2YBRA

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
VQLVESGGGLVQPGGSLRLSCTGSGFTFDNYAMHWLRQVPGEGLEWVSGISRSSGDIDYADSVKGRFTISRDDAKKTLSLQMNSLRAEDTAVYYCARGGVGSFDTWGQGTMVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 26
structure length 116
sequence length 116
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2011-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ybrA00
4C58B 4EEEA 2VXVH 5DQJB 3JUYA 1OD9A 4K3DH 4I3RL 4LKCB 2E9JA 2VL5B 2CMRL 3MXVH 5GS0H 3CX2A 4LSSL 1B90A 3EBAA 5EOCJ 4L8CA 2VDPL 1E27B 1GGTA 4R2GB 4XXDA 4WDIA 4IMKC 2Y06H 3V4PL 2GITB 4OGYH 3NPSC 4PJ9D 3W9DA 1QFUH 3QIBC 3LN9A 1MY7A 1XGPA 3QDGD 4F7EB 1FZKA 3DOSA 4Z7VF 4XH2B 1A7BA 1P9MA 2BMKA 2F5BH 2PYED 3DRTA 2EIEA 1E4KC 5L2JB 1R3HA 2DM3A 1YNLL 3T3ME 1RJLA 1NLDL 1CXKA 1D5IH 5IT2H 4LCCA 4AENA 4XNQB 1FIGH 1X44A 4A6YA 4IIQA 2FEDD 3TO2A 3HLAA 2BVYA 2X6MA 4GW5B 3PL6A 1IAKB 4PGEB 5IG7B 1CK0L 1MLCB 5K9JH 2WWMC 4ZTPH 2CDEA 4NKDB 5EN2A 4G8FA 3SOBL 4YXKH 3MLXH 3QB7C 1NCCH 1U8NA 1CF8H 3PDGA 5F6HI 3RVVD 3IF1B 1TZGL 4WUKL 1SM3L 2VZTA 1AHWC 5F1NA 4PV9B 3HB3D 1JE6A 2FSEB 3N1PC 1MPAL 2QTEA 4HKZB 5J12B 4F15C 3U0TA 1VCAA 3WO4B 4Q6IB 1H9VA 2KZ1B 5EBMA 1ZLSH 1J05A 4Z7NE 3P30H 3IVKA 5DFVC 1F8TL 4RISH 5TE4L 1JMZA 1UH4A 4XTRD 2VLKD 1FL6B 5I8KL 5E4EC 5E5MB 3LAFA 3S4SA 3S97C 4FFWC 4QHKJ 3BT2L 4UQ2A 4TVPH 1R5IB 3LSOB 4RGNE 4FN0A 4LFHD 1AGDB 2OCFD 2YA2A 1JTTA 1MFDH 4MHHG 5TQ0H 4XPAH 4OB5H 1E4XI 4PJ9B 5GS3A 5GJSL 5KSAC 4GQ9L 2CRIA 3QDGB 4KK8D 5HHNB 4MNHA 4X7TB 4LSUH 3TA3D 3PWUA 4X9FA 3WLWD 2DLEA 2PYEB 4OCLC 1HINL 3RX7A 3TVMA 3EJZC 5T3XE 5C07D 4OZHF 5TH2A 1G7HA 2AI0H 3KJ6L 2DQUH 4XZUA 2VDNL 4J3VA 4OFKA 1NBYB 1PG7X 1UXSB 2Q1EA 2XT1B 5INDA 5FO9A 2DOCA 2OTUA 5AYQA 3VFRB 1JMXA 3QDGE 2EEDA 3LCYA 3MV01 2G5BA 1HXYA 5IF0B 4JFFD 2P47B 2X1OA 2X4OB 3LIZH 3ESVF 5BOZG 4Q0XL 4J1UB 2YUVA 4ZNEE 4MQ7A 5I76A 2R1XA 3QDHA 5I15L 1T1ZA 2FL5B 3MRMA 4EQ2A 3ZSTA 4JO2L 5C0GB 4ZFZA 2DI7A 1BJ1H 3SDAC 2CJUH 3RNKA 3NCCB 4KAQL 1FGNL 1CXHA 5GS0C 4AQ1B 2N7AA 3SY0A 3UZQA 3S34H 3V6OA 1S78C 4FMKA 4HK0B 3NZHL 1KLGA 4HWZB 5SV3A 5BW7C 5IFHL 5EUOE 4PLJD 4Z6AT 2DAVA 5ID0A 5JHDD 1K8DB 5DMKB 5KSUA 4CJ0A 3CVIL 3FOLB 1ZHKA 4YHOH 3V4UH 1SHMA 1EFQA 1YECH 1AP2A 3S5LG 1WFNA 1VFAA 1ZLUH 4CRPA 1EZVY 5M94B 4GT7A 2ZPKH 1OCWH 5IGXL 1PJ9A 2VLKE 3QG6B 3B9DA 2CUHA 2MKLC 3TA3B 4K8RD 4YC2B 5ESAB 4LLWB 2YKLL 5HTSA 2BCKA 1T6VN 3C6LA 1HDMB 4I77H 5C07B 3MC0A 2VDQL 4YHIB 3TIDA 5HD8C 3MREB 4QGYA 5I1DB 2FJHB 4P5MB 2V7HB 5CHNA 5F9JB 1P5VA 4HGKC 4Z7OF 4J3XA 4KJPD 5HVGB 1T7ZA 1OB1A 2EYTA 5FYJU 4IJ3B 2CLVA 2H8PA 3U82B 5DR5L 2EKSB 2WP3T 3RY5A 1XF3B 5INCA 1BBDL 4JFFB 3MJ9H 5JUEL 3TJHD 2GY5A 1YEKL 2AJYH 4M7LL 1IQWH 3QI9C 1ZVHA 5GGSA 1G6VK 5HYQA 4NP4L 4Y4FC 1MH5A 5C07E 1JV5B 5SV4A 3MRBA 3MRPA 2E8ZA 4QHLA 4XVUC 2Z0BA 4I4WA 2H3NA 3IXAA 4X6DF 2ESVD 3WFCL 2ZOLA 4UV4H 4PJHF 5L0QC 4S1RL 4LPUA 2IAMC 1PY4A 4HUVA 3BD5A 5GGRB 1EDQA 4XWGL 3KXFA 4PS4H 4B41A 1BAFH 1I9RL 5L8JB 1G7IB 4JFFE 3RI5K 4LNRA 5C0NC 3LKPA 1NAML 3BP6A 3QUZC 4PP2B 1HKLL 1DBBL 2NCMA 5EC1B 3CVHA 1BZ9B 1DQML 5I8OH 4K23L 3HPJB 5JHDB 2QV2A 2MQ3A 1YPZB 2XZZA 1CU4H 1WBZB 2WK2A 4IRSA 4LVOC 4CU8A 1CYGA 4JG1H 4HZLB 1R6VA 4DZ8B 1C5BH 1JZ8A 4DKEL 4ETQA 2IAND 1F4AA 3HMWL 3O2DL 5IBUB 3W5MA 3SE8H 5HI3C 1DQJA 2XY2A 3CC5A 3GM8A 4NO3A 3I3EA 4M1GL 4AEFA 4HCRH 3ULVH 5C0IA 2GJ6D 5DRZA 1CL7L 1IEBA 2K1MA 5E7BA 2GJJA 1KJ3H 4HKJB 4F7CA 3L1OL 4G80A 5JHDE 4G43A 1JIBA 3GUTB 1A02N 2VC2L 4XPBL 2VABB 4PYHA 5JXAH 5C09A 4GBXC 4MB4A 1AD0B 1L7IH 1FVEB 4JRYE 3LMJL 2AAVA 1OT1A 4K2UH 4GKSB 2FJGA 1J10A 2P43B 5HHVH 4M1CD 1BQHB 1A64A 3GJFA 4WFHD 1HHHB 2APBA 3H3PH 1QFPA 3HC0B 1TNMA 4OQTH 5CP3A 3B5TA 5HDBF 2DRUA 3UMTA 4JLRA 3EKCA 2ITCA 5TF1H 1ND0B 4Y5VC 5E99L 5F3BA 3P77B 4Z7QE 1HCVA 2ESVB 1KENH 3TBSA 5IB3B 2P8MB 1IM3A 4UU9B 5GISL 1T4KB 3RWEA 2PF6A 5DVNA 4EVNA 2DIAA 5D6DC 3K4DA 3TESA 4OCWH 2XA8H 4G6MH 5F6IC 3KLSA 3WFDH 4M9OA 1DUZA 4P3DA 4U4BA 3RWJA 1MFCH 1V7NL 4U7KA 3VGAB 5DJ2A 2R0LL 2R8SL 1OD7A 2YWZA 1IGMH 1QQDA 1YZZA 1D5BB 2PTTA 1KPRB 3BKYL 5FKAB 4JZJB 5B8CB 2FO1A 3GHBL 5IWLC 1BFVL 4GLRH 2ESVE 1ZSDB 4YFLI 1T89A 4YR6A 5AD0A 2OYPA 3E8UL 4MS8D 3UBXA 4XNZC 1Z3GL 2YC1A 3G6JB 3MCG1 2EDTA 3O45B 3QRGL 1Y18B 1J12A 2IANB 3DHMA 1OGTB 5FF6B 1EK3A 3VA2C 5I71B 4OF6A 2DI8A 4P5TC 2IBZY 1PG7W 2GJ6B 3C8KB 3DVGA 2OX5A 1FGVL 5J11C 4YWGH 3X11B 2JJUA 1LP9A 1VGEH 4NZUL 3Q6FB 1MRCH 5EOTB 1HHKA 2F58H 9CGTA 1JRHL 3VWKC 2P5WD 4M5ZH 2E9IA 5DD1L 3IGAB 2C7UB 4OF0A 3QUKA 4QRRD 2IANE 3ES6B 4TNVK 5DHVH 2XNAB 3IU3B 1K6QH 3NPZB 2YUZA 4JZNB 5TE7H 2HTKD 3QHTC 4YIQB 4P5KA 2GJ6E 4PJFE 3VGGA 2YA0A 1D5MA 5EZOH 3WKML 1BQSA 3BESR 5E2WH 2ATPA 3T77B 4M8QB 5DK3A 2I60L 5ERWB 3MLUH 1UACH 1U8HA 4KKLD 4FG6C 1ZEAL 1ZVYA 2AK1H 4W4NA 3BRFA 3P0GB 1B0RA 4JGUA 3NH7H 4Y1AD 4PJ7B 3R1GH 4Y2DD 1Z0NA 5AAMA 1RZ8A 5GGVL 4KK9D 1G7QA 2VAJA 5DWUH 4Y8DC 1F00I 4QRSA 2F19L 1CT8B 4QOKD 3I85A 4JM2A 1CIUA 1UH2A 3V6ZB 5IJVA 3GMMA 1CDBA 3P0YH 2AEPL 3BKCL 3UJTH 2ICES 3BPOC 2AQ1A 2R2HA 4PJ7E 1BF2A 1CTNA 1KCRH 2EDNA 3DUSB 4HD9A 4M93C 1H8NA 4YGVB 4X99A 1FPTH 25C8L 2P5EA 3QCTL 4G9FD 5DO2C 