2AXJA

Crystal structures of t cell receptor beta chains related to rheumatoid arthritis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
DGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASRDRGTEKLFFGSGTQLSVLEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SF4 T cell receptor beta chain
publication title Crystal structures of T cell receptor (beta) chains related to rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axjA02
3TBYB 1KJMA 2OJZL 3IFOA 4L4VB 5KS9F 5CSBA 5FYJL 2FB4H 4P5TB 5INCB 3HHRB 4R96A 3V6FB 4MLIA 2P5WA 2Y6SC 4Y16D 5T3XE 4U49A 1LE9A 1NDGB 4UOW0 4NWUH 3W11C 2C3GA 1FBIL 5F9JB 4KI1A 5ESQB 1MPAH 4YAQA 4XNZB 5JHDE 4ZOEA 3PF2A 5EUKA 3MOAL 3VXUA 3HE6D 3SGKC 4Q9QH 2X41A 4P2RE 2NY0B 5C08A 1ZLUK 1RI8A 1KULA 4MQXC 2RJMA 3WIFA 1EBAA 1MF2L 3EZ8A 3OKOA 3VFOB 4OF6A 3DI3B 1U2HA 2JK5A 1T6VN 2LAGB 3FFCD 4M1GH 4MDJA 2AK4D 2R0KL 2BVTA 4NNPL 4FQ1L 1D9KC 4DW2H 2HJFA 4MAYD 4N8VA 4YJZL 4LPCA 1PQZA 4FNLL 4LFHD 4N90E 3G6JB 3VXMA 2ADFH 5C70A 2VL4A 4HHAB 5C7XL 1T03H 5C0RH 3MV7E 4PJDB 2A9NH 5F3HB 2AEQH 3IRZA 4PV9A 4I48B 4NP4H 1G6RB 4LSVH 1U58B 3CFDA 4YHMH 5DZNA 4JY4B 1MVUA 3KPRE 4UUJA 3RWFB 4G8GE 1RJCA 1P69B 3D3VE 5F88B 4S0SD 1GGCH 2FX9H 4PJEE 4WO4D 5DHYB 5FDWB 4LRIC 4ZUVB 2WIMA 3O6LH 3S4SG 3V8OA 4I2XA 3WHXA 4MD4B 3P0YH 4GKNA 5JW4R 5LAXB 1FC1A 4U3HA 2AJUL 3MV9E 3GI9L 5D70H 2AEPL 3BQUD 4K3HA 2BOCA 4LHUB 5JOFA 1FE8L 1AO7D 5MEQA 3HR5A 1KJVB 3P0VL 1A6UH 3RPIA 2HLAB 4GW4B 4MX7A 4UQ2B 4C58B 4HV8B 4TVPD 3EGSB 1G0YR 2R1WA 5JZ7C 1GXEA 2O5XL 3LKOB 1TJHH 3L3GA 3V52L 4KK6D 4ZG1A 2V7NB 1Q9LA 1X5KA 3HZVA 4AIXA 2FX7H 5SWZB 5E6ZA 1HN1A 4KPHL 3DVIA 4KZDH 2GI7A 2DWDA 4F33A 5JLZB 2E3VA 3HNTH 4WV1A 2GAZA 3UTQA 2YBRB 5CWSB 1UYWL 2VH5H 1T80A 4WNQA 5E94A 3GMMB 2CDFA 2WAHA 1XMWA 1H15A 4YNYB 5E5MB 1OLZA 1A9EA 5D71L 4NM8H 1BLNA 2Q7YB 2OS7A 2XFXA 2XY1A 5MENB 4O2FA 5GRUL 4L4VD 2P1YA 1MELA 4NQXA 3VI4E 1K3IA 1XF2A 3M45A 5A3ID 4QEGA 5LBSH 4F7MA 2X44D 2EDDA 3U7WL 5D2LA 5I1LB 2B0SL 2NXYC 1E27B 2J8HA 3VXNA 4F8TA 4U7SA 1BJ1J 1H3XA 4JCLA 3B9DA 3CFKB 1SYSB 2X4NA 4KMLB 3ZTNL 3EO0A 1YEJH 2NY0D 2YPLA 1BOGA 4L9LB 4NNYA 1J05A 4Z7WE 2MKLC 2Y06L 3VE0A 5CIPB 3O9WB 1IEBB 2QQKH 3RVUD 5JOEA 3D0VB 1QFUH 4O51B 5DUML 2O26U 4QNPF 3T0EE 3RY6C 4MWFA 1J8HE 2XZQL 3L1OH 5F9DC 3OJDB 1RK0B 2OTWB 1FGVL 2GQHA 4R4BB 1X4XA 1LEIB 1U8OB 4X5XB 1RZJH 5J3HC 4DEPC 5IVZA 1KENH 4HS3B 5EUOE 1LDPL 3CX5K 1L6XA 1JWUA 4O5LL 3QNYA 5FHAH 4JB9H 4QRUB 5ITBH 3MLWH 1BGXH 4WFED 4WFHD 1VFMA 5C3LD 3ZDZF 2ZJSH 2UZIH 1F42A 3ULUL 4RX4D 4GG6B 3AFLA 1U91A 3VMOA 1YEDA 2CK0L 3NCJL 4WV1C 4XXDA 4LLQA 1AIFB 4P3CL 1KN2H 4JFQA 3MJ9H 1I85A 4LSQH 5DFWH 5T3ZL 1CN4A 1DBML 5L8LB 3NA9H 1N0LA 2NXZB 4LLYB 4LKXB 3AC0A 2LTQB 3MLPA 4DUWA 2CGRH 4FP8H 3S5LB 3UPCA 4HIXH 4LHUD 5IT2H 3MLXL 4XXCC 1CICA 5CILL 1B0WA 2MWCA 3L5XL 4C83A 5TQ0L 5AD0B 4DQOL 4MA8H 3UPAA 4WI6A 5IEKB 1DANT 2Y23A 4M7ZB 4N9GB 3RVTC 1JNNH 1T21A 1UCTA 1YMHA 4PJ8C 5SWZD 5F72S 3DBXB 2EDOA 2IAND 1G6VK 5EBWB 5HHNB 5ADPH 4O58L 5EOCH 4JE4B 3SO3C 4JDZB 1CVSC 1TNNA 2NY6B 4HGWB 2NZIA 1MHEA 4E9LA 5CAYB 3CFCH 3FO1B 4ODUA 4IOFD 3RL1A 2MQ0A 5TF1H 4UIMA 4FFZL 1QFWM 3N9GL 4M02A 3D5OF 1QUNA 3CFEA 3MRFB 1T66C 4QRTA 2IWGA 1KEMH 3HPJB 2XWBA 4I0PB 3K4DA 5MEND 4Z95L 2Z31A 1OSPL 3H42H 4ZQKA 4H88H 1RZ7H 2HJLA 1UVQB 5JXAH 4NBXB 3MV7A 4UOJA 1QSEE 3W0WE 3QXAB 3T3PE 3QR2A 2DN7A 3VFTA 5IV2A 1I1AB 4UNUA 1RULH 2BNRE 4XX1E 2KUTA 5IF0B 3OXRA 4NM4H 1II4E 2PTUA 4WHDA 1A4KA 1MFCL 4HUKB 3HNVL 1IL1A 4TRPL 1WBYA 1FFQA 4G8GA 5LQBL 5IMOA 4NYLA 2EDBA 3D3VA 1YC8A 2VDML 3O9WD 4ONHB 4PJEA 4DOHE 1D5XA 3MRLA 2WBJA 4LOUC 3T4YA 1IILE 4PGBB 1U3HA 4KKCC 3UC0L 3MRDA 2Z93B 3LVEA 2AJXL 4XTRC 4JHZA 4ZTPH 5IB5B 5CGYD 4GXVL 1CGWA 2EEDA 1OTUC 4NN6B 2WV3A 3MV9A 4NQCE 3THML 3CSYA 1CXHA 5JQHC 4JR9L 3V6OE 2UY6A 3CJJA 1HQRA 3BPNB 1JHTA 1T4KB 1UM6H 4HUWA 5B38B 4XT1C 4XNXH 1ZHKB 4X6CB 1I7UB 4JVUA 1FN4A 4H20L 3FN0H 3M17A 1NEZG 1A6ZA 4GO6B 1QR1A 1BZ9B 3MCG1 2Y72A 1NFKA 3OJVC 4Q9BA 4RISL 1TCRA 2LE9A 2FJHA 3G6JF 4NCDA 1JGUH 3W9DB 4L3EB 4W4OA 1KXVC 1AQKL 1IC5H 1TPXB 3KPPB 4BZ1H 4GRLB 2MCPL 1CFSB 4PJDF 3B5TA 4PJFB 4OLXL 5ID0A 1O7VA 2DMCA 1M6OA 2NXZD 1AP2A 3WDIA 1MCHA 5C07E 1QBAA 3D9AL 3ET9F 4FQXC 2FHBA 2GT9B 2P8LB 3EO1B 5E1HB 4MJ5B 4DVRH 2A83A 4X4ME 4TSAL 2F54D 5I1CL 2Z31C 4MJ6A 3RHWF 4Z6AT 1XZ0B 3V9FA 2Z35B 2QTEA 1W0VB 3MODH 3MRIA 3OJMB 3H3KA 4FTVB 1WEJL 3C5JB 1A3LL 4ODTH 4ISVB 3VGAB 2APFA 2H2SD 2V9QA 3CC5B 4BM7A 3QUYA 1X44A 1N4XH 1GGBH 2XIDA 2D4FA 1EHNA 4UDTB 3QZWG 2AW2A 3MFFB 1S9XA 3AMKA 4OCSL 4HK0A 4XCCL 3WO3B 5C0FA 4RZCA 1OL0A 3TNMB 1U8KA 2UVEA 2Z8WC 2GJ6E 3DSFL 4M6OL 1KCUL 4Z7WA 1JPGA 5BW7C 3TBSB 4IJ3C 5DRNA 4NQVB 1EO7A 2NNAA 3T0EA 2E7MA 4XH2B 2W65A 2DM3A 2XRAL 4R9HA 1EGJH 1L7TL 1Z9OA 2GCYB 2X4UB 5HHXH 1I3VA 2ICEB 5DEZA 1S7WA 4U05A 2XA8L 4KUZL 4KVCL 43CAA 3PV7A 4PJ5E 1D5BB 4KJQD 4K7PH 3IVKA 2J2ZA 2DYPA 5HGBA 4MB5A 2ESVD 5AZ2H 5EUOA 3S37L 3REVA 1R3JB 4UT6H 3VU2A 2JIXB 2YHGA 3OR7A 5E2VH 1MUJB 5EOQL 1CZ8H 3UJJL 4HS8H 2V7HB 3V5KB 1T5WB 4YR6B 4LSRL 3SDXE 5IESL 4JFDB 3LS5H 1SJVA 1NCBL 1UJ3C 3BKYH 1MCLA 3SDYL 5AG8A 5C0BE 