1YMHB

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
total genus 39
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhB02
4X4ZA 1FDLL 3IJHA 5I17A 2D03L 4AEEA 2Y5TA 5IMKA 2RB8A 3ECBB 1E6OH 5T33H 4M4PA 3WXWL 3V52H 1INEH 3B83A 4JO1L 4MLIA 1LEIA 5DTFB 1DEEA 4OT1H 2EH8L 4M1DH 4M5YH 5BVJB 1FE8H 5I1EL 3GMOA 5DJ6B 5MEND 3MGOA 3WLBB 4HMCA 1UWGL 4PLOB 5BZDB 3FOLA 2EIBA 1QBAA 2EDQA 3DETD 5AD0A 1MLCB 3L3IA 1ZSDA 3ZDYF 1WT5A 1RUAL 4PGDB 2Y23A 5LWYL 4LIQE 5I71B 4F3FA 3QI9D 3VWKC 4TTGA 1AGFB 4OJFL 2HT2D 3PL6B 2VXSL 3F12A 2ICWJ 2GUOB 4KRPB 1VCAA 1AXTL 1F2XK 1E28A 5CUSH 1CGWA 2PXYC 2DQUL 2GSIA 3IU3B 5EZLA 5LGKA 4JM2F 3VGDA 1BEYL 3AMKA 3CDYA 3MJ7A 5J6GA 2VZVA 2FYYA 1YN6A 15C8H 1F8TH 5HD8C 3FQRA 3Q0HA 3IGAB 1K6QL 4H8WL 1ZA6A 1DQLH 1ZV5A 3C6SB 4PJGE 1ZT7A 4H0GA 4ZNEA 4X9HA 2EO9A 5IB5B 2W0FA 3H9ZA 3BDBA 3AS1A 5IG7B 2HLFD 4LIQL 4MAYA 3OKEB 3TO4B 3U4AA 3EDEA 4HK0A 4HPOH 4UNTA 4B0MM 3OAUH 4KRMB 5CKAA 3W5MA 3QUZA 5GSVA 4QOKA 1QBLL 5CZVH 1JI1A 2Y06L 3BUYB 1EFQA 3IKCB 4Y19A 4ZFOB 4JPKH 4NWTL 1WCQA 4HC1L 2YK1H 4M02A 4Y16A 4ZFGH 1FZKB 3NGBC 3MROB 3F58L 2QQNH 1R3LB 2OQJB 5C86A 4OD3L 4PG2A 4HUXA 2O5XH 4AMKH 3S88H 4KKAD 4X4ME 4G80B 5CGTA 5KBNC 2VLME 4HIHA 4JFXB 2ZPKL 4Z77A 5BW7A 3FO1A 4UB0L 1ZT4A 3BKCH 4EZMA 5CEZH 4KPHL 2V2TB 1IC4H 4GW1A 1Z9LA 3FONB 1NAMH 2CDGA 5ID0B 4FQQB 1MCWW 3UPRB 4HAFA 4MVBC 1A7NL 4PD4K 3S6CA 2DRUA 3KJ6H 25C8L 5CLWA 4HW6A 3T0EE 2UZIH 3UTQA 1RZJC 1WTLA 3OPZL 1W72H 3MLXH 3MRMB 2R0KH 1MHHA 3JV6B 2UUDH 4I2XA 3QRFM 4DQOL 3SDXB 1B0GA 3BEWB 3S3JA 5A2IH 4U6TA 5F7UA 4LARL 2CK0L 3ZE1E 3D39D 2PYED 1LILA 3WFHA 2NLJB 5EO0B 4NZRL 4P5MB 1MCPH 5DVLA 1FBIL 2Y4SA 3FQTB 1DN0A 2RFXB 1NC4D 4KTDH 2VLJB 5C0ND 2JJTC 4OFVA 5JORB 1FFOA 2DDQL 3KPNA 3SY0A 4HS3B 5LJYH 2R1XA 3CLFH 1KC5H 3CH1A 3BH8B 5D6CA 2BY1A 4YHYC 5GRVL 4CVWA 4X6DA 1NL0L 5CMAB 3QWOB 4PPTA 4PP2A 1T4KB 4DVRL 3S98A 4F7PB 4Z6AT 2VABB 4JY6A 4NCDA 5CEYA 4O9HH 3HRZB 5F9OH 3NIGF 3MNZB 3MCKB 1U8KB 1U92B 2ZSVB 3MRJB 4LEXH 5IW6A 4D0BA 1M05B 1J11A 2J2ZA 2IBBA 4OQTA 4DGIH 1M7IB 5I19H 5GGRY 4HKXA 4JO3H 4QOKD 2NYYD 3OV6A 4ODUA 3UTZA 3LEXB 4JLRB 1X3DA 4PB0L 4U1KA 1A6UL 4Y19D 2ZNXA 4RZCA 1QFUH 3WL9A 4YGVB 1P4LB 4GMSL 5C0CA 2VE6B 1GGBL 4OCSH 4UIKH 1INQB 1A6AB 1K3IA 3RI5F 5JW3L 3IDIB 1J12A 3B9VA 1BIIA 1AHWA 5EU6B 4MA8L 4WHDA 5DJ8B 1QD0A 1L6XA 4ODVH 4W6YB 4Y5YB 1REIA 1SQ2N 3DUSA 3LS5L 2W91A 5DQDL 2WWKO 3N06B 3IU4H 5DD3L 2Q7NA 3EW3B 1NJ9A 1YA5A 4U2ZA 3IT8D 3BVNA 1DANT 1GIGL 5E6ID 1TVDA 4K3DH 3UZVB 2NY2D 3L7EA 5KZCB 5E7BA 3NACL 5JOPE 4PRNB 5HVHB 3ARTA 1KXQE 5HTSA 3KDMB 5FYKH 3NA9H 1FFRA 5E2WL 2CXGA 3FQNB 1UACL 5I8CA 1JNNL 3QUMH 3SGJC 1G7JB 4RNRB 4NCC2 3V6FB 5IJVA 3BP7B 4MDIB 3BYYA 3X12B 5D7JA 5C0IB 3LQMA 3KR3H 4GBXA 1NGYB 4J4PD 3HG1E 2GI7A 3PDDA 1A4KA 3EO1A 3V7MA 2HMIC 1NCDH 2VOTA 3T4YB 2N7AA 5JXAH 3RGVB 3WJJC 4Y4KA 3GJEA 2VL4A 2CKNA 4PFEA 2XG5A 2NY3D 5BO1H 3CXDL 4YDLC 3QCUL 2YUXA 4HMEA 3H3PH 2NZIA 2DLTA 4JFFE 4UINH 5SV3A 4O5LH 4WRLA 1D5IH 3MJ6A 4GS7C 3T1FB 3RI5K 3WMSA 3T0AA 4F7MB 4WI6A 3U0TA 3KNBB 5EZJB 1RUMH 3AS3A 1N64H 1UJ3C 5KSAC 3KHOA 4L4TE 2FATL 1NKRA 2D7QA 3MACH 3ZDYE 3STBA 4GFTB 2NX5D 4MJID 3O3BB 3RU8H 4HV8B 4OZIB 1NGZA 4RIRB 4GSDH 1OWRM 2IGFL 4R90H 1IKNC 3QJHB 3VWJA 4YNYB 4M1GL 1DL7L 3HAEG 4IS6B 3ULSA 4WHTB 3FCTB 3PE9A 4D9QE 4FTVE 4ZPTB 5JMRA 4U1SA 4PJHF 4DGVL 1BFOB 3EO9L 3L3GB 3P73A 4QRTB 3MOAH 2VDKH 1GGCH 1ZHBA 5GS1C 5FCUH 3FT3B 5I16A 1GC1C 2LU3A 1KBGL 2ESVB 1HHKB 5KVEL 2EE2A 5TDPB 5I6XB 1JZ8A 4J3OC 1YEEH 3NH7H 2A6KB 2BVTA 3C5ZA 3N50A 5EOQH 3IFPB 1I7ZA 4H26A 2Z0BA 1J8HB 4QT5A 5IIEA 4XCYA 1BQHA 3NBNA 4U0RC 2DWDB 2JCCE 3QNXA 1NCWH 5CAYB 4LCWA 2VUOA 5ABDE 2Z31B 2B1AL 5DI8A 4G9FA 4HWBL 1XCTB 4NQUA 1WWWX 5E8OA 1AD9A 4NM8L 4RMQA 3OKDB 1GXEA 2C1OB 1XF3B 1T1XA 4GBXD 3FB5B 2VWEC 3D85B 1I4FA 1UC6A 1UZ6E 2DM3A 3SJVE 2VDPL 2WQRA 1AKJA 1EHXA 4X9FA 3CDCA 4XBPB 1JUFB 3GSNL 1S78C 2L7UA 4I8DA 1RZJH 1A7QH 4XXCC 2J88H 1N2RA 4J3WA 3LMJH 3WJLC 5DHVB 4JY5H 4YHOL 2BC4B 4GOSA 4PJDF 2KQMA 5DRXA 4HEPG 1EFXA 1DBMH 1EJOH 1A7PL 2GQHA 1ND0A 1JCKA 3BP4A 1P2CA 1CG9A 2ZSWB 3OG4B 1CVRA 4OLZH 3ZDXF 2Q8BL 4Q74A 4PJ8A 4E41B 2EEAA 3RJDA 4BFIB 1FVEB 1VFAB 4WFED 2RAMA 3TF7C 3VXSD 1B90A 1Z3GL 2JELH 3FB7A 3RFZC 4XPBL 4WWID 2R69L 4QEGA 3GM0A 2F53B 1NAKL 1R3KA 1F6AA 1FYTE 3FN9A 4I48A 4QRRD 1DTUA 4OF6A 2VH5H 1VDGA 3HI6H 4ELMF 4Y4HC 5EOTA 4JVUA 2OSLB 3LHPL 1H3TA 4KI5D 4OZGF 4P5TB 4XVUD 1F3JA 1MRCH 2YA2A 5D93B 4YHPA 1JV5B 4DZBA 4MJ5A 2C4FU 3P0VH 4NO0B 4BUHA 4TVPL 3ROOB 1B0RB 3MRGB 2W38A 2DKUA 3V5KA 1ORQB 1MJJB 4FA8A 4L3EA 1H3UA 4AYFA 5DMGC 1YPZA 1KB5H 5J13C 3MNWA 5I8EB 3JSSA 4LLDB 4U6YB 1A2YA 1BZ7A 2EDXA 4O2FA 3PWPB 3Q5OA 3CXHK 1QFHA 1A7RH 5GIRB 5BS0B 3ILPB 4XCNA 5MERA 3L3OB 4P2QB 2IALA 2A1WH 2GJ6E 3DGCR 2BOBA 3WXVL 1UH4A 2P4AB 1R24A 4R0LA 2ITDA 1JFQL 3AB0C 1JPGB 1OAYL 1WZ1H 5HHOA 2F8OA 5IF0B 2F19H 3QAZB 4JFDA 4J8RA 4LQFH 3MJ8B 2QR0B 1RUQL 2Y9RT 1XIWA 4U4BA 3SO3B 2R2HB 3GHBH 3HR5B 4I5BB 5ECJE 1IT9L 5EU5B 4P57A 4KAQH 1M7XA 3QG6A 4WV1B 5JHDE 3L3DA 4WNQB 4K7FA 2XKNA 2Y6SD 1S5IL 5FO8A 4OLVL 