5TGBA 3VGEA 2NTFA 3QIUD 1TVHA 3NPSC 2EYTA 3HMXA 4FQJH 4K2UH 1JL8A 4Z7VB 1E6JH 4U4BA 1ZVYA 1VPOL 3HPLA 3WFDL 2C3VB 4D8PB 3IVKA 4LBEA