1YMHB

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 39
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB02
4Y2DB 5IHBA 2F8OA 1MRDH 4HS3A 4DN4L 3SEPA 1FNEA 4GRMA 4K8RD 1EFXB 2XXCB 1EH9A 3TF7C 3IFPA 3P0YH 5AYQA 4JQVC 3HMXH 4YLQT 4MCYA 5C0NC 1NUDA 2HKHL 3FMGL 4XNXH 2H6PB 5T1MA 1JN6B 2BOBA 2FR4B 4GFTB 3U6RA 1O7SA 1AO7A 5I1CH 4NWUH 3GSRB 4H0GA 4PY8J 1R3HA 2DKSA 1CFNA 2KH2B 4KPHH 2FJFB 3WXVH 1TZGH 3CSGA 4RAVB 1OSPH 3BIKA 2EXWD 3LIZH 2HVJB 5SWSA 2ZCHH 1KJVB 5CCKL 1ZGLA 3FTGB 3QPXL 3MFFB 2CDFB 3U4EA 1A1NB 4HGKC 5EU4A 1YPZB 5F7FA 4HFUL 3U7WH 1JZ2A 4NQED 3O6LH 1BEYL 1SY6L 4O58L 4X5WA 2QV2A 1KPUA 4EKXA 1UXSA 2N1KA 1AJ7L 5IFHL 2FBOJ 2DLEA 2W0LA 3W2DL 5D7IE 4Q9CA 1U58B 2OJEA 3GSNH 3MLWH 3W0WB 2NY6B 1W72A 3RVUC 3BISA 3U0WL 3L3KA 1OP3K 4NRXA 2F5BH 3MNVA 2E5EA 3FFCD 1WWCA 1WC7B 4YDVB 3V4PH 1NMBL 5DXWA 1X4XA 3HPLB 5C92A 3V7MA 1KELL 3RX5A 1J12A 5CEZH 1UB6A 1RAMA 1JYXA 3MLZH 4GG6A 3IJSB 4YEEA 1MLCA 1T89C 3O8XD 4EZMA 4MZ2A 1LDPL 1NC4B 3L3IA 3ZE1E 4Z78A 5E95B 2X89A 4IDJH 3NFSL 5JO5A 4XZUA 1BVKA 2A9MH 4HKXB 4ZUUB 4G9FA 3FB5B 4PJFA 4LRNL 3G6JF 4OQTA 2DKMA 2NY5H 4LCIL 3V8OA 2ADJB 4GW1B 3W9EB 1QOKA 1MREH 3K46A 3GBNL 4EIZC 4NRZB 2X9XA 2I27N 2VWEC 3CVHL 5JMOC 1NCTA 2X89D 1F6AB 3MLUH 4JHWL 3LKOA 5I8KL 3Q1SH 1H15A 4ZUWA 4BQ9A 3QIWD 4RMQA 2ZCLL 1PJ9A 4M5YH 1P4IL 3QUXA 3QO1A 4PJGE 5KSAA 2F9BT 1GXEA 4HULB 5F9AC 3BP7A 5C9JA 1QBAA 1TCMA 4NN6B 1KULA 5CJOH 4PJ8D 2ICWB 2GK0A 1G7PB 1OSZA 3HB3C 3L5XL 5JR1L 3BFOA 3ZHKA 3WJLC 4YHOH 1VA9A 1YEJL 5EZLB 3DX7A 5A40E 1AXSA 3UJIL 1G0YR 1JPGA 5CJXA 3TA3B 1FNGA 4NUGL 2HJLA 3A67L 3KYNB 1J10A 2R1YB 4JLRB 4CUCA 3EDEA 3BE1H 4PJ7B 4PJXB 3VFPA 3WUWB 1M7DA 2PCPA 3WFHB 3FO1B 2EDOA 2Y36L 3SKNB 3HE6D 4KK8C 4I2XB 5HHOA 5HGAB 3QDMB 4X6FB 2R56L 3EHBD 1MCWM 3WDHA 4J1UA 2ZSVB 5FM4A 4NOFA 4OI7A 1RZKH 3QIUC 1KG0A 3D69B 4XCFH 2H8PA 1WBXA 2CUMA 4HCRL 3UTTA 2FWOA 3GIZL 1L6XA 4XNMA 2BFVL 1GVIA 3JWOC 4L9LA 1OAZH 1MUJB 2GY7B 4OLEA 1HEZA 3QXDA 4MXQD 4WUUB 4O2EA 4LL9A 5FYJD 3MV9D 3WFZA 3HZKA 3UBXG 1FIGL 3O3BA 4LSQH 1RJLB 1FAKT 3EJYD 3ZKNC 3CXDL 1KTDA 3L7FB 4U3HA 5E9DB 1DFBH 4JDZA 1T03H 4NQTA 1JYVA 2VR4A 3EDJA 5D7IA 2HVKB 1K4CB 4V1DE 4IDLA 3DIFB 1QFHA 4QGTA 5HGDA 4CL7A 1A9BB 1XF5B 1KN2H 4YPGB 1KJ3L 4Z8FL 1IT9H 4MNHB 3FO0L 3EO1B 4YHNB 3PWPD 1LD9B 5D5MB 1Q9WA 2CMRH 1BJ1H 3TCLB 1IARB 1NDMB 1WTLA 2WBJC 2P44B 3CLEL 3FZUC 2AK1L 5IQ7L 1D5BA 1H3PH 3FQXB 5FB8B 4LRIA 3PE9A 1OGTA 1KCRH 3THMH 5IM7A 2Y06H 3LN9A 4L4TD 4NN5B 4QHNA 3K4DA 2HJFB 4CADB 2CUIA 4XCNA 3KPNB 1S9XB 5IFAL 3O9WA 4X6EB 3DYPA 2YN3A 2O5ZH 3QXAA 2BHYA 5LBSL 5ICZB 3JUZA 4L4VB 2OL3B 4X6DE 4OV5B 1QLRB 4MNGA 3DVGA 4B7IA 3IJYB 4XRCA 2V2XA 3DROA 3OKOB 3MREB 4PRIE 5KN5B 1NMAL 1JPFB 4BK5A 1QA9A 5HHPB 3QULB 5GZND 4WUKL 5IIEB 5F71A 4OZGE 2VXSH 5IMMA 2OTWB 5DK2A 1FSKC 1S7XB 3U79A 5F1NA 2Y72A 5E2VH 5CD5D 1AKJA 2X4NB 5BVPH 3B2VL 3UTZB 2EDEA 1BQUA 1CR9L 4ZOCA 5EZJB 3D0VB 2YPLE 3OAZK 4BSWB 3NFPA 4LIQH 1ZXQA 4PJGA 4OBSA 1ZEAH 4WO4D 4Y5YA 1P7QD 4JO3L 3N0PB 4KK9C 3S3JA 4BZ2L 4DGIL 1I1AA 2FSEB 4OZFA 2ZOLA 1J0YA 1TQCB 5DO2D 4RGOH 4FFWD 4D94A 1G6RL 1XCTA 4F80A 3U1SL 1J05A 4TQEH 2ARJB 1IC4H 5IMLB 4OCSL 2YD1A 3UTSB 4HH9A 4CN4A 4G8GE 1KB9J 3REVA 4JM2C 5E6IB 1X5YA 1BZ7A 3LKPB 1KJMA 1OLZA 2VDPH 2ADFH 1GGUA 3GO1H 4LCCC 5TDOB 3MRNB 4TSCH 1KN4H 1KEMH 3SJVB 3U30B 5CP3A 3TWCH 4JRWA 1EEQA 4KKBD 2VZTA 2EZ0C 4JANB 4R8WL 3VFNA 5ADOL 2IAMC 3IU4H 3VFGH 1TQCC 4WFGE 4J3SA 4FQIH 1SJHB 4MXVF 4FNLL 1CZ8H 2A74A 2QEJA 4PB9H 4JJHA 1XT5A 4NKQB 3FCTA 2B1AL 2Q7YA 2F54E 1X4YA 2A1WL 3MRBB 1I1FA 1EAPA 1IAOA 1J0JA 4Y8DC 3V4VL 4FHBD 3QFJE 4WY7L 1OARL 2HRPH 2V17H 3MODH 4KI5F 4APQA 4X7CC 4XMKL 3DMMB 1EVUA 4OCNC 4KKCD 3BGMB 4U6HB 4KRPD 2FIKB 3CXHJ 4LSSH 3D3VB 2YA0A 3VGFA 1FVDB 3T8XA 3ILPB 5KW9H 4K94C 4DCQA 1UXWA 3OJVC 4LVEA 5DEFB 3HI1A 4WTWA 4JRXB 2EDBA 4AT6A 3M17B 4Y4KA 3QQ3A 1UM5H 3IRZA 2QQNL 4OTXH 5ID1A 3JWDL 1YEDA 3DXAE 4V1DA 5SWQB 3MC0A 1P7HL 1H8NA 3EO0B 1BIIA 4PJCF 5DC9B 4FZ8H 4PGBB 2Z8WC 3GSOB 1V3LA 4IEFB 3SDYL 3ZYZA 5D93B 4HKJA 1NFDB 5T1LD 1HOCA 3FRPG 2OI9C 3CCHA 3OKKB 3R8QA 1PDKA 4JY6A 3BWUC 4GMSL 5EBLA 4JQIH 1FFOA 5GGUA 4ZD3H 3C60A 3RFZC 4U1GC 1FVCA 2ENSA 2OL3L 4PIRF 2PO6A 5DQ9B 4H88H 5C09B 3P4MA 4JN2A 1P1ZA 3C2AL 2OK0H 3U36A 2QHLA 2EO1A 1VFUA 3EYQC 3CMOH 5CWSB 4G7VH 5DJXA 4C56E 4ZXBB 1FLTX 4CMMA 5F9WB 4X6DA 3O6FC 1A6TA 5SWZE 1PSKL 3O2VH 1A4KA 1NGZB 5ILTL 1K8IA 4PRIA 3OPZL 2G5RA 1NAMB 2VQ1B 1JK8B 1QRNE 3SDDC 1YEEH 1DZBA 1QQDA 1JF5A 3NIGE 5D1ZA 3HHRB 3EBAA 2R8SL 1UT9A 3OQ3B 4OCWL 3DSNA 1CK0H 1A7QH 5HDBF 3D2UA 4MHHG 5FGBA 3KG5A 2BNUA 2P24B 4P5TB 4BZYA 2A83B 3K1DA 4WI5A 1VACA 3B9VA 1TVBB 2Z35A 4I0PA 4OF6A 5HDQH 3MLPA 5F9WC 3DSFL 2P5ED 3MJ9L 3TN0B 3MLTB 3F8UB 4D9QD 3FFDB 5DD6A 5D2NB 4FQQA 1YY8B 1A3LL 1QSFB 3D48R 1IAIL 1KIPB 4JY5L 2X5PA 1FG2B 1ZHBA 4S1SH 8CGTA 5J11B 3L1OL 5KG9B 2BSRA 3GSUB 1I8IB 4G43B 1DVFD 3GMOA 4X6BB 4P5TC 5I30L 5E7FA 4R7NA 1NC2A 4JDTL 1L7TL 1W0YT 2NY4D 4G8GA 4U1HB 1JZ3A 1MCIA 4JEGB 3UBXB 1BM3H 1D5IL 2FJGA 5L8KB 5DR5H 4GAGL 1MVFA 2YPLD 5D2NC 1FZOA 1NBYA 5GGRA 