2YBRA

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
VQLVESGGGLVQPGGSLRLSCTGSGFTFDNYAMHWLRQVPGEGLEWVSGISRSSGDIDYADSVKGRFTISRDDAKKTLSLQMNSLRAEDTAVYYCARGGVGSFDTWGQGTMVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 116
sequence length 116
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2011-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ybrA00
1RHHA 3VD3A 3NCFB 2JJUA 3VFMA 3BDYL 1IAKA 4Z7WA 1K5NB 4L3CB 3GMPB 1NFDA 4IJ3C 2YD3A 2EDKA 3ESVF 3IJHB 4CL7A 1S9VB 1L0YA 2FHBA 1JZ3A 3TN0C 2WWKO 3HI6H 3NIFE 3NPSC 3TVMC 3FFCE 4DWHA 4R7NA 4UDUB 4JKPH 5GGRB 3IDYC 3QEQE 2NLJA 1HINL 4W81A 3L95A 4FNLL 1RULH 1D7FA 5T1LD 2AV7B 1KCKA 3RBSA 1P9MA 4X0KA 1FIGH 4PYGA 1P53A 3H9HB 4U1NA 5I8EB 2CLZA 4TVPD 1DEEB 2W0FA 2ESVA 3RIAK 3ORJA 1MPAH 5FUCE 4LSPH 1EIBA 3B83A 5HHQB 3KYKL 5F1SA 3PP4H 3O8XA 1I9RL 3VFRA 5C0BA 5F6HJ 3VE0A 5CSBA 4KRMB 1U8LB 3PJSB 3BP6A 4JANB 2XOTA 5I1AB 5L8LB 1A1MA 1NGYA 3KPLA 4PBXA 2QQKL 3OV6A 2PYEA 1KF9B 4RWYL 1RZJL 4YHZL 1LO2H 3CXHJ 5LGKA 5L9DL 4PJFF 1RIVH 1VFAB 5CWSA 2W38A 4XXCC 1F8TH 4URTB 2GSGA 4JZJC 5CMAA 1Z9OA 4X6BA 2GCYA 3GMMA 5CLWA 4KMTH 3L3HB 4N1EA 1HSBB 5B39B 1A7PL 2WINA 1BQUA 5DMGD 1CK0H 3VFUA 2VZUA 3CNKA 4U6VH 3PQYB 1H3GA 5EU5A 1J8HB 2QSQA 4CMHB 5I76A 3W5MA 5D2LB 35C8H 5FDYA 3CSYB 2XN9D 3ARFC 4AYFA 3DRQB 1K2DA 1PLGH 4ERSL 2HTLD 5ILTL 2HFTA 1DL7H 4P23C 2GJ6B 2N7BA 4YXKL 3SDDB 1A0QL 3QH3B 2YD4A 1I8IB 1HQ4B 1F3DJ 3MRIA 3VG9C 4ZUSA 4YXHH 3U36A 2LV4A 1T1XA 3QUYD 2ZUQC 4GRLA 4KAQH 4DGVL 1D5BA 3MLSL 3K2UL 1QFUH 3PQYE 2N1KA 5M94B 1J8HE 2D7NA 4LFHD 2P5WA 5F1NA 2NY1C 4HGWB 3P0VH 3OPZH 1QHPA 5T3XD 1F90H 2RB8A 4G8GA 2H1PH 3KPSE 4PY8J 5ICYA 4OCRH 2GJ6E 4C56A 2VZSA 4P2OC 2DM3A 3ROLB 4X99B 5FA3B 1BWWA 4NYLB 3CK0H 1NKOA 2OL3A 2VDNL 4EZMA 4H5SB 4XPHL 2EZ0C 2D31A 3SDXF 1WFNA 3EHBC 5EORL 2LQRA 3ARGC 4IRSD 5L2JA 1JNHA 2OZ4H 3ZDYE 3GSXB 4G43A 1J86A 1YJDL 4XWGL 3O2DL 2IAMD 4JHWH 1BEYH 3FN0L 3FRPG 1DLFL 1NCWH 3IVKB 2LVEA 2JJTC 5FYJL 1I7UA 4XBPB 3FB7B 4ODXA 4L8DA 3IJSA 3DOSA 1UEYA 3MRGA 5GRUL 1I1RA 4LQ1A 3S35X 1R6VA 3EYOA 3RAJL 3NIDF 3QJFB 2WMPA 5I17A 2CUMA 1P4BH 2ICWI 1P6AB 1ZTXH 4M5YH 4WHDA 5GGUA 4NKOA 2H32B 2NTSP 4NZDA 1RU9L 3Q6FB 1E6OH 3O6FC 3T08A 4GXUM 3QUXA 3EYQC 1KPUA 4YFLF 1I8KB 1OP9A 4YHIA 2BVUA 4JFEB 1RMFL 5DI8A 3WXVL 3X3GL 4PJGB 1U3ZA 1UCBH 4MA7L 3B2VH 3ALPA 3DSNA 3NBNA 3DIFB 2FH8A 3O9WC 1IC7H 2FECL 4NO0B 1OAQL 2OTWA 3G6AB 1UM5L 1OY3B 4ZAKC 4FZ8H 4V2BA 3LEVL 5E8DL 5E5MB 4OV5B 4WCYH 2A73B 4F15B 5E8PB 1TQCC 3PWPA 2F58L 1VDGA 3GSWB 4B7LA 2FJGB 4PRNA 4JFEE 1TJGL 2XWJA 4OM0L 1A6UL 1HCFX 3EOBA 2DRUA 5C07D 3EO0B 4JM2F 4MS8C 4PJGE 1A3RH 3BUYA 3PP3K 4U49A 5FYLE 4HK3N 3V4UH 4HK0A 1ZE3C 1TNNA 3QI9B 4WW2F 1U2HA 5GGTL 4XX1G 4OIAA 2P8LA 4JVPA 2LU4A 4J6RH 5D7JA 2PTVA 5IB4B 2BXZA 3OZ9H 1FN4B 1KIRA 3VFOB 4D9LH 2Q76A 4OCMC 5FKPB 2JF1A 3MJ8A 4PJHB 3MCKA 4UMGA 3LKOB 2ZKHL 4U1MB 5F7MC 1T2XA 3VFWB 1UWGH 4WU7A 3HZKB 3IRPX 2XWBB 1CICB 2AXGA 1K6QL 3GHEH 5I73B 5IVNA 2B0SH 1WWAX 3TZVD 1VACA 2A6DB 1CGSH 1DBBH 1FDLL 4PG2C 4G3YH 5I0DA 2ZSWA 3NFNA 4AIZB 5FGRA 3ZKMC 3IFOA 2NNAA 4FFZH 1SJXA 4HXBL 4Y2DB 1S5HB 4G6FD 3HAEH 3DXAB 4UOJA 5J1AA 4PJHE 5DQJB 5C8JB 2QQLH 3E6HA 4OZIA 2WM0A 5JW3L 1GGYA 2DQGL 2W92A 4P4KD 4Z8FL 1KFAL 3KLAA 1M7DA 3N1PC 3B5TA 2D03H 3AREC 1YUHA 2WW8A 4ODTL 5TE4L 1Z9SA 1YEEL 2DD8H 4L8BB 2EDHA 4JRXA 1RSFA 3DXAE 1JTPA 5HGDA 4JFHE 4MD0A 3QO0A 1U8QB 3NCBB 3T2QA 2F53A 2NXYD 5GISH 1BJ1J 4RQQB 4NRXB 1CGUA 3TO4B 4KV5E 4GKZA 1NFIA 4W68A 3VXMD 1XGTB 2XA3A 1LEKA 1INEL 2D4DA 3QR2A 2KQMA 4JPKH 1A6TA 3FB8A 1ZHNB 3D3VA 5KVFL 3IDUA 4YXLL 3BZ4A 5IHZB 4U1SA 4I48A 4GSDL 2VDQH 2EIZA 3Q6GH 4WFED 4D9QD 4XCNB 2YOCA 4X8JB 3GMRB 4LASH 3DUUB 1G7QA 2ATPB 2HFEB 5ITBH 4R4FL 5DJ6B 4QTIL 1MCFA 5D4QA 4PJ5D 5ENWB 5DO2D 4MX7A 1N8ZA 3BPCB 1X6NA 4TSBH 4K3JL 5E6IB 1U8PA 4HIXL 4A2MA 1UM4L 2B20A 3JV0A 1XGQB 3DROA 3Q1SH 5FECA 1I9EA 4R97B 3LHPH 3HZVB 3QCTH 4DN4H 3P4NB 5T1DL 5CEXA 3G5VB 2VWEE 3LB6D 1UACH 2R0KL 2R29L 1K4CA 1WAAE 1GSMA 3E8UL 5JPMA 5DEFB 3L1OH 3TBSB 1HEZB 2F9BT 2GTWA 3QIUA 2BVPA 4FTVB 4IJ3B 1KPVA 3OGCB 4HUXA 3C9NB 1INQA 1CXKA 5L88H 1REIA 3TN0B 1PY4A 3MV7D 1FRGL 4O5LH 3QFJD 1ORSA 4PJBA 1UZ8A 3IDYB 1E4XH 1IAOB 3O2WL 1RJZA 2Y72A 5EBGA 3CX5J 1JHKL 1AY1L 3FO1B 5D2NA 1H5BC 1RZ7H 3MGTA 1Q9LB 2NW3B 3A6BH 1MCLA 3CFCH 3T0EB 4L4TB 4G8FB 4FTVE 1EDQA 1MRCL 2PW2B 3U1SL 3MBEC 2ZCKL 5CLTA 2XZCL 1IE5A 3IXAA 2P46B 1OSPL 4XMPH 3AY4A 5INCB 2UYLB 4ALAH 2DJ4A 1LO4H 2D7OA 4NT6A 2EXWD 3G5XB 4AEEA 1JWUA 5D1QC 43C9A 1KUMA 4NP4H 2C4XA 4PJEA 5CD5D 3FT3B 3T0EE 4OI7A 4L4TE 3FQXB 4S2SA 3HG1A 5MEOA 5ICZA 4HLJA 1PX3A 5E8OB 5GGTA 1MQKH 15C8L 3W2DL 4JQXC 4W70A 3GRWL 2ZUWA 3IXTA 4JZJB 3S4SG 4ETYA 2DKMA 2R1XA 1JK8A 4I5BB 2HTKC 5BZWB 4ZOCA 5J6HB 1I3RB 5L2KD 1YYMH 1Y6NR 1QSEA 2UZYB 3QCUL 4N0UB 4QRPB 3LN5B 3BKYH 2F5AH 1PZ5B 4QF1A 5GRYA 1C12B 1S78D 3T0DA 5A16A 3PE9A 1A6VL 5BVJB 1KB9K 5C0GB 4PJ9C 4YGAB 4UBDD 2A1WH 4YHYC 4LVHC 1BVLB 3ARFB 4HLZG 3HAEB 3KR3H 5E8NA 1F58L 3PXHA 3GKWL 2YD1A 4P23B 4UTAL 4NNYA 5LJYH 4HQQL 5ICXA 3FQNA 1MEXH 3VG9B 4N0UE 4QRPE 5C0RH 2FJFA 4J4PC 2I26N 