1I8KB

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVASISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGYSSTSYAMDYWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kB00
3KXFB 4UU9B 3ARDB 3KYOA 4ODHH 4LLQA 1RIVH 2UV3A 1CDIA 5KSVB 1OTSC 5CP3A 4B7IA 1PKQB 4ENED 1DBML 1JRHL 4OAWA 4CADA 1S7UB 1QFWM 4WNQA 2JJSC 4QHLA 5DRWB 2C3WA 4OGYH 4ZO8A 5MI0B 1A0QL 2X4QB 1HXMA 4HIHB 5C0JB 3S37X 4G8GB 1Q9LA 4JZJB 5EBLA 4JVWA 1M1SA 1IC5L 4L9LC 1KELH 2V7NA 5JPMA 1ORQA 4P0DA 5E2TL 4GRWB 1FYHB 4JY6A 1KPRB 4ZS6C 5KVDL 4XPHH 4JKMA 2R1YA 2F5BH 4EQ3A 3O6FB 4OZGE 5EORL 1D9KD 2DQTH 3SBWA 1HNGA 2IAMD 1DQLL 5IB1A 2BVUA 1FORH 4YDLB 1FBIH 4JRYD 1QSEA 1CDBA 1IC1A 3WFEL 3QUZB 3EYFB 4I0KA 4ODBD 3P4OB 5CZVH 4X5WA 4P57B 5K59E 3FQTA 4OFDA 3T1WA 3WKML 4QEGA 5I8OH 3QNZB 3PDOB 4WWID 3VXRE 4L4TE 4WHYH 3GRWH 5E4IA 1FSKC 3ULUE 1J0ZA 1Z0NA 2DD8H 4G6AC 5IG7B 4JY4B 3LEYL 3PWUB 1RAMA 1GCFA 4QTIL 4Z6AT 1RSFA 3ZYZA 1BQLL 4WUKL 4NC0B 3PL6C 3PP4H 2KBGA 4KAQL 3X3FL 2F74A 3HPJA 3B5GA 3HZVA 4Y1AA 1JHTA 1QA9B 3MLPA 4PJIE 4WW2F 1YMMD 5DJ6A 5B38A 2JCCE 2H6PB 3K2UL 4JN1H 5F72S 1C7SA 1Q1JH 5EA0L 4XPTL 3L95B 2APTA 3BMVA 4W70A 2NY4C 3ZE0E 2XKNB 4FQXB 4R7NA 4L4VA 1E4JA 4DKFH 3S35L 4QOKB 2NNAA 5D2NA 5I18H 3IJYA 1FZMB 2ZPKH 3TH4T 3RWDA 5FYLD 4BSVA 4QNPF 2VZUA 1RFDH 3SE9H 4GLRI 2NXYC 3FT3A 3WNMA 1BBDH 2FJGB 3FB7B 2PYFA 3QEQE 4I18C 1C5BL 2FHFA 4Y16C 2I5YH 1JGDB 2R0ZL 5J6GA 1H8NA 2DWDA 2F15A 3C5JB 1DBKL 1KCRH 1EAPB 1BWMA 5IWLC 1XGUA 1PZ5A 1RZ8A 4LARL 4PGBB 5T3ZH 3VFVB 5L9DL 2J8UB 1I7ZA 4JM2B 4HX1A 1PDKA 1P4LA 2OL3L 4NNXA 3OQ3B 1JGVH 4GW1B 4E42A 3W0WA 3X14A 1MY5A 1EO5A 1FNHA 4JDVB 5INDB 4N8VG 2IADB 1YQVH 3ZKXB 2JJWA 3ORJA 4PGEA 2FEDD 3T0DA 1R5VA 2DI7A 4G8GE 4G8EA 9CGTA 2EICA 3KG5A 3Q5YA 3QULA 1B2WL 1MAJA 4CL7A 4K7FB 3AY4A 4RAHA 3MXVL 5I74B 2H2SC 5AZEH 4F7PB 1ZV5A 3V0VA 5GISL 1VENA 4HWZA 2AEQH 4PJ7A 3LZFL 3O4LE 2X4OA 4Q6IB 1F4WL 3X11B 3HE6D 5IT2L 3S97C 3LQMA 3N06B 4LAQL 1IM9A 1ZHNA 2IH3A 5T3XD 3T3MF 2KQMA 2C4XA 5FKAA 1IM3A 4IIQA 4YHNA 1H3XA 3V0WH 3KWWB 2VABB 5D93B 5BQ7A 2KDGA 2VXSL 2OL3A 1GH7A 2ATKA 1DUZB 1OCWH 4OM1L 3IF1A 3PQYD 2F8VA 3LQAL 3G5VB 5ILTH 4KI5C 3MRDA 5IB3A 2A9NL 3WIHH 3ZTNL 5ID0A 4NSKB 1TVBB 2QV2A 4HUVB 5JOEA 1N59B 5GS2D 2Z91A 3KPRB 4KHTL 2YPKA 5JXEC 1TCRB 5ISZB 3I84A 5H37H 4XMLH 3VGFA 3MRIA 1L0QA 1VFAA 3DV6B 4NWTH 5I17B 5I6XC 4M61B 4XWGH 4Y4KB 2HLFD 5ESAB 1FIGL 1UADC 1U93B 1X9QA 2GJJA 4LLWB 5J1AA 4PJDB 5F7YC 4CMHC 1HILB 2G5RA 3VFRB 1JUFB 1FE8H 4ZNCD 2FATL 5ITFA 4DZBA 3OG4B 1OF2A 1HHGB 4NKIH 1PAMA 2VQTA 4K2UL 5K9OB 4G8FA 4CVXB 4ZPVA 2Q8BL 3NIDE 1P7QB 1YN6B 2BNQB 1KJVA 4QRSB 4Z7NF 1CDGA 3WLBA 3QIWD 5I71C 5C7XH 2G5BB 1MNUL 3QUXA 3E6FB 2H32A 4Z8FH 4KK8C 5IJKA 5I1DA 4MNGA 4OLXL 4PJ8A 1Q94B 2F54A 1R5WB 2BSRA 1KUMA 2R69L 4U1MB 1K6QL 4JO3L 4Y2DA 3KYNA 3U36B 2AJVH 4P5TB 1WAAA 2X70B 4M48H 4XRCB 4YDKL 3VFMA 4OCWH 3MRHA 3QPQC 2OXHA 3BPCB 4LASL 2BNRD 1FJ1B 5HPMA 1X5GA 3ROOA 4EJ1C 4FFWD 1HQ4B 1CGUA 4KKNA 3VA2C 4WWKB 1K9TA 2H32H 3VRIB 5E8DH 4M9OA 1RMFL 3M8OH 3GNML 4OGXH 3MV7E 3EGSA 5I8KH 1N5YH 3QDHA 1U8KB 3I3EA 4K8RH 2DTSA 5GRWA 4L3EE 4JHAH 3WHE1 1N4XH 4PJGF 3ULSB 1YEFH 1OWWA 1WZ1H 1I4FB 1QFWL 3BYTA 4U1GB 5IVZB 3S96A 1BFVH 1RULH 3RI5F 4HIXH 4UDTB 4CVUA 3QJFA 4KMTL 5SWQB 3QWQB 2HJKA 4KTDH 5J1SC 5DMJB 4QRTB 4JAMB 3TIDA 3GSWA 3NFNB 1X5FA 5DQDH 3OAUL 3B9DA 1A1OB 3V79C 4TNWF 4PJHB 1U92A 4PJEA 4EI5B 1I7UB 1LVEA 3HZMA 5FDYA 1CICC 1WK0A 1AP2A 4GXUM 1W0YT 2VZ3A 3LMJH 4NQSA 4U6YA 4UU9A 3NCBB 3WIHA 2R0WH 1AHWC 1EFQA 1L7IL 3B3IA 5E1AA 5KS9E 5EFIB 4NO0B 3RVVC 2R4RH 1VACB 1B90A 1YEHL 3ARYA 4NFDA 4NOFA 1KEGH 1KG0B 4J6RH 4XVSH 4NGHH 3HPLA 1W72L 4LEOA 3C6LC 4CW1A 3BXNB 1QR1B 1AFVH 1GZPA 1Z5LA 2ITDB 3X13B 3JWDC 2MFNA 4XVTL 2ZOKA 4HKBB 4M7JH 1FGNH 3BN3B 1ZHBA 2E9JA 4UOW0 1RIUH 3BPNC 3L7FA 5GJSL 3ZLQC 4Q9QH 4MSWB 5BMFL 3OGCB 1NL0H 1W0WB 3SDYH 3RHWK 3LRGA 3VMOA 2UWEA 2ADJA 4RMWA 3TV3L 3BZ4B 4X8XA 4O2FA 4YC2C 1ZE3C 3VFUB 3AS3A 4LHUD 3PNWA 2EDJA 4LVHB 5F93C 3L5IA 4OD2A 5DD6A 4F7EB 1AXTL 1KIPA 1LO5B 4D2NA 4J4PC 4JRXD 1T3FA 1TITA 3ZKQD 4XAKE 43CAA 1EHLH 2FR4A 3HZKA 1YA5A 2QLVB 3T8XB 4KK5C 2EYSA 4H88L 4Y2OA 4Q97A 1JF1A 5D70L 1DQML 4NNYA 4GFTB 1OARH 2IPUG 2CJUH 2BVOB 1M4KA 4Y1AD 2ORBL 2ZNWA 5DRZA 4YJZL 2ED7A 2VAJA 1RUKL 2X4SA 3B9KB 3LV3A 4J3UA 3TNNA 2LVCA 5JLZB 4PJ9D 5A2KH 1S7SA 3IFPB 1HKLH 3NCJH 4J7RA 4X99A 2AABL 3DURA 1P84K 3CZJA 3O3EB 3FKUS 2FWOA 4TUKL 2HTLD 2O5XH 2A83A 1TLKA 4IOSD 2VITB 2AJYH 3TH3T 3DX7B 5ESVA 4HUXB 5CBEA 1IAII 4P2QA 4LIQE 1OGAD 2ADGA 5DJ8A 2OM5A 3HZYB 4TRPL 5DMKB 1R3HA 4Y16A 1V7NH 3WIIL 4G7VL 5F21B 2HLFC 4S1QL 1H5BB 3EOTH 3UTZB 8CGTA 5DJ0A 3VXTB 5EIIB 4RA0C 4TSAL 1JJUA 1VADA 1OD7A 3MV8D 3QQNA 3RWDB 1H0DA 1I9JH 1ODAA 4Y89A 3IETB 1JNHB 1ONQA 3FT3B 3HMXA 4YNYB 3VWKB 4MA1C 1U95B 3PABA 4QY8A 3U7WH 3JXAA 2BY1A 1HSBA 5HHNA 3OF6A 3QAZB 3I2CL 2DIBA 5DXWA 2R23A 4YZFE 4YHLH 4HKXB 1RY7B 1CE1H 2ICWI 1HINL 1F4XH 3CMOH 4D0BB 3VG0L 3L3HB 5HGBA 1G7HB 3ESUF 2ADFH 4CBPA 4YPGB 3CH1B 1QD0A 4PB0L 3DSNA 1BQHB 4DKEH 1NBVH 4PJ7E 2EDFA 3IB4A 4FQQA 5DVLA 4PTTA 3PWVB 