1I8KB

Crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVASISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGYSSTSYAMDYWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAI
publication title Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i8kB00
5KN5B 2OR7A 1A6TB 3RIFF 4PY7B 4NBZB 2XZZA 1OY3B 4LFHD 4OD3H 5K9OA 1FFQA 4RAUB 1FHGA 3MLYL 1DLHB 1L7IL 4K7PY 2GK0A 2EDEA 3QFJA 1NGQH 3BDYL 5C0BA 2OTPA 4FABL 5GRJH 2EE9A 1E27A 3BQUD 5AG8A 4Z6AT 2Z91A 1KV3A 1B6UA 3KPPB 3FTGB 3DNKA 4NM4H 4U1MA 5DLML 5LAXB 1C1EL 5TE4L 3LEVL 4LVHC 3KPLB 4CNIA 3FQXA 4YXHL 5EN2A 1AFVH 3KPOB 3TC9A 5IHZB 4W6WB 3OZ9H 1QR1B 5ID1A 4R8WL 5IOPA 1QVOB 4WHYG 4MSWA 4R7DB 1UVQB 3LY6A 1ZAGA 4JHZA 4X6DE 1N7MH 5HYJE 4AEFA 5FHAH 3GM8A 3WSQH 1AR1C 1DE4B 3DO7A 3D0LA 5IBLC 3IJHB 2YD4A 1PW3A 3H8NA 5FCUL 5LBSH 1KB5H 3EJJX 4H5SB 4PS4L 5FHBL 2HJLB 4CAGA 1AE6H 2BXYA 3TESA 2B20A 3O2VL 4ONGL 2ZNXA 4J8RB 2NY1D 3NBNA 4OTXL 1IRAY 2JF1A 4Z78B 3QFJE 3MNZA 3OSKA 4U31A 5IFAH 2P5WD 5JIPA 2AEPL 2NXYD 3C8KA 4R4ND 3VFTB 1BQUA 3FT4B 3GEWB 3BW9A 5FYLE 2ZWLT 1J88A 3MUZ1 2CLRB 5HHMB 3PWNB 3QG7H 1ZHBB 4KKCC 5F1KC 5A2IH 1VEMA 5CP3H 5DMJB 5E08L 3BE1L 2ARJB 3RHWK 5JZ7C 4TUOB 1KELL 5D7SL 4UT6H 3FB5B 1FZKB 5DD5H 5DK2A 4U1KB 1G6RH 1BAFL 3AC0A 4HMCA 3DSNA 1N3NA 5FM5M 3X11B 4TUJA 5EBMB 1GZQB 3RPIA 3EGSB 1OTSD 4P57B 4X9IA 5I1AB 1KIPB 3TYFA 3IDYC 1HOCB 2VYRE 3IDIB 5C2BH 4ZTOH 1A4JB 3C5ZD 2WP3T 4AQOA 4RWYL 1CIUA 3I6KB 3PWUA 1XR8A 3TVMD 3WEXB 2BNQA 5D7KD 1S7RB 1XH3B 5FYJH 3QWRA 2EYTB 4JFYA 4HQQL 3KYOB 1G7HB 4X9GA 1N8ZA 2XZAL 4LCWD 5HVWA 3S4SG 4EXKA 2IG2L 1JNJA 5IMLA 2DWDB 5HGAA 4KZEL 3MBXL 1PZUB 4KJWC 5DEGA 4JZJA 3SE9L 3VH8A 5EBLB 2C7UB 5EORH 1DL7L 1WCBB 2F5AH 4GKOA 3MJ7B 1ZVSA 25C8L 4HJGB 1A3RH 4F3FB 4FQCL 2YD6A 3T3PF 1SVZA 5E99H 3HE7D 1S3KL 1C5CH 4JG0L 4O5LL 3V4VL 1T21B 3SCMB 5IBUG 1S9WB 2NLJB 5IB3A 3B2UC 4PR5A 3STZB 4M7ZC 2C3WA 2X4SB 2NY5L 1HYSC 1XIWD 1P7KA 4R7NA 2PR4H 1R3JB 1FPTH 2FB4H 4QKXB 1D9KC 3MJGX 1JK8B 4MB5A 4I5BA 4N68A 4DQOL 3QXUA 3GO1L 3VXUA 3L6FA 4P4RA 3QCTL 1FLTX 2GTZB 5C0IB 1JUFA 3QJHA 5EDXA 3U48A 1U8IB 1AGFA 3ARVA 4GAGL 2BNQE 3W2DL 3O0RL 4F7CA 4OLYL 4APQD 2VZOA 5L8LB 3KPMB 3DI2B 4NNYB 3LIZL 5IHUH 2CQVA 3IJSA 1NJ9B 3K4AA 3NCYP 1DBBL 3VFVB 1X7QA 2XQYK 4JFQB 1JP5A 1A6UH 2A2QT 1YMHB 4K7PX 3LKSA 1D9KA 1MY7A 2UZYB 1D5IH 2H6PB 4U1NA 2KQNA 5CIPB 1CD8A 2Y36H 5EZIH 1JGEA 2UWEE 1YY8B 3OKYA 3OJMB 5EZJB 4OD3L 1GOFA 2XTJB 3EYFB 4PJDB 5SWSD 3ZKNC 1M71A 4NNXA 3LQAC 3MRHA 4K2UH 2ESVB 4G9FA 1IAII 1U2CA 1NGQL 4WVRA 4PBVC 5GRJL 1DTUA 3MRLA 5E9DB 4LEXL 2B5IB 4WFFD 4NM4L 5BQ7A 1A9BA 4AH2A 2ICWJ 1CLOH 4DUWA 2FLBT 2ADIB 1CG9B 2DN7A 3TF7C 2Z35A 1AFVL 5HD8C 1JPFA 2W9DH 3OKOB 3VXUE 2CK0H 3OZ9L 1U8KA 3PXJA 5LWYH 4R2GB 3IT8D 1A6VH 4IMKA 2ICCA 2V9QA 5KG9A 5FO9A 4X5WA 1N7ML 3DXAA 3W0WA 4IRSD 5FHAL 3WSQL 3NPZB 5MEPB 4YFDB 1PAMA 5FOBA 2XWBB 5MEQB 3PGDA 5EIVA 5LBSL 1KB5L 2A6KA 2LAAA 2YUWA 1AE6L 3VGEA 4LPUA 3HG1B 4LSDA 5CZVH 5CJ5A 3R0NA 4RZCB 3B5HA 1G84A 4JDVA 1MF2H 4HIEB 5JDSB 4GAYB 5F89B 1K9TA 1TNMA 4ZS7H 3BGAA 3NCEB 4ZFFB 5IFAL 3SDAD 2DL2A 5H2BB 1QFWH 3GMMA 4X99B 4PJXE 2CDGB 5GGVH 4HHAA 3CFCH 3SDCC 2I5YH 3QG7L 5ACZA 5KVEH 1JV5B 3T04D 1KLGA 4JFFA 4QHUB 1QHOA 1MCPH 1IEAB 1IAIM 1RFDH 3BJ91 1RK1A 4ODTH 4O00A 3J8F7 2Q76B 4UT6L 3AY4C 5DD5L 5D1ZB 2DLFH 1G6RL 3BHBA 3W0WE 4RFOH 3C5SA 5JIKA 4KK6C 1D5ZB 3NCMA 4WTXA 5DQ9A 4LHJB 1RZ8A 1NCDH 1BPVA 3RY6C 3NN8B 4LPVA 3SDCA 3GSWA 3OGOE 1F4HA 1UEMA 5AAWA 4QRTB 5I1KH 3PV6B 5TF0A 4WI9A 1QSVA 1Y6NR 3RL2A 3VMPA 2P7TA 3M07A 3RGVD 3TBSB 5I74B 1FVEA 4QOKD 2GY7B 3SO3B 4OZ4A 1MFBH 3UJJH 3AY4A 1J8HE 2IADB 4B7LA 4P9HH 3HZYA 4J6RH 1T1WA 4PJBF 3SOBH 4ZTOL 3DYPA 4HKBB 4X6DB 5HYJB 3BZEA 5E2TH 3KHQA 3OJ2C 5IFJB 1WV7T 2P1YA 5FYJL 3RY6A 5E6IB 1K8DA 1DBAH 3UXFA 1INDH 3LB6D 1MQKH 3K8LA 3LDBC 2GJZA 4U7KA 1D5BA 3BEVB 4EDXA 1NLBH 4JFFE 5EU7C 1P84K 5K9OB 3F5WA 4HIXH 5EORL 2GK0B 5FKAB 2F5AL 1KLFA 1Z9OA 3GGWA 3QFJB 2Y4SA 2MJWA 2PXYB 4DEPC 1A3RL 4FQIH 2Q7NA 3SKNA 1E27B 3WNKA 2Z91B 5E99L 5I30H 1C5CL 3D2UA 4U1MB 5EWIH 4CNIB 4OZHE 5SX5H 3FQXB 4Q74A 4ETYA 4AEHH 3FOLA 2PR4L 5ID1B 1FPTL 2FB4L 4JN1H 3LPWA 2H1PH 4HKZA 2P5EA 5IOPB 4OV5B 1YYLH 2IH3A 1V8HA 4BH7B 2H2SD 4RNRA 5CUSH 3CU1A 