1I8KB

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVASISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGYSSTSYAMDYWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kB00
3RJDA 5J4MA 2JF1A 2YPLB 5FO7A 2FECL 3QNYA 4RNRA 4G7VL 5DXWA 4OFPA 2D7MA 4LSRL 5DF0A 2XN9E 2FGWL 3GI8H 2X10A 3BEWB 1RZKL 2VDRL 5HHXL 4RRPA 5C9JB 4BM7A 1G7QA 3HNTH 4NT6A 2DAVA 4DKAA 4TPRL 3WIHH 3LPWA 2B7DT 4WFEE 3MJ6A 3CXHJ 1SJHA 4WW1A 3I3DA 5I2IB 3CDYA 1S7VA 4UINL 4FQXD 5ALCL 1D5BA 2Z9TA 4U1KB 1P4IH 4QHLA 1UWXK 4EIZC 5DD0H 3RUGE 3OXRA 4QRUB 1CT8B 1PSKH 1U95A 3SE8L 1YEGH 3PL6B 4NQDA 4IM8A 3MV9B 3S37H 4WO4C 3G6JB 4K71C 2WUBL 3WIHL 5IT2L 3DUSB 4N5ED 2A1WH 1OARL 4JY5H 4C4KO 1KTLB 5DD1L 2W38A 5JMOC 1JTTA 2B1AH 4CVXB 1WIPA 1P9MC 2EE2A 1ZGLA 2ZUQC 3UTSE 1CTOA 3DUUA 4FZ8L 3O6MH 4XNZB 1FFOB 1L9MA 5F9OL 3MOBL 1SJEA 1GIGH 4X4YA 2CR3A 1U41A 1EFXA 4M8QB 3ETBF 1J8HA 4EIGB 4RWYL 1ES0B 3UC0H 3SDXA 3BMVA 4J3VA 3NIDF 2XA8L 1MPAH 2W59A 2FEDC 3HS0B 4QOKB 5DO2D 3S96B 1FZJB 1EEYA 3BDYL 5DJ6B 5EUKB 4GBXD 4Y4HA 2B8OT 5DSCB 3WHE1 1J88A 3DRTA 4ZUUA 4PR5B 1RV6X 1URLA 4DUXA 1SMAA 2B1HH 2GTZB 4LARH 4JFPA 3L5XH 4HH9A 3GMPB 1YPZF 1X5IA 5AD0A 3AVEA 3FB8A 4E0RB 2R0LL 2J8UB 5BOPA 1JGVH 2ZPKH 4FQLH 4KROB 1CFSB 4Y16D 1WICA 1EUUA 3DI2B 4LSTH 4PJGE 4Z7VE 3BHBA 5CMAA 1NUGA 4ODWB 1OT2A 1LEIB 1MPAL 3FB6B 3S35H 3QEGH 3ZKXB 4F37F 2H32H 2OR9L 3O3UN 3S7GA 2B1HL 5INDB 2D4DA 5GRWA 3LPFA 1UQSB 1T1WA 1DLFH 5CEYB 3MLZH 3P9MA 3U4EA 3V6OE 5FCUL 1UJ3C 1FGVL 4GG6F 2Y7QB 1T83A 4LLYA 5FYLH 2WM0A 1JHTB 1ZA6A 4XVSH 4S0TD 4BSVB 3MJ8B 1RUKH 3O0RH 4QO1A 2GSIB 1P1ZB 1KV3A 1TZGL 3GBLA 4O00A 1T03H 5E70A 2YD7A 3TCLA 3F65A 4JO4H 1Q9WB 5EC1B 1GRWA 2HTKC 3CFJB 4WFFE 4UILL 4PJHF 1RUMH 3FONB 4P2RD 3HZKA 3FL7A 2C1PA 2YKLH 3T4AA 5IJKA 3SO3B 2K9UA 3DLQR 3NOIA 5CAYB 3TO2B 1I75A 3B9DA 3NVQA 3NFSH 1GGBH 1HK6A 3GMMA 3EFFA 1TPXB 1I4FB 2QSTA 4LEOB 4R7NB 1KNOA 4GQ9L 3ET9F 2Q8AH 5B4MC 2EEAA 2UVEA 3TYGH 1M6OB 1D7FA 5F3BA 3VXTB 4KK8C 4XC3L 4DK3A 5HI5D 3X14B 1RK1A 1DN0B 1EBAA 3VFUA 4QRSB 1ORQB 3EJZD 3FRUB 5TDNA 1A3RH 4WI3A 1Q9LA 3MRGB 5I71C 5I1EL 5FAAA 1DCLA 3NPSC 5KVGL 3CLEH 4LPXA 1INEH 2MPAL 4HIIA 4O2CA 4OGYH 4NIKB 4HS3B 5IW6A 2W65B 4G8EB 1KB5H 2DM3A 4LRNL 1MRDL 1N2RA 4M6NH 4XHQA 1IZJA 2P8MB 1LO5A 5DTFB 3BQUD 1T5WB 2FZ3A 4CU7A 3NN8B 3CSYB 5D2NB 3LVEA 1UM4H 5LAXA 4F7CA 2HFFB 1JPFB 3QIBB 5EIIB 3QQ9D 4LNRA 5A16B 3JBG7 4JR9H 3QRGL 4UIMA 3DGGB 1FG2B 1DBMH 4PB9H 2Q86A 4TNVK 1DANU 1P4LA 4JKMA 1KG0B 3G5ZA 4G43A 1S9WB 1U8OA 3FOMA 3IXTB 5F9WC 3KS0H 5ISZE 4LKCA 5GRZA 5AAMA 1INEL 1RJCA 2D03H 4OGYL 4ODUA 3MLTB 4HC1H 1EBPA 1S7TB 3O2DA 2JJUA 4M6NL 3N9GH 2EYSB 1MVUA 4RDQF 2CMRL 3V2AR 3FQRA 1JUFB 4MAUH 2EIEA 1PEWA 3G04B 4POZD 5EO1A 5C0RH 4PRHB 4KHXL 3DVGB 1DQLH 4Y1AA 2WBJA 1V3JA 5HVHC 3A0OA 2J12B 1DQML 3MLPA 4JR9L 2ICWI 2YPLA 3TGXA 3NFPA 5JIIA 1DBML 2PXYA 5HHNB 4OZIB 2VISB 1VCAA 2F5AH 2E6JA 3RGVA 1YEIH 1C08A 1TNNA 4ONOA 1C7SA 4OGZA 2FJHA 3OB8A 5I15H 4APQD 3B6SB 4WVRA 4FABL 4HLJA 5FECB 3ULSA 5HYEA 4P4RA 3WFBL 5KN5B 2QQKH 4NQCB 5FV2A 2VLRE 3LQAL 4RIRB 3O2WH 1OD9A 3QUYC 3KXFD 4WTZG 1A1MB 3NTCH 3JUYA 3T65A 2IBZX 1UWEH 4R4FH 2CO6B 1KEGH 1ACYH 1OAKH 4DKEL 2BNRD 3L3HB 2DQEH 3P9LB 4QRUA 3HHRB 1PKOA 1H5BB 5IHZA 5CP7B 4WWKC 1I1AC 2LTQB 3G6JA 3MV01 5GS1A 1DVFA 3FQNB 3U30B 3V0WH 1AGCB 1KTLA 3L3DA 2QQKL 2I26N 4S1SH 1F90L 5DURB 4RAVB 5GHWL 3BGMB 3EYVA 3OJ2C 3HRZA 4WUUA 4QRRB 3CFBA 5JW5B 2CUIA 1B4JH 1RZIB 2CJUH 4M8QA 1J5OL 3IFLH 5GGUB 4D0CA 4MJIE 1NC2B 4R4FL 1XR8B 4PJHB 3TO4D 3S96A 5A3ID 2DQEL 1A4JB 1HILA 4HD9A 4LCCB 4J8RB 1MFAL 5IVZA 4H0HB 3NGBC 2YRLA 4EVNA 2EYRB 2GITB 4C4KT 5CSZB 2EXYD 1NC4A 2VDPH 5D7IF 3LKSB 3HE6A 2XFXB 4E0RA 3I6GA 5JZ7D 1MFCL 1AO7D 1FYHB 4NBXB 1CFSA 3VFWB 1NBVL 3W0WB 3PHQA 1WFOA 2G9HB 5BMFL 4PJEA 1VADA 3DV6A 2I5YH 2R56L 4ZAKA 2CLZB 2VZ1A 1E0OB 1SM3H 4Y88A 3MBED 3OKEB 3LDBC 4JRYA 3ZSTA 3M45A 3IDMA 4IS6B 4YHIB 3BT2L 5F7WC 4QRPD 2FR4A 5E6IB 1MFDH 3V4PH 3GJFH 4F7PB 3DVFA 4PG2C 3W9EB 3GBMH 3QP3A 4LLDB 2CXKA 1PGRB 2YR3A 5D6DA 3EOTL 3UDWC 1F02I 1WZ1L 4EOWH 3QIWC 4WI7A 3B5GA 5DT1H 4PREB 4ZSOA 3MJ7A 4X7CC 4HKJB 2DJSA 4Z78B 3VXQA 5HDQL 4OLVH 4PRID 2I5YL 4R96A 5C09A 2CQVA 1G9NH 1I3UA 4YX2L 4RCAA 3W11C 4L8DB 4MHHI 4NZUL 2VR4A 4JO3H 3CZFA 1MFDL 4FQIL 5I1HL 5D7JC 8CGTA 1WIOA 3OG6B 3PNWB 5DFWH 4XCEA 1G9NC 4F9LA 3GBML 5DHXB 5GIRB 1L4IA 3F8UB 3MGOB 5FM5M 1NLDL 4U33A 4RMQA 3QFJD 3PIQA 4MJID 2Z31B 3HZYA 4P5KA 1U8LA 2MKWA 2IJ0C 1EJOH 4XGZB 2HMIC 2W9DH 4XPHL 1I4FA 5KVDL 2FLBT 4YDJA 4W81A 3BPOB 4Z7WA 2H9GA 3MREB 4LOUD 4JFOB 2VLKB 3GKWH 3X17A 3WJJA 5FHBH 4C58B 5JQHC 1NEZA 3PWUB 3SDYH 5D6CB 3F7VB 4U6XA 1A9BA 5J13C 3ZYOA 4L4TE 3V6FB 4N5UA 4ALAL 5DEZA 1M6OA 3QI9C 1YQVL 1N8ZA 2GT9B 1CL7I 2DYPD 2A74A 1B0RB 4XBGA 3RL2A 3UYRH 3FJTA 3GSVB 3REWB 4I18B 3D39D 4D9QD 2NY3B 4LGPB 4M9OA 3C60D 3U7YH 4BJLA 4LPTA 1QBBA 1Y0LB 4FXKB 1BFVH 4OZHA 3SE9H 5IQ9B 5IVNA 1S7WB 1KB9K 1JN6A 2IANA 1JI1A 4XCNA 4MNQE 2LU4A 4I3RL 1ZVSA 4NJ9H 3RZWA 2FEEL 4LGRB 2YMXL 2XZQH 5FDWB 4YDKL 1YN7B 4NQEB 1FPTH 1RAMA 1F4HA 3VFPB 4C56E 1U8MB 3WKNA 4W6YB 2APBA 