2WWKT 1LO4H 5KSVA 3TWCL 4N5UA 4OD2A 3GO1H 4BSWB 5GRZA 5HJ3B 4OFYA 1A0QL 2CK0H 4NRYA 1A4JA 3QXDB 2P5WB 3ZDZF 2MPAL 1I85A 3PWNA 2HKFL 1S9XA 4QRRB 3MRGA 5F70A 4X4XB 5L9DL 1K3IA 2VDKL 1JF1B 5F93C 1QLEL 1FCGA 2GUOA 2GCYB 1AE6L 2BNUB 3EJJX 4XC3L 2QSCH 4Y8AA 4OUUA 2J1KA 2JKXA 4IRZL 1AQKL 4E5XA 4R90L 4XWOC 4LPCA 2Q8BL 4LSPH 3EYOB 5GZOD 1DQQB 2QKIB 4UTBH 1TTFA 1CXFA 2VXTL 4Y1AB 2P5WE 4KRPC 3FL7A 1FC1A 1X5LA 2DF3A 3RPIA 1JNHA 4QRRE 4KTEH 1SYVB 3X12A 2JK5A 5GSRA 4L4JA 5I18L 1IKFL 1PBYA 4LCWE 3WD5L 4DFIA 4YLQT 5DRXB 4ZPVA 2JJTC 4G3YH 1AIFB 1A6UL 5B39B 4QOKB 3TNNA 4L9LA 3MRDB 4CADA 3H9SA 4M62L 5MI0C 2P24B 3P4NB 5JOFA 4X7FC 4PJGF 1MRFL 4ACPA 3G5YB 3TFKD 4LIQE 1MHEA 2Z31D 1K4CB 4MD4A 3CCHA 1T66C 5IVXE 4NQSA 2HA1A 2RIKA 4G9FB 2A9NH 4UAOC 4U7MA 2VXSL 4QOKE 5T1MA 5TE6H 4M8VA 1BOYA 5KOMC 3ZYZA 2NY1D 4WI2A 3ZKMD 4YZFF 5ACZB 4CGTA 1PSKL 4YHMH 5DRWA 1TJIH 3BPNC 5E6IA 5KVDL 5LGJB 3V0WH 3O6FC 3O3AA 3BRDA 2J6EA 2HP4A 2LTQC 1C1EL 2WV3A 3OR7A 4ZAKD 1BJ8A 5BS0E 3GSUB 1JK8A 1X9QA 1FYTA 3EYQD 1EJOH 4G9FE 5C0RH 2XN9D 7FABL 4D3CH 1RU9L 3GGWB 3S5LA 2APXA 3QRFM 4GSDH 5GSVB 3FRUA 3K80A 2HT4C 3C8DA 1Y6NR 4H88L 1CFSB 2ZSWB 4ZXBA 4NNXB 1IJ9A 1BGXH 4RBPH 5KVGH 4HQQH 4NZRL 1N5YL 1IAIH 3PV6A 4YXLL 1AXIB 5DZNA 4LRNH 3SKOA 1U8KB 3DO3A 2Z4QA 4FQLL 3QIWC 1MWAA 2XTLA 4PJXF 4XCNB 5AWNH 5E8EB 4W70A 3T2PA 1MFAL 3L3DA 3HFML 4XRCB 3FMGL 1ZK9A 1ZVSB 1T2JA 2G60H 3ZTJG 1NDGA 3P3YA 2VE6B 4JHAH 2A9MH 4YEEA 1AY1H 5D1ZD 1FV1A 4AH2A 3MRNA 3LEVH 3VE0B 3HZMA 4ELMF 1IGJB 4X5XA 4ODBD 4HPOH 5CGYC 2X4QA 5IEKA 4M4PA 2BP3A 4NQED 5KOVC 3O6KH 5I1LB 4Z7WA 2EE9A 4M6MH 1UCBH 1VFOA 1ZTXL 4QTHA 5MERB 4KDWA 2B0SL 3NCEB 2KH2B 1OAQL 2NY1B 2Q76B 3ARUA 3KPPB 2AK4A 4PBVC 3O6LH 1DVFC 2VDMH 1WZMA 2BHZA 2ZUYA 3MGOA 1QBLH 1XF4B 5C0JB 1UM6H 3STZA 1F4XH 4ZAKB 1Q1JL 4QF1B 3KPQB 2G75B 3D48R 3NCJL 2ZG1A 3MRJB 1Q9WB 4HWUA 4PGZA 3WIHA 4APQD 4NRZB 4X9HA 2Y25A 3B5HA 3F5WB 4RZCB 3F6IA 3I75A 2MCPH 1KG0B 3UTTE 1BJ1J 4G9DA 2I9LA 3FQXB 5DUBA 3IAGC 3D3VE 1QPPA 3MFGB 3C9NA 4G6KL 5GGQH 4TQEH 2FATH 2D3VA 3O3BB 1NEZG 2WW8A 1N8ZA 4YPGA 5GRUH 4F2MB 1XZ0B 3D9AL 4AL8H 1TMCB 5EU4A 2XN9E 4JQIH 1WISA 2WINB 2ADFH 1HOCB 1SJHA 2NNAB 1HCFX 2CIKA 3PGCB 3QQ3A 1S7UB 1ADQH 5JIHA 4XB8A 5D1ZB 3BPLB 1TPXB 3KYOA 5D7IB 4NQEB 3LVEA 5KVMC 2Y5TA 3VGHA 4ODWB 2AJVL 1WAAF 3OJ2C 2CH8A 1ZANL 2W9LA 1FNEB 1QRNB 3FT3B 5J3HD 2R0ZL 4A6YL 1NUFA 4Y4HB 1YMMA 4U1IB 3I50L 1DANT 1R3JA 2M26A 3VJ6B 2ZOKA 3OKYA 1N4XL 5I9QB 1XGQA 1S3KH 4JDTL 1A6WL 4ZO8A 5DFWH 3B83A 4KRMB 3RUGF 2E7LC 4CVXA 1P4LB 5TPWL 1U8JA 3OKEA 1XR8A 3G6DH 4K94H 5CJOL 2VZSA 1H8SA 5IW6B 1RZFL 2EYRB 3MXWH 1FAIL 1R24A 2EYSB 5HGHA 4D8PB 3L3HB 3WXWH 2VOTA 4L4TA 1XCTB 4XPHL 4ZDHB 3ZO0A 5F1IA 5JLZA 1KNOA 1G7JB 3U0WH 5ICZA 3I9GL 3U9UA 4S2SA 3I6KA 1UWEH 4M7KL 4WO4A 5JR1H 4PRHD 4B5EA 3WHE1 4YHKH 3CSYA 2V5YA 1OTUC 4AT6A 5JNYA 1JWUA 2EE3A 4K7PX 4LCIH 1CR9L 2BVPB 3BN9C 4TRPH 4U1LB 3L95B 3O3EA 3H7BB 3TZVA 3H9YA 1TVBA 3KPNB 4M61B 4JFZL 3BGMB 5FGCE 3LRGA 2NY6D 3K2UH 1I7UB 1W0VB 3MV7D 5TQ2L 4MJ6B 1RIVL 3VXRE 3ARGC 3LZFL 3MFFB 3E3QE 4WV1B 3L5HA 2WAHA 3K81A 1KBGH 5CIPB 5K9KA 1XF2A 2W65A 3JWOH 3MO1A 1A22B 5ICYB 4PB0H 2RB8A 3C60C 3VFWB 3T3MF 4JFEA 4NN7C 4RX4A 1V3JA 5HI5D 4PBXA 4TOYH 1V7MH 4UZGA 3FOMA 4AEIL 4LMQE 5LGKA 2AXGA 3BDYL 5GGUA 4L8CB 4PGCA 4MDJB 4WDIB 5MEQB 4U6HA 1T3FA 2I27N 2A74A 1IGYA 1PAMA 2VZVA 3W9DB 1UXWA 2JJSA 3LRSA 1UGNA 4DW2L 3MLYH 4HGWB 4R7NB 3IETA 4GRWE 3OWEA 5D70H 1XGPB 2JTDA 5DZOA 3NFSH 2J88H 1FZKB 3BEVB 5EU5A 2BMKB 1TITA 2OI9C 2IMMA 4O58H 1N0XH 3V8OA 3TVMD 2UYLB 1I7RB 4PRHB 5HDQH 1T0PB 4EN3C 4ZYKB 1JHTA 5C71A 3DETC 4NKOA 3ZE1E 3PP3K 3U4BL 2BVOB 3RDTA 3HC3H 4IIQB 1KB5H 3UZEA 4Z7NF 3HLAB 4RIRA 5D8JL 5EU3B 3OR6A 1FG2A 1RVFL 3AXLA 4FQ2H 4D0CA 2DLGA 2CDEB 1X5AA 4G8FB 1JYXA 3V4VL 5FYKL 4DGIH 3WL9B 2ARJQ 4A2MA 5HHPA 2EE6A 3C5SA 5C86A 3H3KA 2H32B 1T1WB 1YEHL 4NQVA 3MV7B 3A67H 3U0TB 2H1PH 1SBSH 5EBMB 2XWJB 3L7EA 3CFEA 5HVWA 4NBXB 4JJHA 2WNGA 1Y6KR 1MAJA 1JZ5A 3N85L 4XVSH 2QLVB 2VERN 3EFFA 3TO4D 3T8XA 3EFDH 1R3LB 1MIEH 1U92B 2FHFA 3MV7E 2ORBL 4HWNA 4XCCL 2JIXA 4X6EB 1KJ2A 1HHGA 1S7QB 3MUZ1 3LKQB 4CMHC 4OZIA 4OZFH 5HGAA 3T65B 1G7LA 4XBGA 3B4NA 2FECI 4KKBD 2YK1L 4OCRH 4EKXA 1XR9A 5HBBA 2HVJA 1YEGL 1J1PL 3RJDA 1OAYL 3RU8L 2OJZH 1KYOK 1UJ3B 5DC4B 3F12B 5IVZB 3BD3A 3C6LD 4EXKA 2YHGA 4IDLA 1YUHA 1QYGH 2X10A 4RFOL 4KJWD 3HZKA 1RZIA 3CVHL 4XZUB 2PKDA 3BZ4A 3EZ8A 2Y07H 2HFFA 5INDB 4LVHC 2VJXA 5I30L 4D9RE 1LD9B 2CLZB 4KUCD 4D9QE 4PGDB 4RWYH 5EUOF 4HWEL 2VQ1A 1I7ZA 5IROA 1KYOJ 4OGZA 5IJKA 3JV0A 3RIFK 1YNTA 1I3VA 4NQCA 4G42A 2VR9A 1D9KA 3HI1A 4JPVL 3W9EB 1DP0A 3CPLA 3MRMB 3DVFA 4ZFZB 2YXMA 4Z95H 4GXUN 3FT2B 2AW2A 2C4FU 1WT5A 1FNGA 4NDMA 3KXFD 3R06A 5EZIL 4KHTH 1S7RA 3F7RA 3IJHA 3TO4B 5ID0B 5C0EA 5EBWB 3LEXA 4Z0XB 1X4YA 4ODVL 5HGDB 1W8NA 5KSUB 1ZLVK 3ULUL 4JHWL 4XBEH 4U1HB 3HE6C 1KEGH 4Z8FH 4BQBA 1IRAY 3TCLA 1JWSA 3OAZH 3AVEA 2X9XA 5EH1A 3V6OE 1D5XA 5IW3A 1RZGB 2BCKB 3C6LB 4MJIA 3DSNA 3FTGB 4NFCA 3UDWC 1QTYT 3VXTB 4FXKB 2J4WH 2X4NB 1XGYH 2O61A 4U3XA 2W0FB 3QUXA 5EO9B 5CHNB 2FCBA 5CZKA 4Z0BH 2GAZA 5ETUB 5FYKE 