4B41A

Crystal structure of an amyloid-beta binding single chain antibody g7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASRSIISNNAMGWYRQAPGKQRELVARISSGGRTTYADSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCNAASLVRGPLDHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY G7
publication title Crystal Structure of an Amyloid-Beta Binding Single Chain Antibody G7
rcsb
source organism Lama glama
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4b41A00
1UB6A 5DMGD 5C08D 5IUSA 1VEOA 2O61A 1D6EA 3IFLL 4LSTL 3SDCC 3G6JB 1SYSB 4JB9L 3IJYA 1L4IA 3SE9H 3QCVH 5HDLA 3QPXH 1FGNL 5IOPA 2VN7A 1T03H 1IGCL 3RIAK 3LEYL 2FL5A 1E27B 4L8SC 3MR9A 1BX2B 2ATKB 3EJYC 1CLYH 3VWKD 1FYHB 3U9UB 1QNZL 4S11A 1UWEL 1IGTA 1JVKA 2NXYB 1RZ7L 4X5XA 2JIXD 3BZ4A 1QBMH 4L4TE 4PV8B 1ERNA 4K9EC 1BD2B 3B6SA 3U0TB 3NCEB 4YDVA 3UAJD 4Y0GA 3FOLB 4A2LA 2ZP0T 3S35X 1KB5L 4ZO7A 3EDDA 4HCRA 5GS0L 1MQKH 3N0PB 4ODWA 3WJLA 4H88H 4X6EB 3GM8A 1QLRA 1UVQB 3QO0B 1AJ7L 5FHBH 2YBRA 1K4CA 2DL2A 4TSAL 3DGGB 4IRSA 1VADB 4Q6YA 1D5XB 3BESR 3ILPA 2AJVL 3TWCH 1J18A 2GTZA 2VXQH 3IT8D 3MLZH 4KTEL 1LO0L 3P0YH 5J1TC 4H8WC 4LHUD 2HKFL 2EC9T 1OQXA 5D2LE 5CKAA 3EYQC 4JN2A 5CZXC 3TNNA 2B4CC 3WHE1 2MOVA 3I6KA 5F72S 2ZUUA 5I76A 1RK1A 1XF3A 4HKZB 4ZFZA 2IADA 1QA9A 3QIWC 4Y5VB 4L3ED 4LPUA 1A9BA 2GITB 4NZRH 4JZJA 5HVGB 1TVHB 4G8IA 2BMKB 4XBPB 5E9DD 5DO2C 5EU3A 4QKXB 2VOTA 4R2GB 2FWOA 2Q7YB 5HY9B 1J12A 2IF7A 5C6PB 4DAGL 5I6XB 3O0RH 2DF3A 3LQAL 3STLB 3MA9L 1JGVH 1GZPA 3HCVB 8CGTA 1VFAA 5T1KB 2B1AL 1U95B 2G5BB 3NABL 1I8IA 1SJHA 2VDOH 4GOSA 5CP7A 4RZCB 4ODVL 3HE7B 3ARFA 3QDME 4XNUL 1EAPB 4XNZC 4K8RD 3WJJA 4GQ9H 3NA9H 1WBYB 4N5ED 2NW2A 2APXA 3R8BB 1D9KC 5KS9A 3M17B 4WV1C 2AK1H 2VDRL 3LEXB 1JN6A 3FQTB 4ELMA 5FO9B 3MLXH 1MAMH 1FAIL 3TCLA 4I4WA 4K55A 3TVMD 4G7YL 3DYPA 1FG2A 3QUZC 4PJBE 4R97C 2C1PA 3BGFB 4XNMB 3QCTL 1CXHA 4FFZH 4HXAH 1WCBB 2FHBA 5I30L 4XCNA 3IDIB 3K2UL 3ARGB 4X8XA 1S5IH 1XGTA 3UYRH 4YWGH 4C56D 4LCWA 4WHTB 5H35A 1RJZB 2EDTA 3ARBA 1D7FA 4AT6B 5HSFA 4YDKL 2Z31B 2WSKA 3FQRB 1DQQA 4ISVB 1ES0A 4WWKB 3DRTA 3R06A 4JY5H 4U1LB 4PRAB 3G5ZB 4YX2H 2IBZY 2EH7H 4UNTA 5E0QA 1OTTD 3BWUC 3I02B 4J6RH 4L29A 5MI0C 5BV7H 3VXRD 1MCFA 2YWYA 3GJFH 2EDYA 1QFWL 1EBPA 5TE4H 3V95A 2BX5A 3PHOB 3O4OB 1AO7B 1ADQL 1YMME 3WIFA 1Z9SA 1N6QL 1ZGLA 1Q72L 4LCIH 4OZIA 4OAWB 4X0KA 2ESVA 3QFDA 4G3YH 4HC1L 4YHOH 4KAQH 1JV5B 4KC3B 2R0ZH 3RWHB 3FTGA 3P4MB 4M4RA 1XR9B 5JXEA 3QXDB 2NXZD 2OM5A 1VFMA 5GJTH 1WWBX 2Z35B 1BFOB 1HQ4B 1G6RB 1KENH 2DQUL 4EEEA 4CMHC 5JA9A 3T0EE 4AL8L 3DX7B 1NC2A 1FZMB 4JM2A 3A6BH 3V79C 4HWEH 3FB8B 5AEAA 5IMLA 4GBXA 1RURL 4NQEE 5I18L 3L5HA 3UJTL 4K8RL 3MRKA 4MQ7A 4WW2A 3V52H 2CLRA 4U3CA 4YR6B 4P59L 5LWYH 4OD3L 5C07A 4PYGA 1RFDH 2JJVA 4L8DA 4PJAA 4YBLB 5F1IB 4JFFA 1SY6L 3C87A 4PLOB 5B39G 2AXHA 4U2ZA 4X7SH 4Y88A 1CU4L 2R69L 4D9QE 3UYOD 3CPLB 4KK8D 3UBXG 4KK6D 1BFVL 1MJJA 1DQDH 2HAZA 3HR6A 4FQXB 2D2OA 2XN9A 1XMWA 1U8KB 4NZUH 2FEEL 5SWZB 3BIKB 1A4KA 1I3VA 2WWKT 3WUWG 1WT5C 3VFUB 2R23A 2BY3A 4OCSL 4GAGH 1IZJA 5KANI 3MRIA 2AABH 1UQSA 2EDXA 2NY1D 3RGVB 5GGTH 4M43H 1RULL 3QEQA 5DJ8A 1IGYB 4UQ2B 3VXQB 1ACYL 4MVBC 2ARWA 2KZWA 1KCSL 3NMEA 1IRAY 3MRBA 3KPTA 4P2OC 2BOBB 2VC2L 1FN4B 2FIRT 1FL3B 3DTXA 2FEEI 5HHVH 1LD9B 2D0GA 2R1YA 4MA1B 3OKDB 3DJ9A 2Q8BL 3O6KH 2VAJA 5BRZE 4Q0XL 3ZDYF 4R26H 2BVOB 5DJZB 1W72A 2ZCLH 1G7HA 3L1OH 5CSGA 2CUHA 2X10A 3PDDA 1AD0A 1BIHA 4PRPB 4LHQB 2HJKA 4AY0A 1NC4B 3L95A 4Q2ZA 4ZPTB 1F90H 2H6PA 4FABH 2VTFA 5K9KA 1GGIL 6FABH 3D39E 3GMQA 1PLGL 3Q6GH 1NAMA 4PY7A 3WL9A 3NCCB 3RGHA 5HYSG 1KIQA 3KNBA 4FQHA 1NLBH 2FR4A 1G9ML 1KCUL 1UYWH 3O45A 1JGLH 1QRNE 2JELH 1U2CA 4RMWA 4X4YB 2UZYB 2DDQL 4F7PA 2AI0H 5IF0B 4Z7OF 3L7FA 5KSVB 4CJ0A 4RGNE 5GRVL 4DOHB 3IU4L 5ITBH 3DRQA 5DSCB 1X9QA 4D0BB 3ARVA 5JNYB 1YDPA 4L8SB 2WBWB 3QUYB 5BO1H 4LF3A 3BVNB 2ITCA 4Y5XA 2HJLA 4Y4HA 5HHXL 2WZPD 5C0DB 5GGSY 4H25A 5IB4B 3MRHA 3DMMD 1HKLL 1S9WA 4OD1L 4ZFOB 5EUKB 3PWLB 4CNIA 3WFCL 3RKPA 1KLUA 4GLRI 5AZEH 1MRCH 5ISZD 1UZ6F 3ZHKA 1N8ZB 3MACL 1DLFH 3QEGL 5TE7L 5MEQA 1TFHA 3T77B 5F44A 4WY7L 1OY3B 2ORBH 2V7NB 1OSZA 4QLRA 5ID1A 4JG0L 1ZEAH 4N1HB 2ZUTA 1A7PL 4PTTB 5ENWA 4P5TB 2QQLL 1DQJB 1MQKL 1N2RA 4JR9L 4CN4A 2B5IB 4JO4H 3VWJB 2ADJB 4JN1H 4F8TA 4OLZH 3VGHA 4P2QD 4S2SB 3OR6A 1XGQA 2VL5B 5KSBB 4OM1H 2V5MA 4NQDA 5GZNC 3MXVL 3ULUF 2C26A 5HHQA 5BZWA 3P0YL 4RFNC 2NZ9C 5DD6A 1PG7H 1KJ3H 2PYFB 1Y6MR 4XCFL 4XRCB 3O3DB 3RPIA 4CRPA 4DQOH 3LHPH 3MRGB 2R4SH 4NRZA 2A1WL 1VHPA 2WINA 5DMIL 2AK4A 1G7JB 4GG6A 1KG0B 3H9SA 2CK0H 3CVHB 3S6CA 4KJYB 4FQIH 5C0IB 1F6LL 5L0QB 1XFPA 1DANU 4TPRH 1HQRB 3H9HA 2PW2A 2JCCF 1U8NA 3DROB 2VMFA 3S88H 1KNOB 3L7EA 1FNEA 5KW9H 2XWJB 1IVLA 4HGMA 1KTLA 3V7MA 2P5EE 5D1QD 1QRKA 3A6OA 1A7NL 1SHMA 3VFOB 5EDXA 4XNZB 1P7HL 4RMVA 4KPHH 4LCCB 5CSZB 2GT9A 5FUOH 1JGVL 5D93B 2J8HA 1G9EA 3QDHA 3QEHA 5DJYA 2EDQA 2IQ9H 2AQ2A 4N9GB 3ARZA 3HB3D 2IAMA 4R4BA 3QJHA 2V5SA 4M7LT 5EPMA 1BF8A 4GQ9L 5E8OA 2DD8H 1RJCA 3BRDA 3T0AA 2R56H 4P0DA 3SKJL 1BBJA 2F5AH 4JY6B 1T0MB 1FJ1A 2WIIA 4Z9KB 4PV9A 2LTQC 3V8CA 2AK1L 3T4AB 3SDXB 3MUY1 4NDMA 