1I8KB

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'QVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVASISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGYSSTSYAMDYWGQGTTVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kB00
4U3HA 5EC1A 2K7PA 2CDEB 1IEBB 1CFQA 5HHMD 1WT5C 3PXJA 4N8CL 1ZGLA 3IXAA 1XCTB 3WUZA 4JLRA 2O5XL 4ODUA 3QG6A 4EUPH 3WJJC 2EDBA 2OMBA 4GRLA 4KC3B 3KDMB 3WFEH 2ZSWB 1CZ8H 2WINB 1HNFA 1K8DB 3QZWG 4CMMB 5CGMA 2VXTL 4NNYB 4WWKB 1RZFH 2GJ6A 4GUPB 1FFQA 2OL3A 3FFDA 3LQAH 1GPOH 4OLVH 5DS8B 4HS8H 1WWWX 3CFEA 4NQVB 5J12C 2ZCHL 3C09B 3L3OA 2F15A 3VXUD 4U6HB 4TYUA 5J0BA 2ZNXA 3RWGB 5I1AB 3MCLH 2XNAB 2J12B 4DWHA 4O51B 3QXDB 1CLZH 4X8XA 2EICA 5DRNA 3DX8A 5D7KD 1XH3B 1KLFA 5E94B 4NC1E 4S0TD 4BJLA 2Z31D 2OI9B 2FWOA 1FL6B 3CLFH 5IVXE 1YQVH 1YNKL 3GIZH 2Z8RA 3WKML 5I8KL 3LS5L 3MLRL 3D5OF 4P2RE 5D1QD 5DK0B 3SDAB 1A6AB 4L4VD 1DBAL 4HQQH 2YD9A 3QIWC 43C9A 4Y5VC 4JPVL 1FO0H 2BNRA 2VDPH 3VWKA 4G43B 1A2YB 1R0AL 3QEQA 4DAGL 1QZ1A 2H3NA 4HDIB 5I75C 5J1SC 2X10A 4P0DA 5D4QA 2VXUL 4AQ1B 4ZFOL 2VLLA 4TOYH 3LN5B 5J06A 4JHWH 1G0XA 2V9TA 4NN7B 5DQDH 4FMFA 4MJIB 2CGRH 3MGOA 2OXHA 4RFEB 4DUVA 4WRLA 5I1IH 2V17L 3OB0H 4GAYB 4HIXL 2P8PA 4GRMA 4BH7B 2VDLH 2XY2A 1DEDA 2DQIH 1SEBB 2H6PA 1Q9KB 3BH8B 5GRUH 1AHWB 1LO5A 1GYAA 4JRYD 5MI0B 4J7RA 2QQLL 5EU7C 2BJMH 3C5ZD 4X4XB 3ARDA 2X4TA 3QIBB 4G3YH 3OWEA 5GPRA 1SY6A 2R1WB 3H7BB 1IGIH 5H2BA 3IVKA 1IGCH 5J6GB 5EU6E 3U4BL 1FCGA 4Y4FA 1ZHLA 4K7FA 2C7UB 2XACC 1UXWA 3DMMA 2XN9E 3N9GL 4D9LH 2H41A 4ZOCA 1EAJA 5IWLC 4OKDA 3HRZB 1I9IL 3IU3B 3NCFB 3SO3B 1RULH 2AK4D 2RCSL 2CUMA 4UU9B 4W81A 5EN2B 4YDIH 4P2QA 5D7JD 5EO0A 2DJ4A 3EDDA 1ZA3B 5JMOC 3GMPA 1SJXA 1M05A 1U8IB 1YMMD 4FFZL 4YGAB 2V2WA 3WFDH 1ORQB 4KROB 4BK5A 5K9OB 3HMXA 4Q0XL 1XIWC 3OR7A 3QCVH 4P4KD 4FQIL 2DI7A 5DJAA 1CDUA 4LARL 4U2ZA 2CRYA 4ONGL 4Y16C 1K2DB 1NC2D 1LGVA 2IANB 4FZ8L 3PP3K 5I8CB 2QLVB 2GSIA 1IC5L 4G7VH 5DYOA 1BJ8A 4OSUH 2ED7A 4KUCD 4S10A 3GBNH 1FIEA 4U1KB 5BS0D 1T0MB 1YDPB 2HWZL 2XI9A 3UAJD 3HMWH 2OZ4A 2A9ML 1MCDA 4MD0A 4XCNB 1NFDF 3WCYA 5ESQA 5L8JB 4MQ7B 3IXTA 3W81A 3GJFH 5I6XC 5A2FA 3GMRB 3MNVB 1HILB 3MV01 2VLJE 1IAKA 1BBDL 4ODWB 3B3IA 3ESVF 3QO0B 1EJOL 3ZLQC 5JHLH 4KVCH 4L3ED 3NZ8B 4XBGA 1S7VB 3CAFA 5CZXC 3H7LA 3QNYA 2ZUVA 4X4ME 2VO5A 3C60B 4N8VB 4PJXE 4X5LA 4PP2B 4WWKC 5CJQH 2YBRA 3GRWA 2ITCA 1T1WB 5JOPE 2DI8A 4PJGA 1LVEA 4XNUL 1GSMA 3C09C 5F9JA 3HUJB 4JO4L 3U9UA 4XVTH 1BOYA 3WLWD 4ENEC 1HI6B 3VDBA 1D5BB 3IDMB 4XCFL 3VI3E 1LEKB 2BXZA 3U46A 4LVOB 2YKLH 1HZHL 1RVFL 1BPVA 5LBSH 1N0LA 4PRHA 3O3DA 3NIGF 2D7TH 4P4RB 4QT5B 3O0RL 3H3PL 1Z5LB 3L3KA 4KV5E 3O6KH 4PRDA 2P1YA 4NPYB 2IF7A 2MNUA 4H0IA 5TDOA 2JIXD 4OLWL 3EDFA 3RWIA 3BAEL 2OI9C 4LPUA 2IMMA 3A6BL 1JNLH 4ORGA 3VFPB 1A47A 2VZ1A 4TNVF 4F2MB 3BP7A 1CDHA 3GNMH 3SDAC 3GHEL 3SKJH 4Z7QE 4WY7H 3MV7D 1EK3A 2MQCA 3PIQA 4OIIH 1NFDA 3BRFA 1KCUL 3NN8A 3JTSA 1NC4B 4JE4B 2VXSL 4MD5B 1KENH 4X7TB 4PGEA 4N1EA 5L88L 1QSFA 4UQ3A 2OQJB 4M7JL 2V5SA 5C7XL 5FUOL 2ORBH 4ZUTB 3T1FA 2XWTB 4FQLH 4PJ8A 1MRDH 5FKAA 3WJJA 4ODXA 3LN4B 4WV1B 2MCPH 2HLAB 3MROB 3P4MB 4NN7C 1SJEA 4UT9H 3BZFA 1UH2A 5JHDD 3LKRA 5EC2A 3GK8L 4E41E 5M94B 5EUOA 5CBAB 4IM8A 1WC7A 3FN0H 3MXWL 4KWUA 3G5XA 1AHWC 4FNLL 4XHJD 3VXOA 5MI0C 5IQ7L 2ICWI 2GJ6D 1S7SA 1X5KA 3O6LH 1XGYH 2WM0A 4LSDA 1YEHH 2Q7YA 4ESKA 2B1HH 2RIKA 4RFOH 4DW2L 1V5JA 1GGCH 5BVJB 2D2OA 4N9GA 4RA3A 2EDXA 3V4VH 5C0EB 4X9HA 5GSRA 1YNLL 2RBLA 2EZ0C 3RBGA 3SO3C 2C1PA 2C3HA 1H3PH 4YZFE 2DL9A 1U58A 2GTWB 4JANB 4KPHH 4QRQB 5F96L 5T3ZH 5IB5A 1I8MA 3C5JB 4LRNH 4M8QB 3ARQA 3M45A 4K9EH 4OQTA 5FYJD 4HJ0C 4CL7A 1DVFB 1RUPH 4N1HB 4I4WB 1R3HB 1AP2B 5D72H 2KZWA 3UTZA 4KI5D 5C0IB 4KROC 1FYHB 3ECBB 4NC2B 3SE3A 3JTTB 4H1LA 1J7VR 2XXCB 3Q1SL 3AS3A 3ROLA 3MLYL 2YZ1A 2AV1B 3A0OA 3OAYK 5F9AC 1OAUH 1WFTA 1BWMA 5E9DA 3HAEH 1ZLSH 1MY5A 2X1OA 4J1UB 2BNRD 3VWKD 2DJSA 1MHCB 1BD2A 3NTCH 3QEQD 2VZVA 2CJUL 5AUMA 1J0KA 1EBPA 4M1DH 4P59L 3SPVB 1KC5H 2CKBB 3S7GA 1NAMA 1XR8A 1CL7I 3P0VL 3O41B 2VQUA 2I07A 2KQNA 3B9DA 3HI5H 3FB5A 2Q1EA 4NUGH 3G6JE 4GKOA 4GMTH 4FRWA 5JXAL 12E8L 3CVIH 4JREB 1OPGH 3TLRA 3IYLW 1R3JA 5AG8A 4G7YL 3V4UL 3LEXA 2W0FA 4EDXB 1MNUH 5KVGL 1X5ZA 1U6AL 3T0DA 4PRIB 1WZKA 5KN5B 4CN1A 4TUJA 2NY1B 4UBDD 2FB4L 3FAWA 2VL4A 4PV8A 2R9HC 4OF7A 4ERSH 3ARDD 3FB7B 1RZ8B 1PKQE 5DJYB 2PW2A 3MO1B 4NM8L 1FL3B 5KANI 1WV7T 1KPRA 4RWHA 4Y4FD 1RZJH 1V7NH 1C5BH 3DMMD 2CR6A 4JDTL 1BFSA 4LVOC 3STLB 1MY7A 3MJ7A 3PWVB 4XI5C 2DQGL 5EBMA 2AAVA 4KI1A 5MHSE 1KULA 4P2QD 4JAMB 4BQBA 1T80A 3TYGH 1TVDA 1XIWA 5HPOA 2FGWH 3QCTL 4M6MH 4PJFF 3X11A 2YD8A 4RWYL 1WWBX 4QNPF 4GBXA 4DGIL 4BFIB 4ZOEA 2Z9TA 3CPLA 1AC6A 5F1OB 4YBLB 1YQ2A 4GAJL 1A7BA 3VMOA 5DD1L 3KYMA 1R3LB 4MA8L 3VRIA 1UM5H 1EJ6A 4NQDB 4TSBL 1JNHA 1T21A 1U93A 4L8DB 4DGVH 3W2DL 3JWNC 4XP9L 1MHEA 4KH2A 3ULVF 2E9BA 2I9LB 4I18A 1T7VA 2E27L 5ITBL 2AJUL 4X7SH 1MVUB 3QUXA 2VZUA 3HNVL 1HHGB 2QSVA 3WNOA 3AS2A 4N1CA 4PY8I 1LWRA 3S37L 1MWAB 3KDMA 3CH8A 3ILQC 4LASH 4WV1C 2NZIA 2WINA 1K8DA 4HW6A 4KTYA 3V6ZA 5GZND 2DQHL 4FXKB 4GUPA 5GISH 