2H8PB 2DDQH 5I1JL 1IC5L 5C08A 2FWOA 5INCB 3O4OB 3ZYIA 2C3VA 5DUML 5JW4Q 3AAZA 5GGSB 4FZ8H 4X7DC 5HYQB 3OJDB 1MH5B 4O9HL 3TT1L 3U36B 3MRPB 3NTCH 4P46A 4QHLB 4HDIB 1W0WB 4I4WB 4IRJC 4TPRH 3TBTA 4U2ZA 5F7YC 3DXAA 1MEXH 2BHUA 5CZVH 4QWWD 3FT4A 1NEZA 4OT1L 1QLFA 4X6CA 3D39A 4HUVB 3MRQA 5FA4A 3JXAA 1HQ4B 5E2TH 3SCMA 4LNRB 2ZWLT 3L3KA 4HLZH 3LKPB 1S9VB 1MVUB 4L3CB 2IWGA 3CVHB 3VMOA 4QRTB 5CLWA 3FCTA 4O2EA 2CD0A 5JHLH 1IFHH 3AY4C 4CVUA 4IDJH 2PTUA 5F1SA 2W0LA 1BOGB 4HKBA 2J8UB 5MP6L 4KTDL 5FDWA 2JJVA 5CINL 4ETQB 2PO6A 4DK3A 1VHPA 5HGBA 4X7EC 1QFWI 3KXFE 1DQJB 2B4CL 4R6UA 5C0CA 3WS3B 2CLRA 3GBML 1FL5A 2J8HA 1PKOA 4OV6F 4LVNB 4Z7QF 4EDWH 1A6ZB 1IZJA 1EZVX 1MNUL 4MXWL 4P59L 3VWJC 3IYLW 4O2FB 1M71B 3CJJA 2C4FT 4YX2H 1SY6A 5D5MB 1RIHH 4JB9L 1FLTX 1E4JA 3GSNH 4NSKA 4TTDD 3GJFB 2ZCKH 5EDXA 4P2OA 1I8KA 3BSZL 4POZD 4RAVB 3QAZC 2PW1A 2H2PD 1RZKH 3AREC 3CMOH 3IDJA 4JLRB 1VKXA 2ITCB 1X6NA 3MRIB 3HI5H 5I74C 5JW5A 2VXUL 1DSFH 4H25A 5C09E 1FZMA 1G0DA 2BVUA 2A77H 4PGJA 5I1HL 1N7ML 3TBSB 2OK0L 3U4EA 1IM3B 4EVNB 3A6OA 4JGMA 4X7SH 5D5ME 4WJ5B 1MHCA 3D25A 2I07A 3BKJH 3RWJB 3BH9B 1INEL 5C2BH 5DJ0A 2IGFL 3G6AA 4LRIC 2SEBA 1KCKA 4ZO9A 1B6DA 1TZIB 3IFLL 5DJ2B 4QTIL 4KVCH 1S9YA 1PYWA 3O8XA 5DMIL 4JM2D 1QQDB 1KCLA 3MNWA 4QXTA 1VESA 4OCXL 2DM4A 2DQGH 3WFEL 4MD0A 4GAJH 3BEWB 1B2WH 2PXYC 4YR6B 3UJJH 3UBXB 4HC1H 2YC1B 4RMWA 3HS0A 1G0YR 4PJFF 3SGEI 5L7XL 2IQ9H 3BP5A 3BZEB 4CN1A 4CNIB 3MACH 3DVGB 1GZPB 4EOWL 3FB8B 1DDHB 1NGPH 1QNZH 2WUBL 2JB5H 4HHAA 3T0EC 4OCYL 2AKRA 1FORH 4W6XB 3DV6B 1LP9B 4OFYD 2FYYA 3GSXB 2NY7H 3B3IA 3EOAA 4GW1B 3MODH 4Y0GA 1X5FA 5E6YA 2EZ0D 3ZT5A 3FJTA 2V7NA 2VXQL 1IEHA 5J89A 1B9ZA 1XIWA 1CLYL 3VFSB 4Y5XC 1RUQL 4XAKE 5HHME 1CVSC 5JXEC 1M7IB 1ZS8A 4P5KB 1J0KA 1NAKL 5D7LA 5FA3A 5IFJA 2ADJA 1WC7A 2ATPB 5F88B 5IIEB 3QHFL 2H26A 1LP9E 4PJ7F 3ULSA 1BWWA 4IMKA 2AJXL 2L7UA 1QOKA 1MHPL 4PJ8A 4I13B 4NJ9H 5DEFA 1UM4H 2LABA 3QIBA 1TVDA 4MQTB 2J6EL 2HFEA 4O00A 2CQVA 3BZFA 1SJXA 3DX7B 1GAFH 5FV2A 1QPXA 1H3GA 3WHXB 1E4KA 2O5XH 3BIBX 4UT6H 1A1NA 4QRSB 1P4IH 5T5NG 2R1WB 1WCBA 1N6QH 5IJVB 3H9SD 4PLKC 3VG9C 3P73A 2FX7L 3PHQB 4C55A 1C8PA 3QH3B 3B8YA 1QKZH 4YO0A 4EUPH 4JFOA 1N6VA 3GM0A 1UA6H 2YXFA 3IFOA 2NTFB 3SE4C 1UENA 3WYRA 1XH3B 3REVA 2J8OA 1G9NL 2J5LB 5I1CL 1S8DA 4ZPTA 2BVEA 3OG4B 4JY5L 1A21A 1BIHA 2R1YA 1A9EB 1AHWA 1K5NA 1CDYA 1MWAL 3RIAF 2XQBL 4OM1H 5CD3B 5JORB 3QFJD 5HXMA 2FLRT 3FN0L 5E6ID 4O2CB 1A4JB 5DDHA 2WQ8A 1RZKC 3PWNB 4BSVA 4AIOA 3MGAA 3T4AB 2F8XC 2RGSA 4MJ2A 1MCPL 1FYTD 1ZHNA 1YDPB 2P5EE 4QEGA 6FABH 1NFKA 5D71H 1NC4A 2P8PB 1L0QA 3CUPB 4AIZA 5GGTA 3DUUA 1EHXA 1IAIM 4X9GA 1EMTH 1I4FA 5FECB 2DL2A 3OXSA 2FBJH 3S3SA 1G6RA 4JFPA 5B4MC 1N2RA 3KPMB 1VFMA 1Z5LB 4OLVL 3ZHDA 2CO7B 3JWDL 5KSAA 4M7LT 5IVXF 1JNHB 4MVBD 3X12B 1A9BB 2JK5B 5GSRB 1JFQH 2HAZA 1CWVA 5FYLL 5KSBB 3AU1B 3SE9L 2DJSA 2WLYA 4ZPVB 2C1PA 4HMDA 3TNNB 4B0MM 4GXVH 4EI5C 1LO5A 1IGIH 4CADB 1WQVT 3QA3A 5BZDB 3WIHL 3H9SB 5M95B 3JVGC 5JOFB 1GVIA 1NBZA 4HIXH 1MLBA 4L3ED 3PWPA 4G5ZL 1DZBA 3V5DB 2VDLL 3B9EA 4PJAA 3M8OH 1AQDA 3AGVA 1BM3L 2ZNWA 2EH8H 4MD4B 1GRWA 3CCHB 3PWLB 3RBGA 4YDLC 4FABH 4OLUH 1KLFA 2HFTA 3IDXH 5T1MB 2VLRA 4LVEA 5JIPA 4FP8L 3H9SE 1QSFA 2FZ3A 1SJVA 1MCWW 2X1PA 3QFJB 5DRWB 4QXGH 2E9BA 3WLBB 4BZ2L 5E6IB 5C3TA 1GZQB 3SDAA 3I6GA 3S35L 1AI1L 4G6JH 4BFIA 5IHZB 1EEYA 1NPUA 4OZ4A 1AFVL 2ED8A 4WW2C 4N8VG 3ZKXB 3U48A 1FYTB 2Y9RT 5BW7A 2XI9A 4XP5H 4JGJA 3DSFH 3V95A 4NKMA 3S5LB 4M7ZB 4S1DD 5BOPA 5T1KA 5DJZB 1UYWL 3MSPA 1U2CA 1CICC 5JQHC 5TGBB 2Q86B 4JFHD 4YXHH 4HUKB 15C8L 1BVLA 2NXYC 3AMKA 1OAUH 3U2SB 4KV5E 3SKOB 2XRAH 1FYTE 4NUJA 4JKLA 4XX1G 4X98B 4ZD3L 1DQLH 3JV4A 4MB3A 1IBGH 2NY4B 1UVQA 4JPWL 4U1MB 4LLVA 1IMHC 3EOBB 5GPRA 1YEFL 4PR5B 1NDGB 1WIPA 4PTTA 3GB7A 4UINL 2EH7L 4L3EB 2EXWD 4R7DB 3L5JA 3AC0A 5DEGA 1RAMA 2XWTB 1FV1B 1RI8A 4AH2B 5LAXA 3UPRA 1EH9A 4I18B 4X5XB 4XCYB 3BFOA 5IEKB 4YUEL 3N1GC 4TUKL 2FEEL 4Z7WB 3EGSB 5LGHL 5LG1A 1A3LH 1CFBA 2P48B 5J1TC 1OVZA 1TFHA 5CMAA 3PUCA 1R0AH 3QI9A 3ARFC 4OCNC 2NXZC 4Y4FA 1SBBA 4P57A 1KUMA 3QP3A 1QACA 1U8OB 2ZG3A 3L9RB 2VLJD 4JN1L 1UB5B 3RL1A 8FABB 5FOBA 4QHNB 5KJRL 2VDOL 3FONA 5LQBL 3STZB 4JQVC 2LAGB 4P2RA 5E70A 4WGWB 5DJXA 1GGUA 5I6XC 4Z7WE 5FCUH 2EDEA 2VH5H 1JNNL 4MJ5A 3LQAH 3QUZA 1QO3A 5I1AB 2J2ZA 5I19H 2DLFH 2R0WH 5HY9B 1NCDL 4KJYB 2ED9A 2GTWA 1OW0A 4OLWL 3KYNA 3RKDC 4CN4A 1ETZA 3I75B 4U05A 2AK4E 4H5SB 5IUSA 4RGOH 4URTB 5HHXL 3QNYA 1NCWL 5DMGC 5DUBB 4ETYA 3BKMH 1CLZL 1DQTA 1LK3H 5D93C 1T6WA 1X4XA 3EO0B 4QHUB 5FYLE 3F7VB 5K59E 1YJDL 3C9NB 4NC2B 4G7VL 4WO4D 3BWAA 4NJAH 4PD4K 4YPGB 4NHCL 3REWA 2K7PA 5L2KA 4ONGL 3LH2L 3RWGB 3SQOH 4TULL 3PGDA 1I1YA 4N0YL 1OSZA 5D2NC 4O02L 1KT2A 4FRWA 5DD6B 2CIKB 1UH3A 4GBXA 4D0BA 3DVNB 1Q72H 1RSFA 2PR4L 4M5YH 4JFHE 1T1YA 1F90L 1FN4B 5LXGL 4YHNA 5SX4H 4DWHA 3LDBB 3GK8L 3KYOB 3TZVD 1UEMA 5DRNB 5JMRA 4NGHL 3MLZH 3Q48A 4YGAB 2Y5TB 5SWZA 4UTAL 1F3JA 1JPGB 2JCCB 2YN3A 3TN0D 2DQIL 2DLHA 4LPXA 4YDKL 4GH7B 2GQHA 4ODSL 4LQ1A 2ITDB 2HJKB 3FFDB 3RGVC 1XT5A 5HHOA 5ILTH 4KQ3L 1SMAA 2EDHA 1ODAA 3OB0K 2APTA 3ZE2E 4JO1H 