1YMHB

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 39
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB02
4CGTA 3MLTB 3IGAB 4J4PC 4YHMH 2Q86B 4YAQA 3SGKC 1QVOB 3S8WA 3ARGD 3VFMA 1IQDA 2DLGA 2J88L 3CH1B 5F89A 1CR9H 1KTDB 4WHTB 5JIIA 4AEHL 3CCHA 1HILA 2DBLL 4WI2A 4Z76A 1P5UA 2VL5A 4G8GD 4U2ZA 2PO6B 4MX7B 2BHZA 1QA9A 2PO6C 3P30L 3U7WH 2YSSB 2EC8A 3TNMA 4Q2ZA 1F58H 4UB0H 2X70A 3V0WH 3QDAA 4QHUB 2R0KL 1FLRL 4Y4FA 5J3HD 4XWOC 1CLCA 1S3KL 1MCOL 1U8MA 2R1XB 3B5TA 5BZWB 3ESUF 1WZKA 4FQXC 1JWMA 3RI5K 4LHUG 1MLCA 1JGLL 2IAMD 3UMTA 3OB0K 2X4NA 3FHQA 5ICYA 1SY6A 2OTPA 2EKSA 5E2WL 3MV9D 1Z6JT 5D7LB 1CDJA 4LCCB 4WWKA 3FT3A 4LSVL 3LKPA 3FRUB 4U6VL 5HI5D 6CGTA 1JTPA 4X0KB 3OKLB 1LK2A 2OM5A 4OT1L 4HC1A 4XTRC 3KNBB 4O9HL 3T3PF 1P7KA 3LRHA 2DMBA 3NCFB 4F15C 3ZDZE 1P2CB 4ALAL 2GJZB 3H9SB 4WTXA 3E6FB 3TO4A 3T2NL 3BD3A 4QYOB 1MCKA 4PJ8B 5DD6A 3SN6N 3P4MB 4UQ2A 5IB3B 5I1GL 4PJ8C 4ZO6A 3FRPG 4YQXL 1FO0H 4G6JL 4MJ5B 5GRYA 2V17H 3HLAA 3HZVB 2P24A 4X7TA 4ZTOH 1SMAA 5D1QB 3KPOB 3S9DB 2P8MB 1WEJH 4BM7A 5FKAB 1TENA 5D1QC 4E41E 5DC9B 2W0FB 3MRPA 3KYOB 2K3TA 5EZOL 3PQYE 4M93B 4W4OA 1HINL 5IKCB 2PXYA 3F7YB 2GI7A 1VFOA 1HCFX 4YBQC 2YA2A 4RISL 3GMRA 3NA4A 1VFUA 4P57A 3A6BH 1RFDH 3JV6B 3CZFA 4PGEB 1YNKH 4Z95L 1ZOXA 5SX4I 5EZLB 1KTKE 5M94B 3FONB 3PXJA 2V7NB 3C5ZC 5MHSD 5FGBC 1E4XL 2IEPA 1CIUA 5C0NC 1J05A 2JCCA 3B2VH 1OT2A 3BEVB 4UOW0 1YY8A 3V4UH 2WUCH 3FOMB 1LEGB 1MCFA 4U3XA 1T1XA 4U1JA 4MQXD 1ZLSH 4L8BB 5HGHB 4WFHD 4M5ZH 3SDDA 3A6CL 4CUCA 5F9AC 3QXAB 1IM9A 3LIZL 1HHGB 5IQ7L 1ZGLP 1GIGH 2GITA 3OXRB 1KELH 4RDQG 5FM8A 3CDCA 2MSPA 2FR4B 3GBNH 3RBGA 2XZCH 2ZWLT 4KROB 5FA3B 2C4FU 1QFUH 3VMOA 4KROC 2VMFA 4LHUD 4WFGD 1JGEB 1FE8L 4KKAD 5SV4A 3MBEC 4Y4KD 1V3JA 1H8SA 4PP2A 1KB5L 3U6RA 1QKZL 4JY4A 3O9WA 5EDXA 1ZLWK 4X80H 1BX2B 3QNXB 2GJ6E 2Y06L 4EKXA 4WNQB 2C4XA 5FDWB 3TJEL 1DBML 3DRTB 1B9ZA 5F1KC 4P5TA 4P9HH 2D4DA 2HT3D 4L3CB 4M6OL 3KPSB 3P77A 1HSAB 5JW3H 3F12A 2Z0BA 2YD9A 1FDLH 1FFQA 5ICXB 3BKYH 1S7SB 2RCSL 3WUZA 5IEHA 2YKLH 5HI3D 1MJ8H 3DXAA 5CGTA 1IZKA 1NUNB 1JNLH 4ZS6D 4NJAH 5I1JH 1CGTA 1R3HB 5KSBA 1NMAL 4GW4B 5D71L 3WXWL 4ONFL 3N1FC 4QRRE 4EVNB 1RV6X 1D5BA 4RA3A 3BN9D 3RWCA 4OFYD 4NUJA 2ZPKH 3QQ9D 3GIZL 2DRUA 4ZMAT 5CEXB 5I30L 2CLVB 2H26B 4MSWB 3LPGA 1ZT1A 1X44A 1Y6MR 4XP5H 3TBVB 4JPIB 1CICA 3FO1B 5JW4Q 5C0CE 2B4CC 1ZAGA 3TVMB 2DKSA 3LN4B 1C16A 4P3CL 4LSRL 4FFZH 4K7PH 2XKSA 3RKDC 3TH3T 4OM1L 7CGTA 4OZ4B 4M7KL 1OARH 5FYKL 5DQJA 4G6FD 2GAZA 2VDOL 4YDJA 1IKNA 4KMQA 2EDDA 4J3OC 2P42B 2GKIA 4AIZB 3RIAK 2DWEA 3PDDA 3VH8B 2OK0H 5IEKB 5ITFA 5LBSL 5TDOA 4HG4K 3T0EA 2ZSVB 2NW3B 1CT8B 3AAZA 4PJ7E 5DRWB 2W9EL 1MCCA 5HHNA 4Y1AA 1FBIH 4PJHE 2IPTL 3L3OA 4K71C 1FNGA 1NC2A 1FVDA 1OPGL 5L7XH 1T83A 2APTA 3UC0L 5F7UA 1WCBA 4BSWB 4S10A 3HZYA 1I1YA 5T1LA 2YHGA 5IBTL 4H25A 5IK3A 3CZJA 1ZHNB 3VWKD 4Z78B 4YH6A 3GRWH 3I84A 4HCRL 5IR1B 1FC2D 1CGSH 4PGJA 2DDQL 2Y9RT 2H8PB 5EA0L 4GG6B 3LRSA 3SO3B 3PF2A 2KZWA 4OGYL 4YUEH 2EYSB 1UM4H 3LEYL 2H41A 3SO3C 4GMTL 3O11B 1NEUA 2IAND 1ED3B 3G6JE 3MO1B 4L1HA 4XMLH 3TIDA 2ADIB 3HR5B 1ZLVH 4RMVA 5IWLA 3S35L 1ZHBB 5F44A 1ITBB 1JWUA 3WFEH 1J1XH 2JE8A 1IAII 2A1WH 3OR7B 2O61A 5I0ZA 3TIEA 3WIHH 4GKOA 3KPQA 3O6MH 2WMPA 3DYPA 3PJSB 4NQCE 5BS0B 1DLFL 3D69B 3O4OB 4HWBA 5C6WH 2A9MH 4YHYB 4ETQB 3WNNA 2EH7L 3O4OC 4YDKL 3IFLH 4YHYC 3DUUA 3UBXB 5A3IC 3DROA 4TTGA 1WCQA 4KDVA 1A47A 3MJ7A 3UZVB 3E3QE 2P5WD 3ZDXE 4KAQL 1OCWH 5C9KA 4UBDC 3FFCB 4PY7A 1VACB 3MV7A 4FQPA 3RVUC 2YZ1A 4R3SA 1P53A 3NAAH 1QOKA 3PWLA 4NRYA 3VA6A 4LKXA 4OLYH 3ARTA 3DX8A 1J8HA 4UTBH 4FNLH 3KAAA 5EOQH 1L7TL 4LNRA 4GW1A 3RWJB 3PWJA 4OLWH 2OX5A 4L8CB 5C2BL 3KWWB 3O0RL 3RU8H 3T2QA 1XCQA 3TBYA 1KENH 5BMFL 2GCYB 2Q8AH 3PV7A 4Y7MA 4HT1H 3MRDA 5I1EL 2ICEA 1X5GA 5F7YC 1KCKA 3AY4A 1YECH 2YD8A 4GXUN 4QTHB 3QO1B 1JIBA 1A7QL 3P11H 1C8PA 4KKBC 1FNAA 5EBLA 3K8LA 2VQTA 4Y5YB 2XOTA 2E7HA 1MLBB 1T0NA 4HPYH 4PUBL 4CVXA 4MNGA 1XGTB 5JHDB 4Y5YC 1FH5L 3VD5A 1C5DA 1OAZL 4HZLA 1JZ3A 2OBGA 2VNCA 2XZAL 3CK0L 3NZ8B 1CE6A 3BVNB 4Y2DB 4UV7L 4IOFC 3EO1A 3W5MA 4B5EA 4UMGA 4DN4H 2VDML 4ONGL 5DD1L 3V95A 4Y2DC 4MAUL 4Z9KB 1L4IA 4RFEA 1KYOK 1UCBL 2UYLA 2CK2A 3ZL4H 2PUQT 3D85D 4ENEC 5CEYB 3L5HA 3W5NA 4ETYA 1FNSL 1S7RB 4JFDE 4HKJB 1YEIL 3B5GA 4M5YL 1GOFA 1EEZA 1MFBH 2EDQA 5E2TH 1UYWH 2JB5L 2XFXA 5FCSH 5D6DA 1FJ1A 2JIXB 5KG9A 4PTUB 2AV7A 2AJYL 2OR8A 4WU7A 3T0XA 1F6AA 1DBJL 3WFBL 1K85A 3O2WH 1OGAE 3BP5B 4GQPH 1G6RL 4KZEH 1IGML 4LLWA 3AROA 2IG2L 3BRGC 1IC7L 3D48R 3BPLB 5B21A 5EUKA 3VGDA 5IFAH 4F37K 2DN7A 3NGBB 3HB3C 1BM3L 1CGWA 3KDMB 5GGVL 4MWFA 2LABA 35C8L 4XCEB 2I27N 2N4IA 3NGBC 4FQLL 5JTWA 2QQLH 3N0PB 3QISA 3FCTA 3NCCB 3WEXA 1I1CA 4POZD 2MNUA 4NKDA 2VLKD 5D7IA 5IT2L 4O00A 1LEKA 4PGCB 2VLJA 3O41B 2YA1A 3QNYB 4A6YA 2VZ3A 4JQIL 4XMPH 4EN3B 1E28B 5KN5B 4LSSL 2DQIH 2G5BB 3G5ZA 5E9DD 5EZJB 3HUJA 4EN3C 2WV3A 3MA9L 3O6LL 4UIKL 1AJ7L 1RUAL 1W0VB 3OKOB 4WWID 2V5SA 1D7FA 4WEBH 1CF8L 4S1SH 1IM3A 4FFVD 5GSRA 4ISVA 3JVGC 3DIFA 1NANH 3N1QC 4PRPA 2EH8L 5ENWA 4HIHB 1KPVA 4M1GL 3QCUH 2LTQB 