5C6WH 4NQVA 2DLFH 3SGJA 4Z7WB 1OSPL 4C55A 5B4MD 2W38A 5FYLE 5JW4N 4U1GB 2O61B 5TFSL 4R6UA 3QCUL 2NR6D 3LSOB 5CP3A 1CGTA 4IMKA 5ANMB 4OGYL 2D03L 1FPTH 3QQ3A 2YPLB 5JORA 5I1AA 2XNAA 2XKNA 3FO9B 1BM3L 4MAYB 3W5MA 4MS8C 1ZVYA 5D7SH 4G6ML 5F7FA 3RBSA 2X9YA 2Y4SA 5GXBB 5E94A 3L3DB 5FA4B 1KN2L 3NVQA 2Y7QB 4PRHD 1FL6A 4JKKA 4NWUL 2GCYA 4K7PL 2NLJB 3CDFA 3LCYA 4QOKE 2FX9H 5HDBE 3HNTL 5DK0A 3SDAA 1A6AA 1DVFC 3L3JB 5FYLL 1JTTA 3RWCB 5F3BB 4ZTOL 5SX5H 1J18A 2VOTA 4G43A 5HD8D 1A2YA 5I1HL 2X70B 2QSCH 2WBJB 1GHFH 1ZK9A 1NCWL 3T09A 1MELA 4HDIA 2WUBH 1INQB 2C3XA 1NEZB 3UJTH 4HCRL 1QSVA 3MRQB 5CUSH 1HQ4B 1CBVH 3IDGB 2IGFL 4XVUD 5E8PB 4TQEL 2VH5H 3LN5A 5FCUH 3RWFB 1OVZA 2RB8A 4R0LB 3ZE1E 3WO4C 5CZVL 4MJIA 4JRWA 4PJ8D 4PJIB 5FM5O 3CVHH 4PD4K 4GAYA 2ZCKH 2DQCL 4BH7A 1DLFH 4ZO9A 5D7IB 1SEBA 5GRYA 3KJ4B 2AV7B 1Q9KA 3BH8A 1A7RL 2DQJH 1YJDC 4JREC 2GW5A 2B1AH 4EDWL 4X6EB 5CEXB 3L1OL 3MXVL 3QIBA 4X4XA 1I8IA 1T5WB 3FB8A 4MXVF 4P48A 4WO4B 1IAIM 3LKQB 1HQRB 5J6GA 5EZOH 1C5DB 4LSTL 2C7UA 1I7RB 5GGTL 3UZQA 1ZHNB 5ITFB 4QYOB 3VRLF 3WIIL 5C0CA 3GJEA 2W9EL 4RRPG 3IU3A 5DD0H 3VXRB 5E2WH 1OLZA 2WV3A 3ZT6A 5A3ID 3D25B 4Q6IB 1CD9B 3WD5L 1HHJB 1T1XB 2R23A 5ADOH 2VDKL 3LH2L 2Y06L 1FRGH 3BT2L 4BSVB 5K9OA 4YWGL 5LVEA 1XGQA 2IBGA 4OTXH 1IT9L 4HUUB 2R2BA 3MV8E 3ZKND 2NTFB 4RMUA 3QRFM 1K2DA 1HKLL 2IANA 1DQLH 4P3WA 5I8CA 3PDOA 1TXKA 4XX1G 4M7KH 4QHMA 1OP3H 4YBLC 5GRXG 1HOCB 3S35L 4MZ3A 1TTUA 1T0MA 1YDPA 4D3CL 5GS2H 3NCJH 2X4OB 4XCNA 3SGKA 5E9DD 2QR0B 1BVLA 1BD2D 4MQ7A 2C4FU 2MKWA 2H32B 2J6EL 3GMRA 5FM8A 3MNVA 2DTML 5J9PB 2IAMD 3RKDC 5C6TL 2ZPKH 3VMNA 4ODWA 1BIHA 4X80H 4RQQA 2AQ1A 4WENB 1TJHL 2DKSA 3NZ8A 2BNQA 1S7VA 5JIIA 1RK1A 3CXDL 3K2UH 3C60A 4N8VA 2AABL 4XNXH 4PP2A 3ORJA 1T1WA 4JFDB 1HSAB 3Q48A 3GSUA 4C4KO 5DJCB 1OTTD 1E6OL 3ESUF 3N06B 4AENA 3WE6B 1MCKA 2A73A 1XGRB 3I6KB 1FORL 1P4LB 3FFCE 5E4IA 1LDSA 1FZMB 1HI6A 4JY6B 1D5BA 3IDMA 4KDTC 4OZFB 4U1GC 4DOHE 1NMCB 1LEKA 1QFHA 5EO1B 1BEYL 1V8HA 3HKFA 4MAYC 5E0QA 1HXMB 1RV6X 4P4RA 4QT5A 1Z5LA 3VFNB 2N4IA 3AS0A 2HFFB 3AB0B 2FO4B 4JPWH 3QHFL 3QUML 2UYLB 1H8OA 4CUCA 2PN5A 3QQ9D 3T77A 2EDKA 3B43A 3ULUH 2CO6B 4F2MA 4KZDH 2Z8VC 3MX0A 3TCLB 1EO7A 1U8QB 4GBXD 3SDDA 2B4CH 6FABH 5JPNA 3BUTA 1UT9A 4OD1H 5KS9E 3VRJB 3IFPA 5ILTH 3IT8D 4MD5A 1U36A 2R1YB 4HWEH 2OQJA 2WBJC 4OBRA 2CIIB 5E5MB 5HYJD 2ZUYA 5J4MA 2EYTB 4ZUTA 2X05A 4I2XA 5IFAL 3O2VL 4X9GA 3DUUA 1P2CA 3D2UD 4WV1A 4YK4B 5GS0H 2DOCA 1A6UL 3UTTB 4DN3L 4G8GE 3QUXD 2HLAA 3P4MA 4W6YB 3KLHC 3BZEB 3SKMB 1CFVH 3G04A 4R96B 1A7QL 1T2JA 1FIGH 1L0XA 3QI9D 3KJ4C 4KK6C 3L5IA 1KXVC 5EWIH 2GTZA 5EFIB 4XNQB 4Q9QH 4YHKL 2AERT 2FEEI 4OM0L 1TPXB 4DVRH 1Z2KA 4NWTL 4U6VH 1JWUA 2OMNA 1F2XK 1JRHL 1M7IA 4BQ6A 4OIAA 5M95B 5BVJA 1DBMH 4POUB 5FKPB 4Z78A 5C0EA 5H37G 1CXHA 1C16B 2BRQA 1NBZA 1URLA 1RZKL 5T33H 4DVBB 4TPRL 3WEXA 4XPAH 5CAYB 4XPHL 4J4PA 4LEOA 4F33B 4NZRL 4I0CC 2GTWA 2NY5C 4JANA 3HR5B 5FF6A 3O2WH 2XZQH 1QSZA 4ZSOA 1U91A 4WEBH 4PLNC 4LMQE 1A8JH 1B6DA 4M8QA 2FX7L 4Q6IC 4JGJA 4W4NA 2DMBA 3UX9B 4I4WA 2E7BA 3ZDYE 5JZ7D 4ZS7H 1KCSL 5C0IA 3ALWA 2PETA 3ECBA 3JTTA 1X5HA 4WW2F 3GB7B 1WQVT 1MREH 5J6HA 1IGTB 3MOBL 2Z91B 1NGWB 2XG5A 4LPVA 1E27B 4Q2ZB 5DJZB 1OP3K 4J1UA 1AIFB 1JNNH 1MHCA 3MLSH 3KG5A 3IDIA 1GRWA 1HH6B 2OS7A 3VFVB 3T4AA 4OD2B 2YSSB 4FFVC 1EO8L 4I0PB 3ULVD 1G7QB 3SPVA 3VGFA 2X4SA 2O5YH 2CKBA 1U41A 1GAFL 5EPMB 1KSRA 1MIMH 1JGVL 3O41A 4KY1L 3H0TA 4NQTA 1BWWA 2FBJL 1LK3H 4Y4HD 1RY7B 4XHQA 1QHOA 4OUUB 2IQ9H 3CCHB 2OK0L 2IWGA 4WI9A 3UBXB 4EBQL 5E70A 3X12A 4IEFB 2EE9A 4TNWK 1DP0A 3WHE1 1CXEA 5GZOC 2HRPL 2P8MB 1A7OH 5KN5A 2F58H 4U6XB 4MCZB 4WHTB 3O2DH 5DQ9B 5GRZA 3QIBD 2EC9U 1RZ8A 2HG5B 1NCAL 3GHBH 3MRMB 3P0YL 3MC0A 1EH9A 3O9WA 4ZFOB 1K3ZA 5GRWA 1FL3A 1N59B 4OCYH 1A5FH 4Q9RH 3CX2A 4BUGA 4P2RB 1KJ2H 1CK0L 5C0CD 3C9NB 4UT6L 4XGZB 1P7HL 4YHPB 2Q3AA 5DHYB 4LCCB 3PWVA 4LLAA 3MBEB 1V3LA 3GBLA 5HHXL 5B22A 4JAMA 2OTWB 1QSEB 4ALAL 5C0BB 3E3QE 4BH8A 4X5XB 1Y6KR 1MQKL 4JY5H 3M17A 3KPQA 5BO1H 1N0XH 2Q8AL 4ZOBA 4I3RH 4KHTL 4BFIA 4EUPG 3H9HB 1EERB 2O5ZL 1VADB 1T66C 3HI6H 3GEWB 4LOUC 3GSXA 4LAQH 3PWJA 4XP5L 2VN4A 3B9EA 4NRXB 4P23B 4PLKD 5JPMB 1H3TA 3CMOH 1AGBA 1VEMA 5I73B 1XMWA 3ZYIA 2IQAB 2GITB 2UZIH 4NQDA 4OB5L 5E03A 1T3FB 5FDWA 4ZXBC 4CNIA 3NPSB 2E9WA 4I77L 5AD0A 3S4SG 4WU7B 4QTIL 1YY9D 1UQSA 2ADJB 2FECI 5TQ0H 2ESVE 3IDJA 4Z7OE 1HHGA 3SOBL 4PY8J 3TT3H 2HMID 2E8YA 1CF8H 1MWAA 4MDJB 3HB3D 3OKKB 5EU6B 2APFA 4YK4C 2A1WL 4Q9BA 1CTOA 4YDVB 1UEMA 2XQBL 3OHXB 4PJIF 4FXKA 5FK9B 1VGEL 5I30H 2CXGA 4QRRD 5F8QC 4Z7WA 1ZHKB 1VFBA 1QR4A 2BNQD 4LPTA 1YEKH 4OLZH 3JV5A 4O4YL 4BFGA 1CGUA 5IMOB 4RNRA 3C60D 4NZJA 2O61A 4Y88A 3SE8H 2J8HA 2CDFA 1XF2B 3VU2A 3LSOA 1FV1B 4I3SL 5T5FL 4LPWA 4M1CD 1P5UA 1F4WH 1J1XH 2YPLA 2X1QA 3FO9A 2J8UF 5EU3B 4LNRA 1IGML 1NCDH 3L5XH 4R26L 3DUHA 2I60H 2V7HA 1IARB 5FA4A 5GRJH 3K74B 3KYKL 3V9FA 1I3GL 4LQFL 3RVUC 1FFNA 5T1KB 5LAXB 5JW5B 3L7FB 25C8H 5K9JH 3DSNA 4D0DB 1C08B 1ED3A 1KBGL 1N5AB 3SDCC 3U7WL 2AJSH 3RWCA 3T3ME 5F3BA 1P1ZA 3TN0A 4L3CB 1OTUD 3QEHB 2VLJB 2X70A 1JGUH 2WBJA 