4B41A

Crystal structure of an amyloid-beta binding single chain antibody g7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASRSIISNNAMGWYRQAPGKQRELVARISSGGRTTYADSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCNAASLVRGPLDHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY G7
publication title Crystal Structure of an Amyloid-Beta Binding Single Chain Antibody G7
rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4b41A00
4K8RH 1X44A 5FECA 3CLEL 4BUHA 4B5EA 2YC1B 1RHHB 3ZZ1A 1LP9A 1CFSA 4CDHA 2WQ8A 1S9WA 5HHOB 4PLJC 4DGIH 1WT5A 4AENA 4CN6A 4DQOL 1RZJL 5C70A 1T1XA 3F5WB 1QLFB 4L5FL 2EXWD 1Q94A 2ZZUT 1J1XH 1S7UA 3QXAB 3WS3B 3EYQD 3QQ9D 1P7QB 3OAUH 4OKDA 4PJHF 4IDLA 5J3HD 3RIFK 1MJ8L 2Q1EA 3DYOA 3L95B 5J12B 4HIHA 4P59L 5GGTH 4BFBD 5BQ7B 5IB4B 1I3VA 3M17A 4PGDB 5EFIB 2ZG3A 3GSRA 4HV8A 1JGEA 1I9IH 3UAJC 3O45A 4KK9D 4LQFH 5D1QB 3QIUC 2FX8H 3UTPE 1OY3B 1ZWIB 2V2WB 1SMOA 2Z8SA 4Z7NE 4DKAA 2PF6A 3HFMH 5MENA 1BEYL 5GHWL 2DBLH 4GRWH 2ADFL 2Y36L 2BFVH 1OLZA 1ZT7B 4JHBA 3F7YB 1JNLH 1JWSA 4Y5YA 3ILQC 2NPLX 3GMPA 1X5FA 1DN2A 2ZJSH 3HC3H 5C9JA 3O4LB 3T65B 3VI4E 1JZ5A 3V5DA 4X7CC 5FYKL 1R3IH 4PG2A 3O11B 2D4FA 1ZS8A 5E1AB 3E6HB 5ID1A 1A1MB 3PNWA 1QQDA 1MVUA 3R0MA 3LQAH 4E42B 1X7QA 2A83A 3HC0A 3BP5A 3LOWA 1YEKH 4WUUD 4ZXBB 4U1IA 4Z7OF 2DB8A 5E9DE 3VGAB 1C5CH 2V5TA 5ERWA 3SKOB 1RUAH 1BFTA 4UU9A 3DWTA 5EO9A 3RX5A 3FN0L 3RPIA 1MFAH 4WCYL 3B9KB 3EW3B 1E6OH 2O5ZL 1YC8A 5DJCB 5EPMB 3IAQA 1HKLL 2YPLE 3WYRA 1OF2B 5J13C 1MIMH 7FABL 1IAIM 5GS0H 4LDOB 3LB6D 5INDB 2HMIC 1Q9WA 1KELL 3OX8B 1IAOA 1I8KB 2BVQA 4OLYH 4NC2B 1FZMB 3NPSC 4APQD 2A6KA 1WBXB 3C60D 2DQIH 1SYVB 3GMNA 1FFRA 3Q5TA 4FXKB 3ZKXB 4NN6B 3TNNB 2A1WL 5EB9A 2DTMH 2VWEE 5EC2A 3SDAA 4BFIB 3GMMB 4P3WA 4AM0A 4IRJA 4WI9A 1CN4A 1OSZB 3EO9H 3EOAB 3PWVA 4NQDE 2I9TB 4OBRA 3EOBB 3KR3H 1LD9A 2B2XL 4FTVD 3N06B 4Z7NF 3TT1L 4JDTH 3RVWC 3SE4C 1B4JL 1T03L 4XPBL 3TFKC 3CFJA 4P5TD 1I9EA 3N9GH 2X1WL 4AQ1B 1XR8A 4PRPD 4NHCL 4KGJA 4NPYB 2PXYD 2J3SA 3V7AE 1E0OB 3VA2C 2GW5A 1FN4B 3WMSA 2WWMC 1AGFB 2DOCA 3CDCA 4HLJA 3TO2A 1KSRA 5A43C 2X89A 3IFPB 1T2QH 4XPTH 3JWOL 5FOBA 4JHWH 3RWIA 2AK1H 1QVOB 5DDHA 4J3UA 4C56E 5D2NB 3L3KA 4FXGA 5HGGS 4OGAD 1X4YA 1ZGLM 5DUPH 1JNHB 3SDAC 1EZVY 3LDBB 2HT2D 2PCPB 1KCUH 2HT4C 5F97E 1IL1A 1OW0C 4IRJC 1DQTA 3KNBA 1P5UA 2IPUG 1LEGA 1PKQB 1BFVL 3IKCA 3IKKA 4JRXE 2XTJD 5GRZA 1F3JA 2D3VA 2W0PA 3IJSB 3FFDA 4Y4HD 4YFDB 4PV8B 4F2MA 5IIEB 3HAEA 4JFHE 1MREL 5J6GB 5D7IE 2IAMB 4PGCB 1NGZA 4P46D 1XEDA 4HSQA 4XP9H 4QOKE 1CFTB 5CGYC 2ZUVA 2YXFA 4Y2DD 5F9WB 4MQ7B 5F7EL 4ORGB 5F3BB 1MJJB 1NDGA 3GHEH 4HEPG 1N26A 3IJHA 3MREB 5SWZA 4LQ1A 3SE3C 4ODXA 3CC5A 1UFUA 5SV3A 1S9XB 2AEPH 4PJ8A 4APQB 3BJ91 3QEQE 4X6CE 2Z35B 3VMNA 4ODWB 5JW4M 4ZFOA 4ZNEE 5HVFB 3A67L 4OGZA 4XP5L 3W2DL 4OCRL 4N0UB 3WS6A 1V7NL 4FQPA 4TOYH 1K4CA 1L6XA 1F4WH 2DQJH 5C3LD 2HFFB 3HLAB 1XGUB 2OCFD 4ZO7A 4I3SL 3EYUH 1F2QA 3KYAA 1P7KA 1S7VA 5EBWB 4U1MB 1IC1A 3NN8A 1CLOH 4JRYD 4IJ3B 1F3RB 4GW4B 1QFWL 4NQXA 5C2UB 4O58L 1LDPH 4TN9A 1FNSH 4Z0BL 1WFTA 4HK0B 4P48A 4OAWA 1ZGLB 4RISH 4FQQB 43C9A 4HPYH 1OAKL 1S7XB 3SO5A 4P9HL 1NBYB 4D8PA 1VFAB 4DOHB 2DF3A 3MRMA 1UB5A 1Q9LA 1YNKH 3P11H 1X5GA 3BRFA 1OL0A 4XBGB 2G5BA 5FCSH 3LKQB 5FDYA 4EI5B 3Q1SH 4P3CL 5E03A 5C0JB 2NCMA 2XG5A 4OCSH 1PLGH 2R0WH 4WI4A 1I9RH 4XP4H 3NZ8B 4M4RA 1CGSH 1ZLWH 2GY5A 1L7TH 1V05A 3C6LA 1NCWL 2EE3A 4KZEH 4LLUA 4Q74A 4UTAH 4PJ8C 5KVFH 3VXRE 4JPIA 1E4XL 3T0BA 5DT1L 3C87A 4LPCA 4LCWA 2F19L 3EYFA 4TNVK 1INEH 1IEBA 5FHBL 5D7IF 4YBLC 1RU9L 3MRHB 1YPZB 3DUSA 3HMXA 1T22B 4MA1C 3IU4L 5ITFA 3CZFA 1EGJL 4LDLB 5SX5K 4PJFB 1MFBH 1A9EB 3OKKB 2WWKT 4OCXL 4XCEB 4XI5D 1CBVH 2CKBB 3LH2H 5D2LA 3DGGB 4WUKH 1H15A 4OFVA 2VXSH 4R2GC 5I73B 4Y4FD 5FK9B 3OXSB 2FH6A 4QKXB 5CSGA 2XKUA 4OM0L 4P46B 3HZKA 3TA3D 2BRQA 1G9ML 4RNRB 4X6CF 4XCFL 3ZYZA 1KENH 1YYLL 4U6XB 3WFCH 3GFUA 5L88L 2YWYA 5B8CA 4JKPL 35C8H 2VH5H 3MLWL 1FIGH 5CSZB 3QFJA 3TZVD 5GJTL 5DQ9A 4OCMC 5HYJB 3I02A 2CDGA 4I18C 5HYIA 2X4QB 5IT2L 1K4DB 1AY1L 2YUZA 4I13B 1I1RA 1MY7A 3VMOA 2P8LA 4NBXB 2ZUYA 2Y9RT 4NNXB 3C6LC 1AO7E 4LIQH 1U36A 5F6HJ 3GM0A 2D9CA 5EBLA 4ETQB 3DETC 1YMHB 1J12A 5IEKA 4DUVA 3CMOH 2PYEB 4X7SH 4G6JL 4ZTPH 4TTDD 5E4EB 3NA9L 5DRNA 5EUOE 43CAB 3D39E 5DJXB 1SEQH 3QG6A 4JRYB 4XPFL 3GUTA 3LKSB 3TIDA 1TCRB 4JQVA 4S1QL 1CQKA 4UZGA 2LFGA 1P9MA 4NN5B 1AFVL 3BD4A 4N90D 2X7LA 3MV8E 4JR9L 5FEBA 4WO4A 3KLAB 3CXDL 4XPHH 4I0KA 2GUOA 4PTUA 4QT5A 5J6HB 3QNYA 2Q7YB 1XF4B 3GBNH 5E8EB 5DLMH 3MLPA 1QRNB 2VZ3A 4R4BA 4JFEE 4CADB 1KIPB 5IQ7H 4L4VB 5AG8A 1WFNA 1K5NA 1BZ9A 2C1OA 4HC1L 4P23D 1XIWD 1NKRA 4HJJL 4WTZG 1LGVA 5A40E 5ISZD 3ESUF 3OF6A 5D7KE 4H25A 2VWEC 4LPVA 1HHGB 2L0DA 3GIVA 3PP3H 2VABB 2AEQL 4R7NA 1P4IH 4TNWK 2BHZA 4MWFB 4FQLH 2XN9E 4HKZB 5DJ2A 2GITB 4KJQD 1H5BA 5BJTB 3KPPA 3ZDXE 2VQ1A 5DXWA 3L3GA 4MNQA 2ICCA 5I1DA 2OK0H 5KZCD 1CLYH 2WK2A 1V3MA 3AM8C 3QWQB 4DVBB 3KWWB 4Y4FB 2PUQT 4GJTB 1AGEA 1MLBA 3C8KB 1NC4D 4U1GC 3ABZA 2ENSA 3L3IB 3QI9D 3GK8L 4M8VA 1IM9A 4EN3A 5T3XH 4L3ED 4XP6L 4XHQA 4FQXD 4OD1H 2I07B 5FKPA 3TZVB 3EJYD 2FGWL 3VFVA 