2YBRA

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
b'VQLVESGGGLVQPGGSLRLSCTGSGFTFDNYAMHWLRQVPGEGLEWVSGISRSSGDIDYADSVKGRFTISRDDAKKTLSLQMNSLRAEDTAVYYCARGGVGSFDTWGQGTMVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 26
structure length 116
sequence length 116
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2011-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ybrA00
3D2UD 1KF9B 3DRQB 3QNYA 2Z4QA 4LLQA 2HTLD 4JHAL 3MOAL 2XTJE 5JHDA 2X70B 3STLA 2WSKA 4U6XA 1G7IB 1IGFL 3HFML 3RBSA 5C08D 1ZHKB 4N0CC 3IJHA 5DK0B 1K4CA 1NEZA 3ARGC 4NT6A 4N0YH 4F9LC 2YRPA 1ONQA 5BS0B 3OHXB 1VENA 2DQIL 4XCYA 5B39B 5E1AA 2DICA 2DM7A 1KCLA 2W92A 4X0KB 4HS8L 3WN5A 2I24N 5IMKA 4WUKL 4Y4KB 5HGHA 5J1SC 3HR5A 3DYMA 1I8IA 3FT4B 4HT1L 4U3HA 3U82B 4Z6AT 4MS8C 4ZFOL 1FORH 2AJXH 3MODL 3L7EA 1N5AA 1W8OA 4LLYB 2EEDA 3MMEB 4DVBB 1YMME 2V5MA 4L4JA 2Q86A 2VZSA 4NKMB 4RRPG 3C87A 1DANT 4QHMA 3DPBA 1VGEH 3QDJE 1BVLA 1YYML 5GIRA 5FK9A 4UOW0 3O3BB 1KACB 1I8LA 2A0LD 2AV1A 4TRPH 3FFDB 5EU6A 5T33H 1KIQA 5CJOH 3VGHA 1VGKA 1ZLSL 2I9LB 4O58H 3QO0A 4J3VA 4G6AC 3UJJL 4LBEA 4WWKC 1F45A 2GY7B 3W0WB 2AXFA 2BERA 1J1XH 5FIEA 3IFOB 3RL1A 1WCQA 4M9PA 3TBYA 1K9TA 2ATKB 4RAUA 3VWJA 1QSZA 4I2XA 4U1JB 1JF5A 2MCPL 1OGAA 4HGWB 5DTFB 5E6IB 5C0AB 2H8PB 1CGVA 3L5WA 1F3JB 3QAZC 3VXUA 2P5WB 1ZHNA 1H0DB 1WBXB 4HIXL 1NAKH 1XGUA 1UB6A 4DK6A 2PW2B 3IXAA 2BOCB 4F7PB 3VFRB 5CGMA 3SO3C 2OXHA 4NM8H 2YSSB 3DVNB 3V5DA 4AQ1B 5EG6C 2IANB 4GMTH 4HXBH 4IMLB 4ODWA 4XWOC 1OW0C 2ENYA 2IG2L 2NY5H 3VXMB 1DUYB 2C4FT 4XRCA 5GZOD 1HZHL 3QXDA 1NQBA 4WY7L 4ZFGL 2HTKD 2CK2A 2DWDB 1RZ7L 4RWYL 3SQOH 4JAMB 3RUGB 1OARH 2YEZA 3PWPD 1HHHB 1KNOB 4PJ5B 5T3ZD 5EB9A 5C0NC 1REIA 1P2CB 1OAQL 3NH7H 3A6CH 3C2SA 5ANME 2QSVA 2DQTL 4TUJA 5EA0L 5J6HA 2R0WH 4P46D 5JW5B 1F42A 2UZIL 3N1QC 3F12B 3F7VA 5LAXA 3C6LB 5F7NC 2VSDA 2DJSA 5C0RL 2BNRE 3HZMB 5BOPA 3WXVL 3MA9H 4OIAA 5JZ7D 1YEIH 4JANA 1QRNA 4XVTH 3O3DA 3D85A 3PQYA 4Z7WB 1F3DJ 1L9NA 5DVLA 2A0LC 4I4WA 5D8JL 1UACH 5B4MD 4KVNH 1Q38A 4LPTA 5FKAA 4LAQL 1IQWH 2RHEA 5DQJA 1KB5H 2VERN 4QKXB 2J8UF 4XMKL 2AKRB 1T1ZB 5IVNA 1QLFA 1X5HA 5C09D 5CP7B 3HC0B 5KSVA 5DQ9B 2ITDB 2X1QA 2H32H 5FYLE 4JQXC 1PG7W 3OZ9L 1FV1B 1XR9A 4WJ5B 2AJ3A 3HG1E 4BH7B 3QWOB 4MCYA 4ELMA 2E6QA 2WW8A 3KDMB 1UWXK 4R26H 1BMGA 4X9GA 5EU5A 3RTQC 5IKCA 4PY8J 2VDKL 5KSBA 3GSWA 4F7EA 4YXLL 2VZ1A 1A4JA 1IAOA 2R1WA 4TTDD 5DUMH 1N64L 4PRAA 3SQBA 5MENE 4F80A 2UUDH 3U6RA 1U3HD 4POYA 1ZV5A 3HKFA 5GZOC 4JREC 4U2ZA 3WFHA 4LIQE 2YUXA 1L6ZA 4IOIB 3C5JB 5HXMA 4EN3B 4F37K 4O2EA 4K3GA 3TBTA 1VACB 1MCOH 3RWHB 3MRDB 4Z0BH 1VFAA 5EFIB 1JHTB 2ZNXA 1I75A 4HC1H 5ICYA 4J3XA 1QR1A 1WT5C 3RL2B 2XZAH 4K94C 3PHOB 1KIRA 4R3SA 3PP3H 4PGCB 1Z3GL 2VR9A 4LCIH 2FB4H 4F57L 1I8KB 3DHMA 1FRGL 2P49B 4L3CB 4NHCH 5EBLB 4EI5B 4PG2A 3LKSB 1D6EA 5F44A 4M5YL 3RX5A 4Q6IA 4IRSB 5IB3B 1RUMH 5ALBL 3MC0A 3EYVB 5J13B 3IDNA 1CCZA 1JUFA 1INDH 2CXKA 3V4VL 1TTGA 3LQAH 3O81A 2EYSB 32C2B 4M3JA 3O6LH 5JZ7C 1GRWA 1KLGB 8FABA 4MMXC 1CBVL 1NMCB 5AZEH 2ZKHL 1JGDA 1FYTE 1U42A 3O9WA 2ESVE 4I18A 5B39G 5J7CC 4XPBH 4XNQB 4PRBA 5D2LF 5L9DL 5DJYB 1IC4L 1KCRH 5C0CA 1ZGLP 1ZLWH 2FHFA 1FIGL 2C7UA 3LPWA 3RZCA 5DURD 1EEUA 3ARBA 3QCVH 2YPVL 4JO4H 4NO0D 4L8CB 1KJMB 5GRWA 1NC2A 1U92B 1CXIA 4ZO9A 3TA3A 1HXMA 1GYAA 4HG4K 4PLKC 3RJQB 1RZ8B 2GJ6B 3UTTB 1WAAF 1XGTB 2WWKO 1VFBB 5KW9L 4XMLH 4JHZA 1F58L 2ICEA 4GFTB 5DYOB 3MLXH 3HI1A 1ZOXA 4OZFB 3CK0L 4P2QD 4FXLA 3O6FC 1CDJA 1S7XB 3BGMA 3ARZA 3HAEH 1JNHB 2JB6B 4KKNA 2BSRB 3EO1B 1DTUA 4TTDC 1XMWA 3ZDYF 5D7KD 2GK2A 1LQSR 4ZFFB 3VWKC 2EH7L 5ACZA 1U8OB 4L4VD 4ZUUA 4BUHA 3IXTA 3KYMB 4KI5E 1MJJB 4TSAL 3LRSA 4ZDHA 4CN6A 3PV7A 3EOBB 4X8XA 5IT2L 4M7JL 5TQ2H 4MB5A 4RBPH 5EZJA 3RWGA 4D9QD 3JV4B 2OP4H 1BGXL 1FJ1B 2VXUL 2HKHL 1JTPA 1NUGA 1CVSC 5TE4L 1I7RB 2GITB 4LVOC 4W6YB 5E8OB 1MPAH 5BXFA 4WI8A 5SWSE 3GMNB 3V5KB 4D9RE 2M2DA 2BVPA 1IC5H 5FUOH 5HHOE 4HPYH 3HC3L 1ZKAA 3SKJL 4QT5B 3U2SB 4JGJA 2O5XH 4KMTL 1N59A 4WI6A 1MI5E 1RZKL 3WFDH 3IDIB 1TZGL 3ARXA 3TBSB 3GGWB 2H2PD 3PXHA 4M6OL 1OLZA 1YEEH 5CUSH 4MJIA 3IF1B 3LVEA 1NGZA 3CFCH 3IT8D 4WUUE 3L3HA 2A83B 3MGTB 3MV7E 1DN0A 3GRWH 3RA7H 3LIZH 5EORH 2H9GB 3FT3A 3OG6B 1CDGA 5GRZA 3T0EB 1YEKH 1U91B 1G7HA 5HYJD 4JN1H 5ESQA 1C12B 1AP2A 1A6ZB 4U1LA 4PRNB 5CBEB 2KH2B 1TNNA 4OLZH 3SHSA 4ZO7A 3LOWA 1QLRA 2EIBA 2DF3A 4GQ9H 4KRLB 5EC1B 3D18A 2CDGB 1MRCL 3EYSL 3ARFD 1ZLVK 1I1AA 1DBBH 1I3RA 2YZ8A 3QQ9D 3REVA 2PN5A 4G8GE 5MEQA 1JJUA 3DUSB 1JNLL 2YD2A 5I9QB 3KJ4B 2X4OB 1S9WB 3KR3L 5LBSL 2GYSA 1K6QH 5C9JB 1PZUB 4CNIB 1JGVH 5J6GA 3LKPB 3R06B 4ZTPH 4X80L 3RNQB 1CG9A 1CIUA 4KKAC 3GMLA 4NN6C 3BAEH 3QDMD 2FLRT 4HBCL 5I2IA 4HKXB 4FQJH 5EOTA 5I1DA 4YGVB 5ALCL 5MHSE 1T5XA 3GUTB 2P8MB 2PR4L 1CGUA 3TO4D 1MFCH 4NZUH 5FYJD 1IEAA 5IQ7H 2BY2A 4ODXA 1RZGB 2XN9A 1QSFB 3UTZA 5HI4D 1C16B 4NZRL 4H26B 2HH0H 1NBYA 1XCQB 5F1IA 3V5HB 3EIFA 3FMGL 1BECA 2DTMH 3OJMB 5IW6B 5EUOE 4U6HA 3DX8B 4HWEH 4HJGB 3CFKB 3F6IA 1B4JH 2H45A 1R5WA 3OBAA 2HT3C 5D5ME 2NW2A 3B83A 2H2PC 1BEYL 4GKZA 2B7DT 1X5JA 3AGVA 1XR8A 2MPAH 4FS0A 2FJGA 3TBWA 4YWGL 4ZNCD 