1RY7B 3Q48A 3D0LB 1CXFA 3LEXA 4LVHB 1OSPH 4KJQD 5HYFA 5IHUL 4HK0A 3UBXI 5J6GA 4KTDH 4MS8D 1A6UL 1AD0B 4ODVH 1NC2A 1U6AH 1D5IL 4Q6IC 3OQ3B 2ZSWA 5M95B 1Y6KR 2Y36L 4NRXA 5EZIL 1U41A 3E6FA 3DGCR 5HDOA 1FL5B 3U0TA 5DSCB 2CRYA 5H94A 3VXQA 1N2RB 4P5KA 1O0VA 4F80A 3MNZB 5MHSE 3IXAB 3DETC 1QLRB 2R9HC 1YA5A 5E8OA 4K2UL 3V52L 3AREA 3EYOA 4AIZB 5HHMD 1B3JA 1U3HD 3QO0B 2GJ6A 1TCMA 1CTOA 2GYSA 2QKIA 1S7SA 4Q6IA 2Z92A 1CLOL 5EU7E 1LE5A 4K9EH 5E5MA 3UTSA 5DRZB 1TMCB 4OLZH 1MFCH 1PVHA 2W9DL 2CK0L 3FN9A 2L0DA 2Q7YA 1HHJB 5LWYL 2Y6SD 2VDKH 4MYWB 3W81A 3OR6A 1YMME 1EX0A 1A6VL 4JDZA 3CZFA 1EO8H 2NX5E 1B0GA 3FHQA 5CP7B 2EDDA 4R4FH 4PLKC 2X9WA 4AM0A 3VFWB 1AXSA 2YWYA 3ARFD 3OKKA 3TYFB 1JZ6A 4OFVA 4MGXA 5IESH 4LQ1A 2LVCA 1OL0A 3HC3H 1RZIA 2UYLA 1F00I 4A6YA 5JNYA 5CZVL 4OFPA 4LPCA 1XR8B 2VWEE 4OFIA 5DD1H 2BNQB 3QPXH 1MF2L 2GK2A 5B3NA 1RZJC 5BV7H 2HLAA 1I8IA 2QSVA 4ZS7L 3RY4A 3T09A 1ADQA 4RSVA 3NIFF 3VXNB 1OTUC 3GSNH 4TN9A 4EIGB 3V7MA 1QFWL 5HGAB 3IDYB 5DEGB 5GGVL 3S3PA 3VH8B 3CFCL 1X6NA 5FECA 5FF6A 2I5YL 2UWEB 1H3VA 1ZVSB 1NDMB 5KVEL 3RVWD 1KCLA 2BMKB 2IH1A 5F1SA 1MCPL 1RFDL 1EHLH 4ODTL 2D2OA 4GKZB 4ODXA 3SCMD 1P7HL 4KK8C 1DUZA 2DLFL 5IEKA 4MB3A 3VGBA 1KUMA 3KPSD 4RFOL 3O4LE 5HYSA 4PR5B 1NGWA 5E95B 1P7KB 1NCDL 3PP3H 5AWNH 2XXMB 5I1KL 3HI5H 4I5BB 3IKCB 3VXUB 3L6FB 4P4RB 5A2FA 2XIDA 3KDMA 3AMLA 3BDBA 1JUFB 3QJHB 1MFBL 1AGFB 3QDMA 2BXZA 3UJJL 2XOTA 4P9HL 4J6RL 4F7CB 2F8OA 4JANB 3WFBH 4LLQA 5FUCE 1LO5A 1AH1A 4M7ZB 4I48A 5E2TL 4G8FA 1X7QB 1GOHA 3ILQD 3LKSB 1D9KB 4F57H 1DBAL 1INDL 3UC0H 3FQWA 4WUUD 1MQKL 3WD5H 2BRQA 1XGYH 4PJDF 3MPCA 2ZUVA 1JGEB 3QIWB 3W39B 1NLBL 4DWHA 4HIXL 3JWDC 3MFFA 2ESVD 4Y19D 1T22B 4NNXB 1CGXA 1DVFA 3MRHB 4HFWB 4I2XE 4LBEA 5DK3A 1OP3K 3EZ8A 4FQIL 3O41A 2PTVA 5IMOA 5I30L 4MNQD 4PJAE 1GXEA 3ULVH 2V2TA 1S7VA 5EWIL 2E7CA 4PJXB 5EO1A 1WC7B 4UILH 5D5MA 1RI8A 3WKNA 2QR0A 2Z35B 1HI6A 1JPFB 4X6CF 5LGHH 5T3XH 2HMIC 4AEHL 1BVLA 3CSPA 3EAKA 4R2GD 4JN1L 1U8KB 2R1XA 3V9FA 3S98A 2H1PL 3IRZA 1NAML 3T77A 3QDME 1G7QA 1XGPB 3FMGH 4K3DH 4RFEB 1YYLL 3IVKA 5JMOC 5FO9B 4XBGA 1TTUA 1G7LA 4X5WB 3W0WB 1JJUA 5CUSL 1LEIA 1INQA 3BMVA 5FOBB 2NW3A 3ULUE 2HRLA 2XXCB 5CMAA 4CVXA 3PGDB 4DCQA 3QQNA 4NPYA 3CFBB 5I1CH 1JL8A 1MCHA 5FKPA 4WO4C 3RI5K 1DBMH 4KTDL 1UB6A 3EDFA 4TSCL 2GHWB 4ODVL 3W11C 1U6AL 3QJFA 4NN7C 5HHQA 4MJ6A 2C3HA 2PYFB 1LVEA 4X98A 3WNPA 2BHYA 2R23A 2F8XC 3ESVF 4M9OA 3H9SD 3RU8H 3GMMB 3UZVB 4OV6F 4BSVA 2CIIA 4MWFA 1LO3H 2HFFA 5TF1H 4HHAB 5J6HA 5D5ME 2DD8H 4WGVB 2I24N 1BD2A 5ACZB 3PNWA 4JFFB 4LPWA 4TNWK 4K9EL 3P40A 1RK1B 4Y4HA 2YPLA 4OLZL 3MROA 4P2QA 5I2IA 3TFKC 1MFCL 4S1DC 3S96A 3D39A 4PJCF 2EE3A 3LPFA 4OB5H 4IOFC 2VDKL 4QHKI 3C5SB 2RCSH 1YC7A 1EO8L 5DQ9B 5EU6A 1BHGA 4R4FL 4OZHB 3SDCB 4DKEH 2EDWA 4EI6A 4OCYH 5EFIB 3DX9A 4RBPH 2SEBA 4NUGH 4MMZC 2P7TB 3BH9A 3BP7A 3QPQC 5SX5K 3TA3C 1AJ7H 4X6DF 1PLGH 4X4ZA 1FVEB 5IESL 5K9KA 3HC3L 5FUOH 2HJKA 2FX8H 1KIRB 2APBA 4JQVA 1NKOA 3HZYB 1T1WB 4GBXB 2D7TL 2BCKA 2OL3B 5DQDH 4FRWA 1UM4H 5DD1L 5AEAA 2A6DB 5E6ID 3CXDH 3QPXL 5BV7L 2E9WA 4XHJD 1K8DB 5I8OH 3GSNL 1HWHB 4RAVA 2GJZB 1F02I 5I8EB 5TPWH 1I1RA 2CJUH 1D5BB 3TA3A 4GRWH 2FH6A 1JCKA 4EDXB 3MR9A 3NIDE 4JFDA 1T04A 2MPAH 2YPLE 3CAFA 2L4OA 2PXYD 2GJJA 3GGWB 2OTWA 1P5UA 5CLTA 3SKNB 1EHLL 2QEJA 4X0KA 5IMKA 5FYLD 4TUKH 5DD6A 4QRRA 5EU6E 2OI9C 2B1AH 4PJ9C 5DVNA 4L8SC 3LDBB 4HS3A 5TDOB 2Q86B 4KRLB 1HH9A 5AWNL 4L5FH 3UPCA 3OB0H 4YHZH 2E7LC 4HKZB 5IW1A 3HI5L 5HXMA 5JXEC 4DEPB 2P8MA 2IH3B 3IAQA 5DQJA 1YMMB 3QRGH 2NX5B 4HKJA 3ZTJG 2VLRA 3WFBL 4PJ9A 3DVNA 4L8SA 4HK0B 4PRPA 5JW4M 4D9QD 2J8UF 4WW1B 3RJDA 5J6GB 1TITA 2OCFD 4LCYB 4UOJA 3WIIL 1QEWA 2UV3A 5JO5A 3OHXB 4YPJA 4F57L 4OZIA 3UC0L 3QXAA 2ZSWB 3GBLA 3WD5L 1XGYL 4NRXB 2NXZC 5JXEA 3E6FB 4JQXC 1T0MA 1AO7A 2VAAA 3OPZH 5E2VH 3U0TB 3AM8A 4J3OC 1C16A 5H94B 3LS5H 4P5KB 2IBZY 5IBLD 3H0TA 1FSKC 1KJ3H 4DTGH 3W9DB 4OGXH 1BECA 5FGCE 3ES6A 1FH5H 4CN1A 5GJSH 5E8OB 2Y25A 3EYOB 4XP5H 3GMPA 4QRRE 4C83B 4TVPE 5T3ZE 3VGDA 3WO4C 3ARGB 4GRMA 1P9MC 3ULVL 2QKIB 3DUUA 3AS1A 4Q6IB 3QWOB 4UILL 1MFAH 4HD9A 3RL1A 5E5MB 1LE5B 1VACA 2A74A 2HWZH 4JQXA 3QNZA 5LGHL 1NBYA 5T3XL 1UC6A 1NEZG 2GTWB 4W4NA 1JPTH 4OD2A 4U2ZA 2DQUH 3PHOA 2R1YA 