2HFFA 1F3JB 3HI1A 5HSFA 4WW2C 4J3TA 3VXOB 1QRNA 4I0PB 3RWGB 3VWJA 2VC2L 5IR1B 3U4AA 4QNPF 2I07A 1KG0A 5B22A 2MKLC 2ARJQ 2V2XB 1A6PA 4DAGH 1BFVL 2B0SL 4XMKL 1LO4H 3CMGA 1IRAY 5BS0B 1MJUH 1KBGH 4NNXB 4TQEL 4KK5D 1MFBL 4DFIA 3B8YA 4K8RL 4WENB 2MCG1 1NGZB 3VJ6A 1FPTL 4L29A 3VRJB 3O3DA 5GRVK 1P53A 4U1GB 3PWPB 3IXAA 3RDTD 4Y4FC 1PW3A 3U0PA 3BUYA 2OTUA 5L2KD 3RWCA 1BM3L 4LHUB 3QUKB 3U48A 5I1GL 3X3FH 4DAGL 1YPZA 5DHVH 3LAFA 1MJUL 4JVPA 1KBGL 1UWXH 4ONHB 3ULVL 3NMEA 4M5ZL 4EN3D 3DNKA 1TZHB 4NJAH 5EDXA 1ZTXH 4V1DA 5CD5C 4FFVC 5FK9A 5K9OA 5CSGA 4Z0BH 3IFOB 2NQCA 1T7YA 4Q6YA 2BFVH 3EYUL 2HYMA 3RVXD 5EOCL 2BJML 3MCKA 1F97A 2N1KA 2DTML 4JHBA 1UZ6E 3LOWA 4MNQD 3PDOB 4ZO9A 4HPOH 4Y8DC 3OL2A 3FO0H 2F5BH 4KDTA 1N6VA 4P57B 2VXVH 2DBLH 5IJVB 2VUYA 2X4PA 4FP8H 1H5BA 3TPUA 2ZNWA 5GZNC 2K7PA 4C56D 4OFYA 1FQ9C 2ADFL 3R0NA 4MQTB 1YY9C 3IKCB 3VRIA 3ULVF 3O6FB 4M03A 2R1WB 5HYSA 4UDUB 1ZTXL 4GG6A 1BGXH 4F2MB 5EFIA 4Z0BL 4R90L 1FN4B 1IT9H 5J89A 4OLWL 4ZPTA 5L0QC 3HUJF 2FSEA 1FYTA 4QF1B 5CP3A 3TA3B 1NKRA 1A8JH 1AR2A 3P4NB 5EU5A 3FQTA 3FT4B 1A7NH 4JPIB 4X5LA 3PDDA 5EZJA 3VMOA 1FNHA 4PJHA 4CKVX 1TQBC 4Z7NE 4LF3A 2X4OA 1S7QB 1I85A 1MEXH 1XF3A 4YR6B 4LKXA 1S9KC 1XIWC 3H3KA 3UTQB 1ZE3C 3FQUB 5ID0B 3MBXL 5F1SA 5C6TH 3C08L 1R3LB 3QEUB 3ZKNC 5HGGS 4XX1E 2Q76B 1BGXL 1I8LC 5ERWA 5GGSB 1EGJA 1IT9L 1YEEH 3MYJB 1FFPB 4MD5B 3W0WA 4JPKH 2HFEA 4M9PA 3MZTA 2WIIA 3ESVF 3GM0A 2NYYC 1Q0YH 2V9TA 5IB3B 1YY8A 4TUKH 3Q3GB 3WFDL 1CFQA 4FXGB 3UJTL 2NXZD 1G9ML 4OB5H 4ERSH 4QY8A 4I4WB 2D0HA 3BP6B 2AI0L 3NIGE 2HN7A 3BAEL 3DIFB 3I6KB 5D2LE 3TBTA 3QDMB 5DRXB 2AAVA 5I1AA 4NN7C 2BSED 4E5XA 4XNQB 3MX0A 4RGND 3W9EA 1Z9LA 5CS7A 4NWUH 4Y5XC 2Y07L 3UO1H 2O5YL 1GC1H 1I3GH 1CXKA 4ORGA 3MRIB 4WV1B 2AGJL 2NY0C 2B2XH 4HKJA 1UXSA 1CFNA 2XNAB 5DJXA 3MLWL 1TTFA 1N7ML 4BSWB 2PYEE 3WFHA 5E94B 1GC1C 4OCRH 5T3ZL 4KI5C 4ERSL 2X41A 2NZ9D 4GQPH 1Q9KB 3S97C 3BO8B 1T04B 4YXLH 1HH6B 5L88L 4M62L 2W9LA 1MCDA 5CILH 3QDGB 4ZFOB 1VFBA 3MR9B 3QQNA 4IMKA 4P59L 1Y6NR 5FGCE 4PJ7A 1AIFB 1N3NA 4QXTB 3WXVH 5EUOF 1QUNA 1CD8A 5K9QG 4W6XB 3VWKD 2X70B 3WHXB 4KQ4L 4KTDL 3GJEB 4YIQB 2VLJB 3QNXB 1RVFL 2P46B 2Y9RT 4LCWB 2B2XL 3Q2CA 1NANH 1K6QH 3SGEI 1CF8H 3GHEH 1KCSL 2GIYA 5DRNA 9CGTA 1BAFL 5MEPA 3VFNB 3PWUA 5H8DA 4K9EH 2EDYA 1GOGA 5D7SH 4ODXA 5D1ZB 5JW4M 3MRKB 4QXUL 3VE0B 1V7NH 4J3SA 3TZVD 1G1YA 4QWWD 1JYXA 3OPZL 1QYGL 4OBSA 2QSVA 3EKCA 4RX4A 2BOBB 4K9EC 3D87B 2ZSWB 4DUWA 1L7TH 5A43C 4DKFH 2BVPA 1X5XA 1KUMA 2V6HA 2XZZA 3S5LB 5MENA 1YMMB 1IGCH 3BGFB 4XMPL 4AIZB 1RY7B 4HHAB 1OP5K 1ZT4B 4OLXL 1OGTB 2OJEB 3TC9A 2BY1A 5C92A 4P2YA 4LLQB 2IQ9L 2APFA 2ZCHH 1J1XL 1MJ8L 4N8VB 3RWEB 3P77A 4MB4A 4A6YH 3IGAA 4Y4KD 3S88L 3WV0A 3P73A 1OTSD 1BQUA 2WW8A 4YQXL 3SKUD 3IDIA 1V7NL 3KNBA 2IAMD 1RUQL 5I8OL 3ULUD 5ACZA 4MHHG 1MCKA 2PYED 5HHOE 2HJFB 3EDKA 4DN3H 1NFDF 2V2XA 2AQ2A 3IDJB 1HYRC 4PV8B 4OF7A 4I2XB 1CICC 5DJDB 3U9PH 3MNWB 4FZEL 1CIUA 2A6IB 3HAEB 3HUJB 4Y2OA 5DUPH 1NEUA 5EBMA 1I7ZA 3IU4H 4EBQH 3SHSA 4KFZC 1HHKA 1WWWX 4NGHH 1EO8H 4P5TD 5GGTH 4G9FD 3BH8B 4YXHH 1YC8A 5DD5H 2F74A 5FF6A 3LIZL 5I8CB 1G7HB 4HPYH 4X4XB 4OJFH 2EZ0C 4CADA 2WSKA 1Q9OB 1NKOA 4X6FA 5D7IA 2V2TB 2F53A 4MLSA 2H8PA 4X80H 3D85D 3M8OL 4JQVC 1CGXA 1W0WA 2D2OA 1F6AA 1X4ZA 2DDQH 2ENYA 3SE3C 4Z77B 1AC6A 1IQDA 4Y2DD 3WS6A 2YPVH 4U6YA 2YRPA 1HYSC 1PG7X 3O3AB 3ZT5A 3MLYH 3RHWK 3QEHA 3U9PL 4HG4K 1AR1C 1WK0A 1PVHA 1J8HE 3SDDD 5CZKA 4NRYB 3SDXE 3PGCB 4ZFFA 1T4KA 4PJ9C 3RAJL 4HWEL 1TFHA 3O6LL 3TJEH 1EO8L 3CFKA 1T6WA 4Z18A 3B8SA 4PLKC 5DD5L 1EEZB 3MA7A 1ADQA 1FAIH 1MHCB 4OGAC 4LVHC 1VFUA 4PJBF 3WMSA 4HPYL 1TVBA 4WFGD 5CEZH 4O5LL 2ZG1A 4JDZB 2WWMC 1S9YA 3TBYA 4GXUN 1Q1JH 1WFUA 2AQ3A 2G2RB 4RGOH 4PY7A 2DIAA 1YEDB 1JWSA 4NC2B 1V7MH 3ZE0F 4U1SA 1MLCA 3A6CL 3FFCB 4M48L 3QIUC 2ZUUA 4N0UB 4OCMC 2DN7A 3KPOB 5I1KL 5KTEL 3QHFH 5K59F 3H9YA 3FT3A 4HK0A 2HVKA 1MCOL 2BHUA 1FLRL 5EO0B 4V2BA 4G42B 3VXME 1MJJA 1NMAL 2C1OA 3UP1A 1QQDA 2DQIL 2Y72A 1I9RH 3VRLF 2NPLX 3MRJA 4GRLA 5C08D 3HC4L 1S7QA 1ZVHA 5JDJA 1VGKA 4K7PY 2Q6WA 4O02L 4OKVA 3B9EA 3U6RA 3VXUE 4Z7QE 1UH3A 5I1CH 3F7YB 5EUOB 1Q1JL 1NMCC 2NY2B 3QHZL 5DQDH 1JNNH 1HXMB 1X5KA 5IG7B 4AMKH 2FIRT 5DJ0B 4XB7A 3BP4B 4K7PL 4NQDD 4J3UA 4RRPG 2EDQA 2EE9A 4IHOB 4CMHB 3LPGA 1JNJA 1VFAA 3GUTA 2HT2C 4P2QE 1FE8H 2IQAB 1FFPA 5I76A 4FFZL 1IARB 3QHFL 5CFHA 1JFQH 2NLJA 1BJ1H 3QAZC 3TJHD 4GUPB 3MOQA 5L8JB 4AIXA 5E2JA 3GSUB 3EO1A 1SBSL 1UVQA 1LP9E 2GJ6A 2V7NB 5HGAA 1EFXD 3KLDA 1J8HD 4JFDB 3LKQB 3OSKA 2CUMA 3TWCL 4Q9QL 1UH4A 1L7IH 4YXKL 1LNUA 4G6FB 2ZUVA 4MXVE 4NRZA 3IVKA 3EGSB 4ZNCD 4TUOB 2R23B 1KC5H 2X9WA 4Y4HD 5C0DA 1D5XB 1DEDA 1FDLL 1GJIA 4HX1A 4YE4H 5TF0A 1BIHA 2VKXA 1KLGB 4PLNC 4HGMA 2IH1A 1CFBA 5J0BA 2EICA 4XP5L 5JXAH 3G6DL 5BZWA 2NY6B 4DQOH 1Z2KA 4NWTH 1LE5A 3O4OC 2KH2B 2RFXA 5C0AA 5DD3H 4FQPA 4ZFGH 3LHPL 5F6IC 1UXWA 1ZSDA 3HR5B 3KLHD 3EYOB 4TVPL 4J1UA 4QXGH 1FBIH 3F5WA 1MRCL 3KPQA 4MAYC 1KC5L 1EFQA 3WHXA 1AC0A 2DWEB 3RPIA 2NY1D 2R0ZL 3STBA 5HYJA 3DMMA 1HDMB 2VLJA 3O4LA 1J9CT 5BW7A 3BZFB 4PRPE 4R2GD 5GRUL 2AJSL 5HYFA 