3ZO0A 2FSEB 5KJRL 4PLNC 3P30H 1V8HA 4P23B 3Q3GA 1OTUD 5FGBC 4LCCC 3L6FB 3DYOA 3DROA 3KYKH 3TVMD 4BQBA 5CD5D 1L7IH 2EDJA 3IAQA 2VUYA 2I26N 3Q5YA 2E6PA 1AJ7H 2H45A 1KN2H 3B9KC 4TUKL 5F89A 1DQDH 4KZDH 5T3ZL 1NMAL 4HZLA 2R56H 1EFXD 5DS8A 3RZCA 4XWOD 1EK3A 3IFLL 4I1NB 3GRWA 3GIVB 2C3VA 4NRYA 5GS0L 5E56A 1JPSL 4HKBA 4CN1A 3P0YL 1CE1H 4PJBF 4FFZH 2VXUH 3FRUB 2M26A 3QDGA 3RWHB 4RGNB 5AG8A 2YUZA 1J88A 3QEGL 2F74B 3TNNB 3HI5H 3OWEA 1YEKH 3DI3B 1RUPL 3TA3B 3DUUA 1H3WM 1T2XA 1S7QA 2J1KA 1AGDA 2NY6D 3HE7C 3VFRB 4JKPL 4XPAH 1JNHB 5CJQL 4PRPE 4KKCC 3OB0H 4PRAB 1NCNA 4YC2B 1XFPA 5C8JB 2YMXH 3ECBA 1UYWL 2QQKH 3PXJA 3GMLB 3RL2B 5I1GH 3F7RA 3S35L 4PLJC 4H25B 5BVJA 3QG7L 1FN4B 3S37X 1UVQB 5BZDA 1T03L 4ONHA 4I0PC 1QSVA 2CMRH 4G6FD 5F6IC 3GMMB 5CP3H 3H9SA 4PGDA 2E9JA 2HFGH 4XVTH 2N1KA 3EYVA 1PZ5B 4JFOA 4ZAKC 3ARFA 1EBPA 1WF5A 1MQKH 1AGFA 3AREC 4HDIB 1D9KD 4XI5C 2HFEA 2MTPA 4OCWL 1IBGL 5HHOD 4BFBD 5J1TC 2EIZA 4BZ2L 2JCCB 4JHWH 2NY5L 4UTAL 5C0FB 5IT2H 5DJZB 3IU3A 3MREA 3MV8B 2VQ1A 3CMGA 2Q6WA 4JAMA 4JGMA 4QGTA 4RDQG 3EDFA 1A7BA 1KJ2H 1WFUA 2QSCL 1GC1H 3P4MB 2ATKB 2FX9H 2IH3A 3IGAA 3IRPX 3W0WE 1F4XL 1NGXA 2FECI 3BXNB 5IB5A 4QCIB 4HUKB 4KK9C 4NN5B 3MRIB 4R26H 2VDLH 1S7WB 1JGUL 1LEKB 2I27N 3OKEA 4OCRL 3AC0A 4KK8C 2VDOH 4A6YL 1FFPB 4Y4FC 1E4JA 3SDXF 3R06B 3GK8L 3LQAC 3BUYA 3RZCD 4ZFOA 4X6EB 4PJ7F 1VACA 4X4YA 4FQPA 1I3RA 3ZHLA 5HHVH 5I66B 5JOEA 4BQ6A 5ACLA 4XX1E 2VITB 4HUMB 1E4KC 2EEDA 2FLRT 1J1XL 4X5WB 2AK4D 1R3LA 1YQ2A 4O51A 3OZ9H 4FQLH 3VRLE 1QRNE 2PETA 4KJWC 3O8XC 4Q9RL 3O6KL 4NNYA 4JFXA 3R1GH 4GT7A 5T33L 3O45A 1HQ4B 3L3JB 1GYAA 4HIEA 5I74C 2A74B 1G1YA 1NCUA 1TCMA 2BX5A 2CKBH 5GISH 3I50H 1P9MC 3FONA 4TUOA 1G9NL 4XMKL 1S9XB 2V5RA 4FQQA 1NGPH 5JQ6L 2Q3ZA 4ZO9A 3FTGA 3MFGB 4ZOBA 3D25B 2J7LA 3VH8G 3R4DA 4H88H 1U3HD 3CCHB 2GTZB 3MLWL 4LHUA 3BEWA 1DSFH 3VFUA 3ZDXE 2HJKB 2NXZC 4RFOH 3THMH 2R23A 3MJ9A 3NCYP 4IOIA 3H9SD 3O6ML 4MWFB 5CUSL 5A16B 1A0QL 3FQTA 1FGVL 1I9RH 5MI0C 3ARFD 1GZQA 2X4TB 4WU5B 2VLJA 4FQ1H 5IEKA 1EA9C 3PHQA 3QWRA 2VZ1A 4M1CD 3OL2A 1IEBA 5I0DA 4ELME 1MI5A 1CI5A 1KLUB 2AQ2A 4HS3A 4UDTA 1D6EA 4NUJB 3NCBB 4KY1L 4TSAL 5IR1B 4OGAD 5IMLB 1T66D 4NN6C 2V7NA 5ALCL 1T4KA 3DARA 2YD1A 1ZHKB 4LBEB 3MRNB 4FFYL 4OFKA 4FHBD 5E94A 4HXAL 2EDFA 1T7YA 2G60H 1J7VR 3HRZA 2R4SL 5A40E 3MRQB 4RRPG 5H37G 4NJAL 1P84J 1UM6L 2QBWA 1E0OB 3UTTE 1Z9SA 4GAJL 2E5EA 3FO9B 5EBMB 1JVKA 3SGEI 2P24B 2NNAA 2EYRB 1M7IA 1JNLH 2W9LA 2X44D 5CKGA 2OR9H 4I3SL 4EN3C 2O5XL 5HHMD 1MPAL 2FEEL 3S88L 2HKHH 3O41B 1F4YH 1S9YB 3NFNB 1N7MH 5GS2D 2KZWA 3OJDB 4CW1B 1KNOA 4Y7MA 4YGVA 1UEMA 4JFED 2H32B 2VE6A 3HB3D 4QLRA 4RISH 1INQA 3TPUB 3IDIA 3HMWL 5JW4Q 1NFKA 3HAEH 4R4NC 5EU6A 4BH7A 2K7QA 4ORGB 5DD1L 3CSBA 1JZ4A 4QGYA 1ADQA 2XFXB 4OV6F 4NOFA 1H8NA 1T04B 3TCXA 1NLBL 5E4EC 1MJUH 3SDYH 4KROD 2NXYB 3UZQA 1IM9B 3H42L 4KGLA 2H2SC 4I4WB 4XPHH 3MLXL 2R0KL 4Z95L 5KSBA 4BFEA 1JNJA 4JG1L 1KIPB 4LRNH 4NDMB 4RAUB 3V6OE 1UZ8A 1CU4H 1KCUH 1TPXB 5IMOA 1AQKH 3H6JA 1P7QB 2JE8A 2IAMB 1K8DA 3KDMA 1N0XH 1FZJA 4KTDL 3VFSA 4LHUD 2OBGA 1UB6A 1F02I 4LVNC 2IPUK 4LPTA 4D8PA 2NR6D 2DAVA 3Q6GL 4OZIF 3P9WB 3UBXI 5IJKC 1W0YT 1G7JA 4RNRA 1AGBB 3OXRB 3BP7A 3SDDA 4PJBE 4XZUB 1DQMH 3X12A 4S0TD 1FIGH 1NGYA 2DMKA 3FL7A 4JFPB 4NN7C 1MI5D 4KH2A 2J4WH 4X8JA 4ZUTA 3N0PB 4GRMB 4LSPL 4L4JA 3QI9C 5HHQB 2IBZX 4NJ9L 4HC1A 2HT2C 1ZT1B 1ODAA 2NY0B 2R8SH 4IEFB 5FKAB 5AZEL 3TV3L 3WFCH 3DJ9A 3KYOA 4R2GB 5MEOB 3V0VB 5TQ2H 5FGCE 1HILB 1OAXH 5I19L 4OD1H 3IETB 1L0YA 3OR6B 1MCKA 3T1FA 2A77H 1TNMA 3KNBA 5EZJA 3RY6A 3LV3A 5KSVB 1LD9B 2HG5A 1MVUA 1ITCA 4IJ3C 1N3NB 4R96A 3EAKA 3TZVB 2H41A 3UTSE 1U9KA 4HV8A 2CUHA 2FX8L 3VRJB 1QLFA 4RIRA 2R39A 1FRGL 1MF2L 2D3VA 3CZFA 1TJHL 1R3JA 4IOFD 3IDNB 5GGSY 4R97B 3EIFA 3IS1X 4PYHA 1E4XL 2HLFC 1KTDB 4WEMB 4BM7A 5F8RC 4HCRH 3PQYE 4EDWH 3VFTA 2ADIB 5T3XE 4ZPTA 1YDPB 1EMTL 5FYJL 2DQFA 3L3GA 1EPFA 1A14H 2YOCA 4QRTA 1OTSD 1HHGB 4JB9H 4LSRH 1BREA 2WZPD 1XR9B 2X40A 5D7IB 2PR4H 5DEFB 2DQTL 4X4MA 3FT3A 2BJMH 1GOGA 1ACYH 1HHKA 3BOVA 3O2VL 1CGSL 1UWXH 4Y5XA 4KKAC 4N1HB 4KMQA 1CFQB 2A6KA 2R0WH 4ZS6C 1DBKL 3LQAH 1CXFA 3WS3B 3DMMA 5J3HD 3WYRA 4TRPH 1IQDA 5K33A 1W0VA 5EZOL 5IOPB 3GMRB 3BAEL 3T0EA 1AP2A 4JANA 4PJ7E 5CZXD 1VSCA 3O4LE 3VI4E 1XCTA 1G7IB 5T3XL 4NOBA 3SDDD 4DKEL 4PJAF 3SOBH 3TBWA 2C1OA 1XF3A 3HE6A 5J12B 3FB5A 4NFBA 4JRXE 1HCFX 4TULH 3D85A 3PGCB 5CS7A 1J0JA 4C57C 2BVYA 1WT5C 4WUUE 1AO7D 4QHMB 4O5LL 4RGOL 3CMOL 1A9BB 2R4RH 1KCKA 4N8VA 4XBPA 5E99L 3MBXH 4MX7B 3WFBL 1JUFA 3PDGA 4HEME 3WS6C 1RUML 5E9DE 1K2DA 3T08A 5C0NC 1PLGL 3CK0L 3OAZH 5EH1A 2XZZA 2ZUTA 1U58A 4L9LC 3MACL 2VMFA 5DHVA 4ZUSB 2IQAA 5BVPH 5I1AB 4M03A 2P46B 3VH8B 1LE5A 1FNEB 1K85A 3LKRB 1NAMB 5D6DA 5ACMA 4GSDL 4UAOB 3QHZL 2WUCL 4R90L 1VFBB 1T89A 2H8PB 4BFIA 3CSGA 4U3XA 4N0CD 5F7EH 4CRPA 2G75A 3UTTB 1ZLWK 3TBSA 1W72B 2XA8H 5HGGS 2I9TB 3HCVB 4QF1A 5EOCL 1ZK9A 4WFGE 4WI9A 1ZVYA 3ARDD 1YMME 1JF1B 3I75A 2FBJH 2EDBA 2OSLA 3DTXA 1FH5L 3DBXB 4DWHA 5FCUL 3BI9X 5F44A 1SVCP 4ZDHB 4OCYH 2NYYC 4HUWB 1JV5A 3UYOD 1N5YL 1QNZL 1NBQA 