3KJ6H 4C54A 4M8QA 4I0PA 4JY6A 2Y7QA 5E9DA 3T0VA 4UDUB 4ZXBB 3BDBA 1OTTD 3RWCB 3V52L 2RCSH 1AGEB 4NO5B 1LO3H 4XGZA 4ZFOA 5L8KB 1Z5LB 4NO3B 1YJDL 1MHHB 2WNGA 1G9MC 2E7LC 1JZ7A 1BZ7A 3C8DA 1CDBA 4YDIH 4LCWD 2A6JB 5D1XA 3TZVB 4XBPA 35C8H 1YY8A 3LKQB 4MWFA 4JRXD 2XACC 4E41B 1VEMA 3PGFH 2R69H 4LLAA 1AGCB 4LSVL 2P5EB 3SOBL 4XNYL 4LHQB 5FGCE 3WS6A 3OAZH 3MV8B 2HVKA 2L7UA 1DANU 5DC9B 3ARFC 5ETUA 2EYTA 3FRPA 2DIBA 4PJIF 3QQ9C 2QQNH 5EWIH 2DQGL 5D7LE 5EN2B 3HE6D 4X6CF 1U8HB 3OAYH 4NOBA 1FE8L 1FN4A 3MCG1 5BO1H 2L4OA 2G60H 3PWJB 1LILA 2IQ9H 3QQ3A 1CE1L 1QLEL 4FP8L 4WCYH 4X8JA 5L7XH 3CH1A 2V2XA 4WIQA 2Z8VC 1RVFH 2B4CL 4OZFG 3WFCL 1P53A 2R2CA 1QRKA 2DB8A 3WS3A 4UV4L 4D94A 4GG8B 1JGUL 3SKMA 1MHEB 2VQ1B 5JQ6H 1FGVH 2XNAA 4OGYH 1OLLA 5E2TL 1P7HL 3IDMA 3HRPA 3KPSA 2CD0A 4Z7VA 3IDYC 4MCZB 3NVQA 5DJ2A 1MJ8L 4QRPD 3VGAC 4WI9A 2I60H 1AGBB 2YN5A 3ARRA 3WE6A 1SJEB 5LJYH 2WUCL 1S9VB 1PLGL 5I1JH 2A9NH 4M61A 4EBQH 4OLYH 2DOCA 2XKNB 4AQOA 2IPTH 3FQWB 2C4FU 2YMXL 3L6FA 4NCDA 5LCVL 5CIPA 4BQCA 5FDWA 4X6FB 3QCUL 3BUTA 2VDOH 1FG2B 5F6HJ 5ENWA 4TULL 5C1MB 1CL7H 4B5EA 1OTTC 4ORGB 4HBQA 3B6SA 4OBRA 2IEPA 4QOKB 4Z78A 1A7QL 3VFWB 2RFXB 3DTXA 3BH8B 3RPIA 1V05A 3P2TA 3MNWB 1WBYA 3OG4B 4S1QH 3GJFB 4Z7UB 1EHLL 4OZ4B 3UJIH 3C8KA 5CP3A 3QG6A 5IJVA 1RZJC 4PJFE 3WDIA 5D1ZD 1GIGH 2Q7YB 3O4LB 5I8EA 1OVZA 1J1PL 1I7ZA 2XKUA 3LH2H 4H88H 4P57A 3UPRB 1EHAA 4KKCC 4AJ0A 3MQIA 2LTQB 5DJ6A 2GEEA 1KT2A 4OLXL 3DX9B 4JO2L 1YNTA 4FABH 2X4UA 5IB1B 3LN9A 2IQAA 4HIIA 3L3GB 4OLUL 3OR6A 2ED9A 3AB0B 4ZUTA 3H6JA 2DL2A 1T0NA 1MREH 5TF0A 2FEDC 4DEPB 4O2CA 4C55A 4LEOA 1Q9KA 4ZS6C 4NC0B 3HNSL 3I6GB 4TPRH 1BWMA 2JIXB 3KYNA 4FQHA 4JFQA 5GGQH 5GGTH 4BSJA 4OZGE 5E5MA 2BY1A 1BBDL 2EDQA 1CFNA 4M4PA 3RKDD 2E6JA 4JFOA 4NBYB 3BSZH 3J7HA 1OT2A 1XF2B 4U1SA 3O8XB 3Q0HA 4QXTA 5D2LA 4NQDB 1B6UA 4CMMB 2EDLA 5MERB 3IFLH 3PG2A 1FNGB 2ADFH 2A6KA 3FCTA 3MLYL 4M1CD 3QQ4B 3U4BL 4LCUB 3ARVA 4O4YL 5I1AB 3QUMB 3LN4A 5KAQF 5ILTH 3K7UA 4G6MH 4WO4C 5FYKL 2NYYC 3IJSB 4X9HA 1AXSA 4JRYD 3TM6A 1PVHA 2VXVH 1QSVA 4OTXH 1WC7A 4E9LA 4JPWL 3G5XB 2P8LA 2A74A 5F88A 4ONHB 4JZNA 1ND0A 4P23A 5I15L 1WAAA 1U8QB 2NLJA 4OGAD 4XVSL 2W0FA 1FDLH 3CFEA 1DE4B 2BNUA 4H25B 4LCCB 1WZ1L 4QY8B 3IETB 3V9FA 1P69B 3O2VH 4G6JL 3HZKA 2D2OA 1U93A 1L4IA 3FHAA 4ODHH 4XAKE 4OM1H 1KEGH 2Y9RT 3C5SB 2FX7H 1EMTL 3V7MA 4KDTA 5DJ0A 3BOVA 5A2KH 4KJWD 3LKRA 3FT2B 5TDPB 3H9HB 5E8EA 5K59F 3UTPD 2W0PA 1L0XA 3ZO0A 4APQD 5IM7A 1RULH 3VJ6B 2WIMA 4LPCA 3W9EB 4XMPL 5JOPE 2JELL 3RWJA 3MYJA 1FPTH 2V2TB 5J12C 2CIIB 5D2NA 1UJ3C 3L3OB 1QQDB 3T8XB 3MJ9A 1FAIH 1P6AB 4L4TD 2DI9A 5GGVH 2DAVA 1I1RA 3EYOA 5AWNH 3RY6A 3NFNB 4TVSa 1X5FA 2XTJB 4HJJL 4KTEH 1MFDH 5J11C 1CQYA 1IGJB 2F53E 5DC0A 4HAFA 3QUXA 1P4IH 4NCC2 1J8HE 3AS2A 4OIIH 1NDGB 1C5DA 1SMAA 1TVBA 3LZFH 3NCBB 3O2DL 1TQCC 4QHKI 1UQSA 1RIHL 3REWA 4PJXE 1MEXL 3ULUH 5JIIA 4PGZA 3P40A 5J0BA 1GGYA 1S7VA 2ZZUT 3IJYA 4UAOC 2E27H 3ZTNH 1JYXA 1P5UA 1TENA 5GGVY 1Q9WA 5DJ8A 2XZCL 3RNKB 1FAKT 5T1KB 3TWCH 4BQ9A 4X6EA 5DDHB 5LWYL 4X7TA 5DFTA 4WEBH 5CKAA 1S3KL 2A77H 1BAFL 4K9EH 1OCWL 3VU2A 1YMMB 1R3KB 4KMLB 3CDCA 3KPLA 4MJ5B 1QBLH 4CN4A 1E6OL 3MV11 4OGAC 3OKNA 4YBHA 3QDJB 4PY7B 5EZOL 1Q9OA 2BHUA 1FL5B 4HUXA 4WGVB 4D3CL 3P0GB 1KEML 4ZO8A 4Q9QH 1IVLA 1ZVSA 3DXAA 1OQXA 2GIYA 3BGFC 2H1PL 4KHTH 3NZ8B 3PABA 1IBGL 1B0GB 5MP6H 3W11D 1CN4A 4FN0A 4DUXA 1NFDF 5HGBB 5F3HA 3JBG7 4RMRA 3FQXB 4MAYC 3NFPA 4JN2A 3BJLA 4APQC 3PWPA 3F5WB 5HGAB 3N1PC 2VLRD 3NIFE 4EJ1C 4KKBD 5GRYA 5JDSA 5HHQA 3HPLA 1C5CH 2EEAA 4P46A 2DQEH 3FONB 3QUKB 2G5RA 3S5LA 2YA2A 4LVHB 5I8OH 4KRPC 4PJ8D 3VI3E 4K71C 3BVNB 1BFSA 3TIDA 2EKJA 4IRJD 1HINH 2ZOLB 3VFOA 1IZJA 4YR6B 2D7TL 3VCLA 1ZEAH 2FO4B 4HEPG 3JXAA 5ID0A 1S9YB 4HJ0D 3H3KA 5A16B 4N0YL 4Y1AE 5SX5K 2WLYA 1A6TA 4LF3B 5HVWA 1A9BB 3AU1B 2ADGB 2ZUYA 5I0ZA 5E2WH 2F8XC 5DK2A 2AW2A 5CSZA 4MX7B 1I9JH 3D39E 4JFZL 2GTWA 5HD8C 1KC5H 4C4KT 1UB5A 1A1NB 3I2CH 3OGOE 3TFKC 5C09A 3C9NB 5ANMB 1YYLH 2DLFL 1FORL 1A14H 3QIBB 5CZXD 3OXSB 4QRTA 5IFAH 3KYAA 1JTOA 3BQUC 3CXHK 4PJGF 2R2BA 5IHZB 3BP4B 2HFEA 1RMFL 4ZSOE 3B43A 2BNRB 4ZAKB 1Q1JH 4XHJD 3CVHB 2BVYA 1RZIA 3MOQA 2GT9B 3PXJA 1OB1B 3U7WL 1XCTA 3RDTB 3WSQH 4NSKA 3T65A 3GSRB 1J0IA 2LQRA 4UINH 1ZVHA 1ED3A 4YHZH 4ZD3H 1U8MA 1A2YA 3MGOB 4B41A 1EX0A 2Q76B 4TRPL 4HCRH 3ZZ1A 3FQRB 5D7IE 3VXRE 4HIEB 1U3HA 5F71A 2IADA 4PJIA 4NZTH 5BJTA 4OD2A 3QRFM 3VXSD 4X6CA 1NGYB 4LPVA 2R15A 1LMKA 1QSEE 4OT1H 4X5XB 5DZLA 3IDUA 3UDWC 2DIAA 5C70A 1R0AH 1QNZL 1G7MB 3U79A 2JJTC 1NL0L 4I3SL 4WI3A 2AEPH 4LSDA 4GW1B 3MFFA 2R29L 4Y0GA 5EBWB 3HG1B 2ZCHH 2OL3H 2UZYB 1I1FB 4G6KL 4KKBC 4U4BA 4GMSL 5HHPB 2QQLH 1TFHA 4QRSB 2AV7A 4CU7A 3QT2A 1T0MB 4JO3H 5M94B 6CGTA 2BC4B 3JV5A 4PJ8C 3PWLA 4P5MB 4GXUN 4HXBL 2Q87A 5MENB 5HDOA 3GMOB 3VXOA 3JVGC 2NY5L 3QXTA 2BVQA 4PJCA 5MEPB 1ZLUH 3T4YB 3GBLA 4LLVA 4Z9KB 6FABH 3QIUD 1HNFA 1G6RA 1F11B 2W65B 3RWIA 3TESA 4J23A 1KLUB 5IROA 4R96A 1D5ZB 1S5HB 1BQLL 1ZWIB 3CX2A 3QHFH 1HSAB 1UCTA 3IDJA 1TZHA 4YO0A 3L5HA 1W8NA 1OARL 1G7JA 2VABA 4N5UA 2NY1D 4FXGA 4YXKH 5CCKH 3BO8A 3MZGB 2BK8A 3WO3B 1Z9LA 4IHOB 