2MCPL 3S8WA 2A6KB 1FZKA 2OL3A 2FO4B 2XWJA 1RI8A 2VDNH 3MV7B 3JTTA 2R1XA 3TN0D 1WF5A 1RJYB 1A9EB 4GAGL 5IV2B 4MQXC 1FO0A 3HE7C 3SOBL 3DGCR 3R0MA 1OT1A 3QUMA 5DA4A 3WDIA 4E41A 5CJ5A 2JIXB 2I9LA 1NUNB 1CFVH 4YHOH 1EO7A 3ZDYE 1I3RB 1PZUB 2XPGB 1CGUA 3O45B 5HHMB 2ZG2A 2IGFH 5J1AB 2HJLB 3OJDB 5BV7H 3LS5L 1E27A 1YDPA 1UG9A 4JFXA 5IF0B 2PW1A 4L8SB 5HHVH 3OR6A 4P3CH 4Y1AE 4LLQA 1OWRM 5DK2B 4FXLA 3GSWA 3STLA 4ZUTB 2PYFA 3SCMB 5BV7C 2VDNL 3M1BA 3UAJC 4U05A 3RWEA 4PJBB 1R3KB 3L1OH 5CHNB 3HG1A 3O3BB 1L9NA 1J0ZA 3PG2A 5D1QB 4P2OA 2F58L 2HLFD 4YHOL 2D7QA 4ESKA 3OKOB 4D9LH 4QCIA 3V4UL 1DQQA 4LAJH 4HULB 4Y19B 3U7AA 3OKKA 2JK5B 4WU7A 4YEEA 3RRQA 1RUAH 4X8XA 4RBPK 1A7OH 25C8L 1KPVB 4OF3A 1FH5L 2ADIB 1N4XL 3MNWA 2DQFA 4P3CL 3WS3B 3QUZB 4LBEA 5DJCB 2ZJSL 4M93B 4UBDD 3AAZA 2VXUL 3LRHA 1IEAA 1VACA 1ZHBA 3WYRA 1MRFH 3TBWA 1EHLH 1MNUL 1IAKB 1U8PA 3DV4B 4D9LL 4G8FA 2VAJA 4X4XA 2J88H 3QXAA 3B3IB 4YDLC 3VFGL 1JZ8A 1MCWW 1NLBL 1Q9OA 1QSFB 1C8PA 1M1SA 1WSST 15C8H 1YC7A 3IDYC 5MI0B 2E27L 2BXYA 5LGHL 3EOAA 4BUGA 5FO8A 3BKYL 4XC1L 1A7OL 1I9JH 1ONQB 1M7IA 1D5MB 2KKQA 4U1NB 3BZDA 3MLSL 1X5YA 4WUUE 3MXWH 1NUFA 2DQHH 4NO0A 5JPMB 4WGVB 1QBMH 2PUQT 5DJAA 2VZTA 1XGQA 1UZ8A 2GY5A 4HK3J 1T66C 1W72H 3T8XA 1DQJB 5DS8B 1TVDA 2ZUSA 3CNKA 2VXSL 3ZT7A 4EQ3A 2X4NB 5IVXE 2XICA 1FV1A 2VN7A 5DWUH 3EDDA 1U3HA 3RVWC 4Y1AD 2WBJD 4K3EH 5FYKL 3PQYA 4I8DA 5I16B 4XH2A 4F7MB 2YPLD 1QLRA 3UPRA 5D1XA 1K2DA 3GMRB 2PXYD 1QA9B 4GKOA 4IMLB 5DLML 2E9JA 1FG9C 1PLGH 5D96B 1S78C 4NKMB 4TVSa 3RGVD 2FCBA 2D9QB 5I66B 2HRLA 3QZWA 1BOGA 2Z93B 4LDOB 1NUDA 5J6GB 4F15C 1O7VA 1QBML 1CQKA 1VSCA 4GMTH 4PY8J 1W72L 4JRYE 1INDH 3RTQA 1CLCA 2EH8H 4MWFA 2A9ML 5EORL 1UB6A 5DFVC 3VFRA 2X7LB 2RCSH 2WWKO 3LKOA 2AKRB 4U4BA 3JV6B 4XP4H 2CIKA 4OM0H 4JJ5B 3MROB 2VE6A 3KYNB 5BRZB 4GW4B 4GRMB 1OOAA 4UT6H 1BZQK 2QEJA 3BPNC 1QSVA 4RGMB 2ADGA 4UIKL 3VGDA 2VDKL 1AGFB 4ZSOE 3WSQH 1VEOA 3V5KA 3P4OB 4JM4H 3EO0A 2X9XA 4YBQC 1DVFD 4GMTL 1OSZA 3B2VH 3T0EA 4HKZA 3MCLH 5E00B 3GSNA 4POUB 3IS0X 5AWNL 1U3ZA 1ZANH 2GFBA 1PJ9A 5KZCB 2NY7H 4JZOB 5T3XH 3T3PF 5KS9F 3REVA 3CSPA 1WWBX 3TIEA 4WUUD 4NHUB 3LN5A 5E2VL 3C2SA 4XP4L 3ALXA 3LKPB 1CLYL 4U3CA 4U1LA 3PP4H 3QA3A 1A3QA 1RK0B 5FDYA 3KPMA 3VW3H 4HFWB 3QHTC 5I17A 4Z7WE 2V17H 3ARGA 4S1DC 3N85H 2NW3A 1MVFA 1NC4D 1T0MA 3AREC 3HC0B 2GAZA 2OZ4A 3W9DA 1I7UB 4DZ8B 1MCWM 3HE6D 5KOVC 3N0PB 4BH8B 4HCRA 1ZANL 3MODL 3MXVH 1QNZL 3WFEL 1R6VA 1R3JA 5MP6L 4NNPH 5DO2C 2O5XL 4ZAKD 3IJSA 3UYOD 2DTSA 4HKBA 3BSZH 3VG0L 3C6LA 4FTVA 4OZHE 1NFDA 4PB0H 1YYML 4JRYD 3VW3L 5CD3A 2IANE 5HDBF 1DP0A 5MEOB 1OAQH 1RJLA 1JNLL 4D9RE 1ZV5A 3CH1B 4EDXB 2FJFA 4ODTH 1DUZB 5DQ9B 1FNLA 5IESL 1FVEB 1HOCA 2V17L 3BZEA 3N85L 3OR7B 3I3EA 4Z8FH 4YHML 1ZS8B 4MJ5A 5I30H 4Y16C 2PR4L 2UY7A 2W9EH 3O2DH 3KVQA 3TVMB 2Q3ZA 2EDEA 4LVOB 1OGAA 1S5HA 3OB0K 2AJYL 1T2JA 1NBYA 5JIHA 1OQOA 4NZTH 3NZHH 1QRNE 2BVEA 4UQ3A 4Z76B 3QWQB 3PGFL 4R7DB 1OB1B 1XF5B 3O9WA 2IFFH 5C09D 4PRAB 1OP5H 1H3XA 2AXJA 5IVOA 4JHZA 1BBDL 1OAQL 4O4YH 3IDGA 1DL7H 1K4CA 1ZVYA 2JKXA 4ODTL 3QWRA 3SKOB 5EG6C 1QSEB 4IIQC 5JPNA 4XVJL 3F62A 1DBKH 3B83A 5ADPH 3ZYIA 3N1QC 2ILLA 3EO9H 1QFWI 4MS8C 5C7XL 4CN1A 4Z8FL 2FO1A 1YMHA 3MRRA 5FO9A 4M5YH 1X5ZA 1XGYL 1J7VR 1FJ1B 1MCPL 3BKCL 5BO1L 3B2UD 3HZVB 3T0DA 1DUYA 2XTJB 4NZTL 1FCCA 2NTFB 2OJZH 4HIHA 4JN2B 3V0AC 1K8IB 2IFFL 1S3KL 3I02B 3KYKH 1CXEA 4OFIA 1U8QB 4GW5B 5DK3A 1TNMA 2ICEA 3LV3B 3P30H 4V1DE 1A2YB 2AXFB 4BFBD 5EU3B 4ZYKA 1A1NA 2Z8VC 3G9VA 5B3JF 1FP5A 3KR3H 4GAYA 5IHUH 3F12A 2Z0BA 5H37G 2ADIA 5C3LD 1BFOB 4FFWC 4OF0A 5INCA 1SY6L 4DEPC 2AEQH 4MJ2A 4F7EB 3FT2B 2KQMA 1NGQL 5ADOH 2IAND 1KJ3H 4IOIB 5DJCA 1HHGB 2YC1A 4PIRF 1YUHA 3LN4A 3T77A 1QFUL 4MX7A 1PQZA 5JW4Q 4Y89A 5BOZG 2DQGH 5EU7E 4R97C 5IIEA 1KENL 3VFOB 4PD4J 3RUGF 3GB7B 1LILA 2KUTA 1LE9A 1FZMA 4WCYH 3CFCH 5DDHA 3QIBD 4FQ1L 2FJGA 1JPTH 1FORH 5GRYA 3EJZC 5IB1B 1A7RH 1XF1A 2E8ZA 4QRQB 5SWQA 2COQA 5JHDB 4X9BA 1EHAA 4MLIA 5ALBL 35C8L 3VWJD 3OF6D 1ODAA 3BKML 3CVHH 4G80A 4RMTA 4JZJC 2MHAB 5TFSH 1B90A 2AEQL 4GW1A 4MDIB 3DROB 5CCKL 1KJ3L 3SDCB 4OD3H 5GS3A 3NACH 3VH8G 5KS9B 3QXDA 4Q0XH 4KZEH 1AE6H 1RIVL 3OKNB 2WLZA 2DQGL 4IJ3C 4MVBC 1BVLA 4OQ1A 2BCKB 3SE4A 5I73B 4NN6B 4IOFD 5F7DA 1MHEA 3X3GL 2CLRA 4ZNEA 4UOJA 4L3EB 2C3XA 5L6YL 1NCCL 1EH9A 4NFDA 4NO2A 2VXTL 4BFIA 1XEDA 1Z9SA 3O3EB 4G6MH 4OGXL 4TSBL 4GKZA 4OCLC 4R26H 4PJGF 3CZJA 1Z0MA 4Z7VF 4Z95H 1CIDA 1OLZA 4HWBH 1AE6L 1MHHB 1N0XL 4N9GA 2ZSVA 5F70A 2QQQA 3GO1L 1AHWC 4MZ2A 2NW2B 4TSCL 3U2SB 3R06B 1A4KA 1I1YB 2IPKA 3L7FB 5LGJA 4FMKA 5C0EB 1XT5A 4FQXB 4KTYA 5I75C 1NGPH 2CIIA 5T5FL 3HN3A 3AMKA 5B8CC 1K4DA 3KS0J 1G7MB 3RU8L 4KUZL 3FKUS 4HS8L 5H37H 1AGFA 1A7PH 2P8PB 3E3QC 2H45A 4APQC 3VFVB 3QO0A 1JHLH 4OFYD 1MAKA 4R26L 2VL4A 2P5WA 3Q48A 1IGYA 5C8JB 1KIQA 3AS1A 3GSXA 4J6RL 4CU8A 1D9KC 4KVNL 4JPWH 4PG9B 2HAZA 3Q6FA 4ZMAT 1B3JA 2OQJB 1PX4A 3SBWA 1YEKH 5E8DH 5HGHA 3WJLC 4NC1E 4N0RA 4WNQB 5HGBA 4NO5B 1KJ2L 1FYTD 1K85A 4PJ7E 1WBYA 2PO6A 3UTZA 4DGIL 2W60B 4GRWB 4OCWH 5DRWB 5LBSH 3JZ7A 4DTGH 3KJ4C 2P8LB 2UY6A 4GJTB 