2WP3T 3QH3B 1YEFH 4L4VB 3IJSB 1M71B 1ORQA 3EYQD 4M9OA 3PWVA 1OP5H 2CGRH 4U6YA 4MHHI 1YEGL 4FMKA 1JWUB 5MEPB 3RUGB 3TFKC 4L8BB 1KSRA 5GIRA 4B7LA 3MO1B 1U93B 3VFGL 3CH8A 1KEGL 4CUCA 1IC5L 1F58H 1X7QA 4NQEB 4G6KL 1HN1A 3DMMD 1KENL 2YPVH 3S3PA 2IAND 5A2JH 5ISZE 3QQ9C 3ZHKA 3H0TA 2P5WB 4Y0GA 1JPGA 2W65B 3VXUE 2Z35B 5E6IC 3UZEA 1AR2A 3C9NA 4YDKH 3MJ8A 2QR0A 2YRPA 3O4OC 1TQBC 1U8NB 3DURB 3EFFB 2R2HA 4YK4B 5GJTH 1HWHB 4I5BA 1MWAA 5EU5A 2NY2C 2HKFH 4BSJA 3WNMA 2RBLA 4K71B 4K23H 3NCFB 2NY4B 3HE6D 4QRPE 5EIIA 5LQBL 4FZEL 1BBJB 5F1SA 1MCCA 1RZJL 5D70L 2FSEA 4JFHE 4LNRB 2J88L 5HGDB 3KG5A 4X6CB 1BWWA 4P23A 1T6WA 4K3EH 4B50A 4QXUH 4ZUWA 2ADGB 3QXWA 3HG1A 1DDHA 4RWYL 1B4JH 3AMLA 1E27B 1LO3H 4FFWC 3W5NA 4QHUA 4J4PC 1BWMA 2ZUYA 4G8EB 1J0ZA 4N0RA 2E7LA 4JFFA 2NY3C 3L3KB 4M7JH 1U8QB 3HI6L 4M7ZB 4DN4L 1I9JH 4P5KA 2A0LC 3LZFH 1WWBX 3LQZB 3HPJB 2WMPA 2Q7YB 1M7DB 4L4TA 4PJXB 1DBBH 4MB4A 4WW2B 2JKXA 2M1KA 2W92A 3GSUA 1BQUA 5GJSL 3TNNA 5AUMB 1PEZA 3QUMB 1F4HA 1KG0B 1B88A 3TA3A 3V0WH 2OJZL 3FO2A 2YPLE 2FHBA 1BD2E 1KB5L 4JQVC 3O6LL 3LKPB 2QV2A 5D1QB 3G08A 4AK1A 4L8SB 2WIIB 1JNHA 2H9GB 3NIDF 4PRAA 5C8JA 1A7RL 1B2WH 5FM5M 4EUPG 4N9OB 3LH2L 1A6WH 3RL2A 2UY6A 2PF6A 3MLRL 4HFWA 5IHUH 4FTVA 2A1WL 4KXZI 4G7VH 1UVQA 2VDRH 5I9QC 1PVHA 1PG7X 4JPVL 5CCKH 5DD6B 5DFWH 5CJXA 4TTDD 1LE9B 4UTBH 1HYRC 3SBWC 1FFNA 3RJQB 4OGXH 1MUJB 4YHNA 5IB1B 1BJ1J 4JRYB 4FQCL 1CICD 2B2XL 1X44A 3VWKB 1FSKB 3B8YA 4GO6B 1K5NA 5I75C 2Q20A 4Z7NF 2E7BA 2JCCA 1I1YA 3SCMB 4UNUA 5DJZA 1FLTX 3T3ME 1FNGB 4Z7VE 2PXYB 3U6RA 1AJ7L 1E6JL 4HUVA 1DVFA 3MNVB 1IKFH 4RSVA 1NDGA 4LKCA 4R8WL 3L3HB 5DGRA 1Z5LA 5I1HL 1DQDL 3RVUD 4S1DD 4UV7H 1EHAA 3HG1D 1U8PA 5C6PB 4IMKA 4FQJH 3SJVA 3BXNA 2E6QA 1H15A 1MH5B 4QHLB 4GBXC 5H37H 4ZOEA 2UWEB 2WWMD 1FO0B 3MRIA 4ERSL 1S7WA 1LEKA 5JTWA 4FQIL 1HYSC 1CQKA 3TNMB 1IFHL 3VGEA 2FR4A 1Z0NA 5E5UB 1TETH 5HYSA 3UJJL 4JFFD 1LO2L 4X6EA 1UKSA 1SJEA 4KJYB 4NWUH 4W4OA 4BQ9A 1LDPH 4GW5B 5DUML 2NTFA 2P8MB 1DE4B 2VITA 4P4KA 4FN0A 4IIQA 3MXVL 3S4SA 5IM7A 4LMQE 4W4NA 3NGBB 4XPAL 1OW0A 4N5ED 4APQA 5BCAA 1XH3B 2A73B 3GNML 5FGRA 1XGYL 1MCSA 4B53A 5HPMB 1WAAE 4PJEB 5H94B 1PSKH 1PKOA 2BNQE 4W70A 5C09E 1S8DA 3V8CA 5HJ3A 2ERJB 4MXVE 4UILH 3PP4H 4LPYA 5B4MD 1JBJA 2CMRL 2VLRE 2AJYH 4D9QD 6FABH 5A43C 2ATPB 5D7LB 4FTVD 4K2UH 4JM2D 4XVJH 3U9UA 1MAMH 3KPSE 4KI5C 5GGVY 4XVUC 4IRJA 4QY8A 4OBSA 5A2FA 3GHEH 3R0MA 3WUWG 4JZOA 4ZODA 4YZFF 2DKMA 3OQ3B 3D2UB 2IMNA 1WZMA 5D1XB 4TNWF 4Y2DD 3W39B 5A16A 1I8KB 1KCVL 2VL5B 3GJFA 4UQ3B 4WU5A 4HWEH 3FT2B 4RMUA 4DW2L 1KJ2L 4N8CH 2GJ6A 4LF3B 1J87A 4NQDE 5BV7L 1KLUA 1UXSB 3HUJF 4NUJA 2FX9L 3O2DL 4L8CB 4ENED 2GW5A 4X6FA 5EBLA 4HIJA 4LGPB 4D94A 4RGMC 4YFLF 5E5MA 2BY3A 3IDYC 3WE6A 5D96C 3OAYK 1ZHKA 4LBEA 4WDIB 4YHYB 3MRNA 2BNRB 4PREA 1CTOA 3U1SH 5JHDA 1FP5A 1AY1H 3GFUA 1XGPA 2VDOL 5DLML 4F7TA 2VKXA 1EVUA 3VI3F 2IADB 5HVWA 3ULVF 2Y6SC 5EBMA 4GAYB 3ZE2E 3BW9B 4E42B 3HNVL 3QRGH 5JUEL 3RWEA 5BMFH 3OKMB 1A7OH 4ODHH 2EYRA 5IROA 4QXTA 3WEXB 3VMOA 3D18A 1OTUC 4HWZA 3BSZH 5FKPB 5GRZA 4EOWH 3DOSA 5MEQA 3OZ9L 4TVPD 4UU9B 2BY2A 5TE7L 3TVMC 1PKQB 5CD5C 3NFNA 1NUDA 2CUMA 4JR9L 5IV2B 4CW1A 2VAAB 5KVDH 5M94B 4P4KD 4WTZA 2ADFH 1KPUB 5JR1L 3RHWF 5L88H 3S37L 5GISL 2EDKA 2QQLL 4CVXA 4ORGA 1OD9A 5ESAB 3PGDA 3U4EB 1NGPL 3LD8C 1J0YA 4M6NH 5DJXA 5HY9B 4U6HA 4AJ0A 1K4CB 1AFVH 3SE9H 5HGAA 1FYTD 1IM9A 3I9GH 4L9DA 4LSUL 4I4WA 4X98B 4P4RB 4H88L 3DHJA 3BEVB 3SE8H 3VXTA 4TNWK 1JMXA 4OZHE 1YQVH 3UDWC 4K7PY 2IFFL 1AXSA 1KIPA 4NDMA 4RFOL 1BF2A 4L5FL 3AUVA 2QTEA 3EOAB 2ILLA 5D72H 2NY6C 4EVNA 4PRPA 1P7QA 3NZ8B 4JG0L 1NFIB 3T65B 1I9RL 3MYJA 4X7SL 4IRJD 5IESL 4HJJH 4RMTA 4PRHE 2OTUA 3EBAA 3TYFB 3DYPA 4QYOB 4YGAB 2BVEA 4LU5L 3OXRA 3EGSA 1G1CA 4YDIL 4LL9A 1FPTL 4Y5VA 3NAAH 4K07A 1T1ZB 4KWUA 2EDHA 4XAWH 5IHBA 1NEZA 2GJ6D 4PJFF 4ZSOB 1CLYL 4KMTH 2QADC 5KAQG 2PO6A 2YC1B 4A6YA 5T3ZD 1IGMH 3M8OH 1QO3B 4RBPK 2HLAB 5HHQA 2X1XR 3NIFF 3E8UH 5K9KB 1HHHA 4IMLA 1D9KC 4X5LA 1ZT1A 2CIKB 2GAZA 1OARH 3NIDE 4XP5H 5D7IF 3TIEA 5GS0D 1TIUA 1HIMH 5JHDD 4LVOB 4G8GB 4FQXC 4NHCH 5GXBB 1JNLL 3IETA 4FOMA 1FL3A 1U95A 4JDVB 1GL4B 3EFDH 4ONOA 3RHWK 3RKDC 1NUGA 4GS7B 1N7ML 3UBXG 1N3NA 3W0WA 4S2SB 3TZVA 2BHUA 3VFOB 5KVMC 2BXZA 1UJ3B 5KSAB 1JGLL 1L4IA 3CDFA 3IXAB 1ED3A 1AR1D 1QR1A 4NRXB 4ZQKB 3JWOC 1TZGH 3U30C 5DMIL 5LXGL 3IDNA 3LRSB 4AEIL 3PWUA 4UBDD 4LCUB 4W6XB 1G0YR 1RK0B 1S7VA 2GT9A 2VXTL 1PBYA 4L3CA 1MJUL 3IKKA 1IAIL 3VDBA 2C3XA 5H2BB 2ADIA 4G6AD 3VXMB 5FA4A 2WUBH 2FH8A 3K4DA 4Y88A 4M8QA 2B20A 3DVNA 1FC2D 1O5DT 2BNUB 1HHGA 2EDDA 4GLRI 3BZEB 3VFWB 3MLYH 4LLQA 4V1DE 2BSTB 5CILL 1TCRA 3B5HA 1T3FA 2YN3A 4BQ8A 1R3HB 5GS1B 5JXED 2X09A 3ULUF 4CADA 3QEHB 1CFQA 3OKOB 3ZE0F 5J1SC 2BNQB 3E0GA 3WS3A 5C09B 4Z78B 5DFTA 3ZKQD 4U1LA 2VZUA 3T09A 3V4PL 4UIMB 3GMRA 4U0RB 3WN5C 3FOMA 3ESVF 1H3XA 2P8PB 3NFSH 4OM1L 4OZFG 4RCAA 1G7IA 5CIPH 3RL1B 4QHKI 1T0MB 1U3HC 3TLRA 3QIWB 5JHLL 3FHAA 3GEWB 3B9AA 3PGCA 5ETUB 1OVZA 4M6MH 2R8SL 1IGTB 2AEPL 2PO6D 3A6CH 4ELKB 2IPTL 5F9WC 2OS7A 1A9BA 2HWZL 2IC2A 4NKMA 3BIAX 4MX7A 