1R5IB 4WI7A 5C07A 4KAQH 4K3JH 4JVUA 4S11A 5IB4B 2JCCF 4XPGH 1RUQL 2R0WL 1H15B 4OFVA 4FXKB 4C83B 4MXQD 3AS0A 2UY7A 3H42L 2XOTA 3UPCA 3VFVA 4QNPF 3SKOA 4IJ3C 4KVCL 2FL5A 4C56D 3B2UD 5CINH 1KG0B 4O9HH 4KMQA 3RWDB 2YUZA 4P2QA 3VG0L 4NRZB 5E8NB 1YEIL 3AXLB 4XVTL 2FD6L 1FYTB 2ESVB 1ZK9A 1JN6A 4HK3N 3V6ZB 5BS0D 1WTLA 2XQYK 5BMFH 2XZQH 1MCWW 3S4SA 2K7PA 1RJZA 5E00B 3X3FH 4AH2A 4L4VA 3CXHJ 3HI6H 4XX1E 4OCYL 3PUCA 3T1WA 4Y4KD 4TVPE 1FP5A 3S37H 3L1OH 5KG9B 2C3WA 1BVKA 1IKNC 1MCDA 4NN5C 2K7QA 4NQTA 1CDHA 5JTWA 2A2QT 3QNXA 1DQDH 4ODUB 3HRZA 3OWEA 5K33A 4BH8A 5A2JH 2NY4D 1X44A 2X7LA 3BEVB 4OZHE 5I66B 4JPVH 4R26L 4D0DA 3VW3L 4JFPA 3PL6B 4PJAE 4P9HH 4NO2B 5CSGA 4YX2H 5E8PA 5TPWH 2P48B 5I8KL 2FSEB 3B3IA 4M5ZH 1AD0B 3W0WD 3QUMH 4WFFD 4PD4J 2EZ0C 4UQ2B 2XWTA 4AL8L 4Y5YC 3L3IA 4LRIC 4QYOA 3QULA 4Y8DC 2Y36L 1YEFL 5I76B 4RIRB 4YHKH 5JPNA 4Z0BL 3FB6A 4LK4A 4JFXA 5C0AD 1W0WB 4LLMB 4ALAL 1WCBB 5IBUB 2NY1C 2XZAL 2P5WD 2H26B 1FVEA 2VDNH 4X4YB 1QKZH 4NFBA 1DLHA 3CMOH 4LCIL 5FFLA 3B5HA 2FB4L 4JHWH 5HYJA 4NHCL 2J1KA 1BF8A 2D7PA 4XVUC 3ARSA 1RUML 3SDAB 2QL1A 2VH5H 3ULVE 5I16A 4W4NA 3B2UC 1YUHA 3OKMA 3LQAL 4FFVC 5ESAA 3VXMD 4QF1A 1MI5B 3ALXA 4X6DB 5ABDE 1NBZA 2ZCKH 1U6AH 4UT7L 3P0VH 1YNKH 3ARFA 4XPBL 4JVPA 1B2WH 3RU8H 4QHUA 1S9KC 1QFPA 3KXFE 5B3JE 4WUUB 1YECH 2IPUK 3MV7B 2BSSB 5TDOB 4QTIH 1R3IL 4I2XE 4Q9RL 1OGAE 2R8SH 3WHXB 1NAML 4PJ5D 3B5GA 3QCVL 1S7UB 4Y4KC 5IMOA 3ULSB 4MQ7A 5LG1A 1GGTA 4JO4L 4OZIE 1AQDB 4IS6B 3CSPA 4Q7DA 3QDMA 2UWEA 4ETQA 4P5TC 1GC1H 3C6LD 4CUCA 1CL7I 2JK5A 4ZNEE 1KIPB 1TCRB 4XMLL 5DD5H 3OKDB 1F4WL 4LKCB 5GSVB 5I1GH 3TO4A 4KK8C 2NY4C 1NMAL 3MLXL 4GW4A 43CAA 4UUJA 3CVHL 3BMWA 1WISA 4PTTA 4AENA 3ES6A 5GGSB 4GW5A 5JW4R 4XP6L 5DT1L 5BQ7B 4G8GB 4RMVA 3TP4A 2PTTA 2PW1B 3UYRL 1INQA 2BJML 5F6IB 2EKSB 1TQBC 3BP6A 2AJZB 1P1ZB 5GGUB 3X13A 3RGVC 3C6SB 5HGDA 4OSUH 2ICWA 2WQRA 5TQ2L 4WW2F 2YD8A 3K2UH 1DEEB 3LV3B 3NA9H 4QEGA 1UC6A 4LSRH 1FC2D 1YQVH 2QSTA 2OP4L 1LP9E 1SY6L 3ZE1E 3QDGA 1SEBA 1D5XB 3KPQB 1BZ9B 3EZJB 5L6YL 4LCWA 4I77H 1H3PH 4NRYA 1P7KA 1KB9K 1GGIH 1QRNE 4V2CB 3PQYE 2VUYA 5FUOL 4XHQA 1N5YH 1T20B 4JRXA 1CT8A 4RA0C 1I7UA 3TNMA 1WK0A 1RZKC 1KPVA 5DD6A 5EUOB 3V6FB 4E42B 4UB0H 2NY6D 2XFXB 3MRJA 3ROLA 1SJHB 3OGCA 5D5MB 1EV2E 1NFDA 3Q3GB 5K9KB 4KZEH 5HVHB 3KPTA 4OUOA 5CUSL 4EN3D 5DEFB 3SGJC 1T2XA 1LDPH 5J1AB 5EIQA 3HE6A 1NJ9A 5GRVK 4DVRH 4U2YA 5CMAB 3U30B 1NLDL 3GRWL 3RA7L 5DVKA 3LIZL 4FFYL 3U4AA 4MYWB 3JTTA 4K2UL 3G5ZA 2SEBA 4LDOB 2Q6WB 1BFVL 4EI5D 1SM3H 3E6FB 4FQIH 4CVWA 1U8JA 3ZKXB 4DAGH 5LXGL 4IRSD 1I8MB 1U3ZA 3DV4A 1FFNA 5KSBE 2CKBA 4WTZA 5SWQB 3RVUD 4JFYB 2XTLA 3WNMA 4TUOA 4PBXA 1EJOL 3BZ4B 4GQ9L 5I1CL 3HS0A 2V5TA 3ARDC 3SE8H 2QV2A 1OAUH 5FGCB 4HD9A 5TF1L 4LLWA 3MLPA 1PKOA 4AEHL 4C4KO 1HN1A 3S36X 1J0YA 1T3FA 1VADA 4Z8FL 5DHVB 1WEJL 3PJSB 4QRPA 2CMRL 5D7LB 5D7JB 5GZND 2XWBA 5T1MB 1VERA 1JGLH 2AXGB 3MUGB 4B0MM 2WP3O 1JGVL 4OJFH 1YEGH 2H41A 4GRMB 2ZSVA 2VC2L 3SEPA 3L9RB 1FGNH 1HHKB 1UWEH 4K7PY 4LVNC 1J18A 2JB5H 2GJ6D 4PJGA 3UTTD 4KC3B 3AFLA 4YDJA 3VD7A 4FQJL 3C60A 1RURH 1MCEA 3SCMB 3TO2A 3LSOA 3V0AC 1MFBH 1Q0XL 1A7NL 4NWTH 4JO1H 4JR9H 4YUEH 4YBLC 4OV5A 2NY3B 2HH0L 3BHBB 2GUOB 1CE6B 4Q0XH 1X5AA 4L8DA 2YWYA 4NC1E 3MRCA 5IR1A 2QKIA 2JJSC 5D1ZA 3K3QA 4NFCA 3I84A 1CTNA 4HUVB 3QUZB 3BPNC 4LFHG 2NY6C 1MRFL 4Y16B 1B4JL 3S36H 3O41B 4MNHA 4S1DD 5IBUG 2MPAL 3IFPA 4ZPVB 3ZL4H 2FH8A 1KTLA 1WWBX 1R3HA 3CLFL 1KYOK 1KB9J 1Z6JT 3EDKA 5EBMB 3NN8B 1YJDC 3I3DA 1QO3B 1OHQA 2RCSL 5F9JA 1IAKB 2E7HA 2KPNA 2X40A 1LO3L 3QO1A 1JFQH 4AM0A 2DYPB 1BBJB 3JWOL 5CILH 3LEYH 2ERJB 3F7YA 4N0UB 4JM2B 2V5SA 4IRSC 3EO9H 4YDIL 1RJLA 3DBXA 4NRXB 3RVUC 35C8L 2X4NA 3FOMA 1EZVY 2XV6B 1QVOA 4V1DE 5AUMA 5CEZE 4PJFB 3D69A 1LGVA 1SYSA 2N1KA 3DUUA 4M7LL 1P84K 3SPVB 2G5BA 4P59L 3AREB 2EYRA 2ATPA 3CSYA 5DHYA 1A3RH 3L3DA 2B1AL 5AD0A 1CI5A 3PWVB 2EE3A 3PIQA 1EXUA 2QQNL 5EWIL 1KPRA 5GZNC 1P5VA 2FZ3A 4R4BB 4J1UA 15C8H 2VWEE 3BPCB 4TNVF 4JRYA 4U7KA 3T0ED 5IFHH 5FA3A 4L5FH 4MB4A 1OP3H 1IARB 3DUHA 1EFXB 2JCCA 3QI9B 2B4CC 2E5EA 2V7HB 2Y5TA 5EU4A 1LK2A 5KS9B 3NZHH 1T7WA 5DR5L 2V9RA 4K3DH 3LMJH 4N5ED 2AK1H 4P3CH 5B38A 4XPFH 4OZGB 1T83A 5C92A 1FGVL 4YGAB 3DMMC 5F9AC 1KSRA 4JZJA 4JFFE 2DKMA 4D8PB 2G75B 5GS2H 1QD0A 1JK8A 3T3ME 3DX6B 4U49A 3TYFA 4BQ8A 3C2AH 3HZYB 1DP0A 2LU4A 5JPMA 3ARGB 4MJIE 2I60L 1FQ9C 1U8NA 3MJ6A 1N6VA 4WDIA 3UTQA 1IKFL 1FVCB 1U8IB 1K2DA 1YN7B 4IOFC 3TT3H 3P9MA 4Y5VA 4Y5XB 1T22A 2WBWB 4AT6A 3RUGF 4NQEE 1KTRL 4XP5L 3CDGA 1A8JH 4OAWB 2GFBB 4DQOH 3U9PH 3LKOA 4MA1B 2VDOL 3AS1A 1E27B 1F6AA 3KPPB 4PS4L 4ZOBA 3WO4B 4CVXA 4Y8AA 1QFWL 3SJVE 4H5SA 3DI3B 4WHYH 4S1RH 4FTVB 2VN7A 3QG7L 3HUJA 4LMQE 2IFFL 2NW3A 4KK9D 5CBAA 4K8RH 2DLIA 1HYRC 2LFGA 4GG6F 4RQQA 2XI9A 1QSFD 3GBNH 2W0KA 3WHE1 4FG6C 3F65A 4NQXA 1KYOJ 3SDXE 3WJLA 4Z7WF 4LSSL 2OR9L 1GGBH 1A7PH 1D5BB 3PHQB 4RZCA 4WWKB 5D1QC 4DCQA 3LH2L 1N8ZB 4W6XB 2EE2A 3K8LA 1EO5A 3CD4A 4U1HB 1G0DA 1FNSL 1W72H 3BUYB 4MD5B 3CUPA 1KB5A 1U8LB 2XWJA 1AO7D 3VXTB 2YPKA 3DYOA 2FRGP 3ALWA 4ISVA 3GIVB 1IGTA 1IC7L 3PNWA 1DQJB 5E0QA 1WZMA 4X4XB 4ZYKA 