3UJIL 4JVUA 2VZ3A 3SDDD 5E8EB 5IROC 4UDUB 2X42A 1INQA 4UAOC 5KVDH 3WXVH 1FYTE 1LMKA 3MRQA 3H3KA 1QFPA 4LDEB 3VGAB 1HQ4A 2X7LB 3IDGA 5E8PA 1AKJB 3BN9C 3FB6B 1KCVH 4I0PC 3SEPA 3CFIC 3RHWF 2VDOH 3QBTB 4W4OC 4R0LA 5T3XD 4PJXB 2NY2D 1P6AB 4PJIA 1OCWH 5E2TL 4XAKD 4H8WH 3O45B 1EXUB 4KK8C 4AT6B 4PGDB 4JJ5B 1U2HA 3RDTB 1IEAB 4X6EA 1RZIA 4GJTB 5C6PB 1XF4B 2VZTA 4H20H 5FHAH 4AIZB 2EDTA 1T5WA 3BSZL 3MUHL 4HXAL 1QR1B 4ZFGH 4WO4A 5HTSA 2H45A 2M26A 1T7XA 2J8UA 3DBXA 1C5DA 1I7RA 5J56B 2LU4A 2ICEB 1ZHNA 4PB0H 4QYOA 1YECL 4ZTPH 4NC1C 4L3AA 1MEXL 4KJWD 5KAQF 2NW3B 1A9EA 4U6YB 3VXRA 2FH8A 3MLVL 2ZG1A 4WUUD 2AXFB 1NGZA 2E8ZA 3D25A 3VGGA 3TPKA 4LCCC 1T1XA 1IZKA 3MBEC 1MCEA 4LF3B 5HGBA 4J4PD 2F53E 4DGYL 2LV4A 5HHOE 2Y1VA 4PY7A 1MFAH 4PJDE 5F97E 2P24B 2NTFA 3QXTA 2ZSVA 3SHSA 1OARH 1KJ3L 3LIZH 4OF8A 2BVOB 3WDHA 1I9RL 1JF5A 4PS4H 1YEGL 4NQEA 1HOCA 2ZG2A 1TTGA 4P23C 3EDKA 1AI1L 3R8QA 1KJVB 5I73C 2B0SL 1INEL 3VWJA 3SDYL 3QAZB 3NPSC 4E41B 4ACPA 7FABL 3EYSL 2AXHA 1K85A 2A2QT 2W0LA 4PRNA 4LLQB 3T2QA 5IGXH 4M7LH 5IBTL 1VGKB 4YO0B 4L8CA 3AC0A 1KIQB 3SQBA 1T0PB 1H3WM 5DLMH 2EH8L 1OAYL 4KRNA 4HF5H 4HWZA 3DTXB 3V0AC 3BIKA 3EOBB 3S98A 1OB1B 4JG1L 1QEWB 1DBBH 2AGJL 4UV4H 4KHXH 1ZTXL 3C2AL 1HSAA 4JFDA 5DJCA 2H1PH 5CEYB 3SDXF 4HKZB 4K8RC 5SWSA 2PO6C 3WE6A 4HAGA 1Q0XL 1R5WB 2NY1D 1XGRA 1NDMA 3VXNA 1P4LA 4OZFA 5I74B 3FOLB 4JY6A 4KK5C 3CUPA 4HG4J 4GSDH 3KR3L 3O9WD 5EO1A 3CX5J 2EO9A 4OCSL 3MA7B 4ZFFA 1EPFA 3HFMH 3WN5C 3P77B 4PTTB 3VFNA 5FB8B 1G7IB 3NIFF 3GKWL 4K2UH 4XCEB 4Q58C 3WFBL 2UYLA 4YGVB 4NO3B 3P2TA 2N56A 1I8KA 3PHSA 4AJ0A 5AWNL 5KVMC 1U8QA 1GL4B 3SGDH 3RVTD 1IFHL 2XG4A 2EEAA 4LPCA 2ILLA 2VDNH 3L9RA 3VRJA 4AL8H 3DJ9A 1MCPL 3OB8A 4BZ1H 3MACH 1LP9E 3FQRB 2R1YA 1CL7L 3G6JB 5CMAA 1UWEH 4XP1H 2CIIA 2GJJA 3RRQA 5F1NB 2VC2H 4NQDD 4LKCB 1FBIH 4J23A 1ZSDB 3VGAC 1CQYA 1K4CA 4GQPH 5TE7L 3PGFH 2PCPB 1DSFH 5D7LE 1N64H 3DV4B 4NQCE 3UTTA 4HIJB 4OCLC 4AH2B 2E6QA 1PKQB 2BP3A 2XWBB 3SKMA 3MLTB 4R96A 4K3HA 3FJTA 3R1GH 3SDXA 3RDTC 1ZGLP 2VXQL 5EFIA 3QRGH 5FYKL 2A0LC 1F11B 4JO1H 5ICZB 3R4DA 5LGHH 1A21A 1CGWA 1UZ6F 4LP5A 2FHCA 3T0EE 4J3UA 4Z0BL 3ARBB 3PF2A 5HVFB 4R2GB 2P5EE 3S5LB 4HWBH 2B39A 3IFLH 1T83C 2H2PC 4JHAL 4HIHA 3MA9H 5IVXF 2YPLD 4DVBA 5L2JA 3QIUB 3WFZA 5EOQH 1BQLL 2Y07H 4BQ9A 4YE4H 4FQ2H 3HR5A 3EBAA 5FV2A 3BMWA 4KKCC 1FGNH 5E6YA 3LRGA 2K1MA 3A67H 3ZE2E 1RJZB 3O4LA 2FNBA 4TSAH 2DJUA 1IGTA 2Z91A 3S3JA 5IVNA 5IROA 1E27A 3OKOA 4Q2ZA 5IW3A 1JUFA 2JK5A 2MTPA 2DM7A 4HPOH 3TN0D 1AIFA 1KLGA 1HSBA 2LE9A 1HH6A 4OD2A 2YSSA 1E4XL 2WBJD 3OMZA 4I0PA 3TA3D 3BW9B 2IG2H 1G7QA 4LGRB 4JR9L 3OTTA 4W4OA 1KNOB 3I50L 1BAFL 2D4FA 3L3HB 3QAZC 1GGBL 1WBXB 3F58H 5EPMA 3QB7C 5L0QB 4F7EB 3LS4H 3JV6B 4HKBB 1ROWA 2BRRH 4OUUA 4TN9A 5B3NA 4XC1L 3GDBA 4H0HB 4F57L 5IW6B 1RJCA 1SHMA 4K23L 5D70H 3NZHH 4LHUB 2PXYB 5DHXB 3W39B 4Z9KB 4A2MA 4U6XA 4MCZA 2XTJE 4LGSB 1RK0B 5DQ9A 5L7XH 2UUDH 5LG1A 1ZLWH 3SKNA 5CKGA 2HG5A 3MRMA 4ZFOA 4WO4D 2VABB 1EZVX 1BLNB 4K94H 5IVXA 1N59A 3TC9A 1U8JB 2V5RA 3PL6A 3P11L 1OAQH 4QOKB 2A77H 3FQXB 5CGYD 4HUXB 5I74C 4P2RA 4MQSB 5GGVY 1DUZA 3C9NA 1RIVH 1MI5E 4F37F 2P5WE 3FMGH 2KUTA 4JB9H 1X44A 2OTWA 1WK0A 4M5ZL 1MFCL 3FO0H 3TVMA 5D6CA 3PDDA 1QYGH 4I9WD 3ZYJA 4BM7A 1YPZF 1T89C 1U8KA 1J05B 1QHPA 4RFNB 2ZCLH 4Z7NF 1VADA 3NH7L 5D71H 3E6HB 2W9DL 4NRXA 5J89A 2HT2D 4Z77B 1CE6B 2GYSA 4P23A 5JPMA 4KQ3L 3BO8A 1UEYA 4HC1H 5D9SB 4V2BA 2Y36H 2ZKHH 4YPJA 2NXYB 3EOYG 4NQED 4NZUH 5TE6H 2EDRA 4FFVD 5GGRY 3PGDB 5ACZA 1INDL 4DZBA 3VWJD 3D0LB 2KH2B 2E5EA 1YN6B 1JF6A 1WZMA 5HDQH 3QA3A 4JGMA 4BZ2L 2J88L 2XZZA 1H3VA 4MDJA 3ELAT 5EU6A 5C8JB 3H42H 1FFOA 2VE6B 4YDVA 5I18L 5SV3A 3QDAA 2XN9A 1MJ7H 5FK9A 1DJSA 2EDHA 2JJUA 3RWDB 4QRSA 5AYUH 3S88H 1FVCB 3REWB 3U7YL 3KLAA 3RVVC 1NEUA 2AEQH 5IMOA 1CDIA 1TJIH 5FGBC 1S7RA 2BDNL 1H15B 1FV1A 4JFDD 5C2UB 5SWSD 2OJZH 3O6FA 2F19H 3ARBC 5EU3A 1NUNB 5DMGC 4O9HL 4R2GC 3MV8B 4PB9L 4BZYA 5ID0B 3GBML 3TEUA 3ARWA 2WWKO 5IBUB 1Q94A 2PYEA 1HEZB 3HRPA 1VENA 3QIUC 2ARJA 3WBDA 4NT6A 4RIRB 4NKMA 5T1KA 4D9RD 3FTGB 5LAXA 1I85C 5EULV 4Z7QF 1FG2B 3GUTA 4D0DA 1C08A 5D2LE 1N5AA 1OAXL 4LCWB 3QHZL 4NHUB 3QWRA 4L3CA 4OCNC 2DF3A 1A1NB 2X4UB 1A6VH 5J13B 5A2JH 5C0NC 2VLJA 2D0GA 1DQQA 3VFMB 3MRLB 2YRPA 5E8EA 2VLMD 4QRUB 4H88H 5BQ7A 3UC0H 1MAMH 1AKJA 2W60A 1P53A 3FB6A 4ODTH 5AZEL 5CEZD 4LU5H 2YOCA 3F7YA 4MJ4A 3SGEI 5K59E 4BKLB 3OBAA 1A3RH 1TETH 1G6RH 3QUMB 4PJXA 4XC3H 3IETB 1J8KA 4MX7B 2GQHA 3WS3A 4YHNB 3O45A 1EXUA 5KVEL 1Q0YL 4PGDA 4UIMA 5DUPH 4AT6A 4JJ5A 2JELL 5DF0A 3FQNA 3RDTA 3DPBA 3UTTD 2YR3A 1IEAA 3FFCB 2K9UA 5K93A 5KTEH 2Z93B 4DKEH 2L7JA 4DOHB 4FA8A 5F6HI 1OW0C 1C1EH 1XF4A 4AIZA 1QR1A 3K3QA 1AO7E 5ESVA 3QWOB 2QBWA 5EOCJ 3O11A 4NYLB 4WJ5B 2ICEA 1T83A 4YHLH 4M4PA 1G7PB 3LZFH 2NW3A 1Q9OA 3UCRA 1K6QH 4FG6C 4U6YA 4S1DD 4O2CB 5FOBB 1EEUA 5GGSB 3QEGH 5F9DC 3V0WL 2OL3H 1RUQH 2R4SH 4LSQL 2H26B 4R4NC 2R8SH 4N0RA 3VXSE 5DI8B 5KS9B 3CZFB 3EW3B 2G60H 2H9GB 4Z6AT 5L9DH 4ISVB 3WLBA 4NKIL 3MV9D 2BVOA 5E1AA 3X3GL 5H35A 4RFNC 3G5ZB 4I5BB 2HH0H 2RQ8A 2ZCKL 3O4LD 1RUAH 4OI8A 4LL9A 