2AXJA

Crystal structures of t cell receptor beta chains related to rheumatoid arthritis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
DGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASRDRGTEKLFFGSGTQLSVLEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SF4 T cell receptor beta chain
publication title Crystal structures of T cell receptor (beta) chains related to rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axjA02
3MV7B 4YPJA 1MFBH 4XX1G 4QHLA 3T3PF 1V7NL 4WO4C 2CLZA 2G75A 1UM4H 4N9GA 1T7YA 1J0KA 2CDFA 4L4VA 2I60L 1UXSA 4XNYL 4WU7A 5F9OH 3MRBA 1OAQL 4S2SA 4HULB 2VDOH 3B6SA 3QG7H 1G9MC 3G5VA 2ICWA 1NUFA 3MBXL 3EAKA 1QBBA 1JGEB 4HS8H 5GGTL 5D7IF 3IDJA 5FEBA 4U2ZA 1CU4H 1S7XB 3SE8L 3ABZA 1NFKA 2BNQD 1F3RB 4R4BA 2BNRE 2HG5A 1P4BH 5IQ9A 3EKCA 3S37L 2HMIC 4P23C 3IJYA 1JPTH 3DLQR 3INUH 1WK0A 1ZEAH 4QHKI 4Y16D 3O6FD 5D7IB 4FOMA 3RA7L 5KSVA 4DW2H 5HDBE 4BSVB 5HJ3A 2CIIB 2VE6A 3UBXG 4JFPA 1KIUA 4FTVD 3BDYH 4OIIH 1FC2D 2F8VA 1A1MB 1PY9A 1R24A 3KPRE 4IOFD 1VKXB 2V17L 4HMEA 3LPWA 4F7TB 3P40A 1KPRB 4ODVL 1N8ZB 1U2HA 3FHAA 3UTQA 1MLBB 4GUPA 5LKNA 1KPVB 2L4OA 1TCRA 2DQJH 1CXLA 2YZ8A 4GMTL 4F7PB 4MS8D 1Y0LB 5F7WC 4J1UB 4LPUA 1IGJB 2VKWA 2YN3A 3EOBA 5BW7A 1FH5H 3CVHB 4JZJC 1KJVB 4P2CG 3QEUB 3GSUA 4ZFGH 3QIWA 4NUGH 4E41B 4L9LA 4H0IA 4KHTH 1WF5A 2YOCA 3HHRB 1AO7B 1IFHH 5J0BA 4TSBL 3LS4L 4QHMB 3KPQA 4ZD3L 1X5GA 2DYPA 3BE1H 1GOHA 3BI9X 3FAXA 4E5XB 1YN6A 2FCBA 3RWFA 2ADFH 1YYML 1T83A 1E0OB 5DVKA 2IH3B 4Z78B 1CGYA 2DBLH 5JA8B 3RL2A 2VITA 2P48B 3HE6B 4NQCD 3RX8A 4W6YB 1MPAH 2XA8L 4D9QD 2GI7A 1I8IA 2CDEA 2DLIA 5FHBH 4HPYH 4U1LB 1D5IL 5D9SB 4RA3A 1BECA 3RY6C 2CRIA 1HEZA 2PXYB 2JJTA 1FAIL 5L2JB 3OJ2C 2IG2L 3JWDH 1SJHB 5IB5B 4NZRL 3EJZC 5LJYH 1FPTL 4OGYL 5C6PB 1WWBX 2Z93A 2C7UA 3OJDA 1JWSA 1H0DA 4BZYA 3V0WL 4UOW0 1Q0XH 1JL8A 4K9EC 2VABB 3QWRD 3VXME 3KNBA 3G6JF 2Q86A 3MNVB 5IG7A 1XZ0B 2FSEA 1O0VA 3NA9L 5HHPB 5TF0A 1NANH 3MRMB 1UB6A 1LP9F 2B2XH 5DRNB 2CK2A 3G6JB 3SJVB 1IM9B 5F21B 2A77H 4FNLL 4K23L 4L1HA 3RX5A 3WL9B 5IGXL 5DRWB 1NBVL 3V7AE 2R29H 4MJ4A 1LP9B 5GRVL 1RUPH 5DJDB 5IOPB 4LU5H 2V2XA 1CCZA 2XXCB 2P44B 3O41A 1LO4L 5I8OH 1R0AH 3MRIA 3DWTA 3GUTB 1B4JL 3LN5B 4GRLB 4XBEL 1HQ4B 4OD1L 3IDIA 4S1RL 3VWKD 3VXNA 3MA7A 4LSTH 5GJSL 4D0DB 2QHRH 3LKRB 1MSPA 6CGTA 5IB3A 4NPYA 1BP3B 2D4FA 1HHIA 1PEZA 4O02H 1AKJD 5TPWH 1K3IA 2RB8A 2VLKB 3LN4A 3D3VD 3QDGE 1D7FA 3MRNA 5EUOB 4OI7A 2NY1C 3ZZ1A 2AJUL 1MCPL 4HHAB 2EEBA 1BQUA 3P30L 3CIQA 3TV3L 35C8L 3IDMA 1MH5B 5F7YC 3V7AG 4NO0A 5E5RB 3RGVB 3P4OA 3DI3B 4GG6F 2ZWLT 3HLAA 2X42A 1MCLA 3OHXB 4DGVH 4S1QH 1YQ2A 4U1IB 3QZWB 4QRUA 4G80B 5C0EA 3ZKMC 3TT1H 3V6ZA 5EO9A 1YEFH 3VFOB 2XZCL 5IVZA 5KBNC 5F89B 3FT4A 4MZ3A 5JOFA 3GMMB 4S1SL 4Y5YA 4N0UA 1EGJH 3BP7B 3CH1B 1IGIH 4KKNA 4KI5F 5C0GA 5LGJB 4GKNB 4LVOB 3MV8B 1G0YR 1EMTL 3MRJB 1LEGB 3CK0L 5DHXB 2FLRT 4NJAL 5HGAA 5DRXB 2F5AH 5HVFB 2JIXD 3LH2L 4QTIL 3RHWF 4MQTB 4P46C 4G3YH 3RZCD 4PRPD 5E8OB 2RCSL 2MHAB 1F58H 2P4AB 4ZFFA 2A6KB 3QHFL 1CE6A 5EU7E 1J8HA 3SKNA 3IFLL 4QHLB 5SX5K 2BY0A 4HBQA 2CLZB 2G75B 2X10A 5TQ0L 1ZLUH 4N9GB 5HVHB 1CZ8H 1SM3L 2CDFB 1UXSB 4L4VB 4X80L 2IJ0C 4WU7B 3MRBB 1Q1JL 3L3KA 2OJZH 4S2SB 3B6SB 2MCPH 3G5VB 4HFUH 3UP1A 1QG3A 2OR7A 4XMLH 2ICWB 1HQRA 1DQQA 4KHXH 5C09A 3IDJB 3C8HA 4XPTH 3GSQA 3PL6C 4N0CD 2WNGA 3GI8L 4MA3B 4RQQA 4R4BB 2R4SH 2HG5B 2Y72A 5JMOC 5IQ9B 2VLRA 5C6WH 3IJYB 3V4PH 1HHJA 5KSVB 1BREA 3E6HA 2YD5A 1PKOA 5HJ3B 2VE6B 3D5OF 4JFPB 1RUQH 3QH3A 1YYLL 2BVPA 4U3CA 1LO5A 2UY6A 5MEND 5JXAH 3A6CH 1R24B 4PLJD 4Q9QH 4OQTA 3ARDC 3WE6A 2IPUG 3CGTA 4P48A 2P8MA 1IBGL 4JFDE 2BX5A 1UCTA 1RZJC 1S8DA 5I75B 1P7KA 1T66D 3IDYB 4JFED 4RDQG 3UTQB 3L3JA 3EJYD 4GUPB 1TCRB 3CFDA 3BZ4A 1XIWA 3S97C 4MNQD 3EOBB 3WFZA 1DEDA 1NLDL 2A6JA 3U7YH 3MGAA 3MOQA 3GSUB 1H9VA 1GGIH 3QIWB 1G7QA 3STBA 4ZXBC 4JPWH 3D85A 3WJJA 3L7FA 4L9LB 5F7UA 3GRWA 1T0PB 4WU5A 4FQ1L 4FA8A 2L0DA 2LU4A 3UTOA 1KV3A 3WS6C 3DJ9A 5IV2A 5CJOH 3RNKA 2NY2B 4AEIL 5B4MC 3KPQB 1LO2L 4FHBD 3VG9C 1J0HA 4U33A 5K9KA 1JMXA 1QUNA 1ZHBA 3TZVC 2DYPB 2WLZA 3MPCA 2EDHA 5JLZA 5D1QA 4C55A 3FO1A 5DD3H 2EDDA 4G7VH 1FGVL 1ZANH 4PJEA 1YN6B 3RWFB 3VD7A 2UZIL 1PEWA 3PV7A 1MAJA 1JPGA 2R15A 5KOVC 4JFQA 5DA4A 2XY2A 5J1TC 2D03H 2DQFA 3RL2B 5BRZD 1CLOH 1CDGA 2VITB 1MFBL 4FMFA 4GRWF 4QF1A 3W39A 2FATH 1UM4L 4WI5A 1NDGA 5F9OL 1I8IB 2CDEB 3EOAA 2VDOL 4R0LC 3DETD 3QG7L 4HAFA 4ORZC 2X05A 1TFHA 1HEZB 4GRWB 5DK0A 5D7KD 5HI5D 4HS8L 5D7LE 3WNMA 3TWCH 1CU4L 3HMXA 3QNYA 3BYYA 4MB5A 3PNWA 4MCZA 5T3ZE 1KACB 3QI9C 1MCCA 1P4BL 2Z93B 1JZ7A 2R0LH 3BP4A 2C7UB 3OJDB 1JWSB 1H0DB 1JPTL 4JO2H 3T04D 3V4UH 3INUL 1ZEAL 4Y4KA 4ZO7A 4DW2L 5TFSH 1FLRH 4G6AC 3QWOA 3VWJC 2IQAA 2R1YA 3BDYL 4OIIL 5FKAA 2XIDA 1JYVA 3GMQA 3KNBB 1DLFH 4POYA 3LRSA 4MAYD 1M1SA 2Q86B 2VDMH 3NN8A 5IG7B 1WWWX 3SOBH 4MA8H 2FSEB 3L5IA 1E4WH 3WN5C 3F6IA 3QCTH 4JFZH 1UB6B 4XVSH 4ETYA 2DQJL 2QKIA 4YQXH 4OSUH 4X4MA 5CD5C 4PG2A 1FH5L 2QQLH 5E8EA 4PY8J 1QHOA 4ZFGL 2G9HA 4NUGL 2V2XB 1X7QA 3D25A 4KHTL 4EQ3A 4Z9KB 5BOPA 4OZHF 5J3HC 3VXRA 3O41B 4HUUA 2Q3AA 1IFHL 3MRIB 1A3LH 2OTUA 