4PGEB 2F53B 4W81A 1Z9MA 3VXNB 1MREL 1P84J 4JVWA 1LEIA 1T4KA 2YKLL 5DO2C 2VTFA 2CGRL 3TZVD 5IIEA 2R1YA 3D2UB 3SE4A 4BSVA 2XN9E 4JKPH 3QDHA 2PTVA 3MRIA 5GGTL 5GGQL 3OB0K 4E41D 4RRPA 3OR7B 3OPZL 5D72H 3K46A 4QXGL 2EH8H 2W91A 1QFWM 3ZLQC 1X5IA 2F5AH 1HH6A 2P5ED 3ZDZF 1MLBA 1HHIB 3BSZL 4PJXB 3QNZB 1WFOA 3MV8D 5J9PB 4HIHA 5DA4A 5FOJA 2ADFL 2A6DA 3UMTA 2F8VA 4OCSH 5I9QC 4G6ML 4RISL 5DS8A 2UYLA 3T0WA 1MSPA 4Y4HB 5E9DE 5AYQA 5DMKB 3TJHD 1IFHH 1LE5B 2VXVL 4LPYA 4OTXL 5GJTL 3FFCD 4MD4B 2VLRA 4NGHH 3H9SA 4ENEC 2QADC 4HC1A 3QFDB 1XGQA 2V7NB 3QB7C 2HT2C 3TH3T 3DVGA 4PJ7A 3KWWA 3MREA 1Y0LB 2CR3A 2CR6A 4M43H 3QEUA 4CADB 2HP4A 4OLEA 5BCAA 1ZAGA 5FGSA 4UDTB 5LGHH 1CQKA 2BZDA 4IRJA 4XCCL 2YD5A 1AIFA 3JVGA 3SY0B 1KEGL 2DM3A 1WBZB 3IGAA 1JI2A 5GXBB 3VXPA 4K23L 3QPQD 2WWMD 1K8IB 3MXVH 1XGYH 2CDEA 4Z77A 1RD6A 1OGTA 1A1OA 2GK0A 4EIZC 4J4PC 1NGWB 1EBPA 1RULL 1OAYH 3GMQB 3NIGF 1U8KA 1IT9L 1BOGB 1OF2A 2R1XB 3ET9F 3P9LB 2CIKB 4A6YB 4ERSH 4JB9L 4YDKH 2YZ1A 5SV4A 3MJ8A 4N9OB 4O00A 1HDMA 3HPJB 3RIAF 1CICC 4M3KB 1JNNL 1KTDA 2ARJA 4QOKD 5DRWA 2DI7A 5IOPB 4L29B 4KTEL 4LEXL 3RBGA 4MZ2A 1GGCL 4Z7QF 3M17B 5HI3D 5CSBA 2DWEA 3RTQB 1P4IL 1P4BH 3NOIA 4OIIL 3V6OC 1U58B 3TBVB 3TZVC 2VL5A 2VDLH 4ZMAT 5CJXC 4Y1AB 3P30L 5FCUH 5D6DC 2Q3AA 1CR9H 5DEZA 5TGBA 5DFVD 3ULUL 3WFBL 1NCAL 3D39B 5FKPA 2J8UE 1MHPL 1UVQB 1XEDA 4YLQT 1KJ2B 3F58L 5C2BL 3OB8A 4GSDH 5DSCA 4I3RH 1NSNH 4NNYB 5IESL 4UT6H 4ZTOL 4JE4B 2BY0A 1ZSDA 5KTEL 1KJVA 4GLRI 2NCMA 5H94A 3HTLX 1VB9A 3TJHC 1ZGLB 3O6MH 1MCRA 4D0BB 3T08A 3GMPB 1J12A 5EOCH 1UEMA 1MIEL 2DQUL 1QBLL 1JL8A 3I75A 4RAVB 4XTRD 3QFJA 2JIXD 2F54D 1D5MA 4NC2B 2OX5A 1MCPL 5DJXB 3LKNB 2IMMA 4KHXH 2J5LC 5F3BA 5TDNB 5FYJU 1VFUA 2AJVH 4I3GA 4I48A 2B1HH 1LEKB 2Z91A 5D7IB 1MUJB 5FECB 5FUZL 3O8XD 5JHLL 3HLAB 4NQDD 2XPGA 4KHTL 3T09A 3S35X 3QIUA 4LNRB 2C1PA 4EKXA 5MP6L 4X6BB 3C5ZD 3LN5B 4ZQKA 4UTBH 1QSEB 4F9PC 3GSNB 4Y2DA 1NBVH 4Y5YA 3MZTA 1F6LL 4XWGH 4ZFZB 1A5FL 1K8DB 3MRRA 5KOMC 3M07A 5GQBA 5HYEA 4HKBA 5H35A 4PJBB 2M8XA 4ODVL 1IJ9A 4OIBA 1WFTA 4XVJL 1VCAA 4YQXH 3R4DA 3BXNB 4R4NC 1JPFA 4X4ZA 2D31A 5LQBL 1SMOA 1UM5H 4BZ1H 1C5CL 3DRQA 2DQEL 5KSAC 3VDBA 1MHCB 3QZWB 5I8OL 2X70A 5T3XD 1DUZA 2OSLA 1IL1B 5HI3C 2X4PA 1G7IA 1IM9B 3N9GH 3FL7A 4L8SC 1ZHKA 3AAZB 3O6FB 3BN3B 5DK0A 1MF2H 3O3AB 5JOEA 1JWSB 1JPSH 3BT2H 2YRLA 3AM8A 3OHXA 2DD8H 5DFVC 5E2WL 2ZUXA 3VWKB 2E9IA 2I07B 3S35H 5B39A 4ZOCA 1F2XK 3UJTH 2YK1H 5LKNA 4X0KA 1KC5L 1IGCL 2FHCA 4Y4KA 3KPRA 3I2CL 3VDAA 4XT1C 3PE9A 3S34H 3FT4A 1TNMA 1JYVA 1YYLL 1UKTA 1A14L 2R4RH 5B21A 1EGJH 3VGBA 2FJFB 4YZFF 4LLYA 4OFYA 2XTJD 3MMEA 1XF1A 3OKYA 3AB0C 5IFAL 5AZ2L 4DVBA 2AGJL 3GSOB 2Z9TA 5BVJB 4NKMA 4DEPC 1LK3H 1JNJA 1NCBH 3VFGH 1BIIB 4XTRC 1V5JA 4LVOB 5E94B 3WSQL 5ERWB 3HNVH 2BMKB 1QHOA 4CU8A 3QPXH 4JKKA 5IUSA 1UH4A 1I9RL 3ZDYE 3O3BA 1NUFA 4J3WA 4ZD3L 2ZP0T 3FFDA 1JPTH 4KPHL 4N1EA 5H2BB 2I9LA 1IMHC 3W0WA 1DBJH 2BX5A 1EPFA 1EO8H 3BPOB 4K7FB 3C5ZC 3MRBB 5D2NE 2J12B 4BKLB 5T1KD 3X3GH 4U1JA 3BDYH 5CKGA 5DTFA 4HGWA 5E6IA 3RHWK 1ZA3B 3PDGA 2H8PA 4DGIL 3S88H 3P73B 2P5WA 1YMMD 1H0DA 2ZCHL 1E4WH 2OL3L 1WBXA 4NO0B 4OZHB 4TSCH 5GS1A 2X1WL 2DQJL 3BWUC 4UTAL 4PJAB 3QDJD 2PW2A 2DKSA 2IAMB 2BOCA 1CDCA 3VFRA 4F7PA 1N0XH 2YSSA 5HYQB 1OAZL 3WLWC 2FECL 2IANA 4D2NA 4EUPB 2XA8H 4NT6B 4IMLA 4NOFA 3Q6GL 1ONQB 4UI2A 5CP3H 4UT9L 3VXMA 3B9KA 4P2OC 1G9NL 6FABL 2EXYD 43C9B 1A6AB 1IEHA 5HVFB 3I6KA 3QHFL 2DWDA 1I8IB 4JAMA 3RUGA 3SDCA 4BELD 1O5DT 2QHRL 5C6WH 3L7EB 1F3DH 1HHHA 1KNOA 1T2QH 4PJ5A 4YXKL 4WFHE 3K0WA 3MLVH 4OF8A 5KJRH 1AHWB 1KLFA 4FNLL 3WIFB 4XPGL 5K9OB 1FNAA 5JW5A 4NN6B 4NKIH 1R3JB 3IU4H 4C57C 5FO7B 3F12A 5ELIA 2XTJC 3C6LA 1AE6H 5F7DB 5IG7A 2Q8AH 1CLCA 3EBAA 3H7BB 3HZMA 1KN2L 4G8EB 5CINL 4O9HL 1VGKB 1P6FA 2D0HA 2X9XA 3DXAE 4O02L 2Y1VA 2CQVA 3ABZA 4Z7WA 1U8PA 2P45B 4ODSH 5M95B 3KXFB 1WQVT 5BMFL 4HPOL 1OWRM 3QXAA 4HIJB 4NN7B 4XBGB 1F6FB 3QRGL 4KQ3H 2CSPA 5C0FB 3X3FL 2IPKB 3BZEB 2OJEB 4F2MB 2AKRA 1T1ZA 3S37L 2FR4B 5CP7A 3HC0A 5GS0L 4BFEA 4OZIB 2DBLH 4OKVB 5D7SH 3QIBD 1CLOH 2ITDA 4X5LA 3MUJA 3MA7B 5CGYD 1FV1A 4DK3A 1DQDL 3AMLA 3QWOA 2BNRD 3KDMA 4ZAKD 2D0FA 4R7DB 4N8VB 3T2PA 4L3EA 4HW6A 3RDTD 4S0TD 1NKOA 1ORSB 4LASL 2W1NA 4P9HL 4RFNB 4YX2L 2DS4A 1N7MH 3E1F1 1ZA6B 2UUDK 2EE6A 2LU7A 2XXCB 4FQ2L 5TPWL 4HGKC 1X6NA 3ECBB 4M5ZL 5IJKA 3GSXB 2GAZB 3C09C 3VD5A 3IVKB 4L1HA 4JEGB 2AVGA 1MFEL 4M1DL 3GNMH 4IOIA 1V7NH 2MFNA 3QQNA 4EN3A 4HK3J 2AJUH 1IE5A 3G9AB 1VACA 3RWHA 2Z93B 4DW2H 3MRDA 5E99H 4YHKL 5EFIA 5KVEL 3PP3K 5FYLD 1JHTA 3MJ9H 2R0LL 3PHOA 5EC2B 1UGNA 3HG1D 4PGCA 4X98B 2VDNL 1LP9B 5A1AA 3CMOL 3TV3L 1I8KA 2ZCLH 3P11H 4JFDE 5IWLC 3FO0H 3QZWG 4L3CA 4JHWL 1M7DB 4EI5A 1T6WA 3LKSA 1OQOA 2WINB 1IILE 2B2XH 2C1OA 4IRSA 3EYVA 2FIKB 3D85B 3PQYB 1CXFA 3LQAC 4M62H 3DO3A 1X9QA 3X12B 2VH5L 4M02A 3WFEH 3G08B 5MEND 3MRGB 4I4WB 3S8WA 2EYSA 5GGTA 2QR0B 5JR1H 32C2A 1A6VH 1KLGA 5ITFB 2W9LA 4PRIE 1HSBB 4FQ1H 3LEXB 4WTWA 3T1FB 1ZGLM 2ZCKL 1MCFA 5DQJB 1YNKL 3IDYB 4XNQA 5F21B 3SO5A 4X4MA 3BD4A 1ZLWK 4X6CE 5DJYA 3RU8L 3VGAB 4TNWF 2EDWA 4DGVL 2BNQE 1YECL 1GXEA 1R5VB 