3HFML 3T3PE 1NAKH 4KUCD 3V7AG 3X3FL 3I6GB 2EXYD 2LTQC 3N85L 4U6YA 3KPNA 3MGOA 1YEDA 5CD3A 5ERWA 3QXDB 5BO1L 3WKML 2V2WB 2Z92B 3BJ91 3DSFH 4OZFG 1A7NL 3SE8H 1JZ2A 5KTEL 2WBJB 2F5BH 2EDYA 2JK5B 3OB0H 7FABH 2Z35A 1W8OA 2HN7B 2HMID 2AQ2A 4X6CA 3WS6A 4RIRA 3LS5H 2QJDA 4ONOA 1RURL 3DPBA 2A0LC 1B4JH 5B39B 1C5BH 5IJVA 2E7LC 3DV6B 1GOGA 1MREH 1PJ9A 4KJYA 3SGJA 3SGDH 5DHVB 1CFNA 1QEWB 3FO0H 4EJ1C 3AS0A 1KUMA 1UH4A 4J12A 3KYMB 4OBRA 2Y07H 4P46D 2FSEA 3J8F7 3SQOL 1RU9H 4GMSL 1A9EB 3K8MA 4N5ED 1SJVA 1CD1B 5J9PA 3SHSA 5FYLD 4QRPB 5DVMA 1ETZA 4JRYB 5E1AA 1TJIL 3DWTA 5A2FA 5IVXA 3HZMA 5F6IB 4YPGA 3B43A 5DJXB 2F54A 3H0TA 3PXHA 4U1HB 5JW5B 5T3XH 1JNHB 3BPNB 5DUPH 4PB0L 1FYTA 4HUUA 4PLNC 1R3KB 1OQXA 1MNUH 3LOWA 3BPNC 4MJIE 4ODUB 3GBMH 4TUKL 1MCPH 4L4VA 4NUGH 2AP2A 3D3VB 2WBKA 3ECBB 2ATPA 2PTTA 4V1DE 3S6CA 3LQAC 4GKZB 4QEGA 2APFA 4LSUH 1K4CA 1KB9J 4X5XB 1NLBH 3RTQD 3BT2L 1B0RA 3I02A 5K9KA 2Y23A 1UA6H 4FG6C 1OP9A 2X4QA 5EG6C 2W65A 1DN2A 5IQ9A 5I76B 1Z5LA 1O0VA 4OJFL 1Q8MA 4PJEA 4CJ0A 5HGBB 4LRNH 4FMKA 5AWNL 1F4XH 1QR1A 3NZHL 4LKCA 1NUGA 3MR9A 2BNQD 1K8DB 2VIRB 4LNVA 2J8UB 5IB4A 4EI5D 4N8CH 2X4UB 4XMKH 3D39A 4ZUTB 2XZQL 3PV6B 4X98A 1A3LL 3IFPB 1E27B 1F3RB 2NX5E 1P6AB 1UH2A 3H9HB 5IBUG 3EO9H 4G9FB 1CXIA 3Q0HA 3P4NB 5I8EB 1JYWA 3QJFB 3B8YA 1JV5A 1OTUC 1RULL 2BVYA 4OZHE 3S7GA 4JRXB 3QIUD 4QT5A 1PGRB 5T1KD 4C56E 2H6PB 2ADJA 2R2HB 1ZGLA 4KK9C 4PTTA 5IW1A 1G1YA 1N2RA 4XAKD 4K3DH 5DJZA 4X5WB 2MKWA 2DTMH 1CG9A 1YMHA 2NYYC 4LPTA 1BREA 3NIDE 4YHLH 5ANMB 4BFEA 3DO3A 1NFDA 1NBQA 2HFFB 1KLFA 4I0PA 1HI6B 2V6HA 1OAKL 3L7FA 4MMXC 4AZ8A 4EDXA 3BGMA 2GK0B 4MS8D 4KMTL 4FXGB 1OAYL 5BOZG 2IGFH 5FCUH 5FGRA 1JMXA 4PGBB 5JQHC 2WQ8A 2H2PD 3TNNA 4U1NA 4Z0BH 3HAEA 3ULUH 4Z77A 3BYYA 4UUJA 5D1XA 4RGMB 4XPAH 4D9RE 4QTIL 4X6BA 5DGQA 3JV4B 5TH2B 4RGMC 3RL1B 4H26B 1NEZB 2XKUA 5IVZB 3I75A 1SEQL 5ADPH 4TULL 1T5WA 2PYEB 1PEWA 5I8OL 2BP3A 1IEBA 2VAJA 3P0YL 3L9RA 2W38A 1GGCL 3SQBA 1H3XA 4YHNA 3KR3H 1JMZA 3QDJA 5EOCH 4QHLA 1FFNB 4CL7A 1VPOL 1DCLA 5E0QA 1TPXB 1E4JA 2VSDA 2HFTA 3BOVA 5HGDA 5BRZA 2J3SA 3HRZA 3SDYH 1TPXC 2YUVA 3PHOB 3C5SB 5E6YA 1YQVL 2OL3L 2VXQH 5TF1L 3U82B 3VXME 2ZJSH 5EWIL 4PJFE 4WW2F 4MNHA 1RZKH 4NWTH 1NC4A 2NTSP 4Q97A 5DC0A 3UTOA 1NBYB 3DGGB 2FYYA 1NGZB 1HCVA 2R15A 4TOYH 5DK0B 5TDNB 1MCJA 2APXA 3P9LB 4F57H 5HGAB 1BOYA 2P1YA 3NCMA 3EUUA 1EEYA 1WZLA 4JVPA 4ZAKB 3MZTA 1ZS8A 4C58B 3LSOB 5MENA 5FF6B 2E9JA 5DQDL 5GS0H 2X10A 5C07B 2V5RA 3DMMD 4XPBL 1ZHKA 2IJ0C 4XNYH 4WUUD 5D2LB 2LAAA 3RVXD 3TFKC 3CJJA 3OV6A 3G04A 1S5HB 3HZKB 4NQDA 1E6OH 3TPKA 4Y19D 3ARGB 4NQVA 4Q9CA 2XN9E 3FQWB 4O2EB 3DHMA 4KGLA 3ARGC 3Q5TA 1DQQB 4OLZH 5SWZE 4P4RB 4BJLA 5DUMH 3SE3A 4ZNEA 4WV1A 2WIMA 2VZVA 2EXWD 4G8GB 3NCJH 3THMH 1JPST 4QXUH 5HVGB 2C3XA 3NIFF 3IYLW 3DRQB 4GAGH 3MCKB 4AG4H 5HPOA 3GB7B 4TNVF 4WI7A 3DARA 1M6OB 3WJJA 1A5FH 5DTFB 3IRPX 2FH8A 4LDEB 4XP9H 1MIEH 1Y0LA 1SBSH 2VLRE 1OTTD 5E8DL 1NGWA 5J3HC 3U79A 1AKJD 3NA9H 1R5VB 4R90H 5EUOA 4LF3B 2F58H 2VAAA 3LQAL 2AJXL 1FRGL 2IAMB 5GZND 5HJ3B 1LE5A 5JPNA 3MREB 4D0DB 4IRSD 2IAMC 3MV9B 4HF5H 3U0PA 1BFVH 3F6IA 1U8QB 4DWHA 4JAMB 5L8LB 3H7LA 2A73B 1JZ6A 3U30B 3NTCL 3W39B 5CIPA 4ZDHB 1OQOA 3UTQB 4HLJA 1DBBL 1CTNA 3QI9D 4JY6B 5L0QB 1KIPB 4IMKA 3MROB 5L0QC 2KDGA 4OM0H 2MWCA 1S9XA 2RFXA 1QBLH 12E8H 4OZGA 4NM4H 4X7DC 32C2A 1IC4H 4MHHI 4K94L 3QUKB 5MEPB 4R9HA 1LE9A 5A2LH 1PAMA 3KLSA 4U1GB 4PJAF 4RBPK 1MEXL 1T04B 4U1GC 4BSVA 1U8HB 3JUYA 3I6KB 5C08A 2PCPA 1AQDB 4XCYA 5C0RH 1HOCA 1TJGL 4BUGA 2FDBP 2FD6H 3GSRB 3PDOA 1BJ8A 3B2UC 1IAMA 3B6SB 1ZKAA 1RK1B 4LLDB 1RZJL 4Z7OF 5GSVB 1YN7A 5T3XE 4RQQA 1LEIA 2X89D 1GGTA 3IDMA 5FGCB 3V6OE 3MUHL 1VCAA 2AJ3B 2EDWA 1D5IH 4G9DB 3AM8A 5GS3A 4XH2B 4R0LA 4Q9QH 4MQXC 3QCTL 4R4ND 2PW2B 1F4YH 4G7VL 4PRNA 1HHJB 4I18C 1MCWW 1QPXA 4UT7L 3GHBH 3TZVC 1KCRL 2GY7B 1I7RB 2E5EA 4GUPA 4UOW1 1U3HA 1BGXH 3BSZL 4LHUB 3MACL 1UM6H 1MWAB 4Y4KB 1TZGL 4PRHE 2AKRA 3LH2L 3QAZC 3QJHA 4PB9L 1OB1B 1DQDH 5E99H 2IFFL 1NFIB 1C5CL 3MLUH 4MD4B 4FQQB 5GZOD 3C87A 4JO3L 1A6AB 5I1AA 3X13B 1G7HB 5HDQH 4LPWA 2AK4E 2YEZB 4YX2L 4E41D 2R69L 4OLVH 1NCWL 2DI7A 3PQYD 1P7QD 1NCBH 4PBWD 3QZWB 2O5YL 4TNWK 1P4IL 3MFGB 3PWPA 1NH6A 2CDGA 5HI3C 4KQ4L 1QSFA 5J4MA 5KVDL 5EIQA 4F2MB 3NACH 5JZ7D 3U36A 3VI4F 5CCKL 1QG3A 2DM7A 3BIAX 2MFNA 3BN9C 4X4XA 1GGUA 1BOGB 5JO5B 1MCLA 1K2DA 5JQ6H 2VLLB 5J1AA 4JO4H 4BA8A 5DURD 1N4XH 2E9BA 4LQFH 1D9KA 1IGFH 2QQQA 3G6AB 1UKSA 4PRIA 4I9WE 2YPLA 1AE6L 5F96H 2R23A 2WBWB 2HJLB 3RWHA 5C1MB 3OAZH 4YXKL 5HHOE 3RNQA 2Q87A 2QQKL 3MRGB 1GL4B 1CLZH 4B50A 5DJCB 4LK4A 1DEEA 1TXKA 3ULUE 4GLRI 4HUVB 2DQGH 5E2VL 4R8WL 2B1HH 4I2XA 5F8QC 4NZUH 4RAUB 1WIPA 4X9FA 4JEGB 4ODTL 1UCTA 3VXUA 1KXVC 3K7UA 4YHIB 5IBLD 4NSKA 4OV5B 2GJ6D 3BZEA 4MQTB 5IG7A 1N5YL 5ESQA 1AGBB 1SEBA 2C7UA 3BZFB 5EN2B 3IAGC 5F7MC 1QFWI 5KVMC 1K8IA 4JFZH 1ZHLB 2I07A 4H5SA 3RWDB 4ZFGL 3N1PC 4WU5A 5CD5D 3UROR 1U58A 5AAWA 3PL6C 3MMEB 4ZYKB 3EFDH 1LHZA 4FQHA 1IGJB 1XR9B 5T1DH 3SE4C 3VWKB 1RUMH 4NYLB 4LCYB 3MNZB 5KAQF 1G7QA 3MRFA 2DLFH 3KPLA 3VWKC 4Y16C 1EAPB 