4K3DH 2G9HA 2B8OT 2J1KA 4XT1C 3PP4H 3VXUB 1T6VN 4F58H 3L9RA 4K71B 5EBLA 4FFZL 4AQ1B 2HMID 1JNLH 4U3XA 1RUQH 1U8LB 4H0IA 4A6YB 2I5YH 4Y4FB 2WLYA 4OCRL 4PJCF 4M9PA 4GKSA 3ZDYE 5I75B 3NFPA 3BKYH 3OPZL 4DZ8B 1VPOL 1ODAA 4YXKL 4E5XB 2DMKA 1AC6A 4XMLH 1ONQA 1IGML 4TQEL 1CICB 3BH8A 1C5DB 5D96B 4QHNA 5GHWL 1FO0B 2LU7A 1U8MA 3A0OA 5JOPD 4MNQA 3C60A 5BV7L 1EPFA 3TPUA 3MNVA 1GCFA 2X40A 4QHLA 4ZPVB 5EOTB 2G2RB 1QR1A 4W70A 5BMFL 2AQ3A 2EE9A 4HHAA 2Q6WB 1L6XA 4XCYA 1P53A 1FNSH 3BJ91 4U6VH 4Z7OE 4NQCB 4CMHB 4KGLA 4G3YL 4KAQL 4JFZL 2E7CA 5TE6H 4ODTH 3NBNA 3G08B 1ROWA 5JMRA 1WEJH 4UB0H 3VFGH 5GJTL 1NFDB 1J0IA 5KSAB 3LRSA 1ZA6A 2ENYA 3RL2B 3O8XA 1MI5B 4YHIB 5CJOH 3I9GH 2X4TB 1IEHA 4K3GA 4XVJL 1L0XA 1W0WB 1A8JH 5I1IL 3QQ3A 4JFDA 1UZ6E 3D0VA 2GTWB 3UZVB 3V52L 1WTGT 2DQTL 4GAYA 4NFDA 3GM0A 4ZSOA 1GYAA 1RFDL 5BW7A 3O6FC 4HGKC 1OLLA 5CIPH 1TMCB 3UJIL 4X7SL 3MLYL 1CQYA 2DJUA 3W5NA 4V2CB 4KVCH 4XCCH 3QQ4A 5C0BE 3MYZA 3ULUH 1T1YB 4M62H 1I8LA 4NZUL 3ULUE 3V5HB 4APQB 3HG1B 3T0VA 2HYMA 2QKIB 3O2VL 4W6WB 2AXGA 5C09A 1JYNA 2WIMA 1D5MA 5HVHB 5I16A 2FX7L 1ZLSH 1KIPA 3BRFA 1CFQB 1WGOA 3O81A 1TQCC 3CZJA 3LZFH 2AABL 5AWNL 4P2OB 5CCKH 5IG7A 2EDFA 5CKGA 1R5IA 1MVFA 3GGWB 5IVXA 5F7EL 5A16B 2VISB 3CAFA 4EUPA 1FIGH 3HE6A 2BNRE 5TQ0L 3TT3H 4JFEB 3CDCA 2JCCE 5DEFB 5E6ZA 2EEBA 4F3FB 1GZQB 2BY0A 4M00A 2OR9L 1RSFA 1G84A 4J3SA 3TIEA 3SGKA 1A7QH 5FKAA 2R9HD 2JB5H 2Y5TA 2BHUA 1VENA 1ORSB 1G7MA 3S3PA 1CR9L 1OGTB 3PE9A 1NBYA 3NA4A 2CDFB 4JJ5B 4R26L 1VACA 4N8PA 3AU1A 3L1OL 1YY8A 4OI9A 5IMKA 5FYJH 3WUZA 2DQFB 4PJHA 3U0PB 4KV5F 4QGYA 3AM8A 1NGZA 3B9EA 4YC2B 5KSUB 5IBUB 1G7LB 3GBNH 3BJLA 2YHGA 4GW5B 1P84K 5IBLD 1IFHH 3FQNA 1F90L 1VFUA 3FL7A 4JDZB 1OM3H 2FBJL 2EIEA 4URTB 1J1OL 3IKKA 4YEEA 1XZ0A 1UFUA 3S3SA 5JA8B 4UV7L 4XPAH 3VXMA 3Q6GL 3OB0H 5GS3A 1CFVH 2CKNA 5IESL 2YD2A 4XP1H 3SPVA 5IGXH 3C5ZB 1EDQA 3V9FA 1IGIH 4L4VA 4ZMAT 5I8OH 2NTSP 1FH5H 1ED3B 1JGLL 3U82B 1NUFA 5I73B 3FO2A 1HWHB 4QRRE 2AI0L 2AV1B 2NY6D 4PJCE 5ILTH 3VA2C 3KLDA 1X4ZA 1U93A 1L7TL 1GGUA 1AI1H 2A6IA 4UNVA 5EBMA 2PXYA 4OZ4A 1ITCA 3MOBH 4NQXB 5F93C 2UVEA 4FNLH 1I7UB 1BVLB 4NYLA 4HH9A 3W2DL 3MODL 2AAVA 5AZEL 3NCYS 1EGJL 4NHUB 1S9VA 4GW4B 3HR5A 3DX9B 3OJ2C 4G9FB 4AIXA 4Y2DB 3IFPB 3EO0A 4NJ9L 4NSKA 5E2VH 1YEHL 4IBLT 3FO1B 1KYOK 4YHZH 1KELL 3O6MH 4NQSB 4ZUUB 3PV6A 2GQHA 4PJ8D 4ERSH 2WBJD 4I48B 1BQSA 5I1LA 1FNAA 3RQ3A 4BQBA 4DQOL 3LH2H 2APWA 2GJJA 3T8XB 4B5EA 4MD5A 2X4UB 3VGAB 1CGSH 1NLDL 3TA3D 3BPCA 2DYPB 2CK0L 4WUKH 3UTTB 4PGJA 1N6UA 2P5WA 2EIZB 1A6ZB 4KZEH 4DK3A 3RZWA 4ZS7L 3MV8D 3GMOB 1JZ6A 4ZXBC 1SYVA 5TDPA 3I3BA 1JHKL 3C9NB 3H3PH 2XXMB 5D70L 3LIZL 3GUTB 3MRFB 3HC0B 4U49A 3EOAB 3V5DA 5ABDE 2EICA 2GUOB 4RGNC 5DVLA 5JOFA 5FO7B 4QXTA 1FFQA 3LKRB 4XHQA 3U4BH 1CXFA 5I1CL 1HI6B 4IRJC 1RZ8B 1J8HA 1S9YA 2UY6A 2AEQH 3GIZL 4PIRF 4L4TB 4LKCB 1AC0A 4DFHA 4U1SB 3VFSA 1E4WH 4X5WB 4HKJB 1ZOXA 2YOCA 5BS0A 5EBWB 1H5BC 2A74B 4NN5C 3SKNB 1ZVHA 1YC7A 3HC4H 3LD8C 4JDTH 4X4MA 2V2XB 1T5XB 4MGXA 3UTPE 3EDEA 4OIIL 1YMHA 3L3GA 3KLHD 4NRXA 4QTIH 2AV7A 2EDDA 2N56A 4J3TA 3UTSD 5JHDB 3UBXI 4F58L 5SWSE 5EO9A 3LQMA 2CSPA 2G75B 5SWQA 1HH6A 2B0SL 1AHWB 2OR8A 3K8MA 4KI5D 4F15B 5IR1B 2WWMD 5D7JB 3SE4A 2I5YL 1WAAA 3JV6B 4EN3D 4KJPD 4TSCH 2FX8H 3AREA 1C5BH 3O11A 5D2LB 5KJRL 4R0LC 5C08E 2EDBA 4PJIA 3KJ6H 2BOCA 3NIFF 2PNDA 4PS4L 5M95B 4KV5E 5DZLA 2HFEA 4L9LC 5DLMH 4OF7A 1BHGA 5FGRA 4K94C 4K3EL 5GSRA 4XCEA 1A9EB 4ZOAA 4JKPH 5C3TA 1BFTA 1MCIA 4UT6H 5A43C 5GGQH 2CXKA 3S96A 3WEXB 3F12A 1ZANH 2XKUA 5I19L 3VMNA 4YDLB 1HSAB 2XWTB 4U05A 2IEPA 4LSUL 5F9AC 1C5CL 2BVQA 3V0WL 2VXVL 3QDGA 1IM9D 4P4KC 4HW6A 5CGTA 3SGDI 3MV9A 3G6AA 4WI7A 4D0CB 2AXJA 3EYFA 4HBCL 1JZ8A 2CR3A 2DQJL 2ZSVA 3QDMB 1S7WA 4JGUA 1K6QH 5KZCD 3NFNB 3P40A 1ACZA 4JDVB 1WEJL 4HWUA 4UB0L 5F9OL 3VFGL 2VIRA 4WEBL 4WJ5A 5GQBA 4EI5B 3FCTA 1DUYA 3RX5A 1NDMB 4NKDB 1Y6KR 3TH3T 3EBAA 1J1XH 3VFMA 4MD0B 2Y7QA 5MEOB 4CUCA 1OAYL 3MCKB 3PDOB 5IMOA 2BSRB 3SN6N 4PJBB 2NY0C 3A67H 3F5WB 2RAMA 3C5JA 3UZEA 2OXHA 3PL6B 5E5MA 4L3EE 1TTUA 3WFDH 1JPGB 2Y6SD 3NOIA 3VG0L 4DKFH 1FPTL 3L3DA 5E9DE 1HCFX 5CD5C 3RVUC 3D0LA 1CS6A 5FECB 4BQ9A 1B90A 2ATPB 3DYMA 1MY5A 5L6YH 4UTBH 4KVCL 3SDAB 4ZNEA 5L8JB 1KOAA 1KIRA 2VUYA 4OCNC 4ZO6A 1V5JA 3DIFA 4MJ5B 3J8F7 4WEMB 3RX8A 5B8CB 2MNUA 3FFCD 3GJFB 4G6KL 4XZUA 4ZUVA 2EDLA 4TULH 5FIEA 4OTXL 3LZFL 4IHOB 5E2WH 4WIQA 3SGEI 1VEPA 4OZHB 1KBGL 4DEPC 3PGFH 3MJ9H 1XIWA 1X44A 3F58H 1W72H 3GSQA 1N0LA 2VQUA 3EDJA 3OXSB 4P3CL 3DVNA 2BJML 3E2HC 1ZHKA 3IDUA 4FQQA 1MVUB 4F9PA 4YUEL 4B41A 5EFIB 2ZOKA 3PGCB 3B3IA 4WNQB 3KPRA 1TZHA 5BJTA 4JPIB 1C12A 4C56E 2SEBB 1U3HA 1ZV5A 3WE6A 3H0TB 1M7IA 4R7NA 3STBA 3T0EB 4U1NA 3ARDD 4QCIA 2J6EA 3WFHA 1I4FA 1SVZA 1T22B 4HUXB 2YC1A 2VZUA 1G9NL 3VCLA 1RZFL 1GC1L 4ALAH 3KYOB 1JHLL 3SCMA 1GAFL 5J56B 1KN4H 1T80A 4FQ1H 3U83A 1EEYB 2EDWA 4W68A 3BDXA 4X9GA 4ZAKC 3EYOA 2XT1B 3QYCA 4I0PA 1J88A 3CH1A 1DVFA 5HI5D 3RKDC 8FABB 4XC3H 1C7TA 5F89A 3VXRE 4WW1B 5K9QG 1OF2A 1E6OL 2P48B 4PRNA 1EUUA 2UUDH 3AROA 3BI9X 4FQ2H 5D7IB 4PRHA 4PG9B 1KJVA 1FDLL 1IGIL 4M1DL 4L8BB 1BZ9B 1A3RH 1FSKC 