2UVFA 3MRMB 4EOWH 4QTIL 1W0VB 5FAAA 2PXYC 2V2WB 2AJ3B 4L8CA 3ISWA 4HWNA 4P9MH 4MCYB 1U92A 2I27N 5I1IH 2WMPA 5IKCB 3DWTA 4OCWL 5CGYC 1RZ8A 2GJ6A 5KSBB 3GB7B 3X11B 1AD9B 1VFBA 1AI1L 1E4KA 4NJ9H 3WMSA 4M00A 5DYOA 1FZJA 4OZFA 5C6PB 3U6RB 4POZD 2YC1B 3T4AB 1JNHA 1FYTD 2JB6A 2ESVD 2BSRA 4AY0A 2HJFB 3EO1A 3RRQA 4XX1G 4MA7H 5FCSH 7CGTA 1KJ2H 3FTGB 4PP1D 1DDHB 1BQHB 1U8OA 4M1GH 1VEOA 1E6JH 3NTCL 3UBXB 2VMFA 3KYMA 5ICYB 1MJJA 5CHNB 2RR3A 3GHBL 4R3SB 4NUGH 3CIQA 3EOBA 4RBPK 3VFNB 3EDDA 4YE4H 4QHKJ 2H2SC 3JV6B 4K94H 1C08B 4OSUL 5C07E 5T3ZH 1G7LB 3K2UL 4WHCA 3NA9L 4XNUL 1F97A 3ZKND 2NXYC 3JV4A 4LSRL 2P44B 2BDNH 1FL6B 3QEQE 1IAIM 5F93C 4YFLF 1R24B 2JF1A 1I7RA 3HNTH 4EUPG 3TIEA 2L7JA 2GITA 2OJZH 3PL6D 3I6LE 4HLZG 1AGDB 5E8OA 4J3OC 5BZWB 5C8JB 2K1MA 3GMNA 3V5KA 4ZUWB 2J88H 3DV6B 1WZLA 3LPFA 1QYGH 3VA2C 3WL9B 4QT5A 5KBNC 1AFVH 4NNXB 4JLRB 3U2SA 4AIOA 5EBGA 4QTHB 3GSNH 3IDIA 3U7YH 3TBSA 4N8CL 4KI5D 3GGWA 2HKFL 3KAAA 4KZEL 5KVDH 4PLNC 4W4OC 1MAMH 1U2CA 4LARL 3TEUA 2E8ZA 3IF1A 1CFQB 1KULA 1ZHBB 4LFHD 5KN5B 1T03L 2A83A 4DVRL 3EJYD 3OX8B 4QGTA 2RBLA 3IDXL 4WO4B 3NMEA 2H9GA 1FSKC 4NQCE 3T0EA 5E08H 4TQEH 1L7TL 3D48R 2JE8A 3QIWB 4IM8A 1U91A 2DQDL 4PJHE 1K4DB 2J4WH 2DTSA 4GBXA 1C12A 2XQBL 3X14A 4PRNA 4RGOL 5SWSD 5CBEA 3T77B 4D9RD 3SDAD 5HHOD 1KXTB 4K7PL 4V1DB 3M45A 2IBZX 1GPOH 3ULVL 1MI5D 5EC1A 1A3LL 2Y6SC 4HHAB 1EAJA 2CDGA 5I8CB 1OAUL 4F15C 1KCSH 3LDBC 2CKNA 3QWQB 5SWZA 3CFIC 2BFVH 3MRQB 2FX9H 1JP5A 1AR2A 3WNLA 2CK0H 1Z0MA 2PYEE 4WUUD 4ZDHB 4PGJA 4ZODA 5I18L 3HMXH 4U1IB 3DUSA 4UIMB 4PP1C 3MV7D 5KZCB 1K3ZA 5E2VL 2QHLA 4AEEA 1CFVL 1S9WA 4BSWB 3G6AB 1HWGB 5C9JA 4CNIA 4GO6B 1TDQA 4UIKL 5ESVB 3LKPA 4Y4FD 2AS5M 1F02I 4OJFL 1YEGL 5J8OA 5J12B 2VDML 2FGWH 1UJ3B 1FGNL 1MJ7H 4RNRB 1UWEL 3MLRL 4ACPA 3NACL 2F5BL 4N8VG 2K3TA 2JB5L 5A2IH 4HKXA 5BXFB 4YGVA 4TYUA 3GUTA 2BVPB 2P8MA 4F7MB 5HDBE 5J11B 3ZT7A 4NWTL 4JFFB 5IV2B 1UZ6F 4JO1L 3PL6C 4JR9L 1RZGA 1QSFA 4K55A 4WNQB 1C16A 4YUEL 4GUPA 4DN3H 1ITCA 1MFNA 4H26A 4J3SA 1OOAA 3G6JE 4JPKH 3WNOA 3O0RH 1XCQA 3V5HA 1MWAB 5K59E 4G8GD 5IW6A 1G6RH 1TQCB 4Z0XB 4TNVK 3W2DH 3DX8A 1PG7L 4HJGA 2EO1A 5JMOC 3ILPB 5DRNB 1PGRB 4NQEB 1W2KT 2CPCA 3ZL4L 2DLGA 4PRDB 5FYKE 4QLRA 4F7TB 1NEUA 3DHJA 2X42A 4UDUA 1ZTXL 1CGWA 4KH2A 4ZXBA 2VXTL 4HF5L 4M7KL 4U1LB 3SJVB 3RWCA 3JWOC 1DR9A 1AGEA 2JJUA 5MHSD 4WHTB 5AAWA 1JFQL 1Z5LA 4NO3A 1PQZB 4N90E 1MHHA 2FATH 3LEYL 3TN0C 1I3UA 5CFHA 2A6JA 2WLZA 2Z0BA 2DRUA 3TZVA 3FB5B 4Z7OF 3LKQA 4E41A 1UM4H 1I1AB 4W70A 3SDXB 1AGCA 3OAZK 4G9FE 2P5EA 4ZPTB 1FBIL 2P8PB 4P0DA 4OLVL 1QFOA 3U1SH 2N56A 2MQ3A 3OL2A 4HCRA 3GEWB 3VE0A 1A3RL 3OAYK 3INUH 1KIUA 5EN2A 1U8HA 2VAAB 4PRHE 4P4RA 4MAYB 1I85C 1T66C 4APQB 3PWJA 5F7EL 1OD9A 4Y4FC 4Z7NE 3D3VE 1SEQL 3KG5A 1T5XB 3RVVD 4LSQL 3QDGE 3DVFA 4NKDB 4O2FB 1HH9B 4MHHG 1XF3B 2QSCH 2AJSL 3NZHL 4HFUL 4K3DL 3LMJL 4ODXB 4M7ZB 3UTZB 1LO0H 3SGDH 4ONFH 4MQXD 4R4FL 4P3CL 4GG8A 1MHEA 3HB3D 2VQ1A 4KRPB 4MDJB 2WBJD 4K71B 1YEHL 1IGYA 3PWNB 4MZ3A 1HYSD 1PKQB 1BQHG 3IS0X 3QXUA 3UBXG 3U0WL 3LQZB 1NGQH 1AGBA 5D7LD 5D7JD 4MNQE 3TT3L 5F6IC 2R2EB 1H3TA 3D5OF 4M6MH 5IBTH 3E2HC 2XKNA 5FV2A 3FQWA 1NCCL 1QFUH 5F9WC 4ZFOB 4L8BB 5EZLB 2XRAH 5IMLB 1A7RH 4URTB 4X6FA 4DQOL 3U9PL 1FG2A 2Z31C 2PCPB 4P4KD 5B8CC 4ORGA 4YHOH 1EH9A 4QOKA 3BQUB 5E8DL 3SCMD 3TJEH 4LL9A 3VFWA 2RFXA 4MWFB 1CF8L 2W59A 1U36A 3BH8A 3VMOA 2KQMA 2CLRB 2D3VA 3KYKH 4K8RL 3U9UB 3MNWA 5GHWL 5T1LB 2X2YA 3TCXA 2A1WH 2NY0D 4AEFA 3GJFA 4Z7UA 5I73C 4OZ4A 2NY3D 2HVKB 1HKLL 5ETUB 1T1WB 2Q7YA 2EC9T 2NX5E 4OQTA 3GSQB 3S96B 3QUZD 2G9HA 3V4PH 1GAFH 3MLUH 1MQKL 4Y16D 2IH3B 1EEYB 3O4LA 3OAUL 2BRQA 1A7PL 4M93C 3EGSB 5BV7L 1YDPB 2J8OA 3UPRA 3G9VA 5HVHC 3SGEH 2Y07L 4OLWH 3PP4H 1DZBA 3LHPL 1FFOB 3U30C 1J0KA 4MVBC 3MRPB 3X17A 5DMIL 5IB1A 3L3GA 4PJGE 5FEBA 4IRZH 4JG0H 2DYPD 3WS3B 1CXEA 3RVVC 3MLZH 5FGBA 1T7XA 3ZKXC 4OV6F 5EO9A 4WU5A 5AYUL 2XYCA 2JIXA 3CU1A 1FNHA 5FYJH 1MVUB 4M48L 2HWZH 4GRLC 1GOFA 3T0DA 3HB3C 1HI6B 4OD3H 1UT9A 1XIWB 2WBJC 4NJAH 3DJ9A 3E0GA 4OD1H 1XF2A 3O8XA 4MMZC 2QBWA 3ARED 4NQDA 2VDQL 3CFDB 4CMMA 3QJFB 2J8UB 4JM4H 4D9LH 1FNGA 3BP5B 3QQ4A 1AC0A 3RIAK 4LCUA 3EFFB 4KI5F 3W39B 5IP4A 5D7JC 2VZVA 5C0GA 5I1AA 3QUMA 1CFSB 4HUUB 4CJ0A 2GTZB 3IJSA 8CGTA 2RGSA 2ORBL 3QHZH 3G5XA 1EFXD 2LE9A 4PJEF 3GMMA 2GJJA 4OFIA 4ONHA 4XCFH 2FYYB 3TT1H 4PJDF 2ZPKH 2FBJH 4FQXA 3RWFB 1U8QA 5A3IC 4J2XA 4P4KC 3BRDA 1DE4A 4H25A 4LCCA 4DUVA 3F7PC 3SCMC 3LRGA 1UKSA 4FFZL 3IETA 3C8KB 4IJ3B 4RSVA 1S78C 4RDQF 5HJ3B 4XXCC 3DX7B 3U46B 2VYRE 1RZJH 1J5OH 2NY0C 3C5SA 1G84A 3HE7A 1A4KB 1FZOB 4L3AA 3SBWA 1S7SB 4X6DF 4ODBD 3ARGD 3BKCH 4P57B 4WFGE 3FT2A 5TDPA 3GI8H 3H9HA 3G04B 1JMZA 1T1YB 3VJ6A 2OTPA 3W9EA 4F8QA 2VSCA 5FO8A 1OAYL 4LP4A 2OK0L 2V2TA 2CIIA 1T89C 1LO2L 1QACA 4OF7A 3L3OA 1QQDA 4ZUTB 3BKYL 4ERSL 3ELAT 4YDKL 3IKCB 5F89B 1KGCE 2X9WA 3FN0H 5HHNB 1RUPL 3NFNA 4LEOB 5E7BA 4G8FB 3KNBB 4JY4B 1EVTC 4NN5B 2Z8SA 4RGNC 4QNPE 3PV6B 2NTFB 4JFQB 4YXHL 1IGJA 2V17H 2CKBH 2ERJC 4XPAL 1J0HA 4XAKD 1UZ8B 4X9BA 3AMKA 4GKOA 1P4BL 4XPTH 2VR4A 1NDGA 4QRUB 4ZOEA 4XAWH 2VLME 3VFMA 3ULUC 1MELA 