4XVTL 1BD2E 4RWYL 1CL7L 5GJSL 4QRRD 2X1XR 3LN5A 4XNXL 5J6HA 1C7SA 2IANB 4AM0A 1MFCH 5DT1L 2Q6WB 4C4KT 2VXVH 1HK6A 3Q3GB 5F7DB 2YK1H 1XF5A 3DO7B 5F3BB 1BFOB 1FSKC 5TQ2H 4KK8D 3CVHL 1LO0L 4GRWE 1KJ2B 2VE6A 2ZOKB 5E5RB 2OP4L 1R3LB 4WW1A 4JHWH 3VI3F 2WINB 1RZIB 3C08L 2LVEA 4LPVA 3T04D 1KG0B 5D7JD 4I5BB 4Y8AA 4XNQB 3GJFH 5IHZA 1JUFB 2P5WB 5SX5K 4PFEA 3P4LA 4HH8A 4S1RH 5I8CB 1A21A 1TCRA 4F7EB 1WT5C 1FPTL 4NQXB 4CADA 2PNDA 1RJLA 43CAB 4KJQD 1CLOH 4XPGH 1UKQA 5EIVA 5TDPA 1RY7B 1MJ7L 2AJVH 4F58L 5EOTB 1WTLA 1E4KA 4OSUH 1QLRA 3ARUA 3NFPB 4CNIA 2V5YA 4P2RA 3M8OH 2VZUA 2Z4QB 1N8ZA 1JRHI 1MFAH 5CLWA 2VWEC 4G5ZL 2YC1A 1AD0A 3MRJB 2OTWB 1GZPA 3CU7A 5E00A 1ES0A 1C1EH 3QUMH 1F2XK 5KOMC 5GHWL 3GSUA 3WJLC 5H35A 4H1LH 2O93L 4RA0C 2HKHH 2A77L 3MTRA 2OZ4H 3SCMC 3L5WA 2VR4A 3PWNB 5D6CA 3FQTA 43C9A 5HYSA 5E6IA 3OX8B 3G5VB 2R1WB 1X6NA 4KV5E 2CKBA 4DJMA 3PABB 1KLGA 2ICCA 1IL1B 5B38A 3L3JA 1KB5A 4NQCD 4OZIB 5C6PB 3QUYD 4R97C 3P40A 1RJYB 4OCWL 2VC2L 1SJEA 3FB8A 3GBLA 2HAZA 4DN3L 2MKLC 2JTDA 2YUZA 2MHAA 5FFLA 3NFSL 3D85B 1OD7A 4Z7VF 4QXTA 3ALXA 1A6TA 4JLRB 4F7PB 3VXOB 3JWDC 1WQVT 5T3ZH 2UVEA 2F53A 1JPGA 3QDMB 5TE4L 3PGFH 4MJ6B 4XVUC 3CDGA 1TIUA 2VDLL 3QDHA 3DGCR 4PYHA 2FGZA 5A16A 3BYTA 4KJPC 4TVPL 3PIQA 5KS9F 2XT1B 3BIKA 2PYFB 4UDUB 5B8CB 4PJIF 4KVNL 1M4KA 4RZCB 5C0BE 5B8CC 3Q2CA 4K8RH 3IDIB 3OL2A 5DK2B 1C08A 2YBRA 4QRTB 4R7DA 2R29H 5KSVB 4J4PA 3F6LA 1I7UA 3BH8A 3MLTA 3IGAA 1BVKB 3T0EE 2Q86A 4M61B 4M1DL 3C8HA 3NIFE 1BQLL 3CH1A 5T33H 3FMGL 1XGUB 2VLKB 2AVGA 1KTDA 4WHTA 3GMMB 3OJDA 1OSZB 3F5WB 3IS1X 2DI8A 2ARWA 5IB2B 1ZWIB 2D3VA 1GHFH 2KH2B 3OBAA 4QRQB 1AP2A 3CVIH 5E9DB 2PO6A 2QSQA 1NAML 1UWEH 2VKWA 2QQNH 4MX7A 4XC1L 2YSSA 1IKFL 1ZANL 2YWYA 4Y0GA 5DMKB 5ADOL 4RFNB 3BHBB 3DX6A 1XGYH 2MCPL 1N59B 4E5XB 5L2KE 3PNWB 4ZS7L 2R1XA 3GIVB 2J6EL 2XTJC 1NSNH 2X1OA 4FFVC 1Q1JL 4XBEL 2A83B 3HE7D 4XVJH 3IDYB 4Q9RH 4JG1H 2EXYC 1IGIL 1WK0A 4JFDD 3BRFA 4I77H 3QULB 5AUMB 5D7LA 3IDYC 4LCCA 5HY9B 3TT1H 3FRUA 3BO8B 4JDVB 4QLRA 3V4PH 5KSAD 4X0KA 5FO9B 4AIOA 2KZ1B 1R3IL 3KNBA 3D0VA 5F7FA 1ZGLM 1YEFH 1KXTB 1P2CA 3H9SA 5I15H 3E6FA 4QYOA 1T2JA 4PJ8A 3S4SA 4O2CB 1OGAD 3P4MA 1J11A 1W72B 2J8UF 3IXAB 4PJAE 4YHOH 4IDLA 2HMIC 1BEYH 4UZGA 1HIMH 1JGUH 4TPRL 4X7SL 1P1ZB 3OKMB 4MJ5A 3BGFB 4IRJC 3ARFD 2G5RA 3HZVA 2JJVA 2O5XH 4BQ9A 4UAOB 3BGFC 3LD8B 5D1QA 3KPOA 3ZHLA 2P8MA 1NMBH 1RZFH 3KS0H 4G7YH 5J1SC 5FKAA 5FV2A 4M62L 3LD8C 1MFEL 1DQLH 2W0FA 3KYOA 5D4QA 5E5MB 3C60D 1LQSR 5IKCA 1JHKH 3F7YA 4A2LA 1JI1A 3UJJH 4Z7OE 5D5MF 3SKUD 2GJJA 2Y5TB 3JV6A 1A6PA 1U8NB 4GFTB 5CBEB 4PGEA 5DZLA 3C5ZA 1UWXH 2CRYA 1QP1A 3WL9B 2CO6B 1JFQH 3FONA 1XGQA 3OB8A 1ZEAH 2V7NA 1JF5A 2AK1L 3NH7H 5ITBH 4MAYD 2QSCH 3BEVA 1X5FA 3F65A 4EUPH 3FOMA 2EE9A 2CMRL 3BKML 1X5LA 2W59A 5HDBF 4L8BA 4QHMB 5HGHA 1BQHB 4MNGE 5DA0B 4OV6F 4NFCA 3QXAA 1I9IH 3LB6D 4HKBB 1HHGA 3CFKB 3QG6B 5D7KE 4FQ1L 1KCVL 2FR4A 1WFOA 5FA3A 4CRPA 4Z8FL 3FN3A 3KPMB 4FOMA 4KK5D 4LU5H 5GGRB 2VDRL 4XHQA 3HHRB 1AFVL 2BNQB 2DQUH 3UTPE 2KPNA 4ZPVB 4AQOA 5D7SL 3MOBL 4EI5B 4DKFH 1QTYT 1YYLL 3RGVC 1FGVL 3O8XD 4U7SA 1A3QA 4EI5C 3EDEA 4OQTH 1BX2A 3QNXA 4U1SB 4WNQA 2FL5B 4X9BA 15C8H 3RZCD 3L3KB 3MRCB 3DRTA 4OD3L 3JWDL 5HYEA 1CGXA 2FX8H 3TCLB 4XX1E 4L3CA 4NCC1 3KPSA 1AHWB 4MA8L 1HSAA 3QIUB 3SDCC 1KXQE 5ICXA 4WI8A 5T1KB 1S7SA 1AHWC 1R24B 3VXPB 2IALB 3QIUC 3QUXC 4YFEA 2E7CA 4JM4H 1R3HA 4PRBB 4JVWA 1BMGA 4EVNA 4MJID 1MJUH 5CJQL 3D2UD 2YPVH 4MDJB 1VGKA 2AEQH 4V1DD 4J7RA 2H9GB 4ONHB 4P9MH 1IFHL 4H8WL 5CEXA 2CLVA 5IGXL 2H26A 4MSWA 1IGCH 3C6LB 3TBVA 4JPIA 3FO1A 4OLXH 3HUJE 1IAKB 2VDQH 3TVMA 3LN4A 1KTLB 3C6LC 3EFFB 5EZIH 4PR5A 3O4LE 4OZ4A 1FGNL 1T03L 4NFDA 2XA3A 1ACYL 1I3UA 2VABB 1FFPB 4P99A 1RZ8B 4K3EL 4D0BB 4M7LH 4AIZA 2W9DH 3RVWD 3VH8A 3QFDB 1QQDB 4KC3B 3MRKA 3ELAT 2ZSVA 2NW3A 3SDXB 3U9UB 1CT8A 1UEMA 5HBBA 3V4VL 1VSCA 1HQRB 1L6ZA 4PJ9C 1FG9C 2NX5D 1VERA 2AJSL 5F1NB 1JGVL 4YC2C 4FXLA 2KBGA 2NY2B 1QNZH 4UINH 3CGTA 2NY6D 2NY2C 2VQUA 4BSWA 5JHLL 4P49A 1PKQE 3U4AA 2V9RA 4R7NA 1TDQA 1ZHNA 1A4JB 4Z78A 1CS6A 1T66D 4J3VA 5T3ZE 5IR1A 1NDGB 2H8PA 2E27H 2MJWA 2CIKB 4LMQE 4XP4H 3UTSE 4GG6A 1IBGL 3VGAC 1AR1D 5IBUB 2EYSA 2ESVB 5BW7A 3VW3H 3VI3E 1EXUB 3MO1A 1ED3A 1GC1H 3IT8D 5BOPA 4KZDH 4U1LB 3HR5A 1JL8A 4EIZC 4MA3B 1ZHBA 3DMMB 2CO7B 4NBXB 2L7JA 3OR7A 1XGPB 2BNUA 3K2UL 1YJDH 3VFWB 1TVHB 1A0QH 5C7XL 3PJSA 4P3WA 2XY2A 5BS0A 3D69A 2FB4L 1CFQB 5FO8B 4ETQA 5JA9A 2D7QA 4D9RD 2UUDH 5F88A 3UBXA 4HFUL 4ZNCD 3CX5J 1MRCL 4Y4FC 5I2IB 2FEEI 3RDTD 1CE1L 4HQQL 4JJHA 4PBXA 5IESH 2HWZH 3CFJB 1R6VA 3FFCA 5FHAH 1VACA 1OHQA 2XWBB 1HKLL 4IOIB 4X8JB 5FXCH 1EAJA 5I75B 5FOJA 1K3ZA 4PD4K 5LGHL 2Y25A 4JG0L 3A67H 1U8LA 1QSEE 3SE9L 4DOHE 3O2VL 4O5LL 5T5NG 5HHME 4KKLC 4PJEE 3RWJA 4BYHA 4IRSB 5CEZD 1AY1H 2NY3C 4P5KB 1QYGH 4P2QE 5SWSB 2WIIB 4OCSH 1KEML 4L8CA 3KWWA 3VXMD 1G9ML 1A7PL 3RA7L 3DBXB 3FT4B 3O6KH 1OTSD 2GCYA 3HNSL 1IT9H 5DD5H 1FL5B 3D39E 3BMWA 5CMAB 3TA3D 3WHXB 4NWUH 1A6VL 1KIRB 1INEH 2F15A 3JV0A 4QY8B 4HJJH 1JNJA 4QTHA 4X6DF 1N64H 4IIQB 2JELH 5BJTB 4Y5YA 4IIQC 