4PFEA 3HRZB 4M62H 4HCRH 5GSRB 3LD8B 4XWGL 2N56A 1WCBB 1B4RA 1JZ2A 4HIHB 1DEDA 3DYOA 3I6KA 4KI5F 5ACMA 3S96B 3V5DB 5CEXA 1LHZA 4UV4L 1CGTA 5EBGA 2DQEH 3EOYG 1EZVX 1AXSB 1WVZA 2YA1A 1CLOH 3H9SE 4MA7L 3FOMA 4X9HA 5ESVB 1DBJH 3GGWA 1GOHA 2EIZA 3WJLC 3VXOB 4JO3L 1S7RB 4GOSA 4YEEA 4WFFD 2WQRA 2NW2B 32C2B 1CWVA 2P46B 4RGOH 5EWIL 3OAYH 4RGNC 2V9TA 2YRLA 3QAZC 1M7DB 4A6YH 4MMXC 4W6WB 4Z8FH 4I9WE 5IB3B 1YZZA 1E6JH 5E2WH 4HWEL 3DMMD 3FRUA 1MCOL 3I2CH 1EXUB 4GG6F 4OKDA 1D5MB 1HINH 4S1RH 3BIBX 4FTVD 4G9FE 4PV8B 4F58H 1BAFL 2VZSA 4NZRH 4U1HB 4E5XA 4ELMB 1QLEL 3L3IA 5E2UL 1QSEA 3W0WA 2AV1B 3V7AG 2ADJB 1CD1B 1ZLVH 4M9PA 1HCFX 3U4EB 1AI1L 2BNRA 1WC7A 4YPGA 4C54A 1I1YA 4K94C 4M93B 5AYUL 1P4BL 1FH5H 3QQ4B 3KVQA 4GUPB 4KV5F 2CRIA 2HKHL 3EO9L 1DP0A 2CRYA 3L7FB 4LLWA 4OCRL 1LDSA 1FJ1A 5SX5H 4YHZL 5I6XC 1RJZB 4GH7B 3VWJC 5DQDH 3QNXB 3HRPA 5FF6B 3C2AL 3S3JA 4XVJL 5E6IB 4JY5H 3PHSA 1LK3L 2FYYA 3VMPA 4OCWH 1RURL 5D2NC 3V6OA 2Q76B 2GUOA 3VRIB 1UH4A 3FTGA 3PP4L 4NC1E 4JPVL 2F74B 1A7NH 4HJGB 1D6VL 3UJTL 4DK6A 2X4RB 2JIXD 4BSJA 3OV6A 4IRSA 3L95A 2GJZB 4IOIB 3GSWA 5KSBE 5I8CB 2VOTA 1U3JA 3B8SA 3ZKXC 4GXUM 1Z9MA 3BZ4A 5DQJB 5CSZB 4MJIA 1YEHH 5C07A 4U1IA 5JIKA 5FA4A 1A2YB 2DQUH 2VXVL 1BQHA 4NGHL 5IBUG 2PO6A 1QSZA 2K7PA 3O3EB 2A0LC 3L3HA 4UQ3A 4BA8A 1IKFL 1QFOA 2XZAL 1E4KA 3NIFF 5JORA 2HFFA 3EOTH 1MJ8L 4LLMA 4X6FB 3KHQA 5FOBB 4G43B 2GTWB 2FJFA 2NZ9D 5EU4B 2WUBH 1F4XH 3VXPA 5IFJB 3DETD 4PLNC 3TYGH 1VADA 1LO2L 1CU4L 3ZMRA 4HQQL 3EYFA 3S35L 2A1WL 4Q9CA 4ZS7H 4X7EC 1X5AA 2GJ6A 4AEIH 3ZDYF 4NKMB 3F7VB 4X6CF 2RCSH 3ARTA 1QSVA 2DLIA 3UCRA 2WLYA 1G7LA 3MA7A 4JRYB 2F5BH 3A6BL 3MRQB 5L7XH 5DGRA 4HG4J 4JLRB 2YUXA 4RQQB 5IEHA 5GGVL 2B5IC 3EOBB 2RHEA 3REWA 1DJSA 2Y9RT 4PJFF 4EOWL 2AGJH 3H3PH 4FZ8L 3RWGB 1IGYA 4FFVD 4CNIA 3O8XB 5D6CA 3L5HA 3BWAB 2WP3O 3JWOC 1MRDH 5DA0B 3RNKA 3U9PL 3TZVC 1ZKAA 2X2YA 5HVWA 1VFOA 4N8CH 1NSNH 5E8PA 2V2XA 1NBYB 1CDJA 4AYFA 5HYQB 5J4MA 1Q9WB 4TULL 1A64A 1NUFA 2A6IA 4O02H 3BPOC 3ZKSD 5FECB 3SDXA 5D1XC 4PRPA 3RKDC 4ZDHA 2CR6A 4WHTB 1J87A 4YE4H 2VWEC 4XC1H 5E6ID 3O0RL 4HPOL 3KLAA 4PLKC 2DICA 2A2QT 1FO0L 4OV5B 4JM2C 5FA3A 2BVEA 5C0BA 1JWSB 4BSWB 3STBA 1E4KC 4FFWC 2BJMH 1FORH 4LVHB 4LQFL 4BELD 3SDAD 4WWKB 4CMHB 3SE3A 4XI5D 3ARBB 2XI9A 5I15H 2OYPA 3RZCB 1CK0L 3H9SA 4LFHG 3UTSE 3L7EA 4EI5A 3EYOB 5GZOD 3NIDE 4Q9RL 3I3DA 3M8OL 4JCMA 4R90L 4LP5A 1EAPB 1YEFH 1KGCD 4KTDL 4PRAA 4N0YL 1H3PL 3P9LA 1OAQL 1PG7H 3R8QA 3DX6B 3FOLB 2P49B 2CIIB 4NRZB 2DQTL 3ZT5A 5C0AB 4AT6B 3HC4L 5JPNB 4JPKH 1C5DA 1N7MH 3EBAA 3WFDL 5CZKA 1YEKL 3S98A 3HMXH 1XR8B 1DFBH 4G9FA 3FAWA 5FYKU 4MD5A 3QNZB 2AI0L 1H0DB 2E7LC 1OAKL 2E8YA 4RNRB 2BY3A 3QDGD 3FQXB 4LSSH 2HT4D 4LNRA 2JCCA 1TETH 2ERJB 1C1EL 1CFNA 5I8OH 2XWJA 3BT2H 4XCFL 3Q2CA 3F58H 1HHHA 3FFDB 3SCMA 1FVEA 1UWEH 2WUCL 4MA3A 5E4EC 1FL5A 3RAJL 1TJGL 4X6EA 2VZ1A 3DHMA 5EZOH 4Q6IB 3KPNA 1CFVL 5JIHA 4JHAH 4OZIE 3QDME 2QSCH 3E6FA 1DUZB 1ITBB 3VFSB 3D69A 1M1SA 2D2OA 1KB9J 1PDKA 1VEMA 1G1YA 1KUMA 1R3IH 5KW9H 3ARDA 4UTAH 4X4YB 1TQBB 3QDHA 3P4NA 4QNPE 5I0DA 1YYLH 1ACYL 3HZMB 3TJEH 2AJVL 2ZOKB 3GJEB 4HIJB 3TJHD 3O8XD 4LCYB 1AC0A 3EJYC 1T7ZA 4GW5A 4PJGB 1F3JB 3QO1A 4QRPD 4LAQL 3UTTE 1DVFA 4M4PA 3SDDA 2XKUA 3UDWC 5JA8B 4I18C 2VDRL 3OQ3B 1T1YA 3IDYB 5C9JA 4JPIA 4LPWA 5KSBA 1YEIH 3TO2B 1IGTA 1UB5A 4ELMF 4AMKH 1IFHL 1AD9A 4BJLA 5D93B 2VRAA 3KAAA 3B6SB 4GRWB 2M8XA 3HA0A 4G42A 2ATPA 3BPCA 3AY4C 3C09B 3BGMA 4HBQA 3I6LE 1FIGH 2R4SL 4QRSB 3O6KL 2ZCLL 5KG9B 3B5HA 1W2KT 5EO9B 5HBBA 1A6AB 4R97C 3MZTA 4WW1A 3BDBA 3ARBD 3PJSB 1UZ8B 1OP5H 1GGTA 1T7VA 4XVTH 1CGSL 4QOKD 4PJHB 4WEMB 3RZCD 1HH9A 2YK1L 5CJQL 4HIIA 3P3YA 4P3DA 4Y2DB 3Q5YA 4JO1H 1NLDH 1U8QA 3ES6A 1S7QA 4BZ2L 5D5MB 5KS9A 1FO0A 2Y4SA 4EBQL 4I4WB 5DT1L 1MLBA 4Y7MA 5CUSL 2PW2A 1WBZB 3T8XB 3K2UL 4Y4FA 4M6AA 3D39B 4Y5XB 3MRPB 2ZG2A 2HG5A 2IH3B 1F5WA 1I4FB 5C0AD 1FSKC 4U6XB 4P5MA 1XGQB 1A7OH 1FFPB 3CDGB 3KLDA 1FZJB 2CMRH 5IVXB 4PYHA 5HHMB 4HDIB 1QFWH 3STZA 3NZ8B 4XAKE 5EU6B 3WFEL 2Z8SA 4XP1H 5ABDE 4YX2L 1RZIA 1LO5A 5IB4B 4JG0H 1A4JA 4U6TA 3ZT6A 5F1IB 3PGFH 2Z4QB 1BREA 2JJTA 2ARJQ 3NCYS 4OQTH 2CLRA 1HILA 4X8JA 4X9GA 4U0RB 4QRRB 3QDJE 2J7LA 3X13B 4U33A 2BC4A 4M3JA 3SJVD 3V2AR 1ZMYA 1EEYA 1WICA 1YQVL 3MV8D 4NZUL 8FABA 1CD9B 4XBEL 4ZFZA 1JIBA 2R0LH 15C8H 1P1ZB 3X12B 3PQYD 3AROA 2CO6B 3KDMB 5I8EB 5KZCB 5I71B 4IIQA 1J0YA 1A47A 3CXHK 5D7LB 1MIMH 3M07A 2Y7QA 3IDGA 4Y8AA 3T0BA 3ARGB 3PG2A 3ECBA 1MCPH 4K3EH 4NHCL 4WI3A 5K33A 2I25N 1W72H 4WTZA 2DIJA 4I0CC 3F65A 3ARWA 1PGRB 1F90L 1BBJB 4WJ5A 3ZKMC 2BVOB 5F7EH 3KPQB 5F7LB 3QIWA 1E4XL 3C8DA 3L3JA 5HHVH 1REIA 4R0LB 3TNNA 3MJ8B 4XPBH 4NPYB 2BNUA 2UVFA 4K23L 3UTSA 4V1DB 4JFYB 2QQLL 2VDNL 2QJDA 5TPWL 3QQ9C 1ZHLA 1NL0L 5C0JB 3C6LB 3SKNA 4R4FL 5IG7A 4LSUH 4YIQA 3AB0B 2HT2D 2IBZX 3G6JE 2VITA 4J3XA 2R0WL 5K9OA 1WAAF 2B2XH 2EKJA 1JRHH 4JO4H 4XAWH 5E9DD 4XWOC 2FSEA 1J0ZA 1VFBB 4YDLC 1UM4L 1I7TA 2Y07H 5BV7B 1X5LA 2VIRA 1KCVL 1N64H 5KAQF 4XGZB 4G7VL 4ZS6D 3WXWL 3GSVB 1R5VB 1ZT4B 3OKNB 3QI9C 1YNKL 1ZS8B 4EN3A 1Q9OB 1FNEB 5J1SC 2EXWD 4JAMA 3BZFA 1CE1L 3OJ2C 1A1NA 4HPYL 