2NZ9D 1I3RB 2VUOA 4CU7A 4M43L 1BECA 1E4WH 1UB6B 4JFOA 4G8GB 3O4OB 4UT7L 3RZCD 3X3FL 1IILE 2NXYC 1IEHA 2GI7A 2CLRA 5KSAB 35C8L 5SWQB 1YEJL 4OJFL 1TVHB 5FUZH 4LLQA 1I9EA 4UILL 2CO7B 3TIEB 1VGKA 4Y19E 2OX5A 5CHNB 1KIQA 2YXMA 2XV6B 4KK8D 4NRYB 2GFBA 2L0DA 1U8MB 2FEEL 5C09D 2W0KA 3EO9L 4FP8H 2VKWA 3B2VL 4LDLB 3DTXA 3EOBA 1Q1JH 1OB1A 1QEWA 3DGGA 1DL7H 1Z3GL 4K3EL 5C2BL 3NA4A 5JQ6H 1YYML 4XVSL 1WGOA 4KUZL 5CEYA 5KW9H 4KK9D 1FNAA 1CGVA 4N0CC 4K07A 2XRAH 1T03L 5DMIL 4XNMB 4JO3H 2OP4L 3IAQA 2DBLH 3D39E 4EQ3A 2WANA 4CADB 3MA7A 4OLYH 4UB0L 3PL6D 4PG2C 4QHUB 4XBEH 1OF2B 3P77A 4PTTA 3T2OA 5FB8A 4P2RD 1TIUA 2ZUUA 2P42B 1G7IA 4O2FB 5B38B 3TJEH 2KQMA 1J9CT 3ZHDA 1KELH 1SY6H 1RHHB 2ADIA 3HNSL 2BSSB 3TVMD 4MJ2A 1K5NA 1QFWI 5D1XB 3CSBA 2I27N 3HA0A 1FE8H 4XCYB 4LHJB 1N4XL 1A3QA 2EIZA 5C86A 2VLRB 2AXGB 4X7FC 1ES0B 3I2CH 3A6CH 3FQRA 4XZUA 3WUWB 5CJ8A 4CBPA 5ICXB 5F1NA 1F58H 4CU8A 1J1OL 4LKCA 4U2YA 2DLIA 1VHPA 2XZAH 5F72S 3HMXH 3M8OL 1K9TA 3CFBA 3P9WB 4MMXC 1I7UB 1JK8A 1YEFH 1MFBH 2ENSA 1PKQA 4NRZB 5CILH 2FO1A 2XWBA 3B5HA 3MLTA 2A6IB 3LB6C 2VNCA 3Q5YA 4ZG1A 2NY0B 2OZ4H 4WI5A 1F11A 5FGBA 2XN9D 2P49B 5ICZA 2X4QB 1F3RB 3ZHLA 4ZQKA 4JO2L 1LO0L 4O2EB 1D5IH 2F8VA 3PWUA 1YN7B 3ARBA 1QNZL 2CMRH 2CH8A 4P2OA 3EAKA 4K3JH 3EOTH 1N8ZB 3RIFK 2PR4H 1S9XA 4OUOA 1Q9LB 1L7TH 3O6FD 3QIUA 3KPRE 2ADGB 3UDWA 1C5CH 1NLBH 3DHJA 2HT4D 4M6OL 3RY5A 5IUSA 3CZJA 4QF1B 3FQTB 3TO2A 1LO3H 3IJHB 3DHMA 3UZVB 2PYED 3GRWH 3OSKA 3MJ9L 3BUYA 2NY6B 1KCRL 4L29B 5FAAA 5T1KD 1CVRA 3WNPA 3GO1H 2Z8WC 3G5VA 3T2NL 3DIFB 4L9LB 2XA8H 3ARFB 3OKEA 1HINL 2ESVB 1LO2L 3DRTB 3QPXH 1HYSD 4CN4A 5I15L 3QWRD 1KYOJ 2FECL 1NAKH 2N7BA 5BV7H 5DEFB 5EBWB 1TJGH 2I9TB 3BDYL 3OAZH 3GM0A 1NUGA 2I5YL 1KEML 2VLJD 4NKDB 2EXWD 3ZSTA 1ZEAL 3BW9A 4P3DB 4X6DE 3ZE1F 3MJ8B 5E6ID 1KNOA 3D69B 3O4OC 5F70A 4CW1A 3RQ3A 3EZ8A 3L3HA 1WBXA 3B8SA 4R4FL 4D94A 4HKBA 4OGXL 5KSAC 1RURH 3HC0B 3C8DA 4ZFZB 4ZAKA 2XY1A 4RMVA 4GQ9L 3RL1B 4Q6YA 5IW6A 5EU4B 1OW0A 5JOPD 4HBQA 4LLMB 4LSVH 4LHUA 2PXYA 1W72L 4WFFD 4RGOL 3W39A 5EZIH 1MCFA 3OGCB 1UYWL 3VJ6B 4XPTL 3RDTD 4TVPL 4WEBL 2A0LD 5CFHA 1T1YB 2XZCL 3RPIB 4KTEH 4HCRA 5GJTL 4MJ6A 2DB8A 5MP6L 1NGPH 5JW4M 2VDRL 2VABA 2CK2A 4X7DC 1BLNA 1A1OB 3NA9H 1U8JA 3V5DB 1NANI 3MRRA 5FM4A 4O02L 1PJ9A 4EIGB 4QOKA 4U1SB 4HUXA 1KFAH 4NBXB 3X13B 3ZZ1A 2R4RH 3ULUF 4HPYH 4JG0H 3DURB 4PRBB 1ADQL 3ZMRA 3TFKD 4XP6L 5GRVK 1IAIL 4ODVH 2VAJA 3QXAB 3LRSB 2Q6WB 1IMHC 4F3FB 1U8HB 1G7JB 3W11C 1MCRA 1MCLA 3QNZB 3MZTA 1U8NB 4P5KB 1MFNA 2VL5A 1J05A 1WCQA 1FYTB 3GMMB 4QWWC 4QXGH 3E6HA 5L2KE 5JR1L 1SJVA 3LHPL 5GGTA 4HGKC 4Z77A 1PD6A 1CE6A 5D1XC 2WBKA 3MLXL 2EXYC 4FQJH 5MEOB 1NPUA 2AEPL 1B4RA 1J8HE 2E7CA 3OAUH 4PJCF 2IC2A 4OGAC 4P3CL 5AYQA 5DVNA 3U0WH 1QBLL 3PGDA 2R0LL 4OQTH 4E5XB 3BJLA 3D0LA 1X4XA 1AGFB 1KGCE 2DQEL 5E24E 4L8SB 2IPKB 3AY4C 5HJ3B 1VFOA 3J8F7 2Q86B 4H1LH 3ZL4H 4FQXD 3DXAD 3B2UC 5C8JA 3VFOB 3KS0J 4X4ZA 3HZYB 3WNLA 4G8EB 1JVKA 1EV2E 5JDJA 1A4JB 3FRUB 2PKDA 4P5TC 1G9MH 3M07A 1FVCA 5A2KH 3REWA 1KV3A 2FJFB 2I24N 5MERA 1NAMH 4NGHL 2R0WL 4NNPH 4G6AC 2J6EA 5AEAA 2F53B 3U82B 2X4PA 4PG2A 1K4DA 4HUNB 5HHOB 3PV6B 3E3QC 4HHAA 3KNBB 3FQUB 3MV8A 4PJDB 5ID0A 4M3KB 5EA0L 1S9VB 2G9HB 5D8JH 4YHZH 5DD5L 2ICWB 5SX4H 1Q72L 4JM2B 1KIUA 4LFHD 4RIRA 1N6QH 4HZLB 4FXGB 1JZ2A 3DVNB 1KG0B 1FVEB 43CAB 3QISA 3Q0HA 5IMMB 1UH3A 2EE3A 1HHIB 5KS9F 2XPGA 3HE6B 4NHUA 3DVGB 1A1NA 3LDBC 4M61A 5E5RB 5J1AA 1QKZL 2A6JB 2YD7A 3S36H 5DC9B 4U1HB 5LXGH 4L9LC 3INUL 4LKXB 3WXWL 3MRBB 3BDXA 3PWPE 5HBBA 2JCCF 3UBXI 4QRUA 3D9AL 3VE0B 4NO0B 2HTKD 1OL0A 4GMSH 2QQKH 5EOCH 2MHAB 4N5EC 1NSNL 5CS7A 4R7NB 4BKLA 1N3NA 4HGWB 1IC4H 4MX7A 4NCDA 4QRPE 1AQDB 3TBVB 3P40A 4YHNA 5A16B 1P7KB 2DIJA 3FFCA 2FEDC 3TV3H 5DO2C 5H8DA 1RFDH 2NY7H 1ACZA 4ETYA 1MHPL 2NPLX 2NX5E 5C1MB 3T0XA 5DRZB 4KAQH 3QWOA 2EE6A 5C0DB 1NFIB 2YPVH 5DHVB 3NCMA 4X99A 4WJ5A 4GAGH 4NN6B 25C8L 2Y5EA 4WFGE 2X6MA 1XT5A 2DN7A 3B8YA 4ODSL 1F3DJ 1G7PA 5F7EL 5MHSD 1I7ZB 3ARBD 2R0ZL 2IPTL 2HKHL 3WIHL 2JB5H 4P2OD 4JM4H 3UZEA 4O2CA 5FOBA 3TBYB 4M62H 4C4KT 4Q9CA 5GGSA 5J7CC 2NTSP 4FHBD 4ZS6D 1FH5L 2HFGH 5L8LB 1NLDH 4XPBL 4PUBL 1VEOA 1A14H 3NOIA 5KS9A 5DI8A 3CZFA 3S34H 2G75B 1WEJL 1EMTL 1LP9B 4ISVA 1HKFA 4QHKJ 4I3GA 4OCRH 5CP3H 1YEDB 1T5XB 3G5ZA 1JGLH 1I1CA 1N2RA 2NY4D 4I5BA 3ZDXE 3LAFA 1GXEA 3B9KB 4QHLB 4HS3A 4M02A 4OV5B 1UCBH 2VXVL 2HJKB 1I3RA 3U6RA 5D7LB 2BVPA 3IKCB 1A0QH 4NQCB 4G8GA 5D1ZC 4JEGB 1ZV5A 1BVKB 2E9JA 4U1NB 3O2DA 2UVEA 4NP4H 4FQ1H 1QVOA 4Q7DA 1GIGH 5SWQA 5B39G 1TVHA 2F8OA 4TNVK 1QFOA 4JRXE 3GSQB 1YC8A 3O8XA 3TIEA 4UTAL 3OKDA 4L8SC 1LO4L 4X7EC 3V6FB 2N1KA 1HE7A 1YA5A 1JMXA 4HH9A 3T0EB 2AK1L 3D85B 4FOMA 5FCSH 3CLEH 4ZAKD 3QO1A 5FYLD 2P5EB 1D6VH 2IFFH 1DQDL 2W9LA 3TZVB 4GG6E 2VLKE 1F97A 4D9QE 1SMOA 4LHUD 4XNZB 2PXYD 4S1SH 4NQSB 4XH2B 2YD6A 1LNUB 3FONB 1KN4H 3OXSB 5LJYH 2X09A 2Y25A 5E2UL 4V1DE 2FGZA 1H8SA 4JFHD 4POZC 5DEGB 5JOEA 1C12B 4HJJL 1PX3A 4MCYB 4WNQB 3BYYA 4CADA 4FG6D 1OF2A 1LD9B 4Z7UE 4PJ9B 4QOKD 1F8TL 1P4IL 4YQXH 1F4AA 4O2FA 5B38A 3MRIB 4MAUL 4UZGA 5GS2D 2BOBB 4AZ8A 