2FEDD 4PREB 1MLBA 4JFEE 1XGTA 4Z7VE 4UV4H 2P4AB 4RX4D 3KJ6H 5J13B 2XN9D 4JHAL 1BWWA 3NZ8A 1BBJB 5TE6L 4WHDA 3BVNA 4Y2DA 2I25N 3VG9B 5SWZD 4WY7L 3LEVH 3SJVE 1U8KB 3CDFA 2UVFA 4KGJA 4U49A 3F8UB 5EU4A 5KS9E 5I1DB 1RIVH 3U4BL 5CEYA 3V8OA 4PJIE 3JWOL 3CFDB 1LP9F 1S7RA 1OWWA 4HKJA 4G8EB 2J88H 1BAFL 2VLRD 5IMOA 1M7DB 2DYPD 3DUSB 5C0AE 1LO5A 5IOPB 5TE7L 4AEHH 4CU6A 2JIXA 4PTUA 2DBLH 1JPSL 3BWAB 4LCUB 2IADB 5ETUB 5FYJL 4ODXB 4PLKD 3L5IA 4P4KD 3BP5A 1S9YB 3P30H 2AQ1A 1DQJB 1NKRA 2XYCA 1T2XA 3L7EB 3UZQA 2BY0A 2R0KH 1FLRH 3KDMA 1S3KH 1MCOH 2ATKB 4PJ5B 1ZA3B 3GJEB 4OIIH 4XCEA 1C7TA 1MQKL 3HMXL 3WDHA 3U7YL 4I3SL 3QDJE 1D6VH 2ZUXA 1U41A 1U3JA 1JGLH 4F3FB 3VWJD 3MLYL 5DJAB 4PGCA 3O41A 1KPRB 3QNYA 5E2WH 1A3RL 4W6XB 4EN3A 5KN5A 1E28A 4LSVH 4U6VH 4CMMB 2G5BA 5CILL 4LCIL 4NGHL 3CXHJ 1U93A 4OT1H 1W0VA 4O9HH 3OKOA 5LQBL 4E41B 5J8OA 4ALAH 2H3NB 1DEDA 2YRPA 4OB5L 1D3CA 3T2NH 2KL6A 3PQYB 4HZAA 1P7QB 4M8QB 3GK8L 1OSPL 3CFIC 1J86A 3I6GA 4YQXH 4G6JH 4WI4A 4WHYG 3ILPB 1IAIL 4D2NA 2A9NL 4JREC 1G9EA 3VXSA 1NCDL 3MRHA 3GSNB 4DAGL 2X7LB 2V2WA 4RRPA 5HD8D 1S7XB 2Z92A 1CICC 3LZFL 3B9VA 5JZ7C 2DD8L 4EQ2A 1T7ZA 5GRZA 2GSGB 5T3XD 2WBJA 4YDVB 5EZOH 2A38A 4XPFL 1HINH 4HHAB 4ZNEE 5FYKU 5DURB 4RISH 5CUSL 2ZCLL 2HN7A 2HTKD 2VQ1B 4HPOL 3ZKND 1T1WB 1JZ8A 2E7LA 4NO5B 5B39A 1KIQB 4Z95H 3ARVA 3DV6A 4PJXF 4U6HB 3ESVF 2WWKO 4XPHL 5D5ME 3LY6A 1XIWD 1E4XH 5DHVA 5C8JB 4V2BA 1QEWA 2BRQA 2E6PA 1KCLA 5IB1B 5L8JB 2FIKB 4NKQB 2X05A 1OP5H 1CD1A 1QRNE 5F3HB 3A6CH 4QRPA 4IOSD 2GJ6B 1XF2B 2X4RB 2GSIA 4JRYA 4QWWD 5FM5O 5IBLC 3LIZH 5IQ7H 1N26A 2F8OA 2HH0L 5HDBE 5DJXA 4U1HA 3P73B 4K3JL 4K9EC 4HC1L 1JNHA 4XNMB 5JW5A 2AK4D 1R3KA 2XI9A 3LKSB 4ODUA 5INCB 1L0XA 1FE8H 4LGSB 4ZFOB 3D3VA 3ECBA 5CD5C 4NDMB 4GKZA 1QKZH 2AV1A 3T65A 1KFAL 1YEJL 2Y06H 3LKRB 4X5XA 3SGEH 1II4E 3EYQD 1CQYA 4QRRB 3TJEH 1DBMH 3MGTB 2CUMA 3BW9B 5I76A 4M6OH 5HGBA 1N3NB 1JZ4A 5SV3A 2IPUK 3QHFL 2H32H 2IQAB 2NNAB 2OJZL 4JKPH 1K8DA 2VIRA 5EC1B 2RCSH 1VFAB 4I9WD 3HTLX 4Z7UF 5C0CB 5I6XB 2A74A 3QDGE 2X4UA 5F70A 5FUOL 2W91A 4ZUTA 4DQOL 3PV6A 5HHOD 5I6XC 3H6JA 1JYNA 1NMAH 3EYVB 5D71H 3WXWH 4ONFH 3IFPA 5D7JB 3GMNB 1E27A 3I3BA 2WWMD 3HE6D 5FA4B 3WNKA 1Q94B 2HJFB 3H9HA 5D7JC 3UBXI 1MH5B 3ULUD 3T08A 4ZUWA 2RB8A 5I8EA 5I30H 3QJFA 1AGCB 1H0DB 3DX9B 1N6VA 3OF6D 4PJ7B 2QHRL 2ZG2A 4JRXA 5GRJL 4WWKD 3ZHDA 5KOVC 4P3CH 2ERJC 4LSRH 4YJZL 2H6PA 4OM1H 4PJHB 2BVTA 2R2HA 1X5ZA 4M7KH 5FYKH 4KTDL 3CX2A 2Q7NA 5DJDB 5AG9A 4PV8B 5C3TA 4X5WA 4K7FB 5ESAB 1CDHA 3KYKL 4WDIB 4FHBD 4GW5B 4ZUSB 5ANMA 2WQRA 1KACB 2P5EB 2HFFA 3FZUC 5J6GB 2A6DB 1EJOL 1HI6A 1FIGL 1UQSB 5LBSH 4YHZH 2GK0A 4OQ1A 4N5UA 5GGQL 1VADB 2W9EH 1MFNA 4PGBA 1BD2D 1N0LA 2IPTH 1U3ZA 2EDEA 4M48H 3G6JB 2V9TA 1OLLA 2XWJB 3MXVL 1OPGH 4IHOB 3UC0H 1NUDA 5ALCH 2XY1A 2YXFA 3JV4A 3FO2B 4NZTL 5TH2A 5F21B 2ZUSA 1J0JA 1V5JA 4H26A 1NEZA 4RFOL 5IVZA 5DC4B 5IBTH 5EC2B 5IMKB 3GI8L 2PYEA 4HCRH 4NQCB 5GS0D 2R0ZL 4IM8A 3RIFK 5EA0H 2JJSC 2AEPL 1I3GL 1WV7T 4PRAB 4ZFZB 4OGYH 2OR9L 3LEYH 4OCRL 3ES6B 2F19L 4KJWC 4MZ3A 1FFNA 4GMTH 2WP3O 4KY1L 4NHCL 4P0DA 4CVWA 3KG5A 4I4WB 4AEEA 5EBWB 2UZXB 4R2GD 3E3QC 3PHOA 3C5SA 3RX8A 3S3JA 1VEPA 1WAAA 4M9OA 4NJ9L 1EH9A 4MNQE 3SDDD 1DLFH 4B53A 3EYUL 3T4YB 1IM9D 1IGTB 2CPCA 1NBYA 2EH7H 3DGGA 1NGZA 4YDKH 5DK0A 4HG4J 5TDNA 3JSSA 3P9LA 5HGAA 2CR6A 1AGEB 2OTUB 5ACZB 4P2YA 3WNLA 4ZAKA 5C0GB 5C0IB 3EOAB 4KAQH 4TUOA 4Q58C 5FF6A 4WENB 1T0PB 5C07A 1WUNT 3W11D 2OR7A 2XQBL 3V5KB 5D2LA 4OFDA 3VXUE 2HKFL 1NGXB 3ALWA 1S5HA 3CUPB 3HZKA 3QHTC 4ZTPL 3ARGA 4FRWA 1UWGL 3FQWA 4O2EA 4EI6B 4N0YL 1DQQA 5CP3A 1L7TH 1WVZA 3MUZ1 4P4RA 2X9YA 5E95B 3RHWK 3LS4L 3WXVL 1MHHB 5C2BH 4G8GA 4LHJB 2Q8BL 4DGIL 3O0RH 1UEYA 4BKLB 3K2MC 4S0TD 3T77A 5BMFH 3WFZA 3B9KD 5M95B 4QCIB 5I1EH 3DRQA 3MLRL 1Q9WB 5F7KC 5DVKA 3GB7A 4K9EL 1FO0B 4X8XA 5DTFA 5B4MC 4MD5B 4XXDB 1GCFA 4AT6B 1M7IB 3HNTL 3UX9B 1A7QH 2UWEB 2BXYA 5E7BA 1R5VA 4LF3A 3DVFA 1NL0H 3T1FB 2IAMA 5HJ3A 1HDMB 4PUBH 3MREA 1EGJL 4D0DA 4JPVL 2QADD 1FH5H 4JFDB 4JN1L 1OAZH 3MV9A 4X6DE 4UILL 3F7PC 4DZBB 2RIKA 2XZAH 1U8QA 3CK0H 5HYJE 2Z31B 5KSAB 4M3KB 4UV7H 4JAMA 5EO1B 4X9HA 4HWBL 5MERB 2Z31C 2VDMH 4ONGH 3CMOL 5DD1H 2A73A 2MMXA 4MAUH 5CJ5A 3W39A 2NTFB 2EEAA 4ZDHA 3UTQA 1UCBH 4TSAL 1OGAB 4JY6A 5C0BD 1KIPA 3MROA 3SY0B 1MRDL 1FNSH 1T2QL 2P43B 4DUXA 4JY5H 3MRRA 1YEIH 1UJTA 4M5YH 5F7EL 3T0ED 3ARFB 1EX0A 2JB5H 4OKVA 1JI2A 3MOQA 4PG9A 3QUKA 3RPKA 5MEPA 3G5XB 3ARFC 1LP9E 3S36L 5J11B 1CD0A 3EJYD 1PYWB 3IJHB 4YXHL 1NC2D 1DBJH 3C60B 3WFBH 1S78C 1T04A 3TYGL 4PS4L 3PG2A 1U8HA 1G6RH 4URTB 1IGMH 3Q48A 3VFVB 2IG2H 1IC7H 3I6KA 1NJ9B 1T20B 2Y6SD 1DANT 1AQDA 3LEXB 1CXHA 2A2QT 3GMLB 1BM3H 5GGVH 4LSDA 4LHQB 3B8SA 35C8H 4FQLH 3JZ7A 3GSRA 3TESA 1INDL 5L2KD 4JFFE 5I73B 4O58L 3B6SA 4LLAA 1RK1A 4L8SB 4LLDA 4MAYB 5IT2H 5I73C 1ACZA 5JOPE 4JQIH 2YMXL 4MAYC 3K3QA 4U1MA 5FKPB 4LSSH 2RJMA 4P9HC 2AJ3A 1KYOJ 4NZRH 4D3CL 3MA9H 4G9DA 4XH2A 3EJJX 3O6LH 4UIKH 3X14B 4KHTH 5L2JB 1RUAH 1OY3B 2PW2A 4L9LB 1CF8H 5C2UB 1HHJA 2HRPL 4LCWA 4X6FB 5HDLA 3LB6C 3UJIL 4L9LC 1Z9LA 