4JDZB 3S97C 5D96C 3FMGL 1B0GB 2BOCA 4K3DL 2GFBA 1HN1A 4X5LA 4KKCD 2MFNA 4PRPE 5C0AA 3O4LB 1AXSB 5KAQG 3QDJA 5JZ7D 1EERB 1DUYA 4ZXBC 3OKKB 5I1LA 5I1CL 3BSZH 1SJHA 3L7EA 6FABH 4F7EA 4OZIE 2UYLB 1DBML 3QQ9D 3PP3K 2P8LB 4A6YB 2BK8A 5JNYB 1AO7E 1A7PH 4NQEA 4OCRH 1OF2A 2KPNA 5C08D 4W4OC 2CUIA 4WHDA 2ICEA 1GYAA 2OR8A 4U6YA 2HLAB 1I8IB 2WW8A 1R5IA 2X4PB 2J2ZA 3ORJA 3P4NA 5FO7A 1MFDH 4ZXBA 1FO0A 3RU8L 4GUPA 2UWEF 2VLJE 4AZ8A 3RZWA 2Q1EA 3FO9A 1LO3L 5TF1L 2RHEA 4P46C 4IDLA 3VI3F 2J5LC 5FF6B 5FECB 2A9NH 2DD8L 1MIEH 2CH8A 4FMKA 1KTKE 3BFOA 4W4OA 3V5KA 5H8DA 5JOPE 4P3DB 3K3QA 4OIAA 4MXQC 1T6VN 4I2XB 3WBDA 4YHPA 1DUZB 3L95A 4KI5F 5IEKB 2C26A 1CFVH 2YPVH 4OB5L 5GJTH 1OGAA 5MEOA 4PJAB 5HYSB 5JHLH 1NGWB 2RCSL 3QUMH 4KI5D 3KJ4C 3ZDYE 5EIIA 3QDJE 4X8XA 4JY6B 1I9IH 4P46A 4DKEL 4L4VA 2D9CA 4OCYL 3VXUD 3X14A 3A0OA 5KSVA 4NUGL 1EZVX 4JCLA 1AJ7L 1PLGL 1I7UB 4NQEE 5FUOL 2PO6C 5CZKA 3QDMB 3B2UD 5TFSH 1WIPA 5DQDL 1A64A 1UM4L 4LSTH 1LO5B 3WJLC 1HYSD 1JF5A 4PGDA 4JJ5A 4EBQH 3GHEH 1KJMA 4I48B 2C1OA 3PGCA 2MQCA 3CLEH 3CXDL 4HLZG 1DN0A 1WBZA 3FQWB 5I8OL 1A6WH 2QQQA 3QIWD 2IQAA 3RWIB 1AI1H 5TPWL 2CJUL 2CXGA 4MX7B 4UU9A 4ZOEA 2PO6A 4FTVD 4OM1H 2FJHB 2G2RA 4M7JH 4CDHA 2FIRT 1V3LA 4N0UA 3HAEA 3MFFB 2MPAL 1IQWH 4XCNB 5DC0A 1NKRA 2W0LA 4MA7H 2AJUH 4LBEB 3WJLA 1R3IH 4QY8A 4PJXF 3O41B 1Y18B 5IMOB 1OGAE 1VESA 4G6FB 3PF2A 4CU8A 2V2TB 1S7VB 2VZUA 4TUKL 3VXSA 4NQCD 1I1CA 1NGYA 2B1AL 5D2LF 5D5MB 2QR0B 1HI6B 4P49A 4WU7A 2K1MA 4DOHE 1J8KA 4O2FA 4YIQA 5L2KA 5F96H 3LPGA 4L5FL 5GZNC 2R1XB 3R4DA 4YHZL 5GIRA 4L9LA 4HG4J 1ZE3C 2ED8A 4NQDA 1FC1A 3RWHA 5DI8A 3SKOB 3IVKB 4XBGB 1YUHB 1G7LB 2ZCLH 3D18A 1WAAF 2XKNA 3RWEB 1A1OB 1LEIB 4HWBH 1INQB 3OMZA 3QRGL 5F9OH 2NY5C 4CVXB 5CMAB 4JPWH 4DCQB 4XT1C 1T7VA 5HD8D 3BKMH 2FDBP 1W0WB 1IM9B 4Z7UA 5FKPB 3GMNA 1XR9A 5IHBA 1UB6B 2ADGB 3QJFB 4GS7C 5HHQB 4MJ6B 1J8HD 1TVDA 4RBPK 4LHUG 4X98B 4N0UE 5DR5H 3OPZL 5E2VL 2R23B 4Y16D 2UY7A 1OARH 3BVNB 1T66C 2PNDA 3LS5L 4FFVC 3P4MA 4XB8A 1S7XA 1KJ3L 4DTGL 4NQUA 5KOVC 4OGXL 2X4RA 1FH5L 5GJSL 6CGTA 5FGBC 2ZP0T 3DUHA 4XAKE 2CIIB 4XP5L 2VDNH 4MWFB 3VXSE 3ZMRA 4BSVB 1PDKA 4WO4B 3JTSA 3P77A 1I3RA 4JFFD 4NN7B 3DMMC 1BD2B 1XF4A 3QAZC 5DJXA 4EUPG 3PNWB 1G9NH 3RAJH 1MFAL 1WICA 4QCIA 2VO5A 2HWZL 3ZDXE 4J3TA 2YPLB 3MROB 4XNMB 1BFOA 4LRIA 5KTEH 4NQDE 1JPTL 3T0AA 4F7MB 3RIFK 5CGMA 4OZHF 2APXA 2DQUL 2P42B 2VITA 5IB1A 5EU6B 3B3IA 2PW2A 3HNTH 3EIFA 4EI6B 3EUUA 1KPVA 3DMMA 3P9MA 3WLWC 2SEBB 5DFTA 2G9HA 3KLAA 1TDQA 3MXWH 3BH9B 3BP7B 3BSZL 4EZMA 1YN7A 5L7XH 6FABL 5K9KB 2HJKB 4GBXD 1S5IH 2DIJA 4UNVA 3ARRA 5GS0H 1MJUH 1K4DA 1A7PL 2VC2H 3OB0K 5DJ0A 3A6BH 5I66A 4OCRL 5E5RB 2P48B 3MRFB 1CDUA 1ITBB 1P7QA 4M3KB 5SWZE 2YMXH 3ROOB 1BZ9A 4M5YH 3G5ZB 3LKNA 1MFDL 4RAVB 2JJUA 3TBVA 3TA3B 4JO3H 4LIQH 5KSBA 4KROB 1WVZA 4G6JH 5B38G 2IEPA 1FZJA 2Y7QB 3B4NA 2A9NL 1MIEL 1T04B 5MHSD 4LSVH 4PBXA 4M3JA 2OTWB 12E8H 4OZFB 3WXVH 3NZ8A 5AAMA 4Z0XA 4X7SH 4Y1AA 5FGCB 1HSBA 5IMKB 2ZOKA 4ZFGH 3CUPA 4QRRB 5DD6B 5MERB 1CFVL 2YPVL 5GJTL 5JHLL 3QUML 1MY5A 3ZYZA 4RCAA 3V6BR 3ECBA 1I9IL 4UOW1 1HHKB 4M9PA 1NEZA 1NUFA 1HH9B 1FC2D 3Q6FA 5IW1B 4ZUUA 5EU4A 1CIDA 1KPRA 2P8MB 3OG6B 4BZYA 3T2PA 2CUHA 1UM5H 1YMMD 3WV0A 2NX5D 5DQJB 5GRXG 4KY1H 1T0PB 1IZJA 5MP6H 4ODUA 5TFSL 2OI9B 3P73A 1KENH 4HKJB 4PJ9B 2DF3A 3FQUA 4L8SB 4LSTL 5GZOC 4PRPB 5JOEA 4MCZA 4HKXA 1EAJA 4EBQL 2ZUQB 3GHEL 3M1BB 3CLEL 5CP3A 3V5HA 1UYWH 3SPVA 2NY4C 4N9GA 4WW2B 1QEWB 4OZIB 5KSBE 1DEEB 1CDHA 5D7IA 1A6WL 3DOSA 1AI1L 1XGTB 3I9GH 1T0MB 1AO7B 2VAAB 3PGFH 2GKIA 5ACMA 1S9VA 1CBVH 1G6RA 4DN3H 5IBTH 4OM1L 4M7JL 2WLYA 4F8QA 4Y1AE 1IQWL 3C2AL 4I3SH 4MA7L 2AJUL 4OZGA 1R3IL 5ENWA 1CFBA 3GMPB 5GHWH 1T7XA 3RVXD 3ARGD 3QQ4A 4HH8A 1ZANH 2VLJB 4GRMB 1JFQH 3DUUB 5AG9A 2GT9A 4LGSB 4WDIB 2CRZA 3RL1B 4EN3C 2NXZB 1I8KA 1VACB 2A74B 4PPTA 2FNBA 4D94A 1NBVH 1NBYB 1T1YA 5F96L 3E6HA 1FSKB 3UCRA 1SEQH 4Z7OE 3UEZA 2BP3A 1S9XA 3DUSB 3BN3B 3PHOB 2R1YB 2BOCB 5T1LB 3VXTA 2GFBB 3O4LD 2ZCLL 2BY3A 1LO2H 3WO4B 4K7FA 4R97C 4HWBL 3T2QA 2LV4A 4UB0H 4WI2A 1RIHH 5F9OL 3QDJB 1A6AA 4NP4H 4JPWL 4H0IA 5I1LB 1DUYB 2CMRH 3BKML 1PYWA 5EU5A 3AUVA 4EN3A 1SJHB 3L7EB 3FCTA 5EOQH 4F7EB 3RUGA 3TH2T 1ZT1A 4ODSH 3U4BH 3MREB 1KEMH 