3MLWL 2G9HA 4UB0L 1KB5L 1YEKL 4TUOB 1MI5E 2Z9TA 1YC8A 2NXYD 2MPAH 3QISA 5ADPH 4CGTA 4EN3A 5F44A 2DYPB 4ZXBD 3FAXA 3QBTB 1R6VA 3WNOA 1S9VB 3HE6A 1PG7L 4GQ9H 3QCUL 4XNMB 3O4LB 3LOWA 4GAGH 1ORSB 3JBG7 2BRRL 3BIBX 5FM8A 2IGFH 4O02H 5DQ9A 3T77B 1IL1A 3TJHD 4HPYH 2AV1B 2O5ZH 2VC2L 5MEQB 4HWZB 3ILPB 3NGBC 1C1EH 1EZVX 1GZQB 4R4FH 1L0YA 1EMTL 1QQDA 3RVVD 1C5CH 4UAOC 5KSBA 3WN5A 3VGEA 3SDXB 1QSZA 3PQYA 2QQKL 4LCIL 1IC7L 2YZ8A 1GGIL 2OTPA 4HJGA 3AMLA 4K3DH 1NBZA 5E5MB 4PBXA 3PHQB 4L3CB 4XTRD 2BDNH 4NPYB 2EIZB 4GAJH 1DQQA 4HPOL 3LQZB 3VGHA 4G5ZL 4KROD 3FZUD 1QKZL 4MWFB 5FGBA 3EFFA 3DV4B 1NEZA 1NGZA 2ATKB 1DUZA 2VZOA 4YHYC 2V17H 1G9EA 3HRZA 3PP3H 3VI3F 1QBBA 1WWWX 4XXCA 3BWAB 4NN7C 1E4KC 4KUZH 4WJ5B 3H9SD 1INDL 3ULVH 2QL1A 4JR9L 4Y88A 1FV1A 4WFED 3ESVF 5SWZA 3QUKA 2I07A 5AAMA 4HFWB 3Q6GH 3PE9A 3CMGA 3O11A 1KBGH 2GSGA 1HQRA 1J1OH 5KVFL 3A6BL 2OJEB 2A0LC 2CKBH 4WO4C 4RISL 4OGAD 1AIFB 3MNZA 4DW2L 1LO2L 5J06A 4JO4L 1QSEB 3VDAA 4HIEA 5H35B 3CXDH 1HYSD 3MROB 5I0DA 2VLJD 3VFRA 5FUOH 1CGVA 2JCCB 2AK4D 4OLWL 3CVIL 4YHKL 4MJ2A 3VFTB 1IILE 4CNIA 3WO4C 4G6JH 2D7OA 3T0VA 4Z5RB 1I8IB 3D3VE 3PHOB 1WBZA 4LPVA 3C6LD 4DGVL 4R7DB 4N5EC 1MCWW 5MHSD 1GC1L 2EIEA 1JWMA 1NC4A 4U6HB 2AJZB 1J8HD 2D7MA 4ISVB 5MI0C 2HFTA 1MFCH 3V5HA 5FIEA 3CK0L 4MQXC 3RNQB 5HYEA 3CSPA 4FHBD 3WFDH 4J3VA 5HDBE 2P24B 2JTDA 2XV6B 5DJ2A 5EZOH 1U2HA 15C8H 3X17A 1OTSD 1UYWH 3V6ZB 1MRCL 3ARRA 4P3CL 2XWJB 3GBML 1MJ8H 3G04B 1VSCA 4WTZG 4Y1AB 3BPCA 1JHTB 3EYQD 3IXAA 3WUZA 5HPMB 4O2CA 2OYPA 3HNVL 5DJ6B 4NM8H 2GT9A 1T22B 3QI9C 1YMME 4S2SA 1C08B 4WWKA 4R8WL 3QEHA 4XXDA 4WRLA 2AEIT 5ACZA 5FYLH 4S11A 3L3DA 2HTLC 1SQ2N 3MOAH 4WUUE 4I13B 2OTUA 5GPRA 1QVOA 5D71L 2A6IB 4XCFH 5IHUL 5JIPA 3PGCA 5IVXF 4TVPD 3UP1A 5IB2B 4X7CC 1JGEA 5I74C 2BC4B 4X0KB 1VFBA 2FBOJ 2AK1L 4MHHI 1DQDH 4EEEA 3LHPH 1CIDA 5FDWA 3F65A 3U30C 5HGDA 1PZ5B 4LFHD 1RZ8B 3VFVA 3U46B 4AEIL 3FAWA 4PJHA 4OJFH 1ZLUH 3GMRA 1KTDB 3JTSA 2DQEL 3GHEH 1R3LA 4OFKA 3I3DA 4IHOB 4M3KB 3MLSL 4Z7WE 1C12B 2HRPL 5FHBH 5F88B 1IC4L 3D39A 1IKNC 2P7TB 4MJ5A 4U0RC 5JO5A 2OMNA 1ZT7B 4G8EB 3S34L 1A1NB 3CD4A 5LQBH 3JV4B 4LEOB 1P1ZB 1QYGL 3MRRB 4PJIA 4OZFH 3BP5B 4Q7DA 1S9WA 4LHUA 3OGCA 3E6HA 3L3IB 2R39A 4YDVA 2P48B 5SWSE 4X6FA 5CUSH 2B1HL 3BP6B 4XCEA 3DBXB 4JQVA 4QNPE 2A1WL 5EU4A 2MOVA 1F4AA 4YHNB 2YD8A 2IALB 5I1LA 2QKIA 3IDMB 3GKWH 3TJHC 3T09A 5BQ7B 3W11C 4ERSH 3S3JA 4MA8L 4XAWL 3DYMA 1K3IA 4J8RA 5D7JB 4JDZA 2CPCA 1JNLH 3MRDB 5IB3B 2APBA 5DDHB 1BLNA 3VXSB 5D72H 2O61A 4I0CC 1TJHH 4KY1L 3V4PL 1PYWA 1CWVA 3HI1A 4WY7H 1MCNA 4LQFH 2KZWA 5D7JD 5KJRH 2V2XB 3QUMH 5I66A 1JYVA 3REVA 3SDXF 1NGWA 5F7LB 3IFPA 4X9BA 3L1OH 4J23A 4LNVA 4PJDA 3C2AH 1RUQH 1NC2B 2HKHL 2W9EH 4XH2B 1KC5H 4G6FB 3SE8L 4FP8L 5IMKB 2PXYD 5C1MB 3O45A 5DJ8B 5K9OA 2X4QA 2GTWA 5GRUL 5I1IL 4WUUB 2V5TA 5D1QA 2QR0A 2WBJC 2B8OT 3H9HA 4BFGA 3SQOH 2JK5B 5BZDB 2FEDC 2H32B 5C08E 4WW1A 4YFEA 4OCMC 2CGRL 5EU6A 1KJ2L 2BSRB 1QBLH 2FCBA 4OV5B 1VCAA 1NKOA 4L8SB 2EDNA 3KJ6H 3V4VL 4IMKA 4P49A 3KPSD 4KVCL 3F7VB 2AAVA 1NC2D 3KYMA 4FQJH 4M5ZH 4XX1E 4HUKB 4RCAA 1T5WA 4ZFZB 1HSBB 3DHJA 3EYFA 4HUNB 1Y18B 5H94B 4HCRH 2WNGA 3KPMA 1NLBL 1H3PH 2WIIA 2ZNXA 4C56A 5EUKB 2EH8H 5IESH 3BH9A 5TGBB 5EU7C 1S9XB 1WVZA 5E7BA 5I8CB 3S7GA 4XBGB 5KSUB 3D9AL 1N0LA 3KGRA 1JF6A 4DZ8B 2DLEA 1E6JH 2EC9T 3O4OC 1FGVL 4LSQL 1E0OB 4QTHA 2W38A 2I9TB 4B53A 4M6OL 2ZKHL 4WEMB 1L9MA 5GS1B 3HE6B 1UACH 3VWJA 3RUGA 3TBWB 3MA7A 2J6EL 4OD1L 5I2IB 1PW3A 3NFNA 1CVRA 3VXNA 1E6OH 4PJ5A 2ERJC 2DTMH 3EJJX 1N64H 2NY5L 4ZOBA 3HZMB 3I85A 1JGLH 1NANI 2WINB 1AP2B 4NQSB 5DD3L 1CDJA 3SQBA 1HEZA 1BAFL 3O0RH 4S0TD 5DA0B 3SKMA 3OX8A 5SWZD 5EFIA 2NNAB 5DHYA 3WFCH 2N4IA 3MPCA 3PWNA 1VKXA 1MAKA 1GL4B 2Y36L 1TTGA 5GRJL 4YBLC 1G7MA 2Z35A 3U0WL 2VDRH 1CF8H 4KDTA 5GS0L 3MRQB 1Q0XH 4OF3A 1UM5H 1SJHB 5HXMA 4LVNB 3QWRA 2GTZA 4B0MM 2YUWA 2DWEB 4XMKL 1FFQA 2VLJA 1U3HB 1ZT1B 2R56H 3SCMA 5SX4I 4OBRA 3QEUB 1RJYB 1FDLH 2JJUA 2V2TA 2LU4A 3C6LA 5F3BB 2FB4H 4HIEB 1J05B 3KPSE 3SHSA 1ZK9A 1AC0A 1RZKL 3R1GL 4OD2B 4PGEB 2E8ZA 2PTTB 3B9VA 3TWCH 5MERB 5JQ6H 1TJGL 1K5NB 4IEFB 3P40A 2FJHB 3O9WB 1ZA3A 4KVNL 1MI5B 1WBZB 2VUYA 1YJDL 1JV5B 5K9JL 5KVEH 4YX2H 4U6HA 1DN2A 1MJUL 3FRPG 2H3NA 2BVTA 1SY6A 1YPZF 4ONGL 5D2LE 1PEZA 5DYOA 3S5LA 1JYWA 5E70A 5C08D 1OSPH 4C59B 1VPOL 4I3SH 5EIVA 4YQXL 1LE5B 2Z0BA 1MCPL 4P2RE 7FABL 2RFXA 2VXVH 2FL5B 3MV9D 4MAYB 3G04A 2M2DA 1PD6A 4BJLA 1QRND 4LFHG 3ULUH 1MWAA 2WW8A 4GRLB 2VUOA 3WMSA 2W0KA 4PS4L 4EI6A 1MEXL 4GW5A 4TTGA 1T5XA 4P3WA 3G5VA 3QHZL 5JNYA 1XEDA 1CFSA 4I48A 4JVUA 4P23D 3D18B 4X7SL 1I7TA 1U8QA 2A9MH 1IQDA 3K0WA 4D8PB 4OCRL 3MJ9H 1AJ7L 2F53D 4PTUA 2VLLA 4HWEL 3ARBB 4PJHF 3S88L 4NWUL 4FMKA 3NZ8A 1T20B 4ORZC 3H9SE 1D5ZB 1NAKL 3DPBA 1ETZB 2IPKB 3HCVA 3SDDD 5L2KA 4UILH 1RZJC 5E08H 2QHRL 1HHGA 4D0BA 1X5AA 2YMXH 3T4AB 1SVZA 4K3JL 1G84A 3ZSSA 3RWGA 3OKDA 4MB3A 4NHUA 3OKEB 2HLAB 1IGTB 1X6LA 3WFHA 4JPIB 4NC1E 2EDKA 1INQA 1Q94A 2F54B 4LCUB 4E5XB 3C6SA 1A5FH 1IGIL 2HVKA 3MMEA 5JO5B 3O2WL 4KKBD 4P4KB 4KZEL 5E1HB 3TYFB 3D85B 3G5YA 1OGTB 