3U46A 4PREA 4QRPD 1T2JA 2AKRA 5INDA 5LGHL 1D3CA 3GSUB 4YO0A 3SDDD 3C6SB 3RVXC 5FO8A 4O5LL 3OL2A 4ZODA 5DRZA 1AR1C 2D7PA 4UOW0 2DQIH 1LDPH 3SDYL 3OHXA 1BJ1J 4PJDB 2GK2A 4HLZH 4RAUA 2FYYB 3PG2A 1OTSD 4HCRL 1YEJH 2D7OA 2EYRB 2ICWB 2IGFH 1MIML 4NKQB 5IFAL 1UXSB 3AMKA 1CIUA 1UXWA 2Q3ZA 2NY7L 4LEOA 1HNFA 1HILA 4RX4A 1CGVA 4PG2C 4BK5A 2OP4H 3RU8L 3H2WA 5I74B 3U2SB 1ETZB 3BH9A 5EOCL 1IARB 1HH9A 4Y19D 2OQJB 2EXYD 4TUOA 3OR7A 4B50A 2PYED 4I0CC 4DN3H 4I3RH 5JUEH 5DQJA 5DQ9B 5E2VL 1E4KA 3RUGF 1XT5A 4Q9CA 2XZCH 3MFFB 1Q9WA 1H3VA 4PUBL 1BP3B 1UM6L 4Y16A 3LN9A 4EUPG 1U8JB 4XWGH 1JHTA 3NPSB 3V7AG 3OKMA 1MHCA 2F74B 5D71H 3NTCL 3GMPB 4YNYB 5I17A 2FH6A 1RZGA 3X12A 4IIQB 4F9LC 1H3WM 3ULVD 1UWGH 4WUUA 4YH6A 5I71C 2XQBH 5JLZB 2OI9B 1EAJA 2ED8A 4HX1B 3WLWD 5HYJD 1QHOA 2XXCB 4FFWC 4K23H 5E6IA 2GK0B 4JAMA 1AGDB 4MLSA 5J1AB 1XGUA 5HXMA 1A1MA 5JOEA 4WUKL 2P8MB 4GBXD 1JPFB 4NZTH 1MJ7H 1IEAA 3EUUA 2NY3D 1IBGH 3VFTA 5K9OB 1G1YA 1QHPA 5C07D 5C86A 4OLEA 3RZCA 1KJ2L 4XP5H 3S5LB 4DWHA 2Z8VC 1PJ9A 2XPGA 4HSQA 2C3WA 3ROOA 5DQDL 4GRLB 4LDOB 1YYLL 4HWZA 4FXGA 5IM7B 3ROLB 1J05A 2H1PH 3QNZB 4EVNB 1RUMH 4GUPA 3DBXB 4PJ9A 5DA0B 1REIA 3C09C 2VR5A 1YY9C 5EIIB 3CSYA 5IEHB 4NN5B 5TH2A 2IJ0C 3L3JA 4PGCB 4X9FA 2AEQL 4HGWA 1A4JB 3QDJB 4UDUB 4AG4L 4IMKA 2N4IA 1PSKL 5DUMH 1U58B 4Y4KA 4NNXB 3TT1L 3MRLB 2R2EB 4IOFC 5DEZA 2XWBA 4OLUH 1QBBA 5IVZB 4AENA 4I18B 1FYTA 5F7UA 1AGBB 3BQUA 3K1KC 1Q8MA 4W6XB 3GSXA 4OLYL 3EFFB 3HHRB 3QEQD 2EH8H 5D2NA 3LS5L 1NDGB 3MRRB 2IPKB 4RNRA 4YPGA 1CD0A 5KVEH 3KXFD 1HCVA 3B2UC 5CWSB 3P77A 1N0XH 1MJUH 3QJFB 2AEPL 3MRMB 3QULA 5EUOA 4KDTA 1A7RH 4ODXA 3RTQB 4TSCL 2FX8L 3MUZ1 4HKXB 3BIAX 4GKZB 5DWUL 1KT2B 3U7WH 1MPAH 3RJQB 4EXPX 3HNTH 2XZAL 3GB7B 5CINH 5DD1L 4LCUB 3RIFF 4AEIH 4WO4D 4MHHG 4N1CA 4LEXL 4QWWC 4HFWA 2NLJB 2PO6C 4JRYB 4OGXL 1RIHL 2CUIA 3QRGL 3A6CL 3BP7A 5GGQL 3I6GB 1R5WB 4XBGB 4IJ3B 3ULVL 2J7LA 3DI3B 5ISZE 1LO3H 3V4PH 1I9EA 5FYKH 2WUBH 4JGJA 4H26B 2P5EB 2JK5B 5GS0C 1GRWA 3RDTD 5I9QC 1WIOA 4RWHA 2A6JA 5DK0B 1E28A 2L7JA 1AGFA 1NAKL 4Z5RB 5D1XD 3B5GA 3TF7C 3BHBB 3WS6C 1RAMA 5DHYA 2FECL 4BZ1H 3BN3B 1OT2A 5CEZL 4P2QE 4X7FC 3ZE1F 5F9JB 3MJGX 4W4OC 4F2MA 1T2QH 1I9JH 5EA0L 5IP4A 2WUCL 3RVWC 5A3ID 1QLEH 3PABA 4JO2L 3IRPX 4HKBA 2FSEB 3ZO0A 3QO1B 5E8EB 1OAXL 1P4IL 4PRID 2IFFL 1KTRL 3QWRD 3S4SA 2O5YH 4OGAC 2ZZUT 4BH7A 1A6TA 4NPYA 3K4AA 1CIDA 3INUL 1Z6JT 1ZSDB 5DMJB 1IAIM 5FM8A 2D7NA 5ETUB 3OAUL 2VDNH 5KVMC 1ZWIB 4P23C 4NKIH 2XTJD 2B2XH 3LQAC 4PP2B 3QUXB 2NMSA 3RUGE 5C0CA 1JMXA 3FQUB 2DLFL 4LARH 1AKJA 5JORB 5BQ7B 1PKOA 3F7PC 1J86A 3G6JA 4LGSB 2NY5L 1SYSA 3FONB 5DMGC 4G6MH 1MF2H 2HH0L 4NKOB 1E27A 1VA9A 3TCXA 5F7KC 5DZOA 1BX2A 1CXLA 1PKQE 1DL7L 2ATKA 4P9HH 4KY1H 3WYRA 3U0WH 3U9UA 1I9IH 3T2PA 1UH3A 5C0ND 4PV8A 3VWKC 1BD2A 1RUAH 3U0TA 1A6UL 1ZT1B 1R3KB 1MWAH 3FOLA 2AK4D 4M6NH 1G0XA 3UX9B 3QH3B 5BXFB 4PJ7F 1OCWH 2V5RA 4WI9A 2C1OB 1RU9H 1T04B 1LEKB 2VLRD 4WEUD 4X6EA 2ZPKL 1Q1JH 2OMBA 2APFA 4M61A 1UVQA 1D5IH 3QO0A 5DRXB 1B4RA 1MFCL 2YA1A 3DGGA 4F7CB 3MREB 1VADA 5C0AB 1D5XA 1NAML 2HFGH 3QI9D 1AXTL 3GSWB 3MUGB 3QNYB 4KUZH 4UT7H 5SX5K 4KROB 1X4XA 3VRLF 2EE6A 1NCBL 5TPWL 3W11C 1M6OB 4PTUB 1UJ3A 4HKZA 4KQ3H 3NFSH 4Y5VA 2ICWJ 3V4VL 4CJ1A 1C08B 2GITA 4WFFD 1TVHA 3JZ7A 5IQ9B 1CTOA 2X41A 5FYLD 2BMKA 1MCOH 2EDRA 5CIPB 5T3XH 4XBPA 4PLNC 1T83A 4FQ2L 4NNPL 3TN0D 2D31B 1I3GL 3DLQR 1N3NB 2Q7YA 4J3WA 5HY9A 5C0BB 3RWEB 4UILH 3WS3B 4FZEH 3STLA 2QADD 3T65B 2YEZB 3AC0A 4IRZH 3HCVA 4PRBB 5T1KA 5J11B 1U95A 2VXSL 1FVCB 2G5BA 4OZFB 3SBWC 1V3MA 4RZCA 3HE7A 4YHNB 1Q9LB 2VLKD 1LDPL 5EBGA 1EAPA 1YJDL 1W0YT 4JKKA 2O5ZL 1WBYA 1YPZF 5I1EH 2YRZA 1CF8L 2ERJB 4K8RC 2CD0A 2BNRB 5DURB 3M17A 4G6AD 4N5EC 2JCCB 3ARRA 1WZKA 3LEXA 5JTWA 1BPVA 5FGCE 1F3DH 3FQTA 5FO9A 4JQVA 5IB2B 5B38B 1NCWH 2J8OA 4PJGF 1TVDA 5LBSL 5IHUH 3NCBB 4XNMA 1PZ5B 1ZT7B 1WCBA 4HS3B 3TVMC 4BUGA 3IDIA 3ARGA 3UO1H 4KDVA 2RCSL 3RL1B 4WENB 4BSWB 5ESQA 3C6LC 3ILQC 3QIBC 1ZS8B 1H8OA 4JPVH 4WHTA 5JUEL 4ENED 4AT6A 2Z31A 2XZCL 3FQRA 1RVFL 3S34H 2VLJD 4ISVA 4NM8H 4WWKA 3ZE1E 3W5MA 2J8UF 3OJDB 4PRAA 3G5ZA 4CVUA 1B3JA 3HNVL 1R0AH 1C8PA 4J23A 3SDCD 3ELAT 1UWGL 4DCQA 3I02A 4GXUM 5HGDB 2BRQA 3RVVC 1YEFL 1XF1A 2O61B 1AY1L 1OTTC 3HRZB 3VDAA 3V6FB 2MKLC 3PHOA 5IT2L 3MUHL 3R4DA 3WD5L 3EJYD 2O93L 4OAWA 4XPGH 4PJCB 4HZAA 4IM8A 2ZJSH 1JV5A 1DBBL 3RWHA 3P4MA 4TVSa 4X5XB 1XR9A 3QXDA 5D7SL 1MELA 4KI5F 1NCUA 3GBML 1EFQA 4LPTA 2Z35A 3QXAB 1BFOA 1G6RA 3QWOB 4LSVH 5IW3A 2NXZC 5HGHB 2H1PL 3DX7A 4LSDA 1FZMA 4LASH 3H7BB 3K8LA 3GSNA 3FB8A 2YBRB 3REWB 5JQ6H 4OCLC 3JUYA 4NKMB 1IL1B 3M8OH 5CZXD 5HYQB 1DJSA 4BELD 4Y1AB 4YR6A 2X4QB 1A1NB 2YD3A 1DBKL 1G9MC 3MGOB 4JN2B 1UM5H 5EZIH 3FKUS 1T4KB 1L9MA 4PJ7E 4LPWA 2CDGB 1MCBA 2X4NB 3MPCA 2IADB 3T04D 3CPLA 5KVEL 5DO2D 4FQXA 3BSZL 1F8TH 1JGDB 1U8KA 5SWZA 3BIKA 5T1LB 4KK6C 5F1OB 2A77L 3D9AL 3QWQB 2XZQH 4HZLB 1OAZL 3U7WL 4LP4A 1RZJH 2R29L 2VDMH 4XWOC 2K7QA 1MRFL 1ZTXL 1XEDA 3RGVA 3BO8A 1IGYA 4UQ2A 3E1F1 5HGGS 3VXQA 2NY1C 1U2HA 2VXUH 3O6LH 1E0OB 1D9KD 1KN2H 1ORQA 3ARWA 1J9CT 1X5LA 5I15H 2BOBA 1FN4A 4KK9C 2OCFD 3VXTB 4HXBL 2ZKHH 