4L8BA 2RJMA 2W9EH 2YD7A 1RZFH 3IDIB 3MA7B 5E8PA 4QOKD 3VXNB 3M8OH 2FR4A 4JM2A 2YBRA 5IB3B 4NPYB 2EDFA 2NY6B 1HHIB 3BE1L 4A2MA 4NIKB 3IAGC 3IXTA 4MCYA 1DVFD 2N1KA 2X2YA 3LN4B 2ADFL 3ZDXF 3MRNB 5JQ6H 4HPOH 4CN6A 3WNNA 5E7BA 3IDMB 5HGBA 4NO0B 3SDCD 4C57C 3VH8A 3P4OB 1MPAL 2GK2A 3BP6A 2V9TA 3HLAB 2FJGA 5I75C 5FHBL 4JQXC 3V5KA 4QRUB 5C0EB 3ARWA 5J13B 3V6ZB 4A2LA 5EO9B 3JWDL 1MY7A 2M8XA 5DK2A 2DMKA 5IVZB 4AH2A 3FT4B 1DUYA 5JOFB 4Y5YB 4N0UB 1FBIH 3H6JA 1IC1A 1JUFA 4LPXA 3K1DA 5C0GB 3DVIA 1Q0XL 1T04A 4PJHF 1NMAH 3AY4A 3QXTA 2XPGA 3QFJE 1L6ZA 5HGAB 1TZIA 1Y18A 2OZ4A 5FM5M 4KXZI 1U8LA 1U8OA 3MODH 4QRSA 2B2XL 4ZFFB 1CE6B 3TBWA 2A77L 5IFHH 1J8HB 3SKNB 3K7UA 5CZKA 4TTDD 1CL7I 4XP9H 2CKBH 4ZO8A 5AWNH 3QWQB 4YHYC 3MRHA 2VDNL 3L3KB 2R29L 1UJ3C 1NGWA 1RUPL 1G7LA 2R0WH 3KPNA 4LU5L 4M93C 1HQRB 1DQQB 2XTJC 4LSSH 4YX2H 1EHNA 4NO2A 3HUJF 5I8OL 4P5TA 1KT2A 2H2SC 2QSCH 5JHDA 1PVHA 3SDDA 1R0AL 3GSQB 4UUJA 4F37K 4RQQB 5C70A 1BMGA 1YEDA 4QKXB 4LSTL 2QHRL 1YY8A 2IPTH 2VLRB 3E6FA 4M7LT 1DSFH 4R26H 1HHJB 3QIUA 4I18C 4O02L 3U79A 3E6HB 1BOGA 5E1AA 2DLGA 5TPWL 2HRPH 2ITCA 3PE9A 4ZNCD 1NBQA 3QH3B 2BVPB 1A7BA 1LO5B 4LMQI 3K74B 3ARGA 1PG7X 3VA6A 3WE6B 5HHQA 3MLZH 2P8MB 1S8DB 2VQ1A 1P7KB 4Y19A 2DQTH 3L3JB 1D5BA 2NQCA 3CFDB 5FM8A 4DGVL 4KK5C 3BZ4B 1XIWB 2JTDA 4J3OC 4NQTA 2AW2A 1CLYH 1YEFL 2A6JB 2VZ1A 1VPOH 5B8CC 4EXPX 5D93B 1QBLH 1G7QB 1CFTA 3O3AA 1FAKT 3PHQA 3D85B 1N59A 3L7FB 1JV5A 1EGJL 4WU5B 3ZE2F 3DROA 2E8YA 3OPZL 1IGIL 5KVGL 1A3RH 1T5WA 5BZDA 5IV2B 3KYKH 4PJEF 3RNKB 4OUOA 4CVZA 2C3HA 5K9KB 1ZHBB 4PD4K 4GBXC 2Q8AH 1P9MC 3DVFA 5JLZB 5D1QB 5F1IA 3FO1B 3K4DA 2AJZA 4QHUA 4G3YL 4PJEB 3QUXD 4K71C 1ADQA 3WO3B 1JPGB 4F7MA 1F58L 4JFQB 5B38A 1NBZA 1I1YA 2DQFB 4AQOA 4KZEH 1S9XA 3W39B 4TNVK 4QF1B 2UV3A 1NDGB 3H42H 1CZ8L 1WWAX 5F7FA 3T2QA 2OJZL 3QFDA 4OCRH 4HFUL 4XTRD 4S1DD 4XMLL 3MCKA 5DK0B 3IETA 1P7QD 5HYQA 4KHXL 3ZE1E 4RX4D 2VO5A 4XPTL 2UWEA 2PYFA 1FVEA 3QNYB 2Z8WC 3MRRA 4NKOA 3PNWB 5CEZE 4MCZB 3VXOA 1P84J 2R4SL 3BP4B 1A47A 2ZUSA 4Y5YC 3V4PL 4CMHB 3Q3GA 1I8KA 5I9QB 3SGJA 4Y4KB 3LOWA 5GGTA 2ZUQC 1RUMH 1FZMA 3VXPA 4V1DA 1ZLSH 5JXEA 1RUQL 3QWOB 2IQAB 2R1YB 5FKAB 3GMQB 2V9RA 1MI5D 3LRSB 5JXAL 3A6CL 2ZUYA 1EFXA 3NN8B 2AK1H 4Q9QL 4O2CA 2YUVA 3FKUS 4KUCD 2VRAA 5B3NA 5GGSA 2QKIB 2HH0H 5DHVA 4M4PA 1WJ3A 4U1JA 4PJFA 3P4NA 4X7DC 1ZA6A 1JTOA 1XFPA 4R4NC 3IDXH 5E8EB 3U7YL 4PRBA 1GGBH 4ODXA 1GGIL 2G9HB 5KSBA 4PJDE 3O3UN 4JPWL 1X7QB 3E2HB 3D25B 1T0MA 3VXRB 1UACH 4HUUB 4U6XA 5GGRA 4U7KA 5CJOL 4PLKC 5LG1A 1DDHA 2OTUB 4NDMA 2A83A 4L8BB 2X1OA 1RZ8A 5E8PB 5KZCD 2FR4B 4JM2B 4P59H 2YBRB 1HZHL 3PGDA 3IXTB 4MCYB 5DD3L 1I1CA 4G7VL 3DUHA 4M00A 2X4OA 1UKSA 5C07A 3ARVA 2X4TA 4YUEH 3D48R 2D03L 3SKOA 5I1KH 1CLOL 5HGBB 3VH8B 3WNLA 2FATL 2EYTA 3BP6B 2DMCA 3SGDI 1SEQH 2FJGB 2PTUA 4NFBA 4ZTOH 5E6IA 3C9NA 4XXCA 3V5KB 4W4OC 3SKMA 1RY7B 2BC4A 3SKJH 4U6VH 1DN0A 3LS5H 3BO8B 3T0XA 5DK2B 5DZNA 4Y1AD 3TWCL 4XCFH 1TVDA 4JEGB 4AH2B 3F5WA 1VCAA 1DUYB 3L6FA 2PYEA 4NO5A 3CX5K 2R0LL 4JO2L 4Y88A 1JUFB 2VKXA 3ARFD 3V4UL 1OTUD 4ZUWA 1T04B 4CUCA 3T65A 5TFSL 2B8OT 1FLRL 2GJ6E 2XPGB 2VR9A 4FXKA 4KRPD 1TZIB 1DLFL 3IRPX 5GS0H 2VDML 2P5ED 1Y18B 3SOBL 4MA8L 1BZQK 3V0VA 1E4WL 3UTTA 3QCTL 4JFZL 5FXCH 1U8LB 1U8OB 2EO9A 3C6SA 4N0FA 3WO4C 4QRSB 4XVSL 2VZOA 1U93A 3DYMA 4MXQD 3TBWB 4YQXL 4OSUL 2Y25A 3GJFK 4YZFE 5JDSA 4OZ4A 2QQLL 3MRHB 3O9WA 2ATPA 1NGWB 1YPZF 5CGYC 1G7LB 3KPNB 2CK0H 3DURA 3BUYA 3GSXA 1MCJA 3KGRA 4QRPE 4WCYH 5GZND 4NO2B 1C8PA 4P5TB 1KT2B 5BQ7A 5EU6A 5JHDB 3SDDB 4G8GE 5I15H 2F54D 4UUJB 1A3LL 3RVXD 2W9EL 1YEDB 1RZFL 5JOPE 2ICES 3M8OL 1YY8B 3E6FB 1NKOA 4M7KH 3QIUB 1QRKA 2VLJD 1BOGB 3G6DH 4P2RA 5E1AB 2RHEA 2ITCB 2GTWA 3V4VH 5JQ6L 1E4XH 1QRND 2ZOLA 3ARGB 4HPOL 3UJJH 3S5LG 4XAWH 1G1CA 5DS8A 1YMME 5HHQB 3ARBC 4ZFOL 4FFZH 5FKPA 2VQ1B 4Y19B 5TJWK 1A6ZA 1OW0A 1D5BB 2WW8A 4G6FB 3LIZH 4S0SD 1MQKH 1KG0A 3GMPA 5D72H 2MQ0A 3MJ9H 1UM6H 4XVUD 3ZLQC 4L3AA 4CMMA 1I9IL 1I8LC 3RIFF 1LK2A 1OGTA 1KBGH 1CFTB 3O3AB 3PHQB 4XHQA 1V7MH 3ZDYE 4ODTH 1G7IA 1N59B 2W9LA 5EOQH 5IMOA 1JV5B 1FBIL 3QUZD 3DROB 4KY1H 3S35X 3BN3B 1T5WB 3W2DH 3VGDA 1CXKA 5BZDB 4HT1H 1NMAL 4CVZB 5GGQH 1B88A 3BPLB 5F1IB 3D6GA 3WDHA 4PB9H 4QHUB 1U3HD 1PBYA 3Q5OA 3QEQA 3MODL 1NAMH 4OLWH 4F7MB 5B38B 4G6JH 2JJSC 3KLSA 3ULUH 1NBZB 4EBQH 1I1YB 3EGSA 5FV1L 3RTQD 5IFHL 1S9XB 3R1GH 5AWNL 4XP9L 2CKBL 3S3JA 1GPOH 4U4BA 2UWEF 3QFDB 3SGEH 2R0WL 2XTLA 3MCKB 4KKLD 4LSSL 3IETB 4YX2L 3ZE0E 5HYQB 5HI4C 3WUWG 5IF0A 2QSCL 3I6GA 2UWEB 4JFFA 4P2OA 2PYFB 1FVEB 1DZBA 3I02A 3C6LC 2PW1A 3MRRB 3QUYA 4L3ED 4NKOB 3NFSH 4LGRB 3VXOB 2QQNH 2BNRA 2IPTL 1DSFL 4R26L 3Q3GB 1I8KB 4KK6C 4UBDD 3VXPB 1FZMB 5B3JF 4V1DB 3AY4C 1AFVH 1DBAH 4GXVH 2WM0A 4Q74A 3AVEA 2D3VA 4L3CA 3AS2A 1EFXB 4WUUD 1TETL 4HIJA 4EQ2A 5BV7B 1DTUA 3GHBH 3KPRA 4PJFF 4KRLB 4O2CB 4XPHH 3MLZL 5KOMC 4H26A 1E4KC 1L0XA 3CAFA 5EBGA 4RNRA 2DQTL 2GT9A 5GGSB 2PO6D 4LL9A 2X40A 5DHVB 5CJXA 4U1JB 4PJFB 4U3HA 3P4NB 1ZA6B 1T22A 1CLYL 3TN0C 1EZVX 1VPOL 3D9AL 4PRBB 4ODXB 3QHTC 5KSBB 1CICC 1QBLL 4I0PA 4XHJC 1T0MB 4MJ6A 4U6XB 5GGRB 1A3RL 2R2BA 3KYKL 