2P7TB 2VWEC 2E7MA 1HKLL 5A2FA 2OMBA 4NFBA 3P4MA 3U0TB 4EI5A 4LSDA 5C07E 5DI8B 2CSPA 4JJHA 5J3HC 1CD9B 4GBXB 3OAUH 5HYSG 3ZL4L 5FFLA 1JPGA 4NUGH 1XGTA 2ZUWA 4JPWL 4XAWL 2FL5A 3MJ9L 1YEKL 4MCYB 1WC7A 3W0WD 1T1XB 2A0LD 4NC0B 2AJ3B 3R8QA 4AEHH 1XR9B 2XN9B 5A3IC 1FIGH 3V52H 1OAUH 5C0CE 5JA8B 4XTRD 4PV9B 5F93C 1H3TA 3DOSA 3EBAA 3NH7H 3BFOA 5ETUB 5CBAA 5MENE 3T2OA 2ITDA 3T2NH 1MHPH 2YBRA 2QR0A 5C0FA 4LGSB 1WAAA 2Z8SA 5GGVL 4JQIH 3HA0A 3OAUL 2LVCA 5JW3H 4PJFB 1AXTH 4NKDB 5HI3C 4K3HA 2HP4A 4CNIA 1HEZB 1XMWA 1UENA 3T08A 1IC7H 5KSVA 4TOYL 4R3SB 1FL3A 3DBXA 4M1CD 5FUOH 3SPVB 5DJ8A 1W8OA 1ZLUH 4XWGL 3MBEC 1LK2B 1BD2E 5SX4I 1ND0A 3WIHA 1BPVA 3U7WL 4PBWD 2NX5E 3CX2A 2QSQA 2XWBA 1IAIM 1KLUA 3ROOB 1RZ8A 1NGXB 1R0AH 4BZ1H 3ZKMC 1QSEA 5I9QB 4GO6B 4MSWA 4QEGA 3T2NL 4HIJB 1IGJA 5DEGB 5TQ2H 5FKAA 2C9AA 4WO4A 4C54A 4P2RB 1AXTL 1R24A 2OYPA 3L3KB 1K5NA 3IU3A 4J2XA 2C5DC 2AEPL 3RIAF 5E08H 1KT2A 2H6PA 3P2TA 1P9MA 5I0DA 2A73A 5T1MB 1KLFA 1BZ7B 4OFKA 1A3LL 3RWIB 5TH2B 4XZUB 4CN6A 3WL9B 4YDIL 2Y36H 2VLKD 1YN6A 1GGIH 3I02A 4LCUA 3WN5B 1OVZA 5ID1B 1FL5A 5JQ6L 1HIML 2AV1B 4N0FB 4ZS7H 4F33B 5HD8C 4U6HA 4KKNA 1Q8MA 5TGBB 4L5FL 1R5VB 4YPGB 4O58H 4JDVA 5TQ2L 2IG2L 2DLTA 3L3IB 4PJGB 1U2CA 4RX4D 5H94A 2NY3D 4ODBD 4FQCH 4X4ZA 4Z5RA 4DCQA 3V5HB 1G7IB 4OFVA 3JV5A 3MTRA 1CG9A 2BHYA 4XPBH 2YN5A 5CUSL 2BNUB 3GMQB 3LB6D 3D0VA 1GGIL 3BP5B 5IHBA 4KVCH 4JQXA 4F7TA 1CGSL 3T1WA 5C0GA 1NMBL 2EDWA 3BQUB 3V8OA 5ICXB 4X6CA 1SYVB 2DM2A 5GJSH 1S8DB 2OK0H 1JTPA 5DC0A 4XPTH 3S36H 4IRJC 3RWFB 2OSLA 5TPWH 4ZOCA 5F21B 4P5MB 1J8KA 3JUZA 1M7DA 2C3VB 4KK9D 5GS2D 5CJBA 2FYYB 4XP6L 3IB4A 3RZCC 1N64L 1RZFH 4TNWK 2H32A 3C6SB 4M7LL 5FYJE 1UJ3A 2CDEB 1JF1B 2Z8WC 4HXBH 3HI5L 2P49B 1ZHKB 1I1RA 2EKJA 3AXLB 4Y5VB 3WO3B 4HV8B 4JCMA 4KVCL 4HJGB 3P11H 1DQDL 1IAOA 4X9FA 2DD8H 3C5SA 4IRSC 2A83B 4HH8A 3E6HA 4L3EA 3DO7B 2OK0L 4LAQH 3RWJB 2J6EH 1KN2H 43C9B 2W91A 5TPWL 2Z35B 3QPQD 4LHUD 4YC2C 2F53D 1TMCB 4YWGL 5F9JA 4S11A 3BW9B 32C2A 4H20H 4ZUWA 4RISH 1CBVH 2PN5A 4JANB 2ITCA 3D2UA 1S9VA 2V5SA 1TQCB 3A67H 3FB5A 3DURA 4GG8B 4MDJB 4WIQA 2W1NA 2GJ6E 2KZWA 4OLUL 4H26B 1KJ2B 1KCUL 1MREH 1CLZL 2IPTH 5IFJB 3L6FA 2NW2A 4PJ8B 3LKRA 1MI5A 3RDTC 2F8OA 3B5HA 1EZVY 2NCMA 2FWOB 5EBLA 4H8WL 1P2CB 2D31A 1EAJA 2AK4A 4ZQKB 2X44D 5AZEL 4KGLA 3KXFB 4BZ2H 3INUH 1X7QB 1NAKH 1AQDA 2J6EL 3B9KC 2LAGB 1E28B 1QBLL 3OX8A 3JTSA 3RP1A 4UTAH 3SJVE 1NAMH 4EN3C 5JOPE 1A7QH 2KPNA 4OZFG 1WBZB 4NC1C 1XGRB 3AU1A 5C0AE 4AEFA 3O6FD 3NA9L 3CX5K 3FN0L 3SDAB 3RKDC 3WD5L 2ZOLB 4KJWC 2IPTL 2OQJA 5HTSA 1EXUB 5JLZA 3NABL 1BEYH 2ADJA 1JGUH 4KTEH 4PRBB 3DYMA 3I75A 3L95A 2BNQA 43CAB 1MWAL 4UNUA 1KB5A 2G5RA 3K81A 2DI9A 4JHWH 5HYJE 4GRLD 4QHKJ 4M7KH 4U6VH 3WNMA 3TO4B 4LVNC 1NAML 1EVTC 3RVTD 1QTYT 1QFWH 5FKPB 4ZTOH 1CFTB 1P6AB 5E5MA 3M17B 1XCQB 2WBKA 4Q6IC 3QULB 1EHNA 3OHXA 4HF5H 4UUJA 4Z0XA 2Q20A 4R8WH 4CBPA 5C2UB 4E41E 3CFDB 4OD1L 4CMMB 4HWZA 4HC1A 3U1SH 2QHRH 2FX7H 1KJMB 4JHWL 1KIUA 3OB0H 5EBWA 1HSBB 5E1AA 2GJ6D 4U6VL 4NM8H 4Y5YB 4DWHA 5CIPH 3STZB 2K3TA 5ETUA 5ILTL 3O8XB 5B39G 3G08B 5E8EB 3GRWL 2LV4A 3HB3D 2VXQH 5D70L 4QRPB 4KH2A 2VLRB 1BQHG 2ED9A 4D0DB 4K23L 2HTLC 4M43H 1OCWL 3FB7B 2NXYC 4AH2A 2R2HB 3HG1E 3IJYB 4HF5L 1T7XA 1YEHH 1H9VA 4YHKL 3VGAB 4ZO6A 3OMZA 2NXZC 5J56B 3RUGA 1UCTA 3V5DB 5CZVH 4ZO7A 3TBSA 1C5BL 5F72S 3QUYA 5C0AD 1BZ9B 3TIDB 2QHRL 5ACLA 3SKNB 4LFHD 1AXSA 1CK0L 4ZTPL 4LHQB 3DSNA 2EE3A 4UB0H 3WHE0 4NM8L 4RGNC 4TNVF 2VH5L 4OZFH 4N1HB 1CDYA 1XCTB 2VXQL 5DMGD 1PKQE 5IGXL 6FABL 4WWKA 3UTSA 2FH6A 1I1AA 1YZZA 2ORBL 3GIZL 4M43L 4TYUA 3HI6L 1I1FB 4ODHH 1F4WL 2CPCA 4XBEH 4DOHE 5HYJD 4OQTH 4X9HA 1MCRA 1ED3B 4YK4C 2VLJD 3QQ4B 3O4LD 3QFJB 4MJIB 4YHPA 1JWMA 1EEQA 1OSPL 4ZPVA 5T1MA 3T04D 3VFMB 3LH2H 2R29L 4WTXA 5T5NG 2NZ9C 5TH2A 4LLWB 5A2LH 2QSCL 3MRQA 4NHCL 1CLOH 4UB0L 3U46B 2Y5TA 4WDIA 4OCNC 1U8JA 3AMLA 4E41D 1QLEH 1D5ZB 3E6FA 5BCAA 4OIAA 4NN5C 4P2CG 5FUZL 4U1HA 5EZLA 1FGNH 1H3VA 4Z7VA 1XF2B 5J1SC 4Q9RL 4JRXE 3TLRA 4ODHL 5CINL 1A6ZB 1U8HA 1JTOA 1G7IA 3C60B 1IM3A 4GOSA 2PCPB 3G6AA 4PPTA 4XPAH 5L2JB 1FC2D 3P0YL 4EUPB 5IQ7H 2BNUA 3BYYA 1UZ6F 2CD0A 4PP1D 5FYJH 1VKXA 5CJXC 3J7HA 1PX3A 2SEBA 2LVEA 4JFHD 5BQ7A 5F96L 4EI6A 3EDEA 4M61B 3EDJA 3ARDC 4NKQB 2BK8A 1BFSA 2MFNA 3HG1D 4UI2A 3L5HA 5DVNA 5KBNC 1NCUA 4FG6C 1IMHC 3VD3A 5ANMB 5H35A 2X1QA 2UZYB 4WI5A 3ELAT 5DRZA 3V6OA 3GSOB 1FZOB 3LKNA 4J4PC 2GHWB 3VGHA 1AQKL 2FX8H 4KKBC 3TH4T 1UWGH 4JHAL 4L8CA 4H1LB 3UDWA 4G3YL 1J05B 2OP4H 3QIWA 1WJ3A 3GJFA 3ULUH 5F7EL 5IQ7L 5C2BL 1HXYB 1HWGB 4HUVB 5IWLC 3OKLB 5JOFA 1A14H 4Y4KC 1TZIB 2XOTA 5E99H 2R9HD 4QLRA 4Z7NF 1LO0H 2ICWJ 2Y4SA 5DMKB 2IH3B 1KELL 1Z3GL 5T1DH 3ARFC 2IAMC 4XVUC 5TF1L 3U9UA 3GGWB 3FOLA 3JV4A 3ULUC 4DN4L 3LS4H 2C3HA 2Y25A 1S7UB 4OTXL 5K9JL 4PJ5A 1A1OA 1DE4A 1TETH 4WTZA 3TNNB 2CKBL 3GMNB 4RFOH 5D7JA 4U1JB 1JNHB 1EHXA 1LO2H 1T3FB 2BSSB 5IOPA 5KSAC 3GIVB 3T0EE 3VDBA 4RFEA 5L2KB 2FX8L 2H1PL 2GUOB 4QHUB 1DR9A 1ZA3A 2QHLA 1E6OL 1Q0XL 3IETB 4XPGL 2X4UA 1M05B 3H2WA 4NUJB 3NFNA 3ULUL 3LMJL 5J6HA 4PRDA 3L5JA 5DC9B 2R4SL 4ONFH 