2G60H 3BW9B 5IB3A 3UBXI 2EDEA 4N9GA 2APXA 1K6QH 1E4WL 3L1OH 4U3XA 3SCMD 5I1CH 4G6FB 4ZNEA 5HHPB 2X9YA 2AS5M 4X4XA 2GJ6D 3OB8A 4I48B 5EUOF 3GGWB 2VB5A 3QXTA 5KW9L 3CFBA 5D7JD 2P45B 3EDJA 2EIZA 4KK5D 1U91A 4L9LA 4C59B 4AYFA 4P4KD 4RBPH 4AEIH 4RGMC 2VYRE 4N1HB 4NUGL 4KV5E 2EEAA 2Y7QB 2Q8BH 3IDYC 2LV4A 3TBYA 3BT2L 3QCTH 1NANI 2ORBL 2UZYB 5I71B 5C0AE 4XAWL 4POZD 1ROWA 1FSKC 4O4YH 1IQWL 1DVFD 4PJEB 4DZ8A 4LLDA 1TITA 4O02H 1FVEB 1JK8A 4HMDA 2P44B 5DD6A 2CGRL 2OZ4A 2YZ1A 4E0RA 4YHLH 4OB5L 5D5MB 4F57L 5TDPB 2KZWA 5KSVB 3F12B 4LHUB 1N0XL 1H3PL 5HHXH 1L0XA 5IFHH 3K1DA 4FZ8H 2ICEB 3PDOA 3F7VB 4OM1L 1LO3L 4G5ZH 3JTSB 2IQ9L 4CBPA 5IMOB 2NZ9D 4UTBH 3OB0K 2BXYA 1KG0B 2GFBB 4LCYB 1CZ8L 2FHBA 3C5ZD 1A5FL 1MCSA 3OKLA 1ORSA 3ZDXF 8CGTA 5ISZB 1Z9LA 4ONFL 4F33B 2KQNA 3PF2A 1IAKB 5D1XB 5AYQA 1DSFL 3EOYG 4U7SA 4OGXL 1J0IA 2N1KA 1I7RB 3RNQA 3DX8A 1WGOA 4L9DA 5IVXE 3SOBL 1ZLSL 1N2RB 4NCC2 3B9VA 2HLAB 5ALBL 2W59A 1D5MA 3G9AB 1I7TA 3IDJB 1BD2D 1U3HA 4Z78A 4OLUH 1Z3GL 4OSUL 1QBMH 3ARGD 1GOFA 4HCRA 3ULSA 4ZUWB 4LKCA 4NJ9H 1JTTA 2JB6B 4NQCA 1ZLVK 4G8IA 1T0MA 2NY0D 4Y8DC 4R4ND 1OP3K 4FQXB 1ZXQA 3L3HA 3KJ4C 1ONQA 1NCAH 5I1AB 1QKZL 1ND0B 3VD7A 3SCMB 3UMTA 1I8MA 5JQ6H 4N1EA 1R24A 3RWGB 3KG5A 2BSRA 1U8JA 3P4NB 1QRKA 2R9HC 4YXKL 5D7JB 3RL1A 1CD0A 4PIRF 4D9QD 1UCBH 2YRZA 4TSAL 1NCDL 4P4KB 4EJ1C 5FYLD 4JZNA 1E27A 1CF8H 1UZ8A 4NO0A 1G7IA 4R3SB 1YEJL 2P5EE 1R3HA 1DBAH 3LVEA 4JN2A 3TNMA 2FX7H 4WU5A 3F8UB 4S0SD 3AY4A 5FA4A 3ZTNH 4PJ5D 3O8XD 5CEZL 1N5YL 1BVKA 4Q6IB 3TCXA 1DLHB 3K74B 3HMXH 4PRIE 4ACPA 3HKFA 1NGXB 3MLXL 3V6ZA 5F1OB 4F7PB 4LGPB 3PE9A 4MD5A 3FB6B 2AJUH 2CDEB 2R8SL 1AKJA 3WNOA 3IF1A 3WFDH 4HWUA 1T7ZA 1TQBC 2ILLA 2V5SA 4K2UH 2UUDK 3MGTB 3T4AA 1U8HB 1P4BH 3TH4T 4Y8AA 4L8DA 1FLRL 3JVGA 1N64H 1NFDA 2H6PA 2XRAH 4ZAKC 32C2A 1KPVB 5JO5B 2BCKA 1C1EL 3QIWA 2ARJB 4JM4H 1WEJH 3SE9H 3ZE2E 1GYAA 5IVXF 2CR3A 4BZYA 3B83A 1N6QH 4PGEA 3BKCH 3C5ZB 4N0YL 4ONHB 3ZKSD 4G3YL 1FGNL 3HS0A 5DUML 4RGNE 4Y4KA 1N0LA 3A6OA 5DVLA 3WNNA 5KVGH 1S5HB 1I1AA 1OSPH 1F00I 1N5AA 1CDBA 3IFOA 4LBEA 1RUQL 2BVUA 1MCKA 1WJ3A 3ZTJH 1FNEA 3QDJB 4S2SB 1OAQH 3VRIB 3VFWB 4X5WB 4ISVA 3FT4A 3WDIA 4JY4A 4GKZA 5AZEH 3MJ6A 5BOZG 3D69A 4GMTL 2R2CA 5KBNC 3QJFB 4PY8J 4DKEH 1IC4H 2APFA 2BNUB 5T1DL 2BY3A 3L6FA 1FFPA 3VDCA 2AV1B 3PIQB 2FSEA 1FL6A 3FAXA 1A1NA 3HI5H 3BI9X 3L7EA 3MJ7B 1QBAA 5DJYB 4Z7WE 2OTPA 3HNTH 5TE6L 3STBA 2PO6A 12E8H 4P2OA 4OLWH 4YAQB 1QR1A 5CP3A 1KLGB 2NY5L 1EK3A 4OCWH 4LL9A 1RPQA 1JL8A 4WW2F 2KPNA 2HH0H 2Z91B 2Q76B 4KAQH 3PL6B 2AABH 4AT6B 1T6VN 4H8WC 5JHLH 3PWPA 5DHVH 2VDML 3S3PA 1YDPA 5IJKC 5FUZH 2YBRB 4KXZI 1KBGH 1NL0H 5EZLA 5E2TL 1QNZH 3ARXA 1OGAA 3CVHB 4XRCB 3P4OB 4Y4KC 4XNZB 1PG7L 5HHVL 3QWOA 1ZHLA 4OZHB 5F9OH 5C9KA 3I2CH 1I1AC 3GSQB 1NCCL 3MLSL 3SGDI 4D0BA 4MLIA 4P2CG 1A14L 1MI5E 5IQ9A 3CIQA 4J3TA 1U8LB 4IRZH 2E9IA 4HPOL 2R0ZL 1QSEA 3INUL 2NX5E 2O5XH 2GTZA 4U1SB 1AD9A 1FORL 4Y5VB 3LKOB 2EDWA 3IT8D 4HGKC 2ZUTA 4Z7VE 1CT8A 4CU7A 4PGJA 1J8HE 3CD4A 1XGTB 2A6JB 5GRUL 3TBSB 1AGBA 2VAAB 4YE4L 1J0ZA 3L7FA 3UPRA 1YMMB 2CDFA 2PO6C 3VE0B 3WIIL 5CEXA 2Z9TA 2MOVA 4HUMB 5F8QC 3EJJX 2DKSA 1NGQL 3ZE0E 3MOAL 3OR6B 2AKRA 1F4YL 4YFLF 3EDDA 5F3HB 1S9VA 1DQQB 5J9PB 3EFDL 3F7QA 5SWSD 2FLBT 1WIUA 3GJFH 3EHBC 4UIKL 3C9NA 5EO1A 1G7JA 4MS8D 2LAAA 3P30L 4M7LH 4DKFH 3AAZB 1ES0A 4NWUH 5E5MA 1L6ZA 1FO0B 4PUBL 4FP8H 4MDJA 2Z31D 4EI6B 3BGAA 1JUFA 1VFBA 1XCQA 3E0GA 3V0AC 5JA8B 3CXHK 1C08A 4I0PB 4G43B 5I9QB 1J0HA 1OAYL 4OZGB 2NW2A 5HGAB 3SDCC 2XPGB 3SJVA 5CEYA 4BQCA 1JNJA 4GQPH 2DWDA 3VJ6A 1QP1A 2AXHA 4HIXL 3ZHDA 2FCBA 3FO2B 5B39B 1AP2B 3QB7C 3HNVH 5GIRB 2IANE 3QCVL 4IHOB 3CPLB 3KJ6H 4U0RB 2OZ4H 1RZGA 3QBTB 4C58B 4LLAA 1FZOB 1N59B 3FT3B 5DJ6B 4V2BA 4S1RH 3MCLH 1MCIA 1CGXA 3ZKMD 3BSZL 5I18H 4CVWA 3KPRA 2FJHB 3LSOA 4V1DA 4Z7QE 4M6AA 5HY9A 1N4XL 1QFPA 2E6QA 1T2XA 1WUNT 3UBXB 1PQZA 1JHKH 4LF3B 5D7LD 2A9ML 4Z7VF 5I8EA 3MV7B 1FL3B 2XZAL 3KXFA 5IR1B 4ODVL 4NC0B 1FZKB 3K0WA 3EGSA 3ES6B 5DRWA 1U8NA 2DM4A 4YHMH 3FZUD 3GMRA 5DFVD 3WN5B 4KFZC 3MBEC 1BECA 3ZE0F 3FB5B 5IHZA 4W6YB 4K8RD 2JE8A 3TN0C 3W82A 1UZ6E 4LVEA 3VMPA 5FUOH 4XB7A 3VDBA 4HD9A 5D4QA 3WKMH 4XCCL 5J11B 2HTLC 1FBIL 4TVPL 2CIKA 4P5MA 4WEBL 5DRZA 3LRSB 3BYTA 2EDLA 4UDTA 5DHYA 1N8ZA 1NSNL 4CUCA 2DLEA 5HDBE 3QUKB 4M61A 4OZFA 3U4EB 5F7DB 1TZIA 1JGLH 4I9WD 3G04A 2P8PB 5BVJB 1XF5A 2QKIA 3AROA 3IDGA 4P2RD 5C8JA 3MQIA 4LSTH 4X7TA 1XF1A 1AC6A 4HIEB 1C5BH 1CE6B 3PHQB 3TO4A 2EH7L 4ZFZB 4NCC1 1IC7H 1HHIB 4OF0A 4JDVA 1ZSDB 1FLTX 5BXFA 3BEWA 5HYEA 3TV3L 4ZUUA 3BPCA 3H0TB 4XCYB 5KS9B 3BIBX 1IGML 1JHLH 4DGYL 4BQ9A 1EMTL 4X7EC 4O51A 3V9FA 4BZ2L 1T20B 4DCQA 4LLQA 5TGBA 3BISA 4ELME 1IEHA 4JY5L 1IM3A 4X5LA 1NMCB 1Z5LB 1EXUA 4ODSL 3H42L 2P5WA 3PGCB 3QO0B 1LE5B 2E8YA 4NIKB 3VGEA 4Y16C 3T2NL 1DUZA 1NFKA 1OAZL 4JFOB 1BQHA 1ZANH 4GUPB 3NA4A 2FEDC 4P5KA 4Z7QF 1TVHB 1V7MH 1MPAL 4YHPB 4K7FA 3SKJL 4EOWH 3OAZH 3RIFF 3QFDB 4X99A 4KRPC 3A6BL 3TVMC 5I75C 2K3TA 4NRZA 1DBBL 1TZGH 5I66A 3RY4A 1D6EB 2VDNL 1CXLA 2WIIA 4GMSL 1DDHA 3U7AA 4J8RB 3ARFD 1I3RB 3CH1B 1MLCB 1T3FA 3FHAA 1L9NA 2FECL 2OTWA 4H8WH 