1DDHB 2D9CA 2A83B 4NDMB 1RZ8B 4LRNH 4GO6B 5D7JC 2Q8AL 2NY0B 3PGDB 3GEWB 3O3EA 2VJXA 2HT2D 5BO1H 1DQJA 3OMZA 5DJCA 5GRYA 4AM0A 3RJQB 2X4OB 1NMCC 5C07B 2X4TB 4ORGA 4KGLA 2EO1A 3GKZA 4XNQA 2UZXB 4LCCC 1FCGA 5F7LB 5C0RH 3SKOB 2YPLE 3OKOA 3RDTA 4KZEL 1NGPH 2QLVB 1KSRA 5DSCA 4BZ1H 2EYTB 4ETQA 3DTXA 1TMCB 3H42L 5F9WB 3A67H 3P2TA 4ZSOA 1BM3H 1HXMA 4OCRL 1Q9OA 5FB8A 3U6RA 1NEZG 5E6IB 3C9NB 4PPTA 5MERA 4Q7DA 3CX2A 3ULUE 3VFGH 3RWHA 5EZJA 2EIZA 3GM8A 2CUMA 3SKMB 2V5TA 2BC4B 4MD4A 1IGYA 4AL8H 1DN0B 1OLLA 2FECL 5F8RC 4NGHH 5EC1A 1TTUA 2R2CA 3WBDA 2BNUA 4OCYH 3F5WB 4CKVX 3L6FB 2PYEB 4NO5B 4PJXE 2ARWA 3QIBC 3UYRH 2VAJA 3CDGA 3GSNH 3QQNA 4ZUWB 4P49A 1RUML 1ED3A 3T65B 1FZOA 4LLUA 1ZLSL 1LWRA 4TUJA 1S5IH 3VXMA 4FXKB 4RGNE 4ZOAA 5EH1A 5DFVC 4PJ7E 2AK1L 3V0VB 3UTTB 3Q0HA 3C6SB 5FA4A 3W9EA 4N0FB 1U93B 3C2SA 5IK3A 2X44D 2NR6C 2HH0L 4HMDA 2OQJA 3E3QC 5HPOA 5JDSB 4OZ4B 3O9WB 4H1LG 3V8OA 3IDXL 1GGBL 2ATPB 3L3IA 4PRID 4R9HA 8CGTA 2FIKA 4Y4HA 2IFGA 3DURB 1BZ7A 3BUYB 3GSXB 1KTLA 2Z8VC 3ZYIA 2HWZH 4AENA 1UACL 3HB3D 5EU6B 5BQ7B 1VGKA 3GI9H 5IW6A 4Z18A 4PJ9D 4F3FA 4I0CC 1BF8A 4P59L 1X4YA 4XP1H 3JV0A 3F12A 2ZOKA 4P2RB 4I8DA 4JKPH 5LXGH 5IIEA 2GTWB 5TE4H 3QDGA 4M9PA 3BQUA 2ZOLB 3HR5A 1KCSL 3F7PC 1KJ2A 4YUEL 4DK6A 1UWGH 1Z9SA 5ITBH 1XF5A 2EDJA 3V9FA 4WWKC 3T3MF 2PTVA 4APQA 2DQHH 5DS8B 5I1KL 3QUKA 1D5XA 1TVBA 3NCBB 3DXAE 4POZC 5FKPB 1A6ZB 2H45A 1SEQL 3ZTJH 4ZTOL 5JIHA 1KG0B 3GMPB 4X4XA 2A6IA 2D0GA 3P0GB 3SKJL 4LSVH 4U6VL 4CMMB 3LS5L 1IQWH 5SWQA 1LK2B 1OGTB 1A0QH 4XCFL 1G7IB 5IMOB 2PCPA 2AGJH 3GMRA 2Y07H 3I85A 1OCWH 3ZHKA 3PQYE 3FCTA 1FFQA 4OFPA 4RGOH 3SE4A 3FRUA 4XPFH 5GS0L 2AQ3A 3ARSA 1J7VR 3QO0A 1JI1A 3DYOA 1TIUA 2WWKO 3DO3A 3UYOD 4YBLB 4FQQA 3EYQC 3QEQB 1HK6A 5FYKU 1EEQA 3UBXB 4R2GB 2RAMA 3AUVA 1T80A 2AJ3A 3HAEG 3EGSB 3TIEA 1EERB 4JREC 4UDUA 5D2NA 5ENWA 5T1KA 3SBWC 2XN9D 3LZFH 4PFEA 1JVKA 4WO4D 1S3KH 5T1LA 2FWOA 3CH8A 5IF0B 5AAMA 3I6GB 5L2KE 4JFFB 3LVEA 3QUYB 4P2OB 3I02B 5HDBF 4NQDD 2PW1B 5I15L 2QEJA 1Q8MA 2BNRB 5CJQL 1OTTC 3VFSA 3T1FA 4IRSC 1MFDH 4M7KL 2C3VA 3G6DL 2HMID 4P23D 3R0MA 4OZIF 4NN7B 5DQ9A 5FCUH 3QR2A 4FABH 3V4VL 1EVTC 1E4XL 1U8QA 1CDJA 4L3CB 3UJJL 4HIJB 4XAWL 2MQCA 3KPRB 4FFZL 2DL2A 1F6FB 2BNQE 4H26B 5IFJA 3RWGA 4JFDA 4RNRB 2GT9B 3IU3A 4BJLA 5GRVK 5GS3A 5E2WH 2HKFH 3L1OH 3LIZL 5E56A 1MQKL 2MFNA 5DF0A 3WHXA 3OKKA 5D72L 1JTTA 3MJ9L 2YD3A 4FTVE 5A2IH 1T22B 1UM6L 1JFQH 3VI3E 3MJ8A 1G9NH 4PBVC 1YNKH 2DIAA 1KBGL 2FEDC 4I0PB 1ZHNA 3MRQA 1V7ML 4H88H 4ODTL 2BERA 5C0DA 4MJ6B 3MNWA 3HNTH 4KY1L 43C9A 5EDXA 3MV11 4CAGA 2R2BB 3W2DL 5C9KA 1J0JA 5EULV 3TH2T 5GGQL 4ELME 3JUYA 4XT1C 1I3GL 3GNMH 4TVPD 4Y7MA 3O3EB 1XGPA 1EGJA 4PB9L 1FO0H 3I84A 4NC1E 1DQJB 5DJCB 5DRZA 4ZAKC 4AM0B 4KTEH 3RUGE 3BD3A 4OBSA 4ORGB 5E4EC 1NAML 4OLWL 4OGXH 4G6JL 3ULUL 4XNQB 4EBQL 2BSED 1PG7W 1GC1H 3OKOB 4Z7WE 3RDTB 5FGSA 3R1GL 1SJEA 5DSCB 3VCLA 4ETQB 3DTXB 1Q72H 1GPOL 4ZSOB 4LNRA 1HXMB 1Q9OB 5FB8B 3U6RB 5MERB 2MKLC 4X99A 4WIQA 1A4KA 1CF8H 3FHQA 1KIRA 1QYGH 2EIZB 2IALA 5EU5A 5EZJB 3RWHB 4MD4B 1IGYB 1JNJA 5KVMC 4KV5E 5D7LA 3F8UB 5EC1B 1RZ7H 2BNUB 3HG1D 4JJHA 4X6FA 3G5ZA 4NQCE 5JUEH 3CDGB 3NPSB 3EJZD 3BGFC 5CJBA 4D9QE 4XCCH 3ZYZA 3CSGA 2AV7A 4ZQKA 1BVZA 4MDIA 1ED3B 1FZOB 1WISA 4LLUB 3SGKC 4TUJB 4XMPH 3VXMB 1AFVL 4GT7A 1DBAL 4GXVL 3VRJA 1T5XA 3GHBL 3W5NA 1DUZA 1ETZA 4WI3A 4XPHL 3SY0A 5FA4B 3T4AA 5FUOH 3W9EB 2DL9A 2VDQH 5DC4B 5IK3B 4WJ5A 4Z7OE 4HUXA 2OQJB 3OAZK 1FFNA 2D7TH 3L3IB 3B9AA 1HIMH 2FIKB 4Y4HB 1BZ7B 3DMMC 1KTLB 4G8FA 3T09A 5D71H 4AENB 1JP5A 1VGKB 4GAYA 1JF5A 4DKFH 5IW6B 5L0QC 4F3FB 3KJ6H 4LRNL 1HNGA 4KI1A 3F12B 2DI9A 2ZOKB 5BO1L 2UVEA 5INDA 4TNWF 2HLFC 1O7VA 3SCMA 3U30B 5IIEB 1I8MA 3QDGB 3BQUB 2JJUA 3HR5B 1SVZA 1KJ2B 1IMHC 1XF5B 2VUOA 4APQB 5C0RL 3GMLA 5C3LD 1HNFA 2NY1D 1T20A 5EZOH 1NGPL 2X4NA 1D5XB 3QUKB 1TVBB 4U31A 4BZ1L 3T2NH 4OCNC 1S7VA 3A67L 1TJIH 1BM3L 2EDKA 5C9JA 1JZ3A 4PBWD 1NCNA 2QR0A 3VFGL 4X4XB 3AM8C 1FFOA 3NACH 4IIQA 3D3VE 2A6IB 1F2QA 1UVQA 2KUTA 5DYOA 1XMWA 3T77A 4AL8L 2P24A 4JCMA 4NGHL 5CAYB 5E6ZA 5SWQB 3MSPA 3ZKMD 4OCYL 5MP6H 4L8SC 2PCPB 3UYRL 2OXGA 5HYJE 3GSNL 3OJMB 1YEHH 3GMRB 2GFBA 3OF6A 2DM3A 3VE0A 2IWGA 4YGVA 3FCTB 5FA3A 1N5AA 1YQVH 1MRFH 1S5IL 3QFJA 4PGJA 3K0WA 4ODHH 4HEME 3GZKA 1IGFL 2V7NA 3FRUB 2ZSWA 4JGUA 1FNEA 2KKQA 3QO0B 2ICWI 4M5ZH 1IE5A 4FQQB 3JV6A 4P46D 4JN2A 5MEQA 2AJ3B 3TIEB 4RDQF 4BK5A 4UDUB 5D2NB 5ENWB 5T1KB 2NY3C 5DJXA 4K3EH 1X6LA 4KROC 5HDQH 4LCWD 3RHWK 1IAOA 5GPRA 2HWZL 4OLVH 5T1LB 2ID5A 2FWOB 5IVXF 4I77H 1OHQA 4I9WE 4OKVA 5F72S 3GI9L 3O2WL 5CJ8A 5E4IA 2WIIA 5ACZA 3NMEA 3DX8A 5E00A 3VFSB 3T1FB 3PL6D 2WV3A 4XP1L 2QADC 2BSTA 2C3VB 1LDSA 2Y06H 4LSPH 2J6EH 4JKPL 5LXGL 1UEYA 1KFAH 5DQ9B 5TE4L 1AD0A 2EC9T 1U8QB 1UWGL 3B9KC 5ITBL 1VHPA 5IFJB 3RWGB 1J1OH 4JFDB 3H3BC 3IU3B 3ARDD 2J2ZA 4HKXA 2OBGA 4M61A 3GBMH 1QPXA 4PRHD 5DXWA 3WHXB 3LQMA 3OKKB 5EFIA 4F7EA 2EE2A 4HJ0C 5I74C 4KZDH 3MUZ1 4LSVL 4LP4A 5FV2A 3MJ8B 1IQWL 4PP2A 4U0RC 5MENE 1WT5C 2ZCHH 4UNVA 5DC0A 1HE7A 1A0QL 1UH3A 5SX5H 1ZHNB 1S9VA 1EZVY 3MRQB 2Z31C 5C0DB 1M6OA 3BIAX 4PRNA 5D2LF 3MNWB 