4OTXL 2DQDL 1GGYA 1QEWB 1ZVHA 4Y2DD 3UTPD 5B39B 4YXKH 1LO0H 2XG5A 2NY5H 4CADB 4OT1L 1FG2B 3V7MA 4KY1L 3QO0B 1TMCB 4KQ4L 5ENWB 1SM3H 4R2GC 5DD1H 5ESAB 1F8TL 3TA3D 5J9PA 5CZXD 4M7LL 5BMFL 3TPUA 3D39D 4JFZL 1HIMH 3GBLA 5KOVC 3MBEA 1ZANL 1K2DA 4H26B 4L8SA 5FOJA 4IIQC 4NNXA 5F7MC 1JWMB 4X9FA 3PABA 1WTLA 3R0NA 3LEVH 2W9DH 3AREB 3IU4L 4O2CB 1FL3A 5E08H 5HHMD 5IQ7H 5F7DB 5F3BB 3GIVA 1JUFA 1RZGA 2VNCA 1KPVA 5EPMB 5GSVA 4F9LA 5JR1H 4JGJA 3IFLH 1FYHB 2VKXA 4CU8A 2P8PB 3RDTB 5K9KB 4D0CB 1JZ6A 3T2QA 4RBPH 3BGFC 3UTTA 2VSDA 12E8L 4GLRH 3FT4A 4P4KB 1HSBB 2VO5A 1HEZB 2VAAB 4MSWA 5HYJD 4IMKA 4KGJA 1PKQB 4ZFOB 3VA6A 1G6RL 3PWLB 2QSVA 2ARWA 1ZWIB 4UINL 3MOQA 5FUCE 4L3CB 1LK2B 1NMBL 2D0FA 1AXTH 3UO1H 2WINA 5MENE 1G9ML 1N59A 5D7LD 1IGMH 4OZFH 1TZHA 3SKOB 4BYHA 4I5BA 2J6EH 3A67H 1EVUA 2F58H 3RJQB 2RB8A 3ARGD 5DEGB 4F57L 2ZZUT 3HS0B 4N0FA 3RVWC 4M7JH 4XRCA 2I07B 5ETUB 5ELIA 4PGCB 4NO3A 4JN2B 4K8RH 4KROC 4WDIB 2KQNA 5ALBL 4X7SH 2ICWJ 4IRJA 3LV3B 2Q3ZA 1HQ4B 2XICA 1INDL 1U93B 1JHKL 3C60B 1QLFB 3ZE2E 4UT9L 4BFGA 1R24A 5CS7A 2DMBA 4WO4A 1OT2A 3FB7B 2Y5TB 4KI5E 1V5JA 1JCKA 4AIZA 3OHXA 3RWJA 3C6LD 5FCSH 2NYYC 4C4KO 1G7JA 4N5EC 3R8BB 2W0LA 4ZFGH 4ALAL 4N1EA 1MFAL 4C55A 3ZKNC 43C9A 4PJGF 3CLEL 1I8LC 4DGVH 5HI4D 3BQUA 1ETZB 2OK0H 1ZLUH 3SKJH 5HGDB 5E8OA 1KPUA 1YNTA 4X98B 2G75B 2YRPA 1YNLH 4FS0A 1AO7A 4ODSL 4F2MA 1RZ8B 4Y16C 2FZ3A 1S7UA 4NOBA 1VCAA 4HK3N 1K6QL 1P7QB 1DLFL 1B0RB 4PG9A 1AE6H 2BOBB 4GRWF 1RIVL 4ZPTA 3HE6C 1FDLH 3AS1A 2IPKB 2DLGA 3MRJA 2WWMD 1I1CA 1K4DB 5ID1A 4OLUL 3GMOB 1AGEB 1IKNA 1LEGA 1P84J 1AY1H 5H2BA 4ZNCD 5GS1B 1U8HA 2QADB 1Y6NR 3C8KB 3HNSH 5D6DA 1A14H 2IBBA 4WHCA 5GGTL 1RUPL 1X5GA 4QLRA 1XAUA 4MAYC 3RL2A 5IFHH 3QUZD 4KRPC 4MCZB 1HXMB 1F58H 3RTQB 4KV5E 3ARED 2YSSB 3TBYA 5D5MF 4L4VA 5JOPD 5DMGC 4EI6B 1WQVT 4P5TA 5INCA 5HI3D 4X7FC 3V6FA 5CLWA 5I1GL 5JQ6H 4WU7B 1NAMH 1NDGA 3MLYL 3VXRE 5F9JA 3BXNB 5ESQA 4D2NA 3OKYA 5TQ2H 3RDTD 5I76B 3HMWL 4LMQE 3D2UB 3KLHC 1HYSD 5JDJA 5DRXB 2ZKHH 4J6RL 1QOKA 1Q1JH 5C0ND 1RUMH 4ZUSB 3VFOA 3ULVH 1CE6B 4PGEB 3QIBD 1T2QH 4OCYH 2VKWA 5JIPA 1IBGH 1CDYA 1NC4D 3WXVL 3VG0L 4LDOB 5DD0H 3G6JA 2H8PB 3NIGF 4HHAA 4JGMA 2CD0A 3MLSL 2CIKB 2EECA 1OB1B 4FFYL 4PJDA 5F3HA 1YY8B 4NN7B 1KNOB 4I48A 2OP4H 1G6RA 4KK6C 1U58A 3PIQB 4PRHB 3S8WA 4PP1C 5SWQB 4JY4A 1IGCL 2VL5B 4OLWL 3RWFA 1NANI 3ULSB 3C60D 1E6OL 1YYMH 5F88A 4RX4A 2ZCHL 3HZKB 4XP4H 3NIFE 5DHYA 1RUAH 5M7QA 4RRPA 5FDWA 4WY7L 2NY1B 4Q97A 5BS0B 4S1QH 4ZUVA 4S0TD 1MHPL 1I9IH 3BJ91 3QXDB 4MD4A 4AENB 5C92A 5IHUL 1T1WB 2EO1A 5ITFB 1DBAL 3CZFB 1VESA 5LAXA 3MRCB 1IGIL 1ADQL 3O2DH 3EW3B 4LHUA 3ROOB 1GZQB 3UZVB 4O9HL 5M95B 4JKKA 4K55A 3QH3B 4YBQD 1KJVA 3H3BC 3ZDYE 2M2DA 2DBLL 1DTUA 2HLAA 4GW4A 4HZLB 4X6CE 3E6HB 3ME0A 3VXQB 2OI9B 4UQ2A 1DCLA 3EGSA 5A3IC 1HHGB 3LKOA 1P7QD 2ZUQC 4TUJB 2HLFC 2V7NA 1EHLL 3K1KC 4PB0L 1I3GH 1XGRB 4AIOA 5SWZA 5CGMA 2XACC 1GZPB 2J88L 4NFCA 4NQEE 2VB5A 1TTFA 4FN0A 2Y25A 4L3EE 1Q0YH 2H26B 4G80B 2B1HL 5GS0D 1T89A 5F9AC 3O11B 3MJ6A 3SE8L 4D94A 5JLZA 1BP3B 4PJFE 4DTGL 1MVFA 2YBRA 3I75B 5CWSA 3NCFB 4D0DB 5EZIL 4M6NL 5ALCH 3GMMA 3HR6A 2OQJB 3IDNB 5HYSG 4KVNL 5E5MA 3GHBL 4S1SL 4W6YB 1AGDB 2OZ4H 4MNQB 2V5RA 2Q7YA 4R7DA 3WUWG 2P5EB 4K71B 1DN0B 1YN6B 3RTQD 5MENA 4FTVE 5DD5H 3RWCB 1KCRH 1U9KA 2YD2A 4JN1L 1FFNB 4XPHH 5D7JB 5F70A 1T83A 5I1LA 4U1GB 5DMIH 1E27A 4OJFH 5T1KB 1QPPA 5C0IB 3D25B 1UXWB 3CFKA 1SYSA 3DJ9A 5GGTA 1XF5B 2AP2A 5D96C 3MV11 3BOVA 4L9LA 4UT7H 4BUHA 5DI8B 1MCRA 5CIPA 3O9WA 1JGLH 3D0VA 4O51A 2FHCA 4RWYL 4I3SL 4RA0C 5DDHB 4ZXBC 1S7VB 4PRIB 2YUZA 3OJDA 3CK0L 4MGXA 1RK0A 2OTWA 1DE4B 4R4BA 2H3NB 1BF8A 3HAEB 1LEIA 1U8OA 3BW9B 3PDOB 4KAQH 3U1SL 4X5XA 1DEEB 1QA9B 4GG8B 2CLZB 4NO2B 4HS3A 3PXHA 3LH2H 4HC1L 3BE1L 3IXAB 3VFPA 3KPOB 4PRHD 4PJXE 3LRHA 5FKAB 4QRUA 4DWHA 4ZNEA 4GAGL 4TUKL 2L7UA 3CVHB 4NWTH 4DN3H 1UACL 2BNQB 3VMNA 2F53D 5DD3L 4GG6A 3EYUL 1UZ6F 2NY1D 4NQSB 5BS0D 1AIFA 3KYKH 2FEEL 1CVRA 2APTA 4JFDE 1R5IB 2ITDB 4LLYA 3LPWA 4LKXA 1NBVL 4YBLB 3TN0C 3G9AB 4TVSa 3S5LA 2FECI 3SQOL 4XPTH 2W1NA 4YLQT 2ITCB 1IC7H 4J4PD 3MRGB 1MNUH 4P0DA 1NCWL 1MRCH 4EDXB 4PBXA 1MREH 5AD0A 2JJSA 4YHIB 1AR1D 2EDHA 4KTEH 5IEKA 2WMPA 4N9GA 3I84A 5C86A 1TIUA 2X1OA 2YOCA 3IFNL 1VGKB 5B22A 4HXBL 1H3UA 4MYWB 3DBXA 5EBWA 3BDYH 5HHNA 2BCKB 2B1AL 5EC1B 4JDZA 1X3DA 1FZKB 4NN5C 3QIUC 2L0DA 4KK5D 1ADQA 4HGWA 1V3MA 2LV4A 3FB8B 5B8CC 4M8VA 4IHOB 5I1HH 4NRYB 3FO1A 4Y8DC 5IJKC 3EYVB 3PDGA 4RFOH 4P9HL 2O5YH 3KHOA 3MRFA 3CFJA 2OR9H 3HPJA 5CGYC 5HYEA 2Z0BA 3EHBC 4I0PA 4MNQD 2Y5EA 4AH2B 3FMGH 1UQSA 2HRPH 1UM5L 3S97C 1KB9K 4LNVA 4MNHB 4ELME 4EUPB 5HGAB 3QXAA 5JW3L 1KACB 3BMWA 1NGXB 5CJOL 1I1AA 5D7JD 3FQWB 4H5SB 1WIUA 2P47B 3ZLQC 1DN2A 5IF0A 5T1KD 2E9JA 5C2BL 4D8PB 4U1JB 1FP5A 3O6FD 3RWHB 3GIZL 4U1SB 5D7KD 4ONHA 2D0GA 4NBZB 5MERB 4XC3L 3GKWL 5GRYA 4PGBA 3KPLB 4HT1L 1T2XA 2AJSL 3UYPA 5I18H 2Z93A 2JJUA 3C08L 3LB6D 5IB5A 4KK8C 2R4RL 1D9KB 4ORZC 5BRZE 1KB5H 4F9PC 1S5IH 3TIEB 4G6ML 1XGPB 3LZFL 1ZLSL 1G7IB 1T4KA 4PJ7B 5B38A 1WF5A 2DJSA 3JZ7A 2ILLA 1ZHKA 4X6CA 1I7UA 3LDBC 4RMQA 1YY9D 1OHQA 1BZ9A 3P40A 