4NO0D 3BD5A 1RZGA 1CL7L 1MWAB 3MNZB 4D94A 1JV5A 1LO0L 3CC5B 3GK8H 3NCMA 2R2EB 1BX2A 2VDML 4L9DA 1OM3H 3FTGB 3MLVL 3NIGF 3I50L 4L4VE 1N5AB 5D2LF 3VCLB 3D25A 3HPJA 3LS4L 4QTIH 5DMIL 3QI9A 4LEXH 1G6RL 4URTB 5CWSA 1FNGA 2PTTA 1U3HD 2WQRA 4MNQB 3PQYD 1CD0A 1LO2L 4WHDA 2D7TH 4WFHE 2WV3A 2R69H 2D7OA 5D1XD 3VXNB 2F15A 2F8VA 3WO4C 3THMH 3X13B 4MB3A 1MQKL 2ICWB 4C56B 5FA3B 1UYWL 4XMLL 3CDGB 4UAOB 4E42A 1W0VA 4P46B 1OPGL 4KRNA 2WZPD 1OTUD 1ORSB 2OL3H 2W0LA 3DTXB 4O51B 4BSJA 4FTVE 2IMNA 4NO3A 3C87A 4HXAL 1MY7A 3RTQD 3MRPB 3X11A 2HH0H 4CDGC 3BZ4B 1QPPA 5ISZA 4WW2A 3G5VA 3IDXH 5AYUL 4FQQA 1X5LA 2GTWB 4PY8I 3PHOA 2N7AA 2HKHL 4CVUA 2QQLL 2CK2A 3Q0HA 3BEVA 1NFIA 3S3SA 3GHBH 3OKDA 4ENED 1KFAH 3THML 5E9DA 1ZHNB 3IF1B 1IL1B 1CFTA 1FL6A 1XGUA 2FECI 2BVTA 4ODVL 3T4YB 4P49A 5HY9A 4JFFA 4M6OH 3QULA 2EH7H 5B38B 3CCHB 4E9LA 5MEQB 3MV8A 5CGMA 1I8IB 4HZAA 1F8TH 1MH5A 3HLAB 3QYCA 4PGCB 3E2HB 4R0LB 5I1LB 1U92B 4WHCA 4Y4FA 1ITBB 4ZG1A 2YD2A 1IJ9A 5E8NA 5GRJL 1I7TB 3EYQC 2GCYB 1GYAA 2HKFH 2DJUA 3AM8C 5I1IL 5J9PA 5JUEH 1GHFL 3ARGD 4KMQA 4X6DA 1MCNA 1S7RA 1NBZA 5ENWB 5FGBC 1VHPA 1T0NB 5DHVA 5F6HJ 2NY6D 5GGRY 3MOAL 4JREC 3CAFA 3MFFB 1WCQA 3MGTB 4CVZB 3TT3L 1QSZA 3KYAA 2F8XC 4OUUB 2DQTH 3QCTL 1RJZB 3QG7H 1OF2A 4MD4A 2FBJH 1UM6L 4XCYB 3C6LD 4FTVD 4KKAD 4X98A 1GAFH 3LEVH 4DGVH 2WANA 4UNVA 1UB5A 4ORZC 5FA4A 2BC4A 3MCG1 4NYLA 1V8HA 2AABH 1BJ1J 3MRLB 2HJKA 3QQ3B 1E4WL 3OXSA 2AVGA 5E2TL 3AUVA 3UBXI 4H88H 5KJRH 3VWKB 4PBVC 4B7IA 1OGAD 5DHYA 1ZXQA 3C8HA 4JM2F 4F9PC 2ZG3A 1BF2A 5F1IA 4YHNB 3RBSA 3MV7D 1CGVA 3EYSL 1IM9A 3O9WD 4RMVA 4LPWA 2E3VA 2VLME 3Q6GH 1IGML 4S1RH 1JMZA 3H0TA 4N90D 3LEVL 1XIWA 1D5ZA 4CAGA 5E2WH 2NY1C 1E4XH 3WIFA 1AD9A 3TZVB 2WBWB 3W39A 2DQCL 4GXVH 2DLFL 3LRSA 1OY3B 1JYWA 3IFPA 2P45B 4P4KC 3SDXF 3RNKA 1I8LA 4NRXB 5DZOA 3S6CA 4PBXA 2XWTA 2DLIA 4X6EB 3TN0C 2NY4D 4K3DL 5D2LB 4AT6B 3KAAA 4BH7B 3H9SE 3SCMD 4YDVA 1JWUA 2CKBB 4IDJH 2Z92A 2ZUTA 1CXLA 2EECA 2UZIL 2FHFA 1LEGA 1E4XL 2O5ZH 4ZUVB 4XNUH 2VDOL 4C83B 1NJ9B 1OWWA 4GXVL 1IC1A 1U91B 4RSVA 3ARBC 4JFQA 5CBEA 2PYEB 4Y5XA 3V0VA 4M8VA 2ZUYA 2E7BA 4AZ8A 1XF4A 2VL5B 3LSOA 1YECL 4MNHB 5KSBB 3HFML 3BPCB 3K8LA 4YGVA 3VFSB 4M6MH 5KAQF 4OV5A 1D3CA 4WY7H 2C3GA 1TZIA 3VFTB 1UKTA 1ZMYA 4L9LB 5FV1L 4QHMB 1SEQL 3V4VH 1ZLSL 1QLFB 1QEWA 3T2QA 5KVEL 1KPUA 2J1KA 1A6TA 3H7BA 5ESQA 2AJZB 4Z7QF 3CVIH 4Q2ZA 4P5TB 5HYIA 4G9FB 5BXFA 5BJTB 4JN1H 2P5WE 3WUWB 5IB2B 1JNHA 1HH9B 3V7MA 1QSFD 4PJXE 5CEXB 2XKNB 3ECBB 1OP9A 1WZMA 4LVEA 2IADB 1XGPB 4GS7C 3DPBA 1MAJA 4UV7H 4YHZH 5I8EA 1BVKB 4Y2DB 3HPLA 4L4TA 4UBDC 2A6JB 1AD0A 4M6ML 3KDMA 4KJPD 4ZD3H 5JA9A 5BVJB 2I60L 3T0VA 2C7UB 1LP9F 4D8PB 3SDDB 1J1PL 4UT7L 5DD6A 4TTDC 5KVFH 1S5IH 3CVIL 2R1YA 4XPFL 4X7FC 4MB5A 1V3LA 1KEMH 1T2QL 3ES6A 4MXVF 1OLLA 4ETQA 4WHTB 5JORB 5DQJB 4NQSA 1X5HA 3PGDB 4G9DA 4NRZB 4U2YA 5EC2A 3C5JB 4OAWA 3DX7A 4HFUL 5FO7B 2ICWA 5IFHH 4RNRB 3CDGA 1VA9A 2EEDA 4P46A 1WITA 3NAAH 2XY1A 5D5MA 5E03A 4LASL 4X8JA 4G6JH 3QUXC 1YNTA 1G7QB 2NR6D 4NT6B 3MLUH 3JSSA 4FOMA 1Q38A 2E9BA 4Z7OE 4XCCH 1KTKE 4GH7B 5SWSE 5L9DH 1WAAE 4OM1L 1SJHB 4WW1B 5IFAL 1S7VB 2J8OA 4O9HL 1IBGL 3LEXA 4OIBA 3DWTA 2ID5A 1D5BB 3D18A 4G5ZL 5K33A 2X4RA 3PJSB 5BRZD 4A6YA 4UT9L 1JRHL 2MJWA 3MMEA 4QHLB 1HHHA 1D5IL 4LMQI 1ZHNA 1HINH 1IL1A 2X6MA 3B5TA 1P4BH 3T4YA 1CICA 3UROR 2EKSA 3OXRB 4LQFH 4OZIE 1U95B 2P5WD 4NQDB 3ORJA 4JM2B 5D7LA 3MLUL 2ZCLL 5A2KH 5B3NA 2L7JA 2OXHA 3ZDYF 1ZGLB 4YJZL 1FNSH 3G5YA 2PO6D 1HSAA 2R0WL 2M2DA 2YN3A 4LPCA 1SJEB 3ZHDA 2AK1L 5EBGA 1EFXB 1J8HB 5GGTA 3PL6C 3SDXB 4JQVA 3SE3A 4EI5D 1DBBL 1EEYB 2OI9B 1IQWL 3O81A 1PZ5A 3TBVB 1UACH 4Y4HB 5I8KH 5ENWA 3DRTB 4ZUUB 3TP4A 1U0QA 1UA6L 2EDXA 4XNZC 5E8OA 5MHSE 4N8CL 3QXWA 4HH9B 4YHLL 5AD0B 1H3GA 3FB8B 1JHKH 4JG0H 1RFDH 4LIQH 3I9GL 2YEZA 2H3NA 4R4NC 3C09B 3BHBB 1HHIA 5CMAB 4QRRE 1MCJA 1HCVA 3WDJA 1T20A 1Y6MR 5IBUB 4U7SA 1T21A 3TNMA 2AJUL 5I8KL 5GGQL 2QADB 4KROC 3MRMA 3MRCA 4S2SA 1UEYA 4K2UH 3K8KA 5T33H 3FMGH 4X6CE 4R2GB 1T1WB 4OZ4A 3U4EB 4PJDA 4YHNA 2GK0B 2VN4A 2V7HA 1IGFL 3ZKXC 3AGVA 1N5YL 1OTTC 3EZ8A 3VXPA 5DJYA 4LLYB 4QXWA 3GJFK 1JCKA 1ZA6B 1J87A 5D93B 2OX5A 5MERA 3VD5A 4MA3B 4ZO8A 1QSED 3TCLB 3U83A 4OCXL 4XHJD 3BIKA 5HJ3B 4F57L 3TYFA 3BWAA 2EDNA 1KF9B 1JK8A 4WO4D 2ARJA 3HZKB 1DLHA 2C1PB 2FHCA 3T4AB 1FSKB 4X6EA 1FVCA 2ZCKH 3G5XA 1DANT 1RMFL 4HEME 4QRTA 2EDKA 4NP4H 1OQXA 3AY4C 1FCGA 3DO3A 4YO0A 5FYLE 4JPVH 3GMMB 3EFFB 1DBAH 4GAJH 3KLAA 4GKNA 4NQVA 2HFGL 2FB4L 2Z8RA 4HJJL 1GGCH 1KNOB 1WIUA 2FEDD 1FRGH 4PJEF 1LO3L 3RI5K 3V8CA 5EN2A 3ARPA 4S0SD 3SO3C 2KL6A 3WDHA 1FVDA 3OWEA 1MSPA 2DQJL 1WFTA 5F3BB 1U6AH 1YEFL 2FATL 1HZHH 3B2UC 1RK1B 3WIIL 3VFUB 1TPXC 3ZDXE 3BPCA 4WEBH 5TDNB 2FHBA 3K1KC 5DGQA 4BZYA 1MJ7H 1IGIH 1U58A 1Q9LB 4X99A 1GH7A 4I9WE 1L0QA 3GSQA 3UBXG 5CLWA 2D7NA 1AGEA 4HBCH 1YNKL 1G7JA 2NY5L 1RIHH 4JPVL 4MQSB 4O2CB 4DW2H 1TCRA 5IW6B 3NCJH 1U8NB 4KJQC 2ESVA 4XP1L 5HGDA 1N2RB 4HIEA 1U93A 1GGCL 1LO5B 4DGYH 4JLRA 1A6AA 2FZ3B 4RZCB 5IB2A 2CUHA 2WUCL 4PRPB 1UCBH 4JY4A 5JHDD 5LAXB 4F7CB 4MAYA 3WFZA 2W0PA 2GKIA 4UIMB 