2VLJB 1SEBA 2HKHH 4HPYH 4JO4H 3KDMA 3BO8B 3FO1A 4JFED 3D69A 1R3KA 1U8JB 3OKEB 5EOCL 3JTSB 1XR8B 3TYGL 4R3SB 2BNRD 1CGYA 2QQNL 1ULVA 3BVNA 1W72H 3GMOB 1FFRA 1OOAA 1N5AB 5ENWA 2B7DT 5CEZL 1K8IA 3WO3B 5ESVA 4OV5A 4HJGA 2VLJE 1NFIB 1S5HB 5JLZB 1BQLL 1INQA 1NMCC 4H1LG 2HH0H 3VFGH 5DVLA 4RDQF 4R4BA 3M1BB 2P46B 3JWNC 4N9OB 3W0WB 2F9BT 2E8YA 5JPMB 4N0FB 4XMLL 4DEPB 2V2TA 4GMSH 1DFBH 3SE3C 4QLRA 4AT6B 1JWUB 3W81A 5DQ9A 5DUPL 3IRZA 1CL7I 1I8MB 1KJ2L 2QSQA 3UP1A 5ADPL 3LY6A 1UT9A 3MJ9A 3GMNA 1VEPA 2F5AH 3VWKA 4M9PA 5ISZB 5MEND 1RPQA 1QVOA 1OAKL 3TZVB 1TVBB 2UWEA 5FO7A 4G6FD 5DT1L 3ILQD 4K3EL 4PJCA 3LPGA 5CZXD 5DJCB 3TN0B 4LPYA 1DLFH 3TCXA 3EOTH 3FQRA 5D72H 3MZTA 5K9KB 2W65B 5SWQA 4GRWF 3MO1B 4FQIH 2X4SA 4WHYG 3AM8C 1EHLL 1DBKH 1FH5H 5I17A 4JJ5A 2ED7A 3F7QA 3ZE1F 3U4AA 2IPKA 4JFEB 3KNBA 2DYPA 4K9EC 2VSDA 5IW1A 2BNRB 5CKAA 4N9GA 1UG9A 3PDDA 5CUSH 3FO0H 4XNXL 3MOAH 5A2KH 1T3FB 2WIIA 1FO0A 3C2AH 4JFDA 3K3QA 1QD0A 3UYRL 1SEQL 5JA9A 2MTPA 1UXWB 4M43L 2DMKA 3LRSB 2ZUWA 5T3XH 1L7TH 4HCRA 4P4RA 3GI8L 2QSVA 5DI8B 3IETB 2D03L 3RTQA 3FB6B 4CUCA 1TETL 3QPQC 4JFEE 1J1OL 3UJIL 2GSGB 3MNZA 1LO2H 2Z35B 3KWWA 2VNCA 3QO0B 3U1SH 2BNRE 1EEQA 5AYUH 2CDGA 4LP5A 1FJ1B 1P7KB 3MJ8A 4KGJA 1MIML 2F53D 4P3CH 3CZFB 2KQNA 4MA7L 1FG2B 3DIFA 3LS5L 2AVGA 4PRDA 5LWYL 5SX5K 4K71B 3IAQA 1ZT1A 1DE4A 5DD3L 5IB5B 2FD6H 3C5SB 1HHIA 4L8BB 5MENB 4R4NC 1JRHI 3C8HA 2OXHA 3Q6GH 4HIIB 3MRHA 3MA7B 2OJEA 4NQCD 3HC4L 3A6CH 1BFOA 4Y5YB 4J4PA 4NQVB 4OSUH 2GT9A 4HS3A 4I3RH 3TBYB 2CMRH 4U1SA 2NY5L 1I9EA 5DJDA 4ZQKA 3DI2B 2YZ1A 2AEQH 3L7EB 4LSSH 2VIRB 1CGSL 2OL3A 4XP9H 4HG4K 1T0MA 4ZODA 3BYYA 5BJTA 1MCKA 1XAUA 3P40A 1N59B 3ZE0E 2JE8A 5I1GL 3QO1A 5E1HB 3T8XB 1V3MA 4JFQB 1EXUA 2GFBA 2JJTA 3CIQA 3MBED 1KJ2B 3HZYA 4LLDA 4R2GC 4RRPG 4OZIB 3MV9D 4Z9KB 1NLDH 1FRGH 5DHXB 1G7LB 4XBGB 4PGBB 2LAAA 1JGVH 3DROB 1XR9B 3DRQA 3KYKL 4RWHA 2HVJB 4GKNB 4WVRA 1CFQB 4KMLB 2V9RA 1KC5L 4PRIA 1QBML 2X4RA 3NN8A 1TCRA 1U8PA 3SOBH 3X14B 1BIIB 5BXFA 1NCUA 2XG5A 4ZUSB 2HG5A 1A6VL 5DF0A 3FAXA 4HH9A 4KDVA 2Q3AA 3RGHA 5DHVA 3CH1B 4OZIE 2ZCLL 5ALCH 1KIPA 2HFFB 4AK1A 1MPAH 2F53B 2XFXA 2YRLA 3OJMB 5FGSA 4YQXL 1KJVA 2NR6C 4N8VA 3NA9L 4FQJH 3O6FA 2DKMA 5C08D 2R23B 4MSWA 3INUL 2VQ1B 3F58L 1I7ZB 2VWEE 3LQZA 3HTLX 4QY8A 2C3GA 1JNJA 1IC1A 4LGSB 1F8TH 1QHPA 5TE4H 3ZMRA 4NQCB 4CMMA 1A6TB 1KCUL 3O9WC 3HI1B 1K2DA 5I73B 5IMMB 5J12C 3MYZA 4MA3B 3DXAD 3CPLB 1MQKH 5FUCE 1EPFA 3WO4C 2Y23A 3VW3L 4Q6IC 4ZS6D 4ZFOB 3ULUC 2YUXA 5CJXC 1SY6L 4JY4B 5GJSH 3IJYB 4NNPL 4NQCE 4Q97A 3QIWA 1JF5A 1MCOH 2WBWB 3RWCA 1MY5A 4D0DA 1HK6A 4CW1B 2LV4A 1HINH 1S7WA 3MBEB 2ZKHL 4HWBA 4L29A 4M1DL 2VITA 4OLEA 3PWVB 5DJAA 5FYKU 3DX6A 3MV9B 3OKOB 4CU6A 5JW4N 4YBLB 4PJ9C 1CD8A 3L5XL 3MMEA 1LE9B 1AGFB 3RVUC 4HSQA 3VH8G 2CRZA 3K1KC 1JWSB 4ZFGH 5DA4A 5K9QG 1D5XB 2W9EL 4IEFB 3T3PE 1IGFH 1WTLA 3HNTH 3QDJA 1DBJL 2FEDC 4OD3H 4OGXL 2RQ8A 3VG0L 1RUKL 1J8KA 4K8RH 1JBJA 4GRLD 2GAZB 2OSLA 3U7AA 1S7TA 1DVFA 3S36L 2YD7A 1GC1C 3NFNB 5I15H 2BY0A 1ZKAA 1ACZA 1O0VA 1U93A 2X4PB 2FWOB 4JO2H 4MNQA 4OZGB 5C08B 2W9DH 5C0AD 4RA3A 4P2OD 1CBVH 4YBQC 4JN2A 3TJEH 1RMFL 4MJIE 1Q9LB 2AV1A 3I2CL 3ARBD 4S1SH 3Q3GB 3TBTB 2KBGA 1UCTA 5F96H 5IKCA 3DXAB 3QWQB 4Y89A 4NZTH 2UUDH 3HMXA 4TNWF 2H2SC 4KROB 4YHZL 2WLZA 1NEZB 1TZHB 4X6CB 1ZXQA 3L3OB 4HUXA 5FA4B 3VI3E 5C08E 1S9KC 4P9ML 3EAKA 4P23D 3VFTB 1NGWA 5C9JA 2YRZA 3L3KB 4XTRC 4LCYA 4XMPL 3O8XD 1JF6A 1Q8MA 2CK2A 5HDOA 5IGXH 4EBQH 4GRMB 3EYFA 3GSOA 4M6NH 5FUZH 3BDXA 3DXAE 4EJ1C 4OZFG 4HKBB 1YA5A 5TDPA 4XPFL 1P2CA 2LQRA 4P2QD 4PV8A 4X6CE 3D39E 3HG1B 5B3NA 1ONQA 4DQOH 4HS8L 3O2WH 1S9WB 1FL5B 3BE1L 3WLWC 5DR5H 2FX8H 4YC2C 3GSVA 4LSTL 4RGMB 2NY0D 4MLIA 12E8H 1HQRA 1BBDH 1HIMH 4OLXH 5A43C 3NZ8A 5JUEH 2WBJD 2YPLD 4WCYH 4Z76B 1YEKH 5HYSG 1H3PL 5IR1A 2IBGA 2FNBA 2IJ0C 4DOHB 5D5MF 5KS9A 1GGIL 3SBWC 1TJGH 4NKIH 3RZCC 4GRLB 5J6GA 4PLNC 1E28A 3HNVL 1YC7A 4J3UA 5EBGA 5T3ZL 4IJ3C 2A6KA 2JELL 3VD3A 3X13B 5IV2A 4UV7L 4J7RA 3D2UA 4DCQA 1A14L 5C0AB 5I66B 2BY1A 4PJ5A 5D96B 2E7LA 4PG9B 4NWTL 4P2OB 1ES0B 3KPSA 4M3KB 4FXLA 2X5PA 4XNUL 4XWGH 1LDPH 1I9RH 1JGUL 3ARBB 3QEHB 3NCYS 5JW5B 3QCUL 4H25B 5FYJL 4N0CC 5TDNA 3GBNH 4H1LA 4IOFD 4O4YH 4DOHE 4PJ8D 1WWAX 4OD1L 3ROOA 4K23H 3TIEA 1XGUA 1FSKB 1N6UA 1U58A 3QIBD 4DJMA 4W68A 3VD7A 1MHCB 3D25B 2I07B 4JM4H 4NO5B 3C5ZD 4JKKA 4MMXC 5DJ0B 2ICWJ 4P23B 4KUZL 5L6YH 2VRAA 2Z93B 3WBDA 3O8XB 4KZEL 3O2DH 5I1IH 4QXTB 3MNWB 4PLJC 1EVTC 1NC2A 4QRUA 4WU5B 4MD0B 1DJSA 5GGTL 5ID1B 1A7OH 1NFDA 1GGBL 3T1FB 1DLHA 1EUTA 1N64H 4TSCH 4M6OL 1TQBB 1G6RL 4XPBH 4P2QB 1LEIA 3BQUB 3VA6A 1AD9B 2FJFB 5ICXA 3LMJH 4H26A 4WUUA 4OZHB 4C83A 3BP5B 4DAGL 4OTXL 1S7XA 3MLPA 4K8RC 3PNWB 2NY0B 1LP9F 2E7HA 2DQFB 5C0BD 3QULA 4GS7C 5FYJD 2CXKA 1NCTA 1HZHH 1M7XA 2W38A 3ARGA 43C9A 2WBJB 2YPLB 1Y0LA 1HSAA 2FYYB 4LQFL 3ZT6A 2CKBB 4BJLA 5E99H 4P2QE 3C60A 5BVPL 5EA0H 2YMXL 3TPKA 5J6HA 3IFPA 3L3JB 2DQTL 1UZ8A 3CSBA 1VFBB 3MOBH 3OKMB 5D7JD 1P5UA 4FFWD 5FA3B 5F72S 5IFJB 1V7NH 1ZT7A 1PW3A 4QRPA 3QIUC 4FQPA 2H26B 1WEJL 4WTZA 3QEQD 5IQ9B 5SWSA 5H2BA 1BBJB 4PJ8B 3CU7A 3BKYH 