2VYRE 4MQTB 3MREA 5KANG 5L2KE 4PD4K 3VFMB 4GMSL 3FQXA 3ARXA 1UCBL 1ZLSL 4U3CA 3ZYIA 1FFOA 3HG1A 5IM7B 4JO2H 4PB9L 4X6DF 5LVEA 4YWGH 3P0GB 5TQ2L 3TT1H 3N9GH 2DQDH 1ZMYA 2GK2A 3BKJL 1HQ4A 4DGYL 1AGCB 5I19L 4KRPC 4XTRC 3WD5L 4L5FH 4M4PA 5D1XB 4FFYH 2HFFB 1T89A 1RV6X 1V05A 4PRPE 2DBLH 3C5SA 5DJYA 1LO3L 1CLZH 2NPLX 1F3DH 5JTWA 2NMSA 3LKPA 5HGHA 1N6QH 4FXLA 4YIQB 2IMNA 4MJ6A 5D7JA 1QPXA 3BWAA 4WJ5A 2NYYC 4HAFA 4F57L 2LFGA 1P4BL 2D7QA 1RJCA 5LGHL 1S7XB 4EBQH 4QXUH 3ZT7A 1EDQA 4JDTL 1U58A 5E5UB 4JM4L 5D93C 3VI4E 3RBSA 2YZ1A 5LBSL 3HI1B 4LPTA 3NZHH 1S7TA 2PXYA 5B8CC 4K7PH 1IBGH 4CMMB 3QI9D 5FKPB 4DJMA 1MQKH 1A6AA 2WUBL 4IJ3C 5FYKU 1KEMH 2NXYB 5D1QD 1IAKB 3LVEA 4XC3H 4NO0A 5EN2B 2QSTA 4M1DL 5EU6D 3FRPA 1U8OA 2Z31D 4R26H 4RX4D 4YC2B 2ICEB 4R7DA 4EOWL 3KPSA 1VB9A 1NC4B 1ZHBB 2EDLA 1TMCB 5L8KB 4NFCA 5GGUB 4XZUB 5J9PB 2QTEA 3DUHA 4AZ8A 1MCJA 1NBYB 3VXME 4GLRH 4KDTC 3LS4L 3HFMH 4MJIA 4HWNA 5GS2H 4RGOH 5F8RC 4HK0A 1K8IA 3B9AA 4NQDA 1F42A 2DLTA 5SV3A 3KPQB 4LCYB 2EE3A 1Y18A 1YYMH 4IRSC 4OFVA 5HTSA 3FO1B 4XCCH 1AGEA 1JI2A 3LPFA 3HZKB 1T2QL 4PR5B 4QHUA 4KQ3H 1LEIB 1CFNB 1UKSA 3BH9B 4XXDB 5DUML 1MFNA 4HC1L 1BOGA 3L3JB 1U8NB 4EUPH 1RJLA 3RY6C 2FD6H 3MLTA 3VGAB 1I8MB 1YEIH 2Q76B 1T7WA 3J7HA 4RMSA 2X4SB 3B9KA 2GIYA 4M6AA 1UT9A 4KGJA 2WBWB 4NHCH 4EQ2A 1ZGLB 3IFOA 4K7PY 3SE3C 5GZND 3HE7A 3K46A 4X7FC 5H8DA 4OCSH 2ZP0T 4E41D 3VWJB 3TBSB 4NUJB 5C0RL 2AEPH 3BYYA 2OX5A 3S4SA 4ZD3L 2E6JA 1CL7I 4GT7A 1RZ7L 4PJFF 4IMLB 2ADGB 2BFVH 5JDSB 4X83A 1BM3H 5DMKA 5FYLE 4AL8H 5EULV 3DUSB 1T0NA 3RZCC 1R3LB 1SYVB 5EBMA 2YD2A 2HWZL 1QHOA 1UEMA 3KPNA 5EIIA 5GRVK 1LWRA 3TN0B 2C3VA 3UTSB 3O8XD 3PDGA 3KLAB 4Z76A 4M7KL 1IKFH 3SO3B 4MVBD 3L9RA 5IQ7L 3SCMD 4JPVH 3G6DL 3WSQH 3DI2B 1A7PH 3BDBA 5F7EL 4MNQA 2Z35B 5JIIA 1ZEAL 3B6SB 3ARGC 1PFCA 3EJZC 4JGJA 3SE9L 2R23B 3VRJB 3CFCL 4XP5H 3LB6D 1BQUA 3HR5A 3VCLB 4UTBH 4OFYA 5HHVL 5ERWB 3WXVL 4Z0BH 2XPGA 4AQOA 2CKNA 2CLRB 2MJWA 1PJ9A 4PJ9C 4MQ7B 1ZTXL 2ESVE 2EKSB 4K94L 1CD1A 1J05A 2D0FA 4ZPTB 3OB0K 1ZLWH 3CFIC 4L8BB 4QWWD 3OR7A 4JZNB 2PTTA 2Q8AH 1WISA 1HZHH 1CGXA 1UENA 3MLRH 4N8PA 4XNMA 3LKNB 1LK2B 1NCUA 1KTLB 2BHZA 2XNAA 2DDQL 2XI9A 3DGGB 4U05A 4U31A 3DGCR 3MRKA 4AYFA 5ID1B 1OOAA 3QUZD 3EYVB 2R1WB 1V7ML 4RAVB 3MV9A 2P5WA 3MUZ1 5LWYH 2H3NB 1JZ8A 3MR9B 5C6PB 4ZFOB 5DYOB 3S5LB 2N1KA 4YAQA 3HAEB 1Q72L 3GB7B 5FV1L 1BEYH 4GS7C 4IM8A 1NKRA 3FO0L 2HMIC 4M6MH 1S3KL 5HVWA 3DX8A 4PP1C 3CCHA 5IJKC 4X7DC 1QFWI 3VGGA 5DMYA 2X6MA 4OV6F 1FYTB 4LNRA 1BP3B 5TPWH 4RQQA 4OIIL 3VD7A 3AROA 3SDDA 3MLXL 1IGYA 5EU6B 4L1HA 1JGUH 1XFPA 4JG1L 2LV4A 2VLLB 4BK4A 4OV5A 3S37H 4ZO7A 2A77L 4PJBE 3NZ8B 4LLDA 3OHXA 1YECH 1G9ML 1D5ZA 3D69A 4LSRL 5FGRA 2OZ4H 2DQIH 2VLJE 2CXKA 3T0EB 1OVZA 4U1LB 4NZUL 2EXWC 3HI6L 5CKGA 1DANU 5C09A 3MLZL 2HH0L 4M03A 4PJDE 5EZIH 5F7KC 2WIIB 5JW3H 2IBZX 2AQ3A 4K3EL 3C60B 1M05B 1DTUA 4HIJB 1A6WL 3TO2A 1CD8A 4KI5E 2ZSWA 3EJZD 4NQCD 3RWGB 4JFEE 5GS1C 4RWHA 2H9GA 2PCPA 1RUPH 4XBGA 3VXRB 5T1KA 1GRWA 4TQEL 1KJMA 5FYKD 1NFKA 1NFIB 5ITBH 4N8VA 5E8PA 1YC7A 4R0LC 3HMWH 4F2MA 2DN7A 5HGAB 1NJ9A 2I9TA 3HMXH 1RZKC 3TYFA 3CXHK 4OLXH 4AM0A 1OGTA 1A7OH 3KJ4B 5DWUL 3QXVA 2E5EA 1WIUA 3ARFB 4KUCD 2DM2A 3WIFA 5CGTA 3UO1L 4JGMA 3UTTA 3NA9H 2B7DT 4E9LA 2DMKA 2VLKD 3CLEL 5CJOH 4Z7WB 1NAML 4UTAH 5JDJA 1BF2A 5T1MB 1JN6B 3VW3H 5TDNB 1T04A 1BX2B 3GGWA 4OM0L 3VRLE 2P8MB 1JFQL 4R4ND 5DLML 5DQJB 5DSCB 2BSTA 2DQCH 4ZFGH 4GRLD 1JYNA 1KIRB 2JELH 5IJVA 3BKCL 3IXTA 3VA6A 4XCYB 3SPVA 3QWOA 4GKZB 4KRLB 3BKMH 5F1KC 3G6JF 1IFHL 4PLNC 3FHQA 1LO0H 3QI9A 1NLDL 4UT7L 2CIKA 2R4SL 3PIQA 5DC4B 5DZLA 2KKQA 1A3LH 5KTEL 1SJHA 1S7XA 5C0CD 4HJJH 4H8WH 1QNZH 3Q3GB 4NO0D 2B0SH 1RIHH 1TZGL 4M43L 4NKDB 3WUWB 4F7CB 2R0KH 1BHGA 5HYQA 5DJAA 1RZFH 5I73B 3WS6A 1J8HB 2BSSA 5CFHA 5I1AB 2ICCA 5I73C 1YNTA 4ZQKA 2K7QA 4PJHE 4OZGB 2BSED 4HDIB 3NFPB 4U1SB 3WEXA 25C8L 5DT1H 4N0CC 3TP4A 5JA9A 5JHDA 4BKLB 2KQNA 4L8DB 2XYCA 2XKUA 1A4JB 1A1NA 4X6CA 5T33H 2CK2A 4PRHD 4Q9RL 1HKFA 1JRHI 5C0CB 3S35X 3FN3A 1N3NB 1UZ6E 3QDME 1FPTL 4NQDD 3S36X 1V5JA 2RB8A 2GCYB 3L3IA 2W0FA 1A3RL 4AIZA 3BWUC 4XZUA 3BP6A 1P69B 3QO1A 4MNHA 3HI5H 3TYGL 4U1JB 2EO9A 2PR4L 1GGBL 3D3VB 3GSNH 4RAUB 3L3OA 1OAYL 5LAXA 4XPBL 1N2RA 3M07A 1KYOK 2VZ1A 3T2QA 3E8UH 2ZSVA 1W0VA 3DNKA 3FO1A 4U4BA 3HB3D 5F9OL 2E9WA 3BT2L 4NZTH 4JDZB 4F58L 1FAIL 3Q5OA 5K59F 4FZEL 1LEIA 2R8SL 1D5IL 1JHLH 5C2BL 2CO6B 5FA4A 3HE7D 4HZAA 3BZFA 5L8JB 2N56A 3CDGB 4DVBB 2XWBA 4E41A 4PBVC 1ZVSA 4LLVA 1G6RL 5DMIH 1BWWA 4GKOA 5IROA 4K8RC 2C4FU 3TFKC 2VN4A 1NEUA 2CJUL 4GH7B 3K2MC 1MH5B 2QQNH 5EG6C 3MRLB 4PRBA 5E9DE 1PY9A 2UZIH 1CE6A 3ZDXE 5C86A 1QLEL 3RKPA 5JHLH 3RWIA 4LMQE 1HE7A 5L2KB 1FO0A 2DQGH 4LIQL 3UTPD 1D5MA 1UZ8A 4OFIA 4XH2A 3H9SB 1XR8A 3O8XA 5FUZH 5FXCH 3U9UB 2D4FA 3B2UC 1WAAF 1KJ3H 1MLCA 3NACL 3U1SL 1ADQL 2WAHA 1W2KT 5GGTL 2M26A 1R3IH 1XF4B 3LKOB 4DN4H 3WFHB 1UWGL 2JK5A 5BZDA 3O81A 1P53A 4NQVA 4N1EA 5IBTH 4WW1B 2DKUA 4JRYA 5FM4A 1S7QA 1QSFE 3AS2A 5HYJD 3T1FB 3GJFH 4O58L 5E2WH 5DEFA 5A1AA 5E8OB 3C09C 3L9RB 3D85A 3F6IA 3IS1X 2GJ6D 1NCWL 