2AGJL 2E9IA 4ZXBD 3BRFA 2VB5A 4JFEE 2Y07L 4HWZA 43C9B 4RWHA 1OCWL 4U1GB 1ONQA 1ZT7A 1FN4A 4MNQE 1DBBH 2DM2A 4M7LH 1T1YA 4RGOL 3B4NA 5B4MD 4XPFL 1JGUH 1XGPB 2Z8RA 3TZVD 5DRZB 1HWGB 2CD0A 1AXSA 1JIBA 3ZO0A 5CSZA 5F1OB 1YMHA 5CIPA 3KYNA 3X17A 3EYSH 1WLHA 1SJEB 3OTTA 3VCLB 3LPGA 4LNRB 3TJEH 3LZFL 4NRXA 5J9PA 1CS6A 4X99B 5HSFA 1A4KB 3CLEH 1KIRB 1S3KL 2IALB 5EU5B 1HSBA 1XAUA 5D7LB 3D0VA 3OQ3B 5IB4A 4B7LA 5ANMA 2CKBA 4R3SA 1M71A 4JLRA 4UQ3A 5F7HA 3D87B 2HTKC 2DI8A 4LHUD 4X6FB 2R2EA 3G5ZB 1EUTA 3VG0H 1HSAA 1JNHA 1MFDL 2HFFA 5L88H 1XGUA 1BFTA 3QI9D 5EORH 5GS1A 1BBJA 2AV7B 3MGTA 5HBBA 4MDIB 3DPBA 4XNZB 3KPSD 5FCUL 3TIDA 4FABL 1F4YH 4AY0A 4OKDA 1HHKA 3NAAH 2WBJA 1A6WH 3VRJB 3ALWA 1U8IA 4G6AD 1T5XB 3NTCH 2ZG1A 1DUZB 1ETZB 1U3YA 2CPCA 3VWJD 3NCJH 4O58H 3ZKXB 5ESQA 4L1DA 3F58H 4YHPA 3SY0B 1Z0MA 3T4AB 2X70A 4LLVA 3TBYA 5TDOA 3W0WD 4I5BA 4PYHA 1WGOA 5E2WL 2HKFL 3L1OL 4WJ5B 1MJUH 4HUXB 3NIGF 1FFNB 5EU7C 2VTFA 1JFQL 1G9NL 1YNKL 5CD5D 1EO8H 1X5XA 3T8XA 1B6DA 4PJDA 1L7IH 4H88L 4G8FB 3B83A 1XR8A 3HNTL 3TO4A 4GAYB 5J3HD 1WTGT 1WCBA 2X4QA 1F6LL 3O8XA 3S6CA 5DT1H 3GNML 3S3SA 2PNDA 1FG9C 3JSSA 3N50A 5A3IC 4RISH 3E8UH 1FO0L 2A38A 5INDB 4PJAE 4KTEL 3SCMB 5MEPA 1I8MB 1OP3K 3WXWH 1J11A 3O6MH 2E6QA 4OGXL 3TVMA 5IJKC 3GMLB 1GC1L 1T20B 2X4NB 5E08H 4B0MM 4OI8A 4QOKE 1MCWM 1Q72L 1S7VB 1QHPA 1EHAA 4L5FH 5C9JB 4AJ0A 1IC7H 5T5FH 1JYXA 2GUOA 3DO7A 2QR0B 2FX7H 1CF8L 5J1AA 1QYGL 1FFOB 4IIQB 5J12B 4NP4H 5DYOB 1UVQB 5FM4A 3H0TA 3T77B 2P24B 3PF2A 1CGWA 43CAA 3GFUA 1RZ7L 1SYSA 5FHAH 1PFCA 1WFUA 1F4XH 5JUEL 4X9IA 1BPVA 1P6FA 4FQXC 3UDWC 3L5WA 2GFBB 4XCCL 3KAAA 2NYYC 4K7FA 3VE0B 4YGVB 5FA3B 1GVIA 1N5AB 3TT3H 4G8EA 4XMPL 2GJ6A 1GC1C 3QFJB 4PUBH 4PJIA 2V7NB 2ZSWB 4ONHA 1FNEB 1T21A 5EUOE 1FNFA 4WTZG 4PGCA 1ZLUK 3M07A 1NCWH 5FUOL 2B7DT 3UZEA 4QXGH 3JV6B 1I1AC 2VDQL 3MBEA 3MO1A 3PABA 4JN2B 5MEQB 1A1OA 1DLHA 4JVUA 3BAEH 1MCFA 4OLUH 1C7SA 5HYFA 3S5LA 4HF5H 2D7TL 2W0FA 5DJXB 5DDHA 4DUVA 3VGGA 5FYJD 1HIML 2FHCA 1PY4A 1IAOB 2ICEA 2EC9U 1VGEH 4QY8A 3BW9A 3QXDA 4QRPA 1T7XA 1S7TA 5D71L 3QQ4A 4J2XA 2E7LA 1U9KA 2XTJD 4OKVB 4UDTA 5ACZB 4G8GA 2WIIB 4DKFL 3C60A 3S7GA 2H2SD 1QR4A 3DX8B 3KJ6L 1CT8A 5E00B 4JAMA 4ODSH 2GY5A 2BSTB 4ISVA 2YKLH 5CWSA 4UV7H 2VYRE 3RVVC 2IAND 4ZDHA 1AD0B 3BKYH 1DBJL 3UTPD 1VA9A 3UPRA 3N0PB 4OGZA 3VMOA 5EZOL 4PTTA 4OFYD 1MNUH 1Q9LA 2P46B 3T2NL 1S7WA 3GMOA 1TJIL 3BDBA 1NCTA 4HKXB 4M61B 5CILH 3A0OA 2DIBA 1VFUA 1AGBA 4HX1A 1HHHA 1L0QA 3HCVA 2XFXA 4P9HC 1A8JH 2MNUA 5EOTA 3V6FA 3NACL 4GSDH 5EFIB 4F7EB 25C8H 2FLBT 2YD1A 1FG2A 4KK5D 4PP2B 3WXVH 3OAYH 3RRQA 5TF1H 4CU6A 1S9VB 4G9FD 5MP6L 2FL5A 1M6OB 4JZNA 4PRNB 5AZ2H 1WBYA 2BVEA 1YEHL 3ARXA 4HWZB 4JN1H 3CSYA 3WUWA 1RU9H 2OYPA 1ONQB 1ZT7B 1YQVL 1FN4B 4ONFH 1MRFL 1BBDH 4DZ8A 4P3CH 5F1SA 1T1YB 3R0NA 4ODHL 1RJYA 5IMKA 5C8JA 3MQIA 2KDGA 1T6VN 3FB8A 4U3XA 4GBXD 2JELH 3BZFA 1AXSB 3OKDA 2D7OA 4LSRH 4M5ZL 1CIUA 4EN3A 5CSZB 1YMHB 4ZO6A 4FQ2H 5CIPB 1A2YA 3KYNB 1KLUA 3P4LA 4WNQA 3FAWA 1CL7H 1JPST 4RMRA 4ZOEA 1FZJA 1IT9H 3R4DA 7FABH 4HXBH 1MHEA 2J5LC 3KXFD 1X4XA 3U7WH 5KSAC 3HI5H 3MUJA 4K3EL 1CR9H 4YHOH 5IROC 3DUSA 2VDKH 4NRXB 5J9PB 5HDQL 4XP4H 3Q6GL 3BMVA 4OFVA 3KPLA 4OFDA 4OLVL 1HSBB 1EHXA 5MI0C 4I77L 3D0VB 5IB4B 5ANMB 2CKBB 2IMMA 4R3SB 1IGCH 1M71B 4JLRB 4UQ3B 1SMAA 2R2EB 1HI6A 5L6YH 1KXQE 1HSAB 5I6XC 1JNHB 2BP3A 2HFFB 1XGUB 2AXHA 1KOAA 4X7TA 5GS1B 1BBJB 2Y06L 4LSPL 2J6EL 3MGTB 4YBQC 1H8OA 5ISZD 1KFAL 2DQGH 3TIDB 1OTSC 1HHKB 2WBJB 4WHYH 5C0BD 1U8IB 5FUCE 1BFOA 1MWAH 4JRYD 5ESQB 1QBMH 4YHPB 4X5WA 1J1OL 2X70B 5GISH 3IF1A 4LLVB 1LE5A 3TBYB 5TDOB 4I5BB 3FQTA 4WFGD 3I6KA 3GBML 4X0KA 3OZ9L 1W0VA 1K3ZA 4YE4H 4KZDL 1CGVA 1MI5E 3V2AR 4NM8H 4Y89A 2ZCHL 2IFFH 4JKMA 3KJ4B 3T8XB 4HD9A 1QBAA 4PJDB 4FFVC 2J8OA 4R4ND 3UXFA 3JXAA 1XR8B 3QDMD 1UEMA 3MJ9A 2HAZA 2EXWC 3TO4B 2R8SH 2X4QB 1WCBB 3O8XB 2OL3H 1SMOA 1DBBL 5DJZA 4M7LL 4HGKC 4PLKD 4HV8A 1IGMH 4QRQA 1JGUL 2IAMC 1YEEH 1N64H 3BD5A 5MEPB 2ED8A 5HYEA 1URLA 4L4JA 4U49A 2YMXH 3R8BB 3TVMB 3EYSL 4FMKA 5CLTA 3WHE1 5D6CA 1P4IH 3TJEL 1LO0H 1U3JA 2GUOB 1MHPH 3DO7B 3S36X 1NAMA 2J4WH 3CLEL 3DRQA 5J1AB 4QO1A 5K59E 3H0TB 5AYUH 5F97E 4KMQA 43CAB 2W65A 1SYSB 4H1LA 1ORSA 3I3EA 4EI5A 3E1F1 3VG0L 4PJXA 2FGWH 5L88L 3L5WB 3L3GA 5EORL 4K7FB 5DMGC 3BPOC 2BHZA 2APFA 1OD9A 3GGWA 1DQMH 1VFOA 4G8EB 2GJ6B 2R4RH 1F4YL 1VADA 2EZ0C 3NAAL 4PJIB 4K3GA 4ONHB 1A6WL 2FJFA 4PGBA 1T21B 3NTCL 4Y1AE 4PGCB 3NCJL 4WI6A 4LARH 5J89A 5H8DA 2DTMH 3F58L 3PGFH 3PWVA 4YZFF 4HWBH 4XPBH 3MBEB 3MO1B 2DOCA 3PABB 4GW4A 1A1OB 2A9NH 1DLHB 3GSWA 5SWSD 1KB5A 1MJUL 4M8VA 3S5LB 1T89A 4XCNA 5H94A 2W0FB 5DDHB 2NXYC 5FECA 4JPIA 1AR1C 2P5EE 1EO8L 1GZQA 1MAMH 3EO1A 1L7IL 3ES6A 5C08D 2ICEB 4QY8B 1ZT1A 3BW9B 3QXDB 4QRPB 3U7AA 1S7TB 3PUCA 3QQ4B 5CGYD 5EWIH 2L7JA 5HHXH 5MHSD 3HKFA 1KN2H 4RFNB 1T1WA 4UDTB 4G8GB 3C60B 4MA1C 5KW9H 4CL7A 3UEZA 1AP2A 5DT1L 1CT8B 4OF7A 3LDBB 4JAMB 4DUXA 5EBLA 2QSTA 2HKHH 4ISVB 4RISL 3IDUA 3E8UL 5CWSB 4KAQH 1TVHA 3SQOH 2A2QT 4JHAH 4YDIH 4ZDHB 3WXWL 3O6ML 2EH7H 3UPRB 4LPTA 2F54E 5IR1A 2NPLX 3RWEA 5E08L 4PTTB 3SQBA 3UC0H 4Y5VC 