1FPTL 5J06A 4FXGB 2BNQD 2VLJB 2OL3B 1CXLA 2YMXH 3K81A 2VYRE 4KJWD 3W9DA 1JE6A 5IHLB 4L3EA 2BRRL 4GAJH 5HHQB 3S7GA 1OAZL 3GI8H 4GRLA 4DKEL 4X6DB 1CFSA 3BAEL 4PJFA 3TVMD 1GSMA 4FQ2H 2P8LA 3EO1A 5L2KB 4HC1A 4MJ5A 2YD3A 4RDQF 1MLCB 4XVUC 2P44B 4KJYB 1XZ0A 1K85A 2Z35A 5EIVA 1A3QA 1W0VA 1DLHB 2CK2A 5EOTB 1G0DA 4FTVA 4GBXB 3C5JA 4WI4A 1BJMA 1EEQA 2D7QA 4KJQC 1OTSD 5FYLH 4ISVA 3QJFB 5LG1A 3CC5A 5DWUL 4ZD3H 2QBWA 4Q58C 2YKLH 1XH3B 1V7MH 5T1DL 4UDTA 2ZPKH 3MFFA 4OM1L 4OSUL 1Z6JT 1T1XB 3C2SA 3N1MC 4LSTH 1G0XA 3TNMA 5HD8C 1GGIL 2MFNA 1U8JB 1VDGA 2D7MA 2Y36L 3TBSA 1IAII 1WSST 4NQVA 1BEYL 2IBGA 4Q0XL 1CGYA 4LCIL 4MDJB 2VR4A 3BJLA 4JRYE 4XH2A 3LPGA 2CKNA 2HJFB 4XP6H 3VD4A 2X4UA 2GCYA 2ICEA 1B4JH 1ZT1B 1KIPB 3GSRB 1UEYA 1D5BA 1NCDL 3D85B 4DN4H 2F8OA 1X6NA 1F4HA 3MUGB 2VMFA 4PTTB 4PV9B 3W11D 4E0RB 2EH7L 1WAAE 5CJ8A 2FGWL 1EEUA 5FCUH 3Q0HA 5F1SA 2NXYB 2JIXA 5TJWK 1MUJA 1OPGL 5EC2A 2V7HA 5E5RB 2AQ3A 1T5WA 4MQSB 4YR6A 3V5KA 2KZ1B 3L5WB 4MQXD 3P30L 1KXTB 1R6VA 1K8DB 5F96H 3T04D 4JFDA 3EFDH 4K3DH 1T04B 5FHBL 4JQIL 3DMMC 1D9KD 5HHOE 3HRZA 4W68A 2QR0B 1PG7W 5GSRA 4YGVB 2IJ0C 4JRXB 4X7DC 2W0KA 2MTPA 1MFBL 3EJJX 3AM8A 1WCBA 2CH8A 4GQ9H 1QTYT 5F9OH 4DEPB 4FABL 2ZSWB 3V5DA 3S96A 4NO0D 1HDMB 1U8PB 4CAGA 2DJ4A 1AXSA 5TH2B 2DM4A 4Y4HC 2Y1VA 1CIDA 2AJYH 4LPVA 2VLJD 3ZYIA 1URLA 4M1CD 3D18B 5ESVA 4ZPVB 1CLYH 3VXOA 2F8VA 2VLME 4IMLB 5D7IE 1S7RA 1BMGA 1NFDE 5SX4I 2NW2A 2XV6B 4GMSH 32C2A 4H8WL 3O4OC 1IC4H 3UP1A 3ZHKA 1Z9SA 2BXZA 3VXSB 5JXEC 2FBJL 1M7DA 5FUZL 4Y5VC 4LARH 1SQ2N 5IB3A 5C0AE 2BMKB 1H3GA 5DR5H 1SBSH 3NAAH 4LAJH 3CLFL 3D1MC 1E4WL 3IYLW 3TIDB 4ERSH 1EXUA 3BI9X 4M7KL 1TVBB 2A6JB 2AK1H 5GIRB 1D5MA 1LQSR 2FDBP 4L5FH 4GBXD 1U8IB 4OGYL 4PV8A 5GJTH 4QO1A 1RZKL 4U1HA 1OGAB 3SKUD 4ELMA 3K2MC 1QBML 3RGVC 2AV1A 2ADJA 3O4LB 1CD1A 1FNSL 3ZHLA 5J11C 2F19H 4MAUL 4HUUB 3U4EA 4DKFH 3GEWB 3DVNB 4PJ8B 3RJDA 1MIEH 3WLWC 4KK9C 4UBDD 4Z7NF 4WUKH 4ZUUA 3QQ4A 1XEDA 5GGRA 3SO3B 4GUPA 1IEAB 5E2TL 3L7FA 4XNMB 1MWAL 5GISL 4XPFH 1HCVA 2AJZB 2AS5M 2YC1B 1RJZA 4JQVA 1LWRA 4GSDL 5JW4Q 3QNXA 5FF6A 3A6CH 1ES0B 3E0GA 5E6IA 3EYSH 5HJ3B 1FHGA 3H2WA 2OJZH 4NBYB 5FYJH 3FQTB 2R29H 3D85D 4U1NB 2Q76A 2MPAL 1FBIH 2UUDK 3PGDB 4K9EC 3T3MF 3G5ZB 3L3KB 3VRIA 3SDAA 2E9BA 2VLRD 3MOAH 2NZ9C 1DSFL 2F74A 2YPKA 5AWNL 5I73C 4HJGA 2X1QA 4U1LB 5J57B 3JXAA 2X4RA 3DETC 2PETA 3BEVB 2GJZA 4IOIA 3WLBB 3QEHB 1MF2H 5IJVB 5I8CA 4S11A 2VJXA 2SEBB 2R0KH 4NNPH 5DQJA 4HAFA 4FQ1H 3B9KD 2WBKA 4KRNA 5CSZA 1YECL 4GRWE 3UBXB 4ACPA 1D5IL 4XP5L 4UMGA 5L88H 1A2YA 3GFUA 3QG6A 3FL7A 3DV6B 5C7XH 4HH8A 4L29B 2VLKE 5I1EL 3O41B 3O3EA 3Q48A 4JRXD 3F7YA 2AXJA 3G5YB 1TITA 2C9AA 1Y6MR 1WT5A 4CVZB 4WI7A 1JGVL 4X6FA 5MHSD 2W07A 1NKRA 1NKOA 5FOBA 4HULB 4PB9L 4G43A 1GIGL 2GTWA 5EU4A 4FFVC 2XWTB 1DL7L 5IFJA 2VLLB 2LFGA 3CDYA 3UTPE 4XCEB 5BO1L 3OB0K 4XNQB 2HYMA 2FD6L 2CRMA 2ZWLT 1Z5LA 4KDWA 1XF4B 4PJ7F 5L0QC 3LIZL 3D39E 4NKMA 3F7VA 1P84K 3VW3H 3BKCL 4DGIH 4LLUB 2AJUH 3GI9H 4QTHB 2AEPH 4FQXB 5DMJB 1KIUA 4ZUTB 5ACLA 3TBVB 1LP9B 4JRYA 2GFBB 1FE8H 1YMME 3MRQA 3P0VH 5DO2D 5HHME 5A2KH 2Z31B 4QXUL 4JLRA 4RQQA 2EC9T 3EOBA 5EU6E 4X6DF 2O5XH 1EJOH 3V52H 3SDAC 3O4LD 1PD6A 1Z3GL 3RWGA 1G84A 3RFZC 2QLVB 2E5EA 3O8XA 4U7MA 4ZOCA 3BWAA 5EFIB 2IPUG 2OX5A 2VQTA 4KPHH 4H1LG 4QRPA 1IQDB 3NIGE 4QRRE 1ZHBA 5GZOC 1KT2B 1EO5A 3DX8B 1UYWH 3SBWC 1NBYA 5HYQA 1F6FB 4UV7L 1RAMA 1Q9WA 2YZ8A 3SHSA 1UWGL 4J3VA 5FECA 3MRLB 4U1KB 1LVEA 3BIAX 1NCCL 5D71H 4WHTA 4IJ3B 3BP5B 5INDB 3C5ZD 5D7LE 5FM8A 5GRUH 3IT8D 2DLTA 4OF7A 3R0MA 1JWSA 3MROB 4BSWA 2PR4L 5L9DL 1CFTB 5DJYB 4DVBB 1ZLWH 3U7WH 3BKML 2B0SH 4WWKA 1NDMA 1MWAA 4YHLH 5A1AA 3ARBA 4KU1A 4HKBA 5CJXC 1CDCA 1IAOB 1OW0C 4QOKA 3ZTNH 3RZCA 3I50L 5EZLB 4K3JL 1G9NH 4TSBL 4WUUD 2HT4C 3EYOA 2Y06H 4TTGA 4V1DE 1CXIA 5DSCB 5DUMH 3BD5A 5KBNC 1EAPA 4WI8A 4HEME 2XZQH 5I30L 4LOUD 2CLVB 1QLRB 5GS2D 1ZT7B 5E1AA 3INUL 4FA8A 1U41A 3DX6A 3G6DL 1FGVH 4I3GA 4XTRD 3FOLA 1BOYA 4NRZA 2AEWA 5C0AA 1UJ3B 4AT6A 5JPNA 2WM0A 1OTUD 5C0CB 4Z7UB 5K9JL 5GGQL 4Y1AB 5CKAA 2PKDA 3T65B 4KTYA 1LDPH 1XR8A 4LMQI 1TZGL 1WLHA 3G5VB 3QNZA 4H8WC 2FRGP 1H0DA 3TJHC 4HLZH 4RNRA 3VFUB 3OKLB 3VRLF 35C8L 5I66B 3ULUH 2PNDA 1D5ZB 1AD0B 3FQXA 2CK0H 3NCJH 1S9XB 3ALPA 4P3CH 3E3QE 2B4CC 5T3ZH 3STLB 1DBMH 4XNUL 3QCUL 4LSPL 4HIEB 4PY8I 4F7CB 5CCKL 3FFDA 3U7YL 4RGNB 5EO0B 2W59A 4FQXD 3QAZB 4Q6IA 4CJ1A 3VH8G 3MLXH 5HVHC 5CILH 3VFVB 4RRPG 1DUZA 2NY4D 3L5XH 3VFSA 5TQ0H 1RIHL 5JOPE 4DQOH 1AGFB 3VGDA 2A6KA 2Z9TA 4X4YA 2LVCA 3ZHDA 2Q3AA 3S4SB 3WO4C 2ZOKA 3GJEA 4HIJA 4LCYA 1PLGL 1JZ4A 4PJGA 1F3JA 5E6YA 5E2JA 3GBNL 4O58H 5BV7L 2VE6B 4LCUB 4LEXL 1EH9A 3U46B 3MXVL 4PRNB 3WEXB 4CVWA 3L3OA 3RVVC 1EEZB 1PKQE 2I27N 2ZUXA 3T1FA 3TO2A 4QHUB 1UWXK 3N9GH 5I6XB 4GKOA 3VWJB 1DQMH 3B6SA 4Z95H 4NQTA 3T2OA 2VR5A 5E9DA 4ODHL 2OMBA 1I8IB 3HE7D 1UZ6E 5DJXB 2NTSP 4M03A 4N1CA 4QRSA 5KG9A 5AAWA 2VERN 5EO9A 3EYQD 5D2NB 1A6AA 5FAAA 5C6TL 3PJSA 1UZ8A 4HF5L 1MFCH 3ZSSA 1KJ2B 3HNVH 4PJHA 4TRPH 3HN3A 1J0IA 5T1MB 3FOMB 3K4AA 4Y2DA 5LQBH 2DD8L 2VDMH 1AFVL 3CZJA 2HH0L 5D5MA 3GRWL 4POZD 5CJBA 1N2RB 5C9KA 5GRXG 