2ZUQB 4LLYB 3SE8L 1ZHLB 2DJSA 5DURB 3F5WB 4M8VA 4JO1H 3HZYB 5SWZE 1XCQA 4XCYB 1DANT 5C2BH 2AK4B 1OARH 3T0WA 2PTUA 1VFBB 2EDNA 3KPMA 1U58A 4RGMB 4Z7NE 1U8NB 1CE1H 1IL1B 3BD3A 4HGMA 4M43L 4P2OB 5DQ9B 3UTSD 4XCEA 4CGTA 3MLXH 3EDFA 1N5AB 3MZGB 3CDCA 1F11B 4HKXA 4X5WB 5IMKA 4Z77B 4JN1L 1AH1A 3ZYZA 3OB0H 5CJXA 3BPOC 3HCVA 3FHAA 3ARGB 4HWBL 3RNQB 1CFBA 3E2HC 1QUNA 4JO4H 3IETB 3VGAC 3G6DL 2HJFA 1ZA6B 5LGJB 2Y5EA 5I1DA 1IAII 2B5IC 3RZWA 2X9WA 4HMEA 2C3HA 4J3OC 1JPSH 3MUHL 1MNUH 4ODSH 1QVOB 2YKLH 2FGWH 2LVCA 1JFQL 2W07A 5HBBA 2BRQA 3MJ7B 3W0WD 7FABH 2R39A 2Y5TA 3C09C 1RJYB 3KPRA 4O2EA 5D7IA 4I0PA 4M1DL 5ACMA 5KVEL 3QQ9D 2FZ3B 1IGYA 3F58L 5ALBL 4XVTH 3VRLE 5DYOB 4M4PA 5AZ2L 1GAFH 1YMHB 4WW1B 5JXED 5ESAB 1QSFA 2BY0A 4N9OB 4IDLA 4BQ9A 1G1YA 3UC0H 5HHPB 3Q3GA 3QEGH 2A83A 4RFEB 1G84A 3QUKB 5DD0L 5I1CH 4RNRA 4KI5C 3N0PB 4XPTL 3TBVB 3O9WB 1HCVA 1FNSH 3HMXL 3OB0K 3N9GL 1A47A 2V6HA 3QNYA 2V7NA 3TESA 4R8WL 4ZAKB 1E6JL 1BFVL 2UWEB 4Y4HB 2A9NL 4DUVA 2P5EA 5E99L 4FQCH 4KHXL 5DA4A 2V2TA 1PYWA 3GJEA 2APTA 3MACH 1TQCB 4IOIA 3RZCD 1NGZA 4TUOA 4OF0A 3SKNA 1H8OA 4KJYA 4LLVA 1JYXA 5SWQA 1B3JA 2OJEB 3WDIA 4G9DA 4NQCB 1U41A 4PRBA 4RA0C 3TM6A 4ZXBD 3IKCB 2WNGA 3IJYA 2C7UA 2ADGA 4DZBA 4R26H 1Z6JT 3QHFH 3TA3D 3RHWF 1JZ7A 1LEGB 2SEBB 2PXYD 4LCWA 1Y6MR 2NY3C 1NEZB 5DUBA 5F7NC 3BKCL 3WXWL 3T8XB 4BZYA 5KTEH 1JGDA 4ODHH 3QUZD 4G6ML 4E41B 1YEGH 3NA4A 3ARDD 3C5ZA 5E4IA 4NQCE 5DZNA 5AG9A 2VLJB 1FL6B 1Y18B 1LDPL 4LLQB 3TYFB 2J12B 3ZZ1A 5T3XL 3IKKA 4Y16C 4YR6A 4PJIB 3DMMA 4ONFH 5HI5C 3ULUD 1MHHA 3CVHB 1FG2B 4M1CC 3U0WL 1F3JA 1UKSA 2MKWA 4GAGL 4OCXL 3V4VH 4PUBL 2YWZA 4IOFD 3MMEB 1KG0A 4E41E 3P9LB 4KKCD 3UTTB 2VLJE 3UJTH 4HWUA 2HLAA 1EEUA 3AREB 5IT2H 1WC7A 2IH1B 2NYYD 5GRVK 1E28A 1PKQB 4NJAH 4HWZA 4KVCH 5IQ9A 4M6NL 1WT5C 3NTCH 3O3DB 1FVDA 4LMQI 5KVMC 1AJ7H 5T5NF 3C8KB 4BFIB 1Q9WB 3QEQD 4OQTH 1JV5B 4CDHA 1DQDL 2CRMA 4X7DC 3SGEH 3MRCB 1R3KB 3UTTE 1MAKA 4G8IB 5I8KL 4NQEB 1ZLUH 1IC5H 5DSCA 5HVFB 2AGJH 3MXVH 4PRIA 2OI9B 1EEYB 3TF7C 4H0HB 3IAGC 1G9ML 4MMXC 3EUUA 4U6YA 2MCPH 1K8IA 3SDCD 3OXSB 3RWJA 3VXSA 3EAKA 5C0DB 5F70A 3BKJL 3JTTB 4KDWA 2YK1L 4X7TA 1WICA 3QBTB 2JCCF 1PAMA 1E4KC 2AQ1A 4JFFB 5GIRA 3F7QA 1BQHA 2PR4L 4D0BB 3PWVA 4O58H 4PTTB 1BZQK 3LKPA 4YZFF 4NQEE 1G6RL 3K7UA 2V5MA 2EO9A 4QLRA 3WFCH 1QLRB 4EI6A 5D72L 1C5CL 4EI5B 3FONB 3I02A 3C6SB 3WYRA 1WBZA 5IGXH 2IFGA 4P9HC 1HKLL 1SM3H 2VXVL 4B41A 2IBBA 2QLVB 1N0XL 4FP8L 2JLLA 4JFFE 2BK8A 5D7LA 1VSCA 1B0RA 1ZLUK 3HI1A 4XBEH 3I75A 2VXUH 4OF5A 2MMXA 4HIHB 4BSWB 1V3MA 4LPYA 4P5TC 2X7LA 1MFCL 5D1XC 1IGJB 1JRHH 1BZ9B 1HNGA 3I50H 4XHJC 3OG6B 1KENL 1A7OH 4FXGA 2DQFB 3GBNH 5I71C 3K1DA 2W0KA 1BBJA 3INUH 4JKKA 1EFXB 2F15A 4EDXA 4MYWB 2XRAL 3RVXD 2L4OA 4MCZB 1JNNH 1JHTA 1TPXC 5FF6B 3PWNA 4I4WA 1J8HD 4DN3H 1GOGA 1K8DA 2NW2A 3OKOB 4HPOH 3O41B 2FL5A 2X4TB 1E4WH 5TDNB 1FFQA 4HUUA 2BOBA 1H5BB 4U6XA 5KAQF 1IMHC 1YYLL 3PUCA 1GHFL 5CEZD 4TNVK 5GRXG 1BIIB 1EZVX 3KPSD 3SDAD 3MBEB 2I9TB 3SE9L 3BKMH 2VDRH 4KDTC 3F62A 3SDDD 2X4OB 5EU7E 4CNIA 3FQUA 1AGFB 2G5BA 3D0LB 1VADB 3DVGB 1OAUL 1ZVSB 1MVUA 2GK0B 3P4OB 2J3SA 3PHQA 2X05A 5D1QB 3M1BB 4KPHL 4EOWL 4F57L 4XCCH 3VXNB 2B1AL 3GNML 3K74B 3MRBA 4ENED 1QFWL 2X40A 5EOCL 4ACPA 3PNWA 5B38G 5IVZB 2ENSA 3V0WL 1Q94A 1GZQB 2DMCA 3B8YA 4YNYB 4X80L 3RVUD 1V7MH 3PF2A 2W60B 2CRZA 1KGCE 1HHKA 5MEQA 2EXYD 2A74A 1IFHL 2EEAA 1IRAY 1FC2D 5T33H 3BN9C 2YUVA 1QRKA 4PRDB 2R1YB 1YEKH 4A2LA 1B6UA 2XWTB 5EZJB 3I9GL 4KZDH 4IMLB 3S96A 3KPQA 3OHXB 4PJ9B 3D9AL 4YHYB 1N5YH 4LVHB 4E5XA 1M6OB 2YD9A 2DQUH 5AYUH 3C5JB 4PJ8C 2NZ9C 4HIEB 1MFBH 3ARBA 1P9MC 4MSWA 4CVXB 1I8MB 4EN3A 4QYOB 1T1YB 4JPWL 1J0IA 2R0WH 1CXLA 1FE8L 3IDNB 5T3ZH 3W39A 5JLZA 2G60L 4M7KL 4F7PB 1D9KA 1LD9B 1DVFD 2Q3AA 1AGBA 4WV1A 2LAGB 3QQ3A 2Z31C 3G5YA 4X4XA 3C2AL 4S11A 3S5LG 3DETC 1RK0B 1LWRA 3DI2B 4JDVB 1YNLH 2XY1A 2C1PB 5KSBB 1S8DB 3KYNA 5JA8B 4JDZB 2QJDA 5C0IB 3TPUB 4PGJA 5BS0A 2PCPB 3KYMA 5FYLD 4ZUTA 2AEPL 2Q7NA 4XHQA 1X5ZA 1JPTL 3FL7A 4LNRA 4UIMB 4JQIH 1RUKH 3LKSA 2GUOB 3NA9L 3NH7H 4OBSA 4UT6H 1SBSL 2DQCH 4P59L 2I07A 2WZPD 3BIKA 4M48H 4DGYH 1SJEB 1FYTD 3E2HB 2YUZA 1CTOA 1OGTB 3PIQB 3LMJH 3VGAB 2DIAA 3HZMA 2NR6D 2ATKB 3PV7A 1DP0A 5KSBE 1I75A 5JA9A 3BQUA 2Y36H 4YUEH 2Q86A 5EIVA 3QDMB 2AI0H 5AAWA 1PQZA 2Q7YB 2VH5L 2XXCB 4CVWA 4EUPG 2O61A 3T3ME 3W11D 3OG4B 5BCAA 2J8OA 3C09B 2DL2A 1JGEB 5KSVA 3H3PH 3KJ4C 3ULUF 3VFTB 5JHLH 3X11B 3QIBD 4R90L 3VXOA 2PW1A 4LU5L 2AEQL 3IDMB 4XCFL 4C57C 5DR5L 1YEIL 3MLVL 4ZD3L 3VXRE 2BERA 5FFLA 3QFDA 4ONGH 4S1DC 2WIIA 2ZWLT 4F7MA 4IRJA 1XZ0B 4HFUL 1XF5A 1QOKA 4ZOEA 3QDME 5E5RB 1Q38A 1XR9A 2EYTB 5JZ7D 4F3FA 5DC0A 3DXAD 4JFHD 2VLLB 3RKDC 3T2NL 3MBXL 4Y19A 3CFBA 4ZYKA 3QRGL 3QSKB 1KTDB 5GZNC 4BSVA 4JFZL 3TNMA 4LEOA 1C7SA 1ONQA 2OTPA 3CU1A 5EA0L 4I2XB 4G42A 4JO2H 4N8PA 3UTQB 1P7KB 1I1AD 1HHIA 1OF2A 4RGNE 1QBMH 3B9KC 4P46C 5DS8B 2IFFH 2E27H 1A9BA 1ZV5A 3S34H 4KI5E 1FPTL 1U8JB 1LO5B 4P2QB 5GQBA 4GG8A 3FJTA 4N0YL 5KSAC 5CP7B 3UPRB 2CKBL 5HYQA 3MRNB 1W0YT 2ILLA 4C59B 1KJVB 1K4DB 3QP3A 4DFHA 5F6HI 4I2XE 4X7SL 2VZOA 5FO8A 2H8PA 3RFZC 