4TOYH 3VFPB 4HS8L 2L4OA 3D3VD 2B8OT 2UYLB 4HHAB 2D0FA 1SJHB 3VGBA 4G6JL 5E8DL 3SE3A 3OSKA 1HHJB 5EC2B 3KLDA 1BVLB 3KPRB 3X17A 1RHFA 5TGBB 4NKOB 3RUGF 3SGDH 2CKBB 3S7GA 5B8CB 4OGAC 1JYNA 1UH3A 2P8LB 2H8PA 3F6IA 5T1DH 3UROR 3VXOB 4BH8B 3O3DB 4HT1L 4LLUB 5D2LE 3W0WD 4WWKD 2UVFA 3UTTA 3O6FB 4TYUA 2Y7QB 1MJ8H 5E70A 4C59B 2I9TA 1V7NH 5SX5K 1ZGLM 5GRUH 2Y36L 4YEEA 1BFSA 2J8HA 1A14L 3BHBA 1JRHL 5B39G 2B7DT 4JB9L 2YUVA 2AW2A 1FG2B 2FJFB 5CJBA 4PY7B 4E5XB 4NO2B 4ZDHA 4Y4HB 3HZKB 1RQ5A 1RVFL 1KLGA 4X6CF 3QH3A 5HVFB 5DMKB 2HJLB 1WV7T 3IJSA 2E8YA 4OLUL 3HB3C 1LK3H 2P7TA 1U42A 3SDAB 1QRND 2YXFA 3ABZA 1HZHL 2W60A 2WQ8A 3V5DB 2D7PA 1F11B 5DJ0B 1JGVH 3F7YB 3MLSH 1JWUA 2V17L 3UC0H 4UMGA 5MEPA 4L8BA 1Q9KB 4FABH 5D5MB 1QSFB 4G9DA 1CE6B 3NMEA 2ZUQC 5F3BB 4NQEA 5D1ZB 3N1MC 2PW1A 4NQCB 4KROC 4ZUVB 5SWZB 4DOHE 2P5WA 3V6OA 3SOBL 1H3VA 2HRPL 2W65A 1IQWL 2W59A 4TULL 2A38A 4PJCF 4NNXA 4QHNA 1SYVA 1T5WB 1U8NA 3AB0B 4PJXF 1OAQL 4MQTB 3EYUH 4WW2F 4JHBA 4ZFFB 1P53A 1QBBA 1WIOA 3L1OH 3K3QA 4Q6IC 1IAIM 2VLLB 2VLKE 2NR6C 4LNRA 4ORZC 4PRIB 3QXTA 1QTYT 1MY5A 5LCVL 1TFHA 1Q0XH 2CK2A 2ADGA 1J1OL 4OD2A 3GBLA 4I9WE 4Z7UB 1H8OA 1CL7I 3BZ4A 2FD6L 3N1GC 3EOBB 5JMOC 2UY7A 2Y07H 3OGOE 2ZNWA 3K2UH 1G0DA 1KIRB 4OI9A 3T2OA 3IS0X 1RZFL 1KPVB 3B9KB 3L3KA 4M61A 3MOBL 3LQZA 3HPJA 3QYCA 4P2RE 3P4OB 4KUZH 2Q7YA 1F45A 4XP1L 1MFCL 3PHOB 1M7DA 1WTGT 1OCWL 3IXTB 1TJGH 1FNLA 4DCQA 1YC7A 3O3AB 5AUMA 1A22B 3BMVA 1ETZB 1BX2B 4GXVH 3DV4B 1G7PA 4H1LB 3B9DA 5T1LD 5HI4D 3DX8A 3TH3T 4XNYL 3G04A 3C2SA 3DGGB 4FQHB 3LKPA 5HI5D 4Z7WE 3HE7B 1JF6A 2H9GA 4IOFC 3HRPA 1B0WA 4EQ3A 2DLGA 5FHAH 3PQYA 3RY5A 4HK3N 1CT8B 3DXAE 3PJSB 4HLJA 4BZ1H 2NW2B 3EZ8A 3QDAA 4LFHG 3K4AA 5DQJA 1LP9E 4MAUH 1OTSC 3NABH 2DQDH 1XGQB 5F9JA 4CAGA 3JWOH 4JN2B 1ZANH 2HN7A 5GJTL 3MFFB 4MNGE 5I1DB 4ZG1A 5F6IB 3HS0B 3QCVH 2OR8A 5IB1A 2HKFL 1A1NB 5IBTL 4X4XB 1FQ9C 3VWKA 4X83A 4XNZB 1MAKA 5A3ID 1WZKA 3QFJE 2P42B 1AE6H 1KCLA 5J3HC 3Q6FA 4YX2H 4K3EL 1G7QB 4UUJB 4R9HA 3GRWH 3R8QA 4JDZB 3KPOA 3STZB 2C3WA 2PXYA 5J8OA 4MMZC 1UM4H 4PJEF 3PL6D 3MNVA 4YHIB 4LPCA 4H8WC 3VXNB 4JRXA 3SDDC 3MR9B 2XPGB 1GZPB 2H3NB 2XXMB 1MH5A 5AEAA 4WUUA 5IB2B 2UWEA 3E2HC 4M7JL 3LZFL 1V3LA 5EB9A 2VDQL 3IRZA 3UTOA 4JREB 2VB5A 3EOTL 5FYJD 1TNNA 2EE6A 1EHLH 2BFVL 1U91A 4KJYA 2XWBB 4WW1B 4Y4FB 1GCFA 4C56D 1SEQL 1ORSA 2H1PH 3IDXH 3V0WL 5F3HB 3W81A 4P46D 1TXKA 1G7LB 1HI6B 3MV01 2MMXA 3SKNB 1BOGB 2DJUA 3K8LA 2EDWA 3QQ3B 1XH3A 3UTSD 5GGSB 3ZTJG 4F8QA 1HSBA 3Q2CA 1B2WL 1MIEH 4N0CC 1A6WL 4J3TA 4HGMA 3KXFE 1BZ9B 1AGCA 5IBUB 5GGQH 4LLYB 4PJEA 5H94A 2HT3C 2X89A 5DGQA 1YMMA 5I74B 2P5EB 1IC7H 5HI3D 3ULUL 2MHAB 2YD5A 5AG9A 3UJTH 1H9VA 3ARDC 1WK0A 3PQYD 3VCLA 5I1KH 2XT1B 5DWUH 1P84K 3INUH 2OTWB 4UTBL 5T3XD 1EEYB 3IYLW 2WP3O 2F5AL 3QQ4A 3U4BH 2FB4L 3WIHL 1AXIB 2FDBP 4E0RA 1KJ3H 1MELA 4OM0H 1J0IA 2IEPA 3O0RH 5FA3B 1I9IL 3MA7B 3BX7C 3EYQC 4Y1AB 1UA6H 5KANG 1I8KA 2YHGA 2FEDC 4PRBB 4G3YH 4UQ3A 1MAJA 3V7AE 4WCYL 5B39B 4LF3A 5MI0B 3D39E 5ISZA 2PYEE 4EI5A 2JJTA 3FAWA 3PP3H 1LNUA 3RVTD 1IKFL 1FNHA 3ARUA 3LKOB 3ME0A 4J2XA 1JHLL 2IQ9L 3VXUA 2YD4A 1QHOA 5FUCC 5GS2H 4OLXL 3BT2H 4FQJL 2PCPB 4X6BA 3RTQA 3O4LD 4N5UA 4CMHC 3VJ6B 2DF3A 1HINH 2K9UA 5C2BH 2EXYD 1YNTB 2BNRA 4HX1A 1VKXB 4NN6B 5K59F 4DUXA 3GBMH 3G5XB 3BPOC 4JRXD 4QRPA 5IQ9A 4AIXA 1WEJH 1ZHNA 4BK5A 2AJUH 4CVZA 5LAXB 3BWUC 1HH9B 5C0JA 1D3CA 2PKDA 3QBTB 4GAYA 2JB6B 4WUUD 5E2VH 4NSKB 2OK0L 3I6KB 3OKMA 5GRJH 1JPTH 1OAUL 1KB5A 2IH1B 3T4AA 2R2BA 5E9DD 5FKPA 2AABH 2OXGA 4UU9A 5JW4R 4DFHA 3QEUB 4O02H 3C6LD 2VAAA 4PJCE 4MNQB 5DO2C 3M1BA 2P47B 5IEHB 1NSNL 2CDEB 5ERWA 5CGMA 5I8OL 4PR5B 1WC7B 5IFAH 5D6DC 5HGBA 1XF1A 1PG7L 5ESQB 4ZOAA 3PP4L 4MSWB 1T89C 4P2RB 3TT1H 3U0PA 1MCJA 1JTTA 5HY9A 2GFBA 5C0BE 2AJYL 5EWIL 5E8PA 1CLZH 4K94C 1QFOA 3TN0C 4XBGB 4GKSB 2YKLH 3MV11 5DUPL 3O3EB 4AIZA 1AC6A 4WFGD 2X89D 4X98A 5FO7B 3U46A 3BEVA 5DRWB 5FB8A 1YMMD 3JWDL 5AYQA 1TZIB 1IEAB 1ONQA 5FECB 2ZG3A 1X5IA 3BPNC 2YPLA 3ALWA 2OR7A 1MHEB 1BD2A 1KCSH 2Q86A 3QUYB 3WD5H 1S3KH 3GUTB 3TJEH 3EOAA 1P4IL 3R0NA 4CJ1A 1NFIA 3PABB 1RIUL 3SPVB 5BXFB 1KT2A 1I9EA 2WBJB 4P2OD 3BPLC 5E2UL 5CSZB 4N8CL 3X13A 2DD8L 2BCKB 5EDXA 5A1AA 5E08H 4LVNB 3AVEA 1G84A 5EUOB 2DQEH 1CGUA 1HXYB 4KZEL 2DQIL 1PJ9A 2F8XC 3HNTL 3CAFA 3TBYB 2CR6A 5DURD 4CNIA 2X4OA 5ISZD 1FDLH 1CFVL 5MENB 4EI5D 4NKIL 2DM2A 2JIXA 4KMLB 4TTDC 2YC1A 2D03H 1QO3A 1ZOXA 2HLAA 3VXUD 3WXWH 1MCWM 2FJHB 5C9JB 2D7OA 2I25N 5J0BA 3BGMB 1CICC 4J6RL 3RTQD 2CIKA 3EYOB 5I1EH 3WJJA 2V9RA 4LSSL 1NFDB 4PGBA 3HFMH 1RJZB 1UWGH 3QRGL 4XHJC 4ACPA 5INDB 4G8GA 3I2CH 4N9GB 4Z7VA 4QRPD 3AGVA 4N90D 2Q76A 4JFHD 1H3PL 2EYTA 4HLZG 4JDVA 1KTLB 3O3UN 2FGZA 2BSSA 4S2SA 5KVDL 4OJFH 1RZ7L 4DZ8B 1FAKT 1UJ3A 2VXSH 4IJ3B 4NRXA 4LKXA 4S1DC 1AXTH 3LN5B 2D2OA 3LRSA 2DQUH 4FZ8H 5F6HI 2X4QA 5CP3A 2NX5E 2WWMC 3H9HB 4MJIE 1IKNA 5HBBA 5DK2A 1BIHA 2K1MA 3SE9L 4ZPVB 3C5SB 3I9GL 5H2BA 3VXMA 1F3RB 4OBRA 2HP4A 1S7XB 1BFTA 3IAGC 1K6QH 3ARBD 3U36B 3BQUC 1T0NB 2BNUA 4H8WH 4POYA 2V5TA 5CHNB 3FFCE 3JZ7A 2BSTA 5I15L 3GM8A 3LSOB 