3D0VA 3IRPX 3ECBB 4QHMA 1D5BA 2Y07L 3KYKH 4OFYD 4CMHB 1CDUA 1UJ3C 4EI5C 2J12B 3S5LG 1DSFL 2O5YH 4YDJB 1SM3H 1DFBH 4PRNA 3VXPB 5K9KA 1K3ZA 3PG2A 1OB1B 4ODWA 4K23H 2EE9A 4MDJB 5CINH 1L7TL 4UINH 3ET9F 2NCMA 5T5FH 4L8CA 4KTEH 2CMRL 1R0AL 2OJZH 2Z31C 5J3HD 1LQSR 2RCSH 4ZS7H 4FTVB 1J87A 5EPMA 4AT6A 3QUZA 4JFOB 2DQUH 5DJCA 4RRPA 5I15L 5DJXA 2F58L 3THMH 4XPAH 2E9IA 5T3XH 2A73B 2NY6B 1JHKL 1YNLH 1BFSA 1I1FB 1SBSH 1CK0H 4MNQE 2CRIA 4GAYA 3IAPA 3BE1L 4PJEF 4XVJL 2DOCA 1I9RH 1YMMA 4G6KL 5BW7A 3QNZA 3K81A 5ID1A 2EIDA 4YHZL 3NVQA 1P4IH 3MV9B 1CCZA 1S78C 4GOSA 2FIKB 4KKLD 4WVRA 3UJIH 4H8WC 3DHMA 1JPGA 2GHWB 3KXFE 2AS5M 4FXKA 4WI9A 4OB5H 2BXZA 2WBJB 2ZCHH 2IQ9H 3KHQA 4FQHA 5B3JF 4OCYL 5TE6H 3SKMB 1F90H 1GPOL 1CFQA 1YN7B 1KCLA 1S9YB 4WHTA 1WZLA 4XP9L 4C56E 5AEAA 2VQ1A 4MD5A 1SEBB 2YKLH 2D0GA 3ZKNC 3O3DA 3JWDH 2XWTA 2OR8A 5EBWB 1G7IB 3RPIA 2OSLB 4KKCD 2ZG1A 3G9AB 1YEEH 5GZNC 3JTTA 3ZHDA 3T2NH 3UTSD 5IIEB 2IH1A 1LK3H 4HV8B 2DWEA 1XGQB 4JM2C 4PJAE 4S1SL 3RKDD 4NRZB 5GSVB 3W0WD 3SCMB 5C09D 3MA9H 5HVGB 3OHXB 4QLRA 2WIMA 4LSPL 1CXFA 1QR4A 2PYFB 4NZRL 5AD0A 1MLBA 3STLA 3QQ4B 1NGXB 1CG9B 1NCCH 3T0EA 2OK0H 1KSRA 3GSQA 3OXRB 2ARWA 4GUPA 5D6DA 5MP6L 4FG6C 4GG6B 3EFDH 1JVKA 5FB8A 3I50H 1DEEA 3DETC 3WDHA 5KBNC 3K7UA 5FA3B 1PX3A 5D2NC 1F6AA 1IM9D 3RPKA 3JWOL 4R97B 1IAIL 4CVWA 4NCC1 2IADA 3FOMA 4RGND 5A2IH 5C8JA 2VLKA 5C0BE 3TBYA 1EUTA 2X4UA 2OI9B 2BY3A 1WTGT 2XA8H 4JPWL 3SOBL 4N1HB 4P9HH 1NUNB 4K7FA 2BNQE 5B8CB 2JIXA 3TZVA 4ODTL 3BI9X 4K9EL 2XRAH 3TA3A 1FYTD 2ZUWA 3UTTB 4GRLA 3PWLA 3BN9D 3D6GA 1XZ0A 2X4OB 4LSDA 4JFYA 1KXQE 4RWYL 4RMQA 4U1NB 4HG4K 2VIRA 4QRUB 5EBMB 5F7DA 5GGSB 1A02N 3ABZA 1B4JH 5I1EL 4RGNB 1LP9A 3MXVH 1A6ZB 1D9KB 2C1OB 4LSUH 4K94C 1KIRA 5IJVB 1EGJL 1A22B 3E3QC 2AV7A 4PRAA 3AXLB 1Z3GL 4TSCL 5D7SH 3TCXA 3QPXH 4POUB 3O2DL 1Q9KB 1MCWM 5DJDA 4UV7L 2DJ4A 4JQVC 1DLFH 1UA6L 2D03H 3EYOA 4G9FB 5F6IB 4ZG1A 5CJ8A 4Z7UB 3TEUA 1F58L 4HUVA 3LRSA 1ZGLP 2UUDH 2VXSH 2GI7A 3U9PH 1DCLA 2D3VA 3NPSC 3MUHL 5K93A 1IGMH 3FQUB 3GI8H 1FL5B 3FO9B 5I17A 4PJ8D 5C9JA 2DD8L 1HCFX 3A6CL 4FQ1L 4FRWA 3CFBA 3QQ3A 4LVOB 1IT9H 3AAZB 4ZUVA 4OJFL 5JOPE 4Y2DD 2CUHA 3JV0A 4U0RB 3K4AA 5CLTA 3S9DB 2Q20A 2L7UA 2HVKB 3DJ9A 2DM7A 1F4YH 2AJSL 2BNRA 5B3NA 1FHGA 1GSMA 4JO1H 1LK2A 3LKNA 3NAAH 3W2DH 5JXED 5E24E 5SWSD 4JFZL 5JW4M 1KGCE 1OP9A 2ESVA 4U33A 3S34H 3VDCA 4JJ5A 3HG1B 3O6MH 5IQ9A 3HS0B 3MJ7A 3F7RA 3LS5L 5BOPA 1UH4A 3GO1L 4MDIB 1PSKH 3IKKA 3MR9A 2X1WL 5DMGC 1NMAL 3QO1B 4JFQA 5LCVH 4I5BA 2P8LA 2X44D 1SYSB 3LN9A 4MXVF 4UNTA 1G6RB 3L3OB 4XRCA 5JW4N 1F11B 1BECA 1CTNA 1T0PB 1AI1H 1PVHA 3CAFA 4TNVK 3V0AC 3ZHKA 1WBYA 1X6NA 1WWBX 3OKNA 2Y6SD 2LABA 3W5NA 3EW3B 4XAWH 4KTYA 4MA3B 3AGVA 4LGRB 1SHMA 5E8NB 1TDQA 2XACC 2IQAA 5CKAA 2XWBB 4E41B 1EXUA 4MCYA 3GSRA 4R6UA 1MFDL 5C0BB 5J6HB 1JGVL 1UM6L 3UAJD 5EU5A 3KPOA 4OZIE 5IVZA 3RA7H 2Z8VC 1GGYA 1P5VA 2X4PB 3AS1A 1R3JA 1RMFH 5SWQA 1KIUA 4NNPL 4WCYL 3HE7C 2B20A 1CICB 4O51A 4LEXH 1YY9D 1GIGH 5GZOD 4LLYA 4POZD 3WDJA 4HC1A 4LVEA 1OP3K 1QRKA 4U7SA 3LN5B 1FAKT 5CSZB 4XWOD 5HYJA 2DIJA 43C9B 4CJ1A 5DUPL 3IFNL 2GJ6A 2E27H 2DLGA 3W5MA 3R06B 1U8JA 1KJMB 4IDLA 2HJFB 5ALCL 1KOAA 3SGKA 4I0PD 3LKSA 3BAEH 1PBYA 3GJFA 5IMMA 1CLYL 2ICWB 3QDGE 3SDAB 4OLUL 2F19H 3BEWB 4N0YL 2NY7L 4AM0B 5E8EA 4TTDD 3MRPB 1BD2A 4YXHH 1MJJB 2QHLA 4WO4A 4WWKC 3CFEB 3CFDA 5I1CH 1BF8A 2NR6D 3TVMB 2P5EB 1U3HC 3QXTA 1MREL 2MMXA 4MDJA 3QCVH 5TDOA 4EUPG 5HYSG 1FQ9C 3PGDB 4M1GH 4CUCA 3O6LH 2XZAL 2IEPA 1R5IB 1T04B 4L3EB 4D3CH 3C09B 5D9SA 1KT2A 5CSGA 1KFAL 4YBLB 2X40A 4PJ9A 1HHKB 1H8SA 1I8MA 5FYJH 1YPZB 3KLDA 4TVPH 4ESKA 5C92A 4PJ7F 1DQJB 5IHLB 3QP3A 1U6AL 3U48A 4Y4HC 3H3KA 4CADB 2CIIA 4IRSB 1YNKL 3QWOB 3D9AH 4PRIE 3MUGA 5J1TC 3E2HB 4JFDE 1ZGLA 3NIGE 1OHQA 2IANB 3PIQB 5KOVC 1XIWB 1Q9OB 3MRNB 4Y16D 1XMWA 3MYZA 1A7NH 3D2UB 3WXWH 4ONHA 2HTKC 5I1JH 4YDIH 5I30H 3CSGA 5HYQB 3LV3B 3HNTL 5T1LA 3GMMB 1PLGH 5A16B 3ZHLA 4JQXA 5I1HL 4H20H 3IDXL 5EO1B 4I3GA 4NRXB 1IMHC 1MCHA 3UTSA 3P4OA 2W59A 4OCXL 4I77L 1AQKL 1PZUB 1E27B 3QFJA 2G2RB 3K8KA 3ALXA 3VGBA 3G9VA 1S7WA 1JPSL 3FQRA 1P84J 3LD8C 4HIIB 4P48A 2OSLA 1E4XI 1I8LA 1FZOA 5IFHH 1BQSA 4C55A 1WICA 3VD3A 2GCYA 1LDPL 1QLFB 3T0ED 3S8WA 5E4EB 3U0WH 2VWEC 2C5DC 5I8KL 2CK0L 4QXGH 4L4VE 4LSVL 4MB4A 1ZHKA 4UNUA 5EUOF 3VCLA 4K8RL 5C0NC 3QIBA 3IETA 5FF6A 3IU3B 2CLRA 1KLFA 1KNOB 4H26B 4ZXBA 4LCCB 3PABB 1U95A 1A21A 1CL7H 2JB6B 2ZUYA 3UDWA 3MZTA 1MCIA 2G75A 2L4OA 4X4ZA 1K2DB 5ACMA 4ENEC 4JRXB 5DHVH 4ZSOA 5HDOA 1UWXK 5HI4D 4IS6B 3TGXA 5E99L 1U42A 3ZT5A 4YE4H 2PETA 3ZL4H 1EFXD 4KXZI 3O3UN 2NY0C 4E0RB 3AC0A 5L88L 4JKWA 4OUUA 4NJAH 4HFUL 1HYRC 1DBMH 1JRHH 5HD8C 5K9QI 1IJ9A 3CDGA 3DARA 2UY6A 1WV7T 3TZVD 4QOKA 5KG9A 4NBZB 1GHFH 2CDEB 4ZUTB 3TA3D 3FOMB 1D9KC 4BSVB 4ODUA 5I8EA 4BQ6A 2EDBA 3VXOB 3MRBB 2FDBP 1KELL 5DUBB 4XWOC 1S9VA 5EOCL 3H7LA 4HAGA 3E0GA 3H42H 4WEBL 4NGHL 1IL1B 2VDNL 3B9KC 2R29H 3LEXB 3H9SA 1MSPA 1WFOA 3TA3B 3CSYA 1MWAH 1BQHG 2VDML 3T4YA 3SE4A 4R0LA 4AEFA 3MODH 5D1ZD 3WN5B 5D6CB 3AB0B 2F53E 3I3BA 1HHJA 4JFFA 4OLVH 2ZOLA 4K3HA 