1FL3A 4ELKB 1QSVA 4DVRL 3VXMD 1IKFH 1WZMA 2IPTL 4K7PL 1LD9A 4RWYH 4KXZH 1UJTA 3CLEH 1NQBA 4TSBL 3RWJB 4L4VD 4LNRB 3W0WD 4K9EL 2BVOA 5DJZA 4LVOC 4M7KH 5EU7E 3V6OC 4M7LH 2UY7A 1M7DB 4EXKA 3UTOA 1WLHA 5I1JH 4PRPA 5F1NB 1YPZE 1S9KC 3WN5B 5H35B 1NC4A 4ZPTA 4AEFA 5E1AA 2W0PA 1LMKA 3MRQB 2O5YL 1KJMB 3F7YB 3CVIH 3IETB 4PGDB 1OL0A 4J4PC 3EHBD 5SWSB 5E2TH 2N7AA 2BDNL 4S1SH 1DDHB 5ACLA 4JRWA 1MLCB 1P9MA 1MQ8A 2VZOA 4MXVF 1T3FB 3MV8E 1EJOH 4X4YA 5IF0A 1F00I 5KSVA 4IOIB 5C08B 5HI4C 4PB9L 4MXQD 1DFBL 4N8CH 1BWMA 4D0BA 5JNYA 2J8UE 4L8SA 1C7SA 3QUYA 5DR5H 1XGYL 3HS0B 1IGFL 3BVNA 1YZZA 3I2CH 3P11H 5C0DA 4LOUC 3H8NA 1H3PL 3QFDB 5IB4A 2OK0L 2DM2A 1N4XH 4Q9QH 5GXBB 1JWMB 4ZFOA 1MF2L 1KFAL 1SJEB 2CK2A 5EUKA 3TBVB 3VWKB 4BKLA 3PWLA 4HUNB 2JIXB 1NL0H 3DMMC 4UQ3B 1IAII 3TPKA 3SE8L 4O9HL 1N8ZA 1VGKB 4LAJH 3WNNA 4YXHL 2EO1A 4NRYB 3T77A 1JCKA 1SQ2N 2V7NA 3KR3H 2FNBA 3VD9A 4PTTA 2X4OB 1F97A 5KS9F 4Y8AA 3UTSE 5E2UH 4P5TA 2P5WD 3TC9A 3VWJA 2ADJA 1RPQA 4KI5E 4MZ2A 5C0JB 5HD8D 2GAZB 4PJAB 4S2SA 1CGXA 2VERN 2VL5A 3NZHH 4LHUB 4HDIB 5DJXB 5KSBA 4FS0A 3HA0A 4HF5L 1NBVL 4DKAA 5E8DL 5JMOC 2YKLH 5DS8B 4NHCH 5DF0A 4DW2H 5D72L 2PYFA 4V1DB 4XRCA 3O3DA 5HI3C 4QY8B 3ARPA 3MRGA 5BV7C 2WP3O 2XN9B 5DUPH 1JE6A 5KVGH 4L3EB 4M7JL 3KS0H 4R4NC 5MERB 1KG0A 1INEH 3CVHA 1OW0C 1CCZA 1X4YA 1NUGA 4BQ6A 4KJYA 3RVTD 5C0IA 2LABA 3EAKA 5E9DB 3WLBB 1HQRA 5D5MA 2YD9A 2Y07L 4ETYA 3DROA 2ZG2A 4H5SA 5DD0H 2FHFA 7CGTA 4MVBD 2HJFB 1EFXB 2AJYL 2XWJA 1NBZB 1QKZH 4HQQH 4LDEB 4N0YL 2VB5A 1U0QA 5C6TH 3S4SG 3VFOA 4ZOEA 3TO2B 4LCCA 5CSZA 5D1QC 1UCBH 4RFEB 1FL6B 2AJZB 3LKPB 3EO1B 4MAYB 4N9GA 3LPFA 3L5IA 3GMRB 4IS6B 3ULVF 3ARED 1MREH 4KKCC 2FCBA 3HB3C 3QUZA 3WIIH 1NSNL 1T0MA 3BPOB 3IS0X 3T4AA 3SDXA 2F8OA 4K7PX 3MLUL 3V4UH 5FA3B 4LPVA 3VXUA 3F7QA 4Q7DA 1JWUB 3QHZH 4U1GB 4D8PB 3BUTA 4C56B 5K9KB 3OB8A 4JEGB 5D4QA 1TETH 1U8LA 2Q76B 4A6YA 3D18A 5EOQL 4Y4FA 2VQ1B 3STZB 2J4WL 5IB3B 3C2AL 1YEIH 2M1KA 2BRRH 4DZ8A 1UWXK 4E5XA 1N26A 4MHHI 1KCLA 1U8HB 1U8QB 4FP8H 3UDWC 2E9BA 1CICA 3REVA 3CLFH 1C5DA 4UAOC 5DA4A 3VXRB 1FO0A 2DM3A 2AJSH 1QLFB 1A5FH 4FZ8H 5TF1L 3FFCE 3LKOB 3SGJA 1VFBB 4I13B 4LBEA 1U92B 3HMXH 3ECBB 2LAAA 4S0TD 4ZPVA 5EOTA 2G2RA 4ZFFB 15C8L 4LLVB 2IBBA 4NGHL 2Q6WA 1MFEH 2I27N 4Z8FH 1WK0A 4NWUH 4MXVE 3AB0C 3QA3B 3FB5A 3V8OA 4NQCA 5HHOD 1K8DA 3BP5B 1BLNB 2MQ3A 3G08A 5HGBB 1TENA 1NFDA 2YK1H 3ETBF 5KSAA 1AFVH 3RL2A 1Z3GH 3IDYC 5C9KA 1MI5A 1MOEA 4YHIA 4LSVL 1A21A 2DQGH 7FABH 3QHTC 2X4TA 2VSDA 4U7KA 2WK2A 4U3HA 5GIRA 1NCAH 4LASL 5GZND 2QTEA 3D69A 4C58B 2R1XB 4DN4H 4OZGB 1W0WA 2NZ9D 3F8UB 5IFJB 2ZUYA 1FFPB 4GKOA 2GTWA 3M8OL 4O02L 2PTUA 1OAKH 2Y9RT 2Z8WC 1F3RB 2Z92B 4GRMB 4UTAH 3ZE2F 4ZFGL 5EZIL 5KS9E 3K7UA 4JVUA 2C3VA 1XIWD 3ZT7A 4ELME 1DQLH 4QRPE 1WJ3A 3H3KA 1IKNC 1UZ8B 3OKEB 1T1YA 2YPVL 4JY4B 5F7YC 3QRFM 3B9DA 4Z0XB 3QIUB 3RBGA 4DKEL 3SEPA 3V5HA 4H0GA 3KPRD 4APQA 1HXYB 3HG1A 5C0GB 2QKIA 2XZQL 2V6HA 5TDNB 3RNKB 1QFPA 1CFQA 5T5NG 2OJZL 1A6WH 4IDJL 2D7QA 4P2OA 3BRGC 4G6FD 2DBLH 3GGWA 5A16A 2VISA 1NGYB 1ZKAA 1FIEA 2Q8AL 1AE6H 2FBOJ 3NCFB 2IAMB 4HWNA 1HINL 5HDBF 5F7FA 3IDMB 4JFEA 1NANI 5DEFA 4BSJA 4LIQH 1KN2L 4LSPL 1RIVH 1Q9KB 4N0UA 1ZVSB 3HZMB 2RFXB 1GZQA 4F3FA 2ED9A 5I1KL 4Y19E 2PYEE 2W38A 2NX5D 3OGCB 4NJAL 1ORSA 1TNMA 2R9HC 1OGTA 4JJ5A 4M6MH 2CDFA 3HI5L 3L9RB 1F6FB 3TP4A 4G9DB 4QRUB 2P42B 1JF5A 3MC0A 2DQFA 3U0PA 5J13C 3KYAA 3X3FH 1X5XA 5JIHA 3ULVE 1G7LA 1FLTX 4RDQG 2CIKB 2XKNB 4GW5A 4Y5YB 4TRPH 4D3CH 4JDZA 5HYJE 2EC8A 3BEVB 1T20B 5IBLC 2QQKH 1CFNB 4YPJA 3PIQB 5C0EB 1UKQA 3TYFB 1CFTB 5E2TL 5GRXG 4K2UH 4PJ5B 4K3JL 3WNOA 3MV7D 1ED3A 3W39B 1OQOA 4I8DA 4RGMC 5JW4M 2AV1A 5C07E 1N6VA 3WNKA 3WDJA 4U6TA 4JCLA 2YXMA 3JVGA 2NY6C 1MY7A 2R8SH 1EHNA 1BM3L 1X6LA 4M5ZH 4Z7NF 5JW4N 1JPST 1J7VR 4NQXA 3P2TA 3ZHLA 5DHVA 1PZUB 3Q2CA 1I7UA 1BVLA 1CVRA 2DLEA 2PUQT 4QOKD 1LK3H 5E8NB 5L7XH 1SBSH 4ONFH 4NHUA 1QSFA 3OTTA 4JQIH 4I2XE 4OLWH 2J6EL 3RA7L 3OZ9H 4MA8H 1ZGLP 4G9FA 4HPOH 3QEQE 1MH5A 4Y2DA 3IFPA 4JFDB 5E2UL 4G8GD 4P2QB 5B3JF 3KXFE 1IC4H 3O6FD 4ZUSB 2NY4C 4NQSA 4NN7B 4ZUUA 3RZCD 2DQDH 3OKLB 4I48A 3GRWL 2FGWH 2JJSC 4YE4L 4JHAH 5E99H 4QGTA 4D9RD 1AH1A 3T8XA 3UPAA 1FRGH 5DUPL 2WQ8A 5J0BA 5IWLC 2DYPA 1GOGA 2P8LB 2EIZA 1A6ZA 4MCYB 4NO5B 3ZE2E 4RMUA 3TA3C 5D1QB 5ERWB 5DD0L 3RUGB 3GMOA 3NH7H 2OMNA 3C9NA 1XGRB 4BQ8A 3GUTA 1QKZL 3MRFA 3HC0A 3WNPA 4AIOA 4RFOH 3EOAA 3LB6C 2C3GA 1Y6NR 3HE6B 3E8UL 2GUOA 5GRUL 5EZOH 3GJFK 4HIEB 2R4RH 3FB7B 3QHFH 5JPMB 1UCBL 5FO7A 1QPPA 3O2DH 3LKRA 4ZG1A 4AEHL 5GRYA 5D9SB 3K4DA 1PKQB 1HI6A 5IW1B 3TO4C 1RZ8A 2Z93A 2YSSB 2VWEE 4KJQC 5IEKB 3RAJL 1KEGH 2YZ8A 1HOCB 4PRIE 4TTGA 1FORH 2MCPH 4L4TA 4LKCA 1JRHH 1FQ9C 4U1SA 4X5WA 3WIIL 3N1PC 4HKJA 1Q0XH 2ITDB 4JFOB 4K7FA 4TVPD 5EBWA 5I0DA 2A74A 3SKNA 5HDBE 1MWAB 2WMPA 4OUUB 2V2XA 1T5XA 1F4WL 4LU5L 3N9GH 3V4UL 3V0VB 3IYLW 2HRPH 5MEPB 3TJEH 2G75A 1J0JA 4M8VA 4NM4H 3KLHC 2XTJE 5IR1A 5D7JA 5GJSH 3JV6A 3KYKL 4MA7H 1MFAL 3MRCB 5D2LA 3QAZB 4KI5C 2WWMC 4AQOA 4LRIA 2X89A 2H45A 4H1LB 4F33B 1DQML 1V8HA 2DTMH 12E8H 3ARUA 2B1HL 1J5OH 2CLVB 5T5FH 4JREB 1A9EA 4N8VB 4X4ZA 3IS1X 