4KQ4H 4LIQH 4M93C 1R3HA 4G42B 5CINL 3S97C 1KJ2A 1TVBB 3F7VA 5L8LB 2YPLD 1QBLH 1WAAA 1BD2D 2Y06H 3O2DA 2BNQA 2F8VA 5C09A 3NPZB 4YHKL 2HA1A 4NWTH 1JYVA 4HC1H 5JPNA 3D0VA 5DHXB 4HH8A 3ARZA 3KPQB 2HT4C 1I1RA 1YUHA 2VLRA 2VR5A 4LSVL 4UIMA 3F58H 4XMLH 4MB5A 2GIYA 3IJHB 4U6XB 4JM2C 1CLOL 2ZPKH 2Y5TB 3RL1A 4UB0H 3KLAB 3S36L 3ZYJA 2CJUL 1LEIB 3HMXH 4DGYL 3HC3L 1DEEB 4KPHH 3GMOB 3GI9H 3MGOB 2JIXD 1HIML 4ELKA 3SN6N 4V2CB 4CJ0A 5AD0B 1ZLUK 4Y2DC 1A7NH 4Z9KB 3LEVL 2KBGA 3L3IB 5C2UB 4XP9L 2ZUSA 4NQDA 2GYSA 2PYEB 1AGEB 2MKWA 3VFNB 3OPZH 4F3FB 1NC4B 1HHJA 4G8IA 4DQOH 4WUKL 3KPRA 1DLHA 4LARH 1SMAA 2CKBA 1LVEA 2CK0H 2D7MA 4XXCA 2P8LA 2W0LA 3L5WA 2FL5B 3IDJA 4AL8L 4ZXBD 3VXOA 1FBIH 3O3DA 4LLUA 2GSIB 4GG8A 2PTTB 3ARRA 5EZLB 2QHRH 3FKUS 5SX4I 5J6GB 3DX6A 2AJXL 2FYYB 3U2SB 1OB1A 3FQRB 4IMKC 4FQ2H 4PTUB 3BZFA 1ZA6B 1CYGA 1ZT7B 1MFBH 2W0FB 4PY7A 4WI2A 4DVRH 3QO1B 3ZKSD 4Y4HA 4OI8A 4XT1C 2XZAL 3MODH 2QL1A 4HK0B 5IMMA 4HIXL 1R3IL 4GRWH 5GSVB 5DMKA 4QOKB 1ZGLA 3PF2A 1A1MB 1BQHG 2R0ZH 3MBED 4Y19B 5I1JL 5KS9E 3E6HA 1II4E 3F7YA 3BDYL 1Q9KA 4P5TD 5D5MA 1XF2B 4Z18A 1FVCB 5HDBF 1QLRB 3O9WD 3BISA 4U1GC 5F3BA 4PB0H 4MNHA 4RAHA 1K9TA 4OZHA 3NFSL 2YWYA 2V9TA 2E7MA 3MA9L 1C16A 4GMSH 4Z77B 3FO1B 5HGHB 2VLRD 3S8WA 5JW3H 2VRAA 3VRIB 3KPSD 1IZKA 4WHYH 1VFOA 4GW1B 4MA8H 2CDGB 1CDBA 1HK6A 2OYPA 4JVPA 1Q9LA 8CGTA 3LS5H 3K46A 4ZFFA 3O4OB 5DQDH 5JW4M 4P2QD 4K94H 5DD3H 4MQSB 4EXKA 2VLLA 3UTQB 4Q6YA 1A4JA 2NZ9D 3FN0H 2FHCA 4I2XB 5E2JA 1B0GB 3HAEA 4NKDA 1RZGA 2LVCA 4NQDD 1UFUA 4YDJA 5SV4A 4Z7UA 4G7YL 5FGBA 4LCCA 2XI9A 3NACH 3MUZ1 4JKMA 5JIPA 1DN0B 3LN4A 4M5ZH 3EOBA 4V2BA 5E2WH 1UACH 1HXMA 3NPSC 1FFOB 1JNNH 1MJ8L 1QVOA 3KGRA 1QEWA 3B9KA 3QJFB 4GMTL 4ETYA 3CZJA 3CH1B 5C7XH 2YSSA 1RSFA 2NY3B 3P4OA 5F7KC 4PP2B 3DIFB 4MJ6A 1CD0A 1VEMA 1DQQB 4JY6B 1F5WA 2YRLA 5CEYB 4PJIF 5IK3A 3NVQA 1BX2A 5BRZE 5EO1A 3DV4A 1FLRL 3ZTJH 3CXDH 2O5ZL 5IW3A 5IROC 3DGGA 1Z6JT 3F7QA 4D0BB 1CS6A 2FZ3B 4FQHA 5GGUA 5IW6B 1JGVL 1HSAB 5HDLA 2NX5B 3HE7A 4MJIB 2DLEA 3CFCL 4ODXA 4UBDC 1QRKA 3UTZB 4GG6E 2MQ0A 1CT8A 4U1KB 1A5FL 1ZS8B 5K9JL 3WO4B 2NW2A 1A3RL 2FATH 4RZCB 5C08E 5DHYA 4D2NA 5H8DA 4CL7A 5C0CB 1EBAA 4G6AC 3DUHA 4UT7H 3CFKB 4V1DA 3CIQA 1BIIB 2IGFH 1XGQA 2ZJSL 2VDMH 4I0PA 1WIUA 3MFFA 5I1DA 1Y6KR 3D6GA 3DUSB 1ROWA 3EYUL 1KF9B 1DL7H 1A1NA 5JXEC 4XPFL 2I9LA 4ZAKA 4NQXB 3AREA 1HDMB 5FUOL 4DGVH 1NCBL 2NY5C 5L0QC 1TQCB 3I02A 2BHZA 4PRHD 4UUJA 5L2JA 1FVDA 1Q0XL 3ALPA 1KUMA 2F54E 4G5ZL 5EFIB 4HS6A 3STZA 3PWNA 5EZIH 4PV9A 3RWJA 2KH2B 2W9DL 3T77A 4YHIA 8FABA 2EYSB 3CFEB 4GJTB 5I8CB 1I3UA 5FFLA 1U2HA 5CJ8A 1GZPA 4PJ9A 4WI5A 3BP5A 1SJVA 5IJVB 5JIIA 2XZQL 1FL6A 5HYFA 4GBXB 2PO6C 2N56A 4XCEB 1LO0L 2VN7A 2B1AH 2AQ1A 4HWBH 2XWBA 4Y4FA 4NM8H 1N5AB 3NFPB 1OT1A 4GXVL 4Y4KB 3GJEB 1R5WB 2OZ4L 2ENYA 5F3HA 2C26A 2EDLA 1QFWI 5ICXB 1MFEL 2VC2L 1I7UA 1G7MA 1BOGA 5D2LA 1IAII 2L0DA 1E4KA 4QO1A 3L5XH 5DFVD 4JY4B 4WJ5A 4JZJC 5L9DL 2FECL 3U7WL 1NCCL 3GSNH 4WWKC 1N6QL 5F93C 2YS4A 3O8XA 1XGTB 4JPWL 1CF8L 1G9NC 5TDNA 4YHOH 3VXSB 2EXWD 4MAUL 12E8L 2APVA 1P9MA 1OF2A 1AD0A 3L5JA 1A7PH 3H7BA 3NCYS 4AEHL 5C0EB 2Q8BH 4QRRB 3HC4H 3VWJB 4KKLD 3QCVL 2KL6A 3FQWA 5D4QA 2CLVB 3ULSB 1Z3GH 1A8JH 2AJZA 1K8IA 4V1DD 1P5VA 5KS9B 5DT1L 5FA3A 4I0PD 4W68A 3P73B 1AE6L 4C83B 4L1HA 5TDOB 2Q8AL 1ZHBB 3LHPH 3FT4A 3C09C 4KFZC 5EO9A 4ZAKD 3L95A 5F70A 1UM4L 3ARED 4HG4J 1S7TA 5J1AB 5DZLA 2CSPA 4TVPH 1AI1H 3LKOA 2VXVL 1GHFH 3C5ZB 3AM8C 4WHCA 1TTUA 3OAZK 1BZQK 1I7ZB 2PCPA 4H26B 3KLSA 4QT5B 2HTKD 4RGMB 1YNTA 4D9RE 3L5IA 2DQHL 3ES6A 3QIBC 5D96B 5C0DA 5IGXL 3CJJA 5F21B 4P2CG 3MXWH 1JGDA 2VLKA 4LCWB 4PJ9D 5LAXA 1P4BL 4ZTPH 1HH9A 5DI8B 2FCBA 1AD9B 2YEZB 4UQ2A 2GJJA 4OTXL 2IH1A 1T1XB 4KVNH 3DHMA 5JA9A 1YECL 1QKZH 1OAZL 3RDTD 1C1EL 1AKJB 3SEPA 2QHLA 4RX4A 5TF0A 2P43B 4EN3A 4MNQA 1KJVA 5EUOF 5CZKA 1S5IH 4HJGB 3TVMB 5IEHA 2CDEA 4J3SA 1LEGA 2E6JA 4PR5A 5KJRH 1RZKC 1I8LC 4IDJL 1ZMYA 4J12A 1N2RB 5ESQA 4MSWA 3RKPA 1EV2E 1QUNA 4P2RA 4JFEE 2ED7A 1VPOL 1EFXB 1J5OH 1EERB 3BP4B 1ND0B 1P2CB 3WNOA 1CG9B 4XBGA 5E1AA 4KJWD 3O8XD 3LD8B 1UWEL 3A6BH 5FO7A 3T3PF 2CR3A 2QEJA 1BBDL 4TUKH 3BKJH 1IAKA 3FB7B 5T3ZH 1MHEA 1RZ8A 2V7HA 3O0RL 3GUTA 5JO5B 5HI4C 4I48B 4Z7WA 2XIDA 5I8KL 5HSFA 5BXFA 5GS0H 5EOTB 1Q72L 5HI5C 5LGJB 2NY6B 1RJCA 3D0LA 3DXAA 2BMKA 2LTQC 5CSZA 1F3JB 4DK6A 5K9OB 5CSGA 2BCKA 3T0VA 4YHPB 4NNPL 1T80A 4MJ5B 4LCIL 2DQGH 3QEGH 2NXZD 5EUOA 1LP9A 1RUPH 2GSGB 2AAVA 5IJKA 1AQDB 4L3EB 3ZYOA 3TBYA 3V4UL 1YPZB 1CZ8H 4PJIE 4AEFA 4JKPH 2B5IC 1A2YB 5CJQH 1T1YB 2NTSP 2PUQT 4GLRH 1UYWH 4G6FB 4LASL 2XA3A 1SYSB 2FJHA 5C9JA 1WEJL 4XCNB 1HE7A 2AJUL 2XZCL 3BGMA 2IALB 1F42A 3QG7H 3QI9A 5E2VL 1SVZA 5DMJB 1NFDA 5A3IC 1RJZA 3KPMA 2VKWA 2ITDB 1D9KB 2GKIA 2JJWA 3KYAA 5IFHL 4N9GA 5HHOB 1JHKL 2VLKD 4J8RB 2DLFH 4JFQA 2ARWA 5I71C 1KTLA 4O02L 1RURL 4P57B 5T1MA 3BGFC 4DZ8A 2XKNB 3PL6C 1WFTA 3MLTB 5FO8B 4OCWH 4I9WD 1R5VB 1IBGH 2V5YA 4XCCL 5EIQA 4D3CH 2IPUG 2AQ3A 4NYLB 3LN5A 2NY5H 3E6FA 2R1WB 1YYML 3H9HA 3TO2B 3U30B 3C2AL 2DICA 1WSST 3C5SA 2QSCH 1UT9A 1CFBA 5IKCA 1S7XA 