5DWUH 1CFTB 1RHHA 5FYKU 3L5WB 2OTPA 4QGTA 4JM2C 3W0WE 4WCYH 5B3JF 4RGNC 1QO3B 2Z4QB 4PBVC 1AXSB 5T1LB 2EIEA 4LLUB 5D1XA 5IMLB 1B4JL 5IESH 1AY1H 4DN4H 3EO0B 5IHUL 2NQCA 4XCYA 5DFWH 3HE6C 1S7TB 3BESR 1RUKH 5J8OA 4HV8B 4ETQA 4OT1H 4HXBL 2AXGA 5GHWL 1ES0A 5I1JL 3WUWA 3S36X 1DLHB 3HAEB 3M1BA 4KMTH 3KPSE 3VCLA 4Z7OF 4LSSL 1J5OL 5CJOL 3AY4A 1DEEB 2KPNA 5E8DH 3JVGC 4R90H 1SBSH 4D8PB 4WU5B 1MF2H 3IDUA 4WFHD 2XTJB 3ARRA 4G8FA 5TQ2L 3B6SB 3EYVA 1DBKL 4PRAB 1I7UA 1JPTL 4NRZA 4LBEB 3KLSA 2CDGB 4ZYKA 1AR1C 1CE1L 1BGXL 1MCHA 3RU8L 5JXEC 2A6IA 4M1GL 4UDTA 3DX6B 1FC2D 3MLUL 3LQMA 2YC1B 2JKXA 1A6PA 2X4QA 1XZ0A 4UIKL 1MI5B 3PNWB 2P5WB 3TGXA 1E4KC 2DQFB 5F7WC 4YHML 3KWWB 4MA7H 1OWRM 4NN6C 2R39A 3ULUD 3Q3GB 4IS6B 4EN3C 5I0DA 5DVKA 2DQTL 2F54E 2ADGA 3WHXB 1BQHB 4RMRA 3MV8D 4J8RB 5HHME 1LK2B 1YMHA 3FQTA 4QF1A 5KANG 3IJHA 1JHKH 3OZ9H 1WFUA 4WW1B 1UKSA 4MQTB 4ODBD 4U1MB 5MEND 4L29A 2AP2A 5F9OH 5D5MF 3V79C 4FTVA 1HIMH 1CLYL 1BZ7B 3DIFA 2VQ1B 4L9LA 1S7XB 3N85H 3ARFA 4LK4A 4G5ZL 3TIDB 1EHLL 4IDJL 4Y2OA 4NCC1 4XTRC 5DEFA 2I9TA 3LV3B 4LPYA 3G6DL 1CD8A 4P3DA 2A9NL 2R2HB 5CJXA 4XVJL 3VH8G 4KMLB 2P44B 2A6DA 5TE4H 5DC0A 1MUJB 4HBCL 5D7KE 4FQHA 1BP3B 3HC0A 4ZFZA 3RGVC 1XR9A 4RZCA 2LAGB 3KAAA 5EU4A 4C56D 4Y1AA 3QUYA 1PGRB 4LLMA 1YZZA 4OZGB 2QHLA 5JIPA 4Y5XA 3T0EC 2XA3A 5JW3L 1IQWH 4F7PB 3OGCA 3OJMB 1XCQA 1H5BC 1TTFA 2XFXB 2P48B 5TPWL 3FFCD 4LEXL 4E0RA 1OAZL 3TZVC 4L4VE 1AGCB 5HHQB 2VMFA 5T3XH 1AXTL 4HIIA 2AJVL 4XNZC 5BMFH 1ACYH 2F5BL 3HTLX 4PGZA 3V5DA 2BHUA 4U1SA 5T1DL 3X13A 1A22B 1CVSC 2ZJSL 4YH6A 3DURA 4PRBA 5D2LB 1MJUL 3DRQB 5B8CB 1CXKA 5KVFL 2C1OB 3MRDA 2QSQA 1O0VA 5SWZE 3QXAA 3LRSA 2Q6WA 2G2RB 5ALCL 1OM3L 1U8HA 4F3FA 1G7JA 3BPLC 4Z95L 5D5MA 1ZWIA 3GMQA 4YX2L 3QNZA 6CGTA 5HVWA 4P5KA 3W5NA 2NW2A 2HYMA 5HVHB 1K8IB 1FYTA 5ADPH 3GMMA 8FABA 1VESA 1JBJA 2LABA 5DD3L 4FFWC 4L5FH 4AEHH 2DKUA 4K9EC 3KS0H 2FATH 1X7QA 1N7MH 4IRSA 5MEOA 1OQXA 4XBPB 4G6JL 5C0AE 2ADFL 4J6RL 2P7TB 5DMYA 3TBSA 3MUGB 5L6YH 2JLLA 2AK4E 2IPKA 3K1KC 3MRHA 5B39A 5F8RC 2Q86A 1AO7B 4TSCL 3VFGH 5GGUB 3VFOA 2XTJC 3BH9A 3O8XD 4JZJB 4M03A 4MNQE 3HZYA 5IEHB 3DO7A 4G8EA 4MQXC 2B2XH 3HC3H 4RMSA 1N5YL 3FRUA 3EYUH 2VISA 2R56H 2OSLB 3K0WA 2MQ0A 4MNGE 3U9PH 5EZLB 4Y4KA 4YUEL 1MFEL 4G9DB 4XWGL 2CKBH 3EFDL 4RGMB 3RA7L 1QLFA 4JVPA 3E8UH 3F7RA 5BS0E 3NFSL 3S96B 5IHZB 3PV6A 3Q6GL 4MVBD 4KTDL 5DZLA 2ZOKB 3CK0L 2EE2A 1EHNA 3FQUA 3KNBA 4PJDA 4UOW0 1S9VA 1YJDH 2G9HA 4GRWF 4PJAF 2W65B 4Y2DC 4LVNB 2IALB 2JB6B 2ICWA 1F13A 4JFED 1RZJC 1T1ZA 2APVA 5BJTB 4JM2A 5I8OL 4GW1B 5JDSB 5ANME 4HZLA 4FXGA 4U49A 5EORL 3ZE0E 3DVNA 3SGEH 5J3HC 43CAA 4YDKL 4F7TB 3LEYH 4HFWA 4I13B 2WNGA 1HHIA 3MLWH 3HE6A 4L3EE 4QWWD 2E6PA 3QULB 3DVGA 2A6JA 3QPQD 5D1XD 3BP5B 1T6WA 3MR9A 4IOSD 4LKXA 3QUKA 1A7NH 1NGYB 3MRBA 2DQUH 4P5MB 1UACH 5HDOA 3REVB 1QBML 4WDIB 4NO0A 1XFPA 3JVGA 1G0YR 1S9KC 1FNSH 1QBBA 4F9PC 2MHAA 3TJHC 4NSKA 5I1CH 1NBVL 4GLRI 4EI5B 3UROR 4R7NA 3PG2A 4O58L 1F3DH 4H26B 5ENWB 3TT1H 2CK0H 4HGWA 3UJJL 4HWBA 4QCIB 3VFUB 4ZMAT 3V5KB 3TBVA 5DC4B 1KXQE 1S5IL 2SEBA 5BW7A 1CR9H 3IRZA 4WEUD 4YAQB 5HYQA 2D0FA 5E1HB 1F4XH 4YXHH 3RP1A 2VKXA 3IAPA 4BA8A 2G5RA 3D39B 5DRZA 1SM3H 1W2KT 3ULSA 4M7LT 4DTGH 5C0DA 2ZUXA 1OAKH 2NY0D 4L1DA 1NFIA 5DHVA 1AJ7L 4EIZC 1FVDB 2BY0A 4PJAA 3G08B 1I7ZA 5DUBA 1MWAH 2YPKB 1NCUA 3TBYA 1MRCH 4Z5RB 2B20A 3O3AB 4Z7VE 1QFWL 4ZPVA 5B8CC 4XWOC 5EB9A 1BX2B 3V7AE 5IMKA 3O6ML 3NMEA 5DJ8B 3TO4C 1S8DB 1NCCL 4G80B 5C0RL 3RY6C 1HDMB 2IBZX 1LDPL 4X0KB 1G9NH 4FQCH 1KPUA 3F12A 4MDIA 4XCCL 1AC0A 2Z35B 1MIEH 1WTLA 3GMOB 1YEDA 5JHDE 4JDZB 2NY6D 5A2IH 5HVHC 1T5XA 2VJXA 4OLXH 2CPCA 3O3UN 3DECA 3B9KA 4QHLA 1EFXA 5GS1B 4OV5A 2FJHB 3IU4H 15C8H 4FTVD 2HJKA 5EU5B 5FO9B 1F4YL 1RSFA 4BQ8A 3IKCA 1NDGB 3ARFD 5TDNB 4NQCA 1PLGH 1GGUA 4KUCF 1BVKA 1QD0A 4UV7H 1BVZA 1GGIH 3BZDA 3WYRA 1OGTB 4JFPA 4QXUL 5C0JB 2RR3A 5EBLB 4HT1H 4L4TE 4QRTA 3BQUC 5TH2B 4NHCH 3PJSB 5KBNC 3THML 4CDHA 3RGHA 2NY5L 5I8EB 3MLZL 3V6FA 2D7QA 4P46C 2AI0H 3T0EA 5FHBH 1NGQH 4QXTA 3D85A 4NN5C 3EFFB 4FFYH 5FYJE 4KKBD 4JZJC 4KZEH 4NBZB 2P5EA 1R3KA 3TZVA 4CDGC 4TULH 4Y1AD 2MCG1 3QUYD 5E99L 3ARVA 3QG7L 3BMVA 4F58H 1UA6L 3KPRB 4XH2A 4KJQC 3FONA 4XMPH 1J1PL 3OXSA 1A9BB 3OXRB 3LPGA 4HUMB 4LSPH 3VGHA 1A6TB 1IQDA 2J7LA 2NY3D 3LKSB 4JFQA 4P9HH 3C08H 1RUML 3IAGC 3TBTB 2BNRE 4RGMC 1R6VA 5DEGA 1C12A 4MCYA 2HH0L 1D9KB 4WNQA 2YUXA 4NZDA 4NJ9L 4P57B 1MHHB 4N0UE 4KDWA 4PJ9A 2WQRA 2NYYC 5CD3B 5FYJL 3DX9A 1JZ5A 1E28B 1TCRB 1TDQA 3MRIA 3RVXC 1W72B 1C7SA 1CICB 1CGSL 3D87B 4CVWA 3L5WA 1ULVA 3KJ6L 2AQ3A 2GT9B 4KFZC 4P49A 3WDIA 5LQBL 1QO3A 2Z4QA 1IKFH 1AXSA 5T1LA 3LD8B 1QFUH 2VDQH 4LLUA 1JIBA 1R24A 5IMLA 1RU9H 5KJRH 1H0DA 4PREB 4DFIA 1FYTD 4S0SD 3PP4L 4HV8A 4YPGB 5GSVA 1ZOXA 3QH3B 4QY8B 1PSKH 4ZD3L 2CR3A 4IRSD 2DAVA 2PW1A 5FUCE 4LAJH 5HGHA 2WZPD 5I2IB 4ELMF 2MQ3A 1MJ8H 4WU5A 1I8LC 4ZNCD 1NGXB 3FT4A 3CNKA 4N0YL 4XAWH 2VDMH 4LLWA 4LSUH 4EI5C 3B6SA 4LIQH 2QJDA 4MXQD 4MSWA 1AGDB 4P2QE 1NCTA 4YIQA 2CDGA 4OLYL 5HVGB 5GRVL 3Q5TA 4WUKH 4JFZL 1ZANH 3DX6A 1E4JA 3MUJA 5J11B 4YXLL 2YC1A 