3RNKB 2EH8H 1JYVA 5C3LD 1I7RA 4M1GH 3HFMH 3X3FH 5I1IL 5DEZA 1MWAA 4Y4KA 3N85H 5FHBL 3O8XB 4U6TA 3IVKB 5BO1H 1OB1A 4U7KA 4WO4D 5ID1B 3WKMH 1NFIA 4FQQA 4XCCL 1A6AA 4YHML 4PGZA 1A7NH 2HVKB 3RZCB 3X13A 1G7HA 5J7CC 4PJCF 2YEZA 3CU1A 3RZCC 5DJ8B 1J8HD 2BJML 4S1DC 3QEQE 3QA3B 2D03L 2AEIT 2EO1A 4U7MA 3QZWA 2PN5A 3FT2B 5DWUL 1RURH 5LKNA 2VKXA 4ORZC 1MJJB 4U33A 4QHKI 2D4FA 5CJBA 4WI5A 1PLGL 3K46A 5DO2C 1GGYA 1J12A 3P0VL 2BMKB 2D7PA 4OZFH 4F2MA 3V0WL 5EU3B 4MJIB 5AZEL 5LVEA 3D2UB 4H1LG 5HYIA 3SQOH 5FYKE 5C70A 4OFYA 4PJXE 4GMSH 4V1DB 5JO5A 1BOGA 5BZDB 4YFLF 4J8RB 1GGBL 2VLLA 4A6YL 1GYAA 4GBXB 3G6AA 1TJIH 4FQIL 1KJVB 2B5IB 4GBXC 2HJLA 5TF0A 3RWIB 1HHIB 1WSST 5KAQG 4JJ5B 4PB0H 2B5IC 5D7KD 5F1SA 3GSXA 3MRGA 4HMEA 4TUKH 1P4BL 3LMJL 5DJCA 1KJ3L 3HR6A 5ELIA 3UTPD 4HUVA 3TN0D 4QOKE 4HS8L 3WUWG 1CDYA 2CH8A 4RAUA 3L5JA 3MLVL 4XWGL 4DK6A 3OAYH 3BT2H 4MB3A 4OV5A 2HTLC 1MFDL 4MHHG 2NX5B 2EIEA 4OI7A 1AGBA 4OJFH 5HHPA 1YNTB 4LPXA 4ZPTB 3BZFA 5EN2A 2HG5B 5E2JA 2PKDA 1ZHLA 1UB6A 3F7QA 2J6EA 5AWNH 3S34L 3RWDA 2NY6B 3NZHH 4WEMB 3SE4A 5CGYC 4YHKL 3MMEA 4ZYKA 2EKJA 5CINL 1IGJA 1XR9A 3VWKA 4C56B 4NYLA 3TC9A 1QACA 2XZQH 3MNZA 1ULVA 2Q3AA 1OT1A 2FIRT 3WDJA 1T5XB 1A3LH 1NCAL 1EAPA 4Z7UE 4HAFA 1INQB 1QO3B 4WRLA 5JA8B 4NM8H 2BOBB 5I1CL 1LDPL 1WWAX 3N9GL 5IVNA 3OZ9L 3Q3GA 5F7DA 4NZDA 4PJDF 1F11A 3T8XB 3DO7A 1RULH 5F3BA 1BFOA 1EVUA 2YR3A 2AQ3A 2LU4A 1ZLSL 4N68A 1KJ2A 2OJEB 4M5ZL 1EBAA 1G0DA 3V6FB 1R3LA 5D72H 3O4LD 3OKYA 2WINA 2AS5M 4FZ8L 5AD0B 3TWCL 3MLSL 1OL0A 1QBML 2BX5A 1RZIA 3MRNA 1FYHB 1KG0A 4I5BA 2OSLB 2XZCL 2AXGB 1TJHL 3HG1E 3ILQD 1K4DB 2K7QA 1OAKH 1JUFA 2P5WA 5EU6E 3D9AL 3ZT5A 1WT5A 5IW6B 3O81A 5I8CA 4KMTH 5DD3L 5GISH 4PG2A 4YWGL 2Y36L 4OLUL 4F7EA 1DDHA 5I66B 1Z3GL 3BJLA 4NQTA 4NQXA 3GUTB 43CAA 3U4EB 5DXWA 4LEOB 5DEFB 4JDZB 5EOTA 2FECI 4QTIH 5FUZH 3CSYB 5DI8B 3RAJL 3I6LE 2VDKL 3NFPA 1B90A 1SEQH 2Z4QA 3EDFA 3VXMB 3R06B 3WMSA 4TULH 4FABL 4PJFB 4ZOEA 5I8OH 3RKPA 4HUWA 3WN5B 1EHNA 4PV9A 4ELMF 3MRJA 2BNRE 2OTWA 3GSQB 1UGNA 3WJLA 1GGCH 3TA3B 3WN5C 5T3ZD 2YKLL 1ND0B 2Q7YA 3UTSD 2DMCA 2VDPL 1JTOA 4NO0D 1VPOH 3SCMA 1HXMB 3VDCA 1KT2A 1X5HA 1T7WA 2H2SC 3QPQD 2VZOA 3OKKB 2ICWJ 1HYRC 3PWNA 1YQVH 4LPCA 2OL3H 3STZB 4PP1D 2YS4A 3OX8A 3G5VA 5EWIH 5I0DA 2ZCHH 2FEDC 2Z8VC 1ZTXL 1WFTA 3PABA 4K8RD 3TCXA 3BEWB 4TRPL 2EZ0C 2XN9B 5CWSB 2BSSB 4M4RA 4OZIA 4CU7A 5SWZB 1RJYA 3R4DA 4KK6C 1G1CA 1OARL 2OMBA 5LCVL 4N0CD 2NXZB 2V2TB 2Y7QB 3QG7H 1HZHH 4OGAD 5DQDH 3D85A 1U9KA 2NXZC 4RGOL 3O45B 4JLRA 4F7PA 4XPBH 4F9LC 3VXOA 2VSCA 5ILTL 5INDB 2WLYA 3NFNB 3QDMA 1VDGA 2Y4SA 4MJ6A 2N7AA 2VLRB 3AM8C 1A6UL 4R0LC 4PLJC 1QSED 1G7MB 2MPAH 1OP3H 4UDUA 5B8CA 5L7XL 3UTTE 2WAHA 4RZCA 3IFNH 3F7RA 3IDIA 5DK2A 3ZT7A 4QRTA 5KSVA 4JM2F 4O2FB 3D39D 3BZDA 3MRMB 3NOIA 3EZ8A 1T7YA 4I0KA 4M61A 4KI5F 2HVJA 4ZOAA 3RL2A 1JNNL 4J3SA 4CAGA 3VFRB 3OJMB 4Z7WF 1QFWL 3LQAH 2EO9A 2AJXH 1FRGH 3P3YA 4NN6B 1XGUA 3VWJB 2VLKA 2C9AA 3I85A 3GMMA 1OSZA 3F5WA 5IB2A 2BFVL 1KPUB 4L9DA 4XZUB 4QRQA 4JFED 1J0IA 1IZJA 3OKNA 2AABL 1KGCD 1J1XL 4OF7A 4KVCH 3ULVL 2ED7A 4JPKL 5JW4M 1DUYB 2P49B 4AK1A 1CLYL 5DMKA 4XP6L 3NTCH 4NQEE 3BHBA 3QIWD 3SJVD 4BH8B 1N59A 4JZOB 3ME0A 4E5XA 1DBBH 3PNWA 3UAJD 3GIVA 1J87A 25C8L 4AY0A 5E8OB 4HS3B 1ADQA 4XNUL 3WFHB 2A83A 2HFGL 3QULA 5HY9A 1V7NL 1IC5L 3Q5YA 4K94H 3BO8A 1Z0NA 4JDVA 1QZ1A 4ODSL 3FQNB 2BSRB 3LDBC 5FO9A 5HD8C 4HBQA 4ODWB 4X4ME 1XCTB 5DZOA 1MVUB 1CFTB 1MEXH 5D1XD 4XCFL 3D5OF 3WS3A 5M7QA 3F7VB 4P2OD 4O2CA 1W72A 3IXAA 2XKNB 1B0GA 4NT6B 1TJGH 3KLDA 4KKNA 3ZKNC 2QR0B 5IFHL 3QHZL 1P1ZA 1NBVL 3OKMA 4OTXL 1I9EA 2FX7L 1XIWB 3VD4A 2YD4A 1PZ5B 3QDJD 4LSQL 5DFWH 1CI5A 1XIWC 1RZJH 2NLJB 1DBKL 3OGCB 4GRLD 4U1IB 5I9QC 4PRHB 3D18B 2HLAB 4YK4B 5E5MA 2IBZX 3H7BA 1MCHA 4YK4C 3QCTH 2YN3A 1JRHL 3QUZD 4G7VH 4MXVF 3G08B 2R2EB 3L5XL 3ULVD 4QWWC 2Y5TA 4UT7H 1U8NA 5DJ0B 5CBEA 2AK4B 3DVNA 2DJUA 5HVHB 4JCLA 1D5ZB 3WL9A 4HIJB 4F33B 4YEFA 5ISZB 3V6ZA 4LBEA 4DN4L 3BSZH 3MACH 1FHGA 2BVQB 1BLNB 4W6YB 1JHLL 1TZGH 2MOVA 3NN8B 5C0JB 4QXGL 1F6FB 4PB9H 3FB5B 1CFSB 2YA0A 1F97A 2R0WL 2EDNA 2IFFH 1C5CH 1JGDB 4QHMA 3KVQA 1BQHA 4JO3H 3HS0B 1J0ZA 3KLAA 1HHHB 1VFBB 4HKBA 4ESKA 4YX2H 3CFKA 2O5ZL 3QG6A 1AQKL 2X4TB 1NCWH 4ORGB 4AQ1B 4FTVE 1MAMH 4TTDC 3KPMA 3K8KA 5GGRA 1PY4A 2BNQA 2O5YH 4PJCE 4ZPVA 1P4IH 3RGVA 4EI5A 3VFTB 1N5AB 4UQ3A 3RRQA 4KQ4H 2EICA 3FJTA 5HHOB 4JKMA 3ARBD 1A6WL 2IC2A 5KVDH 5IFAL 5CCKH 4EOWL 4QRSB 3HE6B 2GW5A 3M1BB 4ZOCA 3L3KA 3MRCA 2WWMC 3HE6C 5JUEL 5KVFL 3TCLA 1E4KC 3SDCA 3VFNB 4NC1C 1R0AL 5ICYB 1QRND 1AHWA 1AE6H 3QIUA 3QUXA 3DYOA 3NCYP 5T1KA 2Y72A 4M02A 4YXKH 1R24A 3VXPA 2WUBH 1XZ0A 5CP3H 2QQKH 5GGTA 2X40A 1A22B 2QKIB 4PRBA 1I7TB 3LHPL 4ZO7A 1U8PB 1YQ2A 1YC8A 1ZVHA 5E2VH 4MDJA 4R8WH 2R0LL 2E9IA 1YA5A 4FQ2L 2H9GA 1X4ZA 4ODTH 4ONHA 3GHEH 3IFOB 4LASL 1J0KA 1T4KB 2JLLA 4QNPE 3C6LA 1N5YH 4WTZA 1BD2B 3JTTB 1IAKA 4J2XA 4NBYB 1KTLA 2MTPA 1J7VR 1YPZA 3EFFA 3K80A 5FB8B 1RZKC 1S7VB 3OMZA 4ZFGH 3BAEL 4NKOB 3BUYB 2VABA 1FFPA 3TBWB 3BQUD 3U2SB 3GM8A 4D0BA 1I3RB 5CZXD 5FO7B 3QDGD 3QFDA 1QQDA 