4PUBH 4KVNH 4NQEB 2C3XA 1OF2B 2D31B 3EJZC 4JM2C 4PLKD 5D96B 3P11H 2ICEB 4XP6H 5DR5L 1XMWA 2FECI 3P4OA 1OARL 4OZGE 1TETH 2F74A 3P4NB 1F3DJ 4ZXBB 1YEDB 2YBRA 3F8UB 4GUPB 1DBJH 1PBYA 2VDNL 3S3SA 1S7UA 1XF1A 5HGBA 4JGUA 4LLMA 1R3KA 3IAPA 1G9NL 2Q6WA 1NCAH 3RAJL 1AD9A 4JM2A 2QQKH 4PJAF 5FYJE 2XI9A 5KTEL 3S3JA 4OT1H 4V1DA 2QSTA 3QHFH 4YHPB 3L95B 3HB3C 1C5DA 2MCG1 1D5XB 1OGAB 2EIZA 2YA2A 5MEOB 1MCQA 3PWPA 3E0GA 5EIIB 8CGTA 1H3UA 3ABZA 4P46B 3HNTL 2J5LB 4P23D 1MQ8A 4DOHB 3RUGE 3X14B 2XFXA 4KJYA 3WHXB 1UXWA 3FJTA 3MXWL 5KW9H 4U1HB 3KLHC 4K7PH 5E6YA 2NY2C 1JF1A 4YFLF 5C07A 3UBXG 5L7XL 1VHPA 1XGQA 3AS2A 4I4WB 5DK0A 1S5IL 4KAQH 3ULUF 5J1SC 2H2PD 1IMHC 4MVBC 4XH2A 1MJUL 2AXHA 2VC2L 5GS0L 1V7NH 4ZPTA 3A6BL 3ULUD 4PGDB 4JJ5B 3ARXA 3KJ4B 1KJMB 2C1OB 3PGCB 5F1OB 5DHXB 5DEFB 4G8GD 3W5NA 4PG9A 1FIGH 2YMXL 1DN0B 1KG0B 1UWXH 1SYSA 4M5YL 1WBZB 2FGWH 3P9LB 5C0GA 5K9QI 2IQAB 4J3VA 4JO3L 3BRDA 4LIQL 5BOPA 4UU9B 4G6JL 2PO6B 5CD5C 3LMJH 4KGLA 2G2RB 5IB5A 4N0UB 1G1CA 4LSVL 4AL8H 4QY8B 4V1DE 12E8L 1A7QH 3WXVL 3VI4E 3UZEA 5J12C 5D5MF 2R4RH 4X7SL 1IL1B 2Z8RA 2B8OT 4LP5A 3PWPE 4ZFGL 3VXSB 2DQHH 4EUPA 1NGYB 3QEQE 4XPBH 4YDVB 4HBQA 4WU7B 1FGVH 4ZYKA 1FFPA 4O2FB 5DVLA 2X1PA 5A40E 5H37H 4OKDA 5D2NC 5C07E 3MLRH 5A3IC 2MWCA 4NQDB 2WZPD 3RWHB 5CBAA 5DI8B 3D18B 3VWJC 1UM5L 2XKNB 3C08H 5M94B 1EHAA 2I9TA 4KY1L 4BSWA 2OS7A 5MP6L 3GKWH 5BOZG 3TJHC 1TENA 1N5AA 2R56H 1KENL 1IM9D 2CO7B 1FCGA 1QG3A 4D8PA 3QDAA 1H3XA 1EFXA 1XR9B 1MCLA 4GKNB 1UYWL 5J56B 4X5XA 3HHRB 4UV4H 3QUYB 5D2NA 1FL3A 3AFLA 3GIZH 3HCVA 3ELAT 2LVEA 2A9MH 2X4TB 3PDGA 3I9GL 4P9HC 3PGFL 3VWJA 4CMMA 1CBVL 5F21B 3O3EA 4DN3L 1FGNH 3P4MB 5IBTL 1S7XB 2AK4D 4JFXA 4QNPE 5I1GH 4IBLT 4MAYA 5SWZB 2R2EA 4I3SL 4MZ3A 2IC2A 4WO4D 5GHWL 5GGSY 2ICES 4FQLH 3W11D 5E1AA 3U46B 5B38A 3JTSB 3N9GH 2BHZA 1I3RB 1ZANL 4GS7B 2EDBA 4HGMA 1XF4B 5DJXB 1JFQL 1L6XA 1KPUA 1X5JA 1N6QH 2YPLD 2DLTA 2R2HA 3ARBC 1S5HA 3UDWC 1NBVL 1BFOB 2KZWA 2UUDK 2YUVA 4I0PA 1KGCD 5C9KA 1U42A 1SEQL 4OBSA 4JRYD 4I8DA 1H3PH 3IDXH 3H3BC 2Q8AH 1PJ9A 2VITB 5BS0E 5DTFA 3B3IB 1OGTA 1LO2L 1NGXB 3BXNA 1AGDA 2JK5B 1ONQA 5EA0H 4UB0L 1KPVB 3IYLW 1RIHL 1MLBA 3DMMB 3QAZB 3TBTB 1KXQE 4NP4L 4YQXH 3MRIA 2CMRL 2G9HB 3FAXA 3KLAB 4R3SA 2AV1A 3ARBA 3V6FA 3WMSA 3FRPG 3UDWA 5D2NE 4E41A 2C4FT 4S1DD 5EOQL 4XCCH 4ODSL 1ZVYA 3U4BL 4IOFD 1KEML 4R0LC 2F54A 4YUEH 4PUBL 1K4DB 5DJ0B 3FFCE 1F3DH 4KVNL 2Z0BA 5I66B 2EE6A 5KSUB 3P11L 4XP6L 5IJVA 3KAAA 4U2YA 3BWAA 4MXVE 1BZ9B 3VD5A 4LPXA 2W1NA 1TETL 5F8QC 3QPQD 5T1MB 3EO1A 3ZLQC 1R5WA 3UO1H 3BRFA 3I75A 1AY1H 4KROD 1DBJL 3TBVB 5A2KH 4PJGF 4XCEA 4L3EA 5CCKH 2BVPA 5KSBB 2XKSA 5I8CA 5ILTH 2MHAA 1NAMA 4KUCF 1FZJB 3B2VH 3ZZ1A 3ZYOA 4Y5XC 4R0LA 1U92B 4XNZC 4YGVA 4KUCD 1M6OA 5HI5C 2X4QA 1NCAL 3WL9B 4JHBA 3KXFD 4I9WE 2QQKL 4Z0XB 4Y1AB 2L7JA 3CH8A 4FHBD 3U36B 1HSBB 4QRRD 2ZOKB 4OT1L 4TVPD 1DN2A 5I18H 1KB5B 3VXRD 3EDDA 1RHHB 3PDOA 4AENA 4MA1C 1DSFH 2KL6A 1G1YA 3DYMA 1LP9F 3VGGA 4XAWH 3RX5A 3Q6FB 3MNVB 4K9EC 2V5YA 4Y5XA 2EXYD 4LFHG 5KW9L 1UT9A 1ND0A 2F54E 3CFKA 4K7PL 4GXUN 2ZPKH 1GSMA 3QG6A 1BOGA 1FVDA 1IKNA 1Q38A 3WDJA 3V0VB 4KAQL 3I2CL 3I6LD 5C0FB 4YWGL 4PRPD 3P73B 2R0ZH 4HK3N 4WW2F 1V7NL 5GGUA 2QQNH 4HKXB 5IR1A 1JGDA 3D69A 3V5HB 3ZHKA 3QCUH 1FIGL 3SPVB 2H8PA 3T1WA 3QSKB 4L3EE 2V17H 3ESUF 2FGWL 1AO7D 3KS0H 1HE7A 2EDHA 4PJ7E 3LVEA 3O4OC 3IFOA 1S9VB 4WCYH 1G6RB 4Y4KD 1F4YH 3HS0B 3EKCA 3LMJL 4LLDB 2I60H 3CDCA 3VGAC 5L2JB 2VOTA 1H8OA 4WEBH 3MRMA 1SBBA 3H6JA 1UFUA 4WUKH 4AL8L 5BV7C 2AABH 4OZGB 5ENWB 1A7QL 1BM3L 2AJVH 4PD4K 5GGVY 3KPRA 3O6MH 4K8RH 2VLJD 4ZG1A 3EW3B 3GJFA 3PDDA 2E7HA 2DQHL 4QXGH 2GT9B 2RBLA 4XPBL 1Z6JT 1WF5A 3DURA 4KKLC 1FGVL 3TZVD 1T2QH 5JOPD 1T1YB 1FYTD 3E6HB 1KCUH 4EVNB 1S9XB 3MLRL 4JKWA 1T20A 2DLGA 4WWKD 4YBLC 5T1LD 1MPAH 3GM0A 2VL4A 1QSZA 3VXTB 3C08L 3C87A 1BGXH 4JFPA 4PJFF 1EEUA 2XRAH 1KT2A 1A6AB 2IJ0C 3GKWL 2R56L 4TSBH 5GGSB 1PYWB 5EU5B 3FCTB 3RUGB 1IAOB 5HVGB 3UBXA 4DGIH 3DRTB 5EBWB 4U0QB 4UV4L 3GIZL 4FQPA 4OM0H 2A9ML 4TRPH 4RDQF 3VGHA 4Z7VA 5CSBA 1Q0YH 3P4OB 1KN4H 1FGNL 5C1MB 1JWSA 5C6PB 4R97B 1JWUB 2HVJA 2F74B 2O61B 3KPRE 4OCMC 5I1GL 2RAMA 2YBRB 2JJWA 1QYGH 2YD1A 3GDBA 3PP4H 5HGHA 5BVJB 5JUEH 3UAJC 1O5DT 4PJEE 