3SGDH 1Q9LB 5I1EH 1S7WB 3DXAA 3GMOB 2XQBH 3ARBD 1FORH 4L5FL 4O4YL 1IC7L 1F8TH 5T5FL 2VR5A 2VLJE 1AGBB 3C5ZC 2WQRA 4HX1B 4UMGA 1HHHB 3ZDYF 4UTBH 5J11B 3HCVB 2FX7L 4F8QA 2XFXB 5EOTB 3V6FB 4NP4L 3IDNA 4FS0A 4OZGA 1MCQA 4HG4J 1QRNE 2UVFA 1FG2B 3VGAB 1MF2H 5K9QG 2D31A 5C09E 4X6DA 5E1HB 2XXMB 5FHAL 4F9LA 2FL5B 5I1DA 1F4XL 1MREH 2AJXH 2XYCA 2YN5A 4JZNB 4J3SA 2YD2A 1WBYB 3MLYL 2DLFH 3CSYB 2NX5A 1PD6A 3K46A 3WUWB 3PQYA 4JB9H 1Z3GH 3TO4C 3TT3L 4NZDA 2QSVA 4DZ8B 4P4KA 5M94B 4NQED 3N1QC 4PUBL 1RJYB 1J0ZA 5IMKB 2XOTA 3RIFK 3SO3B 5C8JB 3FB8B 1MRCH 5GQBA 4Y4FA 4IJ3C 5E94A 3BZFB 3OKDB 5I0ZA 1NCWL 4EN3B 4QXGL 1A2YB 1KLUB 1IEBA 4WNQB 3DGCR 3WMSA 3BAEL 4OLUL 2KH2B 4YWGH 1FZJB 1MHEB 3ZE0F 1II4E 4HF5L 5LQBH 3BKJH 3DUSB 5EOCH 1QFWI 4D0CA 4MQ7A 4I3RH 2H2PC 3P73A 5ADPH 1VGEL 2YA2A 3CFEA 3KPLB 1B2WH 2R9HC 4GAJH 4NBXB 5JIKA 1N2RA 4N0YH 2FH8A 4YDLB 3K2UH 2BRQA 5HI4D 3JWNC 3B5HA 2VUYA 1HI6B 3V5HA 2VXSH 3RWIA 3C6LD 4ODSL 3HRZA 2YS4A 2YKLL 4UV7L 1D6EA 3DIFA 3JUZA 3MRGA 4NQSA 2QSQA 4WY7H 2C3GA 4KK6D 3BKYL 2ZZUT 1PZUB 4KDTC 5TDNA 4OAWA 4RBPH 4L4TD 1BFOB 4R97B 3FN0L 2B5IB 2CGRH 4M62H 4XPAH 3U1SH 4OTXH 2BNQA 2E9BA 4X5WB 1MNUL 4H5SA 1BF2A 3IF1B 1LE5B 1GGUA 3QUMH 2C5DC 2WZPD 5CILL 3FQTB 4F9PA 3I6KB 2VIRA 4Y16A 3O6FA 1MAKA 4X0KB 1W0VB 2X9YA 3KHQA 4BQ9A 1TNMA 4GSDL 2AEWA 4UT7L 25C8L 2R39A 4FTVA 4CNIA 1ZSDA 3WXVL 1EJ6A 4Y2DC 5TF1L 2H8PA 4E42A 4WW2A 5KTEH 2F19H 3TN0D 1DBKH 3JVGC 4PJ8C 5AZ2L 1FIGL 4ZOCA 1A1NA 1CICD 4XHJD 2FZ3A 5CMAA 2PKDA 4JN1L 1AGEA 4R7NA 1AHWC 1RU9L 3LD8C 2CRMA 1J10A 2NY4C 4ONFL 1BBDL 5DJZB 4P3CL 3D39D 4ELMA 1NC4D 2XZZA 2LFGA 4HV8B 4KKCC 4O9HH 4QRQB 1UZ6E 2EDTA 5F71A 5DK3A 4KFZC 5I73B 5D7JD 2JELL 2LU3A 1HKLH 4LSRL 3RUGA 3NGBC 5DFTA 4FQ2L 3IJHA 1FDLH 5K33A 1LGVA 4LPCA 5A43C 1CL7L 1RD6A 2JK5A 4Z7WA 1IT9L 2O26U 1DP0A 5D6CB 4HXBL 7FABL 5IBLC 1JI2A 3U7WL 4R96A 3HI5L 1KCKA 1CR9L 4YHOL 2VDKL 3IYLW 1UZ8A 3RBSA 1NAMB 3AB0C 4UAOC 4XP4L 1EDQA 3DRQB 4TRPH 4PJXF 5AG8A 1C7TA 4WI8A 1TPXC 2W65B 1IGCL 3EFFA 3REWA 4XWOC 4QNPE 4H1LB 2X89D 4UOJA 1ORSB 1YNLH 4GS7C 2VL5A 4EI5B 5GXBB 4HXAH 4P9MH 5L6YL 2JCCA 1QSFD 2J8UF 4NQCA 4PJXB 4FP8H 1ZS8A 2DLHA 1VACA 4PJ7F 3L3GB 4YHLH 5L8JB 3QIBD 1ZGLM 3GGWB 2DLTA 2DQGL 1ZE3C 1VADB 2B4CH 2YWZA 4RGNB 4EIGB 2FJFB 4PGBB 4D9RE 1ZHLA 2A9MH 2CXKA 1F42A 2ZNXA 2X5PA 1MWAL 1QBML 4KJQC 7CGTA 5CP7A 3PWVB 5DFVD 5GISL 1F11A 3TF7C 1W72H 2C1PA 2W38A 4GW4B 5FGBC 2MJWA 3GSWB 1KB5B 4UNUA 1E28A 1YC7A 4H0HB 4X7CC 4JDVA 4YE4L 2EECA 4XCNB 2NR6D 4JVWA 3QWRA 5H94B 4X5LA 5FECB 4JPIB 5TQ2H 3NVQA 4NM8L 3EDFA 5I17A 1GZQB 2IFFL 1WVZA 3EO1B 3ES6B 4GAGH 3GMNA 1ZT1B 1OQXA 2APVA 1OT2A 4WUKH 1T1WB 4HWUA 3QDHA 2X4PA 1UGNA 2R8SL 1DQDH 3LPFA 4NT6A 3MFFA 2OL3L 4JKLA 1AP2B 4Q6IC 5EBLB 4D3CH 1IGML 1CTNA 1YEEL 1F3DJ 4PRIE 1N64L 1TVHB 4HLZG 4PV8A 1RMFH 2ICWJ 4IHOA 4JHWH 3T0DA 2Y5TA 3ESUF 2FBJH 2YMXL 4G6ML 5IR1B 3VFUA 3RWEB 2P47B 3I3DA 4AIOA 3VWKA 4WWKD 5ITFA 1P4IL 1BJ1J 1FO0A 2OMNA 3DXAB 4J3UA 5DMKA 1UQSA 1AKJA 1MHPL 2ZPKH 4F8TA 3FQWA 4POZD 2J4WL 2KQMA 3D3VA 4MHHG 4OZGB 5AYUL 2F5BH 3I3BA 1J8KA 1MEXH 1MY5A 2D31B 5JO5A 1SJVA 4X6DB 5D1XC 5I1DB 2W59A 2O61A 2Y7QA 3UBXI 3CXHJ 4CJ0A 2FGWL 4GLRI 4WGWB 2NX5B 4LOUC 2WMPA 1ZLWK 3PQYB 1DQML 1X5AA 3AREC 4P4KB 4MB3A 2RR3A 2R4RL 1R5WA 4DEPB 2GAZA 1ZGLA 2GQHA 3FB7A 4Y4FB 5E94B 4LARL 4TVPH 2DTML 5A2JH 3PGFL 4YBHA 1SVCP 2NCMA 4XPBL 2A9NL 1IEBB 3BFOA 4NN5B 3EYQD 4MWFA 2CIKA 3S34H 3OGCA 1JF1A 4D0CB 4LAQH 4MQ7B 1MAML 2JIXA 3P73B 3CFEB 3RZCA 4G8IA 4MB4A 1F00I 3QAZC 4MJID 4UU9A 5EWIL 3CZJA 1N2RB 5HHXL 1KN2L 3QEHA 5T5NG 5KW9L 3BH8A 3V5HB 3RWIB 3UMTA 3HRZB 2N4IA 1EPFA 4WFFD 2HKHL 1I7RA 2XN9E 4KAQL 1D6EB 1HCFX 1ZVSA 1OTTD 3DIFB 4JRXE 3MRGB 4NQSB 3SQOL 4IRSD 3NZHH 4HQQH 4JHAL 4YDIL 1U58A 4P2QD 3PDGA 1L6XA 4EI6A 3HI1A 5TDNB 4OAWB 1OP9A 3LKQA 4FQPA 4OM1H 4NQDE 3KLDA 2GCYA 3UC0L 2AEQH 3ULVF 2BNQB 3K8KA 4H5SB 5I1EL 5KANI 1PGRB 5ICXA 4K9EH 2XQBL 4LEOA 4LPYA 1FORL 4RMVA 1F8TL 2VIRB 4WV1C 4WW2F 3O6FB 4Y16B 4UTBL 4K2UH 5DGQA 1CN4A 3MC0A 4FTVB 5GGUA 5D6DA 4ZPVA 3TBTA 4U0QB 4CNIB 1ZSDB 5MENA 1MF2L 4TUKH 2B39A 2H8PB 3UPAA 4WW2B 2XWTA 4E42B 4ELMF 1MREL 2AJXL 3U2SA 3OKYA 2CLVA 4IRJC 1A1NB 2FEDD 4QYOA 2FZ3B 2NY7H 5CMAB 5C0CD 2DLFL 3GSOA 4JFEA 3D69A 1AGEB 4R7NB 4LASH 4JB9L 3RUGF 1Z3GL 3I9GH 5JIPA 5MEOA 4MNQA 4ELMB 1QA9A 4X8XA 1FRGH 5B38G 1MRCL 1QTYT 4NBYB 4Z7WF 3U4EA 1ZKAA 3AMKA 3HR6A 2VOTA 1BVLA 4KJWC 3RUGB 3QJHA 5HGHA 2YD4A 5C0AD 5KN5A 3IJHB 1P7HL 4ZAKD 4YFDB 5E24E 3UTSD 2J12B 2JK5B 5AUMA 4YWGL 4Z7WB 2LVCA 5GRJH 4LVHB 4R96B 4OD3H 5LQBL 4TVPE 1A02N 3BKJL 1FNSH 5EOCL 3WSQH 1UZ8B 4LSQH 2CUIA 4I3RL 1XF1A 5ADPL 2XA3A 1B2WL 4GAJL 3N1PC 4HKJA 4N0YL 4WI9A 2IF7A 1MCNA 3K2UL 3HI6H 3EFFB 3REWB 2D9QB 5BRZA 3UCRA 1MCKA 2VL5B 2JCCB 2VXSL 4NQCB 3TA3C 1ZS8B 3VRLE 1KXTB 1RJZA 4H8WC 1VACB 4FQHA 4AEHH 1KC5H 1D9KC 2JJVA 3CVHH 1F4HA 5EBWA 1W0YT 4WY7L 2AXGA 3MREA 3WKMH 3TYFA 1ZHLB 5D5MF 5C07E 4Z7OF 3HG1E 2G5BA 5HY9A 5GZOC 2CGRL 4M62L 4PYGA 4XPAL 3U1SL 4OTXL 5CP7B 1TLKA 1F11B 4P3WA 2C1PB 3QUML 1I9EA 4G43A 2J3SA 3MR9A 1AQKH 3D18A 3HZVA 1E28B 4HKZA 4JDVB 4DAGH 1JYWA 1HH6A 