4OM0L 4U1IB 5D8JL 3O2WH 1JFQH 3HNSH 3WEXA 1CL7H 2H41A 1WIUA 1U93B 4Q6IB 1I8MB 1MEXH 1BFSA 3OF6A 3B9KC 3CXDL 1HSAA 2XWTA 1JZ4A 5HYIA 1Z0MA 5IROA 5KOMC 5D6DA 1NJ9B 4O58H 4PGBB 5EORL 3GSNH 4OJFH 3VFRA 4Z8FL 2AK4E 3T3MF 4JHZA 5GGRB 3GZKA 1FFOB 5EO1B 5IFHH 4D0CA 4PJEF 2R0KL 2VLRE 1T1WB 3QDMA 2W9EL 1BVZA 4CKVX 2DQEH 4HAGA 3NFNA 4JDVA 3C8KB 1G9NC 1GC1C 3WKMH 2VZ3A 1M4KA 4Z7NE 4EI5A 1BAFL 1FZKB 1NDMA 4NKDA 1EMTH 1JI1A 2HFFA 3NIDF 2Y5EA 4MD0A 5MEOA 1Q0YL 2CGRH 1KEMH 4JM4L 3PDOA 5HJ3B 2BSRA 1KC5H 4PJBA 3B9AA 1SJXA 3F5WA 4N5UA 3PL6A 4HEPG 2Q20A 1OAKL 4WFFE 3MRNA 1JPGA 5FYLE 1NKOA 3FAXA 2XRAH 3L3HB 4LAQH 3KLSA 4RISH 2NXYD 4I0KA 2Y6SC 1K2DB 5FECA 5B3JE 4NIKB 3NVQA 2ATPA 5ESAB 1DQLL 1ZXQA 4WRLA 3SDAA 4ZXBD 1QFUL 1BOGB 5HDQH 4NO3B 4HFUL 1H3XA 2PTTB 3N06B 2D9QB 2EDKA 4FQLL 2VLKE 1X6NA 4MJ5A 3O3UN 3WJLC 3FB6B 4P2RE 1WFOA 3U6RB 1F45A 3GJFA 2APBA 2RBLA 3TYGL 3BAEH 2DAVA 4OZHA 5C0RH 2AQ1A 5FCUH 3OXSA 4EBQL 1JGUH 1GSMA 1MVUA 5FAAA 4AIZB 2C7UB 5EFIA 3PGCA 4WNQA 3CFJB 5BS0B 4M93C 4XB8A 4M1CC 1MJ8H 4JPIA 1J87A 2SEBA 4GMSH 3H0TA 2D3VA 4JZJC 3T0EA 1RIUL 1NGXB 2VLJE 1T22A 4HUXA 4EDXB 1U6AL 4PYHA 2PETA 3KYOA 1HH6B 1L7IH 2NY2D 2OX5A 1JTPA 3BEWB 4R3SB 1EEYA 3KYMB 4WHYG 5T1KD 4UT9L 1FE8H 8FABA 2JJWA 1A7OH 4WW1A 1P4BH 1MHPH 4PBXA 4X7EC 3KJ4C 4IMLB 4NCC2 3UJJH 2C4FU 4LCYA 2JF1A 5HI5C 4PJ7B 3ARFC 2NQCA 1LNUB 1WWWX 5D7IA 3WJJC 4PG9A 4H20H 4L8BA 1BZ9A 3C6SA 2R0LH 3HMWL 2I60H 2D03L 4FQCL 4G7VL 1VGEH 3QSKB 3EIFA 1A6VH 2X1QA 4W81A 3VI3E 2G60H 5B4MD 4M5ZL 4PJDA 2FYYA 5KAQF 2QQNH 1TPXC 5GGTA 4ZO9A 2EYRA 4JQXA 4H8WH 4XP6L 1UXSA 3ARBC 2ID5A 3GBLA 3U79A 2ZCKH 1YC8A 3BFOA 1PX3A 2MPAL 5I0ZA 2B4CH 1SBSL 4XAWL 4YHPB 3FAWA 3OXRB 3U2SA 1ETZA 1ZVYA 3MLVH 3OZ9L 1BJ8A 2NY0D 4CGTA 2OQJA 3B5TA 3MA7B 4C55A 3T3ME 3VG9C 3ET9F 4NN6B 2FJFB 4YXLH 4OV5B 4JRXB 4KHTH 1PD6A 4PJEE 1AO7D 5DQ9A 2P47B 2EXYC 4OFYD 2QHRH 4YFDB 5E5MB 3MFFA 3V7AE 1MCPH 4PJ8B 1A1OB 3RVUD 1U8JA 4Y7MA 1YPZB 2WBJB 3IXTB 2F74A 1GL4B 2K3TA 3GMPA 4YNYA 4DGVH 4JPWH 5HYSB 1I9RH 1UH4A 3NIDE 3D39A 4GT7A 2FGWL 4HPYH 5JLZA 4JHAL 5E99L 1RMFH 2ZSWB 1T7VA 1WQVT 1SMOA 3O4LD 4HX1A 3EFDL 2KKQA 5HGAA 3ULVC 5JXEC 1EEQA 4PJGB 2GK0A 3SHSA 1AGDA 5J1AA 3MBED 3WLWC 2BVYA 2VYRE 3HZKA 1QRNA 3MV8B 2P8MA 4UV4L 1B4JH 1JPFA 5DZNA 2R2BB 4JM2C 3CK0L 2YXFA 5J06A 5K9OA 4XZUB 1NCNA 5IBUG 4GBXC 3BWAB 2NY3C 2J8UB 3S5LA 3MRDB 3VXME 4WW2C 2B7DT 4GRLA 2P46B 4L4VE 1I3RB 3W0WE 5IM7A 3ROLA 3QNZA 4EVNA 5ECJE 3DBXA 1U8OB 5F7WC 5FHAL 5EIIA 3RBSA 2BNQB 1J0HA 3S37L 5IEHA 6CGTA 3MZTA 3GK8H 5D7LD 4PGCA 5AAMA 4R7NB 4M3KB 1A4JA 1F11B 3QDJA 4UDUA 5EU5B 1FLRL 1ULVA 1U58A 4NNXA 3MRLA 2R2EA 3O3AB 3WO3B 5IVZA 4I18A 3SCMB 1AGBA 1BBDL 3RKDD 3WCYA 3EYUH 3RGVD 3EFFA 1OAUH 2VRAA 2RJMA 3I50L 1NDGA 1Z5LA 3MRRA 2NTFB 4I0PB 4P2YA 1JZ5A 3N1QC 4X7DC 3T3PF 4XPTH 1ZA3A 2KQNA 4M5YL 5E4IA 4EN3B 2EIDA 1Y18B 5CWSA 3O3BB 3U9PL 1BIIB 5JIKA 4J3XA 4JO3H 5EN2B 2NY5C 1JYXA 4PRHB 3RTQA 4MA7L 2BXZA 3WHXB 4HIIB 4PR5B 2ARJQ 2QHLA 4HKXA 4GKZA 3FMGL 3LMJH 1KT2A 1KUMA 3RVXD 5FB8B 1CDHA 2BVEA 3K0WA 3MNWB 4WI3A 3GB7A 4LCUA 1AR1D 3TH4T 2XACC 4DVBB 4WHYH 1Z9OA 3X3GL 4JFPB 1R3JB 4QHMB 5DDHB 1MCWM 3I6GA 5T33L 1R5WA 4XBGA 5TFSL 4PRPD 4NWTL 5GPRA 3Q6FB 3ZTNL 1PVHA 1F3DJ 4HJJH 1NC4D 1G6RL 1U41A 1SM3L 2IANB 2P5EA 2JK5A 1NMCC 3TFKC 5K93A 4GMTL 3KG5A 4KTDH 3WO4C 3OBAA 2JJTA 4OJFL 5J12B 4HIHB 4Z5RA 4P5MB 2ED7A 3BHBA 5KZCB 4JCMA 3TGXA 2P5WE 3GI8H 2QSCL 4YIQB 1HHJB 3MRPB 3BH9B 1TITA 3RY6A 3EYVB 1G7QB 5F9JA 3TM6A 1AXSB 5E08L 2OZ4H 4P49A 3OR7B 4OQTA 5EC2B 3LN4B 2FSEA 3QO1A 5E8EA 3EDFA 3GSOB 3PWVB 5C2BL 4XVTL 4Y16B 3GNMH 3DUUB 4GS7B 5A2FA 1MHCB 1ZSDA 3T0XA 4Y5XC 4Y4HC 4FFWD 4TNWK 3TBTB 3UCRA 5ETUA 2OTWB 4BH8B 1INDL 1RD6A 1ZWIA 2XRAL 1QZ1A 4XC1L 4MJ4A 5EU6D 4O2CB 4PBVC 4PP2A 1QFWM 3DUHA 3MCLH 3QG7L 3QUXA 4OLXL 2XTJC 5JORA 3KPOB 4D0DB 5BQ7A 3EDKA 1IT9H 4PB0H 5HDQL 1YJDC 4UUJB 3OB0K 3FONA 4N90D 1MIEH 3H7LA 4P4RB 3TBYB 1VEMA 3HI6H 2J12B 1JZ3A 3K46A 4NKOA 1ZAGA 4HWZB 4BQCA 1JWSB 5CMAB 1ZLVH 4M48H 4XPBH 4W4NA 5EZJB 1HEZB 4QRQB 1J0KA 1V3LA 5BVJB 5D6CB 1ZHLB 4JFHD 1DN0B 5FCUL 1ZT1A 5C0NC 1BQHB 1OT1A 1R3KA 3L3JB 4IOFD 3SE3A 3U7AA 3FHAA 3QH3A 5B22A 5BXFA 2BNUB 2C1OA 1T04A 1LEKA 1G7PB 5MENB 2B20A 4D9LL 5DRXA 1MJ8L 3S37X 3ARDB 1I1FB 4F80A 4F7CA 3MREA 4WCYH 2BFVH 1RUPL 3FFDB 1XAUA 4QTHB 1TNNA 2IG2L 2X05A 3B2UD 3GSWA 5L2KD 3MUGA 3QXTA 4YPGB 1F2XK 1DE4B 3QNYA 4AK1A 3L3OB 4FXLA 1JNNH 3BKCL 2IBGA 3ARTA 4YHKL 5DD5L 4OI8A 1M6OA 2VR4A 2FH8A 4PTUA 4ODXB 1FE8L 5E03A 4QWWD 1C08A 1KJ2B 4K3HA 3NZ8B 5IQ9A 2PO6D 2E3VA 1ZHNB 4HT1L 2A9NL 5E7BA 2D31A 1C16B 4QRPB 1N3NA 5DHVH 1LE5B 1WZ1H 3T3PE 4MJIB 5KTEH 3SDDB 5C0BA 4ZFOL 1J1PH 3RWEA 4FMKA 5C7XL 1LO2L 1KYOJ 4F37K 3WS3A 4JANB 4GXVH 3GHBL 4QT5B 5HHOE 2HWZH 5ICXB 3T65A 2YEZA 3FT2B 2AXFA 5M7QA 3G6DL 2R0LL 4PRBA 4F57H 4KDWA 1FVCA 4OZFA 1EEZB 4RAHA 4HK3J 2Z91B 2QADC 1N7ML 1EZVX 4YHNA 1Q9LA 3DARA 5KOVC 3ZSSA 3LDBC 1DSFL 5I1AB 3IJHB 2PR4H 1A14L 3RX7A 2AVGA 4FQJH 1RK0B 1G0DA 4D94A 2BNRA 3RVWD 4HMCA 2XTLA 2JCCA 3N1MC 5IB2A 2FD6H 1CICD 3VG9B 2MWCA 3WXVH 1BEYL 5B38A 1BGXL 5GRWA 4G6AC 2PTVA 4Y19B 5DK2B 4HKBB 