4PLOB 3TBYB 5JW5A 5JORA 2NY3D 4FQLL 3N85H 5I1DA 3N9GL 1R3KB 1UWXK 4LCIH 3N1QC 4GH7B 1N6QL 4N90E 4JM2B 4JGJA 4HWUA 3VDCA 1G6VK 4V1DB 1JI1A 2EXWD 5F7FA 1OGAD 2DS4A 1C5DB 4AMKH 4XI5C 4U1SA 1G7PA 2EIZB 5F1IA 1H3PL 3IDXL 2Q8AL 4MJIA 5HY9A 3PWPB 5EULV 3ULVC 4JVUA 1ZHKB 3QEQB 2CDEA 5KS9A 1FL6A 5JW4Q 2QL1A 5EA0L 1EPFA 1TVBA 5SX4H 2XFXB 4YQXL 4FFYH 1U91A 5D7LA 1UXWB 1IGFH 3G04A 3ARDC 5C07B 4P5TD 4XCCL 4GKSA 1ERNA 3QFDA 1WBYA 5DK0B 1XEDA 4HUMB 1BWMA 32C2A 4W68A 4YUEL 1V3MA 4Z7VE 5HHVH 4ZPTB 3RGHA 4Z77A 4RFNC 5F9AC 4PLJC 4Y5VC 1YY9C 1IGTA 4PG9B 3V8CA 3GSUA 4LCCB 1NC4B 3BKCH 5CD3A 3ZT6A 4K71C 4ODWA 3QUZC 1IKFH 3UO1L 1AY1L 1VSCA 3ARDA 5DFVC 2PO6D 4AEIH 2NY2B 2Z8WC 5CCKL 1NGPH 5ILTL 5L88H 1SJEB 3WE6A 3WUWG 3B2VL 5GISH 4D0CA 1IILE 5F6HI 2J7LA 4P2RA 4Y5VA 5IW3A 3RVUC 4XAKD 3DI3B 5CEYA 1T1XA 5I18L 3BP5A 5FYLL 5CHNA 2I25N 2QSCH 1NFIA 3QUZA 1DSFL 2H32A 5DO2C 3ZDXF 4ZYKB 1FFPB 1HQRB 3S88H 4OI7A 1K3ZA 3INUH 5D7LE 4XAWL 1GJIA 1IGJA 4MD5A 1K5NB 2OXGA 3QZWA 2P45B 1DQTA 1EH9A 1MHHB 5J12B 2ZPKL 5J57B 2BSRA 4JEGB 2I9TB 5BS0B 2DQFB 3ULVE 2AJ3A 4MXWH 3HNSH 4MLSA 1N5AB 2R0ZL 3RZCD 2QQNL 5T3XE 5GZND 3FHAA 1XZ0A 1RJLB 3QUYD 3QCUL 5KZCD 4LDOB 4AT6B 2DQDH 5D2NB 4X80H 1FL3B 2V17L 2OYPA 3MV8A 4N8VB 4WCYL 3VWJB 3FFCB 1F4YL 3O3EB 1BBJB 1Q0XH 2I60L 4KMQA 2DJ4A 4P2RE 4WEMB 5SWZD 2X7LA 4WEBL 5T5FH 4WUKL 3DGGA 2MKWA 2AABL 3AROA 2AJVL 4MD4A 5DJAA 3O6ML 1F4AA 5E1AB 4FG6C 4UT7H 5D4QA 2V5SA 5F7EH 2BNUB 3PWVA 3GUTA 4X8JA 4JKLA 4MD0A 5HYEA 3PXHA 1KPUB 4QXGL 2DMKA 2R2HB 4E9LA 1ZA3B 4FFVD 1NEUA 3D87B 2COQA 1T2QL 1MHCA 4TOYH 1BBDH 1MCKA 1J9CT 1KCUL 3BZFA 5T5NF 2WLZA 4F8TA 3BQUC 2XG5A 1MPAL 2AVGA 2A1WH 3VJ6A 3ET9F 1OGTB 1EAPA 3FO2A 2Q3ZA 3BXNB 1BGXL 3MBEC 3MNWA 4LNRA 3MRQA 2HN7A 4M7LH 1MLBB 2XRAL 1DR9A 3V6ZB 4TSBL 2AV1B 3ARBB 3V6FB 3T0EC 1NBQA 5I0DA 4U33A 3IFLH 4DGIL 2F54B 2F15A 3MACH 1NPUA 3MJ6A 4OM0L 5K93A 3BQUA 2Y23A 4TRPL 1MEXH 4WTZA 3I02B 3BWAB 1Q0YL 1KN4L 1WZ1H 3OX8B 4PFEA 1IARB 3WLWD 5KSBF 1R5WB 3PP4L 1QYGL 2D7PA 3I75B 3ILPA 5JUEL 3UJTH 4GG6E 4XCEB 4L3EB 2BVPB 5I8CB 1UH4A 2XYCA 1NAMB 1FFNA 3NACH 2C4XA 3N85L 1SHMA 4PJ7B 4B0MM 4R0LB 4U1LA 4JPKH 1H0DA 4LCIL 3SHSA 5DJ2B 2NY1C 2WBKA 1ULVA 9CGTA 1T0NA 5C3TA 2NXYC 4R4NC 4F7TA 4HUVA 5BZDA 4PRIE 1TIUA 2BSED 4CADB 4AMKL 2E9IA 4ZD3H 4M5ZH 4GRWE 5HDQH 1CXIA 4HUNB 3L3KA 1X6LA 2P4AB 1FRGH 4JN2A 4Y5XB 2EO9A 5DZLA 4FXKA 4XNZB 1Q9WB 1OCWH 4NRYA 4LNVA 5ICXA 4FFYL 3HFMH 1IGFL 5D9SB 1ND0B 2IPKA 3CFKB 4FXLA 3U0PA 3QG6B 1F4WH 1BOGB 1FVDB 5EOTA 2P5WA 5MENA 3KWWB 3SGJA 5E4IA 1B90A 1MI5D 3H9YA 4W70A 5HHVL 4F9LC 1KN2H 4MA1B 1UCTA 5IR1B 1JGDB 3D69B 4O2EA 4WGWB 1AP2A 1OSZA 4TYUA 1CDGA 2H8PB 3T0EE 3BKCL 4ELME 4WFGE 3V7AE 4HJ0D 4H1LH 4IRJD 4QHLA 1IKFL 4AEIL 3IFOB 1YN6A 1W8NA 1NGPL 5L88L 3C5ZC 3BPOC 5GISL 5DURB 3MRMB 4LLAA 3TVMC 5C0JA 2BSSA 4DGVH 4F9LA 2PW1A 4MHHI 1KCKA 1HNFA 3KPRB 3F7QA 1PD6A 3OKMA 3R8QA 1I4FA 4KDWA 4JR9H 1XGUA 1WFUA 5EO9A 1YJDH 5BJTA 4EKXA 1KTLA 4J3WA 3MLPA 3RRQA 4NKDB 4GQPH 4PRBA 3AVEA 2QSCL 5IF0A 3DURB 5DVOA 3O4OB 3BO8A 3S88L 1Z0NA 1R24B 3INUL 1U3JA 3C5ZA 3VGAB 5FYJD 5JPMA 1JYNA 2VKXA 1KOAA 3TVMA 2P5WE 1SBSL 5MENE 5BV7B 1BWWA 1G7MB 4ZNEA 3GSNB 2F19H 4NO0B 4X4XA 1I1YA 1RD6A 1QSFE 3BAEH 4JFPB 2XZQH 2F8VA 3RUGF 2WP3O 4R4BA 3TCLA 3EOAA 4MXWL 3HNSL 3HMXH 1N6UA 5INCA 1XIWC 1JNHA 5GRZA 1BQHA 1UKQA 1UB5A 4F7PA 5IT2H 3V0AC 4J3XA 5KVFH 2DKSA 2DQDL 3MRDA 4X80L 4YBLB 1EVTC 2GCYA 3HE7A 3CX5K 3ARUA 1AC0A 2PN5A 3EZJB 1N59A 3RDTD 4Z7VB 1ZLVH 2BY2A 1OQXA 4APQC 2HG5B 3WNLA 1Q0XL 3QUMA 2NY6C 4CDGC 5T5FL 3SJVE 5HGHB 1XIWA 1J0HA 5JW5B 5JORB 2CLZA 2VDQH 5C9JA 1LE9A 4UT7L 2OM5A 5F7EL 5FA3A 4ZUTB 2AJYH 4QRUA 5IG7B 1GHFH 4DN4H 1NBZB 3DX7A 4JM2D 1QRNE 2W65A 2GY5A 3UROR 4N0RA 3VI4F 4NNPH 1MREH 4V1DD 2YSSA 5D7KE 3NZHH 4APQA 4TOYL 1BBDL 3K2UH 2VJXA 2DM4A 3KYNB 3PABA 3F7PC 1U8HB 1XT5A 4L3CA 4U1SB 1G7PB 4ENEC 5HY9B 2BVOA 3QEQD 2A1WL 4IIQC 3JBG7 3REVA 4WI8A 1FZMB 2E3VA 2CDEB 4LAQH 3WJJC 1FL6B 3BX7C 4M7LL 4DVRH 3RNKA 3SGEH 1MCEA 1U91B 5D7LB 5C07D 3G04B 5DJ6A 1OAZH 2A83A 2ZZUT 1T5XA 3QFDB 4JFED 3IFLL 5SWSA 3MACL 3T3PE 3ARYA 1IGCH 1X5KA 4Z77B 1MEXL 1AR2A 1TJHH 3CD4A 2YUXA 1IGTB 1NC4D 5C3LD 2EYSA 3GSUB 1WZ1L 1MRCH 5CD3B 4HPOH 3D0VA 1GGUA 