4XNXH 3X11A 1NFIA 3O4LD 1P84K 2AXFA 4MAYA 5I17B 4J4PC 1AH1A 5KTEL 2F19L 3GMNB 4URTB 1DBKL 4CADA 4M7JH 5EN2A 1WUNT 3DMMD 1TDQA 3QT2A 2X4PB 3ZT7A 2ERJC 4NT6B 3STLA 4KRNA 4Y8DC 2YR3A 2YXMA 3MFFB 5I8EA 2Y36H 1WWCA 2DB8A 4O9HL 1CK0H 4IS6A 4UZGA 2I07A 5CP3H 4FFWC 1XF3A 4PV8B 1HKLL 4NCC2 4NOFA 4IHOB 4PJAA 1FV1A 1QFUL 2Y5TB 3Q1SH 1FDLL 1RURH 2HLFD 3MUY1 2A1WH 3IJSA 2H3NA 3VFUB 3T3PE 1I85A 3IFNH 4JJ5A 3VWKB 4WTZA 4QOKA 4JQVC 4X98A 1FO0B 1I3RA 5ITFB 1TQBB 5DMKB 1UQSB 1AKJB 3FQWB 1M4KA 1DVFA 4TRPL 1IKNC 3FMGL 3D3VB 1UADC 3O4OB 3BDXA 3QCVH 3IXAA 1RZJH 3ULVC 3OAZH 5JO5B 5EB9A 5DLMH 3AS3A 3JWOH 1YNLL 5EU6E 5IQ7H 3SDCA 2O61B 4HXAL 4P9ML 2Y7QB 2E9WA 4S10A 3CFBA 4FP8L 2DBJA 2BFVH 2VDLH 2R2HA 1NC2D 2CMRH 4YHLL 1G7PA 1MIMH 1UENA 4K7PX 3AXLA 1CVRA 2F74A 1JHLH 1R5WB 1BFSA 1NANI 2B4CL 2GAZB 1JNLH 2AVGA 1ZGLB 3T0EC 2A9ML 5C7XH 3ARYA 3FB7B 4CBPA 1ES0A 3H9SD 2EDXA 4FG6C 5D1ZC 3MZTA 1W72L 1B0RA 4LRIA 4KRMB 5H37H 2IBZY 4MWFB 2CIKB 3LEYH 1KCLA 3V52H 3OGCB 5TQ2L 1JF1B 3U83A 2JIXB 4GAGL 2NY3D 3RZCB 3UYPA 4G8IB 4KROD 4UU9B 3QHZH 3QPQC 4WUKL 3UAJC 3QEHB 1T7VA 2B4CC 1DQDL 1YZZA 3BH8B 4LVNC 4D3CL 5D8JH 1I7RB 1ZVSB 4CN4A 1JWUA 1RMFL 4FQCH 4I3SH 2QADD 4JHWL 1BQSA 1U58B 4Z7NF 1FQ9C 4EI6B 3HI1B 2ZNWA 3H3PH 4ZUTA 1HYRC 2FBJL 3LKQB 1U92A 3QEQE 4Y2OA 5F6IC 5JA9A 2GCYB 1CLZH 1R3IH 3B9KD 4UB0H 5ICXB 4WEMB 4LEOB 4CRPA 3PXJA 1KIPA 2ZPKL 1JNNH 4AIZA 5CLWA 3VDAA 4G9DA 4PJCE 2VISA 5GGUB 4ZPVB 3TBTB 3K4ZA 2F5BL 2NXZC 5MENB 1MEXL 1CQYA 4KTDH 4HJ0D 1PW3A 2XWTB 1MCRA 3EIFA 4NN6C 3MLWH 4CU8A 3U2SB 4JFFE 2CLVB 4QYOB 4MJ2A 1FHGA 2JJWA 3K1KC 1BD2D 2CR3A 3Q5TA 2Z31D 3GSOB 5LBSH 1EVUA 4JFEB 3D69B 4PRHE 1U95A 4Z77A 1UKTA 3SHSA 2Y1VA 3U82B 5I66A 5MEOB 4MNQB 1CXEA 1F3DH 3HC0A 2P49B 1QA9B 5IW1A 4YC2C 5F7MC 2LTQC 4DVRH 3U4EB 1FE8H 4TVPL 1BVLB 4NUJA 3SDAC 3QJHB 2P1YA 4I48A 5HGHB 5KN5B 4QRRD 3K81A 5DD0H 5IVNA 5AUMB 1BJ1H 2EE6A 4WWID 3S34L 1KLFA 4AEFA 4O5LH 1I4FA 2HVKA 4LAQL 3AS0A 2G60H 1AC0A 3N85H 2HYMA 3WUZA 5HHMD 1DN2A 1VFAA 3QUXA 1BIHA 4HKJB 1N7MH 1ZA3A 5BRZB 4TOYH 1SBBA 1WEJH 1RJZB 4FQHB 2HTKD 1QFOA 5DD5H 5EBWB 3IAQA 2ZG3A 5I71C 3NZHL 2MQ3A 4HQQL 2AXGB 3MREB 5JORA 3TYFB 3SDYL 4RX4A 2ESVD 4PJ5D 4OM1L 4HSQA 4Z0BH 2G5BB 5HY9B 2AEQL 3QQ9C 4J3WA 4K9EL 1H3XA 5JR1H 3P4MA 4H25A 4GG6E 1BHGA 1RUAH 4WDIA 1IAKA 1OF2A 4G43B 3MR9B 4ZSOE 3D18B 3HZVB 4K2UL 4LEXH 4HKZB 3KPSE 1Q9WA 1HH6B 3H8NA 3X11B 1NFIB 1CD9B 1MI5A 2AXFB 2DIJA 4MAYB 5DJ6A 4TUKL 5KANG 1FSKB 1QOKA 3HE7C 4YHZH 5F70A 2BCKA 4CADB 5EN2B 5FYJH 4QWWC 3RX7A 2NY7L 1ROWA 2XG5A 3W0WE 4MAUH 4LASL 3OAUH 4PJAF 2EDBA 3STLB 3FTGA 3I9GL 5I8EB 2DWEA 4HKBA 3WIHA 5IWLC 1DL7H 2WLYA 1FRGL 3AROA 2KZWA 4IS6B 3RVUC 4GRWH 3RWCA 4AT6A 4LHUG 2I07B 1XF3B 1C08A 5A3ID 4PJAB 4XMKL 1FV1B 3O6KH 3IJSB 3GSRA 2H3NB 2I24N 1RVFH 4FZ8H 5J4MA 5GRJL 5IBTH 4JJ5B 4X98B 4QOKB 4JDZA 1I3RB 4OD3L 1MFAH 1BQLH 1FNSL 3WSQL 2P5WD 3W81A 1PX4A 2DQEH 4LSQL 3HPJA 3TH3T 3MA9H 5J56B 1DVFB 3PWPD 4NHCH 2DM4A 5I8KH 1WCQA 5FM5O 1DEEA 2CH8A 2DWDA 3IXAB 3J8F7 1DANT 3HI6L 3OKLA 1V3MA 1G7MA 3SDCB 3CFBB 1XT5A 3PV6A 1U41A 4AEHL 3U0WH 2R2HB 5EUOF 1KC5L 1G7PB 4OZFH 3CVHL 4P99A 1KCRH 1D3CA 4FQXD 3VXSD 1JPFA 3AXLB 2F74B 4M6OH 2NYYD 5KAQG 3WKML 4Y1AA 2IH1A 1ES0B 4F15B 3T0VA 2FH6A 5DEZA 2AK4D 3H9HA 5JTWA 1B0RB 4Z76A 3ARFA 4U7MA 5CGMA 3V6OC 1KCVH 1AQKL 1OP3H 1I1AD 2W60A 4DAGL 4XNXL 3I50H 5TGBA 3PWNA 2P5EA 3BXNA 3O2DA 4M7JL 1QFHA 4CVUA 1L0YA 1RZKH 4NCC1 3W11C 2Y36L 4QGTA 4UOW1 2BJML 4FZEH 2R0ZH 4S11A 1CK0L 3GO1L 5GHWH 4GKZA 3CFJA 2KPNA 4DJMA 1GOGA 5T3ZD 5K9JH 1JWUB 2E6JA 3PHSA 3CZFA 3Q1SL 1RURL 3RVVD 2Q3ZA 1NBYA 4ZUTB 2A1WL 2XTJE 1U92B 2F54A 3IFNL 3E0GA 4F33A 5C1MB 1OP5H 3BPNB 5D2NE 3S3PA 1KIPB 4AIZB 2VLJA 5GRXG 3HE6C 4G9DB 2CRYA 2VISB 3DUUA 2IANE 4GAFB 1I7ZA 2CSPA 3QCVL 1QRNA 1RZJL 3UTPE 4IMKC 5DLML 1FSKC 3JWOL 2PXYC 4UTAH 1F45A 1YNTA 5IQ7L 1NUDA 3DYPA 1ZWIA 2Y23A 2BFVL 2VDLL 4WENB 2CMRL 3G9VA 2VLLA 2VSCA 3BEVA 1U95B 4GMSH 4Z77B 5I66B 4U1KA 4M5YH 1JHLL 3HC0B 5IW1B 4GOSA 3EDKA 4M8QA 2ENYA 5C7XL 3L5JA 1JBJA 5I1IH 4NUJB 4KKAC 3MUGA 2MCG1 4J12A 4I48B 5E9DD 3QUZA 1PKQE 4N8CL 5T3XD 1I75A 4JDTH 2AJVH 3G08A 4LVEA 4BFGA 3P0VH 3V52L 5C92A 3JWOC 4HGMA 1YC8A 2FHFA 3VFRA 1KTRL 2Q76A 1I4FB 4XB8A 2HVKB 2X1WL 1U36A 2OJEA 3DI2B 5KSAD 3DBXA 3PG2A 1U3HA 1E6JH 2EEDA 1VFAB 2GIYA 3QUXB 1CBVL 5B39G 4OZHE 5DEFA 3QHZL 3OBAA 4PJBE 1ZA3B 3IS1X 5SV3A 4XVJH 3RTQA 3BZEA 3P0YH 2NY5C 3KXFE 4WI7A 2ED7A 4DFIA 5D8JL 5C6TH 3BVNA 4MQSB 4GRLC 3MRLA 4DOHE 4I2XE 1EH9A 3O81A 4FQCL 4I3SL 1B4RA 1GZPA 1NCCH 1UYWH 1EEYA 5JORB 3ELAT 4YBQD 1FNLA 3H3PL 4X7FC 3V0AC 3I6LD 1OTSD 4L3EA 1GGYA 3HS0A 1CLZL 1R3IL 4UB0L 5DWUH 1QSVA 3KS0H 3P4MB 4H25B 2VXUH 4XNUH 4KK9C 4WDIB 1IAKB 4J23A 1JNNL 1NCDH 1OF2B 2OP4H 4KUCF 4CJ1A 3RGVC 3BMWA 1Q9WB 4KJPC 1FP5A 5ISZE 2CJUH 3BZDA 3MMEA 3KYOA 1MI5B 5C0BE 5DJ6B 3WJLA 1JGVH 1S7QA 4ERSH 1INQA 4KTDL 3ARZA 2P8LA 4WUUA 2Z0BA 3C8DA 5IT2H 5E8DH 4JRYE 3C5JA 2BCKB 3MLWL 1X5LA 4NZTH 5HHVH 1H5BA 5DHYA 4FFVD 5LBSL 4WFGE 2QQKH 2PO6A 4PJHE 3FTGB 1J12A 2DWEB 1U8NA 4HKBB 2EXWD 3GJFA 4JY5H 1TQCB 1UG9A 5EZIH 4LVOC 4AT6B 3RWCB 1U8HA 4ZS7H 