5HHXL 4XVTH 5EORL 3SDXA 3U9UA 4KWUA 1CL7H 4RWYH 3R0NA 5GJSH 3VXSE 3HC4L 4XNXH 1HQRA 4Y5XB 4M43L 5DT1H 3STBA 2I5YL 5IB5B 4R2GB 1T80A 4EXPX 2IBZY 3CVHH 3E8UL 1LO0H 2D7MA 3OR6A 4KQ3L 1MCRA 2P8LB 5IHUL 3T0WA 3TV3L 3GZKA 2OP4H 3OPZL 4PJDE 1EUUA 2RAMA 1NDGA 3C08H 3DLQR 5TQ0L 5DA4A 2CIKA 1X5KA 4YE4L 5DUPL 2ESVA 4AEFA 1D5XB 4NCC2 3SEPA 4HH9B 1EXUA 1TVBB 2CDEB 4U1LA 2YD5A 5F97E 3BKJH 3EYOB 1X5YA 4MA3A 3GMQB 2NZ9D 1FPTH 2VXTL 3U6RB 1KN2L 2EE6A 4AL8H 1MOEA 1XGPA 3W11C 1VENA 3ZHKA 4QRPE 3VFWA 4LDOB 5D2NE 1TVHA 4LAQL 1MJ7H 4F58H 2ID5A 4XHJD 1WBYB 2FBJL 2DKUA 4WVRA 3EO0B 1CFQA 5FO8A 1GPOL 1F2QA 1O5DT 3WNOA 2X4SB 5I2IA 3P77B 4ZXBD 3QWRD 3BDYL 3B9KB 4G5ZH 1U8IB 1KLUA 2XNAB 4RAVB 5DJYB 2D7OA 3B9KC 4Z0XB 3B9AA 4MVBD 2EDHA 5GHWH 4JFYA 2XWBA 2YRZA 4IOIA 4X8JA 5E08L 1EUTA 4LP5A 4WW2B 1Y18B 3CFCL 3TH2T 2A77H 4ELME 4LCCC 3AMKA 4WW2C 1LVEA 1JP5A 3VXQB 3B83A 3V52L 1IILE 4Y4HB 4JR9L 4JFHE 3PDGA 1RHFA 2QADB 3FTGB 3ARED 4P5KA 4Y4HC 5SWSA 1P4LA 2WIIA 2QHLA 1CVRA 1ZT1B 2QADC 1IEHA 1D9KD 3FT4A 2X9XA 4MNQD 3WO3B 2RGSA 3O2DA 1FL5A 3X11B 4OCWH 2VC2H 3UO1L 5CMAA 3WHXA 4Y8DC 4LPUA 3WLWD 5IVOA 3FN9A 1KIRA 5DUBB 4QY8A 2FJHA 2IFGA 5BVJB 3NFSH 4YDIL 5C0BB 1DZBA 4YHLL 4IIQA 5BJTA 2GIYA 1QD0A 3QWOB 5TE4H 3PP3H 4PREA 3DOSA 2VDLH 3VXUD 1DN0B 3KHQA 4M93C 3K4DA 3OKDB 1A9BB 3ZKMC 1BBJA 1UFUA 5CHNB 1GZQB 4UU9A 1U8KA 3C2AL 3ZLQC 4X99A 4KVNH 5FDYA 1WCBB 4LVEA 4UOJA 3MJGX 5GS2H 3MA7B 5HYSG 1CDGA 1I1YB 4ZO9A 5I1DA 3PHSA 1FZJB 4LQ1A 5BQ7B 1JE6A 4NIKB 3CFDA 2Y6SC 5B38G 1WZ1L 4DKAA 5CSGA 4M1DH 1KBGL 5L2KB 3LRSB 4G8EA 3KPRA 1BQLH 4DKDC 1M7DA 1NBZB 3DUSA 3FMGH 4H0GA 5F72S 5IOPA 2FGWH 2X89A 4KI5E 5F9WB 1UZ6F 3MFFB 4LCUA 4Q6YA 2IADA 5ETUA 3QFJE 4ODXA 1NAMH 1BQUA 4Z7WE 5F9WC 1RQ5A 3MJ6A 1FNEB 4XC1H 2CRZA 5E1HB 2VXQL 1S9YA 1U92B 1X9QA 2CKBL 5J06A 2CSPA 1IKFH 1ZANH 5HYJD 4P23B 1NLDH 5ADOH 3L7EA 4P23C 4PJ5A 5AYUL 2ATKA 4BQCA 4ZS7H 1ZA3A 3GJEA 1S9WB 1EFXD 4XBEH 1G7LB 1Q1JH 1N7ML 1UXSB 3V0AC 4F57L 1ZMYA 2YD6A 1D5MB 1T1YA 4WGWB 1RMFL 2E3VA 1NGPL 3GDBA 4F3FA 2XRAL 4PJAB 5KVEL 3CC5B 1EZVY 2FZ3B 5DJAA 1J5OL 1IGIH 1KPRA 3IRZA 4W81A 3DJ9A 4WO4B 1FVCB 4CMMA 4J3WA 4XNYL 4HJ0D 1WAAE 5HI4D 5IV2B 2FO4B 1FZOB 1WLHA 1R3IH 1WIOA 4XGZB 2HLFD 1VGEL 4E41A 4IRZL 4P2CG 2H3NA 4LNRB 4HW6A 1P7QA 4DW2L 2CLZB 4OZHF 2W0KA 4L8DB 4TPRH 1TNNA 4KTEL 2WNGA 1G9NL 4OCYL 4X7SH 4KXZH 1EBPA 4WI9A 3ILPA 1FQ9C 4GAGL 2BVPA 3DUHA 3GSNA 2X7LA 1A5FL 1FAIL 1QLFB 2R8SL 3QSKB 4JFFD 1S7XA 3NIDF 3VA2C 4HIXL 4M62H 1MFEH 2C26A 4I13B 4WFFE 5CKGA 3TVMC 2GSGA 2DKMA 5TPWH 3ARPA 4YDVA 4CJ1A 3VFUB 4HHAA 5JOPD 4EEEA 3QIBD 1RZGA 5GGRY 3M45A 3W2DL 5E6ID 2FEEL 2APWA 3Q1SL 4PRDA 2VQ1A 1KOAA 4M03A 1A1MB 1T1WA 4M7ZB 1H9VA 1DE4B 4NO5A 3VD3A 1KIQA 2IH3A 3VRJB 4LVNB 2K9UA 3QO0B 4U6HA 4AJ0A 4BQ6A 4MXVE 3QR2A 4LVNC 4GXVL 5C8JA 2AK1H 3SKOA 3RUGF 3O3BB 1U8OB 5IB1A 1RVFL 3QRGL 3TN0B 4JQVC 1ZT7A 2FIKA 3BKMH 4M1CD 3DSNA 3S4SG 1XT5A 1MRFH 2AJUL 2I9TA 1MCBA 1HN1A 3EGSB 3TN0C 4XNZB 4HFWB 5F3HA 3MRQB 2M8XA 3RY4A 2GJ6A 1DTUA 1XF2A 2X4RA 3LKNB 5HHVL 12E8L 5E70A 4FQ1H 5DMYA 3P73A 1KCVH 3KYNB 4XNMA 2GT9B 4I3RL 3GMOA 2VDRH 3LKSA 1AFVH 3QEQD 5INCA 5C0DB 3GJFB 4MDIB 5D7SH 3MOBH 4ZFOA 4PJFF 1CD8A 5BW7C 1YYLH 5JXED 3QQ4B 1EGJA 4MGXA 1FGVH 1DVFD 2UY6A 1F4HA 3CFBB 3LKRA 1A1OB 3V5HA 4MWFB 4RSVA 3I50L 4R26H 4QRRA 2RR3A 4OD3H 4MQSB 3FCTB 3BW9A 3JWDH 3QXUA 5FYKD 4JB9H 2NZIA 4Z5RB 2AGJL 1UC6A 1NGYB 1N3NA 4N0FB 1CK0L 4MA8H 5EU5B 3WBDA 2NNAA 5LGJB 5EC1A 4GO6B 1B0WA 1VFAA 5HSFA 5C0CA 4DGYL 1I3VA 2JB6B 3O4LB 2ZCKH 5KBNC 3QUMB 4XWOD 3EYVA 3GO1L 3PWUB 4E0RB 1MF2L 2ICWB 5D7JA 2XWTB 4H1LB 5CJQH 3TM6A 4XC3L 2F74B 3RWEB 1Q94A 2HJFA 4FQXD 4JGUA 5FAAA 5C9JB 1B2WL 4C54A 1MH5A 1IQWL 1KC5L 1KTRL 3ILQC 3ZTNL 1BGXL 4QOKD 1IFHH 4H8WH 1UM6L 4FN0A 5IGXH 1EO7A 1AGCA 1CQKA 1H0DA 3DX9A 1LO2L 3W81A 4PJBF 2HJKB 4PJ7A 1YYMH 1MSPA 1UACL 5EBMB 4PJHA 4BFBD 1FGNH 1T03H 4LCWE 4PV8A 3SO5A 4K7FA 1UENA 3MJ9H 1ACYH 4GT7A 4WDIA 4GW5A 3QXWA 1GXEA 4ZUSA 2H45A 3T4AB 5E8NB 4YLQT 3EBAA 4K3EH 2Z35B 2P5EA 1IC1A 3PHQB 2A6DA 5J6GA 1PKQB 2R2CA 3FN0L 3WUWB 1E0OB 3EHBD 3V4VH 3W0WE 1VADA 4M6ML 1ZLUK 3UTSB 4NO0B 2FATL 2CJUL 1EERB 3RPIA 3O6FD 2AJSH 3UJTL 1JGVH 2BSTB 5T5NF 3NACL 5C09E 3G6JA 5L6YL 2XWJA 5C0FB 1BF2A 5JR1L 2DTSA 4N9OB 1SM3L 4IHOA 2FSEB 4YGVB 5CEZH 3GI9L 3QPQC 3RI5F 4I3GA 3FO2A 4YBQD 5JHLH 3T0BA 4YEEA 1UB5B 5H2BA 2B7DT 1WTGT 5EC2A 5IMKA 2DI9A 1AGFB 1N4XL 2R39A 3MRBB 3S3SA 2JJSA 1ERNA 4NQCA 4K8RC 1DQML 2X1QA 2EEBA 5TJWK 3OKEB 3DURB 1IBGH 4PRAA 4ZFZA 3C5ZD 1ZA6B 2R4RH 3D0LA 3ES6A 4PJGF 4KTYA 5DSCB 3F62A 3HG1D 5C0ND 3HI6L 2EDJA 3BP7B 3OGOE 4N0CC 5EU6D 1DJSA 5I1HL 4TUJB 5EBWA 3OTTA 1H5BB 3BI9X 3MCLH 5TGBB 5I74B 2D0GA 3K2UH 1RIHL 1K4CB 1H5BC 2ADFL 2B4CL 5C7XH 5FYJU 1B0RB 2FB4H 1CXFA 3T4YA 2ITDB 1QSEB 1IGTA 5SX4H 2E6QA 2W65B 5EPMB 1AO7E 3BPLC 5HHMB 2FCBA 3PGDB 4YBLB 3I6LD 4HFUH 2ZUVA 5E24E 1MRCH 2OTUA 5ACZA 3RY5A 4P2QB 1CE1H 4YBLC 3LRGA 5C0IA 1QR1B 3EOAA 3MBED 4HQQH 2CDFB 4N0UA 1VKXB 3LAFA 1HKLH 4L5FL 5ABDE 2BNRD 3D39B 4FXKB 4J1UB 3V5KA 3GGWB 4DK3A 5LGHH 4BK4A 2BVOB 