1UM6H 2NY3B 2W9EL 1MFAH 1U8HB 3QA3B 1FLRH 1KCVH 1N6QH 2W9LA 2X41A 4NDMB 2VR4A 2YC1A 3OJMB 1A6AB 3QXUA 5KS9A 5EDXA 5GHWH 2K1MA 4LSTH 5L8KB 4FQ2L 4P2QE 3OJDA 3DURB 4Y16B 5FUOH 3QUXC 2QBWA 1W72L 1YEJH 3H6JA 4NQDB 3U7YL 3P4MA 5BZDB 4M62L 2YA0A 1I3VA 4FZEH 4JG0H 1QG3A 5JR1H 3DV6A 2AJSL 3RWDB 3H0TB 3VXUA 3ZKNC 3ILPB 1EX0A 2YN3A 3TYGH 1EERB 3IYLW 3H2WA 1A7RL 1FC1A 1BD2B 3CLFH 4YHNA 3S36X 1WBXB 3UAJC 1ADQH 1XR8B 4U31A 1T20A 4NQDE 5E00A 2F5BH 5EZOH 2OK0L 5IEKB 3RKPA 3QZWG 5K93A 1BBDH 5D8JL 3BGMB 4NUJA 2I60L 4YPGA 1DUYB 3QAZB 4TNWK 5C08B 2ZG1A 5F89B 3MLZL 3N85H 4WEBH 1S7UA 1T04B 5L0QC 1X5GA 2RR3A 1BD2E 3NFPA 1EXUA 1YNKL 3FT2B 1QBLH 3WIFA 2V17L 1ZA3A 2XZQH 3X12A 4F7CA 4PY8I 1KCUL 2PO6A 4O2FB 4HUVA 5DRXB 1C8PA 4M8QA 1H15B 1MJ7L 2AJXH 4JLRB 5FO9B 1TDQA 4AEFA 3RU8H 1AD9A 5C08E 2CKNA 1U93B 1KT2B 4GW1B 3BD5A 3O4LA 2YS4A 3T0ED 1YECH 4L4TD 3DLQR 2CMRH 2Q8AH 3BEVA 3MODL 4APQA 3I6GA 4S10A 4MVBD 4JFDA 4MXWL 5T3ZE 5DD3L 3AMKA 2FO4B 3SOBH 1CL7L 5K9JH 4EXPX 5GS0L 2GW5A 3EFDL 3CXDL 3LOWA 5KZCB 1LNUB 4WGVB 2BVEA 1KBGH 4WY7H 4JGJA 4JJ5B 5ETUB 1DSFH 1IGIL 3R06A 1KPRB 5HXMA 1DFBL 2NCMA 1MREL 2FBJL 4ZFOA 4WRLA 5KVDL 3VWJA 4P5TB 1JZ8A 2YA1A 4XPAL 5JMRA 1GGCL 4MJIB 5D1XB 2OL3H 1JCKA 1XH3A 4KU1A 3AROA 4XI5D 3WUWA 3F7YA 4Z7UF 1CE6B 3EKCA 5CBAA 5EUOB 3CZJA 5I71B 4AG4L 4QRPD 2DQEH 1EUTA 3MROA 4RMQA 4H20L 5C7XL 1P5UA 4J1UB 4ZO7A 5C09A 3ULSB 1TPXB 5ESVA 5SWZD 4F8TA 1HXYA 1YEFH 4L29A 1KC5L 3U0PA 3K46A 4K3HA 4PIRF 3WE6B 2VXQL 4JRWA 2DYPD 2LFGA 1GC1H 4LPXA 4MJIE 4OD2B 1NMAL 1XF2B 1CL7I 2VIRA 3L3IA 4FQPA 4TN9A 3RIAF 2FIRT 4TYUA 5EUOE 1CGWA 1TZIB 1PDKA 1ZHBA 3SKMB 4WTZG 2AKRA 4OD1L 5DURD 2VLRB 3HS0B 4PJCA 3GMLA 4F2MA 3IDGA 5E2TL 5EIIB 4CKVX 4PGCA 3P4LA 3DECA 3ZMRA 4N8VG 4HUWA 3WO4C 4OCLC 5F97E 4XP4H 3A6CL 4LKCA 4NQVB 4LHUG 3OJ2C 3ZE1E 3P11L 1RHHB 4LCCA 3HPJA 3DVFA 2XG4A 4FABL 2DQJH 2B8OT 4NCC2 3QIUC 3C6LD 1NCDL 3QNZB 3JSSA 3GSUA 4HULB 2A6KA 4MXQD 4N1HB 3NZHH 3VFGH 3KHOA 3AFLA 1NL0H 5CHNA 1MCBA 1MJ8H 1OQXA 2GHWB 3TC9A 3EGSA 3QDGA 5CJQL 2K7QA 5EBMA 4PJ8B 3HRPA 1RIHL 3IDJB 1MCPL 4Y1AA 3VA6A 3I6KA 2G2RB 1KULA 4XVSH 4QXUH 4YHKH 3NAAH 4M6MH 4X0KB 3VH8A 3HI5H 5FDWB 5BVPL 1T3FA 2VZVA 1EK3A 1NAKH 2P7TB 2ESVB 3LSOA 4OLYH 3QUMH 1U8OB 1Z2KA 1CBVH 3DSFH 3EYQD 4FFYH 3VFRB 5JHDB 3S37X 3FOLB 1H8NA 5C0BB 4MA8H 2Z31B 3HE7D 5F8QC 1N2RB 4HDIB 3FRUB 2COQA 1QO3B 4OBRA 3BP6B 4RMTA 3WNKA 1DQML 3CZFB 4FXKB 5F7EL 4P5MA 1MIEL 4K3DH 3V7MA 5IB2A 5D71H 2IG2H 4HX1A 1UWXH 4Y4FC 2W9DL 2ESVE 4POUB 4Y4HD 2ZOLA 3ZTJG 5CWSB 2L7JA 3AVEA 3VXTB 1L6ZA 4DKDC 2ZPKH 5CMAB 3EOTH 1NBVL 4UT9H 5JHDE 1AGCA 5C0BE 3GMMB 1PZUB 2I5YH 5INDB 2FHCA 4EEEA 1INDH 4P9MH 4OZHB 1XT5A 2EO1A 25C8L 4CAGA 3VFUB 3WLBA 1A3QA 5E9DA 1FZKA 4ZOAA 4DZ8B 4JREC 4DK3A 2RCSH 4EVNA 4ZFFA 2ZZUT 1HNFA 2R4SL 3QULA 4X4MA 1R3HB 3LDBB 1S7WB 5C0CA 2NY5C 1K3ZA 1NGPH 2EDDA 3KJ4B 3VWKD 5FV2A 3D0VA 3OAUH 3RWEA 5IG7A 1HHJA 2EDYA 2VAAB 4DUWA 4YDIH 4ZUSB 5IESH 1QBBA 2YRZA 1CG9B 1T1XB 1FH5L 4QKXB 3KVQA 1WAAF 4XB8A 3ULVC 2VLJD 3QO1A 1ORQB 1YNTB 3ES6B 4LKXA 2ITDA 1U8IA 2BNQD 4H0IA 1EBAA 1OW0A 2A6JA 3MV9A 2X6MA 3BP5A 3RTQA 2AQ3A 1FZJB 2FX9L 5ICYB 3RWFA 1ZGLB 2R0ZL 5K59E 2Y4SA 2Z92B 3VFSA 1T66C 1BREA 1XMWA 4F58H 1D5ZB 3GHBL 3PWJA 2NY0C 4BQ6A 1WVZA 3UTTD 5LXGL 5TE7H 2MKLC 4N8CH 3T0VA 1F6LL 3R0MA 3B9KB 4P46B 5EFIA 3K81A 3U4BH 3GEWB 3CC5B 3H9SD 4MHHI 4GAYA 3BO8A 4CBPA 2R2EB 4ZQKA 1QR4A 1MVFA 4ZPVB 1NC4A 4G43B 2FR4A 4OGYL 2CXGA 3MLRH 2CUIA 4WWKD 5HGAB 4WUUD 3TJHC 4FXLA 4ZTPH 5EBLA 1VPOH 3LEXB 5I1JL 3OF6A 1HSAA 1J12A 1NCAL 4UZGA 3S36L 1KJ3H 2IQ9H 3BDXA 2BSSA 2KL6A 2JIXD 1EBPA 4HJGA 4NQED 4L3EA 4AK1A 3LKQA 3HUJA 1KIUA 4V1DD 3HNVH 5IROC 4F9LA 1ZLVK 1X9QA 3V5KB 2EDJA 4G8EA 5A2JH 3FB5B 3QUXB 1XGUA 3FFCA 4WHYH 4YHIB 5EN2B 5JNYA 1D5MA 3GSQB 2OS7A 5DRZA 3RX5A 1FFNA 4QTHA 5DI8B 5FYLL 4U6HA 3NACH 1J1OL 1S3KH 4MJ2A 2RHEA 4PB0L 4HPYH 5HGBA 3PGFH 3PL6A 4JFFD 5IR1B 4TVSa 1SMOA 1K5NA 5DA0B 2D9QB 4N5ED 3GMPA 3L3DA 1OAZH 1B88A 2DICA 2R2BB 3IJHA 1S9VA 3AU1B 1ZS8A 1PY9A 4LGRB 3ARTA 3HI6L 3PWPB 4EI5D 3OKLB 4UDUA 4JKPL 4PRNB 1VGKA 2XWJB 2UUDH 1RULL 3HR6A 2Y6SD 2AV7A 5DQDH 3AS3A 3VW3H 2JB5H 4NSKB 1FIGL 1FHGA 3SGJA 4HK0B 3B43A 4PS4H 2J5LC 1J9CT 3ARUA 3JUZA 5L0QB 8FABB 5D7JB 1DEEA 3ZE2F 1KIRB 2Q76B 3RGHA 3MJ8B 3MCKB 2W59A 1WF5A 3DHMA 1MPAL 4LSPL 3BVNB 1MRDH 5HHQA 2AP2A 3NCCB 3PWPE 2ADJB 5E95B 1RV6X 4UOW0 3PP4L 2BC4A 2AXGB 4LRNH 3GKZA 1J05A 2BVOA 3QUMB 3MC0A 3C5ZC 3PJSA 1BAFH 4KKLD 1A1OB 3SCMD 5I1AA 1CD1B 3G08A 2ZSWB 4RCAA 4YBLC 4K7PH 2NNAB 2YEZB 3RNKA 1LO2L 5J1AB 2X1XR 4WEUD 1YPZB 3VGBA 5KANI 2DLHA 2EEBA 4W4OA 1RIVL 1VFAA 3DVNB 8CGTA 1F8TL 3DX9B 4KUCF 2P24B 3E6HB 2Z8RA 4KMTL 4OZIB 1HSBA 5B39A 1KGCD 3A6OA 3ULVH 4RZCB 1IVLA 2VNCA 4PY7B 1CIUA 1OOAA 2APVA 4N0CD 2GSIB 1B90A 3H42H 3PQYA 4U6VL 4YFLI 2Y07H 5SX5H 3U4EA 2ARJQ 3F6LA 5D2LA 3FFDB 1WZ1H 35C8L 3EFFA 5F96H 4MD0B 4RMRA 2BY3A 3OX8B 3ETBF 1BWMA 1PLGL 4M6OH 2FCBA 3T1FB 1HIMH 5MENA 1DL7L 2GJ6A 2HH0H 5B4MC 4GKZB 5FA4B 1NFIB 3HA0A 4OZIE 1EGJA 5HYFA 1HQ4A 4K23H 2HLFC 3D5OF 4YXHL 1I1FB 5L7XH 4KAQL 4OFYD 3BZ4B 1QFUL 3STLA 5HDBE 