1JHKL 1PD6A 1CR9L 3GSUB 4RFOL 4WWKD 3AREC 1UYWH 2MHAB 5C0BE 3UTPE 4EDWH 5JOPD 4U1NB 4G9DB 1RUKH 5EH1A 4GSDL 3RNKA 1NSNL 5T1KA 5F88B 2AJYH 3WXWH 3ZTJG 1ND0B 3BDXA 4DGYH 4M6NH 3F7QA 4IEFB 5DDHA 2W0FB 3CFEB 3O6ML 1ETZB 4LHUB 4HZAA 2F53D 2H6PB 1YMMA 4UBDC 1R3KA 5J4MA 1ZANH 4MJ5A 1RIVL 3AY4A 2DDQH 4FMFA 5EOCL 4A2LA 2M26A 1J8HD 1JF6A 3P0YH 2ZUWA 2CRIA 3DRTA 3QDJA 2VDRH 4PY7A 4PFEA 4KHXL 5L88H 2ID5A 1ZHLB 3LKRB 1Q72H 5GGRB 4LHJB 1CDUA 4XWOD 2PNDA 4C56B 1WFNA 4Q97A 5TQ0H 4HKZB 1D5IH 1EAPB 3NZ8A 5EUOF 3U0TB 3ZT5A 5JXEC 1B6DA 3EFDH 5DMGD 4S0SD 1B0GA 2YD6A 1YEJH 3DO7B 2ADIB 4BA8A 4MA8L 1FFRA 5D5MF 5HGBA 2R4SH 1FO0H 25C8H 1QEWB 3FQXA 4Y5XC 3NAAH 4Y4HD 3F5WA 5HGAA 2VQTA 1C5BL 4P2RE 4XBEL 5C0ND 2VLJE 3ZHKA 1P9MC 3NABH 4NPYB 1CLYH 4EIGB 1MY5A 4MA1C 3WO4C 1RY7B 5ICXB 1RFDH 3QUXB 5CLWA 3R1GH 1UM5L 3FONA 3MOBH 4P5TB 1C5DB 4LCYB 4G7VH 3BVNA 1RUAL 4JJ5B 3BKML 2ZOLA 2NY4B 3FRPG 4YR6A 1HQ4B 1QBMH 2FO4A 1MWAH 1JI1A 1S9YA 4IOSD 2QEJA 2YPLE 1MF2L 3SE3C 4YFDB 4WU7B 5IFJA 3NPZB 3MCKB 4WTXA 3AU1A 4GOSA 5DJ8B 2ADGA 2CRZA 3LS5H 1J9CT 2OM5A 4WV1C 1JHLH 1YN6B 1AXTH 2EDBA 2ZOKB 4MX7A 4OUUB 3UJTL 4KZDH 5MI0C 1TQBB 1NCUA 4EI6B 1A1NA 5DI8A 1RSFA 1RQ5A 4GT7A 1WV7T 2F19H 3H9SE 3WCYA 3S34L 3C9NA 3RGVB 5ANMA 1K3IA 1MJUL 4LQFH 3QIBA 4YIQB 4LGSB 1CLZH 4IIQA 3OXSA 3Q5YA 5LVEA 3SDYH 1UEYA 3CPLB 5F70A 1L7IL 1ADQH 5IHZA 3BP4A 2BNRA 4ZAKA 1LK3L 1JGEB 3RTQD 2GT9A 1OB1A 3RDTA 4DKEH 3MLSL 4DWHA 3DXAB 3HNVL 3GSRA 5I1HL 4U1KB 3U48A 1YA5A 4Y1AD 3MGOA 1WGOA 1YZZA 2Q76A 1JPTL 5GISH 5EU7E 2OR8A 4JPIB 3FQRA 1BREA 1FLRL 2HLFD 2BXZA 3Q1SH 5F3HB 3DIFB 4HIEA 2VB5A 4MDIB 3D39D 5K9QG 5DMGC 1NGYA 5GS0D 3ZYIA 4X5XA 3EYUH 3SGKC 4EVNB 4PR5B 1G7MA 4G3YH 4F3FB 1ZT1B 3ZTJH 1A5FH 4Y4HC 1DQML 2EDJA 2RQ8A 3A0OA 4GW1A 3ZYOA 4JHAH 3D0VB 3MOAH 3J8F7 3S88L 5EBWA 3GMRA 2ED7A 1I1FA 1E4WL 1RHHB 3GBMH 5HHPA 1CYGA 4QRSA 2IC2A 3HMWL 1IGFH 5IHLB 1N0XL 4JM2F 4PJ9C 1T0MA 4JFEE 2KZ1B 4WHDA 5D93C 2BC4A 5J3HD 4P5MA 1I7TB 2XA8L 1N4XH 5MENA 1G9NC 3GMOA 3VXRD 3MNZB 1PZ5B 3I9GL 4PJFF 3BI9X 3T4YA 5MEPA 3ARDB 2DQIH 2MKLC 3EOYG 2ITCB 1T1XB 1F11A 4KXZH 2W65A 3MRLB 4NQVB 1KLUA 5BOZG 4NM4H 3K8MA 1D5ZA 1QSED 1S5HA 4HS8H 4U1MB 2VZUA 4Z7VF 4WUKH 5E2JA 1ZWIA 1BJ1H 2WQ8A 1IGMH 3DOSA 1HSAA 2VR5A 1L9MA 4UZGA 4KRMB 1T2QL 2BP3A 3U7AA 1D9KC 2F9BT 1DVFD 4IHOA 3MLVL 4JFDB 3CZJA 4FZ8L 5IB4A 4QRQB 2UZXB 2I26N 4YHPB 4LPWA 2HN7B 4R90L 1S7QB 4LVNB 4PLKD 1H15A 4PYGA 5TH2B 3QFJE 4WI2A 1TPXC 4FXKA 3SKNA 1JZ3A 1YYMH 4C83A 4I9WE 2R56L 5KS9F 3SDDB 2VKWA 3S3JA 1S7WB 2Q8AL 5HPMB 3L7FB 1KG0A 4OZGF 4AIXA 3RWDA 2OXGA 1IM9D 4NRZA 5E8NA 3O6FD 5L8LB 1OTSD 4PRIB 3UJJH 2C26A 1FYTA 3KPNA 4YBLB 5BJTB 2ESVA 1H5BC 4H0GA 2CLVB 3NIDE 4H0IA 5EUKB 4ODSL 3V6ZA 4DFHA 1NCWL 2BNQB 4QRRE 3VWKD 2HA1A 2HLFC 5E00A 3BPNB 2NY6B 2MCPH 2VUOA 2MQCA 5GS0C 4X9IA 3ARWA 2ZG3A 3QUYC 4LHUG 5KG9A 1LO4L 3HZVB 3PWUB 3T2NL 3B8YA 3KLAB 4G43B 4GAGH 4HIXH 5D7SL 3MTRA 1CLOL 4KFZC 1DLFL 4UNTA 3GK8L 4J6RH 4UNVA 3TF7C 1UM6L 4AZ8A 4H20H 4WW1B 3QH3B 1Y6NR 4ODUA 3BPLC 5DQDH 5AAMA 4FQCH 4Z95H 4L9LC 4LOUC 2LVEA 2BSED 3A6BH 3BEVA 4J7RA 5I66A 2I9TB 3OJVC 2IG2H 3PL6A 1S9XB 3VXOB 4NO2A 4TNWK 1HZHH 1N7ML 2V9TA 1HK6A 4R8WL 4XNZB 1KENH 5J3HC 5BRZE 3MLWH 4ZFGH 2GW5A 5ISZE 2YA1A 2FSEA 2X4QB 2YA0A 1AD0A 1RZ7H 1XGPB 4RWYH 1TZHB 1SYVB 3GSVB 4GRWB 1J87A 4UQ2A 4KY1L 2AK4E 2IPUG 4HFWB 4TVPD 2OTWB 1A7BA 4H8WL 2VDPH 3BO8B 3KPRE 5I76A 5J1TC 4MJ4A 2MWCA 1OAQH 2DMKA 4RIRA 2AEIT 5C07B 4C59B 5E99L 5EA0H 3QSKB 1W72A 3MJ9L 2EC9U 1W0WA 4LLMA 4PJEA 2NY7L 5F8QC 1WCBA 2UZIH 1VKXB 5JOFB 3NA4A 2H26A 4PJDA 4X4YA 1DVFC 3QEQB 1OTUC 1CVRA 4QHLB 4Z5RB 1OP5H 5C0RH 2FL5B 3WXVH 2IAMD 3OKOB 4HX1B 4N9GB 5FB8B 3K8KA 3SDAA 5DD1L 3WFEL 4AEIH 1FYHB 4PUBH 4JCMA 3DMMB 4EDXB 2R0KH 1FH5H 4X6DA 5KOVC 4G80B 5JW4N 1N26A 1S5IL 1OTSC 4LAQH 4FQ1L 4JRWA 4AH2B 4YC2B 3FO2B 5HYIA 3MUHL 4F8TA 4XMKH 1HCFX 3TC9A 4WUUA 2HJLB 3MNVB 2OTUB 5IB2B 3MV7A 2BSSA 3MFGB 5GJSL 4KK6D 4EOWL 4NQCB 1B90A 1S7UA 2FX8H 3ULSA 4MQSB 4LSPL 1KJ3L 2P5WE 4FFWC 4PJHB 5A2FA 4KKAD 1M7IB 4IS6A 4M7LT 1TETL 2VDKH 2HG5A 4CW1B 4D0DB 4HMEA 1NCDH 3ULVD 1KIPA 3OKDA 4LKCA 4P99A 4X7CC 5GSVA 5E8PB 2IANE 3Q6FB 1N64H 2R23B 5ECJE 4HKJB 4LAJH 5BZDA 5JXAL 2GKIA 5CWSB 1TJHH 1M6OB 4BZYA 1BM3H 4PB9L 5GGSA 5IEKA 1AY1H 4XCNB 4MA7L 3KXFD 1A22B 2PYEB 5BQ7A 4G8GA 2QSQA 2YR3A 1CGSL 2PW1A 3IU3B 4HH9B 4M1GL 2QQQA 3O11A 1OGAD 2HT3D 3BPOC 1H3XA 5D1QB 2AJZA 5KSUB 3H3PL 1BJ8A 2KL6A 1P1ZA 3MBXL 5GGUA 3SGEI 1Z3GH 4NUGL 4NHUB 2Q1EA 3C6SA 3K80A 4YE4L 1ZT7B 1KPUB 3LV3A 1DEEA 2VLKE 4RMTA 5GRVL 4U6VL 5F7HA 2BDNL 2DQCL 3U83A 3QEGH 1EBAA 1D5XA 2ARWA 2A9MH 4GG6E 3V4VH 3HNTL 3KPQA 3OKMB 1BZ9A 3VI3F 2OJZL 4E0RB 4XP9L 2IAMC 5CD3B 2I5YH 3FOLB 1CBVH 1OSPH 4H1LB 4V2BA 4DTGH 1J86A 1NBZB 3G6JB 1T20A 4Z7WE 5L9DH 1IC4H 1V3JA 5EUOA 3V6FA 4BFIB 1NCNA 4NFDA 2XFXA 4XZUB 1SJHA 3U7YL 1AR1D 5D5MA 5FHAL 3MUY1 3Q3GA 4HK0B 5K9KA 5EU3B 5KVDL 2VZOA 3JWDH 3WN5C 3ZHLA 5DEFA 2YPVH 5J1AA 5I30H 4HG4J 5CMAA 3PGCA 2PF6A 4QCIB 2X4SB 4KK6C 1A1MB 4F37F 2ICWI 4TQEL 4UOW1 5KW9H 2Q6WA 2QADB 1AHWC 4DOHE 1F58H 3E6FA 3U0PB 2J4WL 4NWUH 1CS6A 