2I07B 2BY1A 4G6JH 4OGAD 1PZ5A 1ZT7A 2PYEB 3VGFA 3MLRH 5F96H 3SJVB 4HS3A 2R2HB 1KACB 1TJHH 3FN3A 3KLAB 5E8PB 1UENA 5GGVH 3RL1A 1LQSR 2YPKA 4BSWA 3C60C 2GW5A 5L9DL 1ZS8A 2EC9U 4P23D 1N64H 1TZGH 2DKUA 4GAJL 3P9LB 4MAUL 3CVHL 2CR6A 4ODHL 4XMKL 4ENEC 4RA0C 3OJDA 3ZHDA 3BT2H 3KPRE 3EYSL 3L5XL 4I77H 4HD9A 5HYJB 5DJDB 4HPYL 5HGDA 1Q94A 2NPLX 4R8WL 3IAQA 4TNVF 3GFUA 3HRZA 4DGYL 4R96B 3V6FA 1WITA 4X6FB 2MHAB 4OKVB 1DLHB 5FYKU 3HFMH 2NY3B 3O8XC 4BZ2L 1UADC 4EI6B 4QRRA 4PJCA 3ZDZF 5BVPL 1NFIB 5F6IC 3D6GA 1NPUA 4EOWH 1NUDA 5FF6B 3F6IA 1RZKL 2UYLB 2NX5E 2DQHL 3QDAA 4OSUL 1DEEB 3MV01 3QXAA 4R90H 1TQBB 3H9ZA 3BKML 3QWOA 1SMAA 5EWIH 2P45B 1B0GB 5HGHA 1YYMH 3TZVB 2GSIB 3V2AR 3H7BA 2X4PB 4M61B 5CUSH 3MJ6A 3REWA 5T1DL 4POYA 3GK8L 4A6YL 4APQD 4I2XB 4NKMA 1IL1A 4X80H 3V6BR 5I1HH 4FHBD 5CEXB 1I8LC 3N50A 3ESVF 5HYQA 3KS0J 4Y1AA 4NCC1 5F8RC 1V7NH 2X4QA 1A1NA 3W11D 1I75A 2UWEF 3MGOA 3EYUL 5A2IH 4OQ1A 5I8EB 1T4KA 3KXFB 3DXAB 3M07A 2CDGA 4LVHB 2X4NA 1UJ3B 2VLMD 1FO0L 3MV7E 3UTQB 25C8L 1DR9A 2VH5H 4U0RB 3WDIA 1MFBH 4FMFA 1QBLH 2QEJA 1JGDA 5T1LA 1OPGH 4XBEH 4HZLA 3BPNB 4WO4B 2BVPB 3LMJL 5SX4I 3BPLC 1J0YA 3RWGB 3T0BA 2VDKL 4LSSL 3ZYJA 4Q9RH 3SGKC 2Y36H 4OLVH 3DSNA 1NGPL 3JWDH 5A2LH 1FZOB 5HPMB 4P9HC 1OGAD 3U4EB 2EYTB 5DRWB 3GI9L 5KVDH 5T3ZD 3FRPA 4QOKE 3AS3A 2VJXA 1TJIH 2KL6A 4OCWL 3RDTB 5F97E 4DGIH 4J8RB 3P4NB 2D0FA 3AM8C 1UEYA 3ZKQD 4DTGH 5ID0B 1T1XA 5DUBB 1EO7A 4KRPB 5D1XB 3VXTA 5D1ZB 5GS2D 4ELKA 4PPTA 3GKWL 4Z7WF 4ZTOH 3LEVL 2EDHA 4G8GE 3C5ZD 3RWJA 2E8YA 3MLSH 4LNRA 3JWNC 1XR8B 2OL3B 1LEGB 5AUMB 1M7DA 3C6LD 3ILQD 3CH8A 3QIBD 2FX9L 1GPOH 3MLTB 4JE4B 2E27L 4XNXL 4PRIB 5ESQB 4OFKA 2DLGA 3QB7C 5F1NA 3WN5A 3QZWB 4HWBA 4D9RE 3JWOH 5EU4B 3S5LG 1QSED 3MRQA 1QBAA 4HUKB 1KJMA 1OD7A 3F7YA 3IETA 4PGDA 2HLAB 2V17H 4CL7A 3RVVD 1CZ8H 5SWSA 4M7ZC 3P30H 1DDHA 2PXYC 3U7YL 4N1EA 3IJSB 3MCG1 4DCQB 5L88H 4TUKH 1MLCA 1VB9A 1MCSA 3EHBC 4PY8J 1T3FA 3N85L 3VI4F 4IOIA 4FXKA 5C08A 1YNKL 1HIMH 1E4XH 3HUJB 3HPLB 2F54D 4HS8H 5D2NE 3HS0A 4MXQC 2UUDK 4PB0L 2K1MA 3BMWA 4WU5B 3UMTA 1JWMA 3LKNB 3MO1B 1SJEA 4JG1L 3TBVA 3VWKA 1X5IA 2X9XA 1AGCB 1LP9F 2W9DH 4P3DA 2N7BA 2JIXA 4UQ3A 2H9GB 2UZIH 4OF5A 2KZ1B 2XY1A 1VGKA 4M48L 1IJ9A 4TVPE 4HUWB 4OD2B 4NRYA 5FDYA 3SOBL 3GSNB 4WU7B 3G04B 5FM5O 2CJUH 1QFWI 2VLRB 5T3ZL 2X4OA 3ZDZE 5LGJB 3PJSB 2AS5M 1FHGA 3UTTD 1BQUA 2EECA 3G5XB 2DQCH 5JW3H 3C08H 3WXWH 3QI9B 4KK5C 5C0JA 2GAZA 5DJXA 4LHUA 4HDIA 3B43A 1XCTB 3DUSB 4NQUA 5HD8C 5DS8A 5T5NF 4V1DA 1OAQL 4X8JB 3RWIB 4QY8A 1XGPB 4WHDA 5ADPH 4Z77B 3T2NL 4L3EA 1NCDH 2CKBH 1AXIB 1QPXA 4XWOD 4LFHD 5MERA 1LO4L 2M2DA 4OF3A 5E9DA 2UWEE 2YA0A 3WLBA 3QQNA 3TN0B 2X5PA 3EW3B 1CLZL 1CLOL 4OT1H 1NGWB 4QHKJ 2EZ0D 5TQ2L 3RVTC 5CZVH 2HJFA 1EFXA 1QOKA 1NBZA 3BO8B 1OARH 1WZ1L 2F19H 5IHZB 2BHZA 5KTEL 2YS4A 3FRUB 3TO2A 2J5LC 4KK9D 1ORQB 1K5NB 2DBJA 3S36H 5JHDD 1F6AB 4RFEA 1FL6A 2VLKB 3LKPA 2AJZA 3TESA 3EO1A 4MAYA 4P2RB 1CG9B 5D7JD 1A3QA 4B53A 1NGQH 3GMRA 2P43B 2AEWA 4IS6A 3SE4C 2L7UA 4FQJL 3MJ9A 1EV2E 2AJXL 2X89D 3MROB 2LU4A 3G9VA 3AREC 5K9JH 1DBJH 1O5DT 3CDYA 1VSCA 3CD4A 3WXVL 3MLWH 1CBVH 3L6FB 5FA3A 5AG8A 1AP2B 1JWUA 3IDXH 1MCDA 3IFOB 5ESVA 5E1AB 4O51B 4BZYA 4J4PD 4D8PA 1PQZB 4C56A 1BREA 1UACL 1X3DA 2V7HB 4WFED 3OF6D 1RJYA 4Q74A 2Q76A 4Z7WE 1TCMA 5GGVL 5GGSB 2VQ1A 4KKNA 3STZA 5IB3A 1KXVC 2EKSB 2VLJB 3V5KB 2AW2A 3KPMB 5DFWH 3VXSD 3PQYD 1GGBL 1XF5B 4M6OH 1DBAH 4NBXB 1IQWL 5HI4D 1U8QA 1U8HA 2MFNA 1RZJC 3QG6B 3SDCB 4YK4C 3VFVB 4P9MH 3H42L 4P46D 3AUVA 2VXTH 4LQ1A 4MNGE 3VXRA 5HHME 4BUHA 1QLFA 4R4FL 3NAAL 3D25B 3EO9H 4LOUD 1PBYA 3LKOA 4JLRB 4XXCA 1VFBA 1HWGB 1U92A 3ECBA 4CDGC 4JHWH 3TNMA 4ZFFA 2FZ3A 3GMLB 3SE9L 4LLVA 3QCVL 3QPXL 3PWPD 5LG1A 2Q1EA 4BKLB 1T03L 5F88B 5IB5B 3OSKA 4LP5A 1WBZB 3QA3A 3LY6A 3VI4E 1L6ZA 1CLYL 2W0FB 3SO3C 3W9EB 4PLJC 3BP5A 1BLNA 4E42B 2GFBB 2Y1VA 1QBML 1URLA 5HGBA 1IZKA 1MAJA 2WP3T 3BP6B 1SVCP 4L8CB 4AMKH 4LRNH 4LGPB 3THMH 4K7PY 2ARJB 4XGZB 1YYML 4PJFF 3RJDA 4H88L 4X4XB 3SKUD 1O0VA 2R1XA 5CUSL 1LP9E 4E41D 5FHBL 1RZIB 4OZGA 3GIVB 5IFJA 2AEIT 1FFPA 4GKNB 4K94H 4MSWB 4X80L 5HI3D 3TWCL 2VXQL 4NZDA 2BCKB 3MLZL 4AH2B 4OZFG 4LQFH 2DLHA 3QIWB 5GRJH 2EEAA 2Z92A 1S7XB 4XP4H 1S7RB 4GRMA 1PYWB 4R4ND 4PJEB 4CDHA 4OFPA 1IAOA 4XPFH 3FN9A 3VFNB 3KPLB 3MFGB 3VMOA 3PP3H 4LSQH 4NQVB 4XVSH 1VERA 1XIWC 3D3VD 4NZRL 4J2XA 1UZ8A 2QL1A 3OKEA 5D5MB 2FO1A 1D5BB 4NNYB 1QBLL 4KHXH 4JY4A 3T0WA 3ZTJH 4ESKA 4H5SB 4Z0XA 3QIUA 5B38G 2YPLB 1HXYA 4OGYH 4LLWB 1VCAA 5C0GA 4XBEL 1IQDB 4F9PC 3BW9A 5TDNA 3RNKA 2YUVA 3O0RL 3MJ7B 2J88H 1U3HC 3JWDL 5JW4Q 1EH9A 4MNHA 1X5AA 1D9KB 4KKLD 4KUCD 1NGYA 2VDOL 1II4E 4WV1B 3MX0A 4KKCD 4OCXH 1WC7B 4C59B 3IDMA 5DFTA 4L5FH 3AXLB 3NA9L 4OQTH 1Q9KA 1ZVSA 3HZMA 1MCKA 2RFXA 5CHNB 1UM4H 4R97B 3QUZB 4YHYC 1JF6A 2FB4H 3K1DA 1H3GA 3SKMB 3HI1B 1DVFC 1QTYT 1JJUA 3HAEB 4YEFA 3P9MB 3OGCA 5E24E 1AO7E 3MLXL 1MAML 3BZDA 9CGTA 2XFXB 4GQPH 1YEKH 2IPUK 3MNZB 4G9DA 4HXAL 4QRUA 4FTVB 3KPSB 3Q0HA 1S5IL 5HHPB 3D18B 4YWGL 3UYRL 3ZL4H 2CIKA 2XKNA 4Y5YA 2RB8A 3O4LE 5FK9B 3JWOL 5MI0B 3BEVA 1T20A 4JY5L 1CFNA 3PIQA 5C0EA 5K59E 3GMMB 3REVB 