1GGIH 1EV2E 3BGAA 1MUJB 3D85D 4JRXE 4DKFH 5ISZB 1FNLA 1IGTB 3P0VL 1C16B 4PJ9D 3OPZL 5TE6H 3OGOE 4P48A 1F90L 4QCIB 4MAYA 5DGRA 4PJ7B 2ICWB 2H1PL 3KPTA 4OCRL 4K55A 4U1HA 4LDLB 5GSVB 3SBWC 3ROLA 4NKIH 4X99A 5FA3A 1QPXA 4NYLA 1NMCC 3CK0L 2FWOB 1HYSC 1LK3H 5E70A 4H5SA 3CDFA 3D3VE 5FIEA 4AMKH 1U8PB 5I18H 1GYAA 5F6IC 1J11A 3U9PH 5CGYC 4EQ3A 2APFA 3GK8H 4MQXC 3RVVC 2OZ4L 1T80A 2O5XH 2YUXA 3GSXA 1KYOK 5GGVY 2BJMH 1P4LB 4OZFG 3DX8B 4JHWL 1BEYL 4PJ7E 5F1IB 1NCWL 1RD6A 3NOIA 1J1XH 1X5KA 3IVKA 4YFEA 2EIBA 1QRND 4ELMF 3WO4B 1PSKH 2JE8A 1T7YA 2DQIL 4F7EB 2AJVH 5CZVH 1CZ8H 1X7QB 3QDJD 4Z76A 1I1YA 3RVTD 4KKBC 1J18A 1CR9H 5K9OA 3QJFA 2GTWB 4CN1A 1CI5A 1P4BL 4XRCA 3QIUB 1ZTXL 4M5YL 4RX4D 2H32A 2YN5A 4HUXB 1E6OL 2I24N 1ZLSH 4X5XA 2C1OB 1I8KA 2X10A 4LDOB 5T1KD 2IPTH 2QADC 4JFEA 5E2WH 4NM8H 3QWQB 1W0VB 1RZKL 3VXRD 3X13A 1UZ8B 2Z0BA 4PJGA 1HWHB 5C86A 1UCBL 4QOKA 3B2VL 1RJZB 3DIFA 5HHOD 1AKJA 1IC7L 4NO0A 5H37G 4P2RB 2HRPH 3G6AA 2OCFD 5IKCB 5FHAH 4FZ8L 1H9VA 4A6YH 5E5MA 1J10A 4OV5A 4WCYL 2A73A 2P1YA 5E8PA 1P7QA 2J4WH 3IXAB 1T83A 3UXFA 2FJGA 2NMSA 4HWEH 4OF6A 2EDWA 1WEJH 4AY0A 1KACB 1A3RL 4RGND 2B2XH 4GAFB 1WK0A 5ESQB 3V4UL 3O11A 2BSTA 3QI9A 3DTXB 4OZGB 4KI5D 4P2RE 5D2NE 3VXQB 4YHLH 4J6RL 5IB4A 3LRHA 3OZ9L 1FN4A 3VFOA 4D9LL 4POYA 4YBQD 5FKPA 4PJHA 4JRYD 3TIDB 4JN2A 2DTMH 4U1MA 2B1HH 3VFWA 1X6LA 1UWGL 3HZKA 2XWBA 1CICA 4Q9CA 4EJ1C 1JK8B 3GHEL 4MB4A 2CO7B 2B0SL 4PJAB 3JWOC 1MCCA 4ZTOH 1CGSL 1KLFA 1ZT1B 4L8SA 4GMTH 4G3YL 2Q87A 4QF1B 4OZGE 4FFZL 4Y2DA 4JREB 2IH3B 1IC4H 3S88H 4KK5D 2FIKA 3HG1E 4H26B 4KJWD 1YEHH 5DQJA 5C8JA 2QQLL 1TNMA 2H26A 2W91A 5EO1A 3F12B 2ERJC 1IAIH 4GMSH 4JM2A 3ARBC 1D6EA 3O4OC 4NNYB 4RGOH 5EU4B 2CK2A 3IT8D 5ACLA 4PJAE 4PR5B 5ICXB 4HC1A 4WW2A 1V3JA 2VDLL 4HS6B 3OKDA 3TCXA 2D03L 4NFDA 2XIDA 5BV7H 3STZA 2AERT 2DD8L 4L8BA 4M3KB 3QCVH 4WV1C 5C71A 3ROOA 3D69B 1U8QA 2EIEA 4NQDD 5FCSH 3LAFA 4Z6AT 5HI5D 4RQQA 4PD4K 4NRXA 3KPMB 3TO4A 4PRPD 1S9XB 1XGTA 1HQRA 3O3BB 4JCLA 4P3CH 4JPKL 3IU4H 5F7WC 2H3NB 5IBUG 3HB3D 2NY0B 3DX7B 1AGEA 3IU3B 4HKXB 5IHZA 5IMKB 5C70A 5BOZG 3HE6C 3ULVE 5A43C 1BD2D 2VDQL 1CDUA 1I9IH 1BGXH 1YY9D 2ED9A 4KJQD 1WTGT 3FMGH 1JP5A 4LSVH 1NFKA 1U3JA 3Q6GL 4XNQB 5F88B 1FNEA 1FG9C 4X8JA 3GMRA 4X98A 5F1KC 1YY8A 4NO2B 2ATPA 2VR5A 2HFEA 5LAXA 5ITBL 2HJFB 4X7CC 5DJ6A 3CSGA 5I8OH 5DJZB 3CFEB 1EJ6A 1BFTA 4U7SA 5ENWA 1I3UA 4PJXB 1DBAH 4QRRA 2ZUVA 3WS6A 2QKIB 3BPCA 1H3TA 1TMCB 1F6FB 2HJKA 4TSBL 4WFFE 4XNYH 2CUHA 3VFVB 5E6IA 1MSPA 1UH3A 1FVEA 4O2EB 2XACC 5D7IB 4FFVD 1XGQA 5KOMC 4R2GC 2HJLA 3F6IA 3Q1SL 1WIOA 3K4ZA 4YC2C 3P0YH 3MRPB 3CJJA 1LVEA 2R69H 5MERB 5HVGB 4Q6IA 3LHPL 4OLZH 3FO0H 3QCTL 5DJAB 4DN4L 3P4NA 5HGGS 1JGLH 3G5VA 5DFVC 3SJVB 1UACL 3CH1B 3U2SB 4BJLA 1C5DB 5DEFA 3L1OL 5D7IE 3QNYB 4FTVA 3D87B 5B38B 2J8UB 4C54A 1U36A 3OGCA 3C9NA 4KQ3H 2P5EB 2QSCH 5L88L 3TN0A 2V2TB 2BRRH 5BXFA 3TVMA 1VCAA 3V2AR 4YPJA 5C3LD 1PBYA 3SKNB 4LEXH 5E24E 5SWQB 4PTUB 4HMCA 1E4XL 1IAOA 3SJVE 1EVTC 3L5XH 3JV6A 5C6TH 2WV3A 4PRBB 3AGVA 3S98A 3EJZD 3FO1A 3IJYB 4LAJH 5IFHH 1RZ7L 4GG6B 2J5LB 3BT2H 1Q9LA 3A6BL 3CFCL 1QQDB 3QDAA 2XG5A 4G8FA 2J8UE 2PW2A 1GGTA 4DAGH 4NBXB 2P5EE 1VA9A 5DD6B 2Q3ZA 3OL2A 1IM9A 1CVRA 2C9AA 4XMPL 5DUBB 4A6YB 4LHUD 1JGDB 2YMXH 3MRFA 1LO4L 1NC2D 3C5ZB 5HD8D 2QSVA 4EXKA 5MP6H 1AXIB 2ADFH 4NP4L 1HI6B 5AAMA 4GG6E 4YR6B 4YBLB 4D0CB 3WEXB 5I16B 1CN4A 3FO9A 3FQXA 4RFNC 5FXCH 4TSAH 5E8OA 1MQKL 2VITA 1F3JB 2DTSA 2OXHA 1MY5A 4MA1C 4XXCA 1UJ3C 2CPCA 3GI9H 1CFQA 1GCFA 4HFWA 4I5BA 5BZWA 1BZ7B 1I3RA 1KG0B 1MHEB 1YYML 2YUWA 4I3SH 2YD6A 3BJ91 1E4XI 5I19H 4N0UA 3D25B 2F5AL 1PZ5A 1U8MB 2AXJA 3FCTB 1CXIA 4HHAB 4J3XA 4UI2A 4X6FB 5C0GA 3UBXI 1CCZA 3TBYB 1CFTA 3ALWA 4H1LB 3GDBA 2A77H 4HWZB 2A1WL 3KJ6H 4KROD 2EIDA 2XTJD 4F33B 1BVLA 2VE6B 3ARFA 4XWOD 3HAEA 3KR3L 3U82B 2MOVA 4PJDF 3RL1A 4M7LT 4P23A 3VCLA 3WFBH 4XBGB 4HEPG 4HV8A 5JXAH 1G7MB 4LSRH 1MEXL 1DBKH 5ADOL 5C0RL 4ZG1A 2FATL 4KH2A 1EVUA 4LLYA 1PVHA 1ZHLA 5DSCB 3F5WA 4JO1L 3HZYA 5C2BL 2AK4A 1OARL 2X4NB 3T1WA 3HRZA 1VFBA 1S7TB 4U6YB 5JOEA 3BGFC 4PLJD 3RWJB 1U8NA 4Z9KB 1CE1L 1IL1A 1U3HC 3GMQA 4TNVF 3ZT6A 2QQNH 5IIEA 4P2OA 4X7TB 1KOAA 3IFPB 1BQLH 3MLXL 1NMCB 1N5AA 1QA9B 2G5RA 5I1LA 2NY6C 2XZZA 4X5WA 2X1PA 3LKPB 5A2FA 5HDQL 3RRQA 4Z77A 4YLQT 5EWIH 5AUMA 2B7DT 1IGCL 4LSSH 3FKUS 5F6IB 1E0OB 4YO0B 4GLRI 3ARGA 2R8SH 3EW3B 5I1EH 3GFUA 5T5FH 4JO4L 3GIVA 3IETA 1QPPA 3O8XD 5LGJA 1ZA6A 5C0BD 3ZT7A 5C6WH 3VDBA 2WBJC 4PV9A 3QG6A 3KDMA 3SE3C 2WQ8A 2Y9RT 3BH9B 1JPSL 1MNUL 4ODSL 2YKLL 2FGWL 4BQBA 1XF1A 4UV4L 4QRTB 4MCYB 4EKXA 3OAZH 4PGBB 5D7LB 2PYED 7FABL 5ALCH 3JV4A 3HI1B 1RJYA 4H8WC 5AYQA 3I75B 4YJZL 1KB9J 5HI3C 4ZPTA 5GJTH 3ZSTA 1F2QA 4XVTL 5DYOA 3DBXA 1GAFL 1YMHA 4WW1A 4MLIA 4HJ0C 3TEUA 5ESAA 1JGUH 3O6FA 3SGKC 1YC8A 4FXGB 2JELH 3RUGB 2JJVA 3PWUB 3QWRA 1IGMH 3UC0L 3TGXA 3KLHC 2H41A 2QADB 3LN4B 3JTSA 1BBJB 5HHPA 3QEGL 4RFEA 1NEUA 3QUKA 1L7IH 3KPNB 1JHTB 5I1CL 1BQHG 5D7LE 4I4WB 1MRFH 3O9WA 1LO3H 1FNSL 5DWUH 3ZYIA 1GGUA 3KG5A 3PXJA 1SJVA 4U6XB 3SKOA 1NUFA 5DC9B 1A7NH 5GRJH 4ZAKA 4AJ0A 2UWEA 2GTZA 3BHBB 4MXVE 