4JHBA 2VXVL 3GHBH 1CGWA 3VFOA 4K3DL 4I9WE 2CGRH 5CILH 3C5ZB 3MLSL 5GS0L 3BZFB 4WHDA 4JM2F 4N8PA 4PY7B 3VGAC 5D7LE 1UWGH 4EN3A 3RWHA 2Y06L 3DGGA 4LIQH 4X7CC 5A40E 3BX7C 3HAEG 3D6GA 3PIQB 2C3HA 3P73B 4G6AD 1QFUL 3MA9H 5B8CC 3PWPD 3BMWA 5D7SL 3IDIB 4YO0B 4EI6A 2EDQA 5J8OA 4CDGC 3Q1SL 3CFKA 3PG2A 4NZUH 3REVB 3TGXA 4ZPTB 3R0MA 1I1CA 2XXMB 1A7QH 3HUJA 5IT2L 5I71C 1YEDB 4G8GA 5C0BB 2XYCA 4AIXA 3LHPH 4JR9L 5ANMA 4F15B 4NWUL 1FDLH 1N3NA 1QSFD 2G2RA 4OGAD 2PN5A 4ZTPL 3OAUH 5JDSB 3WKMH 4YXKL 3MLXL 43CAA 2XKNA 5DDHB 1NCCL 1CF8L 2EDJA 1A4KA 1RD6A 3MLRH 4BSVB 2I60H 3IDNA 2WANA 5DD0H 1EAPB 3VFPA 5GGVY 2X70A 1S78D 4OIIL 5A2FA 1B4RA 3BIAX 3S8WA 4OI7A 3QNZB 3STLB 5E4EB 5D7JB 5FYJE 1Z9LA 3WUWB 1ACYL 1PKQB 1ZLSL 2XPGB 3I3DA 4MA8H 5T1KD 3SJVA 3P30L 3QEQB 5EO1B 1YY8B 2X7LA 1N2RB 1CE6B 5AZEL 4K7FB 5FO8A 1CXLA 3H6JA 3FO9B 1TIUA 1U41A 2EE2A 3BKCH 1HSBA 3VD4A 3C6SA 3C87A 4HV8A 5AAWA 1HYSD 2C1PB 1BVKB 1RK0B 4PG2C 1NH6A 25C8H 2I25N 5IVOA 3BJLA 1LO5B 3EDEA 1ORSA 4OB5L 2P8LA 5HD8D 3OX8A 4RCAA 2LE9A 3ETBF 2EDDA 5DVOA 3VFVB 3QEQE 3S6CA 3PGFH 3J8F7 3BJ91 4AJ0A 4PPTA 1KJMA 2PYFA 3QBTB 3IDMA 3TWCH 1KLUB 4LSUL 5EZLB 4MS8C 4Y4KD 4GG8B 4NQDA 1M7DB 3MR9A 1FNSL 1UWXH 2D7NA 2MPAH 4LHUG 2AI0L 2HKFH 3QI9D 3FAWA 2DQUL 3K4ZA 5I0DA 1HWHB 3VFNA 4L8DA 1ORQA 4IMLB 2VDKH 4UBDC 2YD5A 1QSFB 4NBYB 4HT1H 1QLEH 4NPYB 3PWPE 1KN4H 3GEWB 1QR1B 4XC3H 3I6GB 5E8PA 2V2XA 4KV5F 4JKPL 2FH6A 4R90H 1RHHA 5FM8A 4YDIH 2BNQA 1EEYB 4P2RD 3MBXH 4OZ4B 3FZUD 3LIZL 3K7UA 2QQLL 5C0ND 2DTML 5DJ6A 3UEZA 3FQUA 3O6MH 4WU7B 5L8KB 2V17L 4NKMB 2VLRE 1QFWM 2A6JB 3ILPB 1QSFE 2CJUL 4E42A 4YPJA 3UXFA 3WD5H 1PZ5B 3VH8A 3HE6A 4KKLC 5J1SC 2E27H 2VKXA 1P53A 4LLAA 3S34L 4M62H 3NABH 4ESKA 5FHBL 4IOIA 3LV3A 5HI3D 5T33L 3GIVA 1NGZB 1G9MH 4QKXB 4NUJB 5I8CA 5J1AB 4F9PC 3JV4B 3CDFA 5L2KD 1UVQB 5M7QA 4LLVB 3UDWA 5EU7C 2X09A 1U8IB 3V4UL 3VXQA 5FOJA 3TH3T 3G5VA 2ZPKL 4FQ1H 1OCWL 5DEGB 4Z7WF 1PSKH 3QWRD 4UT9H 3ZYJA 4YBHA 4Y4KB 2VZUA 3D18A 1HEZB 1OAZH 1MJJB 1X7QA 5SWZD 4I77L 4JEGB 3PWJA 4JFXB 3QI9B 2DBLL 1B0GB 3FB5B 1YMHB 4IRJA 3WCYA 1IGCH 5HPMA 3OSKA 1GGCH 4OFVA 2CIIB 3LN5B 5K59F 4AEEA 4HBCH 3QUMB 1U8MA 3MJ9L 3FONB 3FQNA 1HILA 4P2RB 1IQWL 1OY3B 2GK0B 5DJXB 2FR4A 3QUYD 3SGKC 4DKAA 3RA7L 5D6CA 1FCCA 1N5YH 1FNAA 3MLTA 2B2XL 3LKSA 4OZFA 4YXLH 2GTWB 1KPVB 1Z6JT 3KYNB 3MCKB 1ETZB 1J0YA 1I3RA 3DURA 4BUGA 1AO7A 3EOYG 3IDYB 1UM5L 3AY4A 1WIUA 4LVOB 2C1OA 5F7FA 3HFMH 3ALPA 4G8IA 1JYNA 3GFUA 5E00A 2I26N 3ECBA 2FECL 4P2RE 3T0BA 2AJZA 1RZ7H 1IILE 3BWAB 3MNVA 4JANA 4X5WB 5I8OL 3NCFB 5F7MC 4I2XA 5HYSA 4GOSA 5L2KB 2V9TA 1CU4L 3PGDB 1I1YB 3ZE2F 4F58H 3RNQA 1KT2B 2YD2A 1Q9KA 5CWSA 3VWJA 2XG4A 5AZ2H 3S96B 3QXWA 3MRRB 1FO0L 2B0SH 3O3DA 4WY7L 1MCFA 1OAQH 1T1YB 4EIZC 1ZA3A 2NW2B 4PJBA 3S37L 1AJ7H 4HCRL 1VGKA 4NQXA 4YHYB 3TFKC 5DURD 5SWZB 1KJ3L 4LDLB 3D1MC 1F3JB 3H9HB 5L2KE 1AGCA 3AREA 1LDSA 1Q1JH 4ONHA 5IHUL 5JXAL 1UKTA 4WW1A 1L7IL 3NCJH 1BZQK 1ROWA 1NLBL 4ENEC 3FQWA 5DEZA 2NY1C 4K2UL 3ZKMC 4NO2A 4FFVD 5HHVL 4GW4B 1OP9A 3DO7B 4CAGA 3VMPA 3H3PL 2PCPA 3U6RB 4IBLT 3FO1B 1RIUH 4ZAKC 5CIPH 5SWZE 1R3KB 4PJHA 3QUYB 4LRIA 5TF1L 2LU4A 5A1AA 3MRFB 1NANH 1J0JA 5I1EH 5IMOA 3EYQC 3X3GL 1MCHA 3EIFA 2J12B 2W91A 1KENL 2IFFH 3RRQA 4JFDD 3D9AH 1N26A 4OCWL 2XA8L 1G9MC 2PXYA 4RNRA 1QA9A 2IQAA 1INDH 1MFCL 3WIFB 1R5WB 2NW3A 3RTQD 4XNZB 1KACB 4F8TA 2A1WH 1A6PA 5E5UB 1PGRB 1YC8A 5DA0B 4R4BB 2Q7YA 3HCVB 1U36A 5DO2D 2YZ8A 1RJCA 1XGTA 5BV7B 4PJGB 4CVZA 5E08H 3T0EA 4DTGH 1WBYB 2AJVH 4HFWB 2W92A 5IEHA 1ZANH 3GMNB 5FB8B 3OZ9L 2GSIA 1EEZA 4XGZA 1L9NA 4YFEA 2R0ZH 4A6YH 4DK6A 5D1ZC 1FQ9C 3BPLC 5ELIA 1TPXC 5DURB 2AJ3A 4C56D 2V5MA 4Y5XA 2XZQL 5FO7B 1N4XH 5JXEA 2MNUA 4JDTH 4J4PD 5DK0B 2W07A 4DGVH 2F54A 3FQRB 1IEAA 3I3BA 3F65A 2F58L 2BVTA 1XMWA 3VXSA 1IARB 4FFYH 4XWOD 2AXJA 3X3FH 1CFNA 2X4SB 4I0PD 3RHWF 1RZJC 4Y4HC 5CJOH 4ORGB 1A1OA 1K6QL 2MHAA 5EBLA 3OHXA 4UT7H 5TE7L 2UWEE 2IPKB 3ARWA 5F8QC 5EZOL 5JPNB 3L6FA 2ADGB 3HAEA 4XPHH 2RBLA 4PJCE 3W39B 4U6VL 5ESQB 3MLUL 1FVDB 1UACL 3MRLA 5DJYA 2AK1L 1JUFA 3BMVA 3NH7L 1KTRL 4FQHA 4L4VD 5A2IH 3R1GL 1I1FA 4P4RB 3BPOB 5DWUL 3RTQB 3VFUB 3RL2B 3RAJL 1MAML 4KHXL 4PRID 4PJXB 3B9KD 1M05A 3MNZB 3KWWB 4U1NA 2X4TA 4U1GB 5DJ8B 2CXGA 3NFPA 1HXMB 3P0YL 1JP5A 3OGCA 4DVBB 1YQ2A 4F37K 4NN5B 1LEKA 5F7NC 4JFDE 1QEWB 3MJ8B 1KCRL 3W2DH 1IM9D 2MFNA 3DIFB 4PRDB 1S7SA 5F44A 3ZE0F 1VA9A 3U9PH 1GPOH 1DE4B 1VACA 1KTLB 3GMPB 1HHIB 4V1DA 4C56B 2FIKB 1I8LC 1RJYA 3FQTA 1EHAA 1D6VL 4N0UB 2CK0L 1RURL 4WV1C 5J3HC 5GIRA 5HYJA 4I0PB 1PZUB 3BDYH 4DN3L 3QWOA 2OL3B 3PHOA 4KKNA 5KTEH 3N1MC 5B22A 5EC2A 3TYFA 1CG9A 3TBWB 2ICEA 3ROLA 1KFAL 2QSCL 1VADA 3DMMC 2GFBB 3X17A 4OZIF 4Z77A 1J87A 2EDYA 2OTWA 4EI5A 3HR5A 3VXNA 1XF5B 4UTBL 3JVGA 3NMEA 3C5JA 4L4VB 4MD5A 3U4BH 2XQYK 3HMXL 3DRQB 4LHUA 5ITBL 2AXFB 5BQ7A 5CGYD 4E41B 4ERSH 1ZGLM 2IADB 3B9KB 4G3YL 4MCZA 1T2XA 4OIBA 2KZWA 5MEPB 3V4VH 1D5ZA 2R29H 3CSPA 1IZKA 1X5JA 2HG5B 2WSKA 4HH9B 2ADIB 4PJIB 1WV7T 1KIPB 4HX1A 1YEHH 1IM9B 2XFXB 1FL3B 3M07A 3GSWB 3E6HA 4LCUA 4UDUB 5ACMA 1AC6A 4ISVB 4MSWB 2A9NL 4PRIE 5GJTH 3CFJA 3QNXA 4WW2A 