3QCTH 3CNKA 4N0UA 4JDVA 3TNMA 3RVXD 4NPYA 3QXWA 4DEPB 5F3HB 4W4OC 5BV7B 5JMRA 5DEFB 1J88A 3F58L 5B39G 4U1IA 3DMMC 3GHBL 4Z7VB 4U3HA 2I9LB 2AK4A 4HWEH 1FL6A 2OR7A 3G6JA 4MXWH 4R90L 3P4MA 3Q0HA 2FHBA 1RZGA 2EDTA 1HXYA 4HUUB 4IOFC 5CZXC 4P2RD 5JXAH 4M7LL 3BP7A 4H0GA 3RWEB 5HPOA 4Y4FB 2P49B 4RIRB 1CBVH 5DFWH 2P46B 4X6EB 4N0CD 3FO9A 5E08L 1B0GA 1E28B 4MA7H 5SX5K 4KUZL 5FKAB 1XT5A 2VXUH 5SWSA 4XNUH 5EPMB 5A43C 1FP5A 1FBIL 4PJEE 4WNQB 2AABH 1NDMA 2NX5E 3BEVB 5FO9A 2OL3B 2DRUA 4MAUL 1HXMB 3L3KB 2I25N 2O26U 1UM4L 2AJXL 1YMMB 1LO2H 5ENWA 1IGCL 2VKXA 4WWKD 2AJZA 4TRPH 4JY6B 3BIAX 1OW0C 3FCTB 4Z7WA 2WV3A 1OM3H 5B3JE 4P23C 3BO8A 2BY0A 4OLYL 5CJQH 5HHXH 3F8UB 4I5BB 4JFXA 3RVXC 5EIQA 2IAND 1FIEA 3BGMB 5IFAL 2MNUA 2ZG2A 2P8MA 4V1DB 1NAMA 3MV7A 4WFFE 2QSQA 1YYLH 3MUJA 2B4CL 1E4XH 4MD4B 3P73B 4GG6E 3T0EE 1KENL 1NUDA 4GW4A 5DMGD 4MHHG 3FQTB 2NW2A 4S2SB 3QEHB 5BRZA 3MYJA 4OTXH 2CIKB 2APVA 4Y4KC 1I1CA 3L7EB 4MCYB 1G9NH 2NY6C 3HC4H 4M93B 4X7EC 4OLZL 2LQRA 5C0BA 5GSVA 1GGCL 1J0YA 4JY4A 2F54E 1AQDB 5F1NA 4LVNC 5BV7H 3V6OE 3SDCB 4LBEA 5ESQA 5EU5B 5L7XH 4Y2DB 4OZGA 2FSEA 3FOLA 1BGXH 4FXGA 2ZZUT 1UWEH 4M5YL 3STLB 1TZHA 2F74B 3HPJB 1S5IH 4H0IA 1WBXB 1MIEL 2AXJA 3NCYS 4RMUA 2HFGL 1MY7A 2R1XB 3DXAB 3CUPA 3FB8A 4Z0XB 2YSSB 2H26B 3NTCL 4RNRB 1AXSA 3GMLA 1NGPL 5BXFB 1B4RA 3GMNB 5E03A 1I3GH 1BD2D 2MHAB 3RX5A 4JN2B 4TN9A 4OT1H 1OCWL 3OZ9L 5F88A 5L2JA 5KN5B 1FZMA 1LP9E 1WFNA 5KAQG 3QXDB 1CR9L 5LGJB 2ICWA 3PWPB 1GGTA 3QZWA 4KV5E 1VERA 4KK9C 4UQ3A 5GHWL 3D3VA 3LDBB 3FB7A 4Z7UF 5F6IC 1DDHA 5KW9L 3D48R 4EUPB 4WO4B 2HRPH 5IW1B 3AS0A 1SEQL 5MEOB 2ZUXA 3RFZC 4TVPE 3FN0L 3CLFL 3CH8A 1KN4H 2YN5A 2QSCL 1BZQK 4PGBA 4Z7OF 3MOBL 1JZ5A 4YBQD 2IFFL 1MF2H 4A6YL 5FECB 1NMBH 2X4NB 3K2UH 1WTLA 4FQIH 4JN1L 4U0QB 5ETUB 5FYKH 3RWCB 1L0XA 4FQ2H 3O2VH 5HHOB 4NUGL 3X14B 2IALA 5I1LB 1ES0A 4LLVB 4EKXA 4HBCL 4O5LH 4AIOA 1UXSB 5T3ZE 1GC1C 4NJ9H 2Y06H 3MRFB 3HPLB 4I9WD 4K8RD 5T1LD 4HT1L 4LLUA 4LHQB 2APWA 1B6UA 3UZQA 4Z7NE 4RMVA 2VL5B 1FN4B 2P8PB 4JHBA 2B5IC 3BPLB 1A47A 3V0VB 4MSWA 2W07A 3LRSB 3IAQA 2W9LA 3O8XB 4NO5B 1W0WA 1KIQB 2AJVL 4JGUA 1HWHB 5I1KL 4KJYB 3HAEH 1T1YB 2D7NA 1FO0L 2V2XA 3V6OC 3GUTA 1GOHA 4L9LA 2GK0A 4D0CB 1KYOJ 3BHBB 3NH7H 1IM3B 3BRDA 1AE6L 2X4TA 4I4WB 4AL8L 3UJJL 2VABA 2IWGA 4WI5A 4HZLA 3RL1B 2PTUA 2H1PL 1NGYA 3VFGL 4XWGL 1NC2A 1MFBL 4Y4FD 1UVQA 3DO7B 1YQVL 2E7CA 2W0LA 5DVMA 2ZUQC 2FZ3A 5LXGH 2VDPL 1MFAH 1DANT 5A3ID 1T3FB 3L6FB 5GGRA 1D5BB 3ME0A 3UAJC 2SEBA 3QIBD 3FONA 4C56D 2J88L 1RVFL 5FCSH 3G6DH 4HS6A 4NSKA 3H3PL 5LJYH 2C7UB 2Z91B 2BVOA 1ZLVH 1AC6A 4N90D 3EUUA 3O41A 1NCAL 2C26A 1ZHKB 5C7XL 1EFXA 2NYYD 4JFED 2OXGA 2ZUVA 1KNOA 2GAZB 3AREC 1G6RA 4FFVD 4PJFA 3KYOB 4BZYA 4BUGA 3C08H 3QG7L 4XPFL 1HH6A 4IRSD 3MLYL 3V0WL 1ZGLM 2C3HA 4QYOA 1ZTXH 2CGRH 5F6HI 3WLWC 3IDIB 3MLVL 4MB5A 3H8NA 1DQDL 5EUKA 1JPTL 1MRFL 4ONFL 2HT4D 4OUUB 3V4UH 2CRMA 4PREB 2Q8AL 4PJ5D 3L5XH 4LKXA 1S9XA 2R4RL 2YD4A 1IGJB 3IAGC 5FUCC 1QBML 3G6AA 2VJXA 4U6TA 2RBLA 5CIPA 4MNGB 3GHEL 1X7QA 2VH5L 3EYSH 4LSSH 4ODUB 5I8EB 5IESL 4Z95L 4UZGA 3DVGA 3KYNB 5DUBA 3BQUB 1YEFL 5E56A 3OPZH 2X70A 1QO3B 3BGFB 3SN6N 4FQHB 3BDYH 4JFFD 5J3HC 1JNNL 4K3GA 1CFQB 1YN7A 4XXCC 3DRQA 4RFOH 5HVHC 3SCMC 1P7KB 1MCFA 1FSKB 1QG3A 1N0XH 4PJ5B 1WZKA 3QWRD 4Q6YA 4Z7VE 4NKIL 2CO7B 3RZWA 2YR3A 2CLVA 4HKZA 8FABB 4PYGA 1DL7L 2AI0L 3R06A 5ADOL 5C0EA 4JFPB 1KTKE 2IH1B 1RURH 1G9MC 2HJFA 2Y25A 4JCLA 4O9HL 4PTTB 4KK6D 2FH6A 2G9HB 1Z9LA 1FL3A 5TE4L 3FTGA 4OKVB 4LDLB 3ULSA 2EEBA 3A67L 2CSPA 5F9JB 4LL9A 1RUMH 5JQHC 2FECL 1DQMH 3BEWA 2BVPB 5IW3A 1D6EA 2NR6C 1T80A 5DD3H 3LDBC 4CU8A 3QQ4A 2X9WA 5CP7A 1UZ6F 2D31B 3ISWA 3TVMA 5DK0B 2H8PA 5IOPA 3SGDH 4YHOH 1QA9A 3O6FC 5E2UH 3PUCA 1ZS8B 5CJXC 4GUPB 1JTOA 2IPTH 3FB6A 5TDOB 4GG6A 2OS7A 1C7TA 4EI5A 2FX8H 1XIWC 5JHDE 1RJYA 4XCNA 3L95A 1QLRB 5EZIL 1B0GB 1E28A 2DLIA 5D9SB 4WY7L 1FRGH 2XKNA 4KPHH 5SWSB 4HJGB 1I3RA 2VDQL 4YHPB 5C08A 4X9GA 1NGQL 3PHQA 3IDJB 3STBA 4Y5VA 1NCBL 4DAGH 2ZJSH 5EC1B 4HS8L 1NFDA 1K5NA 1QRNA 4KHXH 3TBYB 3TFKD 1QFWH 3L3KA 5DEZA 2J4WH 1FFNA 2ZUUA 5HGGS 3ZKND 1YZZA 2IANA 2C1PA 4Z7QF 1I8KA 4S10A 1IQWH 4PLKD 4M02A 1C16B 3WL9B 4OI9A 1AGDB 4LF3B 3WV0A 5CGYD 4P23A 3DWTA 2W65A 1XH3A 4M93C 4NO2A 5E94A 2CRZA 5T1LB 3D39E 4HX1B 3INUH 2F53A 1FC1A 3NABH 4JQIH 1MRDL 4O2FB 3V6OA 2ARJB 5BRZD 4HS3B 1N6VA 3VXUE 3EZ8A 3PDDA 2EIBA 3ARBC 2RFXB 1CU4L 4IMKC 4U1GC 1N5AB 2VR5A 5GRXG 4W81A 1F3DJ 2NY5C 3MQIA 1X44A 5ILTL 5C0BD 1UH3A 2AV7B 4PRAB 5L2KD 1SY6H 2XFXB 3GMPB 4GW4B 3IU4L 1GOFA 4G6MH 4AQ1B 2BRQA 5EORH 5D7LE 5DD1L 5D1QC 3QULB 4BM7A 3L5JA 4GRLC 5GJTL 2YWYA 3ZE0F 1JZ4A 4Y5XC 3N1FC 1F8TL 2I60L 1A6VL 1NLDH 3O3AB 1JK8A 3NFSH 2DLFL 3RNQA 3PV7A 1IM9B 1CFTB 5D1ZC 4IIQB 4QF1A 1S7RB 2VZSA 3MO1B 4KK6C 4R96B 4IS6A 3GIZL 1XF5A 1XGPA 3N1GC 2QQKH 4LRNH 3P0YH 4HGMA 2MCPH 5CWSB 3HG1D 1QSFB 1G7JB 4UDUA 4K3DL 2BOCB 1C08A 3O9WC 3PWPE 5ACZB 1TPXC 1MCQA 3CC5B 3MGTB 4D0DA 1Q0YH 2XT1B 4NHUB 4AMKL 3IGAB 3RAJL 1VADB 3I6LD 5KN5A 4MDIA 5C0AB 4WTXA 3C6SB 3DSFL 3MMEB 1YJDC 5E6IB 1RUKH 4Y5YA 4OCWL 4UQ3B 