4YX2L 3TYFA 1CZ8L 1CFTA 2EH7L 3HLAB 4PJ5A 1A3LH 3QFJD 4QF1B 3OV6A 3IDGB 2X9YA 1F13A 4J6RL 1T0NB 3ZKMC 3W39A 4LBEB 3P0VH 5HHNB 3RP1A 3KDMB 5TE4L 4N0CC 1IC5H 3BE1H 2AGJH 3EOTH 2C4XA 4LCIL 3VGGA 1MHEB 4UI2A 3FB5B 3VW3H 3CMOH 1K8DB 2VDPH 4YHOL 5ICZB 2VAAB 3VDBA 2R0ZL 4OI7A 4HUMB 1E4KC 3TLRA 4U6YB 5BOZG 5D7LE 3VFPA 2KH2B 1N5AB 3CZFB 4FFYH 2EDOA 5E8NA 3I3DA 4RMSA 1INQB 1KENL 3BUYB 1JPTH 1MFDH 5GIRB 3A6BL 2EE3A 4YQXH 3D69B 1P2CB 4HWEL 3MQIA 3RIFK 4TN9A 5ALCH 3JBG7 4BA8A 4QYOB 3CSGA 3CFCH 4P2QA 5E6IC 2HN7B 2BSTB 4ZUSA 2DQCL 3FRPG 5LWYL 2HLFC 4G8FB 5JW3L 43CAB 4BFIB 1K8IB 1P7QD 1JMZA 5I1DB 2C3VB 1XF4B 3OKLA 3S35H 2VR9A 4PJFE 4FA8A 1CVSC 1I1AD 3E3QC 5KN5B 3RZCC 1DQDL 1MLBB 4P5KB 4XAKD 4MX7B 2F58H 4ODSH 1PAMA 2GY5A 1GVIA 5MP6H 4PRPE 4OZFH 3VH8A 4QRSB 2CMRH 3WIHH 4PJ9C 2P8LA 4MCYA 4NO5A 3MJ8B 3QDJD 4ZDHB 1YQVH 4GAGL 3PWNB 2XOTA 5DD3H 5F9WC 5D1QA 4MS8D 5ERWA 3RUGA 5IMMB 5GGTL 4M43L 4KGJA 3KYNA 1XGRA 4IMKC 4X6BB 4F8QA 1OARL 4OCYH 4Y4KC 3O9WD 1JYWA 2ZUQC 4ZYKB 4C57C 2PF6A 4UIKH 4DZBB 3BQUC 4HIEA 3FB7A 4OBSA 4N0UB 5JPMA 2NW3B 4P57B 2GIYA 5D2NC 5C0FB 1JYVA 5D9SA 1C1EH 1PKQA 4F7TB 5IW1A 4HK0B 2YSSA 5HHVL 2NNAB 5IEKA 1HOCA 3O6KL 1UEMA 4BK4A 1YEGH 2P49B 2ITDA 4KDTC 4JFOA 4AEEA 2ZCLL 4GJTB 2F53B 3B2VH 5JQHC 4NO0B 3QUKB 1MWAA 1J8KA 4OUUA 1MUJB 4JRYD 4LSRH 3V0VA 2ICWI 3ZKXC 3IDXL 1GHFH 4FABL 4U33A 5MEPA 1HSBB 3KHOA 3WHE0 5DRNB 6FABL 2HT4D 5EU6E 4EDWH 2HVJB 3S3JA 4G5ZH 5CP3H 3UC0H 4U7SA 3MRCA 5CBEB 3RI5F 1NLBL 2H26A 1T89A 1WFTA 4M6OL 1UYWL 2JELL 2I9LB 4H1LA 4F33A 4XH2A 2X70B 4N90E 2VXTL 2CLVA 4N8VA 3IVKA 1EHLH 4U1IA 5KSBE 5ITBL 3ARXA 4XMPH 5GISH 4Q6IA 1I8MA 3W81A 2Q3AA 2ADGB 5BO1L 3BGMB 4WFHD 4LHUG 3O3EB 2YD8A 4X5LA 4E0RB 4JHWL 4PGZA 1F58H 3GHEH 1H3UA 4KKAD 4JFHE 5DHVB 1NJ9A 2DIAA 4PGBA 5HHOB 3D87B 5GGRA 1FFOA 3QNXB 5EO1A 3SQBA 3IRZA 1MRCL 4G43B 3MBXH 1QSFB 3K4ZA 1T1WA 1DLFL 5CGMA 4XPHH 2A9MH 3C8KA 1MHHB 2ORBL 2GJ6D 1MH5B 1ZEAL 1OHQA 5SV4A 2H8PB 4I3SH 5L2KE 4TUJB 2NY4D 1FZKA 3K2MC 5E4EC 5I2IB 4JB9H 2OJEB 4RFNB 5DHXB 4JO4L 4JN1L 1FGNH 4OLZL 5HJ3A 3VXPB 1I85A 4FOMA 4HG4K 4OM1L 1A47A 2YUWA 2E7LA 3K80A 1QNZH 3TH2T 3VU2A 1UWEH 1RZ7H 3RY4A 1PG7L 1KJ3L 1JUFB 2QBWA 2R39A 2GYSA 2V9RA 3L3HA 3LHPL 5AAWA 2R4SL 1K2DA 1MCJA 5GS0H 1M1SA 5ESAA 5CJQH 4F7MB 4Z76A 1X5GA 2NXYC 5FA4B 2GEEA 3OKKB 4FQIL 4TPRL 1BOGA 1AJ7H 4NO3A 3LCYA 4TSAH 2PTTA 3LB6D 3UZQA 1S8DB 2ENSA 3S88L 5KW9L 4KTEH 1LO0H 2HKFH 3FB6A 5C0AD 4G6FB 3U6RA 4KPHL 5C2UB 5FUOL 3TO4D 3P73B 5ITFB 4KJQD 2IQ9L 2LTQB 5CBAB 4PLKC 2Z93B 3V6ZA 3PDGA 2IWGA 4UMGA 2DD8L 4JVPA 4XTRD 2D7MA 4AIZA 2C7UA 2R56L 2F5AL 2NX5B 3CFJA 4HWBH 4K7FB 3CSBA 1QFOA 3QUMB 4Y5VC 4K3DL 1BWWA 4DAGH 4EQ2A 3LQAH 1NGXA 3PP4L 3MA9H 4EDXA 1T83C 1EHAA 1TTGA 2B1AH 5DVMA 4ZS6D 1JNLL 4R2GC 3NABH 1RUQL 3BEWA 1SJVA 4ODVH 1AQKH 4R3SA 4XNUH 4X6CF 3KYMA 3NACH 5I6XC 4XNQB 3TBSB 2NY2C 1WZLA 3BKYL 4MMXC 5B39A 5DMKB 4IMLA 1UB5B 4PJ7A 2VDRH 3HE7C 2A83A 1ZGLM 4XMLL 4HLZG 1LNUA 3MV7B 1OB1B 1FAIH 4J7RA 1KCKA 4HH8A 4G7YH 3B9KD 4XVUD 1FC1A 3QCTH 3RY5A 3WUWA 2FO4B 5I30H 1BZQK 4E9LA 3K2UH 2A0LD 3P0VL 5IHLB 4JQVC 2HRLA 4ONHB 5AZ2H 3IB4A 4Z7QF 3PXHA 1KGCD 4YDKH 3BGFC 3DNKA 3VFRB 4I9WD 5HPOA 1FNSL 3C2SA 3PF2A 3ARGC 4U6VL 1BF2A 3LQZB 3VW3L 3GEWB 2WM0A 2ZWLT 4MWFA 5CJBA 4QOKB 4Z18A 4YGVB 5TE6L 2OYPA 5FYJD 5B4MC 4ODTL 2FJHB 3PHSA 2Z31C 3DV4B 4MD4B 1K9TA 1R24B 3W9DB 4FFYL 4WWKC 1TIUA 4CMMB 4YHPA 2E9JA 1CE1H 3OXRA 2IMNA 1BJMA 1QFWH 4WDIB 2HFFB 4QO1A 5CJOL 3I9GL 1MFDL 1S5HB 1JK8B 4LK4A 1ADQH 2YR3A 4G8GB 3MA7A 5GRZA 3HPJA 1N6QH 2FJFA 4OV5A 2IQAB 1Z2KA 3KVQA 3O6FB 4JRXA 5GS1C 2VLME 3CFCL 1O7SA 4HC1H 2VE6B 1FFNB 3BP4B 3MRNB 4PJ8A 3O4OC 1A1OA 4MDJB 1YPZA 2WBJA 2QSTA 3IXTA 5ICYA 4M1GH 3ZYOA 1WBXB 2DQUH 3LPGA 3S35L 3BDYH 5HYSA 5IWLA 3VGEA 4Y89A 3OKYA 4AL8H 1PG7X 4YFLI 4XX1G 2ZSWA 3P4LA 4XCCL 2YN3A 3CFDB 4PJGA 3ULUL 4M62L 1OGAE 1TQCB 1RURH 4ODSL 3N1GC 5T3ZE 1CD1A 3UJTH 5MP6L 4K8RH 3MV8A 4IRSD 3QXUA 4I5BB 2R2BA 4P59H 1V7MH 4OD3H 3MBEC 3MGTB 1ZLSL 2YD6A 2DTSA 1SY6H 3VD7A 3BWAA 4Y1AD 1YMMB 4X7TB 5CCKL 4KMTH 2J8UA 3MRDA 1WUNT 1KXQE 1W8NA 1CU4H 2R69H 3IKCA 2CQVA 1FIGL 3TT3L 4BFEA 1BFVH 3E6FB 2P24B 3GO1H 4XP9H 1I3RA 4YBLC 4M1CD 2HTLC 1U8OA 3LN5B 4P3WA 2BNQA 3U1SH 1C1EL 3CX5J 1AGEA 1A7QL 2JB5L 4OCSH 1KSRA 1F11A 4FQXC 5EU5A 3B9VA 1QSEE 3O3AA 3ZZ1A 1YNTB 3B8YA 4NQEB 2HT3D 5FYJL 3UTSA 1ACYH 1KCSH 3GBNL 2NTFA 3U36B 1IFHL 3ARFD 5F70A 3RGVC 2VC2H 4EN3A 1Y18A 1OM3L 2OLDA 4LCYB 3O3BA 1BIIA 1HHHB 4XPAL 5EN2A 43C9B 1CFVL 3GSRB 4YGAB 3WHXA 2F54E 4XP1L 4HIIA 4PR5A 2Q8BH 5IGXL 3GSVB 4LDLB 4X6DF 2Y4SA 4Q0XH 5FB8A 3OJMB 5I8OL 1FH5L 3MNWA 3TJHC 1BZ7B 3G5YA 1OP5K 4DVBA 4X6CE 1O7VA 2CKBB 5ILTL 1IMHC 4JFPA 4MA1C 1R3JA 1S7VB 4QHMA 5DDHA 4CW1B 2UWEB 4PJXF 1T2XA 4Q97A 1EHLL 5GISL 2A6KB 3Q6FA 1GGIH 4LCWD 2YN5A 1EVUA 5ELIA 1AI1L 3ARBD 2IANA 3MOBL 1IM9A 4GLRH 4U6XB 3FO9B 3MRJB 4FNLL 1LO5B 3RWFB 1G9MH 1KCUH 4HIHA 4P5MA 4OZHF 4NUGH 4WFGD 1VESA 3UTTE 2YD4A 2BC4B 1RHHB 1QUNA 3IU4H 4Z7QE 2XZZA 4YIQA 1HHJA 3MRPA 3EYVA 1G7QA 5CLTA 1AXSA 4R7DB 4QEGA 5ANME 1CGWA 1P9MC 5BRZB 5CZKA 5EC2A 4I3SL 3WMSA 3EOYG 3LN4A 4CN1A 