3RIAK 1B4RA 4HBQA 2OXHA 3NH7H 5CJBA 3VMPA 2BXZA 3F6LA 4R4FH 5JDSA 2VN4A 2P46B 1TVDA 2ATKA 2KZWA 3VXQB 2QQQA 3EZ8A 3CGTA 1GCFA 5HVHB 3DX8A 1RU9L 4AEEA 4XCYA 2F54A 3CH1B 1JMXA 5K93A 4IIQA 1Q94A 1A5FH 5EIIA 3BQUC 2GAZA 4KKLC 3N85H 1N3NB 4RX4D 5E56A 4Q58C 3RNQB 2ID5A 3B2UD 4E41B 1A0QH 4YFLF 1AY1L 5I17B 4QT5B 3AAZA 2X4PB 3UYOD 4YH6A 2DICA 3K2UL 4ODSH 4P23B 5IBTH 3ZYJA 2Y07H 5GSRB 1CLYL 2WLYA 3HE7B 2F5AH 3I6KB 4FQXA 4UNVA 4JR9L 1CE6A 3S3SA 4PJDF 3LRSB 4JPWH 3QG6B 3DXAA 1OAYL 1F11B 3VGDA 3QFJD 1RZJL 5DQDL 4KGJA 1A6UH 5JHDB 1IKFL 5BV7L 3MYZA 1RJCA 1AIFB 1ND0B 4O2FA 5I19L 1TETL 4M3JA 2FHBA 4LLYA 1MHPH 1OPGH 5JTWA 1M6OB 3HE7C 4UOW0 1NCBH 1BX2A 4MJIA 3SDXB 2FJHA 1CICD 2IPKB 2QADC 2P8LA 3HZYB 1NBVH 1NSNL 1NAML 3A6OA 3EYOA 4GT7A 4BH7A 3KLHC 2ZPKL 5J9PB 1A1MA 5IFJA 4PFEA 5F1OB 5AWNL 5IT2L 3QIBB 4DQOL 1GC1L 3PWVA 2YPKB 5SWZA 4HUKB 1ZAGA 3DBXB 2EO9A 5FUCC 1AD9B 3V7AG 4HIJB 5FV2A 4UB0L 3CUPA 3KVQA 1ITCA 4HIHA 4KK6D 1T2QL 2IADB 2KDGA 4YZFE 1S7RA 4LDOB 4M61A 1UVQA 3DTXA 4J3TA 1NCUA 1NJ9B 3H3PL 4YXKH 3JTSA 3WKMH 4A6YH 2ZCKL 2W60A 2Z31D 1OT2A 4CW1B 5CJQL 2DBLL 4M6NL 3VFUB 3V6OA 3NIDF 1QLFA 3EFDL 1FL6A 3V79C 1NANH 5K9JH 4C56D 4XHQA 3VXSB 2HTKD 5KJRL 1WBZA 4HEME 3QEQB 4Q9RH 2BCKB 1TFHA 1QBLH 4DAGH 1LVEA 1JMZA 3MA9L 3DWTA 1EHXA 5E8DH 1HH9B 3ZKSD 4L8SC 2XA8H 2VLRB 1QRND 2JLLA 3MJ6A 1E4XH 2E7BA 1AXIB 2GKIA 3CC5B 4QYOB 3DUUB 4ZS7L 3SDCD 2FX7H 2P5WB 3AU1B 3C09C 4NWTL 3UDWC 2GITA 1MRDL 4IRSA 2GSGB 1IMHC 3T3PF 1JRHI 4GRWF 3RY4A 5EOCL 1WCBB 5JDJA 3P0YL 3UTQA 1T0NA 4F58L 5L9DL 3MLRL 2GIYA 5DUBB 1YEGL 1LGVA 4PRPE 4XNXL 2UV3A 1JGEA 1LE9A 3INUL 1DTUA 3KPRB 2X40A 1Z2KA 5D7LB 5I1CL 4NWUL 4NKDA 2CIIA 5D8JL 3BYYA 3GM0A 4KPHL 3TBTB 3MNWA 2W0FA 5C07D 5E8OA 4DZ8B 5T1KD 3O3AA 3G6DH 5HYJA 3TNNB 4RISL 4HS6B 4WHDA 3VXUB 2YUXA 3H2WA 5EULV 2PXYB 1ORQA 1QVOA 2Q87A 5F7MC 3WHE1 2NLJB 1ZLVK 3EOTH 3OBAA 5IB3A 2IH1B 1SJXA 2CK0H 1ZA6B 4QRTA 4RGNC 4AL8L 4P2QB 3QAZC 2XOTA 2OJZL 1CXEA 1BVLA 5IB2A 2AI0H 5GGQH 3MR9B 5J0BA 4UDUA 3PDOB 3B6SB 1VHPA 3L3HB 3CFEA 2BDNH 4PRBB 3BJ91 3WCYA 5DQJB 3KPOB 5SX4I 4PGEA 2AAVA 3ULUH 1NEZG 1B2WL 1BD2E 1MCOH 2WANA 1DN0A 3RGVD 4XAWH 4YGVB 5HYSG 3VD7A 2Y6SD 3VJ6A 5JZ7D 3PWNA 1VCAA 4FQ2H 1A6ZB 5JXEC 3LQAC 1TNMA 2JELH 4KMQA 2FATH 3NOIA 1FH5H 1ZWIA 3VFOB 2MKWA 4BA8A 4MXWH 3RWGA 4BQCA 1LNUA 3G6JB 2DMBA 2R69L 3VH8B 2QQLH 2GY5A 3U83A 1I7RB 3L7EA 3WNKA 2YD3A 4WI2A 3CD4A 2X4SA 3WN5B 1MCLA 3HNSL 4X4YB 3MRDA 2MKLC 4KVNH 4Z76A 4KQ4H 5F7KC 4EN3A 1MEXL 2H3NB 3E0GA 4AY0A 3F7PC 1IAKA 2MPAL 3JV6B 4N0UE 4EDWH 5HYQB 2VITA 4E5XA 5EC2A 4K9EC 1PG7L 3UTOA 2XQBH 4NZUH 4R7DB 5HGBB 4JKKA 2P1YA 1VB9A 3OR6A 5DHVB 3WN5C 3Q1SL 2MHAB 2UUDH 4GRLA 4H20H 5HYEA 1J8HA 4M5YL 2JJUA 3OTTA 1GAFH 5DJ0A 3MRHA 4H0IA 1BWMA 5I66A 3IDMB 2WIIB 1F8TH 2Y4SA 4Z5RA 5D70L 1XIWA 3MMEA 3RWFA 3S35X 2XTJD 5KZCD 1ZT1A 1HXYB 3F65A 3X11A 3WS6C 3KYAA 1WV7T 1MFEL 2B0SH 2YXMA 3H0TA 4XC3H 5JIKA 3LS4L 1B90A 1W72H 4YE4L 4ODWB 1FYTB 3VI4F 1QEWA 4LPVA 1OTUD 3EDDA 4OUUB 1ZHKB 3QQ4B 4HJ0D 1NFIA 3HNTL 1D9KA 1G9ML 3IDNA 3MRIB 3SKMB 4UNUA 3MRCB 2X7LB 3G5XA 5I9QC 4PRPA 3ULVD 4KJWD 4D2NA 5IVZA 1HYRC 4HUVB 3ALPA 3BKMH 1PAMA 1NLDL 5FGRA 3BEWA 5I8OL 4QY8B 4X4ZA 3OJDB 1X5LA 5D7IF 4GKZB 2OLDA 3NPZB 4PP1C 4XCFL 1NUNB 4M7LH 4LLDB 3KJ4C 1E4JA 3X17A 1NFKA 4XPAH 1E6JH 4OQTH 4GUPA 3V0WH 2BJMH 2LVCA 4JHAH 4K7PX 1YNKL 4NC1C 4KVCL 1T03L 3QI9B 3ZE1F 5F8QC 1PY9A 4BFGA 4ONGH 2BNQD 3QEHB 3MV01 1G84A 4OZIF 1KPRA 2H32A 3LEYL 3D18B 5JW4M 1BD2A 2LAGB 4HJJL 3H3BC 3RVWC 4WEMB 3C5JB 1IT9L 4HUMB 5DS8B 4K3GA 4G7YH 2FHCA 5FXCH 5KS9A 4WHCA 4G42A 4YXLH 5FDWB 3JXAA 3THML 3VXMB 3SO5A 3DHMA 5E70A 4LFHD 2R2BA 1CDGA 4LF3A 3JVGA 1DQDH 4LKXB 1EAJA 2ZUYA 2O5ZL 3PDGA 4HAFA 2FL5B 1OQOA 1P7KA 2CDGB 1FZKA 3D87B 4FP8L 1EMTL 4S1QH 1U3HA 3CMGA 5IB5B 2VO5A 4OUOA 2D7NA 2APWA 5IQ9A 3MRPB 5C0AA 3IAQA 5GZOC 1CF8L 1LDSA 1RZIB 2H9GB 4I18C 2Y7QA 4N0UA 1F58L 3ARBB 3RWJB 1MNUL 3SDAC 3GSWA 4KMTH 4PD4K 1JGDA 4P4KB 3BW9A 2ZSWB 5L6YH 4M02A 3QUYA 3GHBL 4GLRI 4XP1H 3PIQA 2K9UA 1CQKA 5E1AB 2NY7H 2XXMB 2P48B 3MZTA 5A1AA 2GT9A 1RJYA 1C08A 1G9NH 4Y16D 1N0XH 4H1LH 5HHMB 4PG9B 5IJKC 2V5TA 4AJ0A 4ZS6C 1DQQB 3AXLA 1S7WB 4N8CH 2C5DC 3O6MH 1QBML 1P4BL 3ARBC 4CN1A 4G8EB 1MJ7L 2DQJH 4TQEL 4J3UA 3VRJB 2B7DT 3RZCD 3FQWA 4TNWK 4JFEA 1Z5LB 1F00I 5DMJB 1MRCH 3HC3H 4U0QB 1P5UA 2VL5B 2VDPL 5FA4A 2O5XL 3OKDA 1OTSC 4EXKA 2EDDA 4NC0B 1KN4L 2RAMA 2F53B 3AREA 3TWCL 1J1XH 4OKDA 4JFXA 1XF3A 4PBWD 3U0PA 1YEFH 5E5MB 4XHJD 5HYSB 1AGFA 3D5OF 5F9JB 2I9TB 1N6QH 4J6RL 1R3IL 4OFDA 3DJ9A 3OJMB 4B0MM 2DYPB 3VI3E 1GOFA 3CFJB 3VWJD 3L3GA 3F7YA 1F02I 4H26B 3BP5A 4M62H 1NAKH 1MWAB 4RGMB 4HK3N 5C9KA 5ISZB 1YNLH 3MODL 3CZFB 1YY9D 3K81A 5CGYC 5JPNB 1YYLH 4DK6A 1CU4L 4X6CB 3V9FA 4LNRA 1QLEH 4NQDE 3RGHA 3JBG7 5INDA 5DD1L 5IMOA 1T2XA 3STLA 1S7SA 4P3CH 2WWMC 2CK2A 3HG1D 3PHQB 5F7EH 2P8MB 4PJCB 4Y4FB 1RUPL 1A6AA 5HI5D 1FNSL 2VN7A 4O5LH 4PUBL 3RKDD 3VA2C 1DL7H 4QRSB 1PYWA 2BY1A 4OTXL 3SY0B 4G9DB 3MO1B 4KHTL 1J7VR 3DUHA 3OAZH 4YIQB 4U49A 5CMAB 1XH3A 4YBLC 3RTQC 3E3QE 4AEIL 2BVYA 5FFLA 