4ODWB 1H9VA 3KLHD 3UJTL 2YN3A 4OFKA 1ORSA 3ARDB 3BWUC 5F3BB 4XRCA 3MRKA 3NACL 4E0RB 4HDIA 3WE6B 4MVBD 4D0CB 1AKJD 3LHPH 4QNPF 4BJLA 3MSPA 4JPKL 3RQ3A 5IB2B 4G8EA 4RFNB 2YD9A 4IRSA 4P2RB 4Y5VB 2FEDD 4JY4A 5EU3A 2G75B 3D25A 3SDAC 3CH1A 5CEYB 2QV2A 1T1XB 3BP5B 1T4KA 3QBTB 5HI4C 5CHNB 3PG2A 1I1FB 2E5EA 1NFIB 1LQSR 3OXRB 3QUZB 5JQHC 1ACZA 4ZD3L 4M5ZL 1XF3B 5HDQL 1IGJB 4QTHA 1FRGL 4WHTA 3QZWB 4O2CA 1OCWL 4Q9CA 3JV5A 3HFML 3VRIA 3R06B 4O51B 2VQ1A 5BS0D 2HFTA 1F4WL 2BSRB 3D6GA 4L8CA 4JE4B 3SDAA 2GIYA 2WWMC 1C8PA 1DQQB 4D0BB 4DGYH 4EEEA 1KN2L 3TNMB 1X5XA 1PQZB 5IK3A 3T08A 5D7JD 3FT2B 4I18C 3WFEH 4PRNA 4OLXH 4YPGB 2NZ9C 5A3ID 3B8YA 1MSPA 2X40A 3RGVC 2BX5A 4JY5H 2XQBH 3VWJD 3MV8B 4K07A 3FFCD 3L3OA 3RI5F 5IIEB 2RFXA 5GS0C 4HS6B 1LDPH 15C8H 1HHHA 3SKJH 4DJMA 2X7LB 4YHNA 5AZ2H 1QOKA 4DGVL 4BQ8A 2DKMA 1OT1A 2JIXB 3HLAA 4NQTA 4PG2C 4MD4B 5DJAB 4QRQA 3EYQD 4I18A 4NWUH 4KZDH 1J1XH 4KC3B 4JR9L 3PWVB 1YJDL 4X8JB 4MD0B 4GG6B 2DMBA 3IGAA 3VE0B 5CGTA 3RGVA 2EDOA 3LEYH 4QOKA 3BI9X 2FATH 4S2SB 4X7FC 2R2BB 1MAKA 1MHCB 2AQ3A 1ES0A 3BZFB 4ERSH 4N5EC 4PJBA 5JIIA 4TNWF 1FN4A 4Q2ZA 4OF5A 3SDXF 1M1SA 4PG2A 4MCYB 1CDCA 4PRIB 5KN5A 2F19L 1EAPB 4C58B 3MNWB 4A2MA 1T89C 3BAEL 3MRQB 3EHBD 2XZQL 3ZHLA 4GRWB 4OCSH 5FDWA 1SYVA 4ORZC 3VFSA 3VRLE 1NANI 4FQXD 4NFCA 4YO0B 3ARWA 3SDYH 3ZSSA 1QQDA 2VZTA 5IT2L 2HTKD 5KVFL 3CNKA 4ZDHA 5J8OA 3U2SB 5K9QG 2H2SC 3G6JE 2NYYD 1J05A 2X41A 5B21A 5CLWA 3DECA 5LAXA 2EEAA 3T8XB 3LN5A 3HC0B 1T7WA 4TPRH 3VXMA 3MBEB 1T89A 4JFZH 2APFA 1FAIH 4E5XA 2N7AA 3VFOB 4QRPD 4PJ7F 2EYRA 3ILPB 4RMSA 3LKOA 3T0EB 4ELMB 1FFNB 4NM8H 2AJXH 3CFIC 1N6VA 2FGZA 3F7VB 2AJYL 4DN4L 1GHFL 4U1LB 5FFLA 1H0DB 3DIFA 3OG4B 1QBBA 4FS0A 4XX1E 4NNPL 1T0NB 3CGTA 4PJBE 1MREL 2VDMH 1GIGH 3NZHL 5DRNA 3EYUH 2A6IB 4Y8DC 4F7TB 5BZDB 3K2UL 4V2BA 5DFWH 1AXTH 4H5SA 5D6CB 1VKXA 1U3HC 5J06A 3KGRA 4LIQE 1KJVA 1XCQA 3PL6B 4HLJA 4YC2C 4OCWH 4FOMA 4LAQL 5HI5D 4DVRL 4J8RA 5IWLC 1K8IA 2Z93B 5I19H 2NY1B 4DZBB 2IANA 3FT3B 1OAZL 4JRXE 4UT9H 3U0PB 5IVNA 5EOTB 2P5WB 4PTTA 2NXYB 2W9EH 2Y6SC 5MENB 1EGJH 5HYIA 4XBPA 3VXME 1IGCL 1QSFB 3GZKA 1AHWC 1U3HA 3PWNA 1ZHBA 2EEDA 1UJTA 1TJHL 3GSQA 1AP2B 1OSZB 4ZFOL 1O7SA 3B5GA 3IB4A 2VZSA 1MRCL 3ARFC 2IBBA 4HPOL 5IWLA 2X1XR 3MUGB 4QHLB 4KKBD 3O3AB 1B88A 3O45B 3K46A 4U1KA 2P47B 2W0PA 1YN6B 4LASH 4QT5A 3KLSA 2UVEA 5GS3A 5DURD 3LHPL 1NANH 4X83A 5C0JB 3LAFA 4PJEF 1AHWA 5A2JH 5HHOA 3S5LB 2FLRT 3JVGA 5F7LB 1I4FB 5I1AA 1I8MB 1KIPA 3SJVB 1XGUB 5EO9B 5BJTB 1RJCA 3ARFA 4X4MA 3WS6C 1OOAA 5IQ9A 3PUCA 4NFDA 3WFDH 4PRBB 4Z18A 1V5JA 1BZ7B 3WNNA 1MH5A 1RAMA 4N90D 1QRNB 3C5ZB 3I6KA 5FV2A 5F7MC 5KVMC 2IANE 3BPOB 5JPMB 3WEXA 2GUOB 1XH3A 4RISH 3TVMB 1WWBX 1BP3B 5BCAA 4NO0D 5EOCJ 4UQ3B 4UZGA 3TPKA 4X4XB 1I1YB 2YA1A 4R4BB 1MFEH 1S9YB 4DGYL 3SDDD 1JNHB 5EBLA 3MGTA 1BQHB 4QXWA 1WCBA 1JBJA 4G5ZH 1OT2A 4MJ4A 5F7YC 3ZYJA 4F15C 3WFEL 4F7PB 3MJ9L 4OLXL 3AS0A 4CMHB 5E5UB 1HYRC 4GRLC 4YDJB 4HC1A 4JY5L 3KPNA 2XQBL 4HAFA 1T21A 2VSCA 4C57C 1WTGT 1N59B 3SCMA 2NLJA 1LDPL 15C8L 1I9RL 5HHOE 1CS6A 3QUMB 3KPSA 4HGWA 3SKJL 4K94H 2ZNWA 3VXPA 4XVUC 3BJLA 5AZ2L 1XIWB 2WUCH 1JK8A 3ILQC 2CLZB 3T4YB 4NWUL 1LE9B 1J1XL 4KZDL 1MLCB 5FA3B 4NN5C 5CSZA 1OW0C 3DX7B 2GTZA 2W65B 5C0IA 4QRSB 5DJYB 1U8IA 3LEYL 1JTPA 1ZVHA 3MTRA 4GLRI 3QEUB 2FATL 2YWZA 2AS5M 3KPMA 1MELA 1Z9SA 4NNYA 4APQB 3IJYA 4XXCC 3PWLA 5EUKA 4WI4A 3PABB 4ERSL 4UTAH 2NY6B 4YR6B 3UAJD 1X5ZA 5FGRA 3RVVD 2BVOB 2B5IC 4ACPA 1IEHA 4S10A 3HN3A 3REVB 3NIFE 1F6AA 4ONOA 4FFWD 1NGZA 3D9AH 4WUUA 1YY8A 4LL9A 5DDHB 4OCSL 1OW0A 1HHIB 3RNKB 2C9AA 3VH8G 5EZJA 4X7DC 2A83B 1JNNH 4PJDA 3NFPA 3HZKB 3SDYL 1A21A 4KMTH 2ESVA 4XXCA 3ULVF 4Y19A 5C09E 3N1MC 5DRWB 1CGYA 2DLEA 1WISA 4HK3J 4HXAH 3ULVD 2CSPA 3KPSE 4MNQA 4IIQB 2XICA 4OLWH 4BZ2H 1K4CA 4TPRL 1S7QB 3ZKSD 2EYSB 1CG9A 5T3XD 4JFZL 1FAIL 1FG9C 3D0VB 3OKOA 5IVXF 4F58H 3CSBA 4MDIA 1ORSB 5DZOA 3V4PL 2QADD 3O8XD 4XRCB 4X6CA 4HDIB 2NTFA 4NM8L 2AJXL 3BOVA 1GGCH 4PLJD 1JPGB 2ATKA 1YY9D 4S0SD 2VERN 1M4KA 3TH3T 4JY4B 5EU3B 3ZO0A 2VDML 1GIGL 3JV6B 3EYUL 1HH6B 3CH1B 3RWJA 1CDYA 1A7NH 1AXTL 4IEFB 4HZLA 5DFVD 2YRLA 1SJXA 1CZ8H 4EXPX 3CX5J 1T1ZA 3IF1A 4KWUA 4OCWL 5T1KD 4I3RH 3TN0C 4HIEA 1S7TA 4O2CB 