4FQCL 3RGVC 1OGAA 3MACL 1L0XA 2KPNA 5CEYA 3FQUB 3RUGE 1UZ6E 5H2BA 2GJZB 5JORA 2VQTA 1UVQB 1F00I 4NN7B 2HWZH 5CJOH 2OJEA 1ED3A 4GRLD 4OLWH 2W65B 2Y23A 4GJTB 4NQCA 4KY1H 1MHPH 3ARWA 4XP1H 4RMSA 3LZFH 3IKCA 3GMNB 4EQ2A 4N5UA 4NQXA 1BIHA 3MQIA 4UNUA 1FJ1B 4R26L 2P5WD 1BPVA 5CJ5A 4LLAA 3RKDD 3QHFL 2IMNA 4GKSA 2J1KA 3PNWB 4G8GD 3C60C 3U79A 2SEBA 3UBXA 4C56D 2BCKB 3QIWC 2FDBP 1Q9KB 1A9EA 2Z93B 2XY2A 3O0RH 1QBAA 2O93L 1H0DB 5IBTH 3T8XA 5KTEL 1FZOB 4ODHL 1HHKB 4E41A 2A74B 1YEGL 1T5XA 3FQWB 3V7AG 3VD4A 1JF6A 1FL6A 1Y18A 2C3VB 4LLQA 1FVCA 1J7VR 3FAWA 2UZIH 4GAJH 4PJIA 4ONFL 1RZGB 3QJHA 3S96B 1KJ2H 2E3VA 3CVHA 1TVDA 2HFFA 3G6JF 3V4VL 2Y1VA 5CAYB 4N9GA 2ERJB 1D6VH 3MMEA 4G9FB 3ARBB 3O4OB 4MSWB 4LMQE 4K2UH 2XV6B 3Q5YA 4EN3B 2DL9A 2FSEB 1CLYH 4OM1H 2C4FU 4BH7B 1CXFA 3UJTL 1X5LA 3AREA 4PRHB 5CILH 5IT2L 2YRPA 5CD3A 1PKQA 1T1WB 1D9KB 1IQDA 1U6AH 4NJAL 1ROWA 4JPVL 1QACA 4WV1B 1Z3GH 3QUXD 4QRUA 3NTCL 3WHE0 3O3DA 4X4XB 5D96C 4NZTH 1AJ7L 3HFMH 1Q9WA 4HKJB 1X5FA 4OQTL 3R8BB 1JV5A 2X09A 2X2YA 4G9FE 3KYNB 3MV01 3GO1H 1AO7B 2HT4C 5FGBC 3MRCA 4GKNB 1R3KA 3ZKND 4J2XA 3HC0B 3L3KB 4PGEB 5D70L 4ZUTB 3UMTA 2X4RA 1IC5L 4WJ5A 4Q9RH 3MOAH 4PRHE 3HE6B 3RVWC 3WBDA 2AGJL 3MXVL 1HH6B 5D7KD 4IM8A 3RBGA 1IM3A 3BIKB 3GGWA 4FQXC 3VMOA 3PWPD 4LOUC 2XZAH 1NCCH 2MCPL 4DUXA 4NQUA 2PYFB 1BECA 1AO7E 4GBXA 3TO2B 4D0BA 4PB9H 1YZZA 1PQZB 2E8ZA 4O58L 4PTTA 5TJWK 3KNBB 1RZJC 2DQDH 5D7JD 3BSZH 3ZDZE 4JVUA 5CZXC 3A0OA 1JWMB 3OSKA 5K9KB 4R2GB 3WFCL 1QLRA 5JTWA 4YC2B 3WMSA 4WIQA 4IHOB 3C6SA 4HEME 4ETQA 5IGXL 3RPKA 5C0NC 1R3LA 3HC3H 1SM3L 1G0XA 3M8OH 3QFDB 4D3CH 2PETA 3SGEI 3O6ML 5GZOC 1OP5K 4MJ6B 1FO0H 1FORL 1FQ9C 5C0EB 4KK6D 4XBEL 4RMUA 1TCRB 3SEPA 3TIEB 2VXUL 3WFHB 4CJ0A 4F3FB 3G9AB 1OW0C 3L3OA 1JZ6A 3OR7B 4ZYKB 3MV8B 1IGJA 1AIFB 1JRHL 1BZ9A 4BSVB 3I50L 3TNMB 1ONQB 2GYSA 1A7OL 2XT1B 3MCG1 4PGZA 3GBNL 3CMGA 1LE5A 2FD6H 1X5JA 4RSVA 3BMWA 3INUL 4MB3A 3FN3A 5DXWA 2B4CC 1EFXA 3Q5OA 2NTFB 3NIGE 3SE4C 3SO5A 4Z7WF 3BZEB 1JNNL 5FF6A 5FHBH 4HPOL 3OKOA 1NFDF 3E0GA 3O41A 4TNWF 2X4TA 1E4WL 4JRXD 4JVWA 1H5BA 2VERN 1JPGA 4Y19E 5AWNH 2F53D 3MV8E 3CMOH 4OT1H 1BIIA 3MBEA 4N0RA 2I9TA 3BKML 2VDRL 5BRZB 1KXVC 3RJQB 3UJIH 1I7ZB 2J6EA 3BPLC 1AGFA 1F3DH 3D0LA 5FO8B 1AR1D 4ODUB 1VADA 5C92A 3DVGA 2NY2D 3AUVA 1X4XA 3L7FA 1IBGH 1ZVSA 3D3VD 2GK0A 5DK0A 3P4OA 3RWIB 4LAQH 5DZOA 5D1QA 3M1BA 1WQVT 4HKBB 1HHHA 3CXHK 4XCCL 3OJDB 2X42A 1IAMA 5FGSA 4RFNB 2KBGA 3P4MB 3MOBH 4JE4B 5ADPH 1NUNB 4JQXA 4LLWB 4U7MA 4ODWB 4HF5H 3DV6B 4MA1B 4UQ3B 1UJ3B 1V7ML 2W60A 4M02A 3GSOA 4JKWA 3VXUB 1UB6A 3BPNC 3BXNA 5T33L 1KCSH 1RZIB 1CDJA 1I3GH 3JBG7 1CWVA 2R1YA 1YEKL 1JUFB 2XWTA 4PRDA 4XPBH 5EZJA 2CDFB 2AABH 2A0LC 4IIQC 4KZDL 3HNTH 4IMLA 4WVRA 1T20B 4JY6B 5DJYB 2ED8A 4AEHH 1N5YL 3R1GH 3O6LH 5JPNA 1M6OA 5AYUL 1BJ8A 1M05A 5MEPA 1KJ2B 1MFBL 4NUJB 3TFKC 2BVQB 3VXUE 2VXTH 1I8MA 3SGJC 1T03H 1JMZA 4M61A 1T1YA 2R0WL 3WHXA 4NRYB 3IDNA 5T3ZL 4J4PA 2MHAB 3FOMB 1N4XH 3QIUD 4F7PA 4I9WE 4DOHE 1MLBB 1YMMB 1KLGA 1LD9A 4MNGB 4M9OA 1OTTC 3LEYH 3T4AB 4TUJA 3WIFB 4WO4C 4CU7A 1F6AB 2UV3A 4HUVB 3BGFB 4JDVA 1YNLL 4M8QB 2NX5B 1S8DA 1U3HB 1AD9B 4JDZA 3TPUA 4P2YA 1BFOB 4RWYH 2PCPA 5DJ0B 4D2NA 4YHZH 4M93C 4OQTA 4K3GA 2NY6B 3IDIA 4UIMA 4JQIL 1RUKL 1CF8H 4LCYB 3RWHB 3NH7L 1YMME 4W4OC 4BK5A 3BEVB 4OLVH 4UT6L 2DQCL 4MNGE 4TRPH 4M48L 4QHNB 2EDLA 5EZLB 4DGYL 1SJEA 1G9NL 2E9IA 1R3JB 3EO9H 1A7PH 1OGTA 3PIQA 3LMJL 4TQEH 3ZTNH 2ATKA 2WBJB 2CRIA 4LF3B 5CGTA 2Y36L 1AP2B 4TSCH 4YUEL 1T4KB 2AI0L 3O4LE 2Q7YA 4OFKA 3KXFA 4ZMAT 3HKFA 3HG1D 3WKMH 3FZUD 2BSRB 3H3PL 5JHLL 3X11A 1A0QH 1V3LA 1MCWW 3WUWB 2B4CH 4HG4J 5E08H 1N7MH 3LQZB 4NO3B 2VRAA 3DARA 2QTEA 2ZG3A 4GKOA 1QSED 4ONGL 1RVFH 2J8HA 1UA6H 2K7PA 1XZ0A 4X6EB 5AG8A 1OD7A 2NXZC 2OSLB 3QG7H 3VFPB 4L29B 3I2CH 5DMIH 1FO0B 1N26A 2VLLA 4GOSA 4QHMB 4R6UA 1URLA 4YDVB 2M26A 2FGZA 4MAYC 1KTDA 5IMMA 5JDSB 1OWRM 1VHPA 1DQQA 2JJSC 1QFWM 3RGVB 4PP1C 5IHBA 3L3IB 4XP6L 4JO2L 2EC8A 4M3JA 1IT9H 3UTQA 1P7KA 2V2XB 4KFZC 2FJHB 1Z0NA 5EORH 1ZLWK 4KDVA 1WBYA 1QBML 2P49B 5DS8A 2IFFL 2LAAA 2E27L 4LSUH 3ULVD 3S34L 2YRLA 1U8JA 3GMLB 1LO5A 3MNZA 3Q0HA 3O2DH 4P2QA 1GGBH 1DUZB 4NJ9L 1P84J 5CP7A 1WLHA 1BJ1H 3MRNA 5D1ZC 1KJVA 3P3YA 3ECBB 1K4DA 3MYZA 2F74B 1L0QA 3QIWB 4LKCB 2R4RH 1UM6L 4UB0H 5LG1A 1MFAL 3TH3T 1U8HA 3QA3A 3HPJB 4WFFD 1FLRL 1Q72L 3VDAA 1TTUA 5B3JE 3KPOA 4NDMA 1A6AA 5GHWL 4LSTL 4PJCE 4XTRC 4Y16A 2FEDD 5FUOL 2VN4A 1YEJL 5CHNB 3PGCB 5BZDA 1NBQA 4FZEL 3NCEB 4GRWF 4JG0L 5IVXB 3BFOA 3MR9A 5JR1L 3RWDA 3H0TA 2H2PD 3RDTA 3TYGL 3VH8B 4JFQA 3WIIH 4U1GC 1AGDB 1KCRH 3KPRD 2R0LH 1UGNA 1TJHH 3CLFL 1XFPA 2IBZY 4I0PD 1WBXA 5FUZH 1ADQL 4GQPH 1KTLA 3LSOB 1G7HA 5EZOL 2F5BL 1T83C 4B50A 1QSFD 3VI4F 1A6UH 4LIQH 1WT5A 5JO5B 4NWTH 2ZP0T 1BBDL 1PG7H 5D96B 1WIPA 5IVXE 1J5OH 4X8XA 5C08A 5E4EC 3N85L 3C08H 3BE1H 4WEBL 1U3YA 3QXDA 3T0AA 3CCHA 4J8RB 1CFVH 4WI5A 4XNUH 5IB2B 4E42B 4HX1B 3MGOB 4XB7A 3FT2A 2YSSA 4KUZH 2YHGA 1FSKC 4JGMA 1QBLL 2VZ1A 5KAQG 2ZOLB 2P5ED 2ZCHH 2XZQL 4FQXB 1AXSB 1J0ZA 4O2FA 5DRXA 4AT6A 3N50A 5CS7A 2AJXL 5FO9A 3RU8L 4L8SC 3BW9A 1U93A 