4TYUA 4MDIB 1D6EA 4KXZI 5TE6L 3F7YB 4YHML 3QXTA 4S0TD 4UB0L 4P2CG 1TXKA 5KN5B 1T1XA 3F8UB 4X6FA 3RWDA 4PJIE 4YHPB 2HMID 1JVKA 1WZKA 2F74A 2DWEB 1P7QA 4J3SA 2YPKB 5DSCA 2ORBH 4XCCH 3RUGB 3ZTNL 4HBQA 1OF2B 4P0DA 5CD5C 1EJOL 5H37H 1C08B 5C0RL 3OKDA 5EUKB 1WITA 4CDHA 3WNOA 2WUCH 1U9KA 1NCAL 3T3PF 4D3CL 5IMLA 1ERNA 1WUNT 1C7SA 1ZMYA 1JPFA 5A2JH 4LDEB 1LE5B 1F6AA 1NDMA 2IG2H 1J1PH 4EUPA 4D0DB 3CLEH 2FDBP 4GSDL 4KI5C 1S7WB 2IPTL 1ZAGA 5IHLB 2VYRE 4F80A 4WEUD 4MXQD 1BGXL 3HN3A 5KVGL 4HQQL 4Q2ZB 2JJWA 3CVHH 3O0RL 5IB2A 1KCVH 4XX1E 4LRNL 1IQDA 4Y7MA 1J5OH 5I30H 3QXUA 1UJ3C 1ZWIB 4MNGA 1JYVA 3VDBA 4LU5H 4XNYH 3D5OF 1Q94A 4WFGD 2UZIH 2PUQT 4JHAL 2A9ML 1NJ9A 5I16B 1H0DB 4NZJA 2YD3A 1AY1L 4F7TB 1WZ1H 3DX9B 1IL1B 1KCSH 4Q6YA 2D7TH 2OSLB 3VI3F 4HPOL 5BO1L 3FO2A 2D7OA 4JPVH 2CO6B 5KG9B 3MRCB 4M00A 3EO1B 3OJVC 1OQXA 1MQ8A 1U93B 3AMLA 3GSRA 4ODUB 4M6ML 4PJ5D 1NUGA 1U3HD 4U1JA 1H3WM 3KPSD 4NT6A 1GIGH 5JW4R 1W72B 3QQ9C 2ZUVA 1QFHA 4YFLF 2VDML 2AJUL 5FHAL 2HJLA 2QSTA 3GJFH 2B1AH 5DHYA 4X6CF 4NC1C 1F4HA 1F4XL 5T3XD 3VCLA 2BSRA 1MI5A 2OZ4A 3TH2T 3E1F1 1S5IH 4HUXB 5HHQA 3VGBA 3GMQA 1NGWB 4DVRH 5C9JB 3RQ3A 4LCYB 5IQ7H 3V6OC 4L5FH 4UUJB 5EPMA 5C70A 1NC2D 1RUPL 3TO4C 5GRVK 3J7HA 1AXTH 4YDVA 1OTUD 3K8MA 3GSOB 1YQVH 3QJHA 4ZSOA 2CKNA 3RVXD 5IFAH 4CN6A 1O7VA 4GXUM 4TQEL 5GGQL 2FATL 4XBPA 3P9MA 4KKBC 4LFHG 5E1AA 1ONQB 5DYOA 5FKPA 4LLUB 5GRUL 4WUUD 4F9LC 5IBTH 5L88H 4AL8L 2LU3A 4XAWH 4JQIL 3LEYL 1HQRB 2ADFL 3C6LC 5F21B 1T7XA 3OKLA 5E94A 3WUZA 2FEEI 4AYFA 1U95A 4BA8A 2ENSA 3ARGD 5DUMH 3RGVA 3VXPA 1ADQL 1C12A 4X4YA 1IAOA 2ARJB 5KS9B 1YEEL 3SDCD 1CD0A 5FK9A 5EWIH 1A3RL 3KJ4B 5IV2B 4RGNB 1EERB 4BH7A 2VLLA 4PJ5B 1U3HB 5LCVH 3KPSB 4OF7A 4XCFL 2AV7A 4WFGE 2X1XR 5F1KC 3RI5F 5TDNB 4H1LB 4UIMA 5KS9E 5SWSD 4P4KC 5EZJB 4L1DA 3IJSB 3ROOB 5AEAA 1TCMA 1XGUB 1DR9A 5HPOA 4Q58C 5E8NA 2HVKA 3D0LB 4KTDH 2Z91A 4PJ5E 3G6DL 5CINH 2RFXA 3KPSE 5ADOL 5L8LB 1NC2B 3WXWL 2XWBA 1G84A 1DN0A 3SE3A 1LILA 3U0WL 3CFDB 3L7FA 3CFCL 1T03L 4FA8A 1C5CH 4LLQA 5KVEL 1MNUH 1UWEL 3QDMA 4P59H 4YDJB 1LEIB 3U83A 5JR1L 2Q6WB 1E0OB 5ICXB 4WUUB 5A3ID 3D85D 3TV3L 2B8OT 1NKRA 2EO1A 4G8GD 1M6OA 4X8JB 4XP6H 4FQXC 3QQNA 4LVNC 2R9HC 4XHJC 1F42A 1ZHLB 3BIKA 4KVNH 1HSAB 1BFSA 3V6FB 1BZ7A 3SDCB 2ICWA 4LCIL 3P9LA 5EUOB 4TRPL 5F9OH 3AM8A 1G7MA 1N7MH 3K2UL 2MKWA 4WUUE 1IAMA 2BC4B 4AM0A 2ERJB 4PRAA 3P11H 1IVLA 5MEOB 1YN6A 1INEH 5CEYA 1ZT7B 1PX3A 3T1WA 4D2NA 2MSPA 1BQHG 1RULH 3IFLH 4JPKH 4PB0L 2HT3D 2VLKB 3LD8B 4P9HH 5DMIH 5SWSB 4OCXH 3ESUF 2BY3A 1CS6A 2QHRL 2ATKA 3RVWC 4QRQA 2X4UA 3JTTB 1V7ML 1HWGB 4JRYD 4EQ3A 3K2MC 2D31A 3I02B 2XZCH 2P42B 3DGGB 3RX5A 1FFOA 5DC9B 5SWSE 4EDXA 2YPVH 4PJEA 5D70L 2I9TB 1P4BL 2J88L 4AQOA 4OCYH 2HJFA 4E9LA 1J9CT 5CSZA 1VEOA 3CFKB 3KHQA 4O58L 1N0XL 5EO0A 4XT1C 4ZUTA 4NQDD 5HDQL 4G7YH 1HH9A 3D85B 3HUJB 4X80H 2VXQH 1KGCE 1KB5L 4NYLA 3SDXA 3PJSB 3EYUL 1JN6A 1RUQH 5ANMB 2FH8A 4FQ2L 5DTFA 2Q8AH 1NAKH 4KKAC 1LK2A 3JZ7A 2Y4SA 4BK5A 1A4KB 4XCEA 3IDNB 1X5ZA 2BNQD 4FXGA 2ZZUT 1D7FA 2AJXH 4Q9RL 1MHPH 4U1KA 2OXGA 1H5BA 4TTDC 3RWFB 3IFNL 3HUJE 5T1DH 5DQJA 2AERT 2UZYB 4EZMA 2VAAA 3RP1A 4G8GE 4LKCA 1KIQA 2J6EH 1SBSL 2VL5A 4RFNB 2H2PC 1WFUA 2W60A 1WWBX 3QPXL 3VFMB 5ANME 4QHKI 3GRWA 4JPIA 1UQSB 1F6LL 4FFZH 4CMHB 4XVSL 1BHGA 1WK0A 3BUYB 4IOSD 4QCIA 1H3TA 5FO8B 5LJYH 4FMFA 2Q3ZA 3EFDL 4DUWA 2I5YL 2VISB 2PTVA 4JRYB 1G7PB 2DKUA 4HV8B 1MCEA 4ZOBA 1G9NH 1NMBH 2P1YA 4Y2OA 1ORSB 1SVCP 2P8LB 1DBAL 3DTXA 5CJQL 3SJVE 3SGDH 1WF5A 4XI5D 4XNQA 1ZGLB 4HS6A 2VSCA 1MWAH 2XQBH 5IG7A 4LVHB 3SDDD 2R4RH 3UCRA 4WFFD 1ZA6B 3BUTA 4RQQB 2HLAB 3PABB 3FN0H 3CFBB 4NQDB 4GG6B 2J5LC 1QYGL 4TSBH 5CP7A 1SJEB 4ZTOL 4TSAH 1D3CA 3O9WA 4PV9A 3QXAA 4L8DB 1T5WB 2Y07L 4Q9CA 2FGZA 4PYGA 5EORL 5FGBC 1V3KA 4RWYL 1ZLWH 3AS3A 4ZO7A 1VENA 3JSSA 4LL9A 1MF2L 2EZ0C 5CJXA 2A83A 4NQDE 4GG6E 4LEXL 4F7PA 4OLVH 5DJ6B 3FQUB 2OMBA 4P9HC 1PFCA 3EDKA 1FL6A 2K9UA 5C8JB 3GSQA 4HMEA 1REIA 3Q5TA 2Z92A 3HPLB 1AO7D 1KIUA 4PRPD 3SE9H 4Z95L 3TH4T 3TT3H 4E42B 3ARQA 4R97B 1P1ZB 3GNMH 2VZOA 3VH8B 1BVZA 3SKNB 2YN5A 1NL0H 2R4SH 4KHTL 5F7EH 3ET9F 5E24E 3WIHH 4R96B 5IK3B 1P6FA 2BNQE 3HI6L 3LV3B 4FQCL 3GIVB 4G5ZH 1MFBH 4R0LA 4DN4H 5HHNA 5I8CB 3HZVA 4X7TA 1BM3H 4RFEB 4XBEL 3EYVB 2PYEA 1RUML 2APWA 3JV6A 3VWJD 4PJDA 3K8LA 3NACL 4Z8FL 3G5VB 4HUWB 1OP5K 3L3GB 2XQYG 1I7TB 1BEYL 1UXSA 4PJFB 5B39G 3SDDB 4FP8H 1CQKA 4OCMC 3JBG7 1CD1B 3BGAA 2V5TA 3VFRA 4RAUA 2QEJA 2FRGP 3OKNB 3PWJB 1F4WL 2HWZL 5KW9H 3ARED 1CD9B 1CDUA 1AFVH 4JO3H 1MJUH 3ZKND 2X4OA 1NAMB 3L3IB 3CFIC 5HPMB 4POUB 3AB0B 1C5DB 4LCWD 5C0GA 5E6IC 4WFFE 1YEJH 3KPOB 3O4LA 2FR4B 4FZ8L 2HTLD 2IPUG 4UDTB 1B4JL 3ELAT 4HIHB 4TPRL 4HK0A 3LKSB 3OTTA 4AG4H 1NBVL 3CXHJ 1MEXL 2YWYA 1AO7B 1A5FH 4PRPB 5CZVL 1KB9K 1K8DA 4M7ZC 5DMKA 3FOLA 3MV8D 1K85A 4JPWH 35C8H 1A7RH 4JFYB 5E2TL 1YEFH 1CDJA 2X89A 4UINH 1A1MB 4MVBC 4JANB 1LO0L 3UTQA 2C3XA 3QG6A 5ESAA 3ULVC 4LLWA 1IFHL 4IDJL 4YUEH 3MCLL 2NY4C 1X6LA 4JRWA 1HDMA 1PY9A 3ZHLA 5HYEA 1AO7E 5DZLA 3T0ED 4PRPE 5BS0D 1Q9KB 3VWJB 5GS1A 1KB9J 4YHIA 2FB4H 4JVUA 3ARSA 5I1DA 1MUJB 2FJHA 4P5MA 