1CYGA 2JB5L 4G7VH 5JIKA 2Q86B 1P4LB 3G5ZB 4G43B 5F1KC 1IGIL 1QR1B 1U8OB 2FGWH 4LLMA 1G7PA 1RZKH 2VDRH 3FOMB 5HHXH 4LKCB 2DKUA 4YBHA 3H9HA 2CRYA 4ODUB 5DUBA 1T5XA 5D2NC 4JZNA 4PUBL 5E6ZA 3QIBC 3CSBA 5LCVL 3T0WA 2FDBP 2OR8A 3ILPB 1MVUB 3FQRB 3PWJA 1RZKC 3HE7A 4NQEE 3P0GB 4LMQE 5EO1B 1X5JA 5ALCH 3DXAA 3KYOA 4L3ED 4Z7WF 4Y1AB 2HTKD 2WBJB 5FYLD 3NFPB 4K3JL 2PXYB 1CWVA 1XZ0A 3SE8H 3RGVB 3QNZA 1KXTB 2VIRA 4HG4J 1C08B 2ATKB 1B2WL 4X6BB 2CLVA 4N1EA 2FJHB 5BS0E 5C9KA 2WUBH 1J0IA 5IT2H 3MACH 5HHOA 3MRFA 1OARH 3ULSB 4OZHF 4P4RB 5DD1H 2APTA 5I18L 3D3VA 1MI5D 4WUKH 4C55A 4FZ8H 4WI6A 3QO1B 2AK4D 5F9OH 5B4MD 3MOBH 4B41A 1CXIA 3IYLW 3PJSA 4KK8D 2X4QA 2BSTA 5H2BA 4RWYH 2GJZA 3T65B 2XA8H 3TEUA 4TSAL 4OKDA 1KTRL 3ZTNL 1EVUA 3BDYH 3KPPA 2WNGA 5IHZB 4JM2A 1IAIL 3PUCA 1JZ7A 2LE9A 2WP3O 2HVJA 5GS1B 1DVFB 3MACL 3AS2A 1OAZL 5SWZA 4HGWA 3OQ3B 1YEJL 3VXRA 1O0VA 3FQWA 3FRPG 2R0LH 4LPVA 3L3DB 2VZOA 1LDPH 4WUKL 3UZEA 3EHBC 2A6DA 2BNQD 4HQQL 5BVPL 4OLEA 3EYVB 1C5DA 3HRZB 1MLBA 3OKMA 2X4SA 4WUUB 3CFBB 1H5BC 2YD4A 4RDQG 5E4EB 4D0CB 4BUHA 2LTQC 3U30C 2BVOA 1HILB 5IVZB 3TBVA 2OR9H 4WWID 1GGUA 4WU5A 1F42A 2YZ1A 4QHKI 4EVNB 3BJ91 5FYJU 4BK5A 2DMCA 3MUGA 4PLJD 1NC4B 1KOAA 4M4PA 2O61A 4M1GL 1ZT1A 3QFDA 4N9OB 3HE6B 4HUUA 1XH3A 3I6GB 5SV4A 2IF7A 3FZUC 5FCUH 1LDPL 1F4AA 3PHQB 1FGVH 5C0IA 2XN9D 1A6VH 4PJEB 4YUEL 1DJSA 1VADB 3DV6B 4LCCC 1W72A 1R5WA 4XBPA 4ZAKB 1PG7W 1TZGH 2H26A 4JRYB 4WFED 1HHJA 3IDMB 3VXMA 2R2BA 2FR4B 5IMMB 1EJ6A 4UILH 4LCIL 2JJWA 2MNUA 1WWAX 1ZHLA 3VXUA 5GJTL 1I7RB 2ZOKA 3QJHA 4R4BA 5CZXD 2IMMA 2GK0A 3RNQA 1A6VL 3MJ7B 4ZSOB 3VXQB 3CXDH 1CGYA 2VAAA 3KPTA 1Z9MA 1EGJL 1MY5A 4R96B 5E6IC 2EXWC 2XYCA 4P2QA 5C09B 4GQ9H 3L9RA 5TE7L 3FFDA 4MA3A 1CZ8L 2EDBA 3S4SG 3EYFA 1GPOH 3T09A 3F6LA 3E8UL 5HJ3A 3D6GA 4WWKD 3CZFB 4XC3H 5EA0L 3UTSD 1I1AD 3PP3K 2G60L 3VXSA 2PF6A 3QDME 4XCEB 1LP9A 4XAKE 3MFGB 3OGCA 3PIQB 5I1EH 3HZYB 4PJ5E 4A2MA 4P5KB 1KIRA 4LSUH 5KVGH 1U8LB 2MPAH 2DS4A 3D69A 1OHQA 3CXDL 2DI7A 4LRNH 1MRDH 2JJSC 4YDJB 4Z7WB 2CDGA 4NKOA 4P9HL 4CW1A 2H9GB 1WLHA 4JVUA 1CE1H 5EZOL 4MA7H 5DEFA 1WTLA 1NEZB 3ARUA 4M7ZB 4U6XB 1A9BB 1GPOL 1N8ZB 4FS0A 2Z31C 4KKLC 3QRGH 5IW1A 1NGWA 1MAML 4OCYL 1BIIA 2A74B 3QCUL 4XBGB 3RL2B 3AREA 1QD0A 1MCIA 2KZ1B 3T2PA 3BPOC 3S3PA 4OZHB 4LSUL 3HMXH 3BH9A 3CGTA 4ZXBB 5C0JA 2F54A 1JN6B 2IANB 3QDAA 4XCNB 4JAMA 4LCWE 1U8NA 4ETYA 3VH8B 1ZVSB 2VDLL 4QHNA 3BXNA 1CE1L 2CMRH 4J3OC 4MA7L 5IBLD 5KSUA 5M95B 4RZCA 2DWDA 4KHXH 4I18C 4PRPA 4PJCA 3UPCA 3BUTA 2NY3C 3Q5YA 1JZ5A 1JF6A 1N59A 3HI1B 1DQMH 1IEHA 4HAFA 1QRNB 5EU4B 4RFNB 2X09A 3VWJB 1NCBL 5F1OB 2I07B 1X3DA 1C7TA 1TXKA 1QR1A 2Z91A 3T0XA 4F8QA 1H15A 1Y18A 3HMXL 4N0YL 4PJ7F 3CUPA 2DF3A 3JVGC 3QPXH 4FABH 4JO1H 1ZAGA 4WFFD 5GS2H 1T7VA 3WFBH 1NANI 3ILPA 2XZAH 3KJ6L 4I0PC 5IK3A 5ECJE 5EPMA 5E9DE 3DSFL 3VJ6B 2X40A 3W11D 3LQAH 2Q7YA 3K2UL 4L29B 3C2AL 4UDTA 2VKWA 4PJ5D 3O3DB 4JFFE 3SN6N 12E8L 4IIQA 3IXAB 5D7JD 4KHTH 1CI5A 3AB0B 3U0PB 3BUYB 1EA9C 3MV8E 4DKEH 2OTUB 4HJ0D 3LQAC 3RWCB 2IFGA 1KJVA 1YPZB 2E7LC 4K7FA 3C5ZB 4KRMB 2ATKA 2OR7A 4X6BA 2HMID 3O41A 5LXGL 2BRQA 3QPXL 2Z4QA 4JO1L 4V1DB 3PV7A 4U1GC 3RA7L 5FK9B 4BKLA 3HUJE 4PJ8D 5K9OB 2XZAL 4D0BA 1BQSA 3H42H 4POYA 1SY6A 1F90H 2CH8A 4DZBA 5TE6L 2VZUA 5GHWH 3QO1A 4KRPB 1T22A 3HMWL 2Y6SC 3QI9D 1J5OH 3MCKB 2XXMB 4KHTL 4X6DE 4KUCF 1F00I 1F2QA 1OD7A 5CJQL 2GEEA 1MFAH 2X4PB 2J4WH 3TPUB 5IB5A 2A9NH 3ARXA 4LSVH 2O26U 1F3RB 4J7RA 3VRIB 3SDAD 1N6QH 5GQBA 5HYSB 4GG6B 3SKJL 5EFIB 4YBLB 1MFCH 4NZRH 3H42L 4B7LA 1NBVH 4X4MA 4ZPTB 5FEBA 5DZNA 1IC5L 1CQYA 1GVIA 5BMFH 2FSEB 5ISZD 1FYTB 2R56H 5E2UL 3OG4B 2EIBA 5EU5B 4CGTA 3FQTB 1UC6A 1AP2A 3F58L 5EZJB 4B0MM 1AGDA 1T89C 4JZJA 2X4OB 3O6FC 2V9RA 4LF3B 1JZ6A 3QRFM 1XF3B 1PAMA 3BT2H 2Q3AA 4LKXB 2AP2A 5GISH 1ADQL 2J4WL 2WP3T 5IMOA 5K9QI 5IVXA 5HHQA 5J11B 4TULL 2A9NL 4KU1A 4LSVL 4HWNA 5C0BA 4NQTA 1WVZA 1N6QL 3CVHA 3TH2T 3EOTH 3TA3C 3RVUC 1F58L 4NZRL 1WZ1H 5ERWB 3MV8D 2OLDA 1IGTA 4XCFL 2C26A 4N0UE 2HFEB 5DJZA 2WIIB 1OAYL 4WI9A 1WEJH 5F8RC 3MYZA 5HDQH 2AJXL 1YY8B 4MYWB 3GMOA 1CFQB 2FNBA 4YFDB 1N6UA 1TDQA 4K3GA 4Y4FD 2BRRL 4OLZL 5I74B 3S5LG 4QY8B 4F3FA 4YX2H 3O8XD 1P7KA 1QO3A 4NZUH 3L5WB 2VQ1A 5GISL 2HN7B 5ELIA 2R2CA 4U0RB 1A64A 4UQ2A 2XQYK 2DBJA 2VLRD 4FQIH 3RWHA 2YHGA 3TBTB 5IMMA 3RGHA 5I1HH 3IT8D 4NPYA 1BLNA 5FGSA 5I1AB 1DSFL 4MXWH 4N8VG 4E5XB 5A2IH 2VOTA 3BP7A 4K55A 5CD5D 4IDLA 5GGSY 4FFVD 1NLDH 5ITFA 5GS0D 1I7RA 1TJIH 4TUJA 3P4LA 4LDEB 1BJMA 3V79C 4ORGB 1AHWA 2H2PC 4HMEA 3OV6A 2YUVA 4MA8L 3RVVC 4JFEA 1UXSB 1CFNB 1WEJL 1HQ4A 2QLVB 4XPHH 4HWBA 5DJXB 5KVDH 1P5VA 3WFHB 5B8CA 3HB3C 5IKCA 1KCVL 3BN9D 5F6HI 2X1OA 3HAEG 1UH2A 4ALAH 3CLFL 1ZWIA 1YQVH 3C8DA 4APQA 5GZND 4B50A 1VFBB 1DFBL 3DUHA 4WV1C 4P9ML 4MXWL 2UWEA 4ISVA 4KI5E 4PJ7B 1A5FH 3L3GA 4FNLL 2F19L 1N3NB 1D9KA 1TJIL 3BRGC 4HT1L 1JZ2A 1VDGA 5DA0B 2CGRL 1RU9L 5EO9A 3HZMA 3WJLA 1U3JA 3QH3B 3NZ8A 1DDHA 5ESVA 4D3CL 5DYOA 4I3RH 1RZ7L 4JY6A 2QQNH 5HBBA 1BREA 1GGYA 1B0GA 1QFOA 2EC9T 2YMXH 1C16A 1CR9L 3TF7C 4YDKH 5DRNB 3HCVA 4KQ3H 1IM9D 5MEPB 5IBTH 