4BSVA 4LGSB 4HDIA 3MCLH 5DUMH 1XZ0B 4PJHE 2A6DB 4F57H 2W65A 4EI5A 4OIIH 5FV1L 3I6GB 4Y4FC 4OZFH 4ZD3L 1LO3H 3PGFH 4ZTPL 4DOHE 2MMXA 4OZGF 4TOYH 1TPXB 1FJ1B 1PEWA 2D7OA 5I6XC 1EHAA 4H88L 3GHEL 1IGTA 1GSMA 2OK0L 5EFIB 1D5MA 3IDXL 3ZSSA 2D9CA 4EI6B 3PL6D 3T77B 3D85D 1WQVT 3OB0K 5DYOA 1ZHNA 5T5NF 3CMOL 3OXSB 2NTSP 2A0LD 1VFAB 2CPCA 2A6IA 1CFQA 5CP3H 3C5ZD 5F7WC 3MRQB 4U6YA 1UB5A 3OKMA 1FAIL 1YEEL 1JE6A 4ZAKC 4WNQB 1TPXC 3W81A 5D1QD 4X4XA 1WZKA 1AHWA 1CK0L 2WLZA 1V7ML 2VLLB 5CSZA 7FABL 2XIDA 4P5KB 4TPRL 3TVMB 5EU5A 2VXQL 3C9NA 3U46B 4MDJB 3RIAF 1NGXA 1U8OA 5J6HA 1INQA 1RIUL 1WAAE 5EO9A 4L4JA 4G6KL 4QWWD 3MRGA 1LO5B 1J87A 2DIBA 5JQHC 1SJEA 1EVTC 1RVFL 5EPMA 5MEOB 3Q5TA 4X5LA 3R1GL 1HQ4B 1IQDA 3WS3B 1KNOB 2EC9U 1LP9E 4JY4A 4P2CG 1JZ6A 5IBLC 5ALCH 1DR9A 1Y0LB 2H2SC 1JZ4A 1MIEL 3C6SB 5IW6B 3SGEH 1IL1A 1SYSB 2EH8L 3KPQB 4MJ4A 1UCBH 1UH4A 3LV3A 3ARDB 5CD3B 3TIEA 3W9DA 1FN4A 5FGSA 1DANU 1LILA 2I07A 3FONA 1RURL 4KY1H 3O6KL 2Z92A 3B9KC 4Z6AT 3GB7A 3MRMB 3P0VH 2AJXH 4FMKA 3BOVA 2OQJA 4DKFL 2EKJA 2G5BB 1FO0B 4ZUVA 3GEWB 2AV7B 4L8BA 4YXHL 3BPNB 1JTOA 1T6WA 2KQMA 4PGZA 3D25A 3MCKA 3OF6D 1KENL 4P57A 3MLXH 3V2AR 1UYWL 3KXFD 1XGTB 2ESVB 4GS7C 1PZUB 5I71B 4FZEL 3T2NL 4NQDA 4PJDB 3TO2A 3W11D 4ODSL 4U0RC 1OGAD 5IBTL 1BOGA 5EA0H 3DUSA 1CG9A 1IM3A 3O3EB 5IVXB 3BHBA 4OFYD 4DGVH 1LO4H 3E6FA 4M7KH 4C83B 5F6IB 5KVEH 4HV8B 4QXTB 1P5VA 1I4FA 5F44A 4U6XA 2IQAB 2R4SL 2NY3D 1OL0A 5I74B 5EU3B 5GS3A 4NIKB 1ACZA 5B8CB 4HMEA 1XCQA 5I71C 3IFOA 3QUZB 4KTEH 4MAYD 2J88H 5EUOB 4AK1A 4N1CA 1HINL 2OSLB 1RUQH 4X7SL 1CQYA 5I1IL 2K7QA 4PJHA 1KJ2B 3AY4A 5E5UB 2RIKA 4XMPH 3NIGF 1KB5B 3ORJA 4Z7QE 1JPSL 1Q0XL 3HAEB 2UVEA 3BH8B 3K80A 5LKNA 2BHZA 4UINL 1ZLUK 4M9PA 1L7IL 4F33B 1Q9LA 1MI5A 2D7TL 4KGLA 1NBVL 3ARGC 3LSOA 4JFQA 2G75A 5I1AB 1NEUA 1FZJA 4OGAD 4XBGA 1BFVL 2OMNA 4L8CB 4IMLA 3EGSB 4EUPA 3IJHA 3IGAA 1YMMA 2YWYA 2CLVA 1S7VA 2L7JA 1GZPB 4HGWB 1IEBA 1WSST 5BZWA 3ELAT 3HZVB 1CYGA 1UG9A 3GMNA 1SY6A 3WKML 5FEBA 4I48B 3T65A 4KJPC 1JV5B 4LLMA 4C4KO 5FK9B 2ZJSL 2DMCA 4GOSA 4NQEB 1UZ8A 3ARFA 5DEGA 3JV5A 2HWZL 3T09A 5D1XC 4Q9BA 3OR7A 4HZLB 3PWUA 2VE6B 3G5ZA 4P9HL 4Q9RL 5F88A 1KIRA 1R3HB 5I18L 4R96A 4XBPA 2EDNA 4N90E 3A0OA 2VWEE 4JO4H 1KIUA 3WV0A 2XFXB 3LN5A 5CZXC 2ORBL 4U7MA 5E8DL 2XA8L 3WJJA 2XN9E 5AD0A 3B83A 1KYOK 4GRWB 4OZFG 1LP9A 1N2RA 4YAQB 5A16B 1I3GH 1KEGL 4R2GD 1WFNA 1YECH 2XKUA 1YUHB 4WWKC 4M43H 5C0GB 1KCUH 4OF0A 3QJHA 1N64L 4ZUTB 2XV6B 1FO0L 4K2UL 4IBLT 3FQTA 4EDXA 1CD1A 3O8XB 4HWNA 3OKEB 4AENB 4DKEH 1INEL 1NPUA 3KNBB 2DWDA 2VR9A 4JJ5B 3QRFM 4PJIE 4Y5XC 3FOLA 3VXPA 1S7TB 2BSTB 3S37X 5IG7B 4DEPC 4M6ML 2DM3A 3W39A 1IGCL 3UPAA 4P46D 3EJZD 3GGWA 1T1WA 4KJYB 4IRJD 3LN4A 5L0QB 1NGPH 2AK4E 3ARPA 4K7PY 5BO1L 3EW3B 3O3UN 5L88H 3DURA 3NAAL 3V6FA 1U2HA 1X44A 1HXMA 3EKCA 3TPUA 4BELD 5ESVA 4UIMA 1CLOH 4YK4B 3BKJH 4JG0H 3T3ME 5GS0D 4JQXA 2X1WL 1XFPA 1ES0A 2R2EB 1TDQA 1NL0L 1R5IB 4NO3B 1YN6B 3VWKD 3X13B 2AJSL 5J1SC 4U4BA 4Y2DA 3QIWB 5GJSH 2FX9H 2BHUA 3UYRL 1V3KA 1EFXA 2PTVA 4PJ7E 1RULH 2BERA 1KFAL 2X4TB 4I0CC 5GRYA 4J4PC 2LABA 4KROC 4PJ8B 3U4BH 2MCPH 4K8RL 2D9QB 1Y6MR 2H6PA 5LCVH 5C0ND 1JN6A 4O02H 3TZVC 1MCOL 4FFYL 3IAGC 5KSBF 3EZJB 2H26B 2GK2A 3QT2A 5E99L 4Z95H 3GSRA 3ARYA 4OQ1A 3EYUH 3RA7L 2PETA 1RUML 4RAVA 2JELL 1UM4L 2FATL 3QDGE 1LO0H 3HNVH 4YZFF 3NVQA 1AFVH 3E2HC 2HVJA 3VFRB 1EHNA 5DF0A 1KJVA 4MXWL 2BRQA 3MFFA 2QQLL 4N9GB 1A1NA 1FL3B 1CFVL 1RD6A 1RZ7H 2MTPA 1YPZA 4R90L 5LGJB 2PTTB 2AQ2A 3HE6B 4N0YL 5A2JH 5T3ZD 2GK0B 4QXUH 1XR9A 1UA6L 5ACMA 4KUZH 4KVNL 1MJ8H 2O5YH 3MJ8B 2E6PA 4M00A 4KQ4L 1OAQL 1T89A 1FNGB 3DVNB 2ZUQC 2APXA 4R0LB 1U58A 3W0WA 1FZMB 2A77H 3RUGE 5IBUB 3RY6A 3FAWA 5CS7A 1M71B 2UWEE 4LLQB 3RVUD 3RPIB 4YDVA 1WC7A 2FBJH 2G9HB 5MP6H 2XQBL 3UC0H 3HPLA 5D5ME 4TUOB 1F4XH 4HPOH 3MV9B 4WV1B 4RAUB 3ZE0F 2IBZX 3IJSA 4LSVH 3KAAA 1JCKA 5JW3H 5H37H 2EDFA 4F8QA 1NC4A 4R0LC 2JTDA 2B1HH 1F8TL 4JCLA 4CVZA 4OLVL 4HKXA 1QFWH 4LARH 4ZUUA 3L3OB 4JHBA 5I76B 3PWPB 3MUGB 2WWKT 4O2EB 2ADJA 4GW1A 4HXAH 5DVLA 2FEEL 5GS2H 1YJDL 3MBEC 3W9EA 3BXNB 4OZHF 5TPWH 3BZEB 4DN3H 3TNMB 4X83A 1ORSB 4MQ7B 4L4TB 4NRZA 4YDJB 3GJFH 4UV4H 3SE8L 2XRAH 5IHLB 5D7IB 2VZSA 4MD0B 4Z7OE 1F6AA 3UCRA 2DQCH 4HLJA 3FRUA 4DTGH 2XN9D 2Q7NA 4K07A 3FQNB 3WEXA 2AJYL 1ZT4A 3RJDA 2FX8H 3H8NA 4W81A 2AK4A 4ZPVB 5H2BB 4FQHA 3VMNA 3BIAX 1OD7A 5INCB 4OIAA 2ICWA 4M7LL 4PY7B 1G7PA 4BZ1H 4YHZL 5BZDB 4XPAL 1E6JL 3IKCB 5L7XH 5EZLA 3HB3D 3RBSA 3V0WL 5F96L 4JHAL 1VADB 2QSQA 1I9IH 5DA0B 4P5MB 5E8NB 3TA3A 1FC2D 4M8QB 3B9DA 3KYNA 3RDTD 4OZIB 1UKQA 3QDJE 2R1YA 4JLRA 2ICES 2RCSL 1I9RL 4PJ7A 4PJXA 4YHIB 3WUWA 2CR6A 4ZOEA 5FCUH 4RCAA 3WFHA 2V2XB 4MMZC 4WO4B 3FO1A 4JB9H 1J5OH 1P7QB 3VXRD 4TVPH 5GZNC 1T1ZB 3WFBH 4EEEA 4ZG1A 3LEVH 2EYTB 1QA9B 3SKNA 1HHJB 4NT6B 5KAQF 5HGAA 3QDMA 1ZE3C 4RMRA 3D69A 2H2PD 4YXLL 4I8DA 3QIUD 3NTCH 3SGDI 4XVSL 2C3WA 4GXVH 3WBDA 4OM1H 4DUVA 4Z7NF 1MUJA 5CINL 4WUUA 3RWIB 3D3VE 4OCXH 3EO9L 4GXUM 5DO2C 3HMWH 2ZOLB 2B4CH 5KVFH 1RJLA 4JN1L 4OFVA 3L7FA 3VGGA 2JJTC 5E9DA 3OL2A 3ZKND 