5HHXH 3Q5OA 1PX4A 3J7HA 3GSOA 3PWVA 3I75B 4YHZL 1HKLH 3O6ML 4OD1H 5FXCH 3N1FC 2APVA 2ESVD 3DUUA 3LV3B 3WFCH 1KF9B 3QUYC 1R3IH 4KUCF 1R3HB 4ERSL 5JXED 1EK3A 3D39B 3MACH 2HFTA 3TBTA 2OTWA 3IU3B 4BH8A 4Z7WB 3QEGH 3MLPA 5TE7H 4DJMA 3RFZC 3I84A 5HGAB 3H9YA 1LGVA 4MQTB 4WY7H 3LH2L 1HDMB 3GDBA 4JG0H 4O2CA 1NC2D 1A7PH 4JM2D 4ZXBB 1CGSL 5JDSB 5CD3B 2QQLH 1QRNB 2IPUG 3HZKB 5CJQL 2QR0B 3KPOA 4JR9H 4D0DA 3FHQA 5D7IF 3K8KA 2CIIB 5JHDE 4GFTB 4RGNB 4KZEL 4MNGB 5HHMB 4UUJA 2Z4QB 1A6PA 5CEZD 4NQTA 3MXVH 3TBYA 4P4RA 3FFCA 3H3PL 4P5TC 2DKMA 4JFFD 5JW4R 1M7XA 4IRJB 2B5IC 3V6OE 1UGNA 4XCFH 3VWJC 1KPVB 5I8CB 1JWSA 3HMXA 4LLYB 5CMAA 2X2YA 3CSPA 5EZJA 1HEZA 2P8PB 2A1WH 4QRQA 4V1DD 5DMIH 1YECH 5D6CA 5DVOA 4PJDF 5BVJA 1ZHLA 3F62A 4LVNC 1DN0A 1OD9A 3U4BL 1H5BB 1OTUC 1X5FA 2XN9D 3DSFH 1BQHA 3WNLA 1H0DB 4H1LG 3LD8B 3PNWB 2BNUA 2X4RB 4N8VG 2I24N 3KPQB 1G7PA 3WV0A 1E4WL 4WFEE 5MENA 5E94B 5DFVC 4HWBL 1Q9OB 2VABB 4EZMA 3ARDA 1I1FA 3HC4L 4JDTL 1A7NH 1T5WB 3FFDA 3GMNB 5L0QC 2A6DB 1EFXD 2UVFA 4QTHA 3D5OF 4N68A 4YFEA 2NY2B 1T7WA 3VXSE 1X5ZA 1Z5LB 3PQYE 4QTIL 1XF2B 5JZ7D 4MA3B 4FRWA 4R0LB 1LP9B 1DE4A 1ZA3B 1CLCA 2AJ3B 3VXOB 3L3OA 4G42A 5FGBA 4U4BA 4X99B 4L9LB 1AQKL 4X98B 4MAYD 3NACL 5DGQA 4LCCC 1I8KB 1I7TB 5D93C 1C5BL 3SKJH 1KJ2A 1EA9C 3NZ8A 3KJ6L 2BP3A 2EXWD 1ZHNA 5E56A 5DLML 3DECA 3GJEB 1C16A 4QRPA 3PWPE 1QG3A 4JKPL 1LE5A 4MJIA 1A02N 3CX2A 4UT6L 3SDDA 1M71B 5LAXB 1RZKC 4JANA 4P4KB 1ZANL 3TFKD 2W07A 4QT5A 5ICXA 3T1FB 3FT2A 1TVBB 2VZSA 2CRYA 2DLIA 4OBRA 5AZ2L 4OCRH 1EEZA 2ZUVA 4KU1A 2Z91A 4X6DE 3EGSB 4K71C 3OPZH 1VPOH 1G7IB 4HS6B 1FVDB 4YXKH 5I1AA 3IJHA 5DJ2B 1W2KT 4ETQB 5IQ7H 4Y4FC 1IGMH 1RK0A 4TQEH 5AG9A 4PJXE 5GHWH 4E41E 5DEGA 1K6QL 5F7DB 4KRLB 5I75C 1GOHA 2NY0B 5GS1B 5KG9B 4J3VA 3OG4B 4Y19A 5DK2A 1CE1L 2I07A 5BOPA 1CICC 2PYEA 1UA6H 3UTZA 3SJVA 4CU7A 5D96C 2R2HA 1J1XL 3F65A 4Z6AT 5BMFH 3KLAA 3QR2A 5E8PA 5CJXA 5DJAB 4Y4HD 4U1MB 4OZHE 2YWZA 3SGJC 3TIDB 3A67L 1RUKH 1P7KB 4MDIB 1WWAX 3P9LA 4JFZH 3NN8B 3D3VE 3WFDL 3AAZB 4DKFL 4MLIA 2V5TA 5IIEB 4NC1E 1KCRH 2FECI 4N0FB 3BIBX 4M1GL 4U6HB 2MCG1 2GCYB 3O4LB 3R8QA 5HYJA 3BDYL 2QJDA 5DJDA 5L6YL 5F3BB 4UTBL 2F8VA 1PGRB 5AD0B 3MBEB 2I26N 3FT3B 4R96A 4XVJH 1CTNA 2X09A 4X6FA 4C4KO 5I1IH 5KSAC 1P1ZB 2MHAA 4OKVA 1DLHA 32C2B 3D85B 4RMTA 3Q3GB 4DEPB 5J57B 5H8DA 2ADFH 4EI6A 2DQTH 5F3HB 1ZLUH 1JF1B 1V7ML 4HV8B 4NQDD 1SEQH 1FNFA 3VD3A 1EZVY 3DURB 3E2HB 4HMEA 4YDJB 1NFIA 4TULL 5E2WL 3DOSA 1LK2B 4KMTL 3PGFL 3MJ9L 3UJIH 5FF6A 2UYLA 3F58L 1W72L 3RWDB 3MLYH 2F8XC 5CFHA 5D7IE 5DJ6B 1DEEA 3GO1L 4XP9L 2GY7B 1T21B 1B0GA 3H9SD 3TZVA 2GSIA 5D7LB 1QFHA 5F7MC 2X4PA 3F6LA 2H2SD 1ZT4B 1U8IB 1X7QB 2DM7A 3U1SL 3O2VH 2APTA 3QIUD 5F6HJ 4ORZC 3EOBA 2FX7H 2CXGA 3PGDB 4I2XA 4RSVA 4ZAKB 4POZD 5CEXA 4LLDB 5AWNH 1LILA 4J3OC 3H3BC 4PJDE 3D2UB 3VE0A 4APQC 1FGVH 2F15A 5F7EH 4ALAL 1XCQB 4H1LH 1KN4L 4FQ1L 5TQ0H 5I8EA 5HVHC 3KXFA 3DXAA 3K3QA 3QFJE 5JOPE 4XC3L 2IAMD 3QISA 3UTQA 2OR9H 1FSKB 3AY4A 4ACPA 2J2ZA 4LLQB 3PWJB 3VRJB 4KVNH 1H15A 4PJFB 1GIGH 4HUUB 1CR9H 4WO4A 2BVPA 4WI8A 1DUZB 2HT2C 1A3RL 3RWGA 4LLUB 2OSLB 2CRZA 2AXFB 1FZOA 2O5XH 5HPMA 3U4EA 2EYTA 5DRWA 3AS1A 4UU9A 2E5EA 2DQIL 3LKSB 5HYEA 3RDTA 2FBJH 1J1OH 4J8RA 3P4NA 4Z0BH 4UV7H 4YC2C 5ID0A 1YEJL 3DV6B 5DUBA 3X11B 2IGFL 5D1XA 5IESH 5D1ZA 3T4YB 3BZEB 5CJ8A 4MCZA 4NUGL 4EIGB 1S7TB 2Z8SA 4Z7UF 4PJ5D 2OP4L 3O2DA 1XR8A 2OL3A 4MNQD 1LEGA 2BSED 5AUMA 3C60D 1T1ZB 1CT8B 3C5ZC 3DO7B 3MLTA 5EIVA 3WFBH 1I1CA 2WNGA 4PRIA 2YPKB 5M94B 2YUXA 1L7TH 3JV4B 4DN3L 3QWRA 4Z7VF 4I3RL 5I73C 4Z78B 1CD8A 2VLLB 4YFLF 3QZWA 5I71B 1S9XB 5EU4A 5JXAH 4XAKE 5H2BB 1TZIA 2X7LB 1T0PB 3JTTB 3JVGC 4XWGL 1CYGA 2HLAA 4M4PA 5D71L 3W2DH 3MODH 1R3IL 1EGJH 2FIKB 4KJWC 5IJKA 1CE6B 1QQDB 3IJSA 1MCLA 5EU6B 2XQBL 3QDJE 1Q94B 2YA2A 1J0ZA 3PHQB 4S1DC 3SKOB 5FYKD 1F3JB 3O8XD 4OFDA 1NMAH 5I1GH 5MHSD 4K23L 3OAYH 5HVFB 3HUJA 4NJ9H 3HPLA 1YEHH 2VKXA 3P0GB 4RAVB 4QRRB 1TCRB 4JFDD 2BZDA 4NZTL 1KELH 1MJ7L 1IBGL 5JO5B 1LE9B 3ZE0F 1JNHA 4ODUB 4JVWA 4WU5A 2J3SA 4Y2DC 1R3LB 4OF6A 3LKNA 3MO1A 3C09B 4XP5L 4LVNB 2C3XA 1AGCA 5IJVB 3PV7A 2QLVB 4YBHA 2XQYK 5L2JB 2H9GA 1F5WA 1RUML 1S7SB 1WF5A 4HUWA 4L3CB 4OD2A 3NIGF 1YECL 1NLDH 3TBWB 2KPNA 4WU7A 3G04A 2P44B 1HHKA 3DSFL 2VLRA 4JRYE 4PBWD 3L3KB 4FFVC 5LGJA 3PJSA 4ZS7H 4NCDA 5DUML 5C09D 2Q7NA 3G5XA 1OP3K 4ZUTB 1UG9A 3VGAC 4OLUL 1JHKH 5D70H 1RV6X 3QI9A 3LIZH 3Q5YA 5L2KB 3ZSTA 1XCTA 1AQDB 3DUSA 4UOW1 2EH8L 4D2NA 1U3JA 5KBNC 3OJVC 3HE6D 1KLFA 4X8JA 3RWIA 2XICA 1BVKB 4CVXB 1XGPA 2X6MA 4TNWF 5I1CH 2ZOLB 1NEZB 1N0XL 2D4DA 3I85A 4Z77A 1MJUL 2LU3A 3X17A 1FVEB 1RJLB 4HMDA 3GIZH 1A7RL 2PO6B 2EYSB 3FQXB 1M05B 4YDIH 1IC7H 2JB6B 1MPAL 4WFHE 3TN0A 3HNTL 1S7UA 4M02A 5CINL 1NGWA 4AEIL 3OKNB 1GGCH 1AD9B 3BZFB 1KB5B 4HIJB 3AS0A 4O2FB 5I9QB 4OIIH 4LLMB 2LE9A 3KWWB 5IHZA 2EZ0C 3FRUA 2B0SH 1LO3L 1K5NA 3V4PL 1DCLA 1F6AA 5FYKL 2WUBL 2VLKA 4LVEA 5IV2A 1T1XB 2VZ1A 4P2RA 5J6GB 3CFKB 3SGDH 1CG9A 2LV4A 5KJRH 2GJ6E 4OGZA 1AHWC 4PS4H 1JGEB 5GSVB 2DMBA 4F15C 3IGAB 5IQ7L 5D7JC 4JFQB 1DANT 4K3EH 3RRQA 4BZ1L 1MCNA 2D4FA 3BD3A 3MROA 3DX8B 1OP9A 1T2QL 3FJTA