5DGQA 4PJHB 1M71B 4PJ7F 1EO5A 1MI5A 1AD9B 2C4XA 3ROOB 2MFNA 3PNWA 2P5WA 2BMKB 4NQXA 3PE9A 2H32H 2DQDL 2J4WL 3KWWA 3ARGD 4JKPH 4Y4KD 1UZ8A 4PYGA 3T2PA 3QUZA 3MGTA 3EJZC 2WP3O 3Q3GA 5HGAA 3BE1H 3LMJL 4YDLC 3WHXA 1BQHA 3BXNB 3RVWC 5M7QA 5L2KB 3MOAL 4WI3A 1JRHI 1FAKT 4FS0A 4J3VA 3EYFB 5E56A 1LK2A 5DVOA 2R69L 1J8HB 3MBXL 5BVPL 2EDYA 4WW1A 1SEQL 4U1MA 1KEGH 1IAMA 3D3VD 1IGFH 5HI3C 5DD6B 1FFRA 1Q38A 1Y6MR 4ONFH 3CFJA 2R0KH 4OZFH 1BZ7A 1LEGB 1S7XA 2WUCL 4NDMA 4GG8B 1EVTC 3VG0L 2X4RA 3HE6D 4R7DB 2YMXH 3C6SB 3IFNL 3MODH 4PRPA 3BKYL 4GKZA 2X4NA 5IW1B 4F9PA 5F88B 4DQOH 2AJYL 2R2HA 4MXWL 4AIOA 4YLQT 3TWCL 2DICA 1NANH 3ARTA 2BFVH 1MUJA 4UTBL 3KPOB 3EKCA 4KMQA 5HI4C 3L5HA 4LCIL 3MFGB 1MQ8A 3CFDB 2MSPA 3BWAA 3FZUC 3C8HA 4LMQI 5F89A 2ATKA 1AR1D 4PJ7A 1K3IA 3BPOB 3RL2B 1XAUA 5GS0C 2ZNWA 1MCOL 4F7PA 1MPAL 4FABH 2XFXA 4OLUH 5CEZH 2HFEA 3DX7B 1LEIB 1AGCA 1T22B 5HHQA 4Q97A 3RTQB 1FLTX 1UJTA 4XPFH 5EZJB 2XIDA 2WW8A 5D96C 1A4KB 3BGFB 2Q8BL 1MCWW 1NFDE 3IJYB 5D2LA 1CG9B 1CCZA 4O5LH 1D9KC 4IRJB 1GH7A 4TUKH 3WJLA 1M7DB 3WFCL 3JZ7A 3DV6B 1JFQH 4WHDA 5DTFA 4JN1H 1WZ1L 3UO1H 4HS6B 3DSFH 5E2JA 1WAAE 4CU6A 3VW3H 1CICC 2X1PA 1QG3A 3PWPB 1TZGL 4H1LG 3V5HB 1CWVA 2V5TA 1I1FB 2WWKT 5FYKD 2DM3A 3LD8C 2CSPA 4N8CH 1QSEE 5C0BE 1SJHA 4N0FA 1OP5H 1T2XA 2O5XH 3IGAB 4XBPA 3ALPA 3P4OA 1JWSB 4KVNL 4U6TA 4OCWL 4QRPB 3B9KD 3MCG1 4CKVX 1EFXD 4X98A 3RNKB 3L6FA 2VXTH 4JN2B 4NQCD 2ED9A 5EBGA 2P7TA 3RIAK 4R8WL 5HYSB 3GIVB 3MUGA 2ZCHH 3SKOB 2NX5B 4XMLL 4ZUUB 1AO7A 1WSST 1ZMYA 3OKYA 3O81A 4ZODA 2YUZA 5GGUA 4UI2A 1LE9B 4JZJA 3RWEB 5IEHA 2QHRL 3D6GA 3SJVE 2PTUA 3T0ED 2OSLA 3D85D 4KXZH 3FO1A 1DZBA 1FL5B 5J11C 2P5ED 1L7IL 3RHWK 1CD0A 3TZVD 4LLDB 4G9DA 4CJ1A 1KT2A 5KZCB 2J1KA 2ZWLT 1CU4L 4A6YL 2E7LA 5DJ2B 1YNKH 5JUEL 2DIBA 5IFHL 3WKMH 2JJVA 4PJGF 3VXSA 5I8KH 3P9LB 3S96A 3LS5H 3MLRH 1IM9B 2GIYA 1T4KB 1VB9A 2ZOKA 1TFHA 5E9DE 3BPCB 3SKUD 1DBAH 3DETD 5C08B 2DKMA 5ICYB 4JPVH 2JB6A 3MYJB 2LU3A 1X6LA 1NFKA 3AU1B 3N1MC 4GW1A 5JDSA 4PJ9D 4TUOB 1EZVY 4I8DA 4M48L 1WFNA 2CLVB 3U0TB 1MJJA 5DURD 2VXUH 5GIRA 2AXJA 5F7DB 3IS1X 1ZE3C 3V95A 1JPSL 1U2CA 4HKXB 4YC2B 1YC7A 1WCBB 3I75A 3MUY1 4JRXB 4ELKA 2FIKB 5J57B 2CLZB 4K8RL 4Y19A 3FT2A 2DBJA 4P5MA 2V17H 1PG7L 3AM8A 4HIXH 5INDB 4ZUVB 1RJYB 1FNEB 1UC6A 1AQKL 3REVA 4WDIA 1NL0L 5C9KA 3EO1B 3BIBX 1FAIL 4IOIA 2WMPA 2HTLD 3MYZA 2QQLH 2DL2A 4OF3A 1P4BL 3OPZL 4GKNB 3CFCL 4GG6B 3VFWA 2VLKB 4J3SA 5D6DC 3ZT5A 3U4BH 1JTOA 5JNYB 1HH9B 2XTJD 4ODHL 4OQ1A 4V1DB 3N9GH 2OM5A 1I9IH 1D5ZA 4KQ4L 2RCSH 3D39A 4HUVB 3FO2B 3BPOC 1BFOB 3GI9L 4TTDC 3HPLB 5DJ0B 1ND0B 4ZO8A 4Z7UB 1S3KL 5EUOF 3QFDB 1BQUA 4WHYH 4DFHA 4FFZH 3BOVA 4KKLC 5CJ5A 4UOJA 3RTQC 1KB5L 2P5WD 3G08A 5FA3B 2Q76B 5ERWA 3I6GB 4Q0XH 4FZEL 1BJ1H 5DFVD 3W0WB 4FQIH 2YPKA 1EAPA 4LARH 3BGFC 4ONGH 3GGWB 3QUZD 5HYJE 1Y18B 1R5IB 4FZ8H 3U0PA 1IC5H 4IRJC 1BX2A 5FEBA 4G80A 2A9MH 1HDMA 2D0HA 4X0KA 3QDJD 2F74B 3IJSB 3KPSB 2Z35A 4OI9A 5KSBE 1XGTB 4NKOB 5IEKB 2WSKA 2BVTA 5GS1A 2HVJB 4X6DF 1BBDH 1RAMA 3I9GL 1NDGA 5TDNA 1D7FA 2DI9A 2OR9L 4BK4A 4OAWB 5F1IA 1EJOH 1ZA6B 4DUWA 1QQDB 3D0VB 4PRPD 3LOWA 1JPGA 1WT5A 3NABL 5DK2A 2GY5A 3NFPB 1OGTA 5C0JA 3HCVB 2FYYA 3GFUA 3MJ9A 1PQZB 3ZKQD 3PJSA 1JMZA 5ABDE 2EIBA 4HUWA 5I1DB 4XNUH 2HN7A 5I8EA 1T6VN 5MEPB 3IDNB 5DDHB 4X8JB 3T0AA 1I1YA 3MRGB 4JO4H 3H9SE 2E7HA 3OB0K 2P47B 2IADB 3PHOB 4JFXA 4XCFH 4B53A 4PJFE 4BELD 1V7ML 3D18B 4GRLD 5E8NB 4QNPE 3SBWC 4XXDB 2VITA 3GSVA 1BF8A 4LSRL 2WWMD 1HZHH 1RVFH 5CD5D 1A1MB 3TM6A 4H8WC 1UJ3B 4RX4A 2F54B 3KPRA 3H3PH 1QLEL 3O0RH 2YD1A 2BK8A 5DZNA 3OXRA 4UNUA 1JHTB 5HHMB 3OKMB 3TESA 4OLWH 1PX4A 3BAEH 2F5AL 3A6BH 1DANT 2DLGA 4P57A 1MHHA 1GZQA 5FM5M 3ULVE 4L1HA 4OZIF 3L95B 2J3SA 3GHEH 3U48A 4JQXC 4YNYB 1A0QL 3LKPB 4FN0A 4RAVB 2XOTA 2ZP0T 3V52L 4Z8FL 4JKLA 1E28A 1TCRA 4QLRA 1KCUH 2BSTB 1W72A 1CICA 3KYOA 2VXSH 4FQ1L 5IB2B 5L88H 1DCLA 4K3DL 5I66B 4DKFL 5K9KB 1UXSB 3QIWA 4M7JH 4Y5VA 5C7XH 4X6DA 4MYWB 5FUOH 2FD6L 4ZUSB 4PREA 4ZOAA 4Y8DC 5IT2L 1QLRA 4YPGA 1CFSB 4B7LA 4IOFC 4NZTL 4QY8A 1LILA 4YC2C 4NNXA 3QJHB 5E8OA 3ULVL 3EHBC 1UH4A 1A7PL 1ADQA 1DFBL 3D48R 2AJ3B 1H3XA 4WVRA 3GI8L 3GK8H 2X41A 3MNZB 4KKAD 5I2IA 3MXWH 5ECJE 3MQIA 3WO4B 2K7QA 3GJFK 5D1QB 4FNLH 4MA3B 3UXFA 5IQ7H 5C0CE 1EDQA 1GOHA 4LQ1A 4M6AA 3NGBB 2DWDA 4L4VB 3LPWA 3MGAA 3G9VA 1AGDA 1IC7L 1HWHB 4DW2H 1F2QA 2XT1B 3JWDL 4N8VG 3I3DA 4R97B 2FLBT 4JQVC 4XPGL 3FRPG 1YNLH 1P7QA 1I4FB 3MRJB 5DQJA 4BQCA 2B7DT 1AD9A 3ROOA 1L9NA 4XNYL 5TF1L 3EJYD 3NACL 1P84J 1DUYA 5F96H 2BMKA 4KKNA 4XMKL 3K1DA 5SWZB 3U36B 3TYFA 5IWLA 4OZIA 3VXPB 4PP1D 4CVXB 2BY3A 1A6WL 2ARWA 1IKNC 3VXSD 3Q1SH 5IBLC 3NCEB 2DRUA 3MLYH 4YFLI 2VTFA 5L2KA 1FLRL 2NYYD 1IBGL 3C5ZB 4NM4L 3EYFA 4CAGA 4JZOB 4EVNB 1J8HA 2V2TB 2RJMA 1J10A 5IVZA 5C0AB 4WTZA 4Y16A 2CJUH 3W9DA 4P59H 1FZKA 3AMLA 5FGRA 1LEGA 4QRRE 3P0VH 4F37K 3KYAA 4MXVE 2AK4B 4R7DA 3UYRL 4OCXL 2BNQE 5IG7B 5LCVL 5D7JB 4OFIA 4CVUA 2KZ1B 1PZ5B 5JXAH 5F88A 12E8H 3OX8B 4MNQB 4OD3L 3VRLE 4G7YH 2BY1A 3HZKB 4JGUA 4Y19D 5DMKB 3V4UH 4C83B 1ZVSB 4RISL 5KVGH 5D6DA 1U6AH 1RIUL 2CDEA 