1RUPH 4RGNC 3AGVA 3HZMA 2ZUUA 5KOVC 2FEEL 5KJRL 3QIBA 1JE6A 4LPXA 4RIRB 4DAGL 2CO7B 2Z92A 4PR5B 3SDDC 5L8JB 3RKDC 4FQJL 5E2JA 2FZ3A 5HD8D 3CVIH 1A7RL 3WFEH 3MYZA 2XACC 1UZ6F 3TGXA 1JPTL 4G8GD 2ZNWA 2F5BL 5A2FA 5FO7B 2E27L 1C16A 3VCLB 3L9RA 4M6OH 1HSAA 2E6JA 1L9MA 2ATPB 3VXSD 4YXLH 1NCBH 5DR5L 1J8HA 5HDBF 2Z8RA 4Q0XH 2VZOA 1NAML 1U3ZA 3VFTB 1BP3B 3ZDYF 5CZXC 3PABB 2JJTA 3V6FB 5AZ2L 1MCLA 2AXGA 4FABH 5CMAA 3CFKA 5KSAB 1ED3B 4LSUL 5F7NC 1S8DB 2X40A 1R3KA 5CP3H 5B39G 5HSFA 5DJ0B 3PP4H 4P2RB 5DF0A 2CPCA 4NFBA 1LO5B 3QAZB 3GBML 4BK4A 1XF2B 2VLJE 4G42A 2XIDA 4GSDH 2R69L 2K1MA 4ELMF 2HTKD 4OLZL 1CICA 3G5XA 3CLFL 1U95A 5A3ID 1GPOH 1FHGA 4M48L 4NT6A 5HHMB 4MCYB 5BS0D 2R56H 4HIJB 5E6IA 3BN9D 5JW4Q 3RBSA 1EV2E 2BY1A 5KVDH 5E8OB 1RZKH 4UBDD 2YS4A 2DS4A 1IFHL 3O3AA 5GRYA 3RVXD 2BSSB 1O7SA 5EIIA 1PYWB 1B6DA 3ZKND 5F7LB 3LEVH 3CDFA 1NC2B 3C09B 4PB0H 4JY6B 1SEBA 2D7PA 3CUPB 2MQCA 1AJ7H 2ZNXA 4GXUM 1NJ9A 3MLRL 2J2ZA 4OIAA 1MQKL 5HPOA 1BLNA 5HGDB 4JM2D 4AEHL 1G7QB 1QR4A 1ZA3B 4QRRA 1RULH 1A7NH 2DJUA 4PJBE 1PSKL 2RHEA 2VDQL 5EZIL 3DO7B 2QR0B 2RIKA 3OL2A 2JTDA 4NZDA 4NM4L 1B0RA 2Y5TB 1R3LB 4CW1B 3FQUB 5IHUH 3WDHA 1JFQH 3O3BB 1LWRA 1T5XA 4POUB 2P24A 3E2HB 3PUCA 4R0LB 1OGTB 1K2DB 2VZUA 4NDMB 5IVZA 3CAFA 3O6FD 3MLTA 5KVMC 1DQLL 4MD4B 5E6IC 3NCBB 1UEMA 1MRDH 3LS4L 3GSVA 2BNRE 3DX9B 4P2QA 4YQXL 3D0VB 1CK0L 4JPVH 4X9BA 4YC2C 5I1IH 5AWNL 3QEHA 3ARBA 3RAJH 3MRFA 2D03L 3RZWA 3FFCE 5F1NB 4D9RD 5EU6D 3D18B 4PLJD 2IG2L 5HVHB 2ZG2A 4F8TA 1ZHKB 3KYNB 3T77B 4GRLA 3VWJB 2FIRT 4HFWA 2FYYB 3C2SA 3DLQR 4M6NH 2VNCA 4G6KL 2ESVE 2MCPL 4JZJA 3I75A 3H2WA 2ZKHL 3FB7A 1X4XA 3SDYL 4ZSOA 3O3EB 5E2UH 5CJQH 1UH3A 1GZPA 3AC0A 3MLYL 4OKVB 4OLVH 4X8JA 4Q9QH 4HS3A 3UZVB 2M8XA 4NQSB 4DUXA 1JZ2A 4D2NA 2CMRH 1OPGH 2VDOH 2GTWA 3SE8H 1PEZA 3WBDA 1F11A 4UT7H 1HQRB 5FDWA 2MQ0A 1KC5H 3ROLB 3AU1A 1LEIB 2YR3A 3LMJL 4TRPL 2PN5A 5GS2D 4PJBF 2X1PA 3RQ3A 4GG6B 5SWQA 4LEOB 3DRQB 3UTSE 5HPMB 3O2WH 4KROD 2E3VA 2DQUL 3QP3A 5DQJA 4U7KA 1U41A 3KPLA 4PJ7E 1WWWX 4XTRC 4OQTA 4M1DH 4JM2B 4NRXA 4G9DA 1DL7H 2GK0A 5MERA 2VR5A 4G6AC 1C7SA 2MTPA 1T5WB 4XXCC 2BVOB 2DLGA 4MHHG 2DIJA 2FJGB 2FD6L 4PJAB 1LMKA 1AQKL 4JZJC 5ESVA 3ET9F 3FOMA 3V0WH 4UUJB 3MJ8B 4NKMA 3FO1A 2ITCA 3BFOA 4HIIB 1HHJA 4RFOL 2VL4A 1NGYA 4QO1A 3DURB 1IGIH 3T4YB 4F7EB 5LCVH 3P0GB 2DQEL 3G6JB 2GJJA 1BOGB 1A7PL 2ZUXA 3MJ9L 2EEDA 1LO2L 3O6FB 2YA2A 5DC9B 3C5SA 4QYOB 3SGJA 4OV5A 2ZOKB 2B0SH 3GEWB 5I30H 2MFNA 1YY9C 2VQUA 4HZLA 5EH1A 2J8UB 1A4KB 2YSSB 1ZEAL 4XMLL 1IC5H 3QUXC 5MEND 3ARYA 2HMID 3MMEB 1FRGH 2B1AL 2RR3A 3LKNB 4NO5A 4D9LH 3REWB 3OKDB 3S37H 4DN3H 5KOMC 3X13A 3O3DB 2PYFA 4FFYL 4YEEA 1YNTA 1NCUA 4PRAA 1N7ML 2V5MA 2UWEE 1HINL 5EU6B 3IDIA 2CJUH 2V17L 5DEZA 2VZVA 1JBJA 4UT9H 1A6WL 4OI8A 3NCEB 4GRMB 1TTUA 1I1YB 1CFQA 4ZO9A 2HJKB 3QYCA 5FA3B 3TP4A 5K9OA 4G9FE 2VLJA 3D3VE 4N0FA 3B9DA 1UQSB 2BZDA 3VGDA 3F6LA 2Q6WA 3WIFA 3DARA 4LSVL 3GNML 3TFKD 2FHCA 1MFCL 3X12B 1PVHA 2CIIA 3OSKA 2BMKA 3QIUB 1KTDA 5C0IA 1GJIA 3JWDC 3SGKA 2IADA 5IW1B 3TYGH 3UTTA 2XI9A 2H8PB 2SEBA 5B3NA 4L8SA 2CUMA 4PJ7F 2WWMD 1UXSB 4X9GA 2QQNL 4QRPE 4X6DE 4BSVB 3RUGB 4WFEE 3O41B 4OLXL 1QHPA 4J1UB 5FECB 1LP9B 1BWWA 1XT5A 1NH6A 2BXZA 3WSQH 4MDIB 1ZLUH 2NXZC 5JMOC 4ODHL 1QO3A 3SDAD 3ULVE 3S88H 1QSFE 4IRJD 3BWAA 3VXPA 2JJSC 4FQCH 2E7MA 4U0QB 3WJJA 2FX9L 1Q94B 4KK6C 5I0ZA 4G6MH 1OAUH 1M7IA 3DJ9A 1X5AA 4XC1H 1XGPB 2JIXA 1OAXL 1FAIL 4P2YA 1RIVL 2NW3B 5EOCJ 3M17B 2FB4H 4YH6A 4ZOCA 5MI0C 3GSRB 3V4VL 4XVSL 3O45B 4ODTL 4BSWA 4FFZL 3QO1A 4FQHA 3KPNB 4KJWC 5J13B 1H8NA 1G6RB 2AEIT 2UWEF 2Y5EA 4X8XA 1YNLL 4M3KB 3U0TB 4LCIL 3REVB 4PJGB 5LGHL 5TE4L 1TDQA 2DLHA 4P99A 4PGBB 2WUCH 4TNWF 2ZSWA 3NPSB 1BX2B 2VDLL 2X89D 3GMPB 4M62L 3KPSB 4YUEH 4HWBH 3ZLQC 4NGHH 3V5DB 3WJLA 2XKNA 5I1HL 3HPJA 2WQRA 1A6VL 4Y19A 2YC1A 4W81A 5ALCL 5FB8A 5I6XC 3GDBA 4PJXE 5FO8A 5HHOA 3LIZL 4I2XB 4ZG1A 2A83B 3V7MA 3BP5B 4CNIB 4KMTL 4TULH 2O61B 1BF2A 2A77H 1QLFA 3FOLB 4X6DF 4JLRB 3WD5L 4QXTB 3QDGE 2KH2B 1KB5L 4KHTL 3QXAA 3WS3A 1FH5H 1P7QA 1HOCB 3RPIB 2XY1A 5BQ7A 3GB7A 5IB4A 2YK1L 2XA8L 1IJ9A 4PGDA 3V4PL 5EFIA 4XVJH 5J4MA 1ZTXL 4JG1L 5JIHA 1H3UA 1MRFH 3ULVF 4HT1H 2HRPL 4E41E 4LARL 1ZWIA 4KQ4L 1Q9WB 2V2WA 1IAOB 5J1AA 5SWZD 4Y1AB 3UTSA 3G6DL 4PJ8D 1X5IA 4KGLA 3NPZB 2QHLA 3F65A 1ZT7A 1L4IA 1S5IL 3SDAB 3VWKC 5DUBA 5LBSH 3N1FC 2YUXA 4URTB 1UJ3A 2HN7A 1QYGL 3N0PB 2R39A 1B0WA 4IRJB 2DLTA 1T83A 3O4LA 3T65A 5GSVB 4YHIA 8FABB 3BKYL 5E5RB 2H2SC 5CJOH 3PWVB 3NH7H 4QWWC 2AJVH 4JGMA 4Z8FL 5E1AA 1A1MA 4FOMA 4Q58C 1V5JA 4U3HA 4KMLB 1J05A 4E42A 2ZP0T 4R2GD 5JZ7D 4U49A 4ZXBA 1PKOA 4CVXA 4S1DC 4PJHB 4OUUA 4YHKL 5ITBH 1G7LA 3RKPA 2EYTB 2J5LC 1S3KH 3SKOA 5H8DA 1SJEB 3C08L 1F97A 3IFNL 1BBDL 2BRRH 1IKNA 3UZQA 4ZS6C 4HX1B 3ARDC 4NQEE 3B9KA 4HQQH 1P4LB 4JFZL 5MEQA 2DL2A 4LNRA 4DTGL 1OF2A 3OGOE 4PJXF 5E8PB 3C6LD 2OP4L 4P9ML 5ESQB 1Q0YL 1RZ7H 5INDA 1GHFL 3QUML 3OX8A 2BDNH 4KY1L 3L3KB 4FXGB 1RIHL 5AUMB 1FZMA 4IDJL 4LCWD 4HXBH 3GSNL 2EIEA 4JAMB 3QEGH 1WBXA 1UJ3C 3T3ME 1SYVA 4R90L 4BK5A 3VFSB 3TNNA 5AG9A 2CH8A 1IZJA 1YEFH 1J1PH 3MA7B 2AW2A 5F7WC 1MFDL 