5E99H 4DVRL 1C08B 1FE8L 5ID0A 5E2VH 1UKQA 2IAMD 2WBWB 1DANU 3OR7A 4NFDA 5DVOA 4JG1H 3QDME 2W91A 4X83A 3EUUA 3GSRB 4KI5C 5DD0L 3B3IA 1GXEA 5K59F 5KZCB 1Y6MR 4JDZB 3C09B 1A6UH 1KLGA 3FFCD 5JIIA 4JQIH 4O5LL 2FECI 2OR9H 3HPJB 3MRKA 2G60L 4Z95H 1WBZA 3N85L 2ZCLH 2I9TA 4ESKA 1XGQA 5HVHC 4JPVH 4MA7H 2APWA 5AZEH 1MCOH 3P9LA 2UZYB 1P53A 1DEEB 2DWDB 3SE9H 3HUJE 3X12A 2EE3A 3OKLB 2I26N 3CPLA 1G7MB 4TOYL 1WEJL 3PV6B 4BQ8A 1JZ4A 4J3XA 5ID1A 3VFWA 1S78C 1IAII 1MRDH 5DD5L 3EDJA 4JFHE 1JPFB 3O3DA 5D96B 4XVTH 5DMGD 4K7PY 2R0KH 4Y1AB 2IH1B 4Z0BL 4BM7A 2EZ0D 3GHEH 1RV6X 2I27N 2DBLL 3H9HB 2AS5M 5JR1L 4Z76B 2X7LA 3ARFB 1RUAL 4HW6A 4ZUUA 1MFEH 1J0YA 5IHBA 4LEXL 4HBCH 4MJ5A 4IBLT 2W60B 2MKWA 4CU7A 3FO2A 4HPYL 3IDYC 4DN3H 1A7PH 4Y5XA 2GEEA 4KRPB 5TGBB 1CFNA 3PWNB 4X9BA 2P5EB 1X5YA 4YHZL 9CGTA 2NXYD 3BXNB 1AR1D 4X8JA 4KC3B 5BW7C 5FYJL 4BELD 1CD0A 1XF4A 3GJEA 4QXTA 3OKMA 3QIWC 4MAUL 1U8KA 5SWSE 3OAUL 4L9LC 2AEIT 1MFCH 2I5YH 3MRFA 4HJJH 3S98A 1DL7L 2COQA 2NY2C 3CFJB 4GKZB 3MXVH 3WNPA 1CD8A 4PRIA 3FZUC 5C08E 1J86A 4MD5A 5HVWA 3O6KL 4UIKH 3CZFB 2F8XC 1B90A 3BH9A 1NBYB 5DEGA 3ME0A 4RMSA 4GFTB 5BVPH 1MELA 2F54B 3ZTNH 1RVFL 4FZ8L 4JO4H 4K8RC 1YEIH 5IBTL 3WLBA 2AQ1A 4ODBD 4PJ9A 1DFBH 1QVOA 1T83C 4F33B 1MFAL 3PDDA 1BQLL 1PG7H 5J7CC 3OAYK 2DQEL 2VLJB 3MA9L 1CGXA 4IEFB 5EIIA 4BUGA 4NHCL 5I8KL 3DUUB 4JGJA 1IM3A 3C5ZD 1I7ZB 4GG8A 2G2RA 1QRNB 1N6QH 2PTTA 1VFBA 4LKCA 3G9AB 5C09B 3BGMA 2JJTC 1YNTB 2E6PA 2RBLA 2Z35A 1RIUH 1KB9J 4X9HA 1ZWIB 3U0WL 1LEKA 1I1RA 4O2FA 1OSZA 2VLLB 3BEVB 1D5MA 1KCRL 3WS3A 4U1KB 4NJ9H 2IGFH 4M6OL 2BVYA 5INCA 4YGAB 4YNYA 2DLEA 3TO4D 3GBLA 4M8QB 3S4SA 4K3HA 5ICYA 2BVUA 3MUGB 3HFMH 2IPKA 2OI9B 4HDIA 4JFYA 3QUZB 2L7UA 4HAGA 3G08B 4FQJH 2VQUA 4KK8C 3DSFH 1KCVL 4YK4B 3RKDC 4NRZA 1ITBB 4N1HB 5JMRA 4HJGA 4NQEE 3I50L 4NNYA 4S1QL 4QXUH 3MLPA 3VFRB 4ONGH 2Q76B 3ZYOA 2OJEB 3TT1L 1W72A 3DBXB 1KF9B 1U3HB 2W0PA 3CMOH 3TBVA 3IKKA 3SE3A 5HTSA 5DEFB 2H2PD 4RGMB 2Q6WA 1SHMA 4OF8A 5FGRA 4ZNEE 2R9HD 1RZKL 3RTQB 1QP1A 3BZEB 5F3BA 2VZUA 5T33H 1N6VA 5HGDA 2NTSP 4FZEL 2R0ZL 4P3DA 3TPKA 3BVNB 5GHWL 2XN9A 3MRLB 4WO4A 5K9JL 4JRXA 2F5AL 1GZPB 1JTPA 1P2CA 2A74A 2J8HA 1EEYB 2NY6C 3MLSH 1E4JA 3ROOA 1OGAD 4J6RH 4NQDA 4L3EB 3HS0B 3ARUA 1WFTA 5FO9A 3QB7C 3OKEA 4M4RA 5CD3A 3EOAB 4P23A 5FFLA 1RZKC 5F44A 5I1GH 2MCPL 3MMEB 3KYOB 1S7QB 1INQB 4WUUB 2P8LB 4UNTA 1ADQH 4L4TE 3C5JB 4UTAL 5J13C 3FONA 5ANME 2PF6A 1O7SA 1QEWA 3U4AA 4KDVA 4Y2DD 1H5BB 1UZ6F 1T7WA 5DHYB 4A6YH 2EDRA 2PO6B 2DD8H 4PJ8D 1KYOJ 4GMSL 4QRPD 5IMMA 4M5YL 5HHOD 1U8NB 4BSJA 1XGTA 3TFKC 3GJFB 1QNZH 2NY4D 3VI4E 1U8HB 5F7DA 5IKCA 1K8DA 1NL0H 5I1IL 5JOPD 5ID0B 5SX4I 4KKCD 5IHLB 1Z9LA 4JZJA 4EUPH 3WDJA 1QPPA 3OR7B 2WWKT 3IT8D 3NIFE 4JDTL 2AJVL 1R5VA 3B3IB 1E6OH 3PXHA 3P0VL 3D39E 1H3UA 1AJ7H 5BMFH 1KLGB 1QFWH 1RULH 3FN9A 4QNPF 5IBLD 5ELIA 3MRKB 1WBZB 1YMMD 3BWUC 5J8OA 2I9TB 2NZIA 3SE8H 1XGQB 4OIBA 1E6JL 5BV7H 3P9LB 5K9OA 2O5ZH 3MCLH 3QXUA 4JM2F 3C08H 1EUUA 3X12B 5F1KC 4XVJL 1A64A 3CPLB 4ODWA 3P0YL 4BQCA 5DHVH 4XWOD 4X9FA 3T4YA 4LP5A 1Q38A 3ET9F 4M6AA 5C6TL 5ID1B 1M7IA 3VFWB 3LQAH 3VXUD 2F8OA 4D94A 1NPUA 3FQRA 5GRZA 3O3DB 1NCCL 1UYWL 3HZYA 2IEPA 1BVKA 2DRUA 3QYCA 1ZANL 3UZQA 3RY6A 3HG1A 2ZG2A 3N1MC 5DWUL 1QSFE 3EO0A 1AXIB 4CN1A 3V6BR 1ACZA 2X7LB 2VXUL 4XNUL 5EZLA 4KJQD 1M7DA 1NCDL 2OP4L 4ZUUB 3S37X 1K9TA 1RQ5A 4MJ5B 4NSKA 3BHBA 3VD5A 2CJUL 4DGIH 3FO2B 4Y5XB 4C56D 1JGVL 4ERSL 4IOSD 1CFNB 1XIWC 4KUZH 5IT2L 1C12A 5E8DL 5EIVA 3DX6A 3EYUH 3U9UA 4X8JB 4NZTL 2EYRA 3D2UD 1T0NA 1XF4B 1A9BA 2VXVH 3GJEB 4QXTB 5HHVL 3OKMB 4L8DA 5BOZG 3CU7A 5D93C 1U8PA 2QQKL 1PAMA 1U8KB 3WJJC 4NO3A 4NNPH 5GS2H 3ZT6A 3H7LA 4D2NA 3DRTA 3MRFB 4LCYA 4JY5L 3O11A 5EZIL 3E3QE 3HN3A 4ZS7L 3QXWA 4I13B 4OCLC 4PRIB 5E99L 4PJIE 2HFTA 4C4KO 5E2VL 4MD5B 3QISA 4JG1L 5D1QC 1C16A 3BH9B 4OIAA 5DEGB 3L3OA 3NPZB 4XH2A 3WLBB 1FAIH 4PJ9B 3SPVA 1DR9A 1QVOB 1A6UL 5HI3C 4JQIL 1HN1A 2HFGH 1YY9C 2OR9L 3ZKNC 4Z95L 4WFED 5EIIB 4O00A 2ZCLL 1X9QA 1UA6H 4JPVL 4MA7L 5AZEL 1MCOL 5HPMA 1IM3B 1SYVA 2G2RB 4GG8B 3SE9L 1BQHA 5FYKD 1Y6KR 2PTTB 2Z4QA 1VFBB 2HT3C 4LKCB 3BGMB 5T5NF 2Z35B 4U1SA 4NFCA 1MOEA 3KG5A 4RAVA 1LEKB 5D1XD 2XICA 1H3GA 4O2FB 1CGUA 1OSZB 1MRDL 3N06B 1D5MB 5AEAA 3WS3B 4OB5H 5CINH 1WAAE 2DS4A 2VC2H 2YZ1A 4CMHC 5INCB 4LOUD 4XVTL 4YNYB 2EDYA 5I9QC 4Y4KC 2R0KL 5DURD 3S35H 3S4SB 3ARED 1ULVA 5ICYB 2DKSA 3GHEL 4EUPG 4Q0XH 2IPKB 1TITA 4JFYB 3IFPA 2I25N 1MFEL 3Q48A 5E2UH 4NRZB 4HBCL 4BFBD 4HJGB 4DN3L 4NNYB 5JW4M 1A7PL 2AXJA 3BX7C 4K07A 2YPLD 2Q8BH 1W72B 5I16A 2D0FA 3AFLA 4PG2C 5ADOH 3TBVB 2XG4A 5DUPH 2ORBH 2Q6WB 4P46A 5CBAA 3E2HC 5F3BB 3NCCB 1MFCL 2I5YL 4HJJL 5HGDB 1KJ3H 2W9DH 4P3DB 4RBPK 2MMXA 1BWWA 4EZMA 2XN9B 3MXVL 5JZ7C 4OBRA 4WO4B 5JW4R 4LCWA 4JRXB 1SY6H 3MOAH 1WSST 4JM2C 4JO3H 2A74B 1P2CB 2OX5A 1CDHA 2AJZB 3Q6FA 4UIKL 3ROOB 1ZLWH 4HH9A 5BVPL 1KUMA 3ZTNL 4NQDB 4JO4L 3STZA 1YEIL 4XGZA 1J9CT 1DFBL 1N4XH 1PG7L 3PL6A 5FO9B 4WFFE 1HXYA 3OKEB 1GYAA 2DMBA 5CD3B 4ZUSA 4OF5A 4P23B 4PJCA 3FQNA 4P2QE 1U8JA 1N6QL 5CSGA 3P11H 1J0IA 3FONB 1Z5LA 3ALXA 1QEWB 1F4WH 1RIUL 4GLRH 3DNKA 