2H6PB 1P4IH 1KT2A 1E4JA 2X89A 4EVNB 1YECL 3WIHA 2CMRL 1MOEA 4WFGD 4KK9D 4IS6B 5LBSH 2Q8AL 2GFBA 5TH2B 1EGJH 5EC2B 4JFPB 4MZ2A 4LCWD 2FO4A 4B0MM 5K9JL 4G6AC 3NZ8B 1HHJB 1PKOA 1X5YA 1ZKAA 2P45B 5EOTB 3V9FA 5E8EA 1NMBH 4I18C 4KXZI 2DMKA 4JPIB 1LNUA 1U42A 4WW2C 1KBGL 3C5ZD 1G7IB 1IEHA 1NUGA 4H88H 4WY7L 5ETUA 1YEEH 1KIQA 1DSFL 5GRZA 2VSDA 1KPRA 4LKXB 3DMMD 3ZYJA 2O5ZH 3MV9B 3FRPA 4X4ME 2GIYA 4HIIB 4P5TA 1WTLA 5C0CE 4MJIA 5D1XA 2OL3L 2X9YA 2IPKA 3RWFB 2VL4A 3WD5H 4BH8B 1CE6A 1UENA 5D5MB 3OAYH 4GW5B 4F9PC 4OFVA 3BIAX 2YXMA 4R7DA 4W4NA 3QEUB 3BWAB 4J1UA 1MCQA 3ULSA 4JQVA 1Y0LB 3BESR 4ZFZB 2DQTH 2VKXA 4S0SD 3B2UC 4ZQKB 1NC4B 3MV9E 2EDXA 1GC1L 5CUSH 4MWFB 1L7TH 3HPLB 3RY6C 4HBCH 5FCUH 1HE7A 1JTOA 2VISB 4KDTA 2CR6A 4PJBF 5F9DC 5D5ME 3I3DA 3BPLB 4WUKH 2FX8H 1TZIA 2BSSB 3RX8A 4XAKE 3SKMA 2F54A 5DEZA 2VLRA 3HUJB 3N1QC 4OCNC 3VGFA 1U92B 4PRID 4X6CB 1F4AA 1Q0XL 1KTKE 1GOFA 1CD9B 4Q6IC 4Z7UA 5GS2H 1NUDA 5DMJB 2YD8A 2CIKB 4AENA 5JNYB 4Q6YA 1A22B 4NWUH 3VXSD 4QTHB 3WFDH 1QNZH 4LP5A 4NOFA 4XP4L 5AD0A 4NQVA 5HGBB 4WI4A 3PL6B 1OB1B 1HYSD 2DQJL 3V8OA 1I85C 4OGZA 4PJEF 4L3EE 3L3DB 3HUJE 3QNZA 4Z7OF 3WKNA 1S7VB 5DJCB 4IIQB 3NZHL 1I7TA 3VFGL 1ZS8B 5I2IB 5F9WC 1NL0L 1FZMB 1VGKB 3I84A 2EC9U 4TTDD 4OIIH 3O2WH 4PJ8A 3IDJA 4KI1A 2G2RA 4XVSL 1GIGH 4QXUL 4OF3A 2EH8H 4YHKL 3NAAL 4M6ML 3FTGB 3HI5L 4ZOBA 5D7LD 5FDWA 4Z78B 1P6FA 2PN5A 2X9XA 3VDCA 1NAKL 2P7TA 2ZCKH 4K9EC 4Y7MA 5MI0C 4OLYL 2P8PB 1JE6A 2BVYA 4XNMA 3QUML 1U8OA 2FLRT 1CBVL 1CXHA 1ADQA 3DSFL 4FFYL 4WO4B 4YDKH 2BC4B 5DMGC 3FOLA 5JHDA 4MA8L 2Z31A 1J05B 2BVOB 1N2RA 2R56L 4HDIA 1NDGB 3FRUA 1QO3A 4DFIA 4FQLH 4J3WA 4LLUB 1CXEA 3G08B 3D48R 3CZFA 4FXKA 5IB5A 1A21A 3AS1A 4M93B 2E7CA 4K3DL 2HTLC 4OGAC 3RL2B 4X4ZA 1ZSDB 1P7HL 5D71L 2IG2L 3RNKB 3P30H 5E5UB 1YN7B 4FQ1H 3VXTA 1M7XA 1SVZA 5J12C 2VABA 2ZPKL 3EOTL 4MD5B 4UINH 4HC1H 4UT9L 2I5YL 3QUYC 5INDA 5IBUB 1INDL 4P9ML 3V52H 1CYGA 4OZHA 1J0JA 3LH2H 3BIBX 5E7BA 3G04B 4LIQE 3L5HA 3WO3B 1TJIH 4IOSD 4DZ8A 1PX4A 3U4EB 5F21B 1T5WA 2RCSL 2GAZB 4L8CB 3EFFB 1ZANH 2QHRH 3LQAH 1KELH 1R3HA 3GJFH 2W1NA 1S7WA 1NGPL 5AEAA 5B3NA 5MENB 3OAUL 4E0RA 4HQQH 3DX6A 5IOPA 2ICES 3D1MC 2VAAA 2Z91B 4YDIL 5IESL 3BISA 1CG9A 3AS2A 5J7CC 4IRSC 1HXMB 1MCIA 3STLB 2XKNA 1ORQA 1YNTA 3ES6A 5D7IF 1AQKH 2NXZB 2IAMC 1JVKA 3AXLA 5D2LE 2VMFA 4PJFB 2EE3A 3S3SA 3UZVB 2H2SD 1S9WB 3S35H 4UIKH 4MAYB 1FZJA 5TQ2H 4XMKH 5MENE 1ZGLA 4M43H 4U1HB 2Z92A 5IWLA 4Y5XA 4OV6F 4PGDA 1MLCA 4F58L 1D5ZA 3ARBD 5B39G 1SYVB 4EN3D 2RJMA 5TE7L 3T4YA 3BWUC 1UKQA 3B9KA 4P46A 3P73A 3U4BL 2D7TH 2HP4A 3CC5A 4KRLB 3EZ8A 4FQHB 1D9KD 1B0WA 4PJFE 2R2EA 2IANB 3ZHKA 4ZPVA 1ZEAH 2Z4QB 5KSAA 3MLRL 4G80A 5HGAA 4ZTPL 4BK4A 5D1ZB 1F4WH 4U1KB 3VI3F 1T0MB 5I6XC 1VPOL 4WNQB 1UH2A 2WUBL 3LEXA 1G6VK 1RUMH 4TVPH 1AE6H 1X5AA 1KJ3L 2IQ9L 5BS0D 4JY4B 4OIBA 4N1CA 4XP5H 5ERWB 4Z76B 1I1YB 3T3PF 1NGQH 4U0QB 2Q1EA 3EO1B 5K9OB 1WITA 3F58H 4XRCB 1JL8A 3MLWH 2IANE 3V5KA 1ACZA 4X5XB 3FB5A 4HCRA 5EOQH 4KK8C 5EN2A 1MFEH 2HN7B 3GSQA 4ZO9A 3NACL 1FAIH 5DTFB 3X13B 1S3KL 4MJ5B 3ALXA 1BF2A 3BQUD 4HPYL 5C0AB 2OX5A 5IBLD 3PGFL 4D0DB 4QOKB 3SDXB 5IR1A 3T2OA 1AKJB 4OCWH 4K9EH 4U1GB 5H94A 4ZNEE 1OAZL 1R24A 5ANMA 1OP3H 2HT2D 1UEMA 2Z8VC 2R2BA 1SEQH 3AU1A 1JGVH 1P7QB 3S4SA 3TZVC 1UKTA 3OKLA 1IEAA 3A67H 3OXRB 4RBPH 2OM5A 5C0AE 4IRJD 4TPRH 5DFVD 3THMH 4QOKE 3SDXE 3MUZ1 3VW3L 2JB5L 4NSKA 5HYSG 5EO0A 3O11B 4TUKH 2BSTB 4PS4L 4XNXH 3FHQA 1YQVH 4LCUB 4FN0A 5HI4D 1B2WL 4PP2B 8FABA 4JG1H 4Y19D 1ZXQA 4W6WB 1U8KA 4JN2B 1FSKB 1XF4B 1MRDL 2VXSH 3BVNA 1XF3B 1L9NA 4NCC1 2ADJA 4GW4B 1UFUA 4HZLB 2JK5B 4HIJB 5I74C 3QUMA 1BAFL 1A1OA 3LS5H 3MLPA 3P40A 1FNAA 3MRKA 4L8SB 1CD1A 4KJPD 5CZKA 2EYRA 3NIDE 3ZLQC 5GPRA 1ZT7A 4K7PL 5DUMH 2NXYC 1OP3K 2YEZA 5FO7A 4L4VB 2FIKB 1YPZA 2DLFH 3MFGB 1Q9OB 1NPUA 1ZWIB 4PV8A 3DVNA 3ARRA 2H26B 5EO1B 4QWWD 1G7LB 3DX9A 2P24A 5C2UB 4JM2B 2OQJB 1D6EB 4P5KB 5IUSA 3BAEH 3ULVL 4I18B 4RZCA 1TVHB 4PY7A 3IAPA 2CGRH 4WW2B 1B0GB 4R3SA 2GSIA 3OKDB 3H42L 5J56B 2Y07L 2CLRB 3STZB 4Y2OA 3FFDA 1WZ1L 2VLKB 5HJ3B 5F96L 4L4VE 2HT3D 3ROOB 3OX8A 3U6RB 4M6OL 4HT1H 1ACYH 5DO2C 3T1FA 2V9RA 1HIML 2HH0L 2YPLA 2QHLA 5FA4A 3GJFB 1HQRB 3VG0H 3BRFA 1LQSR 4K23L 3VXUD 3FN9A 1I1FA 5L7XL 1BX2B 1AGEB 4OCSH 1OM3H 3BD4A 1GGIL 2KKQA 4Z0BH 2VLME 4I9WD 3OTTA 1MUJA 2WIMA 4NNXB 2VLKE 1MCWM 4DKFL 5ISZA 1FNEB 1IGTA 3KAAA 1IGFH 1C16A 4X98B 1YY8B 4MXVF 5DHVH 5TE6L 4QCIA 5LAXB 3LPWA 2ICWA 4PJ7A 1BF8A 3D2UA 3LB6C 2K9UA 2YK1H 5GSVA 3I6LE 3O2VH 4NKIL 1NCBH 3L7EB 3OKKA 3MRMA 4QRRB 2FWOA 4GBXC 2PR4H 1LK3L 4XVUD 2CDGB 1JNJA 2HJKB 1KN4H 3CVIH 4AMKL 3WHE1 5I18L 5I1GH 1FVEB 4OUUB 5FOJA 3U9PL 4ORGB 2HJLB 3GK8L 5D72H 1JF1A 1C5BH 4O02H 1I8LC 2O5XL 4MQTB 2BJML 3WN5C 1P4LA 1WCQA 3DX8A 3K4DA 2Y06H 2PO6D 4Q6IB 5TDPB 5F1IA 5EO9B 1EH9A 4FQQA 1J1XL 4AM0A 1OTSD 4QNPF 2DLTA 5T1LB 5DK2A 2ZUYA 4QRRE 1PSKL 5DHYB 2AV1B 2FYYB 1E27B 3QPQD 4F7EA 3JWDC 2AJVL 5CZVL 2EKSB 1CZ8L 1PEZA 2BXYA 2XFXA 1X7QA 1MCNA 4Q7DA 3O4LD 1KSRA 1W0WB 1CR9L 3BRDA 5DJDB 5F7UA 1OPGH 3NABH 4NKQB 4APQD 4JAMB 1M71B 4JFDD 3AMLA 4BELD 1ZLSL 1MFDH 2C1OA 