1WZLA 3GMMA 4QCIB 2MMXA 4WW1B 2FH8A 3FFDB 3E6FA 1OSZA 3EOAA 3W0WB 4IS6A 2I9TA 3EOBA 5D71H 3RI5F 5JDJA 5ADPL 3D9AH 4JO2H 3VFPB 5GPRA 3C8DA 4NKIL 2YMXL 5EZOH 2WW8A 1JZ3A 2NNAB 4JVUA 3BE1H 4QTHB 5EORH 5CLWA 1NDGB 3QFJD 1L7IH 1YEEL 5LXGH 1NGWA 5SWZB 5IV2B 4WFHE 3OG4B 3HI6H 5IFAH 1AGFA 2BSTB 4TSCL 3JSSA 3LZFH 4L8BB 3KDMA 5B4MC 1JNNH 4PRHE 5J06A 3WEXB 3MA9L 5IVNA 3S35H 2XTLA 3KPOB 3VXQB 4YBLB 3OJMB 4R26L 1IZKA 1WQVT 1G9NL 2NY6C 4PG9B 3HG1E 5D2NA 3T0EE 2VXUL 3V6OE 5GGVL 4E5XB 1JNHA 4TUKH 1P7KB 2PCPA 3QUYB 1DANT 4ALAH 1T1YA 1PGRB 2BVTA 4JG0L 1PKQA 4R2GB 2D31B 3B3IA 2AI0H 3BN3B 2NZIA 1O5DT 4GKSB 2DI9A 3IJSA 5DMIL 2J88L 4KUZH 4LASL 3CK0L 3DRTB 1AIFA 15C8L 5IIEA 1LILA 3MRMB 5CZVH 1UB5B 4OF6A 5J6GA 3DI2B 2G5BB 2FL5B 5A2IH 2IAMA 2X4UB 2AJZB 2L7JA 1EFQA 4I18B 5ANME 4BFGA 4X80H 5FYLL 3U46B 4F80A 4X6BB 3C6LB 3QXUA 1CFTA 1KCRL 4LLUB 4NZTL 4ORGA 5F3BA 3QDMA 4LGRB 1YJDL 3MOBH 4KHXL 4JPIB 3OF6D 2C4FT 4K71C 4EUPH 3ULVC 2BNQE 1S9XA 1Q0XL 3MRLA 4YBQD 4HUKB 2Z35A 4Z6AT 4ODWA 1A2YB 3BZFB 3EYFB 1XFPA 1BJ1J 4FZEL 4WWKA 5T1LB 4N0UA 1KGCD 5E9DB 5I8OL 4FHBD 3BUTA 4MXQD 4MNQD 4JFFE 1WC7B 3HLAA 3SQOL 3NZHH 5E94A 2EIBA 1T1ZB 1H15B 4FNLH 4CDGC 5EBWA 5EULV 1RAMA 1RZJC 1OARH 4M6ML 5J89A 4GW4A 4KZDL 5IK3A 3Q5OA 5AYUH 4JO4H 3I9GH 3HR6A 1VA9A 4A2MA 2R4RL 1IM9D 4EN3D 1X4ZA 4E41A 4AG4H 2J8OA 1ZGLA 3CFDA 1ZHBA 2VXVL 1S7XA 5DQ9B 5KVEL 5TE7L 1NBYA 3DI3B 1VFAA 4JQIL 1FO0L 4RGOH 1UWGH 4XBGA 4FQ1L 1ULVA 3AMLA 3LKQA 4EI5A 1KCSL 2P8LB 1ZAGA 3ARTA 4YDKH 5C0JA 5JLZA 1CFVL 1QLEH 2VLME 4WI2A 1F8TL 4TVSa 2DQCL 1VPOH 1P1ZB 2VZ1A 1FC2D 2NY4C 5ACZB 4WWKC 2D7NA 3BKML 1QG3A 3UCRA 4MAYC 4ZTOL 3DV6B 3QG6B 2JB5L 4UINH 5SX5H 5IMLB 3QG7H 5C92A 1IE5A 2WMPA 2XA3A 1KOAA 3MRHA 1YPZA 4U1GB 3GKWH 1T22A 1YQVL 3LKPA 4PJFA 1HZHL 1A9EA 3OKKA 4XCEA 5CKGA 4P57B 2BOCB 5IROA 1B88A 2CKBA 3S3JA 3IU3B 4Q7DA 3DGGA 3RIAK 2V9TA 4H0GA 1CI5A 2GUOB 4PTUB 4QT5B 3WHXB 5FK9A 3OXSA 4YPJA 5DHVB 4RNRA 4WFGD 2X5PA 1FDLH 4MJIE 3GHBL 4U6XA 3CH8A 2VLKE 3VG9C 3RVUC 2R9HD 2EXYC 3O6KL 5CSZA 4C56B 1YY8B 2E9BA 4LOUC 5HYJA 5BV7L 4KTDH 4K3EL 4CL7A 1WISA 1JGUL 4K7PH 1ZVYA 1D3CA 1K4DA 3TWCH 3A6CL 4RGMB 4YO0B 2CRYA 4ODUB 2X1OA 4F9LC 4NNXA 3IDYB 4JRXB 5DJ2B 4HKJB 1YEGL 3IYLW 4YDIH 3AS3A 2XWBB 4ETQA 2X4OA 4K3JH 1YMHA 1RZFH 2VXTH 4ZO6A 5DJ8B 4KI5E 2DQGL 2BJMH 2PYEA 1LQSR 5BZWB 1FSKB 1JTOA 1HN1A 1U8PA 1MCRA 1JN6B 5C1MB 1U3HD 5D7IB 1KFAH 4K3DL 2DYPB 1UM4H 3PWLB 4MAUL 4NZUH 1MLBB 5KAQF 3B2VH 1SY6A 2XWJB 3EZJB 3TESA 2Z93A 3J8F7 1MWAH 4J4PA 3LKSA 4NQCD 3IFLL 3AXLA 4JN1L 4QRSB 4QXUH 1EFXB 1JGVL 2B1HH 4H20H 2JK5B 5K59F 5M94B 3VFVB 1I8LA 3GJFB 4PJCE 2CK0H 5IB3B 3QEQB 1W72L 3V5HB 3MLUL 2FJFA 3L3OB 1EZVX 2Q7YA 4JFYA 5E8EA 2BX5A 1QRNA 3VH8B 3B2UC 3OPZH 4L4VA 4M43H 3FO0H 5C0CA 4RWYL 1EHLL 1U91B 5A16B 3MO1A 1IILE 1CE1H 4QRTB 4XAKE 4NO0D 2OYPA 3V6OA 3FN9A 1ZOXA 3BH8A 1PEWA 1P2CB 1CDGA 3JWOC 3K2MC 3D1MC 4Z5RB 3U79A 4M7JL 3TBYB 3FMGH 4MWFA 4OGYH 2VRAA 2GITA 1BHGA 1TENA 2XWTB 4XNUH 5GRJH 1FV1A 1MAMH 2NMSA 1DN0B 4PJDE 5LVEA 3CFIC 2ZPKL 2QQKL 1NBVH 4LLDB 4YPGA 2UZIH 3KLHC 3OBAA 2LTQC 1AKJD 3O3UN 4ZD3H 3UJJL 3SHSA 1LHZA 4DVBA 1IQDB 4J4PC 3KWWA 4Y4FA 5ANMA 3KJ4B 1PX4A 4XPAL 3SDXE 4YFLI 2Q8AH 3L3IA 4JDZA 1I4FB 5E08L 3P2TA 4Z0XA 1LO4H 3QIWD 3ECBB 3QUZC 5HI4C 3VXRB 1K8IB 1A7BA 1ORSB 4HH9B 2I07A 5D7KD 3O2VL 4Y4KD 4KI5F 3PG2A 2HLFD 3WLBA 4OF8A 1I1AD 2IPTL 1NEUA 5HHPA 3ULVH 5D70H 2K7PA 1G7PB 5D1ZB 5C6TL 4XPGH 3RNQB 4I48A 3GGWA 25C8H 4UV7L 5HJ3B 3T0EC 4K8RL 3ZTJG 3V6OC 2XZQH 2DWEB 1Q9OA 1URLA 3CLEH 1I7TB 4DGIL 2Y7QA 4XWGL 2VDRH 1H3XA 2ED9A 4BH8B 1DZBA 4PJCF 1DQDH 2A74B 1TQBB 2HT3C 4WFFD 2ZSVB 1DEEB 1IAIH 1RZJH 4MB3A 2PO6D 2QJDA 1T0MB 4P2OD 4L5FH 1C5DB 4PJEA 4ZAKB 3H9SE 1XH3B 4KKBC 5GGTL 3DBXA 1ONQB 5D5MA 2FRGP 5TDPA 1N6VA 3F12A 3LQMA 1I9IL 1VENA 4LHUA 4JKKA 4GLRH 4LQFL 3PWPD 1AO7B 2ICEA 4QF1B 2HFTA 3F7VA 1HWGB 4CVUA 4U1LB 3JTSA 3RL1B 5DMGD 1CVRA 2W9DH 3TT3H 1OGAD 3HFML 5IMOA 2F54E 3GSOB 2GFBA 4LCYA 5I8KL 1UZ8B 4PJDF 1A3RH 2OL3A 2F53A 4F33A 1J86A 4YJZL 2ADFH 2Y36H 1IT9L 1IAKA 1K8DB 5D1XA 3VFNA 2ZJSL 5IKCB 3HC3L 2RQ8A 3H3PH 1I7RA 3TEUA 1QSED 3OKYA 3EZ8A 2H2PD 1M05B 5L2KE 3SDXF 1N2RA 4J3OC 3SGEI 1AKJB 3LQAL 1GGBH 3IDJA 1AD0B 3B5GA 5ECJE 3V52H 1YEKL 1A1OB 1JPGB 5I71C 3O2DA 5T5FL 1MHHA 5FGCE 5EOCH 4JFEB 4LU5H 4F37K 1JZ6A 2MPAL 5CEZE 2H6PB 2P48B 2JB6A 2VLKA 3CSPA 2BCKB 3QT2A 3RGVC 5F7KC 3PHOB 5DURD 1BGXH 5DEGB 4XWOC 2YD4A 1E6OL 3WCYA 1G9MC 4Y4KB 1MCBA 3HE7A 4HKXB 3FN0H 4ZODA 4WCYH 1ND0A 2G2RB 2O5ZH 3SCMA 5JDSB 3HR5B 4PYHA 1D9KA 1HKLH 1UXWB 1RD6A 1B2WL 1KULA 2XN9B 1MHEB 7FABH 1MAKA 3SKNB 5EA0L 3ALXA 3FT4B 4OLYL 3FQRB 4JY4B 1MCJA 1T0NB 2OI9C 2ZOLB 1OTUC 2P1YA 4GKZB 1KELH 2DQIL 3D69B 4LMQI 4KMQA 2CRMA 3Q6GL 4YGAB 2DTML 2PETA 1F42A 1T66C 4R3SA 3QULB 2DMKA 4FMFA 4L4TE 2A1WH 3TH3T 1FP5A 1HEZB 1A1NB 2EEBA 4J3VA 4OT1H 4U6TA 4Q6IA 2HTLD 3KR3L 2PO6B 5I1KL 1XGYH 1NGXA 2UUDH 4F7PA 1QR1B 4U6HB 4KKCD 3FB6A 2CDEA 4JDTL 3PV6B 2IALB 2C9AA 3MGTA 1U8HA 3N9GL 4AJ0A 4OV6F 5I8CB 4PLOB 5ENWB 5EOTB 3ME0A 1YDPB 2HKHH 3KPRD 4PJIE 1KPVA 5JO5A 4LAJH 4V1DD 1QACA 4XMKH 5EZLB 1IVLA 4NHCH 