2VSCA 1KCUH 1KN2H 2QADD 2MPAL 5FGCB 3X12A 12E8H 4U2ZA 1U93A 4DK3A 3TJEL 1O0VA 2I26N 3MRCA 5DO2D 1FFOB 1Z9OA 4KJWD 1T2JA 1S5HB 2W60A 5DD0H 5IM7A 5CZVL 3RDTC 3O2DA 1WBYB 5E8DL 1AKJA 1Q38A 4PY8I 3O2WH 1B0WA 3L3HA 2V6HA 1UM5L 1YY8B 4CVXA 1CGWA 2XG5A 1P7QA 5F9OH 4K71C 3RDTD 1CGSH 5B39B 1DBJL 3L5WB 1VGKB 5FO7A 3WBDA 1ZHLA 2R0LH 5GGVH 3Q6FB 5J6HA 4M3JA 1B0RA 2BJML 4ZNEE 3LPWA 3TBVA 2R9HD 2AJ3B 3HRPA 4U1IB 1RHHA 4G6FD 1FL6B 1FH5H 1WQVT 1F00I 2JF1A 4KGLA 4RFEB 5D8JH 4HG4J 1EBPA 3D25A 2Z31A 1HXYB 3KNBB 4RX4A 3O6KH 4OGYL 4ORGB 5JHLL 4NKOA 3RWEA 4X4ME 4Y4FA 1KB5B 4KKAD 1PQZA 3PWJB 2VDLH 2H41A 1KCVL 2GJ6B 1DR9A 5FKPA 4H1LH 1OY3B 1GOGA 3GSVA 4NYLA 1ACYL 2EDRA 3KPRE 2YD9A 4QOKE 5CILL 4DKEL 5DVNA 5EN2A 1NGYB 4KDWA 1KF9B 2EIZA 3QT2A 1JI1A 2IPUK 3DO7A 2CLZA 3CXDL 1NEZB 1NGZB 2HKFL 4X5LA 4J8RB 4PG2C 4OZHF 4GBXC 1U8OB 5E8EB 2ICEA 5KS9B 1DE4B 4JZOB 3CFDB 4QWWC 1FNEB 3OL2A 4YEEA 2W9DL 4HK3J 4O00A 1CZ8L 1D6VH 4PJBB 1RU9H 2ATPB 4G42A 4F37K 1WC7A 5TQ0L 3O41B 1DFBL 3ARZA 5BJTA 5HHOD 4HXAH 4WHCA 5JR1L 4YUEH 4Q6IC 5E7FA 5CAYB 3GRWL 4GKSB 4GXVL 1HHKA 4G8IA 2GJZA 2P5EE 3ZTNH 4ODSH 3UPRB 4HLJA 2PW1B 1A4KB 2DMCA 2QQQA 3MZGB 4P2YA 4NC1C 1OTUC 3M17A 1KLGB 3MLSH 3B83A 1FNLA 3DVNA 2NY4B 1GZPB 1Z5LB 5GXBB 1O7SA 4Q2ZA 3M1BB 4HKBA 3QIBC 3VXUA 2CXGA 1XIWA 2YMXL 2OQJB 1GAFL 2Y9RT 4XCCL 4HJ0C 4NO3A 2B2XH 2FYYA 1FNSL 1MPAH 3EOAB 5C07E 3U4EB 3WFEH 1KB9J 3NCFB 2O5XL 5D1XC 3UJIL 5A16A 3RTQC 1TCMA 1MCOL 2H45A 4WFGD 4BFIB 1W72B 2UUDK 1HDMA 2EDHA 1Z6JT 1CQYA 2XWJA 4NUJA 5A2LH 3MTRA 5KAQF 5B22A 1ZVHA 4EDWL 2DQJH 3NIDF 4G43B 4XB8A 1E27A 3QFJB 2P47B 2GT9B 3I6LE 3OAZH 4LDOB 4OM1H 4NHCL 1HYSC 4TSBL 2YSSA 1P9MA 3DUSA 3KVQA 3RY6A 1AXSB 3GMLB 3OKLA 3LSOA 3BD3A 2AJUH 1PG7X 2AEPL 2A6KB 3KPNB 4JFPA 4MJIE 2OTUB 3TN0A 3TVMD 1G0YR 1IGFH 1QVOB 5DRZB 2LE9A 3EO9L 3R8QA 1T21A 5T3XE 5MENB 4JEGB 4JLRB 5JLZA 1KLUB 1XCQA 2WANA 1BFOB 2CRYA 2D4DA 4X99B 5GGTA 4GS7B 5IHZB 4WI6A 3CZFA 4H5SA 4LCWE 3B6SA 2NXZB 1SBBA 4KH2A 1UG9A 3QNXA 1B9ZA 3TBWA 3O8XC 1JWUB 3VFPB 4S1RL 5TDPB 2EEAA 5IHBA 1IZJA 2XTJB 1OAUH 3VXNB 3QA3A 5C0DA 1CFVH 4XPHL 3N85H 5IQ7H 5DD5H 3FHAA 5FV2A 4OQTL 3QDGA 4JZJC 3V6BR 1LILA 5CCKH 4X5XA 1WSST 4FQLH 3I6GA 2Q86A 3MOAL 1MAMH 3IFLL 4PBWD 3FRUA 2X1OA 1FC2D 3OR7B 1BBDL 3LB6C 2CDEA 4JY5L 4DOHE 4OZHB 4PGCA 2Z8SA 1NSNL 2QSVA 2XTJE 1VKXB 2R0ZH 1J12A 4URTB 1H3UA 1ZANL 2WP3O 3JV4A 4W68A 3QYCA 3DGGA 3HUJE 4PJIB 1DUYB 3BH8B 3VH8B 3FQWB 3RIFK 4QXTA 5ECJE 4P23B 3T4YB 1T1YA 4ZFOA 2UVEA 4XCEB 5HGBB 3MCKA 4MQSB 1BVZA 3HAEA 2BVYA 3CH1A 1T03L 4UT6L 3BHBA 4JFFB 5E2VL 2V2TB 1W72H 1RUAH 2EXYD 3LN4B 4Y5YC 4YBQC 1OP3H 5I1GL 1N5AA 4IOIB 1CLOH 3UYRL 5IF0B 2ICES 1N4XL 3GSOA 2FHCA 3RX7A 2EZ0C 2XFXA 3GMPA 3SKUD 1INEL 4XPGL 3K1DA 3BKYL 2I9LA 3HG1E 1CXKA 4FP8H 1EGJH 3CU1A 5GS0C 2VLKE 1VHPA 4XPTH 3SGDI 3F12A 5C0IA 3W82A 4JPKL 1AH1A 3WE6A 3DTXA 3KPTA 5JPNB 2XZCL 2V9TA 3O3AA 4XT1C 3OAZK 4JG0H 3LH2L 3LRHA 2NZIA 3B2VH 4PY7B 1WT5C 2FD6L 2B1HH 4I0PB 2AQ2A 3QIWC 3OMZA 1U8PB 1MNUH 3V4VH 2MQCA 3ZE2F 3OKMB 1C5BH 1WIOA 1YEHH 2HT4C 4X8JA 4MWFA 4CN4A 3O45B 4PD4J 2JKXA 1MFEH 3UTTD 4EVNA 4YDKH 1EHAA 4LSRH 5D7IE 4CU7A 1QBAA 3MGTA 3SKJL 2XQYG 4D0DB 3QUKB 4DK6A 1CD0A 5AZ2L 1RIUL 4IJ3B 4PLOB 4WFGE 5DA4A 5DK2B 3LQAC 4P59H 3RGVC 3VFOA 4X98A 4U2YA 3LKRA 5EUOA 1CXHA 1GYAA 2QQLH 5CD3B 3DVGB 3GBMH 5HYSB 1Q0XL 2HRLA 1K85A 1N8ZA 3MNZB 4YHMH 5A2FA 2PXYC 4WI8A 2FEEL 1P7QD 5HHMD 4BH8B 3MBXH 5LCVL 3RDTA 3PGFL 3DRQB 3MRCB 4P9HC 4W4OA 2HP4A 4DWHA 4D9RD 5H94A 3EZJB 5LG1A 4CNIB 3JVGA 4HW6A 4F7MB 2WZPD 3RBGA 5E00A 4U1KA 3C87A 4HKZB 3AVEA 5GGQL 4AY0A 4YK4B 4DFHA 5C0EB 4DOHB 2HLAA 3OKEA 3EDDA 1TJGH 5ISZD 4PJAB 4J3WA 4LK4A 2ORBH 4AIXA 1C5DB 2CD0A 1AR1C 2NY0B 2Z92B 2RR3A 1I1AB 4E5XA 4LBEB 5ESQB 1WLHA 3I6KA 4K94H 1DEDA 4M6NH 1HINH 4KJQD 4MS8C 4PJCF 3MCG1 2Q1EA 2AXGB 1OT1A 3MLRL 1TZHB 2YC1A 5CP7B 4PRHA 4M5ZL 2XZQL 4P46C 4G9DB 4FZ8H 1NCDL 5ANMA 1U3ZA 3M8OL 4OGXL 2VKWA 5CJXA 1AY1L 4PV9B 4PFEA 7FABH 5K9QG 1IVLA 4XCNB 5IVOA 3KS0H 5JOFA 3QEGL 3WIIH 5AYQA 4KJPC 3FT4B 2OP4H 3DRTA 4U1SA 1KACB 4JN2A 3HC0B 1A3QA 5JHDB 2X9XA 3PWNB 5TF1H 4HPYL 4ODXA 3RL2B 3F7PC 5FHAH 3TT3L 5IB2A 4PJCA 3WJJA 3WN5C 4JKPH 1G7QA 2LTQB 1JGEB 4NQXB 4P9MH 1ZLUK 1NPUA 2R15A 1AXIB 3ES6B 2FLRT 1U58B 4FQCL 4DQOL 4GMTH 4OIIH 4XP1H 4BZ1L 4KKCC 2Q7NA 3LEVH 4AIZB 4CDHA 4MVBC 3UZVB 4HXBL 4PY8J 2FBJL 1QOKA 2Z8WC 1D7FA 1HH9B 3F6LA 4PRID 4UI2A 2ZCKH 2ZUTA 4RZCA 5IV2B 3QDMA 1A7RL 1TPXB 3VXUD 2EDQA 3MCLL 1JL8A 4JHWH 4JR9H 4LARH 1EEUA 1W0VB 5C6WH 4WDIA 2AGJH 1OPGH 3RU8H 5TFSL 2XKSA 3MRFA 5F96L 4N0FB 4ETYA 1KLGA 3CFKB 3NBNA 3QPQD 4YXKL 4HGWB 3MRRA 1JV5A 2NY1B 4PJIF 3WHXA 2P8PA 4DTGH 5IB5B 2F5AL 5D1ZB 1U91A 1UCTA 3GJEB 3KHOA 3UEZA 5GS0H 5ELIA 3VG9C 2ZUQB 5BVPL 1TENA 5IMOB 3NIGF 4AEHH 4YDVB 4HH8A 1NCNA 4PGDB 2FYYB 3GMQB 4TQEH 3MRLA 1B2WH 4L9LB 3QXAA 1BFTA 5KSAA 4WFEE 4WU5B 4BFIA 3D85D 4N5UA 5J12B 1XF2B 5E6IC 4S1DC 32C2B 1BJ1J 1OLLA 5BS0E 5DRNB 1NUGA 5ALBH 5I16B 1I85A 4Z78A 5D70H 1UVQB 3TN0D 4JANA 1MFCL 2QQNL 4PG9B 3U83A 4I77H 5D1XD 5EO0A 1CICD 1CLZL 1U8NA 2AP2A 1DN0A 