3RI5F 1TDQA 2FATL 5KOMC 4I4WA 2CUMA 3MUY1 1WBZA 3T8XA 2DQJL 3UC0H 2AJXH 3U4AA 4Z77B 2AXFB 5E95B 3ZKXB 5LGHL 3D39A 4Y5XA 4GXVH 3TO4C 2ENSA 3MRPA 2QQNL 2IH3A 2WQ8A 3THMH 2G5RA 5K9QI 4ZO8A 4YXHL 4U6XA 5C0CD 4OLYL 4JR9H 1XGQA 1FFPA 3CDGA 4ZFOL 1FZJA 2MQCA 5IVXA 3CXDL 4HDIA 2FB4L 3N50A 3NZ8A 5DQ9B 4H20H 1SYVB 3O2WL 2V5SA 1I9RL 1EFXB 4I77L 4RISH 5F1IA 2I24N 4OFYA 2Z4QA 1IAKB 3V6ZB 1AQKH 4NZDA 4JQXA 5C8JB 2MCPH 4QRRA 4OLXH 3OB8A 2YPVL 1GHFL 3X13A 4D9QD 1CXEA 4JM4L 3D9AH 4HUXB 2YUVA 1SY6L 5JDSB 3B2VL 5ILTH 4TSAH 1U8NB 1YUHB 3X12A 1P1ZA 5I1CH 5FO9B 3KDMA 5I8EA 5TF0A 5F1KC 4MXWL 5D7LA 4UIKL 5I1IL 1WEJH 3ARGA 4CKVX 4ZS6C 2AEQL 2B5IB 2A6DB 5LKNA 3BKJL 1BBJA 3PL6D 2BVOA 4L8CA 4U6VL 3KPQA 2GEEA 4R8WL 4OCSH 3SN6N 4XCCH 3SEPA 2WBWB 1LP9F 4R0LA 2IAMD 3MJ8A 4MHHI 3DSFH 4M6OH 3TZVB 2EYSB 3ARFC 3L95B 3P9MB 1KCUH 1O0VA 2X1PA 4NPYA 4MD0B 1P9MA 2VQ1B 4JFYA 3KS0J 4YDVB 5HDBF 4QXGL 5F6IC 1N5YL 5C0JA 3C6LA 3TA3C 3FZUC 1WIOA 1GAFL 2DKSA 1PKOA 5LXGL 3BPOB 5D1XB 2XRAH 4QXWA 4MJIB 1L7TH 1FFRA 2C3WA 2XPGB 3WV0A 5IM7A 5GS0L 4RMUA 2XA8H 4KUZH 3QA3B 4KVCH 1VFBA 1J5OL 4JM2B 4BH8B 4JPWL 4XGZA 2DLHA 4NQDB 3GSVA 1R5VA 1ZT4A 3OKNA 4K2UH 2HFTA 2NY3D 1ZS8A 3Q6GL 1Q9OA 5LCVL 1FNEA 2HFFB 2VXSL 3S37H 2A38A 4MNGB 5TDPB 3LKPB 3B5GA 1ZOXA 1QEWA 4WI5A 5HVFB 4WCYL 5EOQH 3UJJH 5DJCB 4M5ZL 5B39A 5DK3A 4JKMA 3ESVF 1JGEB 1JZ8A 4LSRH 4CADA 1FG2A 4KZDL 3H7BB 3RU8L 1YPZB 3QO0A 2ARJB 3NTCL 5IESH 4LL9A 5ENWA 1W0WB 5ESAA 5GZNC 3LRSB 4PG2C 5IHZB 4WWID 5CP7B 2XTJD 3DSNA 2H9GB 4LIQE 2JF1A 3TGXA 3SDYH 3ESUF 4GJTB 3GSOB 4H26A 3ZT7A 5ERWA 1ZV5A 1JWMA 2Z92B 5J89A 4XWGH 4WI9A 3AREA 2CKBB 4O2CA 4F3FB 5F3BA 3QRGL 4P46C 3FJTA 3GRWA 5EPMA 3MJGX 3LEYL 3W81A 1C5BL 4MA7H 3SOBH 3KJ6L 1BVLA 2EDLA 2LU4A 5JMRA 3RDTA 2OSLB 5K9KA 4D0CA 4JO3H 4WI2A 1JPST 3V0AC 4P4KA 4QHMB 4Z7UF 1HSBA 1HEZA 2VAAA 5EWIH 1CGUA 5C6PB 1PKQA 1RJYB 4ZFOA 2JELL 3PWLA 4KC3B 5KJRL 1KG0B 2Q87A 3QIBA 5DJZB 4ZFFB 4JJHA 4KZEL 1ZWIA 5SV3A 4HWEH 4R4ND 3SGDH 1MCOH 4PRPB 3PWPB 4L3CA 1LK2A 1NEZB 2GY7B 5E4EB 1NC4A 3L1OL 4MNQE 5F8QC 5TGBB 2P5EE 5HI4C 2XQYG 4NUGL 3SKOA 5F1NB 2MHAB 1BAFH 5DEGA 1BHGA 1QLEH 2O5ZL 1MCEA 5E2UH 1I7ZB 1YJDC 2I07A 5ETUA 1KENL 4PGCA 4JN2A 1AI1H 4LF3B 3LS4L 4WDIA 1SY6A 4JB9L 4LDLB 4D9LL 3EDEA 1HQ4A 1MCQA 3F8UB 4BFEA 4P23C 1U93A 1P4BH 5AYUH 3UROR 4FQLL 3C60A 2HKHH 3EO9H 1QLFA 4G8FB 4I18B 4OCRH 1BJ8A 5K9QG 1A7QL 1KPRB 4YHZH 5T5FH 3FB7A 2Y5TA 4GT7A 5BZDB 4Y5YC 5CHNB 2GYSA 3EJZC 4JKPL 3C2AH 3HPLB 4XVJH 4PRIE 1GCFA 4WHYH 5D1XD 3RKDD 4FHBD 4QHKJ 3WHE1 1MAML 3NFPB 3NZHH 1OAXL 1XF3B 5CMAB 3GUTB 1LK3H 3QUZC 4PLKD 1ETZA 3I6GB 1F2XK 4I3RH 4JM2D 1RURH 5HGDA 5IK3B 4WGVB 2C4FT 4X98A 1UKTA 2G75A 4IEFB 3MLRL 1J0KA 1YEEL 3IS0X 3PP4H 4MA8L 4JPVH 1RZ8A 3DRTB 4FFWD 2CDEB 1MHCB 4QGTA 1D6VH 3UJTH 2ED8A 4R97B 1RVFL 1P7QA 4HUVB 2LAAA 1B0RA 2BNQE 2BOBA 4JZJC 3HTLX 1C5CL 1M05B 1YA5A 2E27L 1Q0XL 3LQAL 3T09A 2XN9B 2GITB 1K4DA 4Q2ZB 5C0NC 5HDLA 3GMOA 1WTGT 1AGEA 3QPXL 4PY8J 3QIBC 5GS1A 2IADB 3C8KA 2VXVH 4NGHH 4X6EB 4R26L 3RWIB 3HG1D 4PY7B 4Z7NE 4LASL 1IKFH 2XZAH 4UTBL 4OFPA 1FSKB 1HXMA 3RTQA 2YSSA 5H8DA 4MZ3A 1MJ8H 3IS1X 3KGRA 1A0QL 4MHHG 3MCKB 4C59B 4JHWL 4WU7A 1EERB 2D9CA 2VXUL 3BXNA 4G3YL 3O45B 3RBGA 5I76A 1LO2H 1CU4H 3D2UA 2AV7B 5DK0B 4HQQH 3S35H 2A1WH 3ZTJH 1S8DB 4LU5L 5DRXA 4JFFB 3CUPB 5DVNA 3QRFM 1HWGB 4ZUSA 3T3ME 4LP4A 3L9RB 2W0FB 1CE6A 3JVGC 4PGEA 3U36B 3ZL4L 3WNKA 5C0EB 1FV1B 1T6WA 4D0BB 3CVHL 2APWA 1ONQB 3PWPD 1OLLA 1WWBX 3DXAB 3A6BH 4D3CL 1X5JA 1ZSDB 3HZYB 4G42B 1HSAB 2H8PA 5GGVH 4Y4KC 1ED3B 2C3XA 3FO9A 4EOWH 1E0OB 3MQIA 2CIKA 1OB1A 3QEUB 2WSKA 3WS3B 1YY8A 1DQLL 4JY6B 1KNOA 1DBBH 1NBZB 1L0QA 5DZOA 3ULVD 3JSSA 1M7IB 3OKDB 3SE9L 3PIQA 4PRHA 3MR9B 4EQ2A 4XCYB 3U9PH 5SWQA 5A2FA 2VL5A 1QQDB 5GGUB 3ULSA 2VC2L 1P4LB 1QRNB 4QCIA 3HZKA 4HJ0D 2IG2L 4TULH 4U2YA 4GKSB 5BS0A 4H0IA 5IROC 4C56B 3WNMA 4NUJA 1XCQB 2YD5A 3QXDA 3BVNB 4OZHE 3O0RH 1J1XL 4AENA 1RQ5A 2YRZA 1T1WA 5ITFA 1R3LB 2FJGB 1FO0H 3CZFA 3OR6B 4HXAL 2OTUB 3MRCA 2DQGL 3V0WL 5GHWL 4OF8A 3BYYA 1UADC 3ROOA 4J4PA 2HKFL 5JTWA 4YDLB 3S88L 1QSFB 4Y19D 5DJ6B 3QH3A 4LQFH 5D1ZC 4HZLA 2VUYA 3E6HA 3VXQA 3P2TA 2XT1B 3QI9B 1K3ZA 2OR7A 4LHQB 1HHGA 4TUJA 2XOTA 2VDKL 3MOBL 1CK0H 2V2WB 1XGRA 5D1QC 3K74B 1GGBL 4P9ML 3UYRL 1GZPA 3MLUL 4Q9RH 1QD0A 3M8OH 3LKQA 4LLDB 4R90H 2H26A 4Z9KB 4G80A 4JM2F 4X6DE 3O11A 5DJ8B 4LKCB 5SWSB 1H3PH 1OAQH 2M26A 1J86A 3I75A 2VZ3A 4R2GB 4D0DA 1XF1A 1IVLA 4OLVL 5L2KE 2DQTH 2OQJA 3IDNA 1BQUA 5CBAB 3HC4H 1K5NB 1AGDA 4MNQA 1FVDB 3WFDH 4IIQB 2P5EA 1YEKH 1DN0A 1YN6A 2HAZA 3MCLL 4ZYKB 1YPZF 4UDUB 2AI0H 3RWCA 3QUMB 2C3HA 1OAKH 4IBLT 4NIKB 5DJ2B 1FFNA 2BSSB 4OF3A 5C09B 5D7JA 3P4MB 2DTSA 2A9MH 3IDJB 3VFMB 2A73B 5T1KA 2X7LB 5C0IA 3DO3A 1NJ9B 3FT2B 3D25A 1UXWA 4XMLL 4QKXB 1C1EH 5IBUB 1XF5A 3BGFB 4PRBB 3S3SA 4XCFH 2P42B 1NGQL 2AJ3B 5DI8A 4F7EB 2VSCA 5CINL 2WUCH 3SE4A 5DURD 3RAJH 4HX1A 1TJGH 2P43B 1RZJC 1CFVH 3SKNB 2OL3L 3VGFA 5DDHA 1S7VA 4PRIA 3DXAD 3FB5B 1SJXA 3VXME 2H3NA 3WS6C 4YO0A 3HAEA 3BW9A 3PDOA 4F15C 3M1BB 1ACYH 1DEEA 1J12A 1QA9A 1VPOL 2AQ2A 4GG8A 2Q6WB 3WFHB 2CLZA 2AJVH 