3VFMB 2IJ0C 1S78C 3HE7C 5T5NG 3C5ZA 4N0CD 4ONHA 1D9KC 1DFBH 1XMWA 2BC4B 1T2QL 4XPTL 4PBXA 3KXFD 1KJ3H 4JHWL 3EDKA 3SDCB 4NP4L 4KI5C 3JWOH 1QSEB 3QDJA 5C0AB 3VGFA 3VRIA 3VFWA 4IRSA 4X5WA 5D6CB 2AAVA 5DUPL 3MGAA 5IOPB 5LKNA 4QRQB 1ZMYA 3QJFA 5C08E 4NZJA 1K3ZA 4I1NB 3PXJA 2LU4A 2BNUA 1CDUA 1XR9A 4ZOEA 1AGBB 2EICA 2VJXA 1SY6H 4FG6D 4KRPD 3W11D 3TVMD 2G5RA 5DJYA 4U05A 4S0TD 2B39A 2APBA 3CDYA 1S9VB 4PP2B 4YAQA 1KLGA 1MREH 4L8CB 4QGYA 4Y5XA 3LEXB 2Z91A 2Q76A 1ADQH 3PL6A 4XP9L 3TO4D 1V3KA 2OR9L 1RIUL 2AQ2A 3RWHB 4NM8L 3SDDD 4X9FA 1EERB 3GHEL 2UYLB 3FQWB 1JUFB 3CVHA 4O2EA 5C0BE 3QISA 1XCQB 3JZ7A 2O5YH 2DL9A 4OZHA 3D48R 3TJHD 4WEMB 2NW2B 3A67H 3MBEB 4PP1D 3LN5B 4IRSC 4XP5H 3TN0B 3VJ6B 1V7NH 1NEZB 2P5WD 3EYUL 4OIBA 5IMMB 4U1SA 4Y5VA 5CZXD 3LKOA 4MNGE 2DM3A 4PJIF 4KPHL 1DBKL 1G7MA 4RMTA 3LQZB 4MA7H 2N7AA 4XP1L 5CJ8A 3IXAB 1LDPL 2VAAA 4M5ZL 4HK3N 1YMMA 1FNSL 3VXME 4S10A 2QADC 1UH2A 4RISL 4RQQB 4HPYL 3KPRB 3IDXL 5KG9B 3OR6A 1YNKL 3P11L 1NMBH 4HJ0D 5F3HA 5HY9B 4Y5XC 1OAKH 3KYOB 3Q1SL 5J9PA 4IMLB 2HVJA 3QIBD 3I6KA 2VIRA 4HHAB 5JR1L 2P5EB 5I0DA 1I9RL 4X9IA 1MI5D 4XP4L 5IBTL 4C4KO 5CZKA 2NR6C 1TQCC 3KXFB 3AAZA 4HS6A 1EX0A 3CSGA 1ACYH 4UTAL 1T6WA 2EYRA 1NCWH 3EGSB 4WHTB 4EI6A 1U8NB 5T1KB 3EKCA 4OFPA 4PRIB 2AGJL 4WY7H 5DT1H 4I0PA 4G43A 4WI3A 1J8HD 4Y16B 4U1NB 3T0WA 5IHZB 3THML 5HGAA 4AIOA 2XPGA 5E95B 2M26A 1CTOA 2APWA 2CIKB 3HUJE 4KRPB 1MFBL 3TVMB 1BAFH 3WO4C 5I75B 3FO2A 4X98A 1IAMA 5DHYB 3LH2L 1AP2A 1H9VA 5GZOC 1EGJH 2PW2B 3EIFA 4QHKI 2OR8A 3NTCL 5HDLA 3CPLA 4OCXH 2DM2A 5J0BA 1XF5B 3IDGB 4RGNB 5C8JB 1BFOB 2AJ3A 4HH8A 3WNMA 3PXHA 1KENL 5GS1A 4ZOBA 4X7TB 1NCTA 3WFCL 1JVKA 2Z8WC 2VLRE 1G9MH 3FT3A 1ZVSB 3MNZA 4JDVB 4X4YA 1JF1B 3SDDB 4UDUB 3U83A 4HUVB 2VH5L 1CICD 3BEWB 4RA0C 5L88H 3L5XL 1OQXA 3O9WA 4ZUUB 2FJHA 4U2YA 1G0YR 3TCLA 1TTFA 1FE8L 1HI6A 5E6ID 2DQTH 5H94B 3ALPA 4MX7B 3HRZB 5IT2H 5I1EH 4XX1E 2OL3H 3VXUE 3UBXA 4NQVB 4LIQL 4LLQB 3MRCB 2YPVH 1BQLH 1IM3B 3MV7A 1FL3A 5IR1A 4JPKH 1FZKA 4M8QA 4Z7WB 3ES6A 3I50H 3NACL 5E70A 2A2QT 5I9QC 1CXEA 3VFRB 2F8VA 4F3FB 3WN5A 4YZFF 1X5KA 2IH1B 1SEQL 3FB5A 4LP4A 3WLWC 3DECA 2BHYA 2WP3O 4X99B 3RVTD 1SQ2N 2IMMA 3PQYE 4XPFH 5I66B 2CQVA 2HWZH 1DDHB 1GH7A 4QRRD 5C09E 3LRSA 2G9HB 4Y89A 3D5OF 1WSST 1AFVH 2NY1C 3HZMB 3QUKA 3U4EA 3GKZA 5F7DA 5GS1C 4JR9H 3GBNL 5BVJA 5DLML 5E7BA 4GAJL 3HA0A 5CWSB 1OM3H 1MI5B 2Z92B 2IF7A 4HIEA 4K94L 1AXIB 4Z7UE 4TUJA 1UGNA 3AMKA 3PHQA 3O9WC 4ZFZA 1HHIA 1ZSDA 2GT9B 1JZ7A 2NX5B 3QCUH 7CGTA 5DZLA 3ARVA 4FQ2L 5KS9A 4G8EB 4HJJH 3EO0B 1HSAB 1SJVA 1MCWW 4S1SH 1J8HB 3PJSB 2W0FB 1TMCB 3OHXA 4OQ1A 3ARBD 4JO1H 3STZA 4JGUA 4MQXD 3MRIA 1Z5LA 3TBWB 2YHGA 1CLYL 1R6VA 3PGCA 4I4WB 3QO0A 1LE5A 1MJ7L 2XICA 3R1GH 4G6AD 4LSPL 4GRLD 1R3KB 3P0VL 4GUPA 1DANU 5BRZA 1TVHA 3DSNA 5FUCC 5ILTH 5KTEH 4YHPA 1F02I 4WTWA 1MIEL 4LSSL 2VN4A 4X9HA 2ARWA 1WAAE 2GJZA 1D6EA 3HE6A 1G84A 4J8RA 1I3RA 3CH1A 3AREC 1MLCA 1U93B 3ZYIA 1MJUH 2G60L 1KEML 5C0BA 4I5BA 4XP6H 5HBBA 5I1CL 2FGWH 3TC9A 1OD7A 1E4WH 4RIRA 4Y7MA 4EXKA 5JXEA 2GYSA 4HBQA 2Y6SD 4LPYA 3N1GC 5CILL 4JFDE 4HF5L 1JPFB 5KW9H 3BJLA 4YC2B 5GGSY 4EVNB 3K8MA 2W60B 1I7ZB 2IANB 5FO7A 4L29B 3VCLA 4W4OC 4LLYA 3STLB 2ATPA 3CNKA 4J3SA 2HVKB 4KUCD 1AQDB 2D7QA 4JVWA 1NJ9B 4XMPL 3BT2H 4O4YL 1K85A 3MR9B 3VFTA 4N8VB 2F5AH 1UWEL 4XAWH 1GIGH 3TBTA 5BW7A 3PABA 3V6FA 4LPTA 2X05A 4DWHA 2YA1A 4O02L 5KSAA 4MJ2A 1HXYB 1DEDA 1EO7A 1ED3A 4YHLL 3FAWA 1S8DA 5HHXL 1TIUA 5IFHL 5DJ0A 4FZ8L 4YLQT 4OZFG 4WUUE 1DLFH 3E8UL 3HE6C 5DMYA 1EEQA 4G5ZL 2P24B 1EHXA 1XF2A 3QHZH 4OM1H 1GOGA 3MXWH 1LO3H 1BQSA 4NC1C 1K9TA 2IQ9H 5EDXA 3G6AB 4U4BA 3E3QE 3CVHH 4MCYA 4HIJA 2MQ3A 3J7HA 4ZFOL 2ARJQ 1JWMB 5E8OA 1KB9K 4OGXH 4UOW0 3PDGA 1XF3B 1CLZH 3QEHB 5H35A 3MRFB 1A8JH 1RK0B 2BSSA 4M02A 3HUJA 5DVKA 1WAAF 5ALBH 5FGBA 4OLUL 1NC2A 4CMMA 1CVSC 5I76B 4HFWB 4CN1A 1CGVA 4PTTB 4JZJB 3BDXA 4KK6D 5I15H 2W65B 2VLJD 1VACB 5HGDA 4HUUB 1HYSD 1S7TB 1GZPB 1U3YA 2JJWA 2QSVA 4FTVE 4F7TB 3DO7A 2QR0A 3QH3A 1NCAL 4JREC 1YEDB 3C2AL 1HIML 4IMKA 3S36X 5JQ6L 1R3LA 3DPBA 1QKZH 3QA3B 5F70A 4CW1A 2YA0A 3FQUA 2ICWB 4PREB 3O3BA 4R0LA 5DYOB 3W5NA 1OGTA 3MV9E 3JTTB 1K2DA 3QUXB 5C07E 4PRPE 4L3AA 1UCBL 1F6FB 4MD4A 5T3ZD 2AERT 1CF8L 4YDVB 4TSAH 2YD9A 2DJSA 1DBAL 3RL2B 3NFSH 4FN0A 4BQBA 2CXKA 4R96B 1YEJH 1CDCA 3DX9A 4HGWA 4NZRH 4RCAA 3ZTNL 3D0VA 2P43B 2EKSB 5DVOA 3HRPA 3HMXL 5F6IC 5CEZH 4PS4H 5IM7A 4NRXB 5C09A 4G9DB 2GK0B 1FIEA 4KDVA 1ZGLP 2AJUL 5F1NA 4K07A 4P3DB 3DVNA 2YEZB 4K2UL 3KYNA 3T77A 3VWJA 1P4BL 2QQLH 1UKTA 1XZ0B 2BVPA 2ITCB 1JMZA 1N64L 2XTJE 4QEGA 2XRAL 4Z7UA 1IKFL 1FLRH 2JIXD 3ARPA 4JM4L 3SE9L 2X4PA 3O3EA 1N6QL 3CFCH 3BGFC 1C1EH 5TDOB 3C5SB 4IMKC 4CRPA 3MACL 4YXHL 4OV5B 4IIQB 4OKVA 1GOHA 1HNGA 5KVGL 4N0YH 3T09A 1E28B 1NKOA 1FGNH 5DUMH 4O00A 4C83B 5EU4B 1U92A 3RX8A 1OAQL 2ED8A 4YHYC 1WZ1L 1X6LA 2VLLB 1FNHA 5AZEL 3OJVC 2JJVA 2OJZL 5DK2A 2NXZB 1I8IB 2V5RA 3X3GH 4DKEL 5MP6H 3ROLA 1LEIA 3UZEA 4GG6A 1WLHA 3RZCA 5T1DH 4QNPE 5JIPA 4MB5A 5HPMA 1PG7W 2H2SD 4Y19D 1JZ8A 5K9OB 4QWWD 4GAGH 2VLJB 12E8L 5HHOD 2R1XB 5GJSH 1NANH 3WE6A 5TE6H 2YKLH 3GI8L 5C86A 