3F7VB 2FB4H 3RAJL 2ZG3A 3NABH 2A6JB 2EIZB 4O9HH 2HVKA 2ADGB 1K4CA 3REVB 1BZ7B 3QDGD 3DIFA 5GRUL 3ZE2E 1EJOL 1A9BA 3QCVL 1XF5A 4YPGA 1LWRA 4NKMB 5GS1C 4KKBC 3QHFH 4K3HA 4MNHA 2HT2C 3EO1A 1NFDE 4YHNA 4KRPB 1LD9A 4BFBD 5D5MA 2QQKL 3I75A 3WIIL 1OAUL 3ARQA 4LLUA 1NDMA 3TCLA 3OMZA 4U6VL 2F8VA 3UJJH 3L3JA 2WBJD 1J86A 1IC1A 3FZUD 3FQXA 5FB8A 1SYVB 1L9MA 2VXUH 3PHSA 2X1QA 1X5GA 2CQVA 5MHSE 2Q7YB 3T0AA 4CADA 3KPNA 1MRFH 1EAPB 3ABZA 2OS7A 1DBJH 4ONHB 5FO9B 4X6EA 1EBAA 1SMAA 1QSEE 3ARVA 3O6ML 4KKCC 5ICZA 3M8OH 3VGBA 5EOTA 4L4VA 3KLSA 3HFMH 4OV5A 4XNZB 1QLRA 2DQJL 5T1LB 3IJYA 3OKOA 3MREA 1N7MH 3QXWA 2H32H 5KN5A 5CIPB 3DVFA 4U1SA 3HC3L 5TF1H 5HHPA 3QULA 1S9WB 3HI1B 5IIEA 3LPGA 4LVNB 4Y4KB 2OTWA 1S7XA 1J1XL 2I60L 3C8KB 2EYRB 2X4NA 4AQ1B 3UTZA 4OJFH 1K8DB 1HKFA 4DGYH 5EZJA 3D0VA 4OD1H 3D39D 4BSWA 4M9OA 2CKBB 3VA6A 3P9MA 5D2NE 3T04D 2R2CA 2AEQH 4M62L 2C3XA 3MA7B 5FYKD 3WYRA 2HTLC 1G7IB 1YNLL 4KK9D 5TQ0H 2FSEA 4XPFH 4JAMB 2PTUA 1HCFX 3MJ9A 3BT2H 1QLEL 2XI9A 1F6FB 5EORH 2NY5C 2ARJA 4UQ2B 5IMLA 1S7QA 1H0DB 3RVTC 1BLNA 3UTSA 4LPXA 2P43B 3TLRA 1IQWH 5E6IA 3LKPA 2P5EB 2XNAA 4JM2D 4WJ5B 4CMMB 1I8MB 5DC0A 4O5LL 2FYYB 3B4NA 5TDOA 3MRNA 3SJVA 1DL7L 5D6CB 1OAXL 1FLRH 4JANA 2G60H 2EZ0D 5D1ZB 3UO1H 4CRPA 1SJHA 2IAMD 4NJ9H 4OZGB 1JWSB 1DVFB 3AS1A 4S1DC 5DUML 4M93C 2PYED 2B5IC 2NY4B 4F57L 1VPOL 5IHZB 4OIIL 3MRBA 2NY2D 3TCXA 5A43C 2HKFH 3VW3L 4WFFE 1LO3L 3QDJD 4E0RB 3BO8B 3RI5K 2YPLB 3DMMA 4LSTH 3BGFB 4TOYL 1NUGA 2X4UB 1C5DB 4NKIH 3V6ZB 4G6JH 3BGMA 3DGCR 4U6HA 3S98A 1AD0B 2BVQB 2FIKA 3D3VA 4UOW1 2UZIH 4MX7A 1FVDA 1JWMB 2BOCB 2CO7B 4RSVA 5K59E 1VDGA 3U2SB 1DVFC 4Z77B 5DEFA 1WFUA 5J12B 4JRXA 3M17A 1QSZA 4M1GL 3ULSB 3VCLB 4G5ZL 5SWQA 3ZDXE 3EO0A 3BGFC 3VDCA 4PGBA 3GSOA 4RWHA 1HSBB 4NO0D 3L5HA 1NKRA 4X7DC 1I3UA 1XEDA 1ZANH 5ITFB 1NFDA 1OAKH 3NIFE 5FKAB 1PY4A 1RZKC 3GBLA 3OKKA 2VISA 1VFBB 5JDSB 5I1GL 1FNFA 5FUCE 3H42H 4GG8B 3SDDA 4LSPL 4OCYH 4UNTA 5DQ9A 1R5WB 1T22B 1T7ZA 5C09A 4P2OC 2ZUXA 1IEAB 2BY0A 1AGBB 1HZHH 3RX7A 1F3DJ 1HH6B 3B2UC 3CFKB 3QFJB 4HLZH 5CWSA 3MV8D 2ZWLT 5B22A 1HHHB 4ZXBA 3EYQD 12E8L 4M1CC 4MQSB 4Q7DA 5DHYB 3WXWL 1JYNA 4OD3H 5F7UA 4XNQB 2EYSA 1NGZA 3O6FD 3O41B 3VI3F 4I3SL 3X12B 4G6AD 3VD3A 1NAMA 1RK1B 2VQ1A 1JK8A 1UCBL 3DRTB 1RV6X 1UGNA 1CICB 3SDDD 1MHCB 2CKBL 3QZWG 1T5WB 2AEPL 4ZO7A 2HH0L 2P24A 4P5TA 2X05A 3P0VL 2AJXL 2A83A 1HQRB 5J4MA 3QH3B 1TVBA 1QSED 3GI9L 2JIXD 3TN0A 3MLTA 4NHCL 2XKSA 3CDGB 3CX5K 3FFDA 5D2NA 1YY8A 1YMHB 4OT1H 4QHMB 1KIPA 1H3VA 2IPTH 2IQ9H 3JSSA 1FG2A 2VLRE 3GMPB 4YC2B 3BZ4B 3AC0A 5KG9A 1RZFL 1DLFL 2VKWA 2Z31B 3GSUA 2P5WE 4YEFA 1AR1C 4PJHF 4QXGH 2AABH 4LEOB 5IWLA 5I1LB 4U1HA 1L0YA 5HI4C 3BPLB 5IK3B 4LU5H 4C56B 2YC1B 1LO4L 1TJIH 2EXYC 4WWID 1CDYA 4LVOB 1VEOA 4U1JB 1QRNB 4P99A 1HSAB 3VXQA 2Z31C 2GJZA 4XPBH 3HI6L 3SDCB 1E27B 5DMIH 4YX2H 3MCG1 4L3ED 3WFEL 3CH1A 1IAII 3TO4C 3DNKA 3KWWB 5CUSH 1FPTH 1QLFB 2F15A 1T1XB 2FNBA 1N3NA 4QXWA 3BQUD 4KKLD 5IESL 3VXUE 4E41A 1CL7H 3I2CL 2VZ1A 5I17A 4ODUA 4QT5A 3ZZ1A 4BQBA 5J89A 2A9NH 2X4PA 2IAND 4LVOC 1R5VA 4JO2L 5F7LB 4Q2ZB 4QTIH 1HYSC 4QRPE 5ADPH 4P23A 2DQHH 1ZTXH 5GSRA 1B0RB 2V2TB 2NQCA 3OZ9H 4Q0XL 3HE7A 3MLYL 4NFCA 2F19H 3SDCC 1R3LB 3I6KA 1DDHB 1WAAF 4N0FA 3NCFB 5KAQG 3L9RB 4CVXA 2VDRL 3J7HA 5C07B 2E9JA 2GITB 1M05B 3LRSA 4M5ZH 3QG6A 5T1KB 3P73B 1F11A 3T2QA 2DWEA 2IBZY 3BH9B 3F5WB 3P4LA 5JHDA 1ZOXA 4G8FB 1J0HA 5GHWH 4NYLB 5FUZH 2HN7B 3VGAC 1RFDL 3CK0H 1AIFA 3IRPX 3MV7E 5EO1B 4B41A 1JGEB 3C8HA 1LE9B 1M6OA 3ZTNH 1U95B 3KPMB 4H8WL 5EU6D 4MNQD 5EU7C 5IUSA 1WWAX 3SDXA 2CIIB 2IPKA 1W2KT 3B8YA 3GMQB 3G6JE 4GKSB 1H5BB 2KQNA 3PNWB 2QADD 3HZYA 4PJEF 4QKXB 1T20B 5TDNB 3WNPA 3IDYC 5E08L 3V52H 2DB8A 1E28B 3BN9C 3RGVB 2HT3C 3FJTA 5J9PA 1MCWW 5DC4B 3KLHD 5LGHL 1TMCB 1BZ9B 2F58L 5DRXA 3QIBA 3HUJE 1YECL 4EXPX 3MRKB 3DBXA 4R4BB 1AD9A 1KCUL 4HIJA 1BVLB 3NA4A 2IADA 4F7CB 3PV6B 2FECL 4L8SA 1ZGLP 2R0WL 1NJ9A 4MS8C 4DKEL 5FYLE 5BS0D 4CW1A 5C86A 1LQSR 5DJDB 5FM5O 3CU1A 1S7UB 2W9DL 4DWHA 3FMGH 3VFUA 3BN3B 1ZLUH 2Y6SC 3DV4B 1ZS8B 1DN0B 4BSJA 2DKUA 5JZ7C 4RBPH 3WNOA 3QEQA 5F3BB 4OCMC 1NGPL 2BCKA 1SVZA 5BXFB 5L88L 4JCMA 4ZODA 4YGAB 1HH9A 4RFNC 2VLRA 3HCVB 5C0EB 4JG0L 4JKWA 5CCKH 1J0ZA 5A3ID 3UZEA 4QYOA 4EUPH 3QPXH 3DUUA 2VXTL 43C9B 2LU3A 2LAAA 4JFZL 2P5WA 1BJMA 3AU1A 2NYYD 4OIBA 1II4E 4AMKL 2ADIA 3WLBB 1BEYH 1FYTE 1QO3B 1SY6H 2GSGA 2PW1B 4O58H 5EZIL 2R0ZL 4Z7QF 5KSBB 2X1XR 4HLZG 3MFGB 1RULL 1WCBA 5C7XL 5IFHH 3W2DH 1F3JB 5JW5B 1WEJH 5DUBA 2MCPL 5CBAB 2XTJB 4YDLB 4JZNB 3KPRA 4NC1E 5KZCB 2Q8BL 1SEQH 5D7LA 1A7PH 3NCBB 4YJZL 1TZIB 4XP9L 1NMBH 1OP5H 5L8JB 3EYUL 1KELH 3TBTA 1BBJB 3UBXI 4ZUSA 4DZ8A 5GRJL 3ZLQC 4X99B 5TGBB 1IAMA 3TNNA 3GRWL 3ARSA 4HS6A 4IOSD 3VXUA 2PXYA 5FOJA 3FKUS 4NBZB 2NLJA 2VDOH 3HC0A 5DJ0B 5D96B 5E4IA 1NGYB 1RZ7L 2IH1A 3NFSH 1MY7A 1ZA6A 2XTJC 4Z0XB 4P2QA 3MSPA 1BQLL 4OZ4A 4RGND 1BQHB 5I1KL 4TVSa 3MR9A 3L5WB 4LCUB 1Z9SA 1MJ8L 2D0FA 2O5YL 3B6SA 3PDOA 3L3HA 3L3DB 1Z0NA 1UWXK 1XGPB 4U1NB 5GRZA 4PRBA 3PXJA 4LCIH 5B38B 2EE9A 4HC1L 5DQJA 3C6LD 4ODXB 4FXGB 