4Y0GA 4YHOH 3CU7A 5I19L 2D7MA 1RURH 4Y19E 2V6HA 1F8TH 3RVUD 4UT9L 2VQ1B 4ZNCD 4UV7H 3IS1X 5H2BA 2W9EL 1EGJL 1ETZA 2P24A 2EO1A 3H9SA 4MNQE 4OIBA 3SY0A 2CDGA 4GLRH 3G5VA 4CUCA 1T2JA 3QXVA 1SVCP 1P69B 1E6OH 3CFJA 5IK3B 2VXSH 3RBGA 4GJTB 3E3QC 4PRNB 4ZUVA 5K9JH 5TDPA 4QHUA 2BFVH 3CMGA 2FJFA 5TJWK 2YOCA 2MKLC 3FL7A 4X6CE 4LHQB 2JLLA 1U8LA 4L1HA 3L3OB 1F6FB 3NA9H 1IC4H 3CXHJ 2RFXB 2VZ3A 4LASL 4TQEH 4HS8H 5CKGA 3C09C 1HHHB 2VISB 1D5ZA 3MA9H 4ONFH 4PJCA 4U49A 2JIXD 4YHNB 5EC2B 3NN8A 4GG6F 4M7KH 2YKLH 4QRTA 3B9KD 5DVMA 4QRQB 4BM7A 3PV6A 4I18B 2LU7A 3IGAB 3RWDB 5JPNB 4U6VH 3OAUH 3RGVB 3WFDL 3O6FC 5E0QA 2IQ9H 4X6DA 1BFSA 1PSKH 3B8SA 2QJDA 2IAMD 1VB9A 1ES0B 4NWTH 5C0ND 4PJBB 2CD0A 3UMTA 1FN4B 4RISL 4LKXA 5H35A 4PRID 2JJVA 5E6IA 3H9SE 4GRWF 4G6MH 4FG6D 3GNMH 4CJ1A 2C4FU 3MLXH 2WMPA 5MI0C 1MFEL 3BEVA 3MRNA 5FDWB 1SYVB 2N4IA 2HKFH 3VFSB 5ETUB 4UMGA 3CIQA 5FKAA 1KEGH 4G5ZL 2FSEA 3ZYIA 1PY4A 1QQDB 4BUHA 2PXYA 5IVZB 4JRXB 1T80A 4ZDHB 2PKDA 2FBOJ 1J05B 5FYKH 4XPAH 2A73B 3LN5B 3MBED 4PJCE 1T03H 2DOCA 4UQ2A 1WFOA 3VXMB 4AQ1B 35C8H 4ELMF 2XKUA 2E9JA 1KACB 4K94L 4E5XB 3E3QE 3T0ED 2ZSVB 4FFZH 2EYRB 2WUCL 3LKOB 4WFGD 1QUNA 2DQCH 1KLUA 3QHZH 3KPTA 5KJRH 3DLQR 4OQTH 4OV5A 1X3DA 3DSFH 5EB9A 1XCTA 4BH7A 4LLUB 5B8CB 5LVEA 1CI5A 1REIA 3DIFB 5D70H 3K0WA 1EMTH 3QT2A 5I76B 2Q87A 1PEZA 5L0QB 5DEZA 5DRNB 1LGVA 4PIRF 1CR9H 2WBJC 4UTAL 4Y2DD 3O3DB 1VKXB 5I16B 4NYLA 1AD0A 3PL6D 4YX2H 4X4YA 2J8UA 1KJVB 1XCQB 4NDMB 3RA7H 5HGDB 3D9AL 3UJIH 4BQ9A 1FL5A 1K8IB 3I84A 5DSCA 1N2RA 4Y88A 2IANB 1OPGH 1JNNL 3IXAA 3GFUA 5MEND 3RBSA 1QLRA 4PTTB 1IGIH 4KMTL 4XBPB 4OLUH 4AIZA 1QSFD 1HCVA 1JZ3A 1ZTXH 2YEZA 1W8OA 2V5RA 3QO0A 4HXAL 3NAAH 1U3HB 3ZE1E 3KJ6H 1KFAH 3GSQB 4OLWL 4FP8H 4BZ2L 3BESR 2AQ2A 3Q6GH 4YC2B 1F13A 1ZXQA 4JO1H 5CEZH 3I3BA 5DRZA 4KHTH 1G0YR 2X4NB 5IROC 4F58L 1EXUA 3QQ9C 1YEFH 1HHJA 3N0PB 4QT5B 3T0WA 2X1OA 3MZTA 2B2XH 5CP7A 1GGCL 4PGJA 1AHWB 3VFWA 3WFHB 1J87A 5HHOB 2VUYA 4PGCB 3RPKA 3SJVD 3BEWA 4D9QE 3QIBD 1RIUH 1I9EA 5J0BA 3ARFB 4XWGH 2J8UE 5IQ9B 1A7NL 3MOQA 1UH3A 4PY8J 1QRND 1MH5B 3EOBA 1CZ8L 2DM7A 3DO3A 4P2CG 1IC5H 3DX6A 4I0CC 1BJMA 2EZ0C 3PJSA 4I3RL 5C08A 3U7YH 5IHLB 4OAWA 1RURL 1ZT7A 3QI9D 1BLNB 3BRGC 1F8TL 1MCSA 4WV1C 4HZAA 3VXNA 3U30C 4UV7L 1A7RH 1QBMH 1CGSH 5FV1L 5FAAA 1JI2A 3KVQA 4KI5C 2YXFA 1JHLH 1MJ7H 4KRNA 5CS7A 3MGTB 1E6OL 4JGMA 2UWEA 4YE4H 2VXSL 3A6CH 1NDMA 3KYKH 5K9JL 2BMKA 2BFVL 4Z7WF 4PRDA 4GKZA 3IRPX 3KPNB 4LCUB 5C09B 5L8JB 3MGOB 3K74B 1IC4L 3NA9L 4WV1A 1DFBH 2FX7H 5F7HA 4TQEL 4XHQA 4HS8L 2VZ1A 3KPSB 4AG4H 4HGWB 3MA9L 4ONFL 5AYUH 3VXPB 5JA9A 4YGAB 3RJQB 1CQYA 4M7KL 2YKLL 2D3VA 4F15B 5C2UB 1YZZA 1RSFA 3IKCA 5CSZB 1UEYA 3QIWC 4B7IA 3HPJB 3JTTA 4DFIA 4U6VL 3OAUL 4YH6A 1QFWI 3JXAA 2BNRE 3CC5B 5C8JA 4GRLB 4GXVH 4XP4H 4YBHA 2IQ9L 1RPQA 5C08E 2VDRH 4JANA 4PV9A 1KXTB 2EICA 1PSKL 3IJYB 3PWLB 2NY6D 5EUKB 4JPIA 4NWTL 1QPXA 1LHZA 4QXTB 4L3AA 1CD1B 3OJVC 4G6ML 3O6KH 1F6AB 3GNML 3O6LH 5DF0A 1T3FA 1NGZB 1VGEH 4WUUB 4NN5B 3MLXL 3QIWA 3B83A 3V6OC 3W39A 2BHUA 2HKFL 1ZEAH 5E2UH 1QACA 1Z9LA 3NFPB 3SKMB 3VI3E 1KEGL 4FTVA 4HUXB 1Q9KA 1T22A 4HFWA 3KNBB 3PWJB 1OVZA 4Y19B 5L9DH 2VH5H 4ENED 4H26A 3GB7B 2XY1A 3DHJA 1EV2E 3MYZA 5FYKL 4MNQB 4XPAL 4XWOD 1K4CB 4KI5E 4PJXA 1WC7A 4XC3H 5GQBA 1T03L 3IDJA 5HYSG 35C8L 4NQCA 3CDGA 2E27H 2GSIA 3WNMA 1U58A 3H9ZA 4XXDB 4FFZL 5D2LA 4MDIB 4ALAH 2DQCL 4MHHG 1CWVA 2Y1VA 2I07A 4X6CB 2NTFB 5C0RH 5KJRL 4OQTL 3DSFL 1XGPA 3H3PH 3N1FC 4S1QH 4RFEA 3G08A 1TCRA 1VFBA 1IC7H 2ATKB 2ENSA 5D70L 4M6OH 3RWCA 4Y16C 5F9JA 3T4AA 4DVBA 1WAAA 3CFBA 4KXZH 4WHYH 3RWJB 1CR9L 2YA0A 2D7QA 4QYOA 3MRJA 1JPSH 3O2DH 1QFWM 4HZLB 3NABH 4U1JB 4ETQA 1CXLA 4XPHH 4RGNC 4MNGA 1AGEA 4YX2L 3IF1B 1T1ZB 1HINH 2PYFA 1YQVH 3RA7L 2KH2B 1J8HA 3UJIL 4FTVE 1S7TB 3U1SH 4NUJA 4X9FA 4GAJH 1PZ5A 3K1KC 4Y16A 1OPGL 3IXTA 1TVHA 3LQZA 4ZOCA 4J3UA 5HI4D 1F2QA 1IGIL 1ETZB 2P24B 3H9SB 1KYOJ 1M7XA 5AUMA 4OLUL 3SY0B 3VRLF 3G5VB 2F53D 1ZTXL 1UCBH 5GS1C 3GSXA 2NNAA 4NQCE 1RUPH 3NAAL 3CFJB 3KJ6L 1KFAL 3V6OE 2IPTH 4FP8L 4ZUVB 3CSYA 3Q6GL 5TDPB 1JZ7A 1TQCC 5D2LE 4JO1L 5CEZL 2EH8H 2FJFB 4KHTL 3TN0B 3VCLA 4NZJA 3G6JF 3VW3H 1JGVH 4B5EA 1U8LB 4GBXC 1DBKH 2WAHA 1IZKA 1YEFL 1DLFH 4R96A 