4OCWL 3D87B 3EDEA 2Q6WB 3WIFB 4H88H 4KAQL 4HLZH 4PJAA 5MI0B 2IFGA 2AABL 1MCQA 4UUJA 5JHLL 3MJ8A 2BMKB 1P7QD 4M3JA 3DURA 1KBGL 1U3JA 3RWJA 4F7EA 2VDMH 4GKOA 1QNZL 1X5XA 4G7VH 3DNKA 2HKFH 1R5WA 1TETL 5TPWH 4NNPH 4MD0B 5E2TH 5F9OL 4YDJB 1WBZA 1DQML 4QYOA 2ZOKA 1FNLA 2J8UA 4KTEH 1A4KA 1CXHA 2YSSA 1FNAA 3UTSD 2AV7B 4EUPB 3GI9L 5GGQL 3L5HA 3MMEA 4MJ5B 4BA8A 1CD8A 2O5XL 5DMJB 3REWA 3WFZA 1A6TB 3OKDA 5HYQB 3MYJB 4HPOH 5C0ND 5F89B 3INUH 3O3DA 4PJBB 2JKXA 5I6XB 2NLJA 3MCG1 4XNQB 5EU6A 3O4LD 3RZCC 3BWAB 4HKBB 3VXPB 3G08B 1X5YA 2APVA 2Y23A 5IVOA 4DZBB 3RIAF 1I1YA 5JIIA 2EKJA 2EXWC 2HJKA 4OD3H 4YE4H 1SM3H 1R5IB 5DA4A 3WIIH 5I1GH 4HG4J 3U6RA 3MOAH 4HULB 4ZXBD 2VE6A 3QO1B 3WNLA 4LSQH 2R2EB 4UNTA 2BNRB 3X12A 1QTYT 4DKFL 3UTZA 4XGZB 5F6HI 1CL7L 5ACMA 3K81A 2X10A 3QIUA 4WJ5B 4FP8L 3B9KD 4QNPF 5DC0A 1X3DA 5F96H 3U9UA 3ZL4H 2ZSWB 3MNWB 4GQ9L 5C6PB 4KC3B 1ZLWK 2CK2A 3FFCB 3VWKB 5B4MD 3RUGA 4HAFA 2XKNB 3HPLB 2ZCKH 4C4KT 3O41A 4J1UA 4JB9H 4WIQA 2ESVB 5FKAA 1RUML 4HUXB 4Y19B 3FHQA 3HMWH 3L3JB 4DUWA 2NY6D 2AP2A 2FNBA 1N3NA 1T89A 5FB8B 4MDIA 2DLFL 2GY7B 5FO8B 2I5YH 4M93C 5EU7E 3OKNB 3RY6C 2WUBH 1R3JA 3SPVB 3BP6A 2OZ4L 3MSPA 1F6AB 1HH9B 4PD4K 4NKOB 1NUNB 1QEWA 1INDH 2V9RA 4S1RL 3P4LA 4ZFGL 3MCLL 5I18L 2J5LB 3MV9A 5C07A 1XGPA 2VC2H 3BSZH 3GB7B 4N90E 2NW3A 1KT2B 3ARDB 5TDNB 3UJTH 4PGZA 1N4XH 3KPNA 2P49B 5EU5B 1G6RA 3IRZA 5J1AB 4N9OB 3UTSB 2A9MH 3LB6C 5B22A 3U0TA 4F9PC 5JPNA 3REVA 1T1WA 4PJGA 4PJ7B 4WNQB 4YHML 4PGBA 5CGTA 1GGYA 1BX2A 3C60C 5DUBB 1UJ3B 2HN7B 3KPMB 2W07A 1XGQB 2H3NA 1EBAA 5EBGA 2EE9A 3KPSA 4YFEA 5D7SH 3MJGX 4YHIB 2YD8A 2B8OT 5FM4A 1F3DH 5FUOL 4PRNA 1M6OA 2FR4B 1KPUB 3WKML 4HCRL 5E00A 1T89C 5GGSA 3WNKA 5JW4N 1CQYA 1FBIH 1KCVH 1F4XL 4GG8A 5HTSA 1J05B 4I2XA 1B0GA 1QFWI 2AEWA 1JGLL 1F90L 1MWAB 5IHBA 4CNIA 1RZIB 2O61A 3SE4A 2WANA 4CVXB 4OUUB 2WP3T 1G7LB 3N85H 4LRNL 4P5TC 3FOLA 4JLRA 4QXTA 4RA3A 4I3RH 3CMGA 1HOCA 2XZCH 3P0YL 2EH7H 4CKVX 2IAMD 2IQAA 3S3SA 1H3TA 5MEQB 4LNRB 4L3EE 4KXZH 2UWEB 3M8OH 1IGMH 4XT1C 3UO1H 3QDMD 1E4XI 4BZ2H 3SGDH 2GJ6E 3T3PE 4Y1AA 1FYTA 5IFJB 1MAJA 3PP3K 3KAAA 2NY6B 3D3VB 1BM3H 3OG6B 3QEUB 4EUPG 4XB8A 4WWKD 2HT2C 1T04A 5C0EB 2OBGA 5GSRA 1YN6B 1OW0A 1V7ML 1TJIL 5GSVA 1Z0MA 4BFEA 4EOWL 1D5BB 3E6FB 8FABA 2XTJC 1MOEA 1AC0A 5J1TC 4IS6B 3DO3A 2FGZA 4Y4HC 2MWCA 1UT9A 3BP7B 1H8SA 4YHOH 5KSUA 1RUPL 3RWFB 4KK8C 1HHHA 5LQBH 5FIEA 2EECA 4QRPB 5D93C 4UILH 5KJRH 4E41D 4PJHA 2UVEA 3CVIL 2EYTA 5GGRY 1NGWB 4Y2DC 3RVUD 1SJEA 1WFOA 4MYWB 4FQJH 2EXYD 5F8RC 4EI5D 4HX1A 4LOUD 2VL5B 3O81A 1RMFH 4K71B 3SE3A 1P4LA 2VZTA 4M6OL 4QLRA 4KKAC 1QSFB 2F5BH 3KDMB 5DS8A 4X5XB 4YXLL 1NCBL 2E27H 5E8PA 2JCCE 2BERA 3MRNB 2E7BA 5HI5C 1WF5A 4RBPK 4M9PA 5ESQA 4Q0XL 5DR5H 4NFDA 1BVZA 5DD3H 4ZYKA 2CUIA 5AUMA 1KIUA 4JAMA 3IDMB 2C3XA 1NAMH 4FABL 2GSIB 2IGFL 2XQYG 1OB1B 3VFSA 1T1YB 4TPRH 5AZ2H 5IW6B 3V4UH 2O93L 3EYSL 4YNYA 3B3IB 3MA7A 2N56A 1BD2E 4QCIA 4WW1A 4JPWH 4ONOA 1D5XA 1A7QL 3W0WA 4FFVD 4GSDL 1AIFB 4LCCA 1U8OA 4NQED 3ILPB 3EYVA 3T3PF 2R69H 1GPOL 4OLZH 3VFPA 1A9BB 2R56L 3UC0L 5HHNB 3CLFH 5EN2A 1CDHA 1EEYA 5C7XL 3MRKB 2NNAA 4XCNB 4QTHA 1RZKL 1BZQK 3QDMB 4MVBD 4HWNA 3K2UL 5DZOA 4KJPD 5HYJD 3B8SA 5IV2A 1JYNA 3F62A 1P84J 4YR6A 3MRLB 1MCEA 4PJXB 2NY4B 5A1AA 1IBGH 4WI6A 1A6PA 2BSTA 1O0VA 3T0VA 3BYYA 3LEVL 4L8BA 4WWKB 5IWLA 2CO6B 5FYLE 3PGFH 4MAYB 2D7OA 3WEXA 5ADOL 5EU3B 3ULUD 3BUYA 2DIBA 3KPOA 3VXQA 1CIUA 3S97C 2R1YB 2PYED 3QDGB 4PG9A 5E94B 4PJ5E 4E5XA 1MQKH 1RULL 4XI5C 3QUYA 2OM5A 3AS2A 2DIAA 3V8CA 4EQ2A 3VW3L 4J4PD 1BQUA 5IK3B 2D31A 3JV4A 4R6UA 2VR4A 4GKSA 4LCCC 1IGJB 4E41B 5IHUL 5SX4H 3CFDB 1ZHBB 2JCCF 1HH6B 3MFFB 3VG9B 3DRTA 5L2JB 1NAKH 4OD2A 3OJ2C 3QRGH 1UADC 2FL5A 2X4UA 1CIDA 2AJZA 1QRND 4I18A 5JLZB 2OQJB 4Q97A 4L4VD 4PY8I 2A0LC 3MUHL 5C0CD 3VFGH 3U46A 2W0KA 4ZUSB 4X6BA 4K9EL 4JPVL 5IG7A 4YQXH 3WXVL 2ZWLT 1CK0H 4FRWA 4TQEH 5EU7C 5AWNH 5IWLC 1FFNB 2D0HA 3I6GA 1A2YA 3NFNB 1NDMA 3BZFA 5T1LA 4KDTC 3U7WL 2DLIA 2NY7H 4M6NL 5E9DA 2VITB 4UB0H 4GOSA 3BHBB 3LKPB 1WC7A 3QUYC 4G6KH 2I25N 2MCPH 4RDQG 5I1LB 3ORJA 2ZKHH 3RTQA 2K9UA 1T1ZA 5E2UL 2YUVA 3U1SH 4NQEB 4KJYB 3MV01 4D0DB 2YPLA 3MLYH 1DTUA 3OV6A 4HWEL 2HRLA 4KVNH 5IESH 2Y1VA 4P23C 3P77A 1G6RH 2X4RB 5DJZB 4IOIA 2VDOL 1XIWC 3IAPA 3SE8L 2MNUA 4UT7L 1RZ8B 5KN5A 3O6LH 1KC5L 4G6FD 1PDKA 5CIPH 1OTTC 2WAHA 3GZKA 3OWEA 1GGIH 3OAYK 1MH5A 3LMJH 1A6AB 4TRPH 5EWIH 1QFWM 4NNYB 2X4OB 3O2WL 4Q9RH 4LSRH 4QHUB 4JFFD 1P1ZA 4X7DC 2DQFB 1ACZA 2HJFA 3FB8B 1FFQA 4NQDA 3V79C 5ID0A 4M1DL 1P5VA 1U8PB 5ACZA 1OLLA 1DL7L 1A7OH 2X4SA 3N1MC 2LTQB 1SJHB 3AM8A 3DV6A 1MRCH 1YYML 5LGJA 5IJVB 2Z93B 5IMLA 3H9ZA 2EDFA 3HB3D 3AXLB 4RAVB 3V0WL 4JFXA 3ZHLA 4UT6L 2FD6H 4KRMB 1AQKH 1QFUH 5CD5C 1CXIA 3TIEA 3RTQC 1KTRL 3QI9C 3NIFE 1IGIL 5LCVL 1ZV5A 4P57A 2BOCA 3IU3A 3QUZB 5JORA 4XWOD 1KPRB 2FJFB 4LHUD 3EJYC 3WHXA 3WNPA 4JFYB 1A7PH 5I30L 3MJ9H 3LRHA 4Z76B 3MRBB 1LO2H 3HNSL 5DHVA 5SWSE 5C0CB 5CKAA 2I60H 1J11A 3MO1B 1FRGL 4XMLH 5EIVA 4OZGF 4W70A 4C56A 3HG1B 4KK5C 1YY8A 3S37L 3T0EB 4DN3L 1OTUD 2B1AH 4JKMA 2F53D 1LEKA 4MJ4A 3BH8B 5D1XD 1EJOL 4YO0A 4ODUA 2CJUL 