1NH6A 2AVGA 4CN1A 5GZOC 1HI6B 4PTUB 1DBBH 5ICXA 3LQAH 1G1CA 4Z7WF 1EFXB 5D7IA 1FVCA 3LKQA 1A9EB 1WF5A 4J6RL 3LIZL 1KJ3L 4JO4H 4Q0XL 2IF7A 4YDJA 3B8SA 2J6EA 4DN4L 1EERB 4Q9BA 5AWNL 3F5WA 1VDGA 4WFFD 5BVJB 3IDIA 4M9PA 4M7LT 3H3BC 4D9QD 4PLJC 1ZOXA 2X4RB 1H3GA 2HJLB 4K9EC 1FIGH 1A6UL 4WTWA 5D1QB 1G6VK 2DQFB 4P5MA 1IGJA 3K3QA 3TV3H 3OAYH 4LLQB 1FVEA 4A6YB 3RY5A 3RGVB 1HSAA 2EXWD 5GGVY 1PKQA 2DJUA 4R4FL 4UT9L 1MIMH 4XP4H 4OAWB 1S7UA 4LCUA 5CEYA 3WS3A 2VXQH 4L8SA 1T83C 4ELMA 3KPLB 3UDWC 4AEIH 3EDKA 4NM4H 1UXWB 4YHLL 2FGWH 3ARWA 3L5HA 2DQHL 5J13B 3D25B 2PYEB 2LAAA 5JPMB 2NQCA 3W39A 1QSFD 1A14L 2VNCA 4N68A 1CYGA 4XPAL 4KK5D 4LPYA 1KB5A 2V9RA 1IC4H 3WUWG 1MVFA 4OD3H 4OI7A 4Y5VC 1MCBA 4OI8A 5D5MA 3SDAC 3OXSA 1A3RH 3IS0X 4F7TB 5CLWA 3B4NA 2FECI 1FLRL 5KSUA 3LZFH 4GRWF 3SDXE 3UTTE 4PRPD 3VD9A 4WV1B 1QFUH 2G60L 4MJ6B 5DF0A 4J1UB 5BW7C 4RBPK 1LEKB 1T4KB 2EKJA 1FNFA 3DMMA 4M62L 5DFVD 1ZLWK 2HA1A 3GZKA 5IR1B 2VN7A 1FNEA 2DM4A 3TH2T 1F90L 4Z77A 4WHYG 3EOTL 3WE6B 4HV8A 5I2IA 1D5IH 1RJZA 4X4YB 4LQ1A 3FB6B 4AENA 1FDLL 1XGYL 4TSAH 4QRRE 2YEZB 3QIUB 4JFFE 5D5MF 4YAQB 4RGMC 1A6AB 1CQKA 3TZVC 3GB7A 5SWZE 3LS4H 4YHPA 5C08B 1U41A 3MV11 4RA3A 2BFVL 1CLCA 3IDJA 3UPRA 1M6OB 4IRZL 4KRPD 4QGYA 4X8JB 2IG2H 2JIXD 5B38B 3VGAC 2HT2D 2NY3D 1N6QL 1FYTA 4LNRB 3EJYC 5KVEL 3FO2B 3S36L 4AEEA 5HSFA 3KPSB 1A64A 5ICZB 2C1PB 4L3AA 3QEQB 4UQ2A 3MRQA 4L4VB 1AGDA 4LF3A 4NFBA 3IVKA 3JVGC 4UV4L 3P9LA 4XNQA 3GBNH 5F7EH 1XH3B 2J8UF 5C8JB 5F8QC 3C2SA 5AZEL 3LKRB 5EUOB 4KDVA 4ETQB 4HF5H 4XAKD 4M8QB 1N8ZB 3D69B 5BMFH 2YK1H 2B1AH 1JWSB 3C5JA 1CXEA 3S3PA 4DGVH 4AG4L 4D94A 1NDGB 5DEGB 4X5WB 1IARB 2R2HB 4YLQT 1WCBA 1MI5A 5AG8A 4P2CG 3GK8L 2NX5A 3LHPL 5J11B 3EOYG 1II4E 1TIUA 4NWUH 1A0QH 5DS8B 4XBEH 5DRXB 1JK8B 3BP4B 1H8OA 5J7CC 3CPLA 2JE8A 1MJ8L 2QJDA 4HMDA 5HD8D 1EJOH 1H3PL 1EAJA 4KQ4H 3U0PA 4XMPL 4NZJA 2JLLA 5C3TA 5IEKB 4JJHA 2E7BA 3EYOB 3QRFM 1KXVC 3S4SB 3VFPA 2JJVA 4PRHB 1INDH 4FA8A 5JXEA 3HC3H 1U8LA 4U6VL 1I9IL 5FYLL 4KMTH 2ESVD 4IMLA 2V2WA 4MMZC 4X4XA 5C07B 5IGXH 1Q1JL 3G6JE 1TNMA 5D7SL 4GW5B 4KFZC 1S8DB 1FZKA 2D7TH 1CFSB 5TDNA 1ZT4A 3CC5A 4X5XB 4LAQH 1BX2A 3GGWB 3UJTH 3KYAA 3DRTB 3KWWA 4D8PA 4C57C 4P46D 3NTCH 3EYUH 4N5ED 2PO6B 4XCYA 5E6IA 1RFDL 1J7VR 1WEJL 4R2GD 5C6TL 4APQC 1ETZA 2Y72A 3MOQA 4XP9H 1EGJA 4PRIA 3G08A 2WWMC 5C2UB 1JGDA 5J6GB 1BVLA 1M7IA 3QDMD 3MGAA 3BKJH 2FO4B 1I9JL 3MXWL 1KCSH 1SJXA 3KPRA 1GVIA 1YECL 2AXFA 3BPLC 1TCRA 1YY8A 2EH8L 3MCKB 4DUWA 2AJSH 4M7JL 5H37G 1FGNL 1P4LB 3VWKD 4PGZA 1V3KA 3W2DL 3QB7C 4G3YL 2F8OA 4ZQKB 1ITCA 3SO5A 5ESAA 4HDIA 3V4PH 5CEZH 2EKSA 5J1AB 3NFPA 3NCCB 4JFDD 1UYWL 1B0RB 1N5YL 4NT6B 1A7QL 4QKXB 1E6JL 3B9EA 2AJ3A 1S3KH 4P4KA 2XQBL 4G8FB 4X6CB 4PB0H 3VXRD 1Q9WA 2BXYA 4ZTPH 4PJXF 3LD8B 4ZDHA 5JIKA 5KSAD 4FNLH 4AK1A 4Z18A 4EIGB 1J1PH 1JTTA 3WLBB 2X7LA 3T0AA 4DGIL 4YHIA 3MRJA 4F7PA 2MCG1 3K4ZA 1FORL 5I1DB 2R2BA 4YPJA 5FYJD 1J18A 2ADIA 4Y19A 5IT2H 3PL6B 4FQXD 2JB5H 4I0PA 2JJTC 1ZHNB 2IH3B 2X4PA 5D1XA 1CICA 1BJ8A 4O51B 4KI5D 5CEZE 2P5WE 2P42B 1K4CA 4Z78B 3GI9H 4L4JA 4WO4D 5D7IF 3ROOB 3LN5A 3PL6D 4LCWB 3BSZH 2PNDA 4K7PX 3VRIA 5KS9A 4OSUH 2DM3A 4ZMAT 5FA4B 3MGOA 4BYHA 3MACL 4XVTH 4X80L 3CX5J 2VERN 5LWYL 3FZUC 3C2AL 3EJYD 2MKLC 4XNYH 3HMWL 4N0RA 2HJKB 4TULL 3RDTB 1LNUA 1YEGH 2YBRA 2MKWA 2YRLA 2FATH 4JAMA 1T83A 1A4KA 1U8HB 3TN0C 3U9UA 5F9DC 4HIJA 5FOBB 3CIQA 3MBEC 2ZSWB 4PP1D 3QDAA 4L3EA 3M1BA 2BY2A 1KT2B 2DQFA 4P5MB 1AO7D 2VLRB 4TNWK 1MRFH 1RPQA 2OQJA 3GI8L 1XF4A 3LKOA 1I9EA 2R0WL 4TUJA 3T08A 2XIDA 3MRMA 4LU5L 3ZKMC 4PJ8B 3NCYP 5HI3C 1I1AA 5KVDH 1NJ9B 1TETL 2AERT 2Y7QB 4JO3H 3U2SA 4U1MA 4ZTOH 1GC1H 3BKCH 3QFJD 5J12C 1K8IB 1HDMB 3MBEB 5I9QC 3CVHB 2YC1B 3MRNA 1VGEH 1ZVYA 3V8CA 5D72L 2JJTA 3D2UA 5D96C 2HYMA 4PRPA 1PG7H 4GQ9L 4F33A 4KY1H 5IBUG 3K74B 1MEXH 1R24A 2FRGP 3P0VH 2WUCL 1R3KB 2L7JA 2GSIA 4O4YH 4FTVE 5F1IA 4UIKL 4OZFA 3FT4A 5IW6A 3CX2A 4PRDA 4Q58C 4F7TA 5EO9A 5DSCA 5EO1A 2OBGA 3AB0C 4U1HB 2WWMD 1PY4A 1LEGB 3IXTB 2R8SH 3GSXB 3VU2A 2G2RA 2ICWJ 43CAB 2A73A 4O9HH 3ARTA 3WNKA 4DCQA 4LPCA 2A6DB 4J4PD 4KTDL 3TPUB 4Z8FL 4H88H 1NFDE 1QRNE 5I19H 5KVGH 3U6RA 3VGDA 5FO8B 1N64L 1NFDF 2J8OA 3RP1A 4Z77B 5TDPA 6CGTA 3Q3GA 5DQDL 3OAUH 1RJZB 1I3VA 5FK9B 4EDXB 1A7BA 4Y19E 5HDQH 4QOKD 1HH9A 35C8L 1T0NB 2VLRE 2X41A 1CGYA 3ZSTA 1JFQH 4P2OB 1S9YA 1KEGL 5BZWB 1UQSB 4PGCB 4XB7A 2GEEA 5BO1H 4NRYB 1GIGL 1SEBA 3EO1B 3G5ZA 1PX4A 4KHTH 4Z9KB 5IMLA 1MHHB 5ICZA 3BW9A 1ERNA 2DL9A 4OZHE 5DR5H 5D1ZA 4NWTL 4Q9QL 1B6DA 3L7FB 1A3LL 3C8DA 4FFZL 3I9GH 2E27L 3OB0H 1BIIA 4RFNC 4XNQB 2YD3A 3I75A 3PF2A 3QAZC 2A2QT 2CKBB 4DGYH 5ERWA 5B4MD 3BZ4A 5T3ZL 1DLHB 1ONQB 1C1EL 3TWCL 1U8IA 4WU7B 1UC6A 3BQUC 3LN4A 3RIAF 5AD0B 2NX5D 2Y1VA 3H7BA 1RZJL 4ZPTA 5HHNB 3S88H 4L8BA 5I16A 1XAUA 4KKAC 3GSQB 5IK3A 5DZNA 3MNVB 4P2RA 1X5JA 4R0LB 3RY4A 4Y0GA 1X5KA 5BS0B 1IC5H 4GAJL 5J56B 1BVKB 1DEEB 4LOUD 2H2SD 1OAZH 3EYVA 1Z9SA 4TPRL 3HNSH 3S37L 4NCDA 1J1XL 3QIUD 3BGAA 3U1SH 4D3CL 1IE5A 4G6KH 1G9MH 4PY7A 5F3HA 4LASH 3MUY1 2DYPA 4HQQL 2VLKB 3MODL 3QNYB 1A9EA 2B4CC 1F3JB 