3GSNB 4QXTB 2HVKB 1JMZA 3DURB 4AY0A 1ZA6B 4JFOB 4PGZA 5TFSL 3IXAA 4ZAKC 2XNAB 4AEEA 3KPOA 4LAQH 2G60L 5FKAA 2WK2A 2CRZA 1H3WM 4KROB 2ZUSA 3CVHA 2VDRH 5IVNA 1JNHB 4PJIB 2BNQA 1DBJL 1NC2B 3NABL 1S3KL 3DO7B 3N0PB 2J12B 4JFXB 4NQSA 1IFHH 5JPMB 3V4PL 1QFWI 4C56D 1U42A 3WNNA 1R5IA 3HI1B 1CR9L 2ITDA 1H8SA 3VRLE 5DHVB 5LVEA 1FVCB 4Z8FL 1EJ6A 5A2IH 5F71A 2R4SH 2ITCA 3O6KH 1FCCA 4XWOD 3UPRB 1ITCA 3MRGA 1RJLB 4JRXE 5KSVB 1MOEA 1TCMA 4EDXA 4HJJL 3MRBB 4NZRL 4OUUB 4YHIA 1A9BB 3MGTB 1NFIB 4OLZL 3NH7L 1CGSH 4Y16B 2YK1H 3MNWB 5CJQH 3RA7L 1VGKA 3QG7L 5FV1L 4BZ2H 3QXTA 2BCKA 4RFEB 1CBVL 5EC1A 3O6FC 3HE6B 5DT1H 4EBQH 1ODAA 5CUSH 1FZKA 3K2UH 5C71A 5SWSD 4QRQB 3FB8A 2LQRA 4WFGD 3VXSE 3QBTB 4IHOA 4R2GD 4NRYA 3EYVA 2OTPA 3FFCB 3LB6C 2AK4B 4J2XA 4M48L 1VACB 3UZEA 1G1CA 3WN5C 3BDXA 1A5FL 4MAYB 4AH2A 1IT9L 4MJ2A 4LPUA 4KRPB 3DV4B 3CH1B 5AUMB 5BVJA 4MNHA 2JCCF 3WFEH 1OGAE 4EUPA 3KWWB 3HCVB 5HGAA 4YX2H 5H37H 3RWDB 2K1MA 1NGXA 4MA1C 3N1GC 1I8KA 5C09D 3ZE0F 4HH9B 1YY9C 3FQWA 1CG9B 4H5SA 4PD4J 5H94A 3D0LB 3IDMA 3IU3B 1CLCA 2EDRA 4D8PA 1JRHI 4U1JA 1A6WL 2F9BT 3SGKA 3RWHA 3LKRB 5H35B 1YQVH 5CD5D 4NZUH 5DVLA 4XBEH 4XVSL 5MERA 3TVMC 5FYJE 1NMCC 3KPLA 4JO2L 3B43A 1KCKA 4JFEB 3R06B 4NCC2 1KELL 4AQ1B 3MFGB 1D9KA 4UI2A 4NHCH 1X5YA 4BUGA 3TIEA 5EULV 4NRXB 5CEZE 1XGPA 1G7IA 4YGAB 4EEEA 4PJ7A 1F90H 1XGUB 1P2CB 1OTSC 1JF5A 5I19L 3QWQB 5E03A 1MCSA 2OMNA 1CS6A 1NPUA 3I85A 3O3DB 2WUBL 3C6SB 4KROD 4QYOB 4FXGA 5JUEL 2VLJA 2OL3A 5GRZA 3MJ7B 4K23H 1NC2D 4DK3A 4G9DB 2QQLH 5HHQA 2VDNH 5TPWH 5L8KB 1NL0H 4X6DA 4Q6YA 4R4FH 3RVXC 1N26A 2NYYD 3G08B 4N5ED 2R0WH 4P59L 5L2KA 1TLKA 3ZKND 1UM4H 1SJEB 1MLCA 1KCVH 4KJYA 4G7VH 3WXWH 1DLHA 5EOTA 1YNKH 1V05A 5SX4H 2ZUYA 4GBXA 1OQOA 1CE1H 3QJFA 4DAGL 4OTXH 2DQDH 5FYJU 3RZWA 2ZUQB 5ACZB 1XH3A 1QYGH 4OT1H 1X7QB 1FLRL 4KY1H 4PGDA 1T1XA 3KNBB 4KQ4H 3GKZA 5CEZL 4HS6B 1I7RB 1F8TH 2ZUUA 5FV2A 3KR3H 1U8JA 4M7LH 2HTKD 3J8F7 4JFZH 2ICES 2BVPB 3NMEA 4OGXL 4FQQB 4KRLB 2EDFA 5L6YL 3BRFA 1NAKL 1LP9E 4CGTA 3IU4H 4KRPD 1ZT1A 1KIPA 3GSRA 5HDBE 2P5WD 1C7TA 4HMCA 5DMGD 3D85A 1FORL 1OWRM 2VISB 5J0BA 4AM0B 3MUGA 1ZHNB 4PTTA 3IXTA 2PYFA 4E0RA 2VLRA 2I9LB 2JJWA 1J8KA 2KZWA 2JJVA 12E8H 2R2EA 3F7QA 4M1CC 4NFBA 3Q1SL 3KLHD 1G6RH 1EHXA 5D96B 3L5WA 5LGJB 3OG4B 2MKWA 4UINH 1K8DA 1NMBH 4JFED 1G9MH 4WEBL 1IQWL 1T04A 3RY6A 4M1DL 4ZXBB 5BVPL 5DJAB 5J13B 2QR0A 4HWZB 5DEFB 4P2OC 4YGVA 5MP6L 4JRXA 4GBXC 1KCSL 5GRVL 4IM8A 5ALBH 2ZSWA 4X6BB 1J0JA 1HDMA 1U8PA 5TH2A 5FGBC 1INDH 3O6ML 1JHKH 1OD7A 3O3AB 5FGCB 5B3NA 1WFUA 5IR1B 3BHBB 4PP1D 3VRJB 3D18A 4UT9H 4ZPVA 4IMLA 4LSSL 2IANB 2IF7A 5IOPB 4LVNC 5GGRY 4P5KA 4UBDC 2ICWB 2UUDH 3OX8B 4UB0L 4DFIA 1A6VL 1N6UA 5DUPH 3BT2L 5EBLB 3WD5L 4ALAH 3VXSA 1MFAH 2KPNA 1MJUL 4GKZB 1UWEL 3CLEH 1TVHB 3IKKA 1CCZA 2BMKA 3TN0B 1K9TA 5C0CE 4JHAL 4LGPB 4MJ4A 4PJIF 4CRPA 2CQVA 3L5IA 3TIDA 4Y1AE 4R7DB 1T5XB 1TVBA 4ODSH 2A6JA 5GIRA 4XXCA 5DF0A 5DVKA 1U8IA 2DL9A 4ZMAT 3ULUE 4PBVC 3SPVB 4UTAL 1OGAA 1K6QH 1DLFH 3U2SB 2FGZA 3O4LA 1RIVH 5T3ZE 5JHDB 2HLFD 4HUUA 4CU6A 3CMOL 3DVNA 4PJ8A 4OLUH 5C2UB 1KIRA 5ICXB 4P2RB 2A77L 5HVGB 3K8MA 1IEAA 4NN5B 3QIUB 4XNMA 1NGWB 3LHPL 5IQ9B 2AJZA 3QEGL 2YC1A 4RGNE 5B8CB 4V2BA 5GGTH 3B9KC 3WFCL 1OQXA 2D03H 1ES0A 4JFPB 4YWGL 3IDIB 4IDJL 2FR4B 5CIPH 5HJ3A 3OB0H 4TNVF 1EUTA 3FQTA 4KMTL 5I1GH 2D31B 4JDVB 4U1NA 4EIZC 5IMLB 1S9VB 2G9HB 3PGDA 3G5ZA 3L3KA 3P4LA 1BWWA 3HMWH 1QNZL 4TQEL 1HHJB 3VFPB 2EEAA 4AQOA 3NCMA 4U1LA 2YN3A 3KPRB 2YPLD 5DJ0B 4J6RH 1XGTB 3BEVA 3CAFA 3WLBA 3QEHA 2AABL 1T1ZB 5IJVA 3AS2A 4YFLI 3BMVA 3B3IB 2SEBA 3ZDXF 2MOVA 3ILQC 2YA2A 4XB8A 4EXPX 3FCTB 2Z91B 1TTGA 3WXVH 3UBXA 3VG0H 3EDJA 4RIRB 3JUZA 4ZXBD 4QF1B 1VFUA 3DV6A 4L29A 4IOSD 2F54B 3O41A 2OLDA 3MLSH 4FFYH 5DO2C 1MCJA 1PSKL 3OKKB 2VXTL 3G5YA 4ONFL 4CVZA 3IETB 4OZFG 2C1OB 5D2NE 5IGXL 1QRKA 4QGYA 1FRGL 2BSTB 4XP1L 1SVCP 3RRQA 1IGCH 1RUQH 3LDBB 4OLWH 3FB6B 2DWEB 2XWTA 2R9HC 1E6OH 3PGFL 2NY2B 2VLLA 2X09A 1GGUA 2GJJA 2IQAB 2ZCHH 4U31A 2Q20A 4XCEA 4OQTL 1KV3A 4WY7H 1CQYA 3MGOB 4XNQA 4JZNB 5I75C 3IJYB 4HGKC 2FCBA 1MHPH 4ZO7A 4OIBA 2C4XA 1XF4A 5IHUH 1DBAH 3RGHA 4G6KL 2EXYD 4LLUA 3MRMB 3CNKA 4QTHA 3TN0D 3PHQB 1ADQH 4FQXA 3VG9C 1MCDA 4ZUTA 3C5ZC 2GY5A 1ZGLP 3CFJB 4MCYB 3TBVA 2EDWA 1CICD 1LP9A 4O9HH 5CGTA 4K94L 1U8MB 2GFBA 3PV6B 5BOPA 2DBLH 5B3JF 1UQSB 3QP3A 3QHFL 5T3XD 1EHLH 3DHJA 1KLGB 1WFNA 5BOZG 4PB0H 1JK8B 3LAFA 1MFEL 5D72L 1HHIB 5JHDD 2J88H 2ESVB 3Q5OA 1PFCA 5EFIA 1IQDA 2B1HH 2DBJA 3SE8H 4P2RD 4APQC 4DTGH 1KT2A 1QHPA 3DX8A 4ODBD 3QIUD 5EZIH 4M6NH 2R0ZL 4RSVA 3U0TB 5FO8B 1UG9A 1KJ2L 4HAGA 4U1KA 3BPLC 4KVNH 5BW7A 1J8HB 3GHBH 4S1SH 3GB7B 3BP5A 5INDA 3OAUL 4HFWB 3ARRA 4N90D 4BZYA 5J12C 1IGJB 3RNQB 3EHBD 1SVZA 1CFQB 3MROA 1X9QA 1CFTA 5DJYA 4JN1H 4DVBA 4HMDA 1F3DH 1KLUB 1L7IL 2UZXB 2XKSA 4J7RA 1H5BC 1BQSA 2ID5A 3TPKA 1IAOA 3KPRD 3BIKB 5EZLA 3HI5H 1Q9KB 1PZUB 5DSCA 2WBJD 3VGHA 5TE7L 4JHBA 3OZ9L 4RWYH 3Q6FB 1MRFL 2R2CA 2VZVA 2CLVA 1QLRA 3CK0H 4MJIE 1ZT7A 3T0AA 1HIML 3NGBC 1QG3A 5KVFL 3MV9D 1UJ3A 4KK8D 3T4AB 4C57C 3DMMB 5C0CA 3BH8B 3U1SH 2NY4C 4Z7UA 4NQDE 3C8HA 2W9DL 4Y1AA 