2V7HA 5F9JA 3SBWA 3U30B 3RZCA 3O3DB 3WEXA 1ZA3B 4PJBB 1VGKB 4S1QH 2EKSA 4I18C 4QT5B 1G1CA 3NCBB 1XF3A 1A7NH 4I2XE 5KJRH 3GMRB 5LQBH 1AGCB 1RUAH 2OR9H 3W11C 4ONHB 4NN6B 1JGDA 1JV5A 4YX2L 1JNNH 2DB8A 3VXSD 5GRYA 2XOTA 4PTUA 5JA8B 3CSGA 3R8BB 2L7JA 4PFEA 1RIHL 1OQOA 1NCDH 4KY1H 4LCWB 1FNHA 4BQ8A 3BD4A 3GSNL 5GS2D 2ZCKL 4PJBE 4OIAA 1KV3A 3V0VB 3IU4H 4O5LH 2AABL 1RZKL 3MUHL 4KMQA 2IF7A 5GGRA 3EYSH 1NCWH 1LNUB 1CLZH 1E4XH 4MAUH 4G8EB 5D1QA 3MGTB 4YE4L 5DVMA 5EC1A 2J7LA 4PLKD 1BZ9A 4X4MA 4Y2DB 3ARXA 4GKZB 4XP4H 3ZHKA 3P2TA 5KZCD 3KPLB 1YPZA 2QADD 2KKQA 3BHBA 3MV8B 5IVXB 1PQZB 2IQAB 2Z9TA 4TULH 3BOVA 3BKJL 3HE7D 4N0YH 5JO5B 5E8OB 5C2BL 4HZLA 1HH6A 3ABZA 1WWWX 2HN7A 2HRLA 3WFBH 1NGQL 2PR4H 3V2AR 4NC0B 1G9EA 3CU1A 4LSVH 2V6HA 1NEUA 1F90H 2DQGL 5IB1B 2AQ3A 1F97A 4NGHH 3UJJL 4Y16A 5F71A 5BS0B 3BP4A 1SQ2N 2DQIH 2X41A 3MV8E 1JGEA 4YDKH 2V5SA 5IEHB 1FVEA 3K1DA 1EEZB 3NA4A 1JPSL 2A38A 2UWEF 2IQ9L 4KMTH 3GMLB 3V9FA 2EXWC 4HJ0C 4GKSA 4PJCF 4V1DD 2IH1B 4Q9QL 3UTTD 5EIIB 4ORZC 5IB4B 2R2BA 1NGPL 4BQ6A 1QNZL 2W59A 1BQHA 1NQBA 2DQHL 4ZUWB 4GQPH 4X0KA 3WJLC 4WHCA 1FORL 2Q7NA 4RSVA 3GKWL 5LKNA 3HC0A 4OBRA 5BVJA 1PLGL 3D3VD 2NY7L 1RFDL 3T0EE 3MODL 3QIUA 5I75B 1AC0A 3TYGH 3LN4B 5HYJD 2CDFA 3HRPA 3P77A 5B4MD 4HKXA 5J7CC 4NFDA 5T5NF 3TBVB 3OBAA 1T4KA 4XB7A 5EOQL 5CCKL 4NCC1 3HAEB 4OLZH 3CXDH 1BQLH 1E4WL 4LSQL 3MQIA 3SQBA 4Z5RA 3H0TB 4WWKD 1JNLH 5DJYB 1FZJA 2F54E 4PLOB 4EI5D 1F4YH 3WNNA 3VXSE 2VB5A 5KZCB 1UM4L 4FQHB 5FKAA 5F9WC 5B8CA 2P7TA 2EC9U 1VDGA 2QADB 4XMLH 1KIRA 1ZSDA 3HE7B 1FNFA 4LHUD 1FLRH 3VD5A 3CMGA 4OKVB 1GAFL 3PDOA 1KJ2H 3G6JA 5ADPH 1M05B 4UT6L 5FFLA 1Y18A 2IANA 2FX9H 1P4IL 3TNMB 4R26L 5FF6A 5MHSD 1N6QL 3HRZA 1ZT4A 3C8KA 1OAKH 3OGCB 4DEPC 1QKZL 1VEMA 1ZOXA 1VPOH 2Z31B 3LB6D 1LEKB 5DT1H 1UKQA 3ARDD 5F7UA 4KFZC 1T21A 4GMTH 4P99A 4UOW0 5EOTA 1S7SB 1J1XL 4HEPG 5IOPA 4WEBH 3MV11 3IGAA 5DK2B 1EJ6A 2C7UA 2XNAA 3UTTB 3TZVC 1EHLH 3IU3A 1RJYB 4OM1L 3FQTB 4JZNA 3EO9H 3TN0C 2B20A 3RZWA 3D3VB 2DQJL 3T77A 1P7QD 5HYJB 3Q5YA 1QLRB 4K07A 3WN5A 2XN9B 2RCSL 6FABL 4PJ7A 1O5DT 3UYRH 1SEQH 4FZEH 4V1DE 3QJFA 3G5ZB 3MJ7A 4OCSH 3V5KA 2D03H 3C08L 4LSRH 1EMTL 1VADB 5C0DB 1ZLUK 1NGYB 4WWKB 4PG2A 1B0WA 4Z77B 1BD2A 2FBJL 4P2YA 4EI5B 5C2UB 3C09B 3V6ZA 4UILH 3HNSH 4M02A 4JZOB 5HYJE 2QR0A 3M17B 3OAYH 3ZTJH 2FHCA 4HAFA 3KPRA 1DQDH 4LHUB 3VXRD 4ELKB 2OZ4L 1MIMH 3DUSA 2B5IB 4DZBB 3UZVB 4YAQB 3V0AC 4PIRF 5LWYH 4BQ9A 3N0PB 1D5ZB 3QCVH 4PJIF 3MJGX 4HIXL 4CKVX 1CVRA 2R56L 4U6XA 1CXEA 5FM5O 3ARDB 3M8OL 4HX1B 2ARWA 2EH8L 3E6HB 5HJ3A 1TVHB 1V05A 4LCUB 4M6AA 2NY5H 3QXDA 3U7YL 4K71C 2P5WA 5EFIB 4FABL 3MUGA 2DQCH 4WW2B 3EJYD 4Z18A 1D6EB 4M48H 2VN4A 1CGSH 5MHSE 2JB6A 4X4XA 2GW5A 1JF1A 3ILQC 4UMGA 2ZUTA 4Y5YC 5CZXC 4QXGL 2IALA 3ZT7A 1T1XB 3RKDD 2BNUA 2E6JA 1U3ZA 3BZDA 3OKKB 3P4MB 4G6JL 2BSTB 4J23A 2F74B 1P7QB 5B38B 5I8EA 3VDCA 1MI5D 5BMFH 3EYOA 1Q9OB 4OJFL 1KELH 3G9AB 4Y1AA 2OMNA 4APQB 4PY8J 2E6QA 1L4IA 1MCIA 4HUMB 1E6JH 3GKZA 1U3YA 4NQTA 3DSFL 5IMLB 4ZOCA 1JPFB 3KYKH 2O5ZH 4F9PA 2BOCB 1NDMB 1EGJH 1QBMH 5DRXA 1AIFA 4WNQA 5B39A 4QOKA 5DS8B 3MROB 3A6BH 3MRDA 3DUHA 4YXHL 2P24A 3P4NA 5FGCB 1A6VH 2K7QA 1OAUL 3MTRA 3ORJA 3S3PA 1FG9C 2XRAL 3IKCA 5LBSH 3UTOA 3G5YA 5KVFL 3VXRB 2ZCLH 1IBGL 4QYOB 3PL6D 1K4CA 1RY7B 2VWEC 4MNGB 4K3JL 2B1HH 1FBIL 2XTJC 3INUH 1Q94B 5EB9A 2XIDA 1NJ9B 3QG7L 1Q0YH 2Q20A 1U8QA 2DMCA 5ACZA 3RIFF 4WFED 3BPCA 4J6RH 3KYMB 1WSST 3B6SB 5LGJA 3VW3H 1MFEL 4U1JB 3BW9B 2GTZB 5IROC 4L8SC 1OTTC 2QHLA 4MNGE 3SGKA 2ICCA 3GSUA 3V5HB 4LEOA 4FQQA 1GOGA 1C16A 1XGRA 3PXHA 4GRWB 1EEUA 2Y6SD 5I73C 5GRJH 3GGWA 2YRPA 4DUVA 5GSVA 3V8CA 1NSNL 1K4DA 5FCUL 2ZKHH 2ZSWA 2VH5L 1L0XA 3SO3B 4NNXA 1OM3L 5HHQB 2WQRA 4XXDB 3GIZH 2DLFL 2R0WL 1I1AA 4DKFL 4D9RD 1U8KA 4HW6A 1V3LA 4K9EL 3ZLQC 3IXTA 4D9QD 1OSPL 4XCNA 4RGOL 3MBEC 4ZSOB 3UYPA 1ZVSA 3BKML 3DRTB 3T4YA 1R3HB 4YBLC 1MI5E 1RJLB 4NJAL 3P9MB 4LCCB 4AENB 4A6YB 1DBJH 3WFHA 1RUKH 1DEEA 3TO2B 4XVTH 5BRZA 4LARH 3VE0A 1IGJA 4F3FA 3PL6B 3S36H 5I1LA 4HFUL 2CR6A 2EDOA 4QXUH 4XXCC 4NQUA 5EN2B 3OKLB 5E94B 5KS9F 1U95B 3MLVL 5MERA 3VXPB 1U8NB 1KN2H 1C12B 1Q72L 4M5YL 1IAOB 5A16A 4ZSOE 2D0GA 5FK9B 5F1NB 2NY6B 4YFDB 3MLZL 4P48A 1XF4A 5C0JA 2G9HA 5F7LB 4ZAKA 5DLML 4QF1A 3GHEH 5E2VH 2CKBH 1J05B 5HGGS 3IVKB 5GZND 1Q9WA 4FTVA 1WFOA 4K94C 1ZGLP 4JO1L 4UIMB 4RZCA 5C6TH 4JO4L 1KG0A 1W2KT 2LFGA 3S4SB 4WFEE 4KROC 4UQ2B 4ZS6C 4NO0A 5E8NB 1E6OH 3QHZL 4JDVA 4JQXC 3O2VL 2RFXB 5D1XC 3O3BA 5FYKD 3QEGL 1A8JH 3ARTA 4F2MA 3VXUA 2N1KA 4K7PY 3BE1H 4MNHB 5C7XH 3PWUB 1MFNA 3L7FB 3GRWL 4BZ1H 1HOCA 3TVMB 2NNAA 3PGCA 2HH0L 4N5ED 1S7UA 5F7KC 5TH2B 3GI9L 3ALXA 1G7HB 5D1ZA 1GYAA 3N1FC 4GMSL 2EXYD 5D7IA 4NQEA 2IC2A 3H8NA 4OF3A 2JELH 4UV7H 4IHOA 4RGMC 3T2OA 1MCNA 2OTUB 5FO9B 2G5BB 1HXYB 1G1YA 3BIKB 4NWTH 3WXVH 5J0BA 2F5AL 3B2VH 4L3AA 5F6HJ 1QRNA 1BZ7B 3FT3A 4XNUH 3JWOC 4Y4HA 4RA0C 4U1IA 4GRLC 4XP1H 5FYJH 2DD8H 4MQ7B 1G7MB 5I76B 2R1XB 4HK3N 4OF5A 1DTUA 1T1ZB 1X5KA 5JQ6L 4F7MA 4WTWA 3FRPG 1P4LA 4NFBA 5D72L 3RNKB 3U7WL 1YN6B 1FP5A 2BFVL 4MLSA 4NM4H 4KUZH 3ARBC 2MQCA 3SY0B 1R5VA 1XFPA 