2WSKA 5FKAA 2CJUH 5BXFB 5F9WB 3NPSB 3TVMB 2IPTL 2LU7A 4RMVA 4EIGB 5E2WL 4NM8L 2AS5M 1W0VA 2EXWC 1R5WA 4ZDHA 5IB3B 3DGGB 5CD5C 3JV6B 4P2RA 3FQRB 4TVPE 2HRPL 4Z7VF 5KW9H 3MJGX 4GH7B 3ILQD 5IKCA 1GHFH 5FHAL 1WFOA 4WFHD 1TZGH 5TFSH 3VWJD 1C7TA 4A6YL 4Y5VC 2AAVA 5ID0A 3VRJA 4QXGH 5MI0B 1IM9B 2J4WL 4ELMA 1I1CA 4RISH 4HWEL 1KEMH 1MJUH 1WEJL 5SV3A 3MRFB 3ISWA 3OKEA 1S78C 1X4ZA 2B2XL 4RFOH 5FM4A 3L9RB 5ESQA 5C09D 4UUJA 1XGYH 3DTXA 4OZGA 2ED7A 3CVHH 3VXQA 4C4KT 2XN9B 4YHLL 3FO9B 2IBGA 2O5YH 4NZRH 1KYOJ 5CSZA 3EYFA 3TIDA 4Y4FA 2DTML 2B1HL 2VITB 4HD9A 5J12B 1CFQB 2GY7B 4HFWB 3P77A 4WI2A 3QUYB 4PJAA 3JWNC 4Q0XH 4ZTOL 2P48B 1ZT1A 2OMNA 4GMTL 3T2PA 3MJ9A 3OJVC 1UXSA 3ZDZF 5IHLB 1HILB 2XN9E 2IH3A 1IC4L 5DJ2A 3S88L 1CFTB 3CSPA 4GLRH 3TV3H 2VC2H 4H26A 1YEHL 1EAJA 1AC0A 2XKUA 3F12A 1BLNB 1IAIL 5LKNA 4GMSL 3RL1B 3VCLB 5IK3A 4KQ4H 4RGOL 4D8PB 4X9BA 5EU4A 4LLMB 1A5FH 4HV8B 4PR5A 4NBZB 1I9JH 4WI3A 4HS6A 4KGLA 5J57B 1FNGB 4X7EC 3G9VA 2R9HD 5BV7L 4NHCH 5I1IH 3QCVL 3ZHDA 5EG6C 2OXGA 3D69A 1KNOB 3C2AH 3V6FB 2NY1B 3BI9X 4BFBD 4BYHA 3HRZB 4LPCA 4OQ1A 1S9XA 1N64H 3QDGD 3TH4T 3QHZH 3GMQB 4Y1AD 2AJZB 3O3BA 5IIEB 3CFJB 4P3CL 1T6VN 5KOVC 3IU4L 2H3NA 1VFUA 4WTXA 3DX7A 5I1LB 2AVGA 3IU3A 3K8KA 2IALA 5GS1C 3QQ9C 3NA9H 5EC1B 5AUMB 3RIFK 1I9IL 1BGXL 3FMGL 4XVJH 1RZ8B 4LSVL 4XNQA 5F88A 2GEEA 2BMKB 1A1NB 2AK4E 4NO2A 5JDJA 4FG6D 3GIVB 3HAEG 1EA9C 1VGEH 5I8OL 4PV9B 1F45A 3O6KH 5DJZA 5GSRA 4ZFGH 3CFEA 4C83A 3QG6B 3JWDH 4LP4A 3KDMB 4PJXA 2VDOH 5DHVB 5I6XB 1DBAL 3LS4H 2VB5A 3V6ZB 2E9BA 2QKIA 3WNLA 2XPGB 1RJLB 4HK3J 4XNYL 3VFVA 5F9AC 3JV4B 4ZPTB 4R90H 2RQ8A 2E7MA 1G7PB 3RZCC 3EJYC 2AXFA 5IROA 1IJ9A 3QPXH 1MCJA 3DBXB 3MRPA 2IMMA 3P0YL 2R69L 4I77H 5MERA 3O6FB 4OLZL 5C07B 2MPAH 5DUPH 3FO0L 5DJAA 3JTSB 1JGLL 4ZXBC 2PNDA 4DEPC 5E6YA 3SJVA 5E9DD 2VJXA 3CH1A 3U2SA 2LABA 1C5DA 5KS9F 3T2NH 3MBXH 3I3BA 3TA3C 4NBYB 2HKHH 1WZLA 4LK4A 2CRYA 4LL9A 2UVEA 4HSQA 2PXYC 3SKOB 5CZXD 5B38A 2J8UA 2J6EH 4PD4J 5C0CD 4KQ3L 2GTZB 2QSCL 3GUTB 1OGAB 3KHQA 2BRRL 3QUZC 5CEYB 4O2CB 1TZHB 5C07E 3TZVB 3ARDC 5H2BB 5JORB 4LEXL 4X9HA 2V7HB 4FS0A 5BO1H 4PTUA 1ED3B 3CUPB 5GS0D 3MFFB 4KKAD 5E03A 2OBGA 3LKRA 1SVCP 2APXA 4N0YH 4NQXB 5BMFH 3ULUC 5IFHL 4GG6A 3BT2L 4FQJH 1QQDA 4ZS6D 1UYWH 1T89C 3MV9D 3L5IA 1K3IA 4GKSB 1A4KA 4KHTH 4DAGL 2OMBA 2UWEE 3RTQD 1CD8A 1RK1B 2BHYA 1NBYB 4IOFC 5DD6A 1W8NA 4YHOH 1OGAE 2VAJA 3UBXB 2W9EH 5E2UH 1A9EB 3RA7H 3L3JB 1A4JB 4A6YA 4MB5A 5C1MB 3K3QA 4R4BB 2YMXL 5K9QG 5I74B 4XAKD 1T5XB 2NYYC 1T7VA 2ITCA 2QEJA 4C4KO 5BW7C 5MP6L 1FVCB 2APBA 2ADFL 1HI6A 4XNZC 4D0CA 1DBMH 3WEXA 5I16A 5IMLA 1Z9MA 4QY8A 2NXYB 4JHZA 3QJHB 4TSAL 1LMKA 2G9HB 5FK9B 4U1LA 2HFFB 2KZWA 4XC1H 3VXMB 1WFTA 3OF6D 3GI9L 2BY2A 4N9GB 1FNFA 3TT3H 3MRLB 1BZ7A 3RDTC 1MHEA 1SY6H 4I3SL 1U2CA 5I19L 4U3XA 3D25A 3BMVA 3FT4B 2VZTA 1XGRB 4L3ED 5JW5B 1U8MA 3FCTA 4HHAA 5DC4B 3LRSB 4X6FA 3MLYH 5ABDE 4CVZB 5CD3B 3QWOB 4NPYB 4PJIE 2VKWA 3HMWH 1IQDB 4H1LA 3TBYA 3I3EA 2A77L 3SDCC 5CINH 1B4RA 3KJ6L 4U4BA 1MI5A 4F33A 3FFCD 3NGBC 4QRUB 2VE6A 5B8CC 1KLUB 5IM7B 1BOYA 4KRPD 3VXME 3TT1L 1TQBC 5JIPA 5CGMA 1NEZG 4JM4H 3WFBL 2D0FA 4XBGA 2IQAB 5JXAL 1G7MA 2X4PB 4LSRL 1M1SA 4WENB 4LVOC 3PL6D 1DBKL 4QHUB 3U48A 3SDYH 2X4RB 1DQJB 4WJ5B 4WFEE 4ODBD 1X4YA 2A0LD 1PKQE 1IM3B 3GGWB 5J11C 4I1NB 2X4NA 4LCIH 1S7TA 3TP4A 2QQNL 3SBWA 3B9EA 4TULH 3IFPA 1BQLL 1QA9A 4GBXB 3O3AB 1FLTX 4I3RH 5I1KH 1FFOB 5EUKB 5EWIL 4Z7QE 4LSSL 2C3GA 2DWDB 1C08B 2Z9TA 4YO0A 1HH9B 1NGWB 2R8SL 5I1EL 5TQ0H 5T1MB 1LP9F 3OR6B 5T5FL 5F3BB 1GRWA 3MOQA 3MV7B 1RUPH 4ETQB 3QFJB 3RVXC 5TF1H 4L5FH 1R3LB 1U95A 3BH9A 1RJCA 5IP4A 4FOMA 4QRTA 1WIUA 4MCYA 4PGBA 2V2WB 5ALCL 2NY4C 4PJCF 3KPPA 3W81A 2DDQH 3EBAA 3SDAC 4I13B 1QP1A 3L3OB 5GJTL 3JUYA 1H3PH 2F8OA 5J8OA 4FMFA 2DF3A 2WWMD 3U83A 5J4MA 4YWGH 1JGUL 3MV7E 3D39A 2JELL 3QFJE 3RUGA 3PWUA 4NHUB 4P57A 1LE5B 1IGML 1D5XB 4YDLC 1RIUH 3LN4A 1YC7A 2JCCB 2ZUUA 3NPZB 5C9JB 3ULUH 1L7IL 1P69B 1F02I 3KPNA 3PQYD 1FL5B 4JQVC 4NNPH 2IADB 5DMKB 4L9LA 4CW1A 4ENEC 4U2YA 1LO3L 5DWUL 3S9DB 2HYMA 4YAQB 3DVIA 1JPGB 1A7NL 5GRJL 4M03A 5J6GA 3RVUC 3BHBA 1BHGA 5MEND 2GJ6D 4Y5VB 2BNRA 4XC3H 5DVOA 5L2KB 2EXYC 1IKFH 2GJZA 1UVQA 2JCCE 2HWZL 3L7FB 5CJOL 1KXTB 4XT1C 4OLWL 3V95A 2W65A 5DK0B 4KY1L 5EB9A 5F93C 1MHPL 4XP1L 4YZFE 4FQIH 3LZFL 5A3ID 5C0JA 3GMNA 3WJLC 4F80A 1FJ1A 1HHHB 1JJUA 3F65A 3MXWH 5F7YC 3MCLH 4MAYD 2ZCLH 1P5VA 2JTDA 2BCKA 1Q9KA 1TFHA 3SKJH 2Z93A 3O0RL 4LHJB 1H0DA 5IBTL 1FZOA 3GSOB 3DUHA 1FGNH 2NPLX 1UB6B 4DQOH 1CLOH 3BXNB 5CIPH 3FQWA 2FEEI 2X1WL 5SV4A 2DAVA 1DVFC 2C3VA 1JMXA 1UT9A 3V0AC 3GM8A 1W8OA 2UZIL 3E3QC 4GAJL 5I0ZA 5FYKH 2P47B 1RZGA 3K8LA 1KJ2L 3REVA 5JPNB 2F8XC 1EAPB 1J1PH 1M05B 3L3GB 3UTSB 4ZUUB 1OT1A 5MEPB 1D6VL 4CADB 4G9FA 5IJKA 4K2UL 2WP3T 3TWCH 4M61B 2FSEA 1CLYL 4K94C 3ARZA 4OM1L 5C0FB 3WHXB 4BH7A 4PRHA 5CILL 3P0GB 3W9DB 4Y4KA 1T1WA 1U6AL 1KLGB 5DF0A 3U46B 4L1DA 4TUJB 4NZUH 1Z3GL 1Q1JH 2NR6C 1OVZA 5JW4N 2OYPA 4X6DF 4NZTL 3BZFB 4JFED 1VKXB 1AXTH 4HKJA 3UTSE 3V0VB 1A7QH 5GS2D 4QOKD 2NQCA 2WANA 3GO1L 1CS6A 1AO7A 3W11C 3W0WB 4L9DA 3WIHH 4GKNA 