4GAFB 3CUPA 3S5LG 4BFIB 4JG0H 3SE9H 3O2VH 4O5LH 4U1KB 4EI6A 2V2XA 5FEBA 4W68A 4LLUB 4GXUM 1KEMH 2ZNXA 2E8ZA 1G9MH 4JFEB 3RA7H 3UYRL 4BKLA 4Z7VB 3DI3B 3HNSH 5TQ2L 5JPMB 4QCIA 5JXAL 4HV8A 4J6RL 4HEME 3Q6FA 4G6ML 4PTTB 1DUZB 1FO0A 3S98A 4H88L 1A6VH 3QIWB 4MD5A 3MBXL 4J3UA 3SJVB 4XXDA 5LJYH 1CG9B 3AS3A 4AT6A 3FKUS 4UNTA 3QIWC 2UWEA 5KS9B 3UAJC 3UBXG 3ULSB 1XF4B 4L4TA 3T1FA 3ZKSD 2NY0B 4LFHG 1HDMA 3WFDL 4PJIB 5E4EB 2WBJC 1PSKH 4JFDA 2NY0C 3EAKA 3VE0B 1B6DA 1Q9OB 4DCQA 4DZBA 4X4ZA 4JHAH 5TE6H 2Z31A 4N8VB 5C0AB 3UPCA 3MRIB 3ZTJH 5EO1A 2MCG1 5HDOA 4WY7H 5MERA 1CLOL 3GMPB 2A6JB 3OAUL 3MSPA 4PD4J 2NTFA 3S36X 3VXRE 3Q6GL 3E6HB 4P2OB 1SBBA 1OGAA 3UTTD 3TBSB 4DKEL 1H3TA 2C3HA 3U4BH 3SY0A 4P2OC 1A1NB 1LDSA 3JWOH 4EUPB 4G42B 3G6DL 2OS7A 4HBCL 5F9JB 1BAFH 3ARFA 4D9LL 3QDJB 1SVCP 5TE7H 3G5XA 3TYFB 4M00A 3VU2A 4GRLB 3I9GL 3ULUF 1JPSH 5F6IC 1PYWA 3IJHA 1AGDB 5FYJH 5H37H 3C60A 5FOBB 4OF6A 4GOSA 4KRPD 5E56A 3QUZB 3VFVA 4YHPB 2BCKB 4M6NL 2YD3A 1T20A 1MI5E 4RMTA 2DMKA 1UZ6E 3LEXA 2IBGA 3QUZC 3H8NA 3GMLA 1FC1A 4G6KL 4UNVA 1PG7L 3BH9B 1CYGA 4NQED 1MQKH 3HMXH 1CFVL 3U7YH 3MLZL 4I3SH 2M26A 2ICES 1A02N 4HUKB 5B3NA 1ZS8B 4BQBA 4L8SA 4U0QB 2VERN 4MAYA 3MLYH 5FK9A 4KUZL 5JMRA 1A3RH 2SEBB 5BXFB 5FKPA 2H1PL 1UH3A 4Y2OA 3RIAF 5CILH 4LCIH 2G2RB 4NGHH 5CBAB 3CDYA 4ACPA 3SKNB 4RCAA 3X14A 3G04B 2YWZA 3UZEA 5L2JA 3X17A 5LQBH 3BE1L 3S88L 4L9LA 2YPKB 4X6FA 4UTAL 4OB5H 1IAIM 1JYXA 5F7HA 3RNKA 5A3ID 1FLTX 1GRWA 3C8DA 3U0WL 1OSPH 2VXSL 1F4AA 3G9VA 1TETH 4GRWF 2IPUG 1OW0C 3MPCA 1IAIH 1WF5A 3OWEA 1N6QL 2A9NH 3KXFE 3O8XA 3ARBB 5HGGS 1NCDH 5B22A 3IVKA 5ID1A 4D0CB 1ZLWH 1CZ8L 5D5MB 1AXIB 1Y0LB 1LO3L 4EXKA 2Y5EA 3LZFH 4QGTA 2QBWA 2DD8H 2HVKA 3RZCA 5I1LB 4TSCL 3UYPA 3EYFB 4XPFH 4HK0B 5DJ8A 2JCCF 5E8EB 1I1FB 5CUSH 2ZCLH 1MPAL 1XFPA 1QRNB 1F8TL 4HPOH 3QA3A 2W0LA 4ZQKB 4YNYB 4WHYH 2R9HC 2VITB 3ARDD 4KHXL 4XPHH 1M71A 1L9MA 2BMKA 3MX0A 5EU3A 5F9OL 4RMSA 2F8XC 4JO2L 3D2UA 3FB7B 3HPJB 2Q1EA 1KN4L 2GEEA 4O51B 5JDSB 4V1DA 5BZDA 5E8PB 3HRPA 4J8RA 4CN4A 1SY6H 3RUGE 5JLZB 4F9PC 2VJXA 5IF0B 2RFXB 4GBXA 1U95B 4I77L 2HH0H 32C2B 4XCNB 2APBA 4M8VA 3IKCB 4K3JH 1HHIA 4HC1H 4RRPG 2DQTL 3V4PL 5DRNB 4Y2DD 4FTVD 2VISB 2XTJE 5TFSL 2NCMA 2HYMA 3BQUB 1H15A 3VFGL 4KV5F 4ENED 3VG0L 4H20L 3BX7C 3QDGB 5CEZE 4XCYB 2LQRA 1KFAH 1YEJH 4M3JA 1BEYL 1HIML 4L3EE 4FFWC 5B39G 1EO5A 4MA7L 2CIIB 5KSBF 3WIHA 1YZZA 2P7TB 2NX5A 1DSFL 3MLXH 1YNTA 3NMEA 4ZPTA 1F4WL 2CXGA 2VN7A 1H3PL 1WGOA 3RP1A 2DJ4A 4WI3A 3QHFH 2V7HB 1RIUL 2OJZH 1R5IB 5D70L 3P9MB 4GRWH 4ZO8A 4ZAKC 1JHKL 4LLYB 4C56A 1OVZA 1AXTL 4DQOH 1MCEA 1BVLB 3HB3D 1Z2KA 3GFUA 1T5XA 3MLWL 4M4PA 1NDMA 1XGRB 3ZE1F 1HNFA 2EC9T 3QRFM 2WWKT 1MIML 1INQA 4GUPB 2BOBA 3EKCA 3OHXB 4L1DA 4LOUD 2DLTA 1OAXL 3T8XA 1H8OA 1MHCA 3BN3B 2QHRH 4EN3D 1RUKL 2BXZA 5GRJH 2VO5A 2NZ9C 4HK3N 3T09A 5IROA 2OJEA 4KTDH 4JFQB 4JHZA 1EFQA 3V6FA 1Q0XL 4XHJC 4PJBE 5AD0A 3KYKH 1CXKA 3C2SA 1U42A 4Y88A 2DB8A 2OSLA 1QSZA 1K4DA 4ZXBB 1FIGH 1P84K 1YEKL 4I48B 2AI0L 4JFPB 5IW6A 1PD6A 5GGQH 1MY7A 3H42L 5IM7B 2LU7A 5KJRL 3F58H 2IWGA 3P4OB 5I66A 4F37F 3GUTA 2CK0L 3VXSD 4JFXB 3U4EA 3FFDB 2YZ8A 4MCYB 1RJCA 5HI5C 2K1MA 4LIQL 1G7IB 1Z9OA 3MXVH 4LEOA 5DEFA 4JDZA 5D96B 3EOTL 3CSYA 1G7JB 4NZTH 5JORB 3U9PL 3WIFB 2DQDL 3AREB 3EOBB 4RFOH 3U30C 4LGRB 3VXMA 5GGUB 3R06A 2Q3ZA 3FQUB 3GI8H 1JF1B 3RFZC 3AREC 4MNQB 1HYSD 2A0LD 3WN5A 2R23B 1BJ1J 3U46B 3GSQA 2AEPH 1I3GH 1T0MB 2HA1A 3R1GL 3WCYA 3TA3A 4X4YB 5GS1B 2OR9H 1ND0A 4OCRH 2F19H 1V7MH 4DVBA 1HXMA 5GS1C 4KY1H 4JM4L 4NHCH 5H8DA 1QLEL 1DEEB 5AZ2L 2ZKHL 2LE9A 2NY1D 3OKKA 4QKXB 1JWSB 2XXCB 4JRWA 3MNVB 2MQCA 5C71A 4PJGE 3MODL 3STZA 3X3GL 5F71A 4NJ9H 3I3DA 1ZLUH 3FAWA 4QRPD 3EYUH 5CSZB 3MV8E 4TQEL 5DD0L 3BEWA 1S7UB 5GRUL 5CWSA 2FJFB 2BSSA 4GSDL 5SWZA 1K8IB 1X5IA 4ODBD 4ZSOE 3V2AR 1WITA 2V2TA 2Y7QA 1CBVL 4F9LA 2DAVA 2DQEL 2LAGB 1NEZG 1EJ6A 1ZLVK 3VMNA 3O45A 4NC2B 2XQBH 5FYJE 1T7XA 2HKFH 3NFNA 4JKLA 5INDA 1E6JL 1H3UA 5CJ8A 4CW1B 1UWGH 3I2CL 2VLRA 4FG6D 1PQZB 3LCYA 1TZIB 3U1SL 2VN4A 1R3JB 1EPFA 2X9WA 4WUKL 1YPZE 4AM0B 4BUHA 3LS4H 3WXVH 5K9JL 2Q8BH 4DGIH 5DFTA 4JFHD 3RWGA 1ZXQA 4X6DB 1RD6A 3H2WA 4JDTL 3MLRH 3UDWC 5HYJB 4K9EH 1GVIA 4KKAC 4Y4KC 3C6SB 3L3IB 4O2FA 3WO4B 3MRMA 4WW1B 3H3BC 4LEXL 3HNTH 2R56L 1EFXB 3WO4C 5L8KB 4XP4L 3HMWL 1TITA 3VFRA 2XPGB 3U7AA 3DVIA 3BKCL 3VGFA 4WCYL 2WP3T 4K23L 4R4FL 3VWJA 1QHPA 4AMKL 1EDQA 1EGJH 5FUCC 4JPVH 2YUWA 4JN1H 1OTUD 4UILH 1KPUA 4XZUA 2HT3C 2R4SL 4FFYL 4HIIB 2CXKA 2VDNL 4EDWL 4KK9D 3MOAL 1DUYA 4HWBH 1LP9B 5HI4C 4CVUA 3CMOH 5TDPB 3ARSA 4B7LA 2AJZB 4KRNA 4JPWL 3ZMRA 4BH8A 4ZS6C 2HLFC 1TLKA 3REVB 4TSAH 4HUXA 3UPRB 2RQ8A 3FO9B 1EO8L 4WGVB 1MRDH 2ESVE 3QNZB 4HS3A 5E8OA 3WFHA 2FLBT 1T2QH 4RWHA 4HS6B 2VXUL 4HWUA 5J12B 5DLML 3JWNC 5E4IA 1JVKA 3QQ9C 1LD9B 4LARL 5F7EH 2YN5A 5FHAL 1MHPL 1ZVSB 3QXTA 4JFFB 4XAWL 3S36H 5IFJB 4HIEB 4JM2D 3FQNA 3GKWL 2BSRA 4D9QE 2ORBL 4M7JL 4ODWA 4G6FB 1XCTA 1MVUA 4KI5D 1NGQL 2N56A 1OAUH 3TYGH 2YOCA 5D7IF 4JQXA 3QIBB 43C9B 2G60L 5F6HI 1YMMA 5HYSB 4APQD 3QFJD 3F7VA 3QIBC 3QEUB 