2VLKD 4IJ3C 3GBNH 3PXHA 4YGVA 2RFXA 3QZWB 4LHUD 4PLKC 3MXWH 3PP4L 3UC0L 5ERWB 4F3FB 5I0ZA 4MDIB 4AIZB 3V4UL 1LO2L 3ULVC 4KJWC 4HPOL 4X9GA 5C3LD 1A6ZA 4NQVB 3FT3B 4QRPD 3TEUA 1PX4A 2WW8A 5JXED 3SKUD 1UENA 4ELKB 3VFOA 3MOAH 2ZCLH 2ZKHH 5C8JB 3TESA 3G6JA 1JPTH 1P4IH 2XYCA 1JWUB 3VH8A 3D1MC 2BNQB 1I7RA 4NC2B 4PJIF 2B1HL 5GSVB 5I15L 1CFTB 1U92B 4OZHB 1A3QA 3CNKA 5D7JC 3WN5A 1QFWL 2UVFA 3L5XH 4LARL 3SGDH 3EYSL 5AAMA 2VLJD 4GUPB 4X4YA 3N1QC 3UJIH 2YD5A 4UI2A 5C0BE 1KOAA 1SQ2N 3MV7D 1V8HA 5C0DA 1HCVA 2JCCF 4D9RD 4D8PB 3A67H 2VAAB 2H3NA 1MCRA 3G5VA 3SPVB 4BYHA 2AW2A 4AYFA 3JV6A 3CAFA 4ZFZB 5HYQA 1JPST 1EEUA 1INDH 2AGJL 5CEYB 2NTFB 4R7DA 5HGBA 5DHVA 4DTGL 1KPRB 2GSIB 4PR5B 2MHAA 1GOGA 4RFOL 4PJ7F 3RVVD 3B3IB 4LMQI 2R56H 2Y23A 2CIKB 1ETZB 2VH5L 4OLYL 3IDMA 1ZSDA 2WIIA 3MXVL 1E4KA 1FORL 3EYVB 1ULVA 1LK2B 4LDLB 3GIZH 4TN9A 1HXYA 5L7XL 3KLAA 2BFVH 1DQJB 5AAWA 1I9IL 1ZVSB 2CDEA 5FYLD 2R2BB 1WTGT 2IGFH 4ODWA 1F6LL 4GBXC 1FYTA 2VB5A 4U3XA 3CXDH 2PN5A 4OUUA 4Y16B 1ZHKA 3QQ4A 3LB6D 5FCUL 3MRIA 1L0XA 2F53E 4KV5E 5D4QA 3SKMA 2YBRA 2R29H 3MRCA 2X7LA 1T0MB 3RIFK 5J56B 2C3VB 1NBZB 1SBBA 4DVBB 4RWYL 2E8YA 1KJ3H 2R1WB 3ESVF 4Z8FH 4HUVA 3RZCB 4QY8A 3NZHH 4FS0A 3OJDA 3E1F1 4GKZA 3SOBL 3CLEH 4O4YL 3RUGF 5ISZE 4LLDA 5IQ7H 1XF2B 2WUCH 4JO1H 4Y16C 4PGCB 2I24N 1C08B 3PHOB 5IB4B 1JGLL 2UWEF 4GXVL 5KSUB 1A2YB 4HMCA 5FOBB 4X6CE 1A7RL 4OM1L 5C2UB 4NFBA 2CD0A 5LGKA 3RL2B 3TH2T 2YUVA 4PJCE 3IU3A 1QPPA 4EUPG 3QI9A 3ROOB 3NABL 4K23L 3VWJB 1J88A 1NMAH 3QEHA 4XP5L 1K5NB 4WW2F 2VAJA 1UCTA 2MQCA 1YEIH 3D18A 4WUKH 3C5JA 3QHFL 4M6OL 4PRHE 4UTAH 5DS8A 3RVWD 5TE6L 5HHQB 1CGTA 5HVWA 1SHMA 3HG1B 1YEHL 5FDWA 1CR9H 3VRIB 4RMVA 2R23B 2IEPA 2VXUL 3VXMA 2VUOA 3O3DB 5BCAA 2WMPA 4OGXH 3L3GB 3BP5B 2QLVB 4Z7OF 1DE4B 4LKXA 4BZ2H 1DBJL 4DGIH 1XMWA 1WWWX 1CWVA 4JM2F 2FL5A 2X2YA 2XICA 2Y5EA 1I85A 3QXVA 2CDGA 4HX1B 1PX3A 3HFML 3U1SH 1S5HB 4MHHI 5J13C 4ODHL 5DJ8B 4OCSH 2ZP0T 5DT1H 1JL8A 4ELMF 5IB5A 3H9YA 1N7ML 3ULUC 3MRPA 3LEXB 3MGTB 5C0JB 5GZOD 1DUZB 4HWBL 2O93L 5JXAH 2AJZB 3ARBA 3RWJA 3AB0B 3D9AH 5DJYB 1R6VA 4P4KA 4HJGB 2ZSWA 3SDAD 3PL6B 2D31A 3D85B 4Y4HC 4FA8A 5ADOH 4HBCL 1XH3B 4NQXB 3VE0B 4OJFL 4FNLH 2HT4C 4HUNB 3ARUA 2ZG1A 2BP3A 3C5ZB 3EOBB 5C0BD 4D3CL 3ARWA 1EXUB 4PG9A 2A1WH 4UOJA 4HUXB 1DQQA 3P0GB 3V4VH 4ZS6D 4WY7H 1OARH 1S7WA 4BJLA 4ZNEE 1JUFB 2PYFB 5D1QB 4K71B 3S34L 3LZFL 4G8EA 2KKQA 3BT2L 5CKGA 3S96B 3VRJA 4KAQH 3PL6C 9CGTA 1LK3L 3RI5F 1Z5LA 1CBVL 3OX8B 2A0LC 1IZJA 5DYOB 1HKLL 2VL5A 2AXJA 2VRAA 3C5ZC 1M4KA 3RL1B 4XBEL 3HN3A 1DP0A 5C0IB 3UMTA 1OTSD 2F53A 1AGEB 5DGQA 3JWDH 3SCMD 2O61B 3TYFB 5HXMA 4PJ5E 4RZCB 3U7YL 3M07A 2G60L 5E5MA 3QUMB 4URTB 5HYSA 4LPUA 4X4XB 5F9JA 2I9TA 1I3VA 2DYPA 5IJVB 2C4FT 3CFJA 4H26A 5EU5B 3ZE2F 1BWWA 1MWAA 3OWEA 5ISZA 1DLHB 2DLIA 2OBGA 4MA1B 4CJ1A 3CZFA 2OL3H 5JPNA 4QWWC 4PJAF 3O11B 4X6CA 4GAJH 5CGYD 4BH8B 4G6JL 4OF8A 4N1HB 2AJ3B 1R3KB 5EPMB 2QSVA 2IMNA 3ILQC 1XF1A 2GJ6E 3PHQA 5C08E 2P8MA 4PJCA 3S4SB 1EO7A 5IVXE 2WWMD 1TCRB 4Y4FA 2BVPB 4OLZH 2E7MA 4NZJA 1PSKH 1UJ3B 1CIDA 4LK4A 4U7SA 4QRSA 5ILTH 3SY0A 4G9DA 1FQ9C 3MO1A 4UTBH 5I8CB 3NZ8B 3B5HA 3KXFB 5CMAA 1IGML 2B20A 5FGCB 2R8SH 4CMHB 5EUOE 3KPPB 3RTQD 2NY0D 1ZANL 2ILLA 4PREB 3MUY1 1XZ0A 1EO8L 1OAKL 1OGAB 4PBVC 2A6DA 1JNLL 2ZUVA 3I6GA 4L29B 4L1DA 1X6NA 3MQIA 4TUKL 3DSFH 3MJ9H 1UJ3C 4OCYL 4ZAKA 1FJ1A 5E2WH 1QTYT 2NY3B 5EFIA 1X5AA 3LQZB 4JY5H 2E27L 4OF5A 4L3AA 4EI6A 2E7LA 2X9YA 3T77A 4CMHC 2FGWL 3L1OH 4MAYB 3P3YA 1GPOL 3OXSA 1VFAA 1KTLB 4PRHD 5HBBA 5T5FL 1EJ6A 4M1DL 4QOKD 7CGTA 5I30H 3KYKH 3MRQA 2RJMA 1L7TH 4WI3A 3RVXC 3NIDE 4HK0B 1D5IH 4WI4A 5IP4A 5M94B 4K94H 1FGVL 4GAGH 3QUXC 4JREB 4N8VB 3QNXB 2NY3C 2DQUH 1S9KC 4JG1L 4Z18A 1JHLH 3VRLE 2AERT 2VLLA 1CE1L 4NQEE 4P5KA 5M7QA 3TVMA 1FG9C 1JNHB 3C87A 3U46A 4MDJA 4ISVB 1CGYA 1RU9H 4PGDB 4XPHL 3DLQR 4J3OC 5GXBB 1LO5A 1H8SA 4OT1L 1C8PA 3NCEB 4HG4J 1KSRA 2IPTL 5MEOA 1HQ4A 4DOHB 1XF4B 3WS3A 1KNOA 2YD8A 1J8KA 4ZFOB 1AY1H 3FFCE 5HY9B 2XZCL 1Y0LA 4C4KT 3LY6A 4LOUD 4X0KB 3C6SA 5IW6A 3K2UH 1SYSA 3BPOB 3LSOB 4QXGL 3KPQA 1QHPA 3B5GA 3BDBA 3HRZB 1CLYH 4LKCB 1IJ9A 2HFTA 3BDYL 1TQBC 3ARDA 5CD3A 1Q9OA 3WUWG 4U1MB 1IM9D 1WGOA 3ARTA 1S7VB 3K2MC 3S35L 4PJ5A 3MRMA 1OAYH 1M7IA 4XXCC 3B9KD 5BZWB 1RZJH 5DQDH 2G5BA 1FO0A 1G9NC 4L9LC 4R2GB 2R4RH 2AV7A 2SEBB 5DMIL 4FQLH 1OHQA 1U8QB 1GZQB 5I19H 4JKLA 1N5AB 3GKWL 2C3GA 5CUSL 3WUZA 4O51B 3ZDXF 5DDHB 1XGTA 2ESVA 1CL7L 3MNZB 4JGUA 5FDYA 2AXHA 2A9NL 3R0MA 3NIFF 4PJDA 4QTIL 1NSNH 1NAMH 5TDPA 3I9GL 5FIEA 4PJ5D 4NO5B 5ADPL 5A2FA 5C08A 4P46B 5IVXA 1ZV5A 2WQ8A 4IRJB 4C83A 5T3XE 5AWNH 5IT2H 4DQOH 1GC1H 4HV8A 4QXTA 3SO3C 2IQAA 2J5LB 4YPJA 5EU3A 1QRKA 5DZOA 2EDTA 4UB0H 5DMGD 1U41A 5B8CA 4LRIC 1G7LB 1NCDL 2WM0A 1J0IA 1ITBB 3QUZA 5EUOA 1V5JA 4PB0L 3S36X 3SE9H 4K7PL 2QSTA 2ZCKH 4ZFGH 2OSLA 3KS0H 5CJQH 4PJEB 2DBLH 4QO1A 3VWKB 2K1MA 1KJ2A 1MVUA 3BVNB 4P46C 3EFDH 3EJZC 3T2PA 5HD8D 2GJ6D 5C08D 2JK5B 1KB5A 1T1WB 3SKJL 3HAEA 3EOAB 1NCCH 1TNNA 3BH8A 4Y19D 3QXTA 3IDIB 5FYJU 4F33A 4GH7B 3V6FB 3MA9H 1CVSC 3V52L 3QHTC 