3T65A 1UWXH 2IC2A 1QBLL 4HC1H 3BE1H 5TE4L 5J56B 3GJFB 2PXYC 1ZXQA 3G5VA 2AXGB 4GAGH 4TUKH 1UACH 3V4VL 4LVOC 3VFUA 1P6FA 1KSRA 3IFLL 5E8NB 3OKLA 2NY2D 4Y4HB 5I66A 5DD3H 1D5ZA 5EIQA 1AD0A 3EYUH 3MYZA 5KVDL 1HKLL 3GMRB 3WJLA 4A2LA 5F6HI 3STLA 1ORSB 4UAOC 4DUXA 3O4OB 1NBVH 4HIEA 4F7CA 3NA4A 4FXLA 5EO0A 1ZTXH 4U2ZA 4WW2C 3SQOH 2V2TB 1X5HA 3JWOL 4YH6A 3MPCA 1AXTL 4Y5VB 3UO1L 3PUCA 1NCWH 3VFVA 4XVUD 2R2BB 1PX3A 3HE7C 4PJ9C 3A67L 1AGFA 2F58L 1HKFA 1FNLA 4OQTA 3F6LA 2VABB 3QUYD 2CJUL 1BD2B 3MXWL 4YHPB 1FLTX 3EYQC 4M5YL 5AAMA 3IFNH 3S4SA 2YXMA 4HXBH 4LDEB 4LCCC 3RGVB 3WCYA 3DPBA 1N8ZB 2B1AH 5I2IA 2VE6A 5J11B 4LCUA 3U46A 4PRNA 3WEXA 5E99L 1EEZA 4POZC 5EC2B 1FFOB 4GXUN 3OPZL 5E8EB 5HD8D 1WCQA 4QHUA 3C87A 4P9HH 1LO3L 1J8HD 4PRPE 2Z8VC 2K7QA 5ICZB 3VWJA 1VHPA 5TE6L 5C0DB 4PS4L 3TH4T 1UM5H 2QHRL 4OD1L 1TZIB 1I8IA 5DJXA 3VDCA 5JW3H 2DYPD 2CDGB 5I1JL 5CJOH 3LMJL 3OAYK 5D2NA 4PUBL 2X4QB 1GH7A 3MUZ1 4E42B 3MRHB 2R69L 5C2BH 2J1KA 1KJ2A 3CSBA 5HYSB 5I73B 2EYRB 3VFGL 2QL1A 2CKBL 5I1AB 5T1MA 2P24B 3GIZH 2R8SL 5TDNB 3WUWB 4RMRA 4YDIL 1N2RA 3LOWA 5EBMB 1N6VA 1H8OA 3GKWH 4XC3H 1A02N 5GRJH 4HT1H 1IMHC 2XQBL 2AJSH 3JV4B 1DQJB 3C08H 4Z77A 2AXFA 3W82A 4P2YA 2DMKA 3GSUB 2R4RH 4OB5L 1ZLVK 5FM4A 1HH6B 3MNZB 5C3TA 4G6MH 2F5AL 4OD3L 3LZFH 1F58L 1W0YT 4GRMB 1L9NA 2OXGA 3BP7B 4PTUB 1F97A 5DQ9A 5B4MC 4Z0BL 4NJAL 1SYVA 5SX5K 3U0WL 5JQ6L 3JTSB 5E8DL 1PJ9A 1FPTH 1JVKA 1EFXA 2OJEB 3OAZK 3PL6C 1HNGA 3MNVB 4POYA 4Y4HD 1IAKA 3MRNB 2XN9E 2BRRH 3V6ZA 1JPSL 2IAMC 1OAZH 2JCCE 4DKEH 5C8JA 4J3TA 3BAEH 4KDTC 4ZOBA 2DIAA 1RUML 4ZUUB 5GGRB 3ZE0E 4HUXA 5F7YC 5JDSA 3WKML 5L0QB 5JXED 1U8NA 3BN9D 3QJHB 4CDHA 3GMLA 1YUHA 5FO9A 5D8JL 3ZE1F 3VD3A 5HXMA 3HB3D 5EU7C 3F12B 1MHHB 2VN7A 4YQXL 3GHEH 3FRPG 3MLTB 3P0GB 4L1DA 4PJ5B 1QSED 1UKQA 4XP9H 3W0WD 5T5NG 1CDBA 4CJ0A 5IMKB 4TNWF 3T0VA 1BD2D 2NY3C 2H1PH 3I9GH 5DWUH 2A6DA 3RGVD 2BNRD 4K7PX 4M61B 5T1DH 3SDAB 4OM1H 4XMPL 3WNOA 4OSUH 2YPKB 4ETYA 3IJHB 3IDXL 1GGIH 4JFFE 3OF6A 3WLWD 3TZVA 2EYSA 4KK9D 2Y36H 3P9MA 5J8OA 4MD0A 2X42A 2VQ1A 3E2HC 2DI7A 2UWEB 4YDVA 1E28B 4Y89A 1BEYH 4Q0XH 4LCIH 3T77B 3RIAF 5E4IA 4U4BA 2XTJC 4GW1B 5D1XA 2CXGA 2V5YA 5HYIA 2XPGA 5B21A 4NQCD 3QA3A 4OFVA 3QG6B 2EKSA 1NCDH 4JM2A 4BH8A 5D7SL 4NQDA 3VD7A 3WYRA 3B83A 3F7YB 2NY5C 3CGTA 2EH7H 2DS4A 3MBXL 4X7CC 1UH2A 2FGWH 4POUB 4MNGA 3V79C 5TDPA 3RX8A 3LKPA 4ESKA 2XZCL 3WIHL 3QT2A 1OPGH 1NUDA 2EE9A 1ZE3C 1QRNE 5DJCA 1MCBA 1JGEA 3QDGB 5KS9E 3QWRD 3H7BA 3P30H 1YPZA 3BYTA 2ARJA 4C56E 4MS8D 1W0WA 2DI9A 3VI3F 1OP9A 3ILPB 1Z5LB 3LRSA 3ORJA 5C07D 4D9RE 5FKPB 5IHZA 5J1AB 5ISZB 5FHBH 5CP7A 4JQIH 4R4NC 2H9GA 4CN6A 2PO6D 2E9WA 3GSOA 3S36L 3X11A 3QUXC 3HG1A 3RI5K 2Z92A 3HKFA 1N3NB 2UY7A 1MFBH 1QSFE 4GQPH 4NDMB 4Z7VB 2CKBA 4FABH 4F3FA 1U92B 3EOAB 5IBLD 4EDWL 1I3UA 1C12B 5IW6B 3UJIL 1KC5L 2DLFL 4XPHL 2VDOL 5IB2B 3W2DL 2E7LA 2OSLA 2XTLA 2BVYA 1CFBA 4QRPB 1PEZA 3HC0B 3GDBA 4QHMA 1ZHBB 5SWSE 5KVGL 2GJ6D 5BXFB 4WFGE 3OBAA 1RJYA 2FBJH 1PEWA 1KG0A 5FUZH 5I17B 5DJZA 4ZFFA 5MI0C 3PWPA 4X8XA 1NEZA 3CLFH 5TGBA 3NOIA 4M7KH 2DKMA 4BKLB 4K8RC 3TCXA 2XXMB 2X10A 3BUYB 3VJ6B 5E0QA 5F1NA 1BVZA 4OGYH 2MHAA 1OTTD 5HVHB 1RZKH 5DTFB 1TQCC 4PJ5D 2ZG1A 2H32B 1QBMH 1I7ZA 3FHAA 2JLLA 5HSFA 1FNSH 3EUUA 5GS3A 4MAUH 3TWCL 3LQZB 4LF3A 1NDMB 4OF0A 1MWAB 3WO4B 3ZYZA 5IKCA 3F6IA 1BFVL 4HKBB 3S3PA 3SKMB 4QOKB 1BBDH 1RZFH 5JHLL 4G8FA 4YHOL 3UDWA 3UBXI 4RAVB 3V4UH 4I18A 2D7OA 2AXHA 2P4AB 3NACH 5GISH 4CN1A 2R2HB 1KPRA 3ARSA 2I5YH 5BZDA 1RFDL 4GSDH 5CHNA 5GRVK 4B0MM 1DDHB 3HPLA 4YDKL 4G5ZL 1IARB 2NY7L 5E1AB 1RUKL 1F6LL 1G7PB 5C0BD 3NFPA 4B41A 1XF3A 4RFNC 5CMAA 3GUTA 3I6GA 2ZNWA 3AY4A 1B0GB 1BZ7B 1O7SA 2MPAH 5IK3A 1F2QA 1INEL 3BH9B 1A3RL 4FZEL 4W81A 3NFNB 3DRTA 2EE2A 2CDEA 1MHCA 1N6QL 1DSFH 5AWNH 5EORL 1D6EB 3P11L 5EB9A 4OGAC 4HUVA 4N8VG 3H9SD 4PJIE 1M05A 3WE6B 2XN9A 2GITA 3QUML 4TOYL 5F97E 3JV6B 1FZMB 2H6PB 2G5BB 3QCTL 4Q2ZA 1CD8A 5KSUA 1YECH 3SJVB 4M8QB 1D5IH 4N5UA 5ISZD 3EDKA 2IADA 3MV8B 4RFOL 5DFVC 3QFJB 3TO4B 5I1EH 3GBML 3RWIA 3PQYB 1V3LA 3R4DA 4PY7A 4LCWB 4KKBC 3WIHA 2F8XC 3MRRB 4YUEH 2XY2A 3WJJC 1JGVH 1NGPL 3TF7C 4G9FD 2A6KB 1MI5B 3MCKA 4PB9H 1GIGH 3TFKD 1FIEA 3DUUB 1DL7H 1JPTH 3ULVC 4XZUB 4YFDB 3O45A 3S6CA 5CP3A 1QKZL 2WANA 5D9SB 1WV7T 5BO1H 5DK0A 2HVJB 2AV7A 5EA0L 5HI5C 2FD6H 1S8DA 2C3VB 4JFFA 3CUPA 3GSNL 4HJ0C 3L3OB 3LIZH 3T1FB 3L9RA 3BKCH 2W0FA 4B7IA 3U36A 2IMNA 2P8MB 4XNYL 3SGJC 5C0EA 1FV1A 3FFCE 4D0BA 5E5UB 1F00I 4E41B 2AK4E 1L9MA 1ONQA 4KJPC 3KJ4C 2MSPA 4PJAB 1MJ7L 3MMEB 4JRWA 4DZ8B 5HDQL 3UTOA 3DXAA 2DRUA 1F3RB 5A40E 3ZDZE 1X6LA 1ZSDA 3HZYA 4QXUH 1HSAA 1YQ2A 5E9DB 3ARDD 1ED3A 1R3KB 1R5WB 3MLVH 3ZDXE 5KN5B 5F44A 4GRWH 3QEUA 4FQJL 3PGCB 1Z3GH 1DZBA 2X4TB 3WS3A 4JY6A 1NGZB 5DS8B 1NBZA 1T20A 1DVFD 1M7IA 3OKDA 3SDDD 3MR9A 1S7XB 4XCYA 1WBXB 1HWHB 1QQDA 5GGUA 1NBQA 3MRKB 1XIWC 1P4LA 1QRNA 1QBBA 5I0ZA 4LPYA 3RVVD 4UV7H 2X4OB 1UWGH 3ARFB 4GKSA 1LEKB 1C08B 1NCCH 4C56A 2AEIT 1XCQA 4ENEC 5F6IB 3BVNA 3TA3B 3SDCC 3GO1L 3OR6A 1GRWA 1R3LA 2FJGA 1RPQA 4BK4A 1F4WL 1HZHL 4KXZH 2OTUA 3TESA 1NUGA 1PG7X 2PR4H 4ELKB 5L9DH 