1IEBA 1DBJL 4YXKL 1DN0B 4P4KB 2DD8L 2FB4H 1NJ9B 3EUUA 1XCTA 1RIHL 1E4XI 4MNGB 3KPNB 1NC2B 1RMFL 3KVQA 3VD3A 4F9LC 1FNLA 1JYXA 2ZSWA 4NM8H 4YBQD 4HLZG 1RZ7L 1L0QA 4CMMA 2BSRB 4NNYA 4W68A 4WWKA 5BS0B 1OTSD 2DLEA 5DS8A 3GSNL 4JDTH 5F7YC 5JIKA 3DX7A 4HKJB 1LEIA 1T22A 5A43C 1T7ZA 2DQGH 1VACB 3RTQA 3D39D 2HKFL 1OHQA 1F90L 1UJ3C 4U6HA 5EZJA 4DZ8B 3QCTH 3T1WA 4KGJA 3RWGA 1A4KA 4RWYH 3FT3B 4F8TA 2XKUA 3EJZD 4DGIH 4O51A 3QXDA 3IDXL 4GAFB 3IJYA 2GJZB 3OR6B 1XH3A 4GAJH 4L3EB 4IRJA 4TRPL 4WIQA 1ORSB 5DD1H 4RAUB 1M7DA 4MA8H 1D5MB 2GKIA 4HS6A 1BREA 4I2XE 3PWLB 5ESAB 1JPFB 4TSBH 4U7KA 5DJ6B 1AE6L 2WLZA 3PWPA 4XAKE 3W2DH 4XP9H 5GGQL 1IRAY 4H5SB 1G7LB 5F93C 2E27H 5ITBH 2AJUH 1JHLL 1Z0NA 3HNVH 4RCAA 3E1F1 4NIKB 3S37H 4QRPA 1XF1A 3WIHA 5T1MB 4WFED 4JCLA 1JI1A 4ONHB 2DQHH 5HYSA 3EIFA 1QSFD 2Z31C 3NPZB 2WAHA 3SKOA 1OSPH 2NX5A 3ZO0A 3U1SL 4WUUE 4ZUUA 5D1QC 4RFEA 4PTUB 1LE9A 5TFSH 3P30H 1KOAA 1G6RB 5F1SA 5E08L 3NGBC 4HWNA 3RWEA 3SBWA 4CGTA 4OGYH 2D03H 1J12A 1AHWA 1BM3H 1VPOL 3PGCB 2GSGB 1FL5A 4G6MH 3BI9X 4GXVL 4R97C 2R1WA 3H7BA 1UWGL 3ILPB 1KN2H 4YDJB 4Z7VB 3VMPA 4NWUH 4RX4D 3KPRD 3P4NB 4BYHA 4K7PH 4RMWA 1Z9MA 5DRXB 3HC4L 3P9LA 4Y7MA 1OT2A 3HNTH 3NAAL 3HRZA 1CFQB 3HUJF 3BPCA 4JQXA 4UU9A 5EN2A 1D3CA 5FYLH 1X5GA 3QG6B 4ZTOH 5JHDB 5ICYA 2H2SC 5CCKL 1ZA3A 8CGTA 3ZTNL 3WSQL 5DRWB 5I1HH 1IE5A 1P9MC 1U8IA 1NCWH 3C5ZC 1ORQA 5IP4A 2OL3B 3LRHA 1CDYA 3U0TA 5E00B 3CFEB 4HCRH 4EZMA 5F7DA 2IGFH 4TVPD 4TQEH 4HKXA 2W1NA 2CUHA 3QIWD 2ZUQB 1WCBA 4JRXA 4L4TB 5GGVL 2FIKA 2OJEB 2CLZA 5CZVH 3T08A 5LWYL 1FGVL 4JFFE 4U1KA 5HSFA 2DIAA 2DQCH 1RJYA 5D7JC 5DRNB 5EIIB 3EO1A 4LCWE 4DJMA 3DX8B 1A7RH 4NUJB 3QP3A 4EDWH 3L1OH 1UWXH 3MXVH 2AJXL 1EUTA 1MSPA 3ZKXC 5TDPB 1HILA 2VLKA 2YZ8A 1O7SA 2R15A 3BRGC 1RHFA 2D3VA 5JNYA 4P4KC 5JO5B 1HH9A 4LSTH 5GGTH 3QO0A 4UINL 2FSEB 2DWEB 1RPQA 3WIIH 4JQVA 3NIDF 2W9EH 3L5JA 4M5YL 2BNRB 3VWKB 2MMXA 3HPLA 5DJ0A 1IM3B 3UAJC 5DT1L 1ND0A 4N0UB 4ZNEE 3FRPA 4S2SB 4Z7UA 4NJAL 1EGJL 1P7QD 4LNVA 5I19L 5DVLA 3WD5H 4XB8A 3HUJA 2VDKH 2ICCA 3LH2H 2VLLB 2JJWA 2Y06H 3BT2H 5FA3A 2Q76A 4YWGH 3I6GA 5CSGA 3MRFB 1IT9H 1I7TB 1X4YA 3W0WA 3GGWA 5B21A 1B0RB 4XX1E 3TH3T 3IS0X 1HKLH 3HG1E 2CRIA 4QGYA 3U30B 1YEIL 4NPYA 2K3TA 2H6PB 3BKJL 3S35H 2X9WA 5L2KD 2IH3B 4D3CH 4XP4L 5F1KC 4W70A 5ETUB 1J8HD 2F74A 1XIWD 5DUML 2D31B 3KPSA 1XGTA 3VFPA 1WICA 4BSJA 2J6EH 4NKOA 2WK2A 4Y16D 5IEKA 4Y4FB 1ZHLB 3JWOL 1UG9A 1X5LA 2DTMH 1NBQA 3JUYA 5SX5K 2HVJA 3WLWC 1UXWB 5C6TH 1DQML 4ZXBB 1MFDH 1NC4A 1JYWA 4DCQB 3B4NA 4X7TA 1KGCD 1T2QL 1ZA6A 4OAWA 5I1LB 3C6LB 4P9ML 1OD9A 2ZZUT 4P2QB 3DUSB 3S37X 1TJHH 5DR5L 3D0VA 3FOMB 5EO0B 5FYJU 5I1KL 3CXDH 4U05A 1IVLA 3NFPA 2XWTA 3T65B 3GMPB 3HCVA 3DNKA 2AABH 1M05B 1PQZA 3BKML 4F9LA 2V2WB 3MV11 2R1XB 3QQNA 3LN4A 1E6OH 4HFUL 5MEPA 5HXMA 4EOWL 5DDHA 5DJAB 3MROA 2X9XA 1FORH 3MRPB 1B2WL 5F7NC 3PHOA 4IIQB 1R3IL 2OR8A 1TNMA 3D18A 5E8NA 3OL2A 3VXTB 5CBAA 4XXDA 4PGJA 5CZXD 5I1GL 1BEYH 3TNNB 5DYOB 2ICWJ 4WWKD 2F54A 4JQIL 5ELIA 5EUKB 3X17A 2IFGA 3L3IB 3QHFH 1HCFX 3QUMH 4ENED 3VXME 4LCYB 5FO7B 4K7PX 4IJ3B 1RQ5A 1IAKB 3FKUS 3L95A 4DEPB 2YN5A 4OM1L 4YNYA 5ALBL 3SE9L 3LKPA 4QRQA 4RAVA 3C5JA 3F7QA 1ZLUH 2GAZB 5IB2A 1DVFA 1S78C 3SDCB 3V4PL 5F7HA 5I66A 4OGZA 1R3HA 1AP2A 4XHJC 5K9KA 1UXSA 1TVBB 2YBRB 4PPTA 1VFUA 5DA4A 2ITCB 4I0KA 5IFAH 5CINL 3O2VH 3PWPD 2AV1A 2YK1L 3SDAD 3BKCL 1CFBA 3U9UB 2QQQA 4B5EA 3OQ3B 4UAOB 1A6UH 4DN3H 4LCUB 3VI4F 2ZUQC 3U46B 4S1RL 4J2XA 4POYA 4IRZL 2AJ3A 2FX8L 4HMEA 4HD9A 4PRHB 1A7QH 1CLOL 3OV6A 4QRPD 2J8UE 1UM6L 3UTPE 3L3KB 1YEEL 4MA3A 1SMAA 2VLRE 5TDOB 4YHKH 2DDQL 3WFHB 5I76B 2ZUWA 4MB5A 4OM0H 1E6JL 3U7AA 1F6AB 2CUIA 2EH7L 4KI5C 2NX5D 4NWTH 1GC1L 4AMKL 3FL7A 4ORGB 4MJID 1JRHH 1BFVL 4JPKL 4I9WE 4EDXA 1I4FA 4PRIA 1NFDB 2YRLA 1RZKH 3SQOL 4TPRH 3JTSB 1Z6JT 4XPHH 3VWKC 5KAQG 1AFVL 4NZRH 7CGTA 4MLSA 4M6NL 3FB7A 4OZFG 5DJYA 5SWZA 2MPAL 3MO1A 4Z7WF 2JF1A 2QQNL 2FX7H 1LE5B 4CVXA 2R29L 1KCSH 3LEVL 4NQEE 1QRNE 1NUFA 3KYNB 5CLTA 3STLA 2F8XC 3UTSE 3MOBH 2EZ0D 1J88A 4PJBE 1SJEB 3RAJL 3BZFB 4JZOA 5JA8B 3U30C 5EC2B 3HZVB 5E2VL 1WC7B 3QZWB 1NCBL 3G5XB 4HJ0D 4AG4L 5C0AA 2P8LB 2W91A 4UBDC 3S35X 1EO8H 3VXOB 4KROD 4A6YB 3RX5A 1GAFH 1UM4L 5FUCC 1JGVH 2APXA 4KY1H 5HHNB 2AK4A 3AFLA 1R3LA 2FBJH 4YHOL 5IG7A 4Y4FC 3HLAB 1U3JA 2IAND 3SO5A 1PZ5A 2OK0H 5AZ2L 4L8DA 5GSRB 4E9LA 3OX8A 3EHBD 4MNQA 4EBQH 5JW4R 5LKNA 1TZHB 3HZKA 5DMKA 2C1PB 1LQSR 3C6LC 4C83A 1ZVSA 2I9LA 5HHVL 3SJVB 2HRPH 1MVUA 1DN0A 3TP4A 4P4KA 1NJ9A 4MNGA 2ZUSA 1NC2A 2GK0B 1NCAH 4X5WB 3P0YH 2WLYA 4D9QD 1MRFL 3ZSSA 4HLJA 2VSDA 1I9JL 1NMAL 3BN3B 1W8OA 3ROLB 5ACMA 5BS0A 1ETZB 4IIQC 1CK0H 5I1EL 5FV1L 5E9DB 5D7IF 4UT6H 3QFJE 4HKJA 2PO6B 4RDQG 5INCB 1VFAB 5HHXH 3MRKB 1BD2B 2IJ0C 2R9HD 5GJSL 4ALAH 1A3LL 4KDTA 3S9DB 1FDLL 5ANMA 1MQKH 2IAMB 2Q8AH 1B3JA 3FT3A 4KHTH 4S11A 4M4RA 4MAYA 3WN5B 2VLME 1XR8B 2O5ZH 2GJZA 1A64A 2I07B 4YJZL 1KTRL 4XP5H 4QO1A 1AR2A 4IJ3C 4DK3A 3MREB 3L3DA 4RAUA 4G6KL 4XI5D 4AEIL 2ZUTA 4DEPC 2Y7QA 5GZNC 2X2YA 1D5MA 3PWLA 4OB5H 1JPFA 5ESAA 2NLJA 3LEXB 5DJ6A 3SE4C 4I77H 1IAII 4TUJB 