1I8MA 3CK0H 2WUBH 4L3EE 3ZHDA 1QRND 5SWQA 3D85D 3PQYD 4JFYA 4AMKL 3H9ZA 5IQ9B 3ULVC 4PTTB 9CGTA 3C08L 3ZDZE 1GPOL 1I8LC 4G9FB 4LDLB 3I50L 1BIHA 2PTTB 5D7IF 4CDHA 4UMGA 5DHVA 3PJSA 3BP6B 3TPUB 5F1KC 4RX4D 3ZE2F 5D7LA 4NN7C 2X05A 3VWJC 5FOBB 4PRHB 5IT2H 4M7JH 1Y18B 5T1MA 3LS4H 3RY5A 1CDIA 2AXGA 3MUGA 4FRWA 3VGDA 3D3VB 4PJBF 3D6GA 2FGWL 1J0JA 1VFMA 3WIIL 2HKHH 3MCLH 3L9RA 1HHKA 4AYFA 5TE4H 1MJ7L 4NCC1 5T5FH 1AO7B 5DMYA 1CICB 3ZDXF 1OP9A 4L1DA 5INCB 5M7QA 1T80A 1CXKA 3TNMB 1QOKA 3I3EA 4KMTH 3B4NA 2NXZC 1RZKH 4RFNC 1TZGH 4P3DB 4XPHL 3BHBA 2GUOA 4M6OH 1EUTA 3O0RL 3NPSC 3VXQB 4IMKA 1G6RL 1A6WL 4HUVA 3QUZA 5GSRB 4MNQB 4Y16A 5L2KE 3E8UL 1AR1C 1SJXA 4KKCD 2VISB 4Q9BA 1FFPB 4ZPVA 5EO1A 5JO5B 2VAJA 5FM4A 5EBMA 1BFTA 3NN8A 2B5IC 3FKUS 3KPOB 2A73B 1QO3A 5IF0B 3DV4B 3CGTA 1IAKA 1S7RA 2DYPA 1DL7H 5IMMB 3FFCB 5ITBH 1BBJA 4Z7QE 1EGJA 3LB6D 2FEDD 2MTPA 1A0QL 1GZPB 3EYFB 4N0UA 2W0LA 4UU9A 4ZS6D 4JM2A 4HWBA 1MRCH 4NRXA 1KCUH 3WJJC 3EYSH 5JUEH 1VADB 2CUMA 2J5LB 4PJFA 2GI7A 1H3WM 1JPST 2NX5B 3BYYA 5BW7C 3UP1A 2IALB 4N0FB 2VOTA 3LAFA 3SPVA 2EIEA 4JDVB 1XF4B 4LRNL 1S7TB 3KR3H 3U1SL 5HY9A 5LBSH 1E4XH 4PJCF 4KGJA 3PWVA 2J8HA 4LP5A 4X80H 4IDLA 4WO4D 1RIUL 1OP3K 2Z35B 4XP4H 5IHUL 2NYYD 4QXUL 3BPCA 4HBCH 7FABH 4AK1A 3QIWD 5ALCH 1EFXA 5DJZB 2PR4H 1FIEA 3QI9A 4BM7A 4OI8A 4BZ2L 1WIPA 2V7HA 3LSOB 4Q58C 4I5BB 4LPXA 2FIRT 5KS9A 2VZ3A 2QSCL 4IDJL 4OZHF 1HKFA 2NY2C 5KSAB 4RGNE 4V1DD 5CEZD 1LO0L 4NZRH 1P7QB 1UENA 3B2VL 4OZGA 5F7UA 1HIML 2DJ4A 2AERT 2P42B 3D25B 2P7TB 1JWMB 3FMGH 4NYLB 1LVEA 3O2WL 1TCMA 4D8PA 5KAQG 2G75A 1X4YA 3DX6A 3GM8A 4L8SB 4F7CB 1CD1B 3HZYA 4XH2B 2BY3A 3ARGA 4OBSA 4F9LA 1NGQL 5HHXL 3ULUE 2BRRL 3CFJB 1FVCA 1U8IA 4YWGH 1KTLB 5KZCD 1YN7A 4MD0B 1XF5A 2J2ZA 2ENSA 1DN2A 4GJTB 5IBTL 3CDFA 3G5YB 3V52H 5F1NB 1QFUL 4CRPA 4XC3L 1P9MA 4AM0B 1YJDH 2GFBA 4OAWA 1NGPL 1E27A 3KPPA 4PG2C 1OT1A 1Q8MA 4Q6IC 3VFUB 1XH3A 3MROB 2ZNWA 4FTVA 3TJEL 4H1LG 3FQNB 3LB6C 3MRNB 3DSFL 3VMPA 1T7YA 4JFFD 2IFGA 3KYKL 2BCKB 3CSGA 1TMCB 2CRYA 4Y19E 2F54B 3O4OC 1TZIB 4S10A 3ROOB 2Y06H 1L6XA 4PP2B 2YD3A 2EYRB 5DLML 2ATPB 3O9WC 4I18C 5F8RC 4NC1C 5SWZE 4MJID 3KLHC 1II4E 4GRWH 4YDVB 2W07A 3L5XL 3MJ7B 2DQGH 5BV7C 3V4PL 1GAFL 3MLUL 5B3JF 1FE8H 3PHQA 1A02N 4WWKA 3V95A 3RZCC 3WD5L 4NQED 1FZMB 3CXDL 3ARBC 1Q9LB 4MNGE 3BGAA 4U1HA 3C5ZB 3MLTB 3BUYA 1BP3B 1J05B 2HFFB 3PP4L 1F13A 4MD5A 4OLWL 5ACMA 4B53A 1CE1H 1QLEH 1U8LA 1MRDH 3VXTA 4MXWL 5TE7L 2X5PA 3TA3C 3SJVD 5EU4B 3GIVA 2B4CH 4Z18A 4OZIF 3EDJA 3QIWC 1DQJA 2Q8BL 4X4XA 4UV4H 3BFOA 2F53A 4GAFB 5B38B 3VXNA 2OZ4A 4YHNB 1A9EB 3RVWD 5E2TH 5BVPL 4JZJB 5HYFA 1BJMA 3D2UA 4GS7B 4F33B 4WVRA 4OZFH 1MCIA 3OSKA 4R97C 3OR7A 1I1AD 4MXVF 4JDTL 2FH6A 1RZFH 3WBDA 3T3PF 1HHIA 1OW0A 1B3JA 2IGFL 3QNZA 4WDIB 2WUCH 1Q94A 4P2OB 5J9PA 5C0BB 3GHEH 5C08A 2HRPH 4X9FA 4D9LL 4JM4L 3UPAA 3SGKA 5LCVH 2DKUA 3CDGB 4CGTA 5K9JL 4XNMB 4HZLB 4MAYD 2IH1B 4O51B 2VWEC 4Y4HA 4TULH 5JDJA 5DMKA 1LE5A 3MXWH 4KK5C 1BOYA 3NCCB 4MD4A 1NFIB 3UTOA 3KLSA 3QFDA 4G8IB 4N68A 1NGXB 2V7NA 3TT1L 5F7WC 3ZE1F 1XGRB 1S8DB 1Y0LA 5TFSH 2XIDA 1DBAL 2XN9D 3ZSSA 1EHLH 4CADA 2DQHL 2UWEF 4KRPD 4UDTA 4E41E 2RJMA 1U2HA 4X99B 1EA9C 4NKOB 5C71A 4RWHA 3SY0A 4NBZB 1J5OL 3FZUC 1WBZA 4TUKH 3VFSB 3DETC 3UC0L 4CVZB 2GJZB 1K8IA 3HC4H 3B9DA 4OLXH 2GSIB 4JO2H 1CXLA 5H37G 1JF1B 3BZFB 5IVXE 4I0PD 2X4TB 1H8NA 5E9DD 4PV8A 3GMQA 1JTTA 5HD8D 4OLUH 3IB4A 4P2RB 1UKQA 2R1XA 1BOGA 2VLJB 4RGMB 3MV9E 3TFKD 3P9LA 2CIKA 4A6YA 2H32B 1AKJB 1DFBL 5DZNA 1TLKA 1LEIB 3HPJA 4HQQL 1ROWA 3E3QC 3HNSH 5DHXB 1BD2E 2AEQL 2APTA 4XP1H 3EZ8A 3FN3A 4JQXA 1XZ0A 1MFAL 3BQUD 1YPZE 3FB7B 4L29A 5IOPA 4U05A 4YDLB 3VG9C 3IAQA 4RA3A 3MRIB 3H8NA 5EIIA 2V17L 2CKBL 1OD7A 3RVWC 3M17A 1KBGL 5D9SB 1UA6L 5T1LD 3RTQA 4FQPA 1U58A 1MLBB 3TBVA 5F7FA 1EUUA 5F9DC 3U36B 3RAJH 3WYRA 1GH7A 5DD0L 4JDZB 2YPLB 1I1AC 4Y1AA 5IBLC 3V0WL 2HMIC 1KTKE 4O4YH 4JG1L 1M71A 1V7ML 2FNBA 5JMRA 1NMBH 3NGBC 3D39A 3C09B 2R39A 4OCMC 4BK4A 3FRUB 4YK4C 4DJMA 1F90L 1UVQA 3VFTB 1KJ2A 4RMSA 3OF6D 4XC1L 1CWVA 5FM5O 1DBKL 1RUKL 2ZUTA 3V2AR 3VA6A 5C0EA 4NNYA 3FB8B 3BE1H 5J56B 1SBSL 3WXWL 2AJYL 1B0RB 3BW9B 4DGYL 4M6NL 1IQDB 2HVJB 4XVSH 2MNUA 1WT5A 2HJKB 4DN4L 4PGDB 4D0BA 1OAXL 3ALPA 1YQ2A 3FAWA 1WZ1H 4KUZL 3GMPA 4QOKE 2X41A 3BMVA 2XT1B 1ZANL 4RAVA 1AC6A 1URLA 3P0YL 4R0LB 5EULV 4GAYB 3BESR 4M7ZC 2VDRL 3LKNA 1KFAH 3FQTB 5TDNA 3BISA 1XIWD 4Q74A 3QJHB 3QEHB 3UTSE 1LEKA 4QWWC 5F72S 5D7IA 1F2QA 1MUJA 4YH6A 5FECA 1D5IL 1FNEB 3HLAA 3M1BB 3O4LE 3T0BA 1P4LA 4LNRA 3EFDL 1BFOB 2JELH 4HV8B 3LN5A 3GSNA 4OF3A 1U8KB 4ZFZA 1K8DA 4WW2B 4ESKA 1NAMB 3KS0J 4I0PC 3ZKMD 1HDMB 2OMBA 4PJBA 2DJUA 2DM4A 1RK0B 5IVZB 5IW3A 2PXYB 3BXNA 3PGDA 4XB7A 2AJXL 2VLLA 5CZVH 1MH5A 1RFDL 3BN9C 5D1XC 3CC5B 4ZUVB 5E56A 4JFEB 5L0QB 1MHCA 3QZWA 4G7VL 2WWKT 2Z8RA 5EO0B 1IL1A 4Y89A 3RGHA 3HAEB 5IK3B 1IM9A 2CUHA 5DJDA 1BX2B 1VGEL 3AAZA 3O6FA 4YHMH 3WS6C 1PJ9A 3W5NA 3P77B 1JRHH 2F58H 3FJTA 1GOHA 1JWSA 5T33L 2XZCH 5CJOL 3VWKA 2I07A 4U7MA 3OMZA 4O58L 1BLNB 3DGGB 1JHLL 3OKKB 5CZKA 3CVIH 5FO9B 1HXYA 3GFUA 2WIIA 3HMXA 2P46B 4KZDL 1J1XL 1C8PA 