2CDFB 1XIWD 2ZKHL 4ZODA 1RQ5A 4ODXB 4QKXB 3WNPA 3PWNA 3AS3A 1BVZA 2DIBA 1MF2H 4ZDHA 2VC2H 2A77L 3D0LB 3ZKND 1A5FL 4KDWA 1W2KT 3QCVL 4ZFOL 2BVPB 1KN4L 2B0SH 4XMKH 3UYPA 1FNEA 2YD8A 4ZXBA 4RMSA 5JMRA 4XNMA 4TQEH 1MFBH 2NYYD 5MENB 4NKIL 1AY1L 3VH8A 5D1ZC 2QQNL 3GDBA 4K8RH 3R4DA 2Q8BL 1F4YH 4KQ3L 2PKDA 3WFCL 4XNXL 3T3ME 3P77B 5IBTL 4X7TA 3IGAB 3P73B 5FM8A 3HNVH 3IDIB 5D5ME 4K8RC 3KNBB 1MF2L 5EOQL 5EU4A 1AO7A 5ACZB 3BGFC 1BD2B 1JPSL 1RPQA 1BM3H 5I1GH 2NXYB 1FO0L 1H3WM 5CIPB 4JKPL 2NY0D 4AENA 2MQ3A 3ULVH 3O2VL 4M5ZH 3RY5A 2DM7A 1M71A 3JWOL 4WRLA 1WZKA 5EBMB 2QL1A 3VGFA 1I7ZB 2YXMA 4KI5D 1ERNA 3KYMA 1F4YL 1HHKB 3EYUH 2Q87A 1EAPA 4RAUA 5JHLH 3HAEH 4HKXA 1W8NA 3ULVC 5EOCH 1Z9OA 2BJMH 3RX8A 1C5CH 2DTMH 2F74B 3HNVL 5FF6B 2I27N 2J5LB 3C9NA 5D7LE 5EU6A 3KPRE 4LLUA 4CL7A 4Z6AT 4OSUL 4CADB 4X6FB 2DQUL 5D7IB 5F9DC 4O2FA 2F53B 5F1NA 4Y19E 2H8PB 4FQ2L 1W0WB 3BMWA 3C5ZA 1F6AB 2ADFH 1IQDB 4L4TD 3H8NA 4U6YB 1IFHH 4MCZA 4MJ4A 3ZKSD 1P84K 1JZ4A 3QEHB 4AL8L 5CJOL 5E6YA 3P3YA 4R90H 4ZUSA 4ZFFB 1T4KB 3QEQE 4OLWH 5JHLL 3CFKB 1HQRA 1JGEA 1T1YA 3GBNL 1S9XA 2VLLA 2NTSP 1K8DA 1C5CL 1VENA 3MA7B 2IALA 3N1MC 5BZDA 4OF8A 3ZHKA 1TVBB 1U42A 4P23B 4YAQA 1S9YB 3TBYB 2NMSA 5TDPA 2XQBH 3CMOL 3MBXH 4PY7B 3C08H 4MXQD 4OD2A 4P46D 3RL1A 1IFHL 1RUPL 1JWSB 2EDFA 4BQBA 2VDQL 2IBGA 1MLCB 4U1SB 4X7SH 4I77L 1WQVT 1RURH 3KWWA 5DK0B 3TV3L 1FFNA 1LMKA 2FD6H 2H2SC 2DYPA 4BA8A 1P7QA 4EJ1C 2JB6A 3FT3B 4HK0B 3MLXL 5E7BA 4MNGA 2ERJB 2HVKB 3WFDH 5FUCE 3D39A 3UJTH 1MJJB 2C1OB 1QQDB 5CEZE 1KPRA 2OS7A 1G9MH 4IRJA 3MRJB 4GRLB 5I6XB 2W0FA 1VGKB 2WINA 2Q6WB 2AI0H 4OKVB 3BAEH 3U6RB 1TJHL 1MCQA 3RZCA 4GMSL 1OTUC 5JNYA 2XQBL 4PJDE 4MA1B 1CICD 4U1MA 3LQZA 3S37X 1G9MC 3BPLB 4JVWA 4PGEA 2Y07H 1OP3K 2O5YH 1EDQA 5D7LD 4X7SL 3JWDH 1RURL 1VFAB 3P0VL 5F3HA 3GUTB 1AJ7H 5I76B 2AGJH 2FD6L 4IRSA 2NLJB 4KDVA 1NQBA 3MLWH 1N7MH 2A38A 5GSVB 3DHJA 2NY2C 3JWDC 1QVOA 5T3ZH 4DJMA 3EO1B 1UVQB 4OZGA 4PJAA 5I1DA 2GJ6B 3R1GH 5HGAB 1C12A 2YS4A 5L88H 4M62H 4X0KA 3L5WA 3V6ZA 1VB9A 3QDJE 5IB4A 4CMHC 4LDLB 1BWMA 3QWOA 1B9ZA 4P59H 1LNUB 3IVKB 3QT2A 5C0NC 3D48R 3LY6A 2J3SA 2J6EA 4AYFA 5C0DB 1MOEA 3JWDL 4HX1B 4KQ4H 1F2XK 4KTDH 1AJ7L 1RVFH 2IH1B 3PP3H 3RDTA 1U8IA 1B6DA 4W4NA 2VYRE 4PLKD 5BZWB 4XXCC 3MUJA 1LE5B 4OGAD 2RFXB 5C0AB 4R9HA 3SY0A 5IMLA 1KCSH 2G5BA 3N1PC 4TVPE 1BAFH 3A6BH 1UXWB 3B9KA 1HNGA 1ZSDB 4MQ7A 3R1GL 2AV7A 3S35X 3UX9B 2WWMD 1EIBA 1I3VA 1UFUA 5IROA 1U8KA 4EN3A 4J1UB 4QXUH 7CGTA 4CN4A 3F5WB 3OPZH 2HLAA 1NGYB 5EULV 5J57B 4TNWF 1QYGH 4CU6A 3KPQB 4HS6A 2ESVE 2NY6C 4UV4L 4J12A 2BP3A 5CEZD 4F58H 1SEBA 4GSDL 1NAMA 1D6VL 3RPIB 1HI6A 1MCFA 5HYJB 3DMMB 2MMXA 3O4LB 4HIXL 3QH3A 2JCCA 3ZE1E 2KBGA 3FQXA 5HVWA 1INQA 4XMPH 3EJJX 1I9IL 5C07A 4OLXH 2BDNL 4XNYH 1V5JA 4J3XA 5HPMA 1FZKB 2IQ9H 4FQHA 2OZ4L 1J1XH 2YD1A 1MJ8H 2OL3B 2XWJB 3U36A 1F4XL 3A6BL 3JTTB 2R1XB 4XXDB 3ARYA 4PTTA 2CDFA 4ODSL 4HCRL 3S88H 3K3QA 4YQXH 1MCHA 5TQ0L 1FO0B 2JJVA 5DVKA 2YK1L 4OT1L 3K0WA 2DQDL 1RUQH 3QUMB 3CU1A 4E41B 1QHPA 5I8OH 2I9LB 3D0LA 3Q1SH 4Q6IA 2IBZY 3VGGA 3VGEA 5L8KB 4F58L 5C0CA 2I9TB 1L6XA 3WKML 1E27B 1YDPB 1KGCE 1OW0C 5SX5K 3VI3E 4JFXB 4W4OC 2PW1B 5CGYC 3DXAE 4FZEH 3OR6B 4XNYL 1CDJA 2AXGA 3GSWB 3STLB 5IMKA 2PYFB 3M1BB 3EDFA 3HG1B 4L4JA 3RBGA 4PTUA 4P2OB 2X1WL 4Z7UE 2LAAA 3LIZH 4OUOA 5C1MB 3KPLA 4QCIB 1DQQB 3MRBA 4L8SC 1BD2A 3EFDH 3Q1SL 1IEBB 3DVNA 3OKKB 5CIPA 5JW4N 2NX5A 4WU7B 3M8OH 1CE6B 3GI9L 3D3VE 3QISA 4OV6F 3IAPA 3SCMC 1RHHA 2EC9U 3T0BA 2DQFB 5F7YC 5F88A 5D1QC 4LBEB 2OXGA 2R8SL 1JGDA 3EZJB 5KG9A 2XQYG 2XTJE 3RAJH 4G8GA 3AAZB 4HWEH 3KPNA 3O6LH 1IEAB 1O5DT 1VACB 1R3IH 1ZHBB 3EJYD 2PETA 4KJYA 1QBAA 4U0QB 3TBWB 1U8PB 3ILQC 4EXPX 1KXQE 4G8FB 4MAYD 3QXAB 3EFDL 5SWZE 4O5LH 3QUZC 3VXRE 3EOAB 5FO8B 2B5IB 3H3PL 4OZFA 4M93C 3DX8A 2Y23A 3GEWB 5D9SB 4XRCA 1M7IB 3IDNA 5DVLA 3MRHA 5HHPA 2BMKA 4R6UA 3A6CH 1SJVA 4KPHL 4JFYA 4M48H 2G75A 1K9TA 4NO0B 4HZLA 5LWYL 4OQTA 5DJAB 3SGKC 1XGQB 1UZ8B 4HUWA 5I1KH 3T8XB 5KTEH 1KIPA 1RSFA 1NDGA 4S1QL 1R3IL 3I6LE 1MCOH 2CO7B 3K8MA 5MI0C 1FLRH 3HE7D 1NMAH 5GZOC 4TRPL 2DQIH 1FV1B 1A02N 4LSQL 1U3HB 4PS4H 3UTTA 5F89B 2EIZA 3HC4H 1LD9A 5HDLA 3PQYB 4O02H 4P23A 4XH2B 4NSKA 1PYWA 1QLRB 3UPRB 2XZCH 5D1XB 3QHZH 1AXIB 1K2DB 4ACPA 4I48A 3D9AL 4U31A 1MIML 2LU7A 5FUCC 4UZGA 4X5XA 4K7PH 4L8BA 2VABA 3QZWB 1BOGB 3MLRL 5CJXA 5DK0A 4F80A 4DVRL 2BX5A 4HUXB 4NQXA 5HHOD 4FFZH 1I8MA 3ARDA 2GQHA 1SVCP 3RTQB 3IJHA 1T1ZA 1DZBA 2VITA 4MWFB 5L7XL 1ZEAL 1UB6B 3VFRB 1VGEL 2R15A 4BK4A 4PS4L 1E6JL 1SBSH 3LKOB 4J4PA 2WAHA 5D96C 3WLBA 2CIKB 4UU9A 3U0WL 2VE6B 4RAHA 5HVGB 3TWCH 3WLWD 4Q9QH 2XZCL 5B39A 1QP1A 2IPUK 3L3OB 4YXKH 4H25A 2ADGB 2OCFD 2P5EA 1BQHA 2APXA 3EOBA 3V5KB 1FDLH 4JM2D 4WI8A 5IWLA 4N68A 1A6WL 1BP3B 4Y4KA 3CX5J 3EO0B 1ZT7A 1JYNA 5K9KA 3BGAA 1OSZB 2QV2A 3GMLA 3ARFA 2IAMA 3T0EB 4XP5H 5F71A 4HKZB 4U1IA 2RQ8A 3G6DH 1UT9A 3GSNB 3IRZA 3N1FC 5GSVA 1C1EL 2GFBB 1VEMA 1YA5A 4RGMC 3LHPH 3VXSE 3REVB 3TIEB 1OL0A 3LN5B 4G8IA 5KSAA 5HDBE 3FO2A 4TVPH 4FQJL 4U1LB 3QA3B 5T1LA 1YNLL 3FN9A 5DGRA 3U79A 1G6RA 2QTEA 3VMPA 