2NZ9C 4M02A 3ARDA 5SWZD 3DHMA 4IRJD 4PRHA 5ICZA 5IMMB 4NJ9L 2IGFL 3QJFA 1XGTB 1U0QA 2MSPA 2HRPL 4HWEH 5F7DB 5IKCB 1K8DB 4LGSB 4JZJB 4FQLH 3HFML 3K4AA 2WUBH 2FO1A 5I19H 3PP3K 1K4DA 4ZXBA 3RU8H 4KJWD 1R5VB 3QNZA 1I3UA 4FQJL 5DJDA 4TQEH 3DSFL 1LK3H 2AEPH 5DVNA 5KSBF 4HS3A 5HHNA 3WS6A 1CQKA 4QXUL 1LVEA 4WTXA 4ONGL 4KPHH 3MRCA 1CYGA 3TZVA 1F3JA 3CMOL 4BQBA 3VRLF 5K9OB 3KPMA 5C0AE 4P2YA 1DE4A 3HNVH 3B2VH 3UTSE 4GQ9H 3NIDE 4ODWB 1XR9A 5T33L 1T7ZA 2E7MA 4P5TC 3T4YB 2EKSA 2ZUVA 3SDDC 1M7IB 1C5CH 1U91A 1PZ5A 4TN9A 5DVLA 3FQRB 3TA3D 3MV9D 2B1AH 2F53D 5F3HA 4BFEA 3HZYB 1NGXA 2FRGP 1BVKB 2LAAA 3MLSL 1D9KD 3QIUC 4R0LA 4B53A 5C3TA 3T3ME 1XCTA 4WVRA 3HG1B 4J6RL 1OQOA 4LBEA 3L9RA 4B7IA 4LHUA 3ARGC 3EO0B 5I1LA 1HYSC 5H35A 5GZOD 2Y9RT 5EZLB 4Z8FH 4GG6A 1R3JA 3MRPA 3QI9A 1M7DB 1BIIA 2X1QA 4NHUA 4NSKB 3BHBB 3KPSA 2ARJQ 4FQ1H 1AR2A 5I1GL 4W70A 3SO5A 2V6HA 3RP1A 1ADQL 1C12B 3VWJA 3DX6B 3U9UB 2EYRB 4J4PD 1T0NB 5GIRA 3DHJA 3IAPA 1A9BB 3VW3H 4L8DB 3V8CA 4A6YL 3WN5A 1U8PB 3W0WA 1G6RH 2DD8L 5I1AA 1EBPA 1G84A 2EC8A 3UTZA 4NO3B 1G6VK 1CDCA 3DRTB 4LCYB 5FYLD 1QNZL 1S7SA 2W1NA 3MOBH 3O11B 3O4LE 4L29A 5L2KD 1NL0L 4HIHA 5I1JH 3LHPH 3BPLC 2EDNA 1C16B 1EIBA 1DCLA 4FFWD 2ZP0T 4BFIA 3SDXE 1JJUA 5EIQA 2XKNA 3TP4A 3L3OB 1E6OL 1HDMA 3NCYS 4XH2B 4BK4A 1JGDA 1EHLH 3OJVC 3REVA 3SPVB 1AJ7L 3LEXA 5BMFL 3RL1A 1QFWL 1MLCA 1RULL 5CKGA 5A1AA 5DD1H 4MA3A 5JPMA 1HH9A 2VZTA 4F80A 5BV7L 3NABH 5HPMB 2O5ZL 1SYVB 1BQHB 3MCLL 4HIEA 2Z4QB 3C08L 3SKUD 1LQSR 5DMIH 2NY1B 1LMKA 4YPGA 3ULVD 4U1SB 1UWXH 4IDJH 4RAVB 2H9GA 5IBUG 3WFEH 4LFHD 3LQAL 4HCRH 1MHHA 1W0WA 3ARPA 1Z2KA 3U36A 2VL4A 4OZIE 4KKBC 3VU2A 3ILQC 1AGFA 2CDGA 3SGJC 2OS7A 2ZCKH 4JQXA 4XCYA 1W8OA 5JXEC 2NTFA 1CTOA 3EZ8A 3TCLA 1J1PH 3T0ED 5L8KB 3IFPB 1GGTA 4I3GA 5BV7C 2AKRA 2NLJA 1QSED 4GJTB 4FG6D 5D1ZD 2BK8A 4JANA 2Y5EA 4OFKA 4DGIL 3WD5H 3RKPA 4L8CA 4OZGE 1EO7A 4KUZL 3R8QA 5I16B 3QDJD 3LQAC 1KJ2H 3N9GH 3EYUL 3H9SE 4JPKH 2YPKA 2C4FT 4LDEB 4X6DE 5CHNA 2VXVL 1S7UA 4P46B 1CGSH 5CBAB 2K1MA 4NNPL 3MJ7A 3QPQD 4UILH 4W68A 2NX5E 4XRCA 3UAJD 4HIIA 1AGDA 4OV6F 4C83A 3OXSA 1QSZA 2GY7B 3GK8H 4LCWB 5CUSH 4LLYA 2NY0C 1B0GA 2ZKHH 1UJ3A 4MSWA 2DN7A 3Q6FB 4PGZA 4MYWB 1FYTD 4HH9B 4YLQT 4PJCF 4NWTH 3STZB 4OLYH 2NMSA 4XGZB 1PQZA 1BJ8A 1V3KA 2V2WA 1X3DA 1X5IA 1ZK9A 3OWEA 3PL6B 5IB2A 2HFGL 1HXYB 4TPRH 2P45B 2DAVA 2XV6B 4ZUSB 1UA6L 2PN5A 4PJCB 3BIBX 3VDCA 5F9WC 2IANA 4I18A 3FQNB 3HNSH 1U8JB 2EXYC 5IFAH 2CK0L 5E6IC 4XXCC 1WICA 4EDXA 2YWYA 4WCYL 2EIBA 1KULA 1Z5LB 2NXZD 1N5YH 5F96H 4OFYA 2C9AA 1JE6A 1GAFH 5DI8A 3ARDB 2WP3O 3ARRA 5B39A 3KLHC 1FFPA 4RCAA 4PRHB 4XB7A 4OB5L 5CINL 2E5EA 5ICZB 4JR9H 5LAXA 2VC2L 5AAWA 3QJFB 3ZDZE 1A6AA 1ZGLP 2V7HA 3S35L 1N6UA 3TBSA 1JK8A 1EAJA 3FT3A 4G9FA 1VFMA 5T1DH 4Q0XL 2C3WA 4W4NA 4OZFA 5B8CA 2VDNH 2EIEA 3ETBF 1NUNB 1BD2E 1PKQA 1SQ2N 1K4DB 4ZXBB 1JF6A 1MVUA 1J1XH 4YEEA 3QNZB 4HG4K 2X1XR 3SDAD 5E2UL 2DJ4A 4HS3B 5JW4N 2A6DA 5HHNB 1G7HA 4IMLA 3MLUH 3ZMRA 2UY7A 2JE8A 3MRCB 3VG9B 2Q8BL 4OUUA 3TZVB 5ADOL 1F3JB 1FNHA 4GBXA 1KENH 1P9MA 1IEHA 1CGTA 3O9WC 4YDKH 3DOSA 1CXFA 4OZHA 3KPMB 5DUPL 2ORBL 4I4WA 5CFHA 4QRRE 5EOQL 1DE4B 1RSFA 4PGDA 2D7NA 4PJBA 5HDLA 5BS0D 1R5IA 4RRPA 4U7SA 1XR9B 1GIGH 2D4DA 3WV0A 3KXFA 4HT1L 2EKSB 4JRWA 1KJ3L 2W9DL 1U91B 5JQHC 1PZ5B 3JV4A 3RVWC 1CI5A 1SY6L 3MOAL 4I2XA 5HHME 5F3HB 4JO3L 4K55A 1NGXB 5HYJD 1WTLA 2YPVH 4R0LB 5KSUA 3B43A 1INEH 1XCTB 3FB5A 3BESR 4LBEB 5BJTA 3L9RB 4EJ1C 1I9RH 4LHUB 5I1LB 5H35B 1N4XL 5E70A 4GG6B 3A6BH 1R3JB 3MRPB 5IHUH 3QI9B 3QQ9D 1BIIB 4P57A 4NHUB 5DZOA 3KPSB 5ISZA 3ZTJG 1JZ6A 3OPZH 4N5UA 1OW0C 2CUHA 5KVGH 3P11L 5C0BA 2DJUA 2ESVE 2QQQA 4PJ5E 3VWJB 3B9EA 4HEPG 1FL5A 1FGNH 4JFOA 4JRYA 5GGSY 2CXGA 1F4WL 3LEVH 5GIRB 3HE7D 1ZLVK 3NFSL 3WN5B 3W0WB 2QQNL 2JCCE 5I1AB 1RPQA 3UTZB 4PJHA 4PV9A 2V5RA 4QWWD 4JHBA 2VWEC 3EYVA 2AI0H 5IMLA 1U2CA 1GGCH 1SJXA 1S7SB 1I9JH 4L29B 4I9WD 5KAQF 2O5XH 2VZVA 4HWEL 5I1CH 4HIHB 3MCG1 5GGRY 4RAUA 4FQLL 3RVUD 2WUBL 3RIAF 5FOJA 5LCVH 5I19L 3QDMA 4BFIB 5T3ZH 3RU8L 2XKNB 4TQEL 1HDMB 4AQ1B 4LDLB 4YBLC 1LK3L 3QXAA 2AEPL 1JGDB 4HS6A 3REVB 1BGXH 3CDFA 3LEXB 4R2GC 3RL1B 1YECH 4KPHL 1MLCB 4OF3A 3ZSTA 4BQ6A 5JPMB 1HH9B 3BN9C 5E0QA 1RJCA 3MV7D 5IB1A 5IVXE 1JCKA 4HIEB 3HUJA 1DQTA 2Q87A 5BZWA 3HNVL 3B2VL 3MYZA 4GQ9L 4YPGB 4P9HH 4YJZL 2H9GB 3PGCA 4P2OC 3KR3H 1L7TH 1C5CL 3QUYC 2P5WE 4Z7UE 3WNOA 1MHHB 1W0WB 1OVZA 3U36B 3PWPE 1JRHI 2B1AL 2F9BT 3FOLA 2YRLA 5DR5H 1AGFB 2CDGB 4LCIH 4XCYB 1IVLA 4W4OA 4NN7C 4P5MA 2C4FU 2NTFB 3RPKA 3ARQA 3TCLB 3VDBA 5DQDH 1VB9A 1A6VH 2BY3A 2O5YH 4BA8A 2AKRB 5DVMA 2NLJB 4Z8FL 4ZODA 1INDH 4JANB 2BXYA 3VXSE 5T3XH 5EU3A 2C26A 3P77A 3WIIH 5C2UB 4L8CB 5CJXC 4B41A 4RA0C 3BKCH 2AK4E 2D7MA 3TNMA 1NSNH 1HZHH 1BFVH 2YPKB 3OGOE 5CHNB 5D2LE 3VW3L 1S7UB 2ATKA 4XNMA 3TESA 2EDLA 4I0PC 2XACC 1G6RL 5SWSA 4UV4H 5FF6A 5HD8C 3MJ7B 4XRCB 4E41D 4HIIB 4UT6H 1AGDB 4C83B 1A7OH 3MOBL 3OXSB 3W11D 1X5HA 1AO7D 2C3XA 2VLMD 3NCEB 4U1HA 1VSCA 4LLYB 5C08A 4YHYB 5I1JL 2WAHA 4M6NH 1B0GB 1T1ZA 3LHPL 1UJ3B 4MSWB 3WFDH 5HYIA 3BRDA 3TO2A 4M93B 5H2BA 5I76A 2Q20A 2XTJB 1LILA 3VFNA