2CO6B 4WEBL 3M17B 3U36A 5I0ZA 4FG6C 5F89B 3QWQB 2WAHA 3DV6A 2B1HL 1U8LB 3DVGB 4MD5A 4WI8A 3QIUD 5DDHA 1IMHC 5DS8B 3RZCB 4IRSA 4S1RL 4P46C 1JGUH 3G6JE 4KVCH 2C3VB 1UM5L 1BAFL 4OCRH 2V5SA 4NRYB 2AERT 3QEQE 4U1IA 1FZOA 3S3SA 2AK4B 4DKAA 3GK8H 4PTTB 1NPUA 3OX8A 1B6UA 3KPQA 4K9EC 4KDTA 1VENA 2AJ3A 2XICA 3DUUB 2UV3A 4ZD3L 5I76A 1S7QB 3QULA 1J1XH 1AGDB 1VADB 4DK3A 5HI3C 5K93A 2AGJL 3QDHA 2IPKB 1JP5A 3GKWL 5IVXE 1CDCA 3MRPA 3PHSA 5T1KD 4U6XA 4Q9RH 3SO5A 3O6KH 4CU6A 3UYRH 3KLAA 3BN9C 4YH6A 5JIHA 4LDLB 4KUCF 4LGRB 2APBA 2FRGP 2RQ8A 4HPYL 3ARGD 2P44B 5DC9B 5J6HA 1U3HB 4XNQA 3HFML 1G9NH 2CDFB 2P48B 3PIQA 4MMXC 4XMKH 3MV9D 4ONHB 4U0QB 3RPIB 3I2CL 5JQ6H 2EEBA 2XXCB 2X9WA 3D39A 2PYEA 3H9SB 5F9WB 5EG6C 1AGEA 2J8UB 3VFNA 3QFJD 3EYVB 3CSPA 4JFOB 3MLWH 3ARFB 3UJIL 1NC4A 3ALXA 3WS6A 1AO7E 4NP4L 2MNUA 3GMQB 2HFEB 3RVTC 4LPVA 4L9LA 2EIZB 5M95B 2ZKHH 2FL5A 3O6MH 1R5IB 2BVPA 1A0QH 4FZ8L 1FGVH 2PTTA 5F7LB 3MREB 1MSPA 1MFAL 4NFCA 4S1QL 5IVOA 4OI7A 2EXYC 2VQ1B 2EKJA 2Q6WB 4JAMB 2E9WA 1A6VL 1NGWB 1IE5A 1ES0B 1EUTA 3ULUD 2EC9T 3U2SA 4TSAH 4KY1H 3F5WB 2IH3B 5IVZA 5IP4A 4PTUA 4NQTA 3TYGL 1NC2A 1NGXB 1WIPA 5ALCH 5JOFA 3QO1A 2J12B 2OL3L 4FFYH 4NFDA 3MOQA 4KQ4L 4HXAH 2R4SH 4NJAH 1GGTA 1UM6H 3C6LC 1A1MA 3W9DB 1XR8B 5HHMB 4GAJH 3BPCA 4IRSD 1OGAE 3U48A 1IAMA 4JZNA 4OZ4B 4WO4D 1BJ8A 1VACB 4X4YB 1I3RB 4JFEB 1YY9D 5C0BA 1XF2A 3KXFD 1FVCA 3IVKB 4QXGL 4I3SH 1QLRA 4O51B 1QQDB 4URTB 1MFNA 4XMLL 1S7SA 1MPAH 3VDCA 1NBVL 4KTYA 4YJZL 3VW3L 2ZUQB 2DIJA 4NNYB 4ZS6D 2GY5A 1IGIH 5HGHA 2SEBB 5IW1B 3O45B 2VZ3A 2UVEA 4HIEB 3HMWH 4HK3J 3VRIA 3HMXL 1R0AL 3MV7E 4KROB 2YA0A 2X1QA 5C0AE 1MCLA 4X6DF 1C8PA 1D7FA 4N8VG 1FIEA 3GI9L 4DJMA 4TUOB 4LVEA 1IZJA 5DD1H 5ADOL 2IANE 4Y5YC 5FUCE 2CRMA 5E6IA 4FRWA 2JB5L 4IRZL 1GH7A 1F4AA 4MGXA 3FTGB 1NLBH 4TUJA 4OCNC 4P2OC 1EEQA 2I60L 3DX7A 3H42H 1A02N 4Z95H 1Q0YL 4GRWE 2NW3A 4GAGH 4LHUB 4PS4L 4JG1H 3VFUB 4Y2OA 5T5FL 2R23B 4U05A 5TF1L 3H7LA 4IOIB 2OXHA 1H8SA 3KS0J 3S34L 3GMPB 1GZQB 1GVIA 1I1AA 1X4ZA 1TZHA 3GO1L 1FJ1A 2QHRL 4EI5C 5IEKB 3PHQB 3GIZL 4YXLL 1IEBB 3EKCA 2FX7L 1DUYA 3Q6GH 4J4PA 3L9RA 1MI5B 1QPPA 1LGVA 1T83C 4QTIH 4LSDA 4UDTB 2E27H 3G5YA 1D6EB 3QJFA 4P59L 5JNYA 4FQ2L 3RTQC 2GITA 5E8NA 1T1WB 4DN3L 1MFBL 2V7NB 4NHUA 3DIFA 1M6OB 1DQQA 1F13A 5E94B 3MODL 1MIML 4LSPH 5I18L 1Q94A 3DSNA 1ITBB 1NC2D 4NJ9H 1Y18A 2C9AA 2YRZA 2R0ZL 1N0LA 4KK6C 4J3VA 5IWLC 4GQPH 3O81A 2FZ3A 3FB8B 5AZEH 3TV3H 3C5JA 4HSQA 3MLZL 1HSAA 4MA7H 2NX5A 2NNAB 4MJIA 1H0DA 1NANI 4JQVA 4O58L 1IL1B 4QNPE 2EH7L 3QP3A 5C6TL 1ZS8A 3BO8A 1C5DA 2OCFD 2YPKB 1KNOB 4KHXL 5C0BD 5HYJE 1TVHA 1T7VA 2FX8H 3CFKA 3FFCA 3KYNA 4UZGA 3P3YA 5HYEA 3ARBC 1FRGH 1MF2H 5D1QD 1TJHH 3TFKD 2I24N 4BH7B 3G6JB 1ZGLP 4POUB 1CXHA 4NBZB 2ZOKA 1BQLH 4U1JA 1E4XH 3SBWA 4TNVF 3DVFA 3CFIC 4K94L 3QQ9D 4NQXA 3N1FC 1PG7W 1WLHA 1UCTA 2XTJE 3N9GL 1TITA 5DEZA 1HDMA 2AEQL 3FN0L 1EMTH 4OIBA 4OLWL 4POZD 5FYJH 5KSBB 1CDYA 1YNKH 3MGAA 3QZWB 1UZ8B 5EFIA 4KU1A 2DQTH 5IMOB 5GPRA 4JRYD 3O2VH 1CGSH 4M5ZL 1K8DB 4XCFL 3V9FA 1FZJB 3VFSB 2EYSA 4AIOA 3CFEA 1UB6B 1S5HB 5HVGB 4D8PB 4Z7OF 5DJAA 1DBKH 4OF8A 4HH9B 4OSUL 2P49B 5AWNL 4DEPB 4JHZA 4GKNA 3SDDB 4K9EH 4RA0C 1BVKB 1I1AD 4NRZA 5C7XL 5EZOH 1QSEE 5FM4A 2KZ1B 5KVFH 4FFWD 3BAEH 3E2HB 1GPOL 1LMKA 4XCEA 2VXQL 4ZUUA 5L7XL 1ZKAA 4KI5F 2XN9E 2Z31C 4Q0XL 4X8JB 1AO7B 4LHQB 3ZT5A 5ADPL 4ZUTB 3GGWB 5T3XH 4CN4A 3C8KA 1N5AA 3NFPA 4DKEH 3HPLA 1R5WA 5C07E 3CNKA 3SDCD 5FYLE 1I3VA 3BYTA 3DSFL 5ICXA 3C60D 4KGJA 1IEHA 2A0LD 3KYOB 4HKZB 4KHTL 1U8IA 4RGOH 3BMWA 4JO4L 4ZO6A 3CMOH 2D4DA 3REVB 1MHPL 4JY4A 2NY1D 4ZXBC 4MA3A 5E99H 3WFBH 4LSQH 4ZNEE 5ITFB 3RNQA 1PLGH 3CK0H 3LV3B 5CIPA 1XGTA 2HG5B 1BM3L 1MVUB 4R96B 1RK1B 5TE6L 1CVSC 4PJGB 3VXSA 4UT7L 2WSKA 1SHMA 1QLFB 4TNVK 3QHZH 4NZJA 2WUCH 3CZFB 1OAKL 2VDML 5C0EA 4MQ7A 2C1PA 1R3JB 4QRRA 3ARDB 1YEDA 4XP6L 2CLVA 2F15A 4JHAL 4A2LA 3FFCD 3I6LD 2IJ0C 3A67L 5KS9A 3VFTB 5EOCH 5FYLL 4X9IA 4JO2L 3GSWB 1EGJH 3MBEC 2DQFB 1YNLL 1CGYA 2E7CA 5JDSA 4C83A 5TDOA 1NMCC 5D7LD 4MCZA 2D0HA 5ANME 1FH5H 4P5TC 5I30H 5BV7C 2DWEA 4NT6B 5EZIL 4TPRL 2X7LA 3PGFL 3O9WC 1N5YH 5J1AA 1QNZH 4Y5XB 4J3UA 1FAIH 2BVOA 4Z76A 4BSVB 1E4WL 2VSCA 3DMMB 1G7HB 1CK0L 2IANB 1IQDB 1YEGH 5HHPA 5J9PB 4FNLL 1W0VB 3ARQA 1L7TH 3VFGH 2ZG2A 4CMHB 1NUNB 1KEGH 3T0EB 1AP2B 1IC5H 4JANB 4RFEA 1L0XA 4G6KH 4ZTOL 4GRWB 1KENH 4HZAA 1LO4L 2WLZA 5GGVL 1ZTXL 3CSYA 2NZ9C 5L2KE 3ZDZF 2YEZA 1NDMB 3TBWB 4R4FL 5JZ7D 4K55A 3HE6B 3MLVH 2W0KA 4ALAL 3QAZC 3T04D 2J8OA 1G6RL 4PYGA 1HYSD 3PV7A 4JPIB 2XOTA 3IAPA 4N8VB 3L5XL 4ZOCA 3OKNB 4X6DE 4HJGA 4O2EB 3TVMA 1K2DB 5LQBH 4FZEH 2AP2A 1QP1A 5D70H 4TVPE 1YPZF 1U58B 2IQAB 3BD4A 1D5ZA 1LE5B 2XWJA 3FZUD 3JUZA 1J8KA 2ICEB 2B0SL 2O61B 4RWYH 3HC4L 1JGEA 2X1PA 3WHE0 2G75B 2OI9C 3RGHA 1SY6H 3TBSB 3NN8B 1MLBB 3GKZA 3DX9A 4QF1B 4HBCL 5B3JF 4PV8A 3TH2T 3ZSTA 3UDWA 5JO5A 3BPNB 1RULL 2PYFB 4LAQL 4DN4H 3EJYD 4PY8I 4AH2A 3I75B 4FS0A 5D71H 4GG6A 5LGJA 3DTXB 1I1FA 5FO9A 3LB6D 2BHYA 1HNFA 1HKLH 5E6YA 5K9OA 5C08A 3X11A 2IMMA 4JN1L 5FHBL 5GJSH 1AI1L 1WICA 1Z2KA 1Y6MR 