5D8JL 2QKIA 3KPMB 5LKNA 1LK3L 3NCYP 1MRCH 1ZOXA 4HMCA 5I17B 3HC3L 3ARGB 2R0ZH 2NW3B 5KANI 2X4TA 1T0MB 5FXCH 2GAZB 1T66D 3W9DB 3O11A 1BBJA 5GRUH 3SJVA 5T3XE 3PE9A 2AJSH 2MCPH 3FAXA 2K1MA 3IFNL 3OZ9H 4AM0A 2HG5A 3D85A 1R3JB 3QR2A 3FO9A 2AJVL 3IJSB 2ZUXA 4GAGH 2UYLA 4HKBB 5EZIH 3C6LB 4FTVB 4GRWE 3SOBH 1NFDB 4ONGH 2F54E 2OTWA 5CD3B 1NGYA 1S78D 4O2EA 1RJLB 2I24N 3AFLA 3NCBB 3VXMD 2FJFB 4LRIC 4QT5A 5J12B 2FX9H 4CDHA 4ELMA 2QADD 8FABA 1HOCB 3U4BL 3BZEB 1G0XA 1NSNL 4AQOA 3LS5H 1DEEA 4KAQL 4MJ5B 1MFEL 3WE6A 3VXUD 2C4FT 4PJCE 4HDIA 1OGAB 1S5HB 3OZ9L 2XIDA 4LSSL 5DFVD 1NBYB 3DYOA 1MCLA 4PJXF 4UQ3B 1PEZA 3LQMA 3TT1H 4XXDA 4GLRI 1CDHA 4NNYA 3O9WB 4P2QD 4X9IA 3OAZK 1TJGL 5EZIL 3BD4A 2F58H 4ONGL 3CPLA 5B3JE 3IDGB 3NIFF 1K4CB 3V4UH 3PF2A 2HT4C 3TVMC 5L8LB 4LVOC 2FX9L 5JPNB 2I9TA 3VXSD 4YBQD 4PGBA 2AQ1A 1H0DA 25C8H 1MCBA 1YMHB 3HNSL 3MRRB 1ZLUK 5IM7A 1BQLL 1FH5H 1JGLL 5FO9B 5DUML 2AXHA 1N4XH 3PWLA 4PJFE 1X6LA 5C08A 5ABDE 3ROLA 2NY4B 5FHAH 4OF6A 1DUYB 3GSRA 1AFVH 2ZJSH 4GKSA 2VXUH 4HIHB 3TT1L 3LD8B 3OAYK 3GI8L 4XHJC 1MNUH 2E5EA 3AM8A 5T3XD 3HNTL 1DN2A 2ICEB 1JZ3A 1RD6A 3VFGH 1SBBA 1IEBA 1NLBH 1EO5A 5JXEC 4S1DD 2E27H 1CE6A 4ZYKB 1A1NB 2XTJC 5GGRA 5LGHH 3ARED 4GAYB 3BKYH 4XC1H 3F12B 5FGBA 4Z7OF 1G0YR 4UNTA 4P2RE 3OTTA 5EOTA 3MLSH 1WAAF 5INCB 1ZGLM 1PKQA 2F54D 1P4IL 5FHAL 3CSGA 1AFVL 1J86A 2YC1B 3DX9A 5FGRA 1YUHB 3LN4B 3T77B 5DMYA 4MX7B 1PQZB 5DD0L 1IC4H 2MOVA 1PSKL 2VXSH 2EO9A 5IIEB 1YEGL 5E5RB 4YHYB 2P24A 4PRPD 1MQ8A 1LE9B 3S37L 1FZMB 4OZIF 5DDHB 5FYKH 2FJGB 4B5EA 2FIKA 2A1WL 5SWQB 4JY5L 1WCBB 3PV6A 5FOBA 2B1AL 4I5BA 5DLMH 4G80B 4X4ME 5JO5A 3O6ML 5D9SA 4JFZH 2HT3C 3H7LA 3OKYA 1GIGL 1AKJA 4GW1B 4M00A 4F9PA 3UC0L 4JQXC 3DJ9A 3OJVC 4G6AD 4JRXA 3QXDB 5F7UA 1IC4L 4OI9A 2A9MH 1BVLB 1B0WA 3G9AB 5EORH 5ESAA 2WQ8A 1BF8A 4LLVA 5C0BE 5F7DB 1MHEB 5F89A 4C57C 2CLRB 4LARL 3DETC 3L5XL 4P4KA 4MS8D 5T1KA 3H9SB 3BN3B 3SDCC 2EDRA 1JGVL 2ZPKL 4NO2B 4FQLL 4BFIB 3MRNA 4UIKH 2VDKH 4LSTL 4JFZL 3NCEB 3PABA 3TN0A 4GKZB 1J0HA 3ZT6A 3PXJA 3MO1A 2CKNA 5I73C 4HUXA 4NN6C 4N0CD 4L1DA 2EYTA 2JJTC 3S35L 3QEGL 3KPSA 4N9GB 1WBXA 2ZSVB 3BWUC 5AWNH 1VESA 1OP3H 3UJJH 4PP2A 1A4KB 2IPKB 4ELKA 3IKKA 5LGJB 5E2VH 1CD1A 1BFTA 3VG9B 2CIIB 1CLYH 3ARBA 1DLFL 1KCLA 1K4DB 1SYSA 3MLZL 3L3OA 1F6LL 1TVHA 4X6CF 4JFEE 4FFWD 5ICZB 2NNAB 3QO0B 1LWRA 2BY3A 5FYLL 3RWDA 2P5WB 4XVSL 1IGYB 4J3WA 1FHGA 3O0RL 1IILE 1RUKL 1KIQB 2AEIT 3W81A 4PJXB 3WEXA 3GSXB 4FQXC 4QYOA 1T03L 2VUOA 3E3QE 4JO4L 3DX6A 3Q6FB 3TFKD 3MODH 3UJJL 4PYGA 1QNZH 5HGHB 3WFEH 4N8PA 1RUML 5HGBB 5MP6H 2UWEE 5JDSA 2YKLL 1WBYB 2PO6B 2MQ0A 2O5XH 3UTZB 2DLEA 4X5WA 4AG4H 3VG0H 1G7LA 2XA3A 4MJ6A 3KXFE 2EDTA 3NFSL 1ITCA 1YYMH 1GGBL 5IEKA 1DBJH 4L4VA 1JNLH 3P4MB 4A2LA 4WJ5A 4GRWH 4EI5B 3FCTB 2ARWA 4N5EC 2BNRE 5IESH 1KTDA 3X12A 5C0BD 4YHMH 4MMZC 2VWEE 3CFEA 2PR4H 2Q8AL 1JPGB 5AUMA 5TE4H 3SKMA 1XGTB 3TYGL 4MVBD 2FL5B 2VZ3A 2AJYH 1WC7B 4YNYA 5E1HB 1G0DA 2YSSB 1D6EA 5EB9A 3PGFH 1A3RL 4AG4L 4CRPA 1A6UH 3ZDXF 1Q94A 4CJ0A 4GBXC 3CLEL 1F11A 5ICYA 1QACA 1DBJL 1BBDH 1PG7H 5CBAB 4PLJC 1KB5L 3RX5A 2ITDB 2NZIA 2YBRB 4XVJH 2QR0B 2Y06H 5C0FB 5SWSB 1LGVA 4PGDA 3S98A 5C7XH 2BOCA 3QUXA 2LQRA 3L3JA 1PDKA 5LQBH 4HEPG 4QTHA 4X83A 3QJFA 1FC1A 5TE4L 1NCWH 5E8PA 1XGYH 1MCPH 1UM4L 3BKCH 5BO1H 5JW4R 3VD4A 1Z5LA 4CNIB 5HPOA 2EE6A 4XB8A 4JFED 5KSVB 2K7QA 1FL3B 3DBXB 4PB9L 1AO7E 5DJ8B 5SX5H 1S3KH 1ND0B 3V7AE 3BEWA 1A6UL 2XWBB 1KLUB 1RZ8B 5C9JA 2D03L 1PG7L 4HC1L 4NOFA 4MSWB 2Y06L 2RJMA 4LP4A 5CJ8A 1IGJB 4F8TA 1JVKA 3N9GL 5HVFB 3EIFA 4MAUL 3BVNB 4QRPE 5CZXC 5FKAB 5I2IA 4WO4B 4JE4B 5LQBL 4K71B 5C0RL 1D9KD 1R24B 3BX7C 3IRPX 1K5NB 1NCWL 3IU3B 1DQLL 3AROA 1SY6H 1QKZH 1KT2B 4U1KA 2H6PB 1NGQH 5KANG 4D2NA 2A73B 5EU6E 3UBXB 2JELH 2IPUG 2ZUQB 1QFUH 1FAKT 5I9QC 1CT8A 2F5AL 1BMGA 1YN6B 4NOBA 1KENH 3PL6A 4LCUB 4PRIE 3ARWA 1YEIL 3MV9A 3DECA 2AERT 1FL5B 2RBLA 3BD3A 4FQ1H 5I15L 1JIBA 5I0ZA 5TDOB 3DUSA 4U6HB 2BVYA 5J3HD 4YZFE 35C8H 5ALBH 4CVXA 2C4FU 1UJTA 4JDVB 2HWZH 2JE8A 3BKMH 3FN3A 5H94B 5ITBH 1FFOA 3O2WL 3GFUA 4Z5RB 4DCQB 4ZXBD 1QKZL 3IDUA 3NTCL 1KYOJ 2V2WB 1ES0A 5CCKH 1CG9B 4D9RD 3MUY1 3WN5C 1UWEL 3QFJE 2JELL 1KEGL 1ACYL 1OAKL 3HS0A 4QOKA 1FZJA 1RIVH 5DJ6A 3D0VB 5EUKA 3QXUA 5DSCA 4F7TB 5HI5C 3SGDH 4PR5A 5C0GB 1VERA 2GTZA 3X3GH 1E4KC 4X6CB 4HUNB 3V0WL 3GMPA 3NCYS 1QRND 5L6YH 1NCCH 1WCBA 3J8F7 2J8UA 2VXTH 2HWZL 4HAGA 4S1SL 2OSLB 4U6TA 5ITBL 5HI3D 1M7DB 1U3YA 2DM4A 4OGXH 4TSBH 4MNGE 1B4JL 2CJUL 3D39E 4D9QE 4ODWA 4DUVA 3IFLL 2H32B 5IBLC 1LEIA 1UJ3B 3BQUC 4LLAA 3FB6A 1GGTA 4NBZB 1N0XH 3GO1H 1MCEA 2XY2A 3V6OC 3QQ9C 4TSCH 1V05A 1IAOB 3ZKMD 4OCSH 3C5SB 5INDA 2VDPL 2BHZA 2BXZA 3E6HB 1UQSA 5T5FH 1NCTA 5EU6D 3H9SA 5ANME 4NZDA 4W6WB 5FOJA 5CEYA 4WEMB 2GK2A 3RU8H 4KUZH 3V7AG 4HS8H 3TM6A 2X05A 3WNLA 4Y5VC 1GZQB 2Y7QA 2C4XA 5GSRB 5F9JB 32C2B 3C5ZD 4ZUWB 1JHTA 2ITCB 3D2UB 1S9VB 4BSVA 3AY4A 3FB5B 3DURB 3MJ8A 3ZTJG 1SM3L 4V1DD 2GSIA 4POZC 4OZGE 1P1ZA 4PJAE 4J6RH 4KVNH 2XKUA 4JDTH 1Q9WA 5EC1A 3CFJA 3L6FB 2AW2A 3V4PL 4KRPD 3LKRB 1MI5B 3FONA 4OCSL 1KJ2H 5EBLB 2D31B