1J1OL 3ARGD 3L6FB 5I1AA 5GS0C 1U8JB 5BVJB 1IKNC 4ZS7H 3VWKC 1KF9B 3AS2A 3QYCA 2QSCH 3EGSA 3X3FL 4NWTH 4WCYH 3X14B 1OY3B 4JRYD 3Q2CA 4G6MH 1GZPA 4HGWA 4AIOA 3HZVA 1R24B 4ETQB 1XGQB 3P4OB 5EOCH 4Y5YC 5F7HA 1KPVB 4I48A 1KV3A 1JV5A 5L9DH 4F58H 1MFDH 3MLRH 1MAKA 5FK9A 1MFBL 4KJPD 5FYJE 3MV9E 1YEGH 1FVEB 4NQEA 3UPCA 1I1RA 3DYOA 4WU7B 3INUH 4NRYB 1FFNB 4HZLA 5D8JH 2VE6A 5D1XD 1CFBA 5IEHB 2XFXA 3DI3B 3BGAA 3VI4E 5CZXD 4RISH 4JPIB 4YAQA 5A16A 3FFCA 1M7XA 2J8UF 4RMTA 3PWPE 3VFWB 2PW2B 3LRHA 4E9LA 1DCLA 1YUHA 4AL8H 5C0GA 4X4MA 4WWKD 2OJZH 4ZUTA 3PQYD 4NHUB 1FFQA 1XR9B 1Y6NR 1VGEH 4L4TE 1SMOA 3O8XA 1MF2H 3OKEA 1A22B 3HC4L 4AENA 4ZNCD 3RWDB 1WEJL 3KNBA 4JJ5A 3BP4B 1AXTL 3HI5L 3OGCB 2DL2A 1B2WH 2DQIH 1S7TA 2BSTA 5IG7A 4JFHE 1NANI 4N0CC 5F72S 1SEQL 1BJ1J 1A7PL 3KR3L 4JVUA 4KJYA 4G6FD 1NDGB 4ALAL 4DZBB 4XVTL 5LG1A 2YD7A 1E4XI 3FOMB 3STZB 3B9AA 4HUWB 2NXZD 2R69H 2VDOL 5EBWB 2R2EA 1G7MB 1N59B 1R5IA 4NO3A 1YN6A 4CVZB 3X13A 3T0ED 4DUWA 2XN9B 4S11A 1P84K 3QIWA 4OZIE 3HNSH 4NNXB 5GGVY 5ESAB 2X4TA 2GEEA 1N5YL 2G2RA 1K2DA 1B88A 1MEXH 3C60C 4S1RL 4J4PD 4PJ8A 4KROD 2MPAH 4LCYB 4OI8A 1BFTA 3K8LA 3TZVD 2H26A 3TH4T 3HUJF 5C0RL 3MXWL 1PG7H 4AIXA 1OLLA 4PJIB 1F4WL 3FRUB 3RDTB 1HWHB 2J2ZA 3H9SD 3WIHA 5F1SA 3WEXB 4GKOA 3K8KA 3VFRA 1ZT4B 3MOAL 5T3XD 2ZKHL 3V5HB 5E00B 1JPTL 2AK4B 4HWZA 4N9GA 3WNMA 1JNNH 4FQHB 3VXRB 1FL3A 2OR7A 4Z76B 3O45B 2JCCB 4KK5D 5LGJA 2PTTA 5D70H 3F7QA 2NZIA 3HE6A 1HNFA 2JB6B 1I9JL 2HA1A 3FB6B 2XKNB 1IGJB 3MJ8A 1WISA 5FGBC 1MFEH 5BMFH 5J6GB 3RDTC 3DVNA 4W6WB 4NKOA 3LS4H 2FO4A 4R0LA 4JFFE 4YE4H 1I8KB 3F12B 3QIUB 1GH7A 1FZMA 5E94B 2QBWA 1M71A 4LLQA 1U8PA 3HNTH 3RPIA 1G9MH 1INDL 3ARZA 4W6XB 3WFDH 5I1EL 4KDTA 2G9HA 4TUOA 3MV9A 4WV1A 1D6EB 1Z9LA 4RAUA 2BSSB 3UYPA 2D03H 1ADQA 1NLDH 2JJVA 4YBQD 2P47B 5I8OH 3EDFA 3RIFF 2ARWA 2W9EH 4RNRB 1Q72L 2H2PC 2LQRA 1C12A 1T0PB 3TJEH 5CEZE 2OR9L 1GGCL 3LQAH 3QDGB 1UWXH 1EIBA 1SVCP 5GIRB 5HGGS 3WSQL 1MCCA 4NP4L 3L3OA 5FUOL 4POYA 1S9YB 5I76A 3PWPA 5F70A 3MUGA 1V7NL 2CLRB 4MCZA 2IGFL 4QRQB 1YNKH 4KZEL 3BXNA 4G80B 2WBJB 3MBED 3PUCA 4IOFC 3BZEA 1RZ8B 3TNMA 1ORSA 4MQ7A 5K9QG 4L4TA 4M7ZC 4KVCH 6FABH 4YDJA 1H3GA 4IIQC 4M6AA 4MB3A 2Z9TA 1MH5B 2R29L 3I50H 4MD0A 3CFIC 5E2TL 2EDQA 4WHTB 4OCLC 3LEYH 4OFKA 3RUGB 2VIRB 2APTA 1FBIL 3FQNA 4XX1E 4HJJH 2UWEB 1QR1B 3VFSB 4XH2B 3NZHL 1BREA 4ZPVA 4O2CB 5H2BA 4V2BA 3I75B 5INCA 2ED8A 4LLUB 2LU4A 4FQXC 5F7YC 4PY7A 4MD4B 3L3JB 2WUCL 4JO1L 5BZDA 3IKCA 1VADA 1FSKB 4P5MA 5E8NA 4M8QA 3PG2A 2FEEI 4OZIA 2OR8A 4X7FC 4WW2B 4JFHD 4P9ML 1CCZA 2P5EE 5EOTB 3D39B 4FP8H 1EMTH 4YHIA 4D9QE 4ONOA 4LGRB 4WO4A 2AXGB 3S8WA 5DHVH 1QSFD 1P7QA 1ACYL 5GGTL 2LVEA 1CF8H 4U1SB 1T1ZA 4OFIA 2EYTA 1O5DT 2PNDA 1JRHL 1YEIL 5LVEA 4ZMAT 1KXVC 1F58H 1I7TA 4XVUC 3BRDA 1MNUH 1HHJA 4NT6A 4UTAL 2NXYD 2FLBT 3LDBB 5HHVL 3GHBH 3HMXA 3NGBC 4MA8L 4X80L 4AH2B 3K7UA 4WW2C 5SX5H 4OCRL 1AP2B 2R0KL 3LOWA 5CP7B 4JM2B 3UTPD 4P2RD 3NACL 3P9MB 4I77L 4LCCB 4OGXL 4JKPL 3JV4B 4ELMB 3VXOA 3RWIA 3X3GH 1I9EA 1PQZB 1XGRB 5DA4A 4ZTOL 2IAMB 1QBMH 1P4BH 1NMCC 2EDLA 1MJ7H 3LDBC 2ZUUA 3F7VA 4YFDB 2PYEB 5DT1L 3JWOL 1S7QB 3V6OC 2A6JA 3ZDYF 1BLNB 2EIZA 3UPRB 2ADGA 5ICYB 3BKCL 3QDJB 2XPGB 3WE6B 3GIVB 3T0DA 4TUJB 2XNAB 4FXLA 2GCYB 2DQGL 4QLRA 2O5XH 3DPBA 3GKZA 3MUHL 4NKMA 5JXAL 3NCYS 3D9AL 2Z4QB 1MIML 2BK8A 1FDLL 4J23A 3QA3B 3ECBB 2HT2D 1RSFA 2GYSA 2I5YL 3SE4C 1JTPA 4Z7WF 4J6RH 1R3IH 1SYVA 3QEUB 3IETB 3WFCL 4KV5F 2NY2C 5JNYB 3HRPA 1UACL 1PZ5B 3HA0A 2D7PA 4ONHA 5FO9A 4JFFD 3RX8A 3I3BA 4NO0B 2XZZA 1CU4H 4J8RB 1FCGA 5T1LA 4KAQL 5DD1H 5CEXB 4MJ5B 1FFPB 2ENYA 3TIDB 1TITA 2OI9B 2LE9A 4MX7B 3QDHA 5CIPA 1RUPH 1S9WA 2DIAA 4U1GB 1FNSH 4X6CF 4PUBH 4W70A 3QNZB 4YDKH 3C8KA 4KHTH 3FB8B 3BZFB 5CEZD 2EYRA 1K8DA 1U91B 5DMKB 4Q6YA 4AEIH 4AEFA 4PJAB 1YYMH 5JIIA 2CKBA 3O6FB 3DYMA 4JM4H 2VISB 4HHAB 4RFEB 3TV3L 3MA7A 1G7IA 2HJKB 3HLAB 4ZTPH 2HTLD 3SDDB 4JAMA 1E4WL 15C8H 3FQRB 4GAJL 2EEBA 2IFFL 3GHEH 3AM8A 4LIQE 2YD2A 4UQ2A 3S37L 3RWEA 3IDXH 1H0DA 3T4AB 3NA9L 5ENWB 4BKLA 3WL9B 3RVTD 1QSEB 1UC6A 2JIXB 4WHYH 3SHSA 4ZPTA 2P5EA 4OLZL 4WJ5A 1I8MA 3GBML 3QR2A 3RWHB 1N6UA 3CJJA 2EYSB 2FYYA 4U1LB 2VOTA 2EE3A 4G6AC 5D6CA 2ICEB 5IKCB 1UH3A 4UTBL 4LEXH 1FAIH 2C1PB 3V6BR 4N0RA 5BQ7B 1HDMA 4OZGA 1JWSA 5DURD 1VESA 3O4LD 1DVFA 3V95A 5E1HB 1V7MH 2YD9A 1C1EL 4S1DD 7FABH 4N8PA 4TPRH 5IHZA 2E6JA 5LWYL 2VXQH 4NZRH 4E0RA 3BO8A 4U6TA 2OCFD 2KZ1B 1WLHA 2YPLA 2A6KB 1U8LB 1FGNL 1RIUH 2DQTH 4EN3C 2X4UA 1C5DA 3V6ZA 1TJHL 2XWBB 4G6KH 3VH8G 5E2WL 4IRZL 1AD0A 2BVQA 1RVFH 4XNUH 1QD0A 3AUVA 4N5EC 3R1GH 1JWMA 2BOCA 4DW2L 3U9PL 3U2SA 5LQBH 1EO5A 4Z77A 2Y25A 5EU7E 3O2WH 1MIEH 4L3EB 1F2XK 3KYKL 2EH8H 5CBEB 5C07E 3WDJA 4OV6F 2Y5TB 3ULSA 2YD6A 3VCLA 4FG6C 4RX4A 2DL9A 3O0RL 2VDLH 3BQUB 4K94L 3BPCB 3K3QA 5EB9A 1HSBA 2IANB 3VDAA 2DQUL 5ITFA 3ET9F 1JHLL 1RURH 1MQ8A 1XIWC 3O6KH 5B4MD 5FKAA 4LVHC 3T0WA 1MWAH 1VFBA 1WK0A 4Q74A 5CZVL 4DKFH 2GJZB 2FH6A 4GG8A 4YXHH 1MJJB 1R5WA 5L2KE 1T22A 3F62A 1ONQB 3O2DL 4UU9B 3IDGB 1IEAA 3TBYB 1RUAL 1AGBA 4P2OD 4CBPA 1KENH 2DQDL 