1DUZA 1GHFL 2GSGA 1UXWA 2OJZH 1QYGL 5F7HA 1AQDA 5C3LD 3PWVB 3VXRD 3NIGE 2R1YB 3O6LH 1ZVSB 5JPMA 4ODWA 1T1YA 4K3JL 4OQTL 3PNWA 3MXWL 1SYSA 3LH2H 4LOUD 4ODTL 3MLRH 1G9MC 1X7QB 4ZTPL 4B41A 2GK0A 3V5HA 3W9EB 3BJ91 3MRKB 5E8EB 3H0TB 5T3ZE 4JPVH 1D9KA 1CICB 1DFBL 3ESUF 4UV4L 4KVNL 3C9NB 3RP1A 1QKZL 4GRLD 2NY7H 1GGIH 4FQXA 4PB9L 3ZZ1A 1MWAB 5I1CL 1XCQB 4FQCH 2B2XH 4CU7A 3MLTA 4MYWB 5F88B 1R5VA 5EIIB 2QKIA 3MCG1 4NYLA 3D87B 2ARJA 4JDTL 2R1WA 4ZUWB 3ZL4L 1BECA 4EI6A 3TO2A 3HG1B 1DDHB 3CFDA 1J5OL 1Q1JL 3OJMB 1X5XA 1OPGH 3A6BL 3ET9F 1T5XA 4QHUB 1E6JH 4H5SB 3E3QE 3G5VA 4JGUA 3RIAK 3M17A 1U8OA 4R8WH 3BKJL 4L3AA 5GRWA 5I1HH 5KG9A 1U8LA 3DVGA 2XQYK 4JFFB 3EZJB 3GB7B 4MQXD 4ERSH 3RZWA 5BRZD 4P5KB 4G43A 4FQIH 2AK4A 1IFHH 5CP7A 5DFVC 2LQRA 4L4TB 4M93B 4PTTA 3TC9A 2YBRB 3UJJH 1LO2H 1O7SA 3LOWA 3C08H 3GSUB 2DQGL 5SX4H 5DUMH 2XRAL 5JW5B 3FO2B 1VADA 5E4IA 3HTLX 3MXVH 3RWCA 2GCYA 2EXWC 1CZ8L 5DJ2B 2IPKA 2V2WA 5C08D 5FAAA 3G08B 1UB5A 1ZLWH 3WN5A 3GNMH 1EXUB 1XGYH 4M43L 4KKLC 2WW8A 4WU7A 4HFWB 4YHML 4FTVB 3QDME 1YZZA 2EDTA 2ZCKL 2I5YL 3PWLB 1U3HA 1UH2A 4LMQI 5GSRB 5CD3B 2CDFA 4HIIB 4WGWB 5L8KB 3RPIA 1P6FA 4XPGL 5J7CC 2IWGA 4YHZL 1LQSR 2QADD 4NM4L 4QRQA 2DLFL 2J8UA 1VERA 1WBZB 1XT5A 1FFNB 3MLUH 3V4VL 3GSNB 4YHNB 4OLEA 4YIQA 4NKQB 1RPQA 3GMQA 5K9QI 2F54D 3OR7A 1RIHL 4D3CL 1FZMA 4WY7L 3KPLA 1K5NB 4I0CC 3D3VE 1B4RA 1CD1A 4WENB 1I1YB 3JWNC 1R5IA 4FQXD 2HTKC 1KCVH 2ZUWA 3N1PC 1FL5A 1KN4L 3RKDD 4DW2H 4PJHE 1NGWA 3T1WA 1ES0A 3U6RB 5BV7H 1U0QA 4HUVB 1X5LA 4PJ9C 3O2DH 4YPGB 3F5WA 4ODSL 1DVFB 1MY7A 1NDGB 4LKCB 4XB8A 5DUBB 1Z5LB 1WVZA 2OJEB 3LKSA 1U8PB 3SJVB 3OKYA 1ZLVH 1H15B 2JJSA 1T7WA 4Z0XA 4MS8D 1B3JA 4KVCL 4TSBL 3RDTC 3UYPA 5KTEL 5DLMH 4HQQL 4P9HC 1SEBA 3W9DA 1XR8A 4U31A 2FR4B 3CVHL 5HYSB 1T21A 4ETQA 4EBQL 4P3CL 3TBVA 1SJEB 3HNVH 4OZ4A 3G6AB 5JUEH 2NTFB 4JFEA 4P4KB 4NPYA 3IVKA 1OY3B 2GEEA 2AEIT 4IIQB 5IM7B 3S4SB 1QQDA 3MRRB 5SWSE 1A6ZA 4ZYKB 3AS2A 5TE7H 3ZDZE 1LO5A 3ARYA 4APQB 2ZCLL 1BLNA 4JR9H 4KRLB 2DBLH 4U1GB 3UYRL 2SEBA 5IW1A 5JR1H 4E9LA 1FYTB 3S37H 2QQLH 1S8DB 4LSTL 3PP3K 5HJ3B 1CDJA 1DBAL 5B38B 3C8HA 1IRAY 4IOSD 3HI1B 1PYWA 4OAWB 4XXDA 3WV0A 3U9UB 1IGCL 1EUUA 4LSUH 5EULV 4PJDE 1H5BA 3BRDA 3T2PA 2VQTA 4IRJB 1T7XA 4Q6IA 4QY8B 1CFNB 1IGFH 2BRRL 2X4SA 4G8FA 4KDVA 3ULVC 2IFFH 4XNMB 5FM5O 4JZOB 4L5FH 2ZKHL 3BWAA 1KPRB 1TPXC 4U49A 4JG0H 1D5BB 5FXCH 3GMPA 2XQBL 2G5BA 4FMFA 2IAMC 4HF5L 3GJFB 4X7SH 5IESH 2KUTA 1MCDA 2GJ6B 5C92A 4PRID 3ROLB 3OF6D 3RWFA 2VIRA 4D9RD 2VISA 2C7UB 5DJDB 4LU5H 4DAGL 4YDIH 4OZGE 1FPTH 4X6FB 5EBLB 2UZYB 4HIJB 1T1WA 5CBAA 5E5MB 3WE6B 3MSPA 1M6OA 4RMSA 3QDJD 1CLYH 1WBYB 3MUGA 4PREB 4XHQA 5JHDB 5TPWH 2CRZA 1XGPB 4F7TB 4JKWA 4YBQD 3VG9B 5KSBF 5KSUB 3MCLL 5F7DB 1F3DH 1CL7L 3JV4A 4PJ5E 1G9MH 2R2EA 3QB7C 3F65A 3FB8A 4YHLL 3G6DL 3RWEB 3K7UA 3K2MC 2HTLD 4QXTB 4HUUA 3D18B 4HWZB 1IL1A 5MEQB 3PXHA 4NIKB 5I73B 2YPKA 1D5MA 1IVLA 3CLEL 2Q87A 2CUIA 1NEUA 1WGOA 1IGIL 3WHE1 1JGLH 3MRBA 2A9NL 3T0XA 4WI3A 4ONFL 1RZKL 4CVXB 3G6JA 5DMIH 5LXGH 4AEIH 3QIUC 4JQXC 1QFPA 3PGDB 4X7DC 1XEDA 4R97C 5DJXB 4U6HB 3WO3B 3IJYA 1FNFA 2VXTH 1IJ9A 1IAIH 1MFDL 5HGAB 4EIZC 2ZG1A 3LEYL 1YEIH 3ZKXC 3VXTB 4NBXB 1YN7B 4GAGL 1FNAA 1IARB 1AXSB 3QZWA 1MCHA 1QR4A 1F00I 4MDJA 4KDWA 5CILH 1A3QA 4OCMC 5IVXA 4EVNB 4PRPB 2YD8A 5DXWA 2AXHA 2D7NA 3JTSB 3MYJB 1ZHLB 5A2KH 2OTUB 1S5HA 1VEPA 3RA7L 3GSQA 3SKUD 4NZDA 1KGCE 32C2A 4BYHA 4QTIL 5FUZL 4HH9A 3VFVB 2E27L 4D9LL 3EGSB 3ARGC 1JZ7A 5FOJA 5HYIA 1BVKA 1CTNA 4Y5VB 3V2AR 3V4PH 2H26A 3MGTB 4YEFA 4ZFZA 3U7YL 2OL3A 1HHIB 1NEZB 1CDUA 4FP8L 3QHFL 2PO6B 1AO7A 2G2RA 2Z91A 4OM1H 4OCXL 5DJYA 4A6YB 2E3VA 3U82B 3GGWA 1T20B 4NUGL 3AS0A 3D3VB 5JHLH 4MXQD 1I8MA 1HHHB 4IMLB 3QISA 3TIEB 2GAZB 4PY8J 2HYMA 5FYJE 1DLFL 2AEPH 4HKZA 4MA7L 4MCYB 2IPTH 4C58B 1CDIA 3REVA 2HWZH 4C56E 4HG4K 1CDGA 5T5NG 1HOCB 5ITFA 3MUY1 4HS8H 1FL3B 1U95B 1EAJA 3BD3A 3RVWC 4G6JH 4JZJB 4LPUA 5E8DH 1RK1A 3W0WB 4N0FA 4WWKB 3ULUC 3HMXA 4PJGA 1HEZB 1ZXQA 1W8NA 3WFDL 4X5XA 3FRPG 1ED3B 2XWTA 4UAOC 1QR1B 4GXUN 5EC1A 3CD4A 4DFIA 1X5JA 2Z9TA 3PWUB 4HT1H 3ARDA 1BQLL 1CBVH 1S7VB 5GHWL 2GT9B 1QA9B 3QUXD 4L3CB 4WEUD 2BOCA 2IBZY 3ZE1F 3ZT6A 3OKLA 1OGAA 3OTTA 3P11H 4OF3A 1OOAA 3MRLB 2Y36H 5FA4B 4M8QB 4FXKB 3MRCB 3DVNB 3GSWA 3RNKA 3B3IA 3QEQD 3I3BA 1JRHH 4IRSC 4WO4C 1YNKL 2A83A 1YY9C 4LLQB 5FF6A 1QRNB 3SKOA 1TCRB 4NT6A 1T3FB 3QXDA 3TGXA 4OKVA 1RVFH 4CADB 5DZNA 2X4PA 1CFTA 5C0AA 4BSVA 1X5KA 1YY8B 4OLUH 4KDTC 3L5HA 3KLHC 1HZHH 1B9ZA 1G7HA 2IANA 4U1LB 4ZFOL 1TJIH 2V17H 5J9PA 4K9EL 4IHOA 3SDXE 4KTEH 5KVFL 3FOMB 2ADJA 2VAJA 1OM3L 4S0SD 4IBLT 1P6AB 1W8OA 4EIGB 4AM0B 2H32H 1NDMA 2HRPH 4NQSA 1IQWH 1MRFL 4S1SL 4P0DA 3I3DA 2YD7A 5C0GA 4JPIA 1OAQH 1F90H 2KPNA 3OKNA 4NGHL 3BE1H 4NKMB 2LFGA 4LSQL 5BZWB 4ELMB 5JLZB 3CVIH 4O2EA 5DRZB 3K0WA 2Y72A 1XZ0A 1Y6NR 4RAVA 2O5YH 4CDGC 3JXAA 2XYCA 3U0WL 5LCVH 4HXBL 4ZS7L 1J1OH 1UG9A 2ICEA 3MJ9L 2O61A 5E2TL 4M62L 3UTPE 1U41A 2APTA 2FD6H 2FJGA 3JWDC 4XWGL 3VXPB 3TN0A 5FYKU 3HC0A 3B2UD 4CDHA 2HT3D 4X99A 3NN8A 3PV6A 1MLBA 4XAKD 