4M7ZC 1CE6B 4L4TB 3OGOE 3U0PB 1MQKL 1LO4L 4GBXD 5IEKA 1UH2A 2FWOB 3P4MB 1JTPA 3RVTD 4RISH 4NP4H 4UBDC 1FO0B 1A5FL 1IGIH 3CCHB 4Y8DC 4HUXA 5CBEB 4OZ4A 4P46A 3EKCA 3ILPA 3PWLB 4LSTL 4B50A 5HHQB 1MUJB 1YMHA 2EYRB 4Y4HB 1RUPL 1C5CL 4OCYH 4X6EA 5E6ID 5SX4H 1R3HB 4Y16B 4U1NA 2QADB 4EOWH 5F7DB 3C5ZA 4JO2L 5GGSA 1UB6A 3SDDB 2UYLA 4L3CA 1IGYB 3UBXG 5HHOE 3MV7D 1DQQB 2OZ4A 3BEVA 2PO6A 4WUKH 2DBJA 5T1DL 5I15H 3WO3B 1I75A 1U3YA 3JSSA 1YEEL 1Y0LA 3RIFF 1Q9KA 4L29B 2RIKA 3VWKA 1T0MA 1NEZG 2PYEA 3G08B 3I2CH 4U1LA 4QRPA 4HFWA 4PRNB 1A6TA 4WENB 1OB1A 4I0PC 12E8L 1T1ZB 2GSGB 3EOBA 4JFDA 4ODWB 5K33A 1DBAH 3QDJE 1M71A 3SDAD 5EA0H 3HTLX 2XZZA 5AAWA 1FL5A 4X9IA 4U1KB 1X5YA 4ONGH 4GSDH 2UZYB 1UKTA 3BGMA 4OUOA 4RGNE 1OAQL 3QQ9C 2WLYA 2PCPB 3VXRA 3WJJC 1NAMB 3MV7B 4MLIA 4FQQB 1T66D 1YUHB 3W81A 1RHFA 4KZEH 5L0QB 4JFOA 2DF3A 1MCPH 1NLBH 1U3HD 5ADPL 4ZFFA 1QEWB 1JBJA 1V7NL 1IBGL 3RWJA 1B3JA 2P43B 4GAYB 4Y19D 1BBJB 3P77A 4Z5RA 2FGZA 3IDNB 4ALAH 5E99H 4POYA 4EZMA 2AXGA 2Y07H 3KYKL 5EZJA 2X7LB 3L7EA 3WIFB 5IEHB 2J3SA 3SY0A 5A3IC 2FIKA 3ROLB 1MHPH 3H0TB 4ZUSB 4N8CH 2OL3H 1JPGB 3TVMC 4Y19B 3PL6A 2A6JA 1JN6A 1HZHL 2VOTA 4YDLC 4IDJL 4QT5B 4FS0A 3AMKA 1R0AH 2FSEB 3FOLB 2CDFA 2VDLL 3VJ6B 2GJ6E 4D9QE 3D3VD 5E5MA 3U7AA 3CMOL 4ZO9A 1MCRA 4WHTB 1F97A 4HPOH 1CDYA 1K4CB 5DFTA 4NC2B 3IXAB 1GGCH 2X42A 2MTPA 3RZCD 3IRZA 4GKZA 5AUMA 1JHKH 2XWTB 2YA1A 3JWOC 1F4HA 3BE1H 2HKHH 3VMNA 4PJDF 2BCKA 3QEQA 4UBDD 3MGOB 3GM0A 5IIEA 5DJZA 5KSAC 4HH9B 3ETBF 1CS6A 3DX6A 2ENSA 3ES6A 1BEYL 1HHHA 4QRQA 5L2JB 1S78D 5D6DC 3P9LB 1MIEH 3WUWA 3QCUH 2A6IA 4GRWE 1OW0A 4ELKA 2OJEA 3PGCB 3P11H 3P30H 2IGFL 2GITA 4J3XA 1YNTB 3FT2B 2BC4A 1EJ6A 2O5ZL 1MLBB 4X0KA 4L3ED 2GFBA 3F58H 1AO7A 1JWSA 4S1DD 2A1WH 4BFEA 2Q6WB 4JPWH 1OAXL 2JCCA 4WDIB 3V6FA 3V95A 3SDCD 5E2JA 4ODTH 2I5YL 4FQJL 1GXEA 1T1XB 1I8IA 4R3SB 5ETUA 5TQ2H 4CN6A 1KTDA 3JTSB 5FM5M 3SGJA 2BDNL 2NX5B 1BQLH 3X3GH 1K8DB 2OZ4L 2YPLE 2QBWA 2E7LC 3C9NB 4S1SH 1QFPA 2UWEF 3O9WD 4I9WE 3U82B 2PTVA 3JV6A 1EK3A 5JORB 3RWFB 3MRPA 3V7AG 1BD2B 4QCIA 5B8CA 1N2RB 1XF2A 4DKFL 1DLFL 3MX0A 4PRPB 5F7MC 4X4XB 4HUMB 5M7QA 3T04D 3TPKA 1O7VA 1R3IL 3EFDL 2GK0B 4D0CA 1EO7A 3QDJD 2CUMA 5DO2C 5FUOL 4IRJC 3ULUL 2HN7A 1LP9B 4JFEA 1WWCA 2DTML 4LP5A 4UIMA 4LGPB 4W4NA 1UEYA 2GW5A 2WBKA 6FABH 1X5LA 2FZ3B 4IRSA 4TOYH 1MH5A 4V1DD 4DCQB 3L6FA 3LKQB 3CLEH 5CJOL 4LVOC 4ODHL 3BGFC 1S9KC 5I8OL 4GG8A 4G7YL 3RWIB 1AHWA 3QJHA 5DK3A 3VW3L 2VAAA 2XTJC 1BM3L 2EC8A 4TUKH 5BVJA 2VLMD 4GRMB 1P7HL 3QUYD 2OJZL 4EDXA 3O6ML 3FQUA 3GBLA 3G5XA 3U0TB 3GMMA 3R0NA 3V5DB 1TZIA 1YEJH 4I3RL 4XMKH 1JYXA 1HH6B 4BZ2H 2LAGB 2HMID 4NQVB 5BZWA 4GAFB 5IFJB 5A40E 5IMKA 2W9EL 1DQLH 3QZWG 5DHVA 4TTDC 5EU3B 2R0KL 1QYGH 3A6BH 2Q7YB 1Q9WB 5IKCB 2AKRA 2OR9L 4XC1L 1FZOB 4X6CF 3S35H 4K2UH 3W39B 3P9MA 1S9WB 4LHUB 1OTTD 3QHFH 3E6HB 2R2BB 2ZPKL 1QSEE 1YEIL 2D7PA 5LGKA 1J86A 2ZCLH 4XGZB 4PUBH 4JFQB 4NQEA 3GKZA 1KCKA 4KKBC 3CVIH 4YHKH 4MA1B 2XICA 2PW2A 4H26A 4LCCA 3IJHB 4M7ZB 1TVHB 3FFDB 1T5WB 2G75B 4ZFZA 5DJCB 3LEYH 5GIRB 4LPXA 3I02B 4KU1A 3KPMB 3FMGL 2XN9A 3MNVA 4P2RB 4J1UA 1V7MH 4KJWC 1LEKA 1MJ7L 8FABA 1U6AH 4EI5D 2MSPA 4GBXA 1MHEA 3ZT6A 3VI4F 3BKYH 3BUTA 4MMXC 5HJ3A 3OBAA 2XA3A 4K07A 1P2CB 5JW3L 1PYWB 4U7MA 4DZ8A 1KJ2B 5L6YL 1YEDB 3QG6B 4DKDC 3C8KA 2BHUA 2YPLA 3RHWF 3T3PF 5I66B 3MRBA 3T2OA 1QP1A 4NM8L 3WJLC 3KR3H 2F19L 3CVHL 3ARVA 1OQOA 1ZS8A 1QFOA 2J1KA 4P46B 4K7PL 5BCAA 3MLUH 1WFTA 3VWKC 2PO6D 5FOBA 1QKZH 3TBTB 5D6CA 1JCKA 1QLRA 2EYTB 2J5LC 2LU3A 4UILL 4UQ2B 1DBKH 1ITBB 3C5ZB 1MFEL 4LLMB 3RVTC 2A77H 1UB6B 1I3RB 3IVKB 1V3MA 4MD0B 2LU7A 1MFDH 3GJFB 4K3JH 3GSNB 1X5XA 4LVHC 3V5KA 3SDAA 4Z7VA 1FFNB 4L29A 2XRAL 1I8KB 1MQ8A 4RGMB 3CVHA 4V1DE 5I75B 1NMCB 4ZYKA 1LDSA 1VFOA 4LLAA 2GTZB 4BQ9A 1U3HA 2VXTL 4YGAB 2FH8A 1G7PA 5EUOE 5IBTL 2R2HA 3PGFH 5E94B 4LCCC 4X7TB 1FAIH 3QEUA 1UCBH 5M95B 2R4SH 3PQYE 5F1IB 3UBXB 5I8CA 4YR6A 3C6LB 1YYML 5F3BA 3ARSA 5IVXE 1LHZA 4KUCF 1YPZA 1BOYA 5DRXA 5FUCE 1CIUA 1FE8L 4ZFFB 1BREA 1RZKH 3R1GH 2E7MA 5MERA 2BNUA 2IC2A 4I2XE 3ARDC 3U7WL 5EWIL 1AXTH 3MNWA 4KTEL 3FB5B 5IBLC 5C09E 1FCCA 1EO8L 1T1WB 3TC9A 3CFJB 5SX5H 5K9JH 4HGKC 3KLSA 4ONHB 5IG7A 2V2WB 3BUYB 1XZ0B 3FFCB 1DVFB 2EZ0D 1SJVA 3H42L 2WINA 2V5YA 2VWEE 2F5BL 4JFXB 3EDFA 1CFTA 1BZ7B 4MYWB 4X6BA 2BVQA 4R8WH 1T2XA 3QEQD 1P9MC 2VXVL 4P2OA 5B21A 4XBPB 3TIEA 1LO0L 2V9QA 1XF3A 2FX9L 1BD2E 5GGSY 2HT3D 4NRYA 4G80A 1T5XB 4XNXH 4HKJB 4PJGE 3TCLB 5H2BB 3EBAA 1AKJD 2B0SL 2P44B 1G7LA 3BW9B 1OAKH 5ABDE 1BVLB 2VDKL 5IB4A 5DJZB 4LSQH 2IQ9L 1QLFA 3BT2H 4NN5C 4CVZB 4KZDL 2VLJB 2IAMB 2NTSP 3SDCA 4Y5YB 1GGIH 5FF6B 5FCUH 1J10A 1WT5A 1NAKH 4BK5A 1J0KA 2E7HA 1K2DA 5KSBF 1CBVL 1UB5B 1IAOB 3PP4L 1A6PA 2Q6WA 4ZUUA 1K4DB 1LGVA 4G9FE 5FHBL 1JZ6A 1AKJB 4Z0BL 3V7MA 4PGJA 2YA2A 4E0RA 3MCLH 1UJ3A 2BNRB 3TESA 4MZ3A 3O9WA 5A2JH 4M48L 4Z0XA 4DVRL 4NNXB 1BVKA 3OTTA 1KBGL 1HKLL 3NCJL 4GW1A 5B39A 3GMNA 4JJ5B 5C07D 1L7IH 3AM8A 5JIHA 3SO3C 3RWHB 2EE2A 2PKDA 4RBPH 2X1QA 3TBVB 2AJYL 4ODVL 4YXLH 1NBVL 2EH7L 5EC2A 4OBSA 4R4BB 1FFPB 1EPFA 3ZKSD 1LE5A