3BGMB 4FFYH 5FGSA 5HYFA 1N7MH 4JRXA 4CJ0A 1HINH 2V6HA 4HKJA 1FV1B 2XWBA 3AB0C 2DDQH 1X5LA 4KQ3H 1A6WH 5DJ8A 3K3QA 1OCWH 4POZC 5BZWA 2F58L 1MF2H 1JF6A 1UVQB 2OXGA 4YPGB 4YWGH 1DVFC 2EDXA 4PLKD 1JN6A 5B3JE 5DD5L 5D7IA 2DYPA 5ANMB 3PWLA 5FYJE 3RY5A 1IGYB 2XWJA 5FXCH 4JDZB 2VLKD 3BXNA 3QXDB 4QOKA 4QRSA 3BESR 3GNMH 4LSVH 4WV1A 4N0RA 1MFCH 4RZCA 4Z0XB 4WRLA 5TH2B 1EFXA 3TYGL 3GJFK 2JK5A 2NZ9C 2X4TA 1U0QA 2YD6A 5CD3B 3HE7D 1S78D 3GJFA 3QEQA 4X6CA 3WLBB 3V5HA 3MRPB 2P7TB 3L3OA 1D9KD 3VG0H 1LNUB 3VH8A 1UACH 4J23A 2ZUQC 4F7MB 3U30C 1ETZB 2H1PH 3MX0A 5D7LE 5A16A 1I3GH 4JFFB 4OLXH 3OR7B 4QRTA 1Q9OB 2PR4H 1EAPB 3MLZH 3WSQL 4RMUA 4GFTB 2Q7NA 3S88L 4L4JA 3NIFF 1BIIA 1P2CA 2A6IB 4ODHH 4Z5RA 1EJ6A 3LHPH 1NBQA 1JI2A 1FNGB 3RFZC 2F8XC 3ARGC 2XWTA 2LQRA 5FO9B 4ZUVB 1DN0A 1OAUL 2FX9H 3ZT7A 1UG9A 2DD8L 5ICXB 4CU6A 4JFQA 3BEVB 2NY0C 3RGVB 3DBXB 2BOBA 2FB4L 1IQDA 1FAIH 5DK3A 4WV1C 2ADGB 1KJ2A 4I9WE 2C4XA 1I4FA 4FFZH 3IAGC 3R06A 1LO0L 4HWZB 5IBLD 3T2PA 4NO2A 3ECBA 2VSDA 4FFWD 4JGJA 1P84K 3VXRA 5AAWA 1K8IA 2CD0A 4HH9A 2FATL 5CGMA 2OI9B 5LGHH 2OL3B 5TE4H 2F53B 3ZO0A 3VFNB 4RAUB 2I27N 4H1LB 2DJ4A 3O0RL 4NGHL 3RA7H 4XVTH 1G7PA 5B3JF 5D1ZA 2KUTA 3QDJD 1W2KT 5KANI 3LKRA 4IRSD 5L6YL 5HJ3A 1MCWM 1HXMA 3O8XC 5I1HH 2E6PA 2DWEA 4GRWE 3RU8H 5BO1L 4YIQA 5IHLB 1MFEL 5ALCH 1FGVH 5C0FB 4TULL 1MHHB 2ZCHH 3LIZH 4BH8A 5KSBE 2A77L 2A74A 4MJIB 2ZSVA 1D6VL 1DEEA 1F5WA 2VLKB 2LAGB 2R29H 4TYUA 1FH5L 3IVKB 5IMKB 3DYPA 3WD5H 1C5DA 4ZAKA 3S6CA 1KEGL 1KB5H 1X5HA 1XH3A 1U58B 2AK4E 3UYRH 3HE7B 4OF5A 2ZCLL 2R2HB 5HVWA 3PL6D 4XVJL 1D9KB 1MRFL 2YK1H 2XA8H 3BO8B 1AO7A 5CINL 4QF1A 5ACLA 1J18A 3FRUB 1ZTXH 4JG1H 4U1LA 4KKLD 4KRNA 5BCAA 5DD1H 3K4DA 3LPGA 2A38A 3GSOA 4XC3L 4OFIA 3G6DH 4G8GE 2Y06L 5LBSL 1MHPL 1RHFA 1NLDL 5D1ZC 5EUOA 1K8DA 1S5IH 2EYSB 3D39A 4U6VH 1SHMA 5IKCA 4GXVH 3FN3A 3RGHA 1QYGH 2X09A 3VXSE 5CJOL 4A6YH 1FPTL 1GC1L 3NH7L 1M05A 4DK6A 1FL5B 3NABH 1IGCH 2D7TL 2R4SL 1KTLA 3MV8A 1TNMA 4R8WH 3OAZK 4Z8FH 4PJCB 3QNZB 1AD0A 5JIKA 4WGWB 5DZNA 1A1OA 1JPGA 5E8DL 1YMMD 1PZ5A 4JFEA 4B53A 4EDWH 5ITBL 2R2BB 5TFSH 1S3KL 4YHKH 2BRRL 1Q38A 5DD0L 3PHOA 5IJKA 5DEGA 3LN9A 3KPTA 4HQQL 1BBDH 4U31A 1HNFA 4HKXA 1KJVB 4GRWF 4DEPC 1D5ZB 2G2RA 1H3GA 5JDSA 4JFZH 3HR5A 2HFGH 1UXWA 5BS0E 1E6JL 2XN9A 3EFFA 4XNYH 3BKJH 1QLRA 1MHEA 3SKNA 2BDNL 4IRSB 5BV7C 4OZ4A 5KSBF 2IBGA 3FQRA 2FO4B 2UY6A 5JOFA 1T0NA 1GHFH 2ZOLA 4HXBL 3QEGL 4KY1H 2WLZA 4I0PD 4OQTL 1JV5B 5TF1L 4IDJH 3GSNH 2P8MB 4PB9H 3QULA 5CBAA 4R90H 3PWUA 4HEME 1XR9B 4DVRL 1JHTB 2PW1B 3GO1L 1HEZA 1RFDH 1KNOB 4XHJD 1BFSA 3SDXB 4ESKA 3TLRA 1MFDH 4NYLA 3MOQA 5CP7B 3B9EA 4NWTL 5D71L 2QADB 3QWRA 1JCKA 4U6HA 3OKOA 3D9AL 3HHRB 4JO2L 1RQ5A 3PWJB 3PV6A 2IALA 5CJBA 4Y5XB 1OP5H 5EZOL 4WHDA 2FLRT 3BE1L 4JRWA 5EORL 5I8CA 5ENWA 5EOTA 3H3BC 2CR6A 1TQCB 4J6RL 4LHUG 3O9WD 3VRLE 5LXGL 2I9LB 4BZ1H 1MCPL 4O2EB 3VFMA 1YEEH 5LG1A 2Z31C 4RMSA 2DQHH 4LVOC 1WCBB 3HI6L 1J0KA 1TLKA 3TBVB 5C2BH 2EIDA 3LN4B 3LZFL 5JNYB 2B5IC 2BC4A 5JW5B 1A22B 2J6EA 3MV7D 3H7BA 3S35L 3RP1A 1VCAA 1JPSH 1OWWA 4OZIE 3SDCA 2RB8A 3MA9H 5C0AA 2XY2A 3DHJA 4QXGL 5D6CA 3WO4B 4TUKL 5IOPA 4QRQA 4PBVC 3GSWA 2VXUH 3NCCB 1G7MB 3VGGA 1AE6H 4D9RE 2AI0L 1TJHL 1AXSB 4NJAH 5H37G 4DN4H 2FECI 1KN4L 2F54B 1VKXB 3OJDB 3LS5L 2FEEI 4PP2A 3CK0H 15C8H 2HVJB 5B21A 2GIYA 2L7UA 3I6KB 2VIRB 3U0WL 4CMHC 4L8CA 4WVRA 3NIDE 3LEXA 5T3ZL 1LE9B 4DGVH 4X80L 2KZ1B 2Q3ZA 3K7UA 2A73B 4HS6B 1TNNA 4HK3J 4UQ3B 3RWHA 5FYLH 3MRDB 2EYRB 5IVXA 3MOBL 2UYLA 1KCRH 2W92A 3FQWA 2W0LA 2F15A 5L2KB 1CG9B 2XNAB 5I1JL 3FZUC 3VFOB 1M1SA 1PW3A 5JHDE 2FBJH 3K1KC 5I74C 5DFVC 4JQXA 4MCZA 4YBHA 1S7RB 4JM2F 3MBEA 5FGCB 4RMVA 3LN5A 3S5LB 1PG7X 3M1BA 3TN0A 3I3BA 4XH2B 3ZYJA 1JGDB 1NEZA 2FIKB 4X98B 3WL9B 1I9JL 3NZHL 5IMMA 1JRHL 1LP9E 4FXLA 4XZUB 3VRLF 4LMQE 3RPKA 5BRZD 4R97C 2AJ3B 2NY1B 5FM5M 3LQZA 2VDPH 5GS1B 3WXWH 3G6JF 3IXAA 4HAGA 5JW4R 1GAFH 4M6MH 3Q3GA 3HE6D 3MNZB 4KZDH 4X4YB 1KJ2H 1D5IH 1UB6B 4NCDA 4RQQA 3O9WB 4ONGH 4RRPG 3TCLB 4OZIF 2NY2B 5C0BD 3B5TA 5KG9A 1HI6B 1UWGL 4WW2A 5D72L 2ATKA 3KYOA 4LVHC 5TE7H 3QZWB 4IMLA 4YDKL 3BH9B 4HHAA 2P5EA 5JXED 1QLEL 5F9AC 4L4TB 4H0IA 2ICWJ 1T80A 1CFVH 1VPOL 2VDKL 2XQBL 3D2UB 4QHMA 1W0WA 4BUGA 1F8TH 4M8QB 2DQCH 4WHTA 3ZDZF 5T1KA 5MENE 3SY0B 4F15C 4PRIA 5MHSE 3QPXH 1Y0LA 4JQXC 5FCUH 4Y16A 4U1NA 4UINL 3QG7L 3BRGC 4ZTOH 4LNVA 1VFUA 2Q87A 5JOPD 2WBJA 1OWRM 2JB5H 3GKWL 1Z9SA 3NIDF 3TVMA 4AY0A 5BMFH 2DQDH 4PJIB 1VDGA 5F9JB 1YQVH 5KSAD 2PW2A 3ARFC 3G5YB 3AREB 3L5WA 5SX4I 3S96B 4GXUN 1NLBL 1BFOA 4JE4B 3ZDYE 1FDLL 2IFFH 5CUSH 4TUJB 3BZEB 3LV3B 1ZVSA 1JF1A 3SDDA 4UDUA 4WW2C 2WV3A 5AD0B 5HD8C 4HUVA 3IGAB 4M9OA 5HHMD 4K7PL 3BVNB 3TWCL 5H94A 4MX7A 4B0MM 3HRZA 4M7KH 1LP9F 4RFEA 3S7GA 1WWBX 4NQVA 4YDIL 1JWUB 3MRCA 3OHXB 3FQXB 3STZB 1YEGH 4LRIC 5JUEH 3OKEB 1QFOA 3MRIB 3I85A 4Z7WA 4X4ME 1OHQA 1VFOA 3U0PB 3VD3A 3VFRA 1KFAL 3D25A 3DX6B 4G8FB 4F3FA 1NC2D 2QV2A 2A6DA 2WBJC 1UM4L 5BRZB 2IH1A 2A9NL 3QXWA 3B2VL 5AAMA 4K3DH 1MWAL 5HDQL 4JJ5B 3NAAH 4ZFFB 2GJZB 4GT7A 3S4SA 3HE6B 2B1HL 4H20L 2G9HA 5D8JL 1JGVH 3I3EA 2HTKC 2CK0L 5C0BB 4I5BB 2JJUA 