1HH6A 3CFKA 3QFJA 2B4CC 1UYWH 4AG4L 1LEIB 2R39A 1WJ3A 4G8IB 1HHHA 2V2WB 4FZEH 4ODUB 2EEDA 3T2NH 5DHYA 2RQ8A 1R5VB 5TFSH 4XNQA 4M1CD 2EDRA 2ITCB 1BF2A 1CGSL 4NQUA 3O41A 3X12A 2VMFA 4LQ1A 2J7LA 2B2XL 1EBPA 2HFGL 1N6VA 1RK1A 5EU6B 3DRTA 3ARXA 1CICA 4NN7C 1MHCA 3G08B 4N0FB 5KVGL 1ODAA 3BZDA 3QJFB 2ERJC 2QADB 1T5WA 4CVXB 4GW5B 3HS0B 3GZKA 2PR4L 2R4SH 3VU2A 4PV8B 3R06B 4TTDD 2PF6A 3BUTA 1HQRA 4NNYB 2DWEB 3T0XA 5IVXF 3QH3A 2ARJQ 2R4RL 4CVUA 2EECA 1HINH 1DEDA 3CDGA 4FQLL 2VQUA 4X7SH 5I1IH 1YMHA 3KHQA 3H7LA 2VQTA 1BAFL 4QHMA 3NCJH 3GMPA 2FZ3A 3BZ4A 1JPSH 1Q0XH 5EUOF 4XXDB 4UINH 5DD5L 4KDWA 1L7IH 2Z31A 5BS0B 3SGEI 4HIXH 4NQCD 2D7TH 2EDWA 4LEOA 4F9PA 1AR1D 3QWOB 5I1LA 5IK3A 1UJTA 4C56A 5HI4D 5KSBE 1EHLH 2YC1A 3RWCB 5CLWA 1BFVH 5DRXB 2EXYD 5DD0L 2I9LB 1RUKL 5AG9A 1X5KA 4U1JA 1QRNA 4Z7UF 2XTJE 5HYIA 4OGZA 4L8SB 1HSAA 5HVGB 3SE9L 3SDCA 1S3KH 1TTUA 1E27A 2X4RB 3KPTA 4ZFGL 3JVGC 2YPVL 5ALBH 1A7OL 2YRZA 4Q97A 3C09B 2ZJSH 3KWWA 2HWZH 1F3RB 1S78C 1T1XA 4JDVB 4JFDE 3TO4D 1U8NB 2P4AB 3QUKB 4LCWE 4KWUA 5E7BA 1NCCL 4P9HH 2DM4A 1BBDL 3FT2B 4LASL 4PG2A 4Q6IB 5DVOA 5I18H 3VRLF 4GW4B 4Q2ZA 4JHZA 4PTUB 3PGDB 2ORBH 1TVHB 4WRLA 3ULVE 1HYSD 5A3IC 5LJYH 1B0RA 4I9WD 5BRZD 5KSVB 2V2TA 1R3LA 1DDHA 3GRWA 1KEGH 1GOHA 2NYYC 3QUYC 2QSCL 3L9RA 2VTFA 3A6BH 3TFKC 4WCYL 5C07A 2ADIB 1M05A 1XGYH 4G6ML 5T1KA 1N64H 1FO0H 3P73A 4K2UH 2XTLA 3ES6A 5ACLA 3L95B 3MACL 3ZE0E 1MLBB 2Y9RT 3BH9A 3F5WA 4WHYG 4Q6IC 4G8FA 1HI6A 4CKVX 4NYLA 1INEH 1RJZB 2HN7A 2LTQC 1B0GB 1MFDL 1LMKA 2E7CA 2COQA 5EO1A 3P77B 3AS0A 4P59L 4HC1A 4WFEE 1QFUH 4M6MH 4RGNB 3QAZB 1U95A 3TBSB 2NZ9C 3KPMA 2C3HA 1IGCH 3N50A 2R1XB 2J8UB 3GMQA 4GKSA 1H5BA 3PNWA 5BO1H 2BNQE 4NM4L 3TT3L 1T20A 4KRMB 3NAAH 5TDNA 1WVZA 3C6LB 3I6LE 4ZUSB 3GSVA 2VLKB 2H1PH 5GGVH 1E28A 1FP5A 4L9DA 4OZHE 3RGVA 3OJ2C 3BN9D 5C3TA 1CTOA 3AREC 4LHUB 2HT3D 1BZ9A 3HC0B 4JZOB 3GSXB 3MRKA 1J1PH 1IC7L 1NL0H 3G9AB 4QRPB 4R4BA 4XNYH 2AJSH 2F74B 1ED3B 4OZ4B 2VDNH 3BSZH 3UYRH 3H3KA 4F7CA 1K4DB 5FHAH 2XY2A 3PV6A 1VGEL 1A64A 3EFFB 4GMTL 1KFAH 1MF2L 1MCSA 2EH7H 5L2KD 3C6LC 5AZ2L 1KJ2H 4I4WB 4MS8D 5DJDA 3SBWC 1S7UA 5KVMC 1JGVL 4Y1AE 4K8RH 2DQIL 4V2CB 1KB5H 3DV4A 1ZS8A 1S5IL 2AEWA 3HAEH 4FFYH 1HHIB 2VLJB 2RFXB 3QQNA 2NY1C 5JLZB 5FA3B 3UP1A 5E99H 3QG7L 5ANMB 5F3BA 3MV7B 3RA7H 5BXFA 1OT1A 2ZOKB 1RUMH 5ICXB 1BECA 1UM4H 3DRQB 5B21A 3HPJB 4R3SB 3HCVA 2D7MA 4HKZB 3IF1A 5C0EA 4XGZB 3LKRB 3VD4A 3T0BA 2ZG2A 1HHGB 43C9A 4UQ3B 4X8JB 5J1AB 1T21B 5FO7B 1JGUH 4DKDC 1CFVH 4R90H 4EBQL 4N0YH 3WLBA 4HIIB 1QO3A 2PW1A 4ONFH 5KSBA 1UA6H 2UZYB 1DEEA 1VERA 4MAUL 3HUJB 4EI5C 1OAQH 3SQBA 3IDJA 1F3JA 5C0DB 5JW5A 1K3ZA 3CFBB 5ETUB 1TLKA 5E2JA 2JF1A 3G5VB 1UWGH 4KKAD 5CBAA 3MX0A 4JZNA 3RJQB 5MENE 2VL4A 3UJTH 3LS5H 1DUYB 1TZIA 5I2IB 4Z7NE 1FHGA 3KPSD 5CFHA 1KB9K 1BBJA 1JHKH 5CGMA 2CRMA 3RVVC 4GRWH 5IGXH 1JZ7A 4MYWB 4X99A 5TGBA 3BX7C 4GKNA 3UXFA 5IROA 1WIUA 3E6HB 4MZ3A 5MI0C 2GTZA 1VENA 1JNNL 1FFRA 1NGYA 1A9EB 1ZSDB 4Z0XA 1KLUB 4LPCA 1MFAL 4OLVH 4ZO6A 5I9QB 1BQHA 4FQJL 1AHWC 2D0HA 1IAIM 3UROR 3KLAB 4LCUA 3L5WA 1S8DB 4U1NA 3L3DA 4MGXA 1XGPA 2CDEB 1RHHB 5BMFL 4LPWA 1B0WA 3V0VB 4MA3B 4AEHL 1OP3H 2WP3T 5B38A 1NCAL 4PRAB 1YJDH 1CI5A 4ODXA 1KIQB 4FXGA 4QRRE 4JFDD 2AJVH 5FECB 3ZDZE 3LB6C 4LCWD 3KJ4B 3OKYA 3QZWA 4K3DL 4Y5VB 4RRPA 3WFDL 3SE8H 3CXHK 2YBRB 5ERWA 4F3FA 4PLKD 4MDIA 4AIZA 4X5XB 4UT7L 1KUMA 1XR8B 4NQVA 3FT3A 3HG1E 1MCQA 3OKNB 4TSAL 1UKTA 3ULUE 2BNRE 2AJYH 2J4WL 2D03L 2XT1B 4KTDL 4IS6B 2CXGA 4ELKA 4ZFFB 3EJJX 4F15C 5C8JA 1K6QL 1MHHB 2W9EL 5CILH 1JWUA 4F9LA 2BNQA 2D7QA 5GSVA 2AJUL 3K4AA 3TJEL 3LQAL 3IXAB 1CFTA 1U92A 4OZHA 3M1BB 1P69B 4YHZH 1SJVA 2FRGP 4Y5VC 5D7JD 5F96H 4HFWB 1OCWL 2EDJA 1WFTA 4D8PA 2VAAA 3DV6A 3RPKA 3Q3GB 4WFED 3SPVA 2AV1B 5HTSA 3IU3B 1A14L 2RCSH 4ZFZA 1N8ZA 1I9RH 6FABL 3UZQA 2Z8SA 4X98B 5CEYA 4HF5H 3I50L 2NTFA 3WIHH 1B9ZA 3I6LD 1BP3B 2E3VA 2GSIA 4PR5A 4FXKB 1KC5L 4Z7VB 1HILB 5TJWK 4HWBA 3B3IA 4K9EL 3W82A 2CIKA 1ETZA 2IFGA 2CKNA 3VFVA 3PGCA 5IVNA 4LSDA 3ZKMC 3BIBX 1QFWI 3EYVA 4I18B 5SWSE 1LK2A 3MBXL 4XVSH 1HE7A 4FTVD 1LHZA 1DQJA 3ZKXC 1ZVSA 3SDAB 1I1CA 4OM0L 5CINH 1BPVA 4XPGL 1KT2B 4I5BB 1MCKA 4Y1AD 3EO9H 2HFFB 1E6OL 1EEYB 4JN1H 4GBXD 5JHLH 2BRRL 5C0CD 5FYLL 4Y16A 3AY4C 2R9HC 5C0BB 2CO6B 3RAJH 3N1MC 5FYJH 3V0AC 4FABH 3S7GA 1P6AB 1T0MA 3TJHC 2AEIT 2C3VA 5GRUH 1NBZA 4EJ1C 1EJOH 5H94B 4DVBA 1P2CB 3QCVH 3CPLB 1AQKH 2R1WA 4TSBL 4X9FA 1LE5B 4M7JL 1K9TA 2CJUH 1F5WA 2W1NA 3ZMRA 1VEPA 3RZCA 1B4JL 4YHKL 1PLGL 2D31B 1X5FA 4LAJH 2QQKH 3G5YB 3EYFB 3WIIH 1OAUH 2BMKB 3VD5A 4U6VH 2KBGA 4GG6E 4XCEB 1XF2A 4C55A 4PGCA 3HAEG 5IB4A 3PHOA 5KSUA 1A2YA 5FOBA 3N9GL 3O81A 5L2JA 3SCMB 5D7SL 5ECJE 3K0WA 3RL2A 3X3GL 4GQPH 4FFVC 5IW3A 3GMLB 4JPVL 2P7TB 5MEND 4NZTH 4F7EB 2IG2L 1VSCA 4GJTB 3ARFC 3ROOA 3VWJA 3V8CA 3GNML 1MJUH 1K5NA 3KXFE 4TNVK 4QRRA 1YQVL 3S5LB 3OKLB 3WDIA 5FGCE 4Z7WB 4HPYL 4LQFL 3SCMC 1DBKL 2I60H 5IV2B 1OGAE 5ESQB 1IGYB 5HHQA 3OXRB 1B3JA 1UQSB 1VEMA 2Q86B 3HG1A 1DQMH 2BNRA 4XTRC 5C71A 2UY6A 2W9LA 2YN5A 3VRIA 4DKAA 3PJSA 2R23A 3FT4B 