1YUHB 2HFEA 2XKNA 3HUJF 2J12B 4NT6A 1V3KA 4YZFF 4CN1A 2QR0A 1RAMA 1YNLL 4NQUA 4RGNE 3L3HA 4M9PA 3E1F1 1INDH 4XB8A 3DI2B 3QEGH 4K2UL 3ZYOA 1L9NA 1XIWA 4O58H 4AEIL 4QHKJ 1PZ5A 2NLJA 2FECL 3OGCA 4HJJL 2YMXH 4PRHA 3D18A 4QXTB 2HLAA 1EVTC 4BZ2L 4D3CH 1IGYB 3TP4A 2H32B 1KCSL 5E2UL 3H9YA 3G08A 2B1AL 2R2EA 2HRPH 3SOBL 4QF1B 3WFCL 5DJ0A 3UJIH 2D9CA 3RWFB 2AK4A 1T22B 3BMVA 1SYSB 3UPAA 4F33A 5ISZA 1Z9MA 5F7NC 1MAKA 3LEVL 3QEQB 5I1IH 2BVQA 1BLNA 3L3DB 1I8MB 1XR8B 3NN8A 1X5JA 5C0JA 4X6CF 5FHBH 4JZNB 4GRMB 1DVFB 2PW1B 3FB5A 1CFSA 5JXEC 1I7UB 1RUPL 1JGDA 1DVFC 4XCCH 2HT4D 1CU4L 2X09A 3HS0A 1HHHA 1VFBA 5IHBA 4DGVH 4PJXB 4WFFD 3PUCA 4Z7NF 2BJMH 5EIIB 3ZKQD 2X4TA 1CDBA 1RJZB 2BY1A 1N0XL 4ORGA 3OJDB 4D94A 1GGIL 2D03H 5DWUH 1AP2B 2JCCE 3VFTA 2IPKB 1N5AA 1PLGH 5IVXF 2BZDA 5HHOA 3P0VH 5FIEA 4PG2C 2ZUYA 3WLBB 2EDOA 3DX6B 5AZEH 5DMGD 4OF3A 5D1ZD 4QRSA 3HE6A 3KPRE 4HKXB 1MCNA 4OIIL 4FQXB 3H3PH 3D6GA 2OXGA 3M1BA 1D6VL 4HLZH 5D93B 4QOKB 5I18H 1GGBH 1JCKA 1QUNA 4A6YH 1KSRA 5D93C 4OCXL 3VFNA 4H0HB 3OF6A 4XB7A 2KQMA 3RZWA 2PTVA 4FQIH 4L29B 4BZYA 1A2YB 4F15B 1MAJA 1YDPB 2C3GA 2GUOB 3D0VB 2QKIA 4PJ5E 1P4BH 1T3FB 3LMJH 4PJEF 3BZ4B 5DHXB 1I7TA 1U8PA 1KJ3H 4NRXB 3ROOB 3S4SB 3ABZA 4HS8H 3BP4B 4OCMC 1MWAL 3QZWG 4YO0B 3MLVH 4MQ7B 3IFOA 4XWGH 3IAQA 2YUXA 5H94B 3EHBC 1T4KA 2C1PA 2VH5L 5BV7H 1MFDH 4Z7UB 1BD2A 3JTTA 1HEZB 3O6FB 1NCTA 3DXAE 4FQJL 3O6FC 5FB8A 3S34H 1S7VA 2I26N 5MP6L 5KSBE 4R96B 4NKOA 3VJ6B 3BUYA 2VR5A 4YHKH 3TBWA 5LG1A 4OUUB 5CINH 3U2SA 2UZIL 4JO1L 1I3RA 3RX5A 5FO7A 1MHEB 1NCAH 1V8HA 3B2UD 3IS0X 4HX1B 3C5ZB 4HMDA 2X41A 5I8KL 3CXDL 1XGQB 3HG1B 5I1CH 4Y5XA 2B2XL 1X4YA 1LDPH 1NFDF 3N9GH 4PGDB 5K93A 5IB5A 5EU6B 3OZ9H 2VB5A 5I1KL 3ZE1E 2CUHA 1LNUB 1HH9A 2P8LA 2QTEA 4NHUA 3NABL 4JANB 4FZ8H 4HWEL 4ZUVB 3TWCH 3MLSH 1QBMH 4HJGB 4LCWD 3TZVD 1UADC 1QVOA 5CJXA 1TJHH 3M17B 3A6OA 4Y1AE 4YPJA 3MBEB 1D5XA 2NMSA 4QRUB 4HH9A 1NANI 3KGRA 3D9AH 3MC0A 1TVBA 2CDEA 2DIAA 3TF7C 1F13A 5DD3H 2BDNL 4POZC 4YWGH 3EYOA 2Y36H 4OLUH 5LAXB 3GMQA 2BNRB 1Z3GH 2DWDB 5L88L 3W0WD 1S7QB 2G75B 3ZZ1A 1DR9A 1WBYA 3EO0A 4NCDA 1FORH 5C09D 3RAJH 4FZEH 2VDKH 4QHUA 5ID0B 4RFNC 3IU3B 4FABH 5A2JH 5BZWA 2R1YB 2X4SA 3KHOA 3RBSA 3QEHB 4B7IA 1M7XA 4OIBA 3B9KA 1U8IA 3AMLA 2Z93B 2XNAA 4JKPL 3ULVF 2FLRT 4RAVA 5DJYA 1W0WB 4Z0XA 4GKSB 5L9DL 2VDPH 4WW2A 1Y18A 4N9GB 4TVPD 1K3IA 3OKLA 1A7RL 3X12B 3SGDI 3VXQA 3PWVB 4KKCD 1A4KB 1VGKB 3ZSTA 4Y4HA 5LXGL 3WNMA 2GJZA 3FTGA 1H8NA 1G6RB 2EYTB 1ZTXH 1JTTA 4TRPH 5IB3A 1U6AL 5GS2D 3SDAD 1KJ2L 4UT6L 4ODHL 3TT3L 3MV7E 5T5FL 3X11A 1AO7D 4PR5B 5FGSA 1TFHA 5LCVH 1HSBB 5DUBA 1YEEL 5BVJA 4U4BA 3UTTB 5C0BA 4UAOC 4P46B 4RGOH 3VMPA 1J8HE 3BPCB 3DYMA 4XP1L 3IDXL 5ILTH 3QWOA 4P46C 4TNWF 3RY6C 1CCZA 4YHZL 3MRKB 5DMJB 4KH2A 1FNFA 1PDKA 1DN0A 4N5EC 3ARXA 1A6UH 4DEPB 3OKDA 4X83A 4K71B 1A9BA 3ZYZA 3HAEH 2LFGA 4LSTL 4DEPC 3B3IB 2GK2A 5EUOF 4JN2B 3D87B 5CHNA 4M48L 1ZV5A 1GZQA 5EZLA 4RBPH 2UZYB 4GLRH 5ALCL 3PL6D 4KRPB 2A6IB 3MA7A 2P5EE 1QFWM 4KRPC 1FZJA 3OJVC 1LEGA 5IMMB 4NRZB 2IQ9L 4R7NB 1XAUA 5BQ7A 3CLEL 4Y16D 1PVHA 4NQEB 1J1OL 3RTQB 3S5LB 2VTFA 4ZG1A 1JNNH 1GAFL 5L2KA 1OM3L 4X7FC 3RTQC 1NBZA 1QFWH 1S5IL 2QSTA 4BK5A 3OXRA 4W4NA 2BFVH 5J57B 2Z9TA 1PW3A 2X4OB 1VB9A 3MFFA 4F80A 2GQHA 5KW9L 8FABB 3HI1B 4C83B 2AABH 2PR4L 5IMLB 1FNEA 1JK8B 3MUJA 4JE4B 1JGEA 3IDGB 2BNUB 3QP3A 3ULVH 4OZGF 1U92A 4JPKH 1CLYH 4P23A 4XP6H 3MV01 4FP8L 4I0CC 4J3TA 1WBZB 1S9WA 4OI8A 25C8H 1G7LA 5F88B 4OZFB 3VXRD 1UXSA 4XNUH 5FDWA 1D5MA 3BPOB 2HFGH 1UXWB 4PJAA 2Q76B 3CC5A 2FZ3A 3BPOC 1SQ2N 2YD7A 3GEWB 4WO4A 1V7NH 1IC5H 1FVCA 4NBZB 4ODSH 2FO4A 5IV2A 1FAKT 1FZOA 4S1QL 1DFBL 4XGZA 3ARZA 1U8LB 3MUGB 3NPZB 1JHTB 4XCFH 1WC7B 3HI5L 4G6AD 2X5PA 4GW4A 4UT9L 2CUIA 2CLZA 4Q0XL 4GKNB 4CBPA 4L8DA 3SKJL 2WK2A 4LPYA 3C5JB 1G0XA 5D7IE 5IFHH 1MI5D 4N0UE 2OYPA 1MELA 3ARDB 2VLJE 1NBVH 3K4AA 3QHZH 4OTXH 4DTGL 2FX7H 4XT1C 2ZOLB 4MS8C 3ARDC 1OLZA 2DQJL 3I3EA 1Q9LB 3WD5L 1QLFA 4LSQH 4YZFE 2EDFA 3SCMD 1DBKH 2H2PC 3FQXB 5C92A 1Q72L 1EV2E 4OIAA 2AERT 2DIJA 3VFUA 1NL0L 3T2OA 4PRPE 1JRHH 3SPVB 1NUFA 4OD1L 5HHQB 1LK3L 3L5XH 1A1MA 3WHE1 5IEKA 1DE4A 3VRJA 5GQBA 4HWZB 3QO0A 4FTVB 5DRWA 5CIPH 1MCDA 1JHLH 4JQVA 1ZT4B 3O3BA 5JNYB 1U8OA 4QXGH 2UWEE 4PJCB 5EU4B 3TN0A 1ADQL 1S8DB 1CTOA 4L4TE 3UP1A 3T0VA 2VUOA 4Y5VB 3EGSA 2R0WH 1HH6B 4IMLB 1F02I 5CS7A 1V3MA 2CLRB 3KXFD 4HFWA 4XVUD 1BIIB 3L1OL 1LO4L 3MRQA 4Y5VC 3ALPA 3QDMD 3S35X 4X6CE 4JY5L 4KJPD 3LKNA 4D8PB 3AU1B 4TNVK 5IMOB 5EB9A 2O5ZH 1AQKH 1LO5B 3KYNA 3CAFA 4PBVC 1PY9A 2GT9A 2AXFB 3ZYIA 5AG8A 2FX9L 5KZCD 5C0DA 3O11A 3GJFA 4MDIA 2L0DA 2OQJB 4Z7NE 2BRRH 2ADIA 1W72L 3IAPA 3QQ4A 4WUUB 1A6WH 3W9DB 2GHWB 3CFBA 3HCVB 3DMMC 3G9AB 4EOWH 3CFEB 1A1OA 4Y19B 3RVXC 2D7TL 4OD2B 2ZSWB 1A14L 3AXLB 5IVXE 5JUEH 1YN6B 5KVFH 1JZ7A 2F54E 1J10A 2XQYK 2F5AL 4Z5RA 1FYTE 3VCLB 3HPLB 1NGYA 4B41A 5DJ6B 1R0AH 1UZ8B 1CD9B 3MJ8B 4ELKB 4N0FA 5EU5A 4LOUC 1NCCL 2EXWC 4L4VE 5FYLL 5LGJA 4XPTL 4ZUUB 3U0TB 4NZRL 4R6UA 1U93B 1BQHG 3ARQA 4KHTL 2JB6A 3O4LA 5A2KH 1IEAB 4XBGB 2IH1B 3QUMA 4RNRB 2VZSA