1U9KA 5A3IC 3OPZL 1W72H 5CWSA 3MLUH 4KWUA 1AGDB 4M43L 1MI5A 4KVCH 2GT9A 3RRQA 2NX5A 4RWYH 4N8CL 4K23L 1DQJB 4G8EA 2WM0A 5GS0D 2CLVB 4MNGB 3EO0A 1Q8MA 4LLYB 3ZKNC 4Z7VA 4Q9BA 1YQ2A 3BP4B 3FMGL 3FQTB 1RJLB 4OGYL 2CLRA 4KKNA 3PJSA 2W0FA 2NTSP 2RCSH 3CFEB 1M7DA 4XNUL 1ZLUK 5GRJL 4M7JH 5FYJH 2WLYA 3VXMB 1CGTA 5C09D 1MCDA 3TBTB 1NBVL 3TBWA 2UZIL 3S5LG 4I4WA 4ZD3L 1NUFA 1VADB 2QQKH 3VWJD 3IDNB 4KH2A 4JREB 3DTXB 1R0AH 1BVLB 4YEFA 1XGRB 3FL7A 2NTFA 2NYYD 4XPAH 4AH2B 5E4IA 5E08H 1NMAL 1U93A 4YK4C 2V2TA 1H3WM 3O2VH 4HGMA 2XFXA 3K8KA 2FO1A 1NUGA 4AMKL 4XPGL 2IPTH 2J6EH 3QZWG 2YUWA 5H35B 2J7LA 4BKLB 3UPAA 3UBXG 3HCVA 3HUJB 1JPFA 2VXQH 5K33A 2OJEB 3IRPX 4OCYL 4UV7H 4WHCA 2GSGB 5DO2D 5SWZE 4EVNA 5F6IB 2W60A 3RVVC 1HE7A 1I7ZA 2IANA 4HWBA 4L29A 4N5EC 2VDRL 3STLA 4CMMB 3RZCD 3ZT5A 2PTVA 4JFPA 1DQDL 2HVKA 4XWGH 5I17B 1J5OL 1AQDA 3T08A 4JCLA 4GAYB 4ZUTB 1IAIL 2P47B 1BJMA 2VLRB 2QBWA 4OF3A 3MLVL 3MR9A 4EQ3A 4N8VA 3GSXA 1ZVHA 3FCTB 3WUZA 4AIZA 1G6VK 4ODBD 5E5UB 2C7UB 2MHAB 3QH3B 1HXYA 3HZYA 5CFHA 3BGFB 3RX7A 2EZ0C 1EHAA 3VXUB 1BF8A 1MELA 2EDHA 4HLZG 5D9SB 1IGFH 3TT3L 2W9DL 4JFDD 2LU7A 3LEYL 4JKLA 4YHYB 3OMZA 3G6AA 4LAQH 1A3RL 1CFNA 2IPKB 5I8KH 5T1MA 1J1OL 2H32H 3H3PL 4HGWB 3RWDB 4DW2H 1IT9H 1JWMA 2VQTA 3ZT6A 3PQYB 1XF3A 3BPOC 5I19L 4KROC 1JI1A 1RK0A 4W6WB 5IM7B 5C09B 2E9WA 4DKDC 3SKMB 4LCWE 1GGBL 1WT5C 3V52L 3DVNB 5KANG 5D96C 5C6WH 1JTPA 5I76A 5EOCL 5DSCB 4LU5L 4XXCA 2BVPB 2HG5A 1F13A 4PTTA 4V2CB 1A3QA 2MSPA 5T5FH 4Z7UB 2W65A 2MPAH 3OXRB 5M95B 1VACA 1B6UA 4HJGB 4HUUA 2X4PB 1BGXL 1U8IA 4Z77B 5D2LE 1S7TA 4F7TA 3UYPA 5E2WH 3GIZH 4MA3A 1YEDA 3UAJD 5ICZA 1FQ9C 4LKXB 3WFBH 1JYVA 3QIUD 3QA3A 4OFDA 1U92B 4ELMA 2ICWA 3W39A 1B2WH 2N7BA 4PREA 5DYOA 3DGCR 1GL4B 3ARRA 5EG6C 3QUXA 3JTTA 3VA6A 2PTTB 5EA0H 3QFJE 5I2IA 1UKQA 4X4MA 5T33H 4X0KA 5DK2B 3O6MH 4YDVA 4PBWD 4Y5YC 3IXTB 5FV2A 3RL2A 3ILQD 3Q6GH 5F72S 5DTFB 3TPUB 4D0CB 3FT2B 4R96A 3RZCB 2FWOB 2EKSA 4OT1L 4EIZC 4OTXH 1NAMB 4PG2C 3DX7B 3WHE1 1XGYL 3F58H 3WE6B 1CU4H 1REIA 5I1KH 3T1FB 1U6AH 2CKBL 2COQA 5LAXB 3ARZA 4P3DA 5BZDB 2WNGA 2YEZA 1OOAA 3MBXH 1KTKE 1CXKA 4B50A 1XZ0A 4UIMA 2I26N 3PGDB 3QHFL 1A6UH 2HKHL 3BAEH 3RWJB 1RURH 3MV9D 3BD5A 4ZDHB 5C07D 4XMKL 1S7SB 1FVDB 1SBSH 4JFDB 3GRWA 1QPPA 1R5WB 3FRPG 3VI4F 2YOCA 4Z95H 5TDOA 1MCCA 3G5ZA 1WBZB 1J10A 2E5EA 1DFBL 2B4CC 3LPWA 4IIQA 5DGQA 4K94C 1E28A 3BQUA 1KJ3L 4ZPVA 3MGOB 5DEFA 4C83A 5EU4A 2Q86B 1M71B 5BVPH 5E56A 3O4OC 3EJZC 3ULUL 4NP4H 2VLLA 4TNVF 3NCJH 4LPUA 1FJ1B 3KPSD 1SBBA 2NLJB 1I8IA 3MODH 5F7FA 4M93B 1A4JA 4WEUD 5D2LF 4R7DB 3VGHA 1MHCB 2I24N 2EC9T 2JJSA 1SY6L 2R23B 1UWXH 4WUUB 3MRQB 1KGCE 4ENEC 2KDGA 2EH8H 3IETA 3G5VB 5EIQA 3AVEA 4MNQE 2R1XA 1SYSB 3U6RB 4JKWA 3BZDA 2XT1B 5BOPA 4KK8D 2VE6B 3RVWD 5JW3L 3NMEA 1ADQL 1KN2L 3UTZB 3W9DB 2OR9H 5ICYB 1RIUH 3MV11 4NM8H 4XX1G 3U9UB 5J56B 1F58H 4IIQC 1EHNA 2M2DA 4DJMA 2O5YL 4MD0A 1MUJB 3BQUC 3LAFA 3F6IA 4YDJA 4KKAD 3C60B 3MFGB 4QY8A 1FNFA 2VUOA 2QHRH 1KIRB 4Y1AD 5HI5D 1TTGA 1FYTD 2AV7A 4WI5A 5FKAB 4EUPA 3UXFA 1Y6NR 4MJ5A 1N3NB 1A6TA 5HYQA 3MYJA 5GRWA 5F89A 5IBUB 1PD6A 2HT4D 1R3JB 4PJBA 2W9EL 3BP6B 4FTVB 4XNQA 2EO1A 4HKBA 4KPHH 3G08A 4MA7L 1DBKH 1Q1JH 2DICA 2C3GA 1J8KA 3SGEH 1QEWB 4DZBA 3U2SB 4NN7C 4XP1H 5L8KB 4EDXA 4P5TB 4M5ZH 3RWCB 1R5IA 1RVFL 4LFHG 3MV9B 2VN7A 5C07B 4PRPB 5K9QI 1NMBL 2C3WA 4LCUB 4PV9B 3IDXH 2PXYB 3VXOA 2XV6B 4NO3A 1PX3A 4EEEA 3U9PH 2BHUA 2R2EA 5E24E 4J2XA 5T3XD 2BNRA 5K9KB 5JR1H 1CDIA 1TVDA 1FFOA 3QR2A 5CGYD 5IBTH 4XGZA 5E2VH 4WFGE 1S9KC 5JPNB 1ACYL 4WJ5A 2E7LA 1T1WB 1ZA6B 1NFIA 4D3CH 4H5SB 5GS2H 3MNWA 5CIPB 4DK3A 4WY7L 4PRDB 3MUGB 3FFCA 2H3NB 5F7UA 1AXTH 2AGJH 3LD8C 3VWKA 3V95A 3WS6C 2XQYK 2ITDA 2OMBA 4PRNB 1M6OB 3HPLA 1T0PB 3DXAE 4QRUB 2IBBA 3THMH 2IPUK 4HFUL 5E00B 5GGSB 3UTQB 1HK6A 2XTJB 2ESVA 3P73B 3G9VA 2AQ1A 1BAFL 4HUXA 5TQ0H 3L3JA 4GG8B 4JO3L 4Y4HB 1B0GB 2LABA 3OKNA 3SPVA 3NTCH 1F6AA 3M07A 1HH9A 2EDYA 4NKOA 1TJGH 5FOJA 5JZ7C 3W0WD 5FYKE 1UM5H 5L0QC 1YC7A 2Y25A 3B6SA 5D93B 1HSBA 1U8QB 1CDJA 4NQCE 1YA5A 5C0DB 1DUYB 4Y2DB 4FQIL 2IQAB 2DQTL 4NRYB 3L5XH 1KT2A 4TUOB 3ARDA 3S9DB 5TDNA 1FE8H 5I1EL 2OL3L 1FG2B 2A0LD 2Y72A 3UEZA 4X6EA 2YPVL 2E7LC 1BQLL 5EU5A 4YGVB 1KLUA 4JPKL 4QHLA 1FYTB 2DBJA 5HVGB 2W38A 3P4MB 2O26U 5DWUL 2E7CA 3I50L 4PJ7A 4WNQA 4JHZA 5ESAA 3AS1A 1T04B 3NACH 3EDFA 2EC8A 3KPMA 1XGQA 1QA9B 1J0YA 4LLVA 5GSRB 3C6SB 1MNUL 4YX2H 4MXVE 5C3TA 2UV3A 4I77H 2QSCH 3O2DL 3JV6A 2FR4A 3ALWA 4ZPTB 1KPUA 4BH7B 2KKQA 4QTIH 4LEXL 2HWZL 5MEOB 4O2CA 3EYOB 3QUYD 2HJLB 2QSTA 2RFXB 5KSUB 5GGUB 2D4DA 5T5NF 1HHHB 1MWAA 4M1CC 3H9HB 4NHUB 1MCHA 6FABH 5HGHB 4MXWH 1RZIA 1OM3L 3HZVA 3I6LE 1GZQB 1DJSA 2K7QA 3UTPD 1I1FA 4M1GH 4GAJH 1T2JA 2B4CH 1PAMA 5B8CC 1NFDE 4K94H 3IJYA 3CSYB 3QCUL 3SO3C 4XXDB 2JELL 5E99L 5HHQA 4OIIL 3W9EB 2P4AB 1AHWA 4FQ2H 5DS8B 1LK2A 5L8LB 4H26A 4S1SL 4UAOC 1TVBB 2UWEA 1RJYB 3OZ9H 5LGKA 1OTTD 5CHNA 1EA9C 1VB9A 1CGWA 4G7YL 1A6ZB 3DETD 1JPST 4JO1L 3X11B 4ZYKB 5EZJB 3WFHA 5IFJA 1YEIH 4LSDA 2C1PB 4JANB 4G9FA 3T0AA 2LU3A 3D3VA 1CGYA 3R1GL 3QEUA 5T1LD 5TQ2H 3S8WA 3S98A 4YNYB 5C0EA 1UYWL 2D0GA