4ZTOL 4P57B 5HHPB 1QSFA 1X4ZA 4XPGL 2VDPL 1AO7E 3BKMH 5DJ6A 3UXFA 1CT8B 2UWEF 3R1GL 4EQ3A 4OIIL 2BVUA 3QI9A 4AJ0A 4TVPE 3MYJB 3I50H 2V2WA 2IQ9L 4K3JH 4MQ7B 3S34L 5KSAC 3DYPA 5DVOA 4JREC 1GVIA 5ANMB 4LLDA 4UILL 5B3JE 3BISA 1A7BA 3JTTB 5DJ8A 5I30H 4LKCA 5SWSA 5HYJB 1BM3L 4L9DA 3INUH 1U2CA 2BSED 2HFGL 2X1WL 3QUKB 3QFJD 5CBAA 1K5NA 3TO4D 3EDDA 4F80A 4OZIB 5K9JH 3QDMB 4LCWD 5GGQH 1FVDA 3V5HB 3QISA 4L4VE 1WISA 1TZGH 4ZYKA 4UDUA 2GSGB 1MI5D 3QUMA 4P46B 4TN9A 5DJ2A 5C09A 2BSSA 35C8H 1GC1H 3P4MA 3IDJA 4M00A 1IGFL 3VFMA 4L8CB 2A73A 2X7LA 3FT2A 1NJ9A 9CGTA 2PW1B 4O00A 1IAMA 4PRBA 2R56L 3MSPA 4XNUH 3QCUH 4LSPH 5FYKD 4Z7VF 5I1DB 2AJ3A 4QHNA 4F7EA 3T0WA 5CCKH 1VEPA 4TVPL 3U7YH 2P7TB 3QWOB 5HGGS 3LEXB 1XCTB 3NPSC 4E41D 4DGYL 1EZVY 2C5DC 4P2CG 1FZOA 3FB5A 1RIHH 3F7RA 5IM7B 3TV3L 3CH8A 5JO5B 5CKGA 3M1BA 4PJDE 3WFHA 2WNGA 2MCG1 2Q6WA 5F9OL 3GSNA 1CGVA 4QXTA 5DK2B 2HVKA 1BQLL 1PLGH 3DURA 4HSQA 1ZA6A 4JFOA 2XNAA 1DBKH 3GBNH 4JANB 5BV7H 1QPXA 2ORBH 4LEXH 4IRZL 3MXVH 5HY9B 1K8IB 3T1WA 1H3TA 1J9CT 3V0VB 1JNHA 4ZO6A 3HC3L 4PJIA 4WFEE 4WFHE 3UTSD 2HWZL 1OGTB 3WIIL 1NC2A 3BSZL 3PE9A 1ZEAL 4P23B 3DO7A 3ARFD 1UB6B 4GMSL 4JFXA 5JPMA 4EIGB 1TTUA 4B50A 4XB7A 4Y5YB 4KMQA 4JDTL 3HI1A 3FONB 3FZUD 4U3CA 5DUBB 1OP3H 4EVNB 5DHVA 1FVCA 4ODHH 3DRQB 2DQFA 3HUJB 1AXIB 4KFZC 4H1LB 2QV2A 5ERWB 1I8LA 3UPRA 4ERSL 1RJLA 3QUZB 5KSVA 2EC8A 5HPMB 2HTLC 3TT1L 3MRBA 5F7NC 4WU5B 4OUUA 5C6TH 1A9BA 1BIHA 1V3KA 1NFIA 3MGTA 4HF5H 4LBEB 5FM5O 4KHTL 4Y16A 1IM9B 5FGCE 4X4XB 3MNWA 2KDGA 3BP4B 3GMQB 5SWZE 1BVLB 1FGNL 2DD8H 1AFVH 3LKNB 2HH0H 2IANE 3GRWH 4JZJB 4RFEA 3IAQA 1PYWB 2FATH 3HE6A 5IUSA 1VSCA 2DQJH 5CD5C 4UZGA 2Q86A 3EAKA 5IWLC 2IALB 4QRQA 4XPFL 2QQNH 5GZND 4YXLL 3MBED 4K7PY 2E6JA 3QIBB 4YXHH 3FFCA 2AK4A 4OLYH 1VACA 3PWVB 3QDMD 3VWKC 1NC4B 4MZ2A 4OCXL 1A21A 3U83A 3DVGB 4MAYA 1I1RA 1FQ9C 4U7KA 3CXDH 5DC0A 3DV4A 2FL5B 3CH1A 5AUMA 3PP3K 1MCWM 2R29L 5FIEA 5JNYB 3KWWA 3HCVA 3O2WH 1I9RH 1EUUA 4I77H 4PLOB 3RWDA 2ADIB 4P46D 1MY5A 3N85L 2D0HA 4PR5B 4HH9A 4WENB 2QSTA 3VFRB 1LNUB 1CG9A 4XBGB 2YWYA 3UTTD 3D0LA 3IU3A 4HLZG 2YN5A 2YPVH 1GHFH 3ELAT 3IFPB 3LKRA 4JM4H 5H35A 3LN9A 1OAYL 1SY6H 3CIQA 3B2VH 4LPTA 3CD4A 4TSCH 4KQ3L 1AHWC 4JFEA 3R06A 2DTML 1IC1A 4MXWH 4CL7A 4UIKH 5I1IH 1W8NA 1EVTC 1TVDA 5L88L 3ARPA 3I6LD 3GMPB 4GS7C 3DARA 3O3UN 2DAVA 4ZODA 2ED9A 4Y4KB 1X5XA 4NRXA 5KTEL 1DR9A 2N1KA 1XGUA 3BKJH 1P2CA 3C5SB 5EH1A 1P7HL 4U6VH 4R8WH 4IRJD 5DHXB 5GJSL 2GW5A 3O3DA 3C6SA 4PJAF 4ZNEE 2ZCKL 4QYOA 2FO4B 5AZEL 4AEHL 2EYTB 3MJ7A 3VH8B 4G9DA 4P23D 4GG6E 3NFSL 5T3XL 2QEJA 4QXGH 2KBGA 1N5YH 3UMTA 2HTKC 1GAFH 5IP4A 1ZGLB 3I02B 5LXGH 4F37F 4DKAA 1RIUL 3EJZD 3VW3L 3G08A 4DGIL 3VFNB 5GS0H 2Q7NA 5DGQA 1J5OH 1SJEA 3IRPX 3AS3A 2F54E 4WGWB 4PJHF 4JPWH 3NIDF 1Z2KA 5KVEL 2D7NA 3KS0H 3Q6GH 4Y0GA 5LCVH 2VXSH 2ZOLB 3DIFB 4XAKD 5IFAL 3X3FL 3W5MA 1EJOL 2DKUA 5D1ZB 3G6AB 1MCCA 1IM9D 3ZE1E 1KTLB 3SGDI 4WCYH 5HYFA 2LVEA 5ACZA 3OKEB 3HLAB 4M5ZH 5D1QB 2V17L 1X7QA 3RU8H 3NTCH 2JB5L 3KNBA 3QDJD 4HS6A 1I7RA 2RQ8A 1JL8A 4JG1L 5IVXF 2CUHA 5DA4A 2R39A 2BVPA 4HFUL 4FQQA 1QZ1A 4AL8L 1ERNA 4GMTL 4RWHA 4DJMA 1U8LB 4EJ1C 4Z76B 3QRGH 4P5TD 3KYNB 3FO9B 3CVIL 3MREB 3LEYH 1C5BH 2VISA 4PJBB 4HEPG 3KJ6H 4AM0A 1ZHNA 4HK3J 2ESVE 1S5HB 4YHLL 2I9LA 3KYOB 4P2QB 4OZIF 1JYNA 4FMFA 1G9NL 2JELH 4G6JL 5KJRH 4QCIB 2F53B 4YHNB 4KZEH 5LGJA 4NUJB 4URTB 4XX1G 2WWKT 4NUGH 3BX7C 1A7PL 4ZXBA 3WFBL 3DROB 5EIIB 5DJAA 2O5ZH 2B39A 4HWZA 5DEFA 3VA2C 2J8OA 1VB9A 4Y4KD 3VI3E 1J1PL 4LIQH 3L6FB 1AQDB 4F15B 4ODWB 3LS4H 4X6BA 3T2NL 4D9LH 3N06B 4ZAKB 3O3AA 4FQLH 5IR1A 3BHBA 3VRJA 1DANU 5HGHB 1A7QH 1YDPB 2IANA 5IOPA 3LKQB 2ICWA 4WFFE 3OX8A 2BRQA 4U1MB 1YEGL 4JKPH 5I74C 5A16B 5TDOB 3H9YA 5LJYH 5EBLA 4KKAC 1OARL 4X7TB 1CTOA 1KOAA 4GKZA 1MAMH 1OAXH 4QTIL 1TVHA 3TN0A 1EMTL 3ROLB 1WITA 1OVZA 1U6AL 2QKIB 4X83A 3MUJA 3MLRH 1T5XA 4N8PA 1YEEH 2IH1B 1F6AB 1QVOB 2NLJB 3SPVA 4HG4K 3X3GL 5D1ZD 1FNAA 1RVFH 4NQUA 1ZA3B 1EBPA 1J7VR 1EO8L 3VXRB 3U2SA 1C5CH 5JHDA 3FKUS 4HUMB 1BQHG 1Q0XH 2E27H 3LQAH 2D7TL 3U0PB 1VGEL 5D1QD 2BHYA 5I9QC 3HUJF 5ICXA 4P2RA 2XKNB 3FN3A 2H2PD 3QPXH 5DRWB 3O6FB 3QIUA 5EO1B 3U6RA 3JWDH 1NGWA 5IBTL 5IQ9A 5B8CA 1PVHA 4HX1B 1U3YA 1JNLL 4PPTA 4R26H 5IJKA 3AU1B 3OXSB 3CXHJ 1EIBA 4JFPA 4LASH 4UTBH 1DQML 3IDIA 2NPLX 2FR4A 1UEMA 2J4WL 5J13C 3WN5B 1Q8MA 1A0QH 2HMIC 4YO0B 2D31A 3IB4A 4JDVA 4JHWH 1BD2E 4NZTL 5IMLA 2VXUH 1S9VA 1LE5B 4J23A 4TYUA 2DQCL 2G9HA 4G3YH 4CVXB 1F4YL 3DUHA 2ADGB 3IGAB 2FWOB 8CGTA 3HAEH 3BZDA 4MA1B 1P4IL 1QACA 1HHJA 2NX5B 3PWUB 4XMKH 2JB6B 3HFML 4P2QD 2X89D 4LU5H 4OZ4B 3KPRA 5E00B 5DJ0A 1XGTA 5F89B 5I8KL 4JZOB 1NMAL 5FM5M 1HE7A 1T1ZA 2EO9A 1I85C 2GSIB 4KI5D 3ZL4H 3MLZL 1Q72H 3B3IA 3CVHH 3LKSB 3TVMB 3FCTA 1O5DT 4JGUA 2Z91A 2EXYC 1NMCB 1NLBL 4XPAL 4D3CH 4RIRA 2YD8A 4RGMC 5MEPB 2IPTL 5EU3B 1T0MA 5DMKB 3F5WB 4QF1A 2BDNL 1CICC 1G7QB 1LO4H 3FQNB 1XGYL 2F54A 4MQTB 3OKKA 4F9PA 3RY5A 1DQLH 2IGFL 2YA0A 3IETA 3ZKQD 2C1OA 3QHZL 2BP3A 4OAWB 3SE9H 5MEOB 2BSTA 2AERT 4ZAKD 1XFPA 3FB6A 2DWEA 1I9JL 2VC2H 1V7NH 2AAVA 2OM5A 4NQEB 2MNUA 2IQAA 3AAZB 2IG2H