3L3JA 4QTIH 5CZKA 4H5SA 4TVSa 3WFEL 3KPSD 3SOBH 1CZ8L 1KB5B 3SDXE 1DQTA 3I6LE 2ZG3A 5T1MA 1RZFL 1JYVA 4YHYC 2A1WH 1NEZA 4OLVL 3LQAL 1GPOL 2EDOA 4HS8L 4ONHA 2XQBH 1NC4D 3MJ7B 1VGEH 3QQ4B 3RWFA 1WIPA 5DEZA 4O4YH 3MCLL 3UBXG 4PTUA 1FZJB 4I3SH 1CLZL 5T5FH 1PY4A 3ILQD 3NIFE 1CT8B 5D7IA 1XF5B 3PP3H 2AV7A 1IGMH 5HD8C 3P3YA 3PGCA 5CEXA 3VFRB 4R26H 3ZT7A 4OKVB 3CLFL 1YQVL 5HYJB 3ZKSD 3MV9E 2Q87A 4M9PA 3LKQA 3GIZL 2D4DA 3ILPA 1JNHB 4GXUN 1HQRA 2OCFD 3KYKH 5BRZE 4NCC2 4Z7VA 1I3GH 1MHEB 4LQFH 2F54D 3P4NA 4XVUC 5ITFA 5TJWK 4WTXA 1S7QB 3D2UB 4I18B 5DRXA 4DKDC 4HQQL 2MOVA 4EQ2A 3QUXB 1FO0L 2VDPL 1KBGH 3U7WH 4MS8D 3PDGA 3JSSA 4PJ8C 1I3VA 3PXHA 5KSBB 5JHDA 1CLCA 4GW4B 5DRWA 3ARUA 3QI9B 4Q6IA 3A6OA 1HHJA 3UJIH 3V6ZB 2BHZA 4BSVA 4TOYL 5E00A 1G1YA 4HUUA 4JHWL 1VSCA 5E95B 3I3EA 1DVFD 1ZVHA 5C09E 5DQDL 2ITDB 2CGRL 5CIPB 4OI7A 2W92A 5I1IL 4L4TA 1L9MA 2OJEA 2VDLL 3RNQB 4RGNE 2DQIL 3QQ3B 5JORB 1UZ6E 5GRUL 2XKNB 5E2TH 3WV0A 3BDBA 2X4OA 2BJML 5EIIA 4G3YL 3H9SB 2QR0A 4K3GA 4WHYG 4NUJA 5A3IC 2XQYG 1IGIL 3JXAA 4PJFB 3RX7A 1IGCL 2H32A 1B88A 3BSZH 5TDPA 4HXAH 5J9PA 2GCYB 1KTKE 4X4YB 4D9LL 5JO5A 3ZKNC 1XF3B 2EDFA 4B50A 1RULL 2FSEA 2DWEA 1YECH 3FQWB 4APQB 4YDIL 3V6OE 1JP5A 1MEXH 4GT7A 3CSGA 3SE3C 3K8LA 3B5TA 3MLVH 2DLTA 1IM3A 2BOCB 4N0UA 4N8PA 4S2SA 3WFDL 4PRID 5IQ9B 5H94B 3QCVL 3I6KA 1MLCB 4DGYH 1G9MC 4Y4HB 1FZMA 4R3SB 1VCAA 2WIIB 3MRFA 5CWSB 1CN4A 4RDQF 1I7TA 5IM7B 5SWZD 2IAMC 2M1KA 4JKWA 5I9QB 1B0RA 4G7VL 1KJ3H 3FAXA 4OSUL 1HXMA 3GBNL 4Y8AA 5A40E 2H2SD 1I9RH 3HMWL 1YEGH 1PYWB 3MMEB 2C4FT 2HFFA 3T0VA 1AI1H 2FO4A 2IH3A 3RUGE 2B0SH 1INEH 4JVWA 5ETUA 3SDYH 1I8IB 4N90E 3FB8B 2D31A 2BC4B 1OTTC 7FABH 3EYSH 2Y6SC 5GQBA 5C0AD 3TCLA 1I75A 4QHNB 2VSCA 5IBTH 4ZXBA 5C0CB 3GJEB 5JHLL 4KVCL 4DCQA 2UY6A 5I1LA 3C6LA 2EH8H 1OAYH 3DUSA 1FFPB 2Y5TB 5E5MA 5FIEA 5CJQL 3FOMA 2EYTA 1MAKA 2APTA 4FQPA 4ZO6A 3T65A 4MNQD 1EEYB 1Z0MA 2IMNA 4JG1H 2V6HA 2AGJH 1G7HB 2R23B 1ZTXH 2EDEA 3C2AH 4XVTL 5F7MC 2R1XA 3RKDD 1UVQB 1XGQB 1FP5A 1Q0XH 3QQ9C 2R2BB 2YKLL 3CIQA 4UOW1 1MCIA 3MRPA 1GOGA 4PBWD 3BZEA 5LBSL 4IIQA 3OAYH 2PYEE 4GBXC 5HGGS 3VXTA 3KR3H 2D7TL 3MFFB 3PDOB 1YPZE 4QHMB 3O3BB 4OCSH 1T20B 3O6KL 4Z7NE 3TNNA 4XNQA 2H8PB 3VDAA 1JNLL 5EUKA 1ZT1B 3L3IA 3GKWH 4B7IA 3GM8A 1CDJA 1BVLB 1W0YT 3WFBH 2X1XR 3GNML 4LCYA 4M00A 5FO7A 5FKPA 3SKJL 4MHHI 4I18C 4WY7L 3KPTA 4OIIL 1C16A 5AWNH 3QUXC 4MAYD 1P6FA 1WAAF 4KGLA 4ZDHB 4RQQB 3RPKA 4F33A 1KENL 1IFHH 4QRRB 3SE4A 2GAZA 1MCPH 2BNQB 3G9AB 3QI9C 1BMGA 1RK1B 2WP3T 1CL7H 3GSNB 2ORBL 3SDCA 2XXMB 4FQLL 5DHVH 1EEZB 1MRDL 1TVBA 4G42B 3GSUB 3GB7A 3SGJC 3MNWB 4GRWH 4AENB 4LLVB 2MCPL 4WFFE 2VRAA 5TE7H 1NGWA 2A73B 1ZGLM 3RY4A 4HGMA 4UT9L 5JOFB 2OBGA 2XICA 5DJZA 4JZNB 4LCUA 5T3ZE 4NFCA 4IMKC 2R2CA 3H8NA 3FN0L 3RI5F 3ARXA 3VFVA 4Z76B 2LFGA 2IBZY 5BOPA 2P43B 2CRZA 3O6LL 1XGYL 1YEHL 2VXQH 5FYKH 5JLZB 3G6AB 2DM2A 2B1HL 4X83A 1WFOA 4RFOL 3WFHA 5I76A 5JZ7C 2YWZA 1F6AA 1GGCL 4Z0BH 3LN9A 3CCHA 3T77B 4GS7B 3V4VL 3KLHD 3UBXA 5C0GB 3U4EB 1FNGB 3SDDB 1H3PL 4APQC 4JHAH 5JPNB 4KPHL 5T3ZL 2P8MA 4LRNL 4KK6D 3E2HB 3IFPB 4WHTA 1BQLH 3GMNB 5ISZE 4K9EL 4XXCC 1RUPL 4LGPB 2P45B 3ULVC 5IB1B 5D72L 1UB5B 2NY2B 1LE5A 4I2XB 1TQBB 1WAAA 3DUUB 4HMDA 1P2CB 4Y4HC 4LFHG 1OAUL 3KYNA 1ZLSL 4XGZA 4YHPA 5DHYA 4LCCA 3JUZA 3MBEA 5I9QC 1QPPA 3VXRD 3NTCL 1QSEA 5C0BA 5JMRA 3G04B 1X3DA 3SGDI 4M1DL 3HZVA 4X5XA 4FXLA 1KC5L 3QZWA 3JWDC 3DXAE 2P8LA 1S78D 1E4XH 2GTZB 4JR9H 3H9HA 2D7OA 3QIBC 3I50H 3HI5L 1BAFH 4A6YA 4C58B 1GGBH 4NUGL 2VR4A 4GMTL 5HHNA 3UPAA 3CVIL 1OPGL 1JWUB 2LVEA 3HLAA 1M7IB 2IQAA 4WUUB 2GITA 2O93L 4XC1H 3MLPA 4JKMA 1T3FA 4F57H 5F21B 4Z78B 4L4TD 2A6KB 1MNUL 1TZHA 4K23H 1NBZB 1NBYB 4WU7A 2EC9T 4MWFB 3WEXB 3QYCA 4LEOB 2QEJA 4RMQA 1JTPA 4ERSL 2ADJA 2UWEE 3SJVA 4F7CB 5FF6B 1KIRB 4ZSOB 1U91B 3N1GC 5IIEB 5TGBB 2NCMA 2GK0A 4X5WA 1ONQB 1RZJL 1V7NL 3OKKA 1C5BL 4PJXF 2D7MA 2FIRT 3OHXA 3P11H 5J6HB 1F4HA 4PLKC 1ETZA 1CXIA 1KCKA 1II4E 5GZOD 1ZHKA 1OGAE 4PLJC 2PO6A 3TYGL 2EKJA 5INCA 1VFAA 3PQYE 2FGWL 3MRKA 4M6ML 3IDIB 3VI3F 1XF2A 4M5ZH 3T4AB 1MFCH 3S5LG 1YY9C 4MB3A 4MZ2A 1J86A 4OZGE 2X4SB 3SGKC 2IAMA 1A6ZB 1FC1A 3WN5A 4LDOB 3WS6C 4KV5F 2HMIC 3H0TB 3NH7H 3HB3C 2W9DH 1UM5L 3WDJA 3MREA 3L7EB 4KQ3H 1KIPB 4DGVL 3QDGE 1BF2A 5FECB 5KSBF 3X12B 2LTQB 4JFFB 5HPMB 5JW5A 5GGRB 4GKSB 4X7SL 3L7FA 1BQSA 1T7WA 3C60C 4LOUD 1T66D 3C5SB 3F6LA 1INDH 1HCVA 4OZ4B 1J87A 3O9WB 3QEHA 4LASL 4M1CC 1KB5A 5IFJB 3VDCA 4BZ2H 2J88H 3O3EB 2E3VA 4NO2B 4M9OA 4UDUA 5GISL 4B41A 4ZXBD 4KDVA 1PEWA 2DLFL 5I18H 5C70A 1ZAGA 4PG9B 3MZGB 2X7LA 1U42A 4U0QB 3C6LD 3QQ4A 4X4MA 4BH8B 3U7YH 4G9FE 1PDKA 4WW2B 3BFOA 3M17B 3KPQB 1FPTL 1FZJA 2BDNH 4LHUG 5D7SL 1CT8A 3GSXB 3PWJB 1XF5A 2AVGA 1OTUC 1MCJA 3Q5OA 4GS7C 4N68A 1JL8A 1MOEA 4O9HH 3VFRA 1S9YB 4IHOB 4PB9H 1AGBB 2OXGA 1U8OB 3GBMH 4OKVA 3SDDC 3VD4A 5HYJA 3T0BA 3HG1B 2FRGP 5FDWB 4CNIB 3E2HC 3KHOA 2FX9L 2UUDK 1ZLWK 5AD0B 1TNNA 1BBJB 1UQSB 1S7QA 3D2UA 1CXLA 4YZFF 2YRZA 2NY2C 3IDJB 3VFTB 1OAXH 3QHZH 2XKSA 1TQBC 2QSCL 5KSBA 2AXFA 1GHFL 5HGDB 3BEWB 4GW4A 2WUBL 3QI9A 3T04D 3UJTL