1OCWH 3MJGX 5E2UH 2L0DA 2EIZA 4HUMB 5CJQH 5B38G 4E5XB 4LQFL 2AABH 2WV3A 3OV6A 2FJFA 4KUCD 3QFJB 1CLZL 1HILA 2X89D 3SDYL 2NXYB 3GSOA 5T1DH 2DBJA 5BVJA 5I1KH 5F3BB 1KEMH 3FQUB 4LSTH 1BIIA 1NAKL 4PRPE 5E94A 5ERWA 2BMKA 5K93A 1ORQB 4NM8L 1JMXA 1IBGH 3L95B 3T3MF 2BOBB 1XIWC 4GMTL 3U4EB 4ZQKB 2YD1A 4Y2DB 4QRRB 2VITB 5H2BA 3ESUF 5EOCJ 4YAQB 4FQQB 3IFNH 4GXUM 1G0XA 2EZ0D 3TVMB 1TTUA 4K7FA 4YHIB 1U95A 4NUJB 3MRBA 4P2YA 4BKLA 4P23D 2FJHB 4G3YL 3ZKMC 3SQOL 3MRHB 3B9EA 1ZA3A 1FSKB 3ZKSD 3P73A 4LHUD 4ZOAA 2NZ9D 1CDYA 3KVQA 2F15A 4NO0A 4OZHA 3NH7L 3A6CL 3GBML 4XVUD 3K2MC 1DUZB 3DLQR 2OSLB 4PJAA 2D7TH 2IAMA 2X4PB 1PSKH 5HYQA 4BYHA 5BRZB 4EUPA 3GJFH 1N4XL 5ISZB 1HHGB 4FFVD 3R0NA 2X4RB 3MA9L 3SDXF 3G5VB 4TSBH 3T2OA 5JNYB 4OQTH 4RAHA 4F15B 3LDBB 43C9A 2AK4B 4JFZH 4NM4L 4GKSB 1A6AA 1UXSB 2O5YH 3KPRB 3TPKA 1UACL 1IGML 4KVNL 5ICZB 2ICES 4UNUA 2VNCA 2DLFH 2YBRB 2FWOA 5C0DB 1IQWL 3TH2T 4MA3A 1KB5L 3L3KB 2ZG2A 3FO9B 2Q3ZA 5I74C 2CDFB 3BIKA 1AHWA 4HGMA 1RMFH 3WIFA 3QUXD 5K9OA 3IKKA 1R3JA 3U7WH 5FO7A 2FDBP 4P5TD 2NNAB 5F7DA 5JHDE 1QP1A 1IM3A 3H7BA 4U0QB 4G8EA 4KK8D 4MAUH 1R3LB 5EIVA 1IRAY 3QP3A 4FQLH 4ZUSB 3RJDA 2JTDA 2PUQT 3HUJF 3O3EB 3ORJA 3CZFB 5DUML 3P4OA 1KCKA 3KXFA 5DEGA 5L2JB 1SVCP 2W60B 4HIJA 4XBGA 3W5MA 4JKLA 1QNZH 1HNGA 3EHBC 3GKWH 4MSWB 5C0FA 1TJIH 3RI5F 1NL0H 1UCBH 4I3SH 1RJYA 2IPKA 4WFHD 2WZPD 2R29H 2OJEA 4F2MA 4HXAH 3BZEA 4R7NB 4HUWB 2FR4A 2PETA 2PO6B 3RGVD 3EOAB 4G6KH 1MCOL 1WWWX 4OKVA 4P23C 4OZIA 4GAGL 1NLBH 4GMSH 5GS1B 1OPGH 3MA7A 4HC1L 3V79C 4NDMB 4J6RL 4OCXH 2VIRB 5EPMB 4H20L 2HTLC 1E28B 4ZNEA 1CD8A 3W9DB 2NZ9C 5DQDL 3EOTH 4PIRF 4BFGA 4FQCL 4R7DA 4Z95L 1UZ6E 1SBBA 2J6EA 4N8VA 1UG9A 3A6BL 2E7LA 3TN0B 5JIHA 3DXAD 3KHQA 2EXWD 5T3XH 1ORSA 3B9KB 4DZ8A 5SWSB 4KDTC 1ZA6A 3MACH 5HHOB 1G7PB 1KENL 5HYSB 1INDL 3MLWL 1BQLH 1YNLH 5EU6E 3D0LB 1B88A 1SQ2N 3ECBA 4XCEB 3I6KB 2EDFA 3GSXA 3O6LL 2GAZA 3SDCB 3IVKA 4H8WC 5AZEL 1MLCA 1PBYA 3VRLF 2F74B 3CX5K 1QBBA 1WLHA 5D2NC 1E4XI 1YMHB 2VDPL 1WUNT 1KCRL 2Z93A 2COQA 4YNYB 3RY6C 1RUQH 3VD9A 3C8HA 1NC4B 2VLKB 4KRNA 1JZ8A 1VESA 1DSFH 5EC2A 2RB8A 4X98A 5E4EC 1CIDA 3V6BR 4Y4FB 3CMGA 1LP9A 3H42H 3VXUE 4P5KB 5IG7B 1M7DA 2ZUVA 4KVCH 4GG6B 2O61B 2V6HA 2WINA 1LO5B 1NDMB 3QUXC 4Z7OE 4NNPH 4P48A 5DXWA 4KV5E 3VG0H 3HAEG 4DKAA 2Z8WC 2FIKA 4PJ7F 2FD6H 3WJJA 3X12A 1U8PB 3G08A 3MRGA 4YBQD 4AEIL 1MAJA 4PUBL 4DKFH 5BW7A 2QR0A 1NH6A 2R0KL 3ARDD 3CCHB 1FH5L 3QXAB 4KJQD 4D0CB 5ITFA 1HSBA 3LEXA 5C0JB 3T1FA 4PV9B 3FO1A 2DIJA 4OCYH 5FDYA 3T0XA 4YHYB 1YEDB 3KHOA 4RX4A 3BP7B 1R5VA 4MJ6B 3MRMA 3EJJX 1VDGA 1C1EH 1W0VA 5CD5D 3E2HB 3E6HB 3IDGB 2FX8L 1KUMA 2V2WA 4JFDD 2D9CA 5F9WB 4DOHB 5FUCC 2EICA 4U3CA 5IHBA 5LGJB 5INDB 3KYOB 4L3EB 2Z31B 3VW3H 2C9AA 5B8CB 3GB7A 3X11A 2FHBA 2GSGB 1AD9A 3SDDD 4U31A 1NCDL 4Q2ZB 3STZB 2JKXA 5CEXB 5IB5B 1A47A 5I8KH 3ZE0E 4PRID 2EXWC 1MPAL 2YC1A 1RJCA 2DLEA 3SKUD 3T4AA 1TJHL 5I73B 2HJFA 1BM3L 1IC5L 4HPYL 1AY1L 2NQCA 4AL8H 4BJLA 2BNQD 4R6UA 2Z92A 4WFEE 2HTKC 1YEFH 2Y36H 3FTGA 1DDHA 1BQHA 2O5XL 3VRJB 3MX0A 2BXYA 3WFDL 5DVNA 4M93B 3UBXA 2D4DA 1BPVA 3SN6N 5CHNA 4ALAH 1WFUA 1YEEL 3ARQA 3VFNA 3CFCL 3JV6A 1C08A 2EECA 2OQJB 1G7LA 4OF6A 3K4ZA 5EORL 2C1OB 4P46C 3D87B 1FL6A 2ZSWB 1YEKL 4KUCF 2C3HA 3QEGL 1R24A 2A9ML 4JN1L 1JWUA 4ELME 3WEXB 1AGDA 3HHRB 5BZWA 5J89A 4PLJD 2I5YL 5C8JA 3CX5J 5HHVH 4ZUWA 3OXRA 1OSPL 3DV6A 4UT7H 4DTGL 1T7VA 4GRLB 2DMBA 4WEUD 3WL9A 4OLZL 4NNXA 4JLRA 4YBQC 2WBJB 1LEGB 3UXFA 5B4MC 4QTHA 4FA8A 3ETBF 1QA9B 1UJTA 4KJQC 5L2KB 3P4NB 2ZG1A 1R3IH 4Q9RH 1NAMH 1DBBL 1CFQA 3JWDL 1ZHBA 5KN5A 5I30L 1FL3B 4WWID 1U0QA 5C07D 3GJEA 3OX8A 5IEHB 2VXSH 4WO4A 1EHXA 3BWAB 3SE9H 5F97E 1F4YH 5CD5C 1K6QL 1N6QH 3QIWA 3QEQD 3WIHA 3GDBA 2DN7A 4GKNB 5DUBB 4ZTPL 1K4DA 1F4WH 4X7EC 1ES0A 4LU5H 4NWUL 1FZJB 1NMAH 3I6LD 1GL4B 3BAEL 2WUBL 2EDRA 3T77A 4P4KB 3CVHH 3LEVH 3SDDC 4V1DA 1H8SA 1MOEA 2YRZA 1MFCL 4NZUL 2BVUA 3DMMD 3EAKA 4XP6H 5DT1H 1BF2A 5IQ7L 4HHAA 4LKXA 2MMXA 4GAJH 5I8CA 4HMDA 2R0ZH 1U3HC 3UYRH 2NY0B 3BZDA 2BJMH 3MRQA 2EDYA 5DJAB 1LD9A 3EW3B 5F7KC 4U1IA 4UIMA 2X10A 2DTML 3CDYA 5FA4B 5DJCB 4IOFD 5C0CE 4HWEL 4PBVC 3LS4L 4BSWA 3G6AA 4NQCD 5ESVA 4PJEE 1FO0A 5FYLH 1X7QA 3BH9B 1UJ3A 4PJDE 1SY6H 1JPGA 2EDHA 3EO0B 3KJ6L 3MCLL 4N0RA 4RNRA 5HHME 5T5FL 3TIEB 1D7FA 1EEZB 5L6YH 2R2HB 2VKXA 3CFBB 4RGNB 4F7MA 4H0HB 5FXCH 5HYSG 1K5NB 4JFFA 5IV2A 1NANH 2GHWB 4PLJC 4X6DE 4RFEA 4WNQA 4FG6D 5GPRA 4XNZC 4XXDB 1X5XA 1N2RB 5IROC 2PYED 1MWAA 3PGFL 1M1SA 2R69L 1RHFA 4LGRB 3S3PA 1T04B 4LIQH 4Z0XA 2FCBA 3V4UH 5I71C 1NLDH 3DGCR 3H0TB 3ILPA 5D1QD 5DRNA 4J8RB 4NQEA 4M03A 4FFYH 2O93L 3EUUA 3JUZA 4PG9B 4K2UH 4PRDA 1FVDB 1BFVH 4NQSB 4CMHC 2BHYA 4F7TA 5DRZB 4S2SB 4GBXB 3X14B 1M4KA 5LXGH 3SJVA 2OYPA 5BO1L 1JZ4A 2G60L 2HFTA 2IQ9L 4WHTA 1FG9C 1DL7L 1PQZA 3VRIB 5ITBL 1EJOH 4WCYL 5L7XL 5I1LB 5I1CH 5DO2D 1RVFL 3VH8B 2DL9A 5C0IA 1ADQA 4Y19B 3FB5A 4AG4H 4YPGB 2MCG1 5TF1H 1KCUL 4BQBA 3RIFF 4AEHH 4Z8FH 5JUEL 2P47B 4HUNB 4JFHE 5SWZB 4HS6B 2V9QA 1WEJH 3SDXA 5JQ6L 4OGYL 2CMRH 2W38A 3O45B 4ZPTA 2P8PA 5L8JB 1RV6X 1ZT4B 4YC2C 5JORB 1Z0NA 2BVOB 2VN4A <