1DBKL 2EYRA 4KZEH 2EYSA 2YD6A 1KLGB 3W5NA 4D8PA 3L3HA 3ZZ1A 2EKJA 5GGTH 1FSKC 4NRXA 5F7WC 1GGBH 2ATKB 4ZDHA 1G7JA 1ZHKB 2X4UB 4KZDH 4IRSD 3QQ4A 3NIGE 4M6OH 4P23C 2M1KA 1ED3A 1AP2B 3LPWA 1VFAB 3MOAL 3WSQL 1TLKA 4WENB 5DD5H 1CI5A 1WJ3A 4OTXH 4U6YA 1HYRC 4XPGH 1FFOB 1L7TL 5FM4A 2XZAH 2FO4A 4EDXB 4GLRI 4KH2A 1UZ6E 2HJFB 3DYOA 5EO0B 3HUJF 1LO2L 3EHBD 4Z7UA 3BQUC 4LQFH 3TIDB 4N8CL 3U1SL 5C09D 2BVPA 3L95A 5FUOH 3H7BA 1I8LA 1OB1B 2EYTB 4M61A 2FGWL 5BVPH 1UEYA 3O9WD 2CLVB 1W0VA 4P3CL 1XCQA 3QEUA 4NIKB 1JGLL 4U0RC 3SDYH 4ZOEA 2WBJC 3MFFA 4WV1A 4PJEE 3UC0H 3N06B 1LK2B 3ULUD 4KK6D 4XCEB 2FD6L 1A47A 5ICYA 3N50A 5TFSH 3MRBB 3VFWA 1GC1L 3A6CL 2H3NB 4U1KB 1H5BB 3IXAB 1CLOL 4OSUL 2EEAA 2VAAB 2ZOLB 4OAWA 3RKPA 1KIQB 2C26A 3SDXE 3MLSH 2W60B 3DMMA 4RBPK 2AEQL 5DQDH 1UC6A 3KXFB 4M3JA 4JPIB 3ARPA 4MDJA 1I75A 2R2EA 3BP6B 4XP9L 5MEQA 4IOFC 1YEIH 4PJ8C 3U0PA 1YNKH 4QCIB 3RVUD 4XC1H 2WMPA 3AROA 2RHEA 4HGWA 4R7NA 5D7SH 3C5ZC 4IRSB 3BEVA 2VKWA 3Q1SH 3WFZA 3T0DA 2UYLA 1I7RA 3P0VL 4PRHA 4ZYKA 1WICA 2X9WA 2DBJA 3SHSA 1FRGL 3DTXB 1A7PL 3OPZH 2BJML 2BVOA 3CC5B 4NO3B 4PRBA 1JGVL 4HS6B 4XAKD 5GHWH 5HHMD 1QP1A 3SGJC 5CJ8A 5C0IB 5DRZB 2GI7A 4JR9H 2Z8WC 1IEBB 2ZUQB 5EU3A 4NWUH 4WRLA 4GG6F 5D7KE 4F7CB 4G80B 1OAXL 3C2SA 4G43B 3QYCA 2DM7A 4XPTL 1IC4H 5IESL 3UPAA 1CGXA 3WL9A 5C09B 5CP7B 3MUJA 1DL7H 3OF6A 4YBQD 3QR2A 4ALAH 2H32A 1T1WA 3UTZA 3O9WB 3QXAB 5ALCL 2FJGB 1PD6A 4OIIH 4LP4A 3MV7A 1T0NA 4FQJL 4JKWA 2AJSH 4HIJA 2H2SD 1DUYA 4LGRB 1ACYH 2XWJA 4Q74A 2G5RA 3L5WA 3O4LD 5F3BB 2A83B 5C6WH 4JHZA 4F7PB 2D2OA 5AZEH 4RMQA 3RWEB 1IT9H 3GSQB 4QXWA 1MQKL 5D7JC 3QUMH 2Z92B 1R3LA 1U92A 1DUZB 4P3DB 4R8WL 4FNLL 3VDAA 4X6EA 3I6LE 1S7QA 3OAYK 3STBA 3LKQA 1T22A 3ULUE 3T65A 1I3GH 3O41A 2X89D 2PTTB 4NNYA 4R0LB 1MCOL 3HZVB 1AGEA 5AD0B 1UJ3A 4PUBL 3F12A 5IVZA 1I3UA 1FNSH 3JV6B 4YHLH 2H45A 4PJDB 2ZCHH 4G6AC 5HHMB 2P5ED 4LPTA 1AR1C 3RZCD 2ZJSH 3ARYA 4ZFGL 1G0XA 1LD9A 2CLZA 4MB5A 3LS4H 4R4FH 4RAUB 3RJQB 4PGDA 1F3RB 4JKPH 1IGFL 1HHKB 2A2QT 2IBBA 2PYEE 3LOWA 1VSCA 3HNTL 4OD3L 3QUKB 4K8RL 2QQLH 2DTMH 4GKOA 5E2UH 5I1KL 4PJDE 4N0CD 4OGAC 2V17H 3W9EA 4LF3A 3UROR 2W9DL 1D5MB 1L6XA 1CBVL 3FT2A 3TJEL 4LAQH 3O4LB 1OARL 1U8HB 2VMFA 2XY1A 4S1SL 1B0RB 5FHBH 5D1QD 5F96L 5FIEA 3TO4A 2BXYA 5T33H 4MAYC 4NZTL 1MAKA 5EBWA 2KQMA 4Z0XA 2VTFA 5HGDA 1RZ8B 1G7QB 4HF5H 3EDFA 4U1HA 1GHFH 3KLHC 1H3XA 1OLLA 4JM2B 5C6PB 3GMMB 3O4LE 3Q2CA 4XVJL 4F9LA 1IAII 3UTQB 2E7BA 4EBQL 4M6NL 2R2HB 5FUZL 1RZGA 1HYSC 4XMKL 3EZJB 3S98A 4X99B 4Y16D 3FTGA 1T04A 5ALBH 3VXTA 5GS1B 2NY3D 4FXKA 2X4NA 2DBLH 4PJBF 2P5EB 2W0FA 5EO9A 4BSJA 5JOPD 1PG7L 4DQOL 4AMKH 3RZCB 3O2WL 3WEXB 5ETUA 5F89A 2VLMD 5KSVB 5BV7H 3SKJL 4LPVA 2FX8L 4OD2B 12E8L 4Y4KC 4WGVB 2WBKA 1WGOA 1HIML 2IBZX 4JCLA 4OLXL 3RVTC 1DBMH 3KLAA 3E2HB 4NRYB 4WCYL 5E2JA 3S35X 1JGDB 3OJDA 1S9XB 3QIUD 1TJGL 3MRGB 3PV7A 4NKIL 1I9IH 3U36A 3RA7H 4PTUB 4HDIA 4W4OC 1W0WA 2B2XH 4P4KA 1W0YT 4WI9A 5IBLD 2GUOB 1T20A 1UM5H 3CLFL 4OUUB 4E5XB 3FZUC 4RMVA 1LDPL 1HQ4A 3ZSSA 4ZXBD 1S9VA 5D1QB 1MVUA 3GBNL 4MX7A 4O4YL 4L3CA 4ODHH 3RPIB 1OPGL 1OW0C 4QRTA 3BHBB 3IDYC 4HXAL 4JM4L 1BOGA 2J8UA 5CAYB 1HH6B 2HN7B 4L9LB 5L6YL 1DEDA 3NOIA 1FO0H 5I1IL 3K46A 1II4E 4WY7H 3ZYOA 3WS3A 4OFDA 3S37H 2Y7QA 3IAPA 1A7OL 4FQXA 4GS7B 1MHEB 1WFTA 1XEDA 3KS0H 3RWIA 4X4ME 1A6ZA 4C4KO 4Y16B 1N64L 4U3HA 3BP4B 4TSCL 1YPZE 2NY3B 1WTGT 1JGEB 4NQSB 5IHUH 2QL1A 4O2FA 1M71A 1NLBH 4BYHA 3FHAA 3FRPA 4I3SH 2X44D 3W82A 5D5MA 1CTOA 4YHYC 1T83C 2AK4D 2R2BB 2DI9A 1HZHL 4X0KB 2N4IA 1ZE3C 3O3AB 1V5JA 1X5YA 4RAVA 3V7AG 5BVJB 1EO5A 3OR7B 4OFPA 5FYLD 3QIUB 1RHFA 3MRIA 1JK8B 2Z8SA 1NCNA 2CDFB 4UIKH 3X3GH 4BK4A 5EA0L 4HKXB 5B3JE 5JOPE 2DM2A 5HI4C 1FC2D 3PXJA 2VLME 2H9GA 3MOBL 2DQDL 4WJ5A 3V7MA 3BH9A 3FRUB 3QUYC 4Z5RB 1TZIA 4ZXBB 2OL3H 2MQ0A 1BD2D 1FZJB 1EO8H 3VRLE 1JHLH 3CD4A 3PV6B 4LOUD 4JDZA 2GK2A 2P7TB 2CGRL 2Z4QB 3BEWA 5CILL 1KIRB 1MWAB 1Q0XL 2E3VA 3KPRD 3L3DB 3PDOB 4BQCA 1TNNA 4KPHH 1QG3A 1UWGL 2AXHA 3OZ9H 4LIQL 4MCYA 3HRZB 2BRRL 3BZEA 3MA9L 5F7DA 3H42L 4CNIA 1ZT4B 3MRNB 1GZPA 4LHJB 3CDCA 3HZMB 2XZQH 3FB8A 1KEMH 1DDHA 2X4QB 4UBDD 3PP3H 5BV7C 2VN7A 1T21B 3DV6A 5DMYA 2AGJL 3GSXA 4QTHB 4GW1A 5IOPB 1A7QL 4YEFA 1J18A 3G6JE 4HK3J 2A6IA 4JG0H 1L6ZA 2AK4B 1YMMD 1IGTA 3VFSA 3V52H 3LHPL 5D2LA 4DGYH 3KAAA 1FDLL 4LASH 1M7IA 3MGOB 2IAMA 3AUVA 3OAUL 5E8DH 2MWCA 3H9ZA 4U6VH 5F88A 3QZWG 5IIEA 3MLRL 5DD0L 2M2DA 4FFVC 2HFGH 5DVKA 3BRGC 2ZP0T 4OM0H 3WN5B 1NMAH 3QJFB 4P49A 5F97E 3MJ7B 4U2YA 3WE6A 4L4TD 3ZL4H 3V5KB 3T0WA 4WFHE 3DX7A 4G9DB 2I9LB 3RAJH 4MA8L 5JTWA 1MAMH 4KHXH 3WHXA 2JLLA 2X2YA 1BD2B 1QFWH 2R1WA 3OAZK 4ZUVA 1I1RA 4NM8H 3IDGA 1N8ZB 3PHQA 2QR0B 3UAJD 3QH3A 2H41A 4LBEA 1J0HA 3KPRB 5EU4B 4V2BA 1TJHH 2NTFA 3DARA 3RTQC 2BDNL 2Y36L 4HWBH 2H6PA 1SJHB 1XH3A 4UNUA 4OI8A 3QQ3B 5K9QI 4KRNA 1H15A 4U1GC 5IMKA 1A9EA 1BD2E 3PGFL 4U6XB 1GOFA 3ZDYE 2IEPA 4S10A 5CD3A 4Z78A 4NN5C 3QXVA 5FGBA 3KG5A 5JORA 4W6YB 1D6VH 3K4AA 4WW2F 3WNLA 3KPRE 4HUUA 4JREB 1RURH 4O2CA 3WIIL 3WNKA 4Y5VA 1I9JL 3MUGB 3T4AA 4CBPA 4DN3H 1YMMB 2DKSA 2JB6B 1NBQA 1R3JB 1YDPA 2ZOKB 4HT1L