3GDBA 4I3RL 4UIKL 3O3DA 3H6JA 1C5BL 3CVHB 4ZSOB 4HSQA 1IVLA 3IXTB 1DE4A 4XCCL 1I7UB 3TBWB 1U8HB 3T4YB 4QRRD 1JI1A 4PJ9C 5E8PB 1T7WA 4YBLB 3RTQB 2NY0B 4HX1A 2EC9T 1S5HA 2OX5A 1WZMA 5DJ8A 4F2MB 5GRWA 2YOCA 2Q8AL 3FN9A 3LEXA 3MGTA 3ULUD 2BNRD 2WINB 5C0JA 2L4OA 1AC0A 1CXHA 2YD4A 3QFDB 2W0PA 4B5EA 4EVNB 3ZT6A 4U1KB 1DUZA 3DGGB 1H3WM 2AJZA 1FRGL 4F7MB 5DJYA 4YDKL 5I6XB 1GGYA 1OAXH 3LD8C 3AROA 4HJGA 5F1IB 3T0VA 1DANT 3C08L 3LH2H 3PL6A 3D85A 4ZDHB 1EZVX 2YKLL 1NKOA 2X70B 4NQXA 4Y4HD 3VE0A 2NY0C 1V3MA 4JQXC 5HHOE 4B53A 1YYML 5DI8B 2YR3A 1GGTA 2HT4D 1H8OA 4PRHB 3QPQD 4QOKB 3C5ZA 3EOBA 4Y2DC 4JM4L 1EXUA 5F9OL 1VPOH 4H25B 3PDDA 5DJAB 3VW3H 4HUXA 3UTTE 4R4NC 3MRRB 2GTWB 1JUFA 2PYFA 5D1QA 5DJ6B 4ZAKB 4C54A 3RQ3A 3HTLX 15C8L 2W91A 2UUDK 2V7HB 3S96A 1LEGB 3VXNB 5T1DH 4PRNA 4CU8A 3OX8A 5IOPB 2EDKA 43CAB 2DAVA 1AO7D 4UT9H 3RL1A 1F90H 1KCSL 5J8OA 1CT8B 5C0IA 2N7AA 2FH8A 1AGEA 2O61A 3QNYB 4M1GH 3TYFA 4RZCA 1AGDB 4G5ZH 4LEXL 3RZWA 5I73B 3U82B 3QUMA 2YMXL 5SWSD 1WT5C 4XC1L 5IHUL 2W07A 2E9IA 3MRFB 4P2YA 5TE4H 4RAHA 5DFWH 5DD3H 5IJVA 1EGJL 5I1GH 4EOWL 3KJ6L 2JJSC 4NZRL 2OZ4L 2NX5E 1DLHA 3HR6A 1PKQB 5ITBL 4LSPH 3RP1A 3PP3K 2DQTL 3CVIH 5KANG 3O11A 1IM9B 4BH8A 5MEPB 2DLTA 5AZEL 4XNUL 4YO0B 5CIPH 5I73C 2NY6C 2AJ3A 1R3KA 3B9KB 5IMKB 3RY6C 4K7FB 5M95B 4JGMA 3IFLL 4IM8A 3S4SA 3ILQD 1TCRA 3WXWH 12E8H 4LOUC 8FABB 2BVPA 5LQBL 1A6WL 4HUUB 4MNGE 3O2WL 5DWUL 1UJ3A 2GHWB 4I3SH 2D3VA 3OF6A 1U3ZA 3WO3B 1BFOB 1C16B 1RZGB 3QBTB 5I8CA 1DN2A 3NZ8A 4KDVA 2VDLL 3KXFA 4ZOAA 5IBUG 5JA9A 5IR1B 5A2KH 1Q9OB 1SBSL 2CKBH 3KPPA 4GS7B 4D0BB 4M3KB 2AEPH 4PREA 2HH0H 4PJEE 5JOEA 1OGAA 1YEKL 5HSFA 4LAQL 4PJ5B 1MWAL 4JFOA 1M7IB 4U0RB 1YDPB 4L29A 3GI9H 4G9FD 4OFYA 4AZ8A 4NHCH 5E2UH 1OWWA 3QWQB 5I16A 1H3TA 1RIHH 5DJZB 3WIFB 1T66C 1RK0B 1GL4B 3LQZA 3BJLA 2MOVA 2XQYK 4JZJB 4QHLB 4E42B 1RHFA 2YS4A 4MAYA 4WDIB 1RZFH 1DLFH 4Y88A 2BVUA 1KTLA 4CVWA 5TFSL 1EX0A 4JFYB 2Q76B 3LPWA 1OM3L 3OAYK 5TDPB 4DFHA 2GJ6B 5C08B 3ZT5A 4HK0A 5B39B 3RVXD 1UFUA 3MRLB 4LNVA 4Y19B 1CLZH 4N8VA 1EPFA 1G6RB 3QNXA 1JP5A 1T3FB 3QUXD 3MJ7B 5KSAD 3ZYIA 1F4YL 4NN6C 5DMGC 1MPAL 3AMKA 4JZJC 2WIMA 3IS1X 2YK1L 2DLFH 4HWEL 3ARGB 5T3ZE 2WBWB 1JNHA 1Z0MA 3HI6H 3QEGL 1YZZA 3TA3C 1A4JB 1AI1H 4ISVA 4BFIB 4PGDA 3WFEH 5HD8C 4U2ZA 4JRYB 1MVUB 3FN0H 4PLOB 3NCJL 3MJGX 1DBML 1MCJA 1WF5A 1XF4A 4XXCA 5IESH 4OGYL 2X6MA 4WTZA 2XWTB 3I2CH 3BAEL 4ZFOA 5HY9A 1F4HA 1T5XB 1MFCL 4X0KA 1A3RH 4JO2H 4HIXL 4H1LA 4Q9QH 1QKZL 32C2A 4Z7UB 3HRZA 2FLRT 4ORZC 4Q0XH 4LKCA 4KJQD 3MLYH 1EHLL 4M8VA 5JOFB 5HHOD 5D1XB 4WI8A 5T33L 4U1MA 4P4RB 2VDRH 3QQ9C 1ZVYA 4L3CB 3T2OA 1TJGL 2YEZB 1KLGB 1NCNA 3UTTD 1EUUA 1U93B 1S3KL 1RFDH 1U8IB 2SEBA 4QF1B 5ALBL 2VZ3A 5F89A 2WWKO 1U8QA 1GZQA 4LDEB 3Q6GL 2L0DA 1N5AA 2GJJA 4WWKB 5HI3C 4BM7A 3PQYB 4O51A 1WZ1L 4H8WH 2NX5A 4QHUB 5DDHA 3KYMB 2CRYA 1WAAA 1OP9A 3MNZA 3E8UL 2J6EL 4YWGL 2MWCA 5JOPE 5E08H 3MLVH 4NO5A 4Y5XB 1C7TA 4ODVL 4DEPB 4P46A 4DUXA 5LGHH 3O4OB 1YN7B 1G7HB 3FFCB 5FKPB 2F58H 4IRJA 2DTML 4G6FB 2B39A 4U2YA 1P9MC 4ODBD 5K33A 3JWDC 1XGUA 3HR5B 4OKVA 3A6BL 2AKRB 4YR6B 1XGYL 1X5JA 3VG9B 1RIVL 1G7LA 1T1YB 3UZVB 2NX5D 4HIEB 4NN5C 4TULH 1DBAH 2R0WH 2NXZB 4NPYB 5MERB 5DK0B 1IKNA 4PYHA 1ZLSH 4W4OC 4PJEA 3VWKA 3RU8H 3QWRA 1DBBL 2W9DH 3O9WD 3T0EB 3LMJL 4YQXL 3BVNA 3IFNL 1QFUL 3CFCH 4OLWL 1IGIH 5GGSB 1E0OB 3O4OC 1Q1JH 1DQTA 2JK5A 1A1OB 1CL7I 3WMSA 3F6IA 3EOAA 3IDIA 5JW4N 3K1KC 4OBRA 3VXRE 5MEQB 2JCCE 4R9HA 3PWLB 4JQVA 3VG9C 2QKIB 1T83C 4KROB 1PGRB 2H1PL 5GGVL 3L6FA 1T2JA 1KACB 2NXZC 1U8JA 3TZVB 5BVJA 2C1OB 2VXTH 4JFZH 2VABB 1A47A 5E6YA 1J1PL 1PKOA 3T0EC 4CNIB 1IBGL 4QGYA 4AMKH 1RY7B 2W59A 1AKJD 3H9SB 3QWRD 4XNYL 3X14A 2UZXB 3BKYL 1GHFL 5EZIH 2VDNL 3BSZL 2QJDA 3EUUA 2R0ZH 3C5SB 5FHAL 3TBVB 1R24A 4ETQA 5I75B 3LAFA 1XGQA 3P4OA 2QHRL 3E2HB 5C7XH 4W68A 5EOQH 1KPVA 2EH7L 2G2RB 4CGTA 1K2DB 1KJ2L 1X7QB 3C8DA 1X9QA 1YC8A 4U05A 1FVEA 1KCVH 1I1AD 1KB5L 4WU7A 4H0HB 4NRYA 2DQEH 5DJ2B 2Q8BH 4XX1G 3S6CA 1FFNA 2FHFA 4XP9H 3TYGL 2OP4L 1I7ZB 1ZA3B 3K8MA 5DSCB 1OTTC 4NGHL 2NW3B 5E6IC 1DSFL 2ZUQB 5IEHA 5GRJH 4PGJA 1U36A 5I75C 1CDBA 3GRWH 4ZOBA 4JPIA 3U30C 3H9HB 3U0TB 4HWZB 4KK5C 3CFDB 5FCSH 1HIMH 2PW2A 3VFWA 1JGUL 1URLA 2KPNA 1MAML 5D71H 1BQLH 4ONFL 4NHUA 5I1KH 3A6CL 4LHQB 1TIUA 1G7JB 1OB1B 1EUTA 4LGPB 1TENA 3RWDA 4GAYB 5GJTL 4NKOB 2FO4B 2MSPA 3BP4A 4HC1H 3OGCA 3QDAA 3ULVF 1CGXA 1UWGL 3DMMC 1JYWA 4NUJB 4APQD 5HGHB 3B9EA 3UJTL 2UYLB 3LS5L 5HHXL 1U8PB 4N0CD 4KXZH 1L4IA 2DDQL 2GFBB 3PP4H 3T08A 1NDGA 2VKXA 5FYKU 3V4UH 1LO2H 4C57C 4DZBA 2EKSB 1CDJA 1NGWB 2VDML 3BEVB 1JHKL 2MCG1 4OD2B 1U8MB 5IGXL 1ZLVH 4MJIE 4YBQC 3MBEB 5T5NG 3FOMA 3MGOB 3STZA 4HUWA 5BV7B 4TRPL 4MQXC 4Y4KD 1KLFA 4FQ1L 5EBWA 5I15H 1C12B 1G7MA 1N59A 4LPYA 4WU5A 2VJXA 4V1DD 3UX9B 1F13A 2XN9A 2ITDB 4I13B 5HPMA 5BW7C 4NNXA 3ALXA 3EYSH 5D93C 5ESAA 3D39E 1P4LB 3P9WB 5A2LH 5DEZA 4MCZB 1Z9MA 3DI2B 4MJ2A 4PS4H 5FYKE 5BJTB 1RZJC 5DLML 1RQ5A 3C60D 2AJVL 4LCYA 3TT1L 5BV7C 2M8XA 4IHOB 2PO6D 4ZYKB 3QCUL 5JA8B 4WGVB 3WJLA 2AGJH 3LKSB 5AUMB 4BK4A 5JOPD 4PJIA