5GGQH 1AKJD 4G6KH 3HC0A 3L3KA 4PGEA 1MCRA 4NO0D 3V6BR 2CD0A 4QRSB 1X3DA 3QIBC 4Q9RL 5GS1B 3MOAL 3IDIB 2NY7H 3HE6A 1HH6A 3UX9B 3BPOB 4M1GH 4DW2H 3CFDA 1P7QD 4P9HH 2XZAL 1NCCL 3AS0A 2VSCA 4Y8DC 5CCKH 5F7HA 3X3FH 3DO7B 3BYTA 2B5IB 1MCOH 2PYFA 5HGHA 4Q2ZB 5HY9B 5CEZH 3QI9D 3TO2A 4PB9L 4ZFOL 1NLDH 1NANI 3B3IB 3FB6B 3KNBA 3KXFB 1EO8H 2CO6B 2DQDL 3BSZL 2R4SH 1EO5A 2J7LA 4C55A 4O51B 1JWMA 2E9JA 5K9KA 3B6SB 2VYRE 1EJOH 2QSTA 4N0FB 1I1AC 1CICD 1ZT4B 3MRQB 4IHOA 4K8RC 4GQ9H 5IFAH 3HC3L 4MMZC 3M8OL 4D3CL 4WTZA 1FCCA 6CGTA 1T1ZA 4NUGH 4MJ6A 4DEPB 1FO0L 5C3TA 2E6JA 5I1HH 5C0EA 5FYJU 1TCRA 3TIEA 4Y2DD 3KXFE 3WFHA 2EDQA 4QHLA 3WS3B 3TA3B 2BFVH 1RZFH 5EOCJ 43CAB 5LQBH 4OUOA 2EDFA 4JY5H 3ME0A 3OR7A 3MV8A 4LVNC 3NIFF 5IMMB 1AIFA 3ZYOA 1DQQB 5IWLC 1ND0A 1QFHA 1RFDH 4Y5XC 2ADIB 4JM2D 2R15A 4LRIC 2FD6L 1IEBB 4CMMB 3ARDB 2NTFA 5JIKA 5CKAA 1WBYB 3MREB 4LPTA 3VGHA 3BZEA 2FLBT 4XPGH 4GXVH 5GGVH 2X44D 4ZS7L 3MNZB 3EYUH 3L5WB 4S1RH 3FQTB 5KBNC 4ZO6A 5AWNL 4YX2H 2BNUB 3CMOL 4OT1L 4CVUA 3TO4D 3ELAT 4CUCA 5BRZA 4LHQB 1S7QA 1A64A 1I7ZA 4G6JH 3UJIL 4ODUA 1SBBA 1IBGL 2WBWB 2EKJA 2HFGH 3KPOB 2MSPA 3RWIA 4LAQL 3GMOA 4HKBA 5C9KA 4XNZB 3ULUE 2DKUA 2R1WB 2ZNWA 5DDHB 3MOBL 2WQRA 5ADPL 5EBWA 3QEQB 4BZ1H 4LLWA 4MDIB 3MR9B 4ODWA 4HF5L 2YR3A 4J12A 4UQ3A 1UJ3A 1V5JA 4QRRD 4I0CC 4K94H 4YIQB 3RDTB 2KZ1B 3ZKXC 4JFQB 5E6ID 5LGHH 3EDEA 2H9GB 1KCSL 4XP9H 1RZIA 2X1QA 1I3GL 4XPBL 1JUFA 5D9SB 2CDFA 2AABL 3HNTL 5CIPB 4HH9B 5TPWH 1KTLB 5JUEL 4W6YB 1BQSA 4JY6A 1G7HB 5DJYA 3SDCB 4AEHL 3R1GL 3O6LL 3NGBB 5B8CB 4KXZH 5M7QA 1RZKC 4R4ND 1KJ2A 1TQBB 2E6QA 2WP3O 1A6WH 2BVQA 1AFVH 2VXTL 3SGDH 2XNAA 3T0EC 1T03L 3DWTA 3C5SB 4LVOB 4NRYA 3QXDB 3CCHB 5D6DA 2MHAA 4MVBC 3FOMA 5D2LF 2Q8BH 1N4XL 4AEIH 4FTVD 1QLEH 2E9WA 1MLBA 1YMMA 2YSSB 3KS0J 4IMKA 2JKXA 5ID1A 1QEWA 4MNGA 3VGGA 4FFWC 3LEYL 1WGOA 3T4AA 4AL8H 4H25B 3TN0D 2DBLH 3N06B 1XGPB 2EYSB 1F6AA 3TVMD 5J11B 2J2ZA 4MJ4A 5FYKE 5HHNB 3MV11 3UJJH 4AT6B 3MUJA 4P3DB 2NX5A 1U3HA 4OJFH 4KVNH 2L7UA 4OTXH 1BFOA 3BW9B 1NDMB 3QISA 3ARVA 5DJ0A 3EDDA 2WK2A 3JXAA 4RRPA 3IFLH 3J7HA 3CX2A 4GS7C 3V5DA 1CF8L 4XI5C 3DPBA 4LCYA 3RWHA 3ZDYF 2GFBB 4OLVL 1VESA 4YE4H 4LARH 3VGEA 2FX7H 4K8RH 1SQ2N 4TRPL 3LRGA 4QHNA 5EZLA 1IM9D 2D0GA 1R3JA 1H8SA 3EO9L 4TQEL 3ZTNL 2R23B 5E8EB 1HK6A 1QKZL 1S9KC 2WBJA 4ZO8A 4LF3A 4FA8A 3SE3A 1AP2A 4TSCL 4U3CA 1UADC 5E94A 1T4KA 1KIQB 3O3EB 2BVTA 3P9WB 4M7JH 4UAOC 3WKML 2NY4B 4OGAD 3KPSB 3ZDXE 2BSRA 3SDAB 3IB4A 5GS3A 3X17A 3GSNA 2IPKB 3AAZB 4RAUB 2B4CL 3N1FC 5E08L 1N7ML 3SGKA 5I15H 3LQZA 4NO3A 5FOBB 4Q97A 4YDLB 4OKVA 1LGVA 5ACZB 3QXAA 2ZUSA 1RVFL 2AW2A 4OZ4B 1UA6L 2Y7QB 4R7DB 4X6EA 4XGZA 3KGRA 4WI9A 2D4FA 3WV0A 2XQBH 3MNVA 2OSLA 3QG7L 3VXPB 3VFPA 3B8SA 3DUSB 3I2CL 5DMIL 1HWGB 5CEZE 2HG5A 1FO0A 4QHMA 4YDVA 4BA8A 4BZ2L 4RGMC 3FAXA 3ARFD 3LKNB 1LO0H 5JDSA 3K0WA 3ZT5A 1AD0B 2I9LB 3CPLB 3RGVA 2IWGA 1A14H 3LCYA 4P23D 1GOHA 1Q0YH 1NLBH 3AM8C 3DJ9A 1IT9L 3N1GC 2V2XA 3UYRH 4PJGF 2FJHA 2GT9B 4F7TB 3C6LC 3Q48A 5M95B 4K07A 2F54B 4LSUL 4MXQC 5I30H 4HCRH 3QNXA 4Y5YC 1GGBL 5DHXB 1DUZA 2AK4D 4LBEB 2NY1D 1KEGH 4Z7UB 4HUKB 3ECBA 1F97A 4PRAA 4YH6A 4AENB 4M6AA 2F74A 3C60A 4LSQH 3UCRA 5LCVH 5AD0B 4EDWH 1N59A 2DQIH 3QIWA 5ELIA 2R4RL 4P2OD 3PP3H 4UB0L 4DJMA 5HYSB 5EU6A 2VUYA 3S37H 2EZ0D 2F54E 3B4NA 5CBEB 3EHBD 5JIIA 2VLRE 4JR9L 4WI6A 1DVFB 3ARGD 5C6PB 4PJHF 5DGQA 1I7TB 3OKMB 4HXAH 3HE7C 4Z7UE 2BDNH 1RZKH 3PGCA 1ZAGA 3CAFA 5E6ZA 3HC4H 5GJSH 4AIXA 4UV7H 3CGTA 5IVXA 3B9DA 4HUNB 1DE4B 1OSZB 4WI7A 4XX1E 1NBZB 4HLZH 3WIIL 3WJJC 4AZ8A 1MCHA 5IMOA 1AGDA 1KCRL 1UB5A 4Y4HC 2R0LL 1TJHL 3KWWB 1MIMH 5FUZL 5A1AA 1T0PB 1FYTB 1LE9A 3E3QE 3M45A 4XNMB 4M7ZC 3O6FD 2VDKH 1JYNA 3H7BA 4KK8D 4LIQL 4KV5F 4NWTL 5JO5A 3QWRD 3JVGC 1PG7L 1PJ9A 1RUAH 1J5OL 5IHUL 1BJMA 2FO1A 2E7LC 3C08L 3BE1L 5FGBA 5IB5B 3O9WD 1OTUC 5IF0A 3U7AA 4J8RA 1CFVL 1IC1A 1BVKB 2IGFH 4P49A 4XNUL 4E42A 1B9ZA 2Z35A 3VWKC 3MGOA 2L0DA 3QIBB 4OAWB 2MQ3A 4KUZL 4MNHA 4ZAKD 1Z9LA 1FYTE 2ZCHL 5GGSB 4BFEA 1OGAD 4LQFH 2VABB 4FQXA 2IC2A 1AXSA 1UXWB 3FO2B 3QHTC 6FABH 4DGIH 1EO7A 3UPAA 4IBLT 2J88H 5EU3A 4MS8D 2FECI 4NQCD 1MWAH 1DANU 1T7WA 4H0GA 4I8DA 1UWEH 2H6PA 1P4IL 4MLSA 2Q6WB 3ARSA 1T5WB 4LGPB 4XPFH 4J3TA 1ZHKB 3K2MC 2P8MB 4IS6A 5LBSL 2DM2A 5TH2A 1EGJL 5F3HA 5EC2A 4JFPA 1TCMA 2OLDA 2V9TA 3HLAB 4E0RB 3DV4B 3NZ8A 3DX6B 3H9YA 5EOTA 1I1AB 5IOPB 4Z0XA 1AR2A 1NMBL 1SEBB 4HS3B 4JPIA 1T21A 2VDLH 4OZHE 4E41D 1A02N 1G7IA 1Z5LB 4H88L 3CDGB 2FB4H 2XKNB 2YZ8A 4XZUA 4NO5B 1EZVY 3ZKMD 4JDTH 4WWKC 3AXLB 1UWXK 4U0RC 4OZFA 2MFNA 2O5ZL 3UP1A 4HIIA 3S3PA 4LVNB 3U0TB 2Z8WC 2HKFH 1WWBX 3WD5L 4BH8A 5IW1A 1OLZA 4Y5XB 4PGDB 3SQOH 1MLCB 5D5MA 4GW5A 4UDTB 3T4YB 3QEUA 3T0XA 3SE4A 3BWAA 2AK1H 3X14A 3NN8A 4M5ZH 2OI9C 3P73B 1Y0LA 3ARED 4ZFZA 2DQTL 4KTEL 1RAMA 4F37K 5KSAB 4G80B 5CUSL 4MWFA 2OJZH 1L7TL 3HPLA 4HBCL 5FCUL 1FAKT 2VISA 4N5EC 3QXWA 4WUKL 2FX8L 3BN3B 5E1AB 4MZ3A 3QXTA 1JN6B 4QXWA 4EI5C 1U92A 4X6CA 5EZIH 4BQCA 4WEMB 3UROR 5IV2B 2CIKA 2DQHH 3O2DA 4NWUL 2X70B 2EH7H 2Y6SC 3WFDL 1QNZL 2OR9H 2DWEB 1RUQH 2ARWA 4QHKJ 4QRQB 4GBXD 1OB1A 3HNSH