1NGQL 1RZFH 3QXAA 2APFA 2PYFA 5E1HB 1IC1A 3BKYL 1EGJL 5ITBL 4P49A 3BHBB 3MOBH 3S5LB 4Y8AA 4U7KA 1KJMA 4XP1H 1MFCH 5I30L 1OGAD 1OCWH 5ILTL 4WW2C 3U7AA 1KLGB 1MREL 5HYJA 4JM4L 3QUYD 1FAIL 2ZCHL 4XNYH 1MJ7L 1MNUH 2P7TB 4J3XA 2FEDD 4LLMA 2W60B 2R1YA 1ZVSA 5D1QC 3JVGC 4L8SC 5TFSL 1KEML 4KQ3L 4UT9L 1L7TL 2A9MH 2CLZB 4G9DB 4PGEB 3MV7D 4F33B 2B5IB 5C0AD 1C5BL 1QBML 2AJVL 4FXGB 1U8MB 4FFVD 2Q1EA 4C55A 3DNKA 5A2LH 2PW1B 4YFEA 3W9EA 3BIKA 3MRKA 4TVSa 5E8EA 1C12A 2VR4A 4JJHA 1CICA 4MZ2A 4POZC 3MLVL 2H2PD 5IB3B 4NNXB 5DQ9A 2M2DA 1JYXA 3DO7A 1U6AL 4QHNB 5IFJB 1SYVB 1N8ZA 5I1IL 1XCQA 2ZOLA 1ADQL 3SHSA 5IBTH 5I2IA 5F88A 5KW9H 1FSKC 4AT6A 4N90E 3BGFB 4PJBB 3OJ2C 3WBDA 3SCMC 1QSEA 2WANA 4LFHD 1CXIA 4L8DB 1ZA3A 1I1AC 2XN9A 4OD2B 4OUUB 2LU4A 3BZ4B 3RWDB 5DO2D 5EBWA 3ZKMD 3PWJA 4F2MA 4H5SA 2X4RB 5C07A 1RJYA 1SY6L 3FFDA 3G5ZB 1EAPA 5CBEA 4GAFB 1RV6X 1VGEL 3BQUA 3GB7A 3LIZH 3SDCC 4F7EB 5FGCB 4C56B 3C60C 4M61B 4OZIE 3TN0D 5ALBL 2VDQH 5D71L 2A2QT 1MRDL 1P69B 3D9AL 4P46B 4XC1L 5DR5H 1HKLL 2NY1C 5B21A 3TBTA 3EOTH 2YBRA 4XH2A 2OP4H 3N85L 1S9WB 2BFVH 4DCQB 3MRFA 3UTSB 2JCCF 1SEQH 4GUPA 1BFVH 5EU7C 1G7PB 1I7TB 5JW5A 3DX8B 4UOJA 3WNPA 2V9QA 3G04B 1RD6A 5DJ2A 4U6VL 1U8JB 1F3DJ 5HYJD 3HA0A 5CFHA 1C08B 2EICA 3CU7A 4KJPC 1EXUA 3VG0L 3PQYB 3WIFA 5SX5H 4HWBA 1TENA 4JM2A 4OB5L 2ESVE 1UZ6F 3PWLA 3QO0B 5C0RL 5GSRA 5CD3A 3ULUH 2ERJC 4HIIA 5DQJB 5ANMA 1G6RA 4D0CA 1A3LL 2XTJD 1ZAGA 1J8HE 5F9JB 2NY7L 4XNUH 3HLAB 4YDVA 1GGIL 2HN7B 2F5AH 2DMBA 4JFYA 1WBZA 4Y2DA 5GGTH 1DQJA 2PW2A 3GSNA 2FB4H 4O2CA 3WIHH 4PGCB 5ACZA 1NCTA 2AK1L 4XHJD 1A47A 1I9IH 1RMFL 1UEYA 3CX5J 5D1XC 2E9BA 1J0KA 3Q6FB 4H20L 5ID1A 4QTHB 4PRDB 1XF5B 4PJ7B 2W0PA 4UDUA 4WCYH 3KPOB 1OPGL 3O4LB 2FWOA 3LKQA 5D7SL 4J23A 4YPGA 5L2KA 1QSED 1YEJL 1JHLH 2IQ9H 5DUBA 4JRXB 2EC9U 1V05A 2OJEA 4OLXH 2XN9D 2DYPA 5JZ7C 1HNGA 1MCEA 4WUUB 4FXLA 1ERNA 4Z7QF 5H35B 4YE4L 1OGTB 5EORL 5C07D 5D8JL 5E9DB 5FYLD 1MCBA 2B39A 2WIMA 2OMBA 5K9QG 5D7KE 2D7TL 4E41E 1UKTA 1X6NA 4AG4H 1EVTC 3BQUD 5DEGA 3C08L 1U91B 3C6LB 4KUCD 2OK0H 2RCSH 3G6AA 1ORSB 1OAUH 3VE0A 2MOVA 1WWAX 3VD5A 3FZUC 3MRRA 2F53E 5KANI 4MAYD 3KHQA 4ZYKA 2DLIA 1C5CL 4PJAE 3QUZD 1FFQA 3QCTL 1HSBB 1IILE 5EBGA 4AZ8A 4LCYB 3O11A 1NSNH 1AGCB 1FYTA 4Q9BA 5I8OH 2HT4D 4Y16D 3T2NL 1YMMB 4KRNA 1PG7H 3MUHL 4XBEH 2B4CL 4XP4L 5B38A 1YYLL 2WLYA 3EJYC 3RWIB 3VCLB 5EWIH 3HI1A 3IF1B 4OAWA 5DUPH 1P5UA 1CFSA 3LB6C 3B5TA 4XB7A 1PGRB 1NANH 3MLUL 3QQ4B 5EPMA 3JWDH 5DD5L 3PWPE 5FK9A 5BS0E 4JCMA 4X8XA 1CFNA 3MPCA 1Q9WA 4P2OB 1J0HA 4E0RB 4XNMA 1P7KA 4P2QE 2MCPL 1CQYA 1P4IH 3X14B 3MRDA 1KPRA 4I0KA 3B43A 1D5BA 1RIUH 1VB9A 2A6IB 3OHXB 5LG1A 3LN9A 3GSXB 5E2UH 1CR9L 5DURB 2DD8H 5ISZB 4LOUC 2YD2A 3ROLA 3MZGB 4EI5B 3LY6A 5DJDA 2C7UA 5GRYA 2PTVA 1LNUB 3NCEB 3UEZA 1KYOJ 3VXUB 2NMSA 2RHEA 2DQIH 2RGSA 2ZUVA 3ZMRA 4KZEH 3HNTH 3JTTA 1X9QA 4X6BB 3RTQB 2JJVA 1NBYA 1KFAL 1CFVH 2BRQA 4NKIH 1TTFA 5MHSD 3AAZB 4HX1B 1WBYA 1SBBA 4GRLC 3BH9A 5L2KD 4K8RL 1NLDL 1SM3L 1NMBH 2HFFA 4QRPB 5IQ9B 5KSUA 3MJGX 5F7DA 4XGZA 4JRWA 3S36X 3GJFK 3UO1L 4PGJA 5GZOD 1ZHNB 2APWA 3IFNH 4CVZB 1J05A 2DYPD 4J6RH 5C0JB 5DVKA 3VU2A 1P7HL 2Z92B 4LSSH 1JN6A 4LVOC 1KB5B 3T4AB 5IBLC 3OKKA 2AKRA 2R2BB 43CAA 3CGTA 2X1OA 1L9MA 1H3PH 1JF5A 2BVQB 1MOEA 3ARSA 1MWAL 2VR9A 2DBLL 1CDHA 1RZ7H 3M1BB 4C54A 4ONGL 3DI2B 1NCAL 2XNAB 5ERWB 4YBLC 1UJTA 4RGNE 1XAUA 2J5LC 3GBNL 3MRHA 3O2WL 5HGBB 4Z8FL 3ARBB 4MQXC 1QLEL 5IUSA 3ZSSA 1I3GL 5GZND 5SWQA 3U0PB 2HJFB 1S9VA 1YMHA 4XNXL 2GFBB 4XMPL 3P4NB 4KI1A 5E8PB 2P1YA 4UNVA 3ARWA 2X41A 1PZUB 1ZLSL 4AIZB 5C0CD 3U46B 5TE4L 2Z4QA 5FB8B 1YN7A 5JXEA 5F1IA 2EKSA 3DO3A 1ONQB 5C6WH 5F71A 1IGFL 2YPLB 5DC4B 1BD2B 1F6FB 1Z0MA 5D2NC 2Q86B 1EO8L 2GHWB 4MXWL 5I15H 1DCLA 4MA1C 5CJOL 1FO0H 2EC8A 3JTSA 5CINH 1KT2B 1ZHLA 3QDMA 1UKQA 4LRIC 4PGZA 1JIBA 3X13B 4YHKH 3HZMA 3UP1A 3U9PH 3VFVA 1RFDL 4JGJA 5E00B 5LGHL 2RIKA 4F57L 4JE4B 4F9LC 4MB3A 4LSVH 4B7IA 2WK2A 3MGTA 9CGTA 5FV2A 1HHIA 2ENSA 4CNIB 2JK5B 2X4OB 1YEHL 4CMMA 2JIXB 4YUEH 4H1LG 4S10A 3MV8E 3UCRA 3WSQL 1CLOH 5TPWL 1T20A 3CVHA 3S36H 3KYMA 4RA3A 2O26U 2CJUH 3D3VA 4DGYH 3QIWC 4LGSB 1G9ML 3HC3H 7FABH 4LEOB 3VRLF 4PGBB 5D7JD 3IDGB 4MCYA 2AV7A 2LV4A 2DM7A 4YDLB 2LAGB 5KVGH 3LEVH 4PJHA 4Z7VB 3Q1SL 1HOCA 5KN5B 1BGXL 4XP9H 5DRNA 2Q76B 2DIBA 2EYTB 4F8TA 4J7RA 4ZXBB 4JZJA 4Y4KD 5IQ7L 1X4YA 2BSSB 3SKJL 1EHNA 3V0AC 4WWKA 4WUKH 1HEZA 3MUJA 3V79C 2AXGA 5B8CC 1WCBB 3X3FH 3GZKA 4LKXB 4AL8H 1HH6A 2GJZA 1YJDC 2X4QB 5E5RB 3VGAC 4OF5A 4LNVA 1QFWL 4Z7NE 2J6EL 4MS8C 3CPLA 5DK2B 4BELD 1RU9L 4O4YL 3O6FC 4Q58C 1QA9A 3RX7A 2AJXH 5LBSL 1YEIL 2X4NB 4KJQD 3MRLA 3WHXA 4OIIL 1PW3A 4FXKA 1AC0A 3MRCA 1W2KT 4I13B 4OLYL 5SWSA 4HAGA 3FJTA 3MBEB 4PJAB 1QRNA 3VWJD 1WJ3A 4GQ9L 1NMCB 2WINA 2XZAH 1L9NA 3CDGA 4HIXH 1JJUA 1KJ2B 1R3IH 3TWCL 3F7VB 5BV7B 1YY8A 3O9WB 4Z7QE 1FGNH 1C7TA 4M6AA 5I1JH 3SDAC 5JPNB 3D0VB 3B8SA 3BDYH 4ZO8A 3AM8A 4PG9A 1I1CA 1YUHB 2VLRB 2FNBA 3K1DA 3QUKA 4MD4A 4OFIA 3QDMD 3KPSB 4PJDA 3QIBA 4G6MH 5D1ZC 2X9XA 4M7LL 3TP4A 1JHTB 2IFGA 3MA9H 5EU4A 3C5ZD 3DECA 4AM0A