5I1JH 1LO0H 3R1GH 5CGYC 2WWMD 3O9WC 1JIBA 2B2XL 3FRUA 2YR3A 1CGUA 4OGAD 3VFUB 4PJCB 4DZ8B 4I13B 1WAAE 5GS1A 4OZHA 2DL9A 5KSAC 5E7FA 5EFIA 2NZ9D 3TT3H 1RIUL 4WWID 2J6EA 1WFNA 2OSLB 5JHDA 4MNGE 4XWGL 3DRQA 4ZTPH 1KIRA 3QWQB 5GS0D 2X44D 4GBXA 2OL3A 2V7NB 1IC5L 3LKQA 3C09B 3O9WA 4BZ1H 3IAGC 1U0QA 5ICYB 2ZUYA 2A6DA 3ARTA 1RK0B 3U7YL 1BVKA 2BRRH 4LKXB 5H35B 2XT1B 4IS6A 1DQDH 5C6TH 3VD7A 5KSAA 1A7RL 1QBML 5I8EA 1CGSL 4RGNE 4K3HA 3OB8A 3MRNB 1CL7H 2E6QA 3O6FB 5F9WC 1JHLL 1MJ7L 2C1PB 3HUJA 4YE4L 3TGXA 3TT1H 3A6CL 2FSEB 1NCCH 1CFTA 2OP4H 4JRXD 3BT2H 3KYKL 4N5ED 5GRWA 5IKCA 4B53A 1NCWH 4JQIH 3VXMD 1MCWM 2DB8A 5HPMB 4UQ2B 1DFBL 2FX7L 3WIHA 2R0LH 2Z4QA 5TDOA 2Q86A 5MI0B 4WRLA 4AG4L 5AYUL 2P8PB 3MJ8B 3GMRB 5JHDE 1KB9K 1P4IH 1KLUB 2FEEI 5D1XD 3O3UN 5EZLA 4BKLA 3TH4T 1ZMYA 5CZXD 1XCTB 4ZO8A 4XCYA 3LH2H 4XVJH 1RIVH 1YMMA 2J8HA 2VWEC 4GXVL 4PYGA 4XP4L 2NX5A 4JDTH 3RWFA 3SBWC 3UPAA 1VEOA 1GVIA 2EDLA 1ROWA 2VDRL 3QCVH 3C60D 4WW1A 1MHEA 3OKLB 4LCYA 3E2HB 3P2TA 4NYLB 3RVXC 2ORBH 3ARGC 3NCCB 1YJDC 2XA3A 5DWUH 1RUAH 3OHXA 4RIRA 1TPXC 4X4YB 2J8UB 4U6HB 3O6KL 1Y0LA 2Q8BH 1VGEL 1P4LB 3HUJE 2IAND 3ARZA 1KC5H 1ZEAL 5E2UL 4KI1A 1YPZE 1WWAX 3HZMA 2AP2A 1RZFH 3FO1B 1FNEA 3W9DA 3QXWA 3V8OA 2A38A 5EUOE 2PCPA 4ZO6A 4OZFG 4P59H 1CDJA 5L9DL 3SO5A 2VH5L 2WBJB 4C83A 4J4PD 4TTGA 2YEZB 4Z7NF 4LDEB 3ARGA 3GSVA 2WIMA 3QWOA 4XC3L 1PKOA 2E27L 3Q3GA 4JHAH 2Z31C 4NHUA 2GTWA 1EXUB 4ALAL 4RMVA 1YNLH 2JCCE 2V5MA 2BVTA 5C0RL 5IMMA 4K3EH 3H3PL 2ZG2A 1JHTA 5HHOD 2WQRA 3MUJA 3OV6A 1IC7L 1X4ZA 5FUCC 3O4LA 4A2LA 4ONHA 1EBAA 4M6OL 5HGGS 3BEWB 3MA7A 5F7WC 4NQVA 3O81A 1J11A 2X89D 5ANMA 3OR7B 5F3HB 3M17A 1JPSL 3O2DL 3NABL 3ZTNH 1H3GA 4XPHL 2P8LA 3FO0H 2MNUA 4WFEE 3EOBB 1V3KA 4Y2OA 2BNRB 1HINL 1G7IA 3DX6B 1YQVL 4UUJA 3PJSB 5C08B 5AZEH 2HJFB 5ACLA 3U1SL 3Q2CA 4OAWB 1ZT7B 2X4PA 4GAJL 3QNYB 4PJHE 3DROB 4LHUD 2ERJB 1IE5A 3LQMA 1HCFX 1UCBL 1RUPL 4FQ1H 4G8IA 3GK8H 1MCWW 3ZE2E 3JUYA 4P23C 2IPTL 3FQRA 1KCRH 4UIMA 4NO5B 4NQSB 1NUDA 1F5WA 2EH8L 1RHFA 4HUWA 4P2YA 4LEOB 4P3DA 4PRDB 5C09D 1NFDA 3VW3L 1JGVL 4I2XA 2XWTA 1I8LC 2H41A 1DBKL 4RMWA 4WV1B 1DLFL 5I1JL 3U30B 4C59B 1LO0L 3R1GL 4RRPG 2H2PC 4PJAA 4P0DA 3HNVH 3AXLA 3GMOB 4UI2A 5E6ZA 3ULUC 1X5HA 4JY6A 5ANME 3QIUC 1BEYH 4UINH 1CFQA 3GHBH 1AGCA 4P23A 1VADA 5KANI 2GAZA 3TT3L 1OAUH 4YJZL 2N56A 4FQ2H 1FNFA 1ZK9A 3JTTB 4GRLD 2YXMA 1I7UA 5C8JB 4KKAD 4ZTPL 4P2OD 1I8LA 4AYFA 4PBWD 4MB4A 4UAOC 3SOBL 3VFNB 3QEGH 4PV9B 4BZ1L 1Z9MA 4JPIB 4XVUD 1R3LA 3KHOA 5FM4A 3JUZA 2D4DA 3QIUA 4LSQH 1NMAH 2BRRL 3MO1A 4ZFOA 5C6TL 1DQDL 4G8GA 5GGRA 3I6GA 1EJOH 1T3FB 2XN9A 3RWIA 2VKWA 1X5FA 4U1IA 1CL7L 1ZHLA 3KYMB 4MX7A 4HCRH 2ATPA 2FJHA 4FTVB 4GSDH 5DA0B 3TT1L 4NT6B 4XCNA 1A2YA 1Q9KB 1GC1H 1II4E 1NFDE 1NCCL 3BYYA 2ADFH 2OP4L 3BT2L 1Y18A 4H26B 4M1DH 1H8SA 1FNAA 3L3DA 1NCWL 2PYEA 4JQIL 1HDMA 2X4UA 3IDJB 3BGFC 1N0XH 2R0LL 4NQCB 4OFYD 3CDGB 5K59E 2OK0H 1RUMH 4M7LT 1HNGA 2GSIB 4BFIA 1E0OB 1U58B 3TIEB 5D2LB 3HR5A 4LSUH 4RA3A 1HHGB 1P4IL 2I07B 3UYOD 3SKOA 1ORQA 4D9RE 3P0YH 1YUHA 3G08B 1TCRB 1VFBB 3RWEA 1A1OA 3Q5YA 3LH2L 4XVJL 1RIVL 1DQLH 2BZDA 3RWCB 5F9JB 1MJJA 4JDTL 3T4AB 1E28B 2X09A 1OSPL 4DVBB 3QCVL 3FQTB 1JNLH 3L3JA 3SE4C 4G8GE 5B4MC 1W0WA 1IM9A 3KR3H 4QYOB 1CLYH 3MRJB 2RQ8A 4ETQB 1KF9B 2XN9E 5I17B 2Z8VC 3MJ9A 2F5BH 4EI5D 2ORBL 2ADGA 5DWUL 4MLIA 1RUAL 4MNGB 1AGEB 4NZDA 3SKUD 4NJ9H 4QHNB 3RVTD 2Q8BL 5SV4A 4K3JH 1U36A 1J8HB 4H0GA 5F44A 4X7CC 3GSOA 4CBPA 3BVNA 1KC5L 4NUJB 2IALA 4HWZA 4JFOB 1EEZA 1PZ5B 3B9VA 3HAEG 4Y16B 2WINA 2XQYG 1TVHB 3IXTB 1RZFL 5F8RC 3LQZB 2PYEE 2AK4A 3MODH 5T1DH 3SE4A 5AUMB 4P59L 1E4XH 3BD4A 4WO4A 2R0WH 2NNAB 2XA8H 3GSXB 3FONA 4PB0H 4RGNB 4ZPVA 3V4UH 3MOAH 3CSYB 3FOMA 2VN7A 3TN0D 3NMEA 4F37F 2WQ8A 1UXSA 4FQHB 3VCLB 3VXOA 4JHAL 4XNMA 1AIFB 1P6FA 1EUTA 1O7VA 4Z95H 4R96B 4F7MA 1YNLL 1WSST 2HFGH 3F7YA 1I7TA 3FRUB 1HWGB 4JRYA 4K3EL 5IP4A 2DTMH 3MFGB 4PJ8D 1RZGB 5GS1B 4MZ2A 5HTSA 1A7OH 5BRZD 4XP1H 3D3VE 1HKLH 1NDGB 1TQCB 1UACH 4X6EA 5JHDB 4OCLC 4HEPG 4Y7MA 5CINH 4KROC 3DRQB 4ZFZA 3ZTNL 2DQTH 1GAFH 3C8DA 3FO0L 2RB8A 2FHFA 3LKQB 4L8BB 3O9WB 1EZVY 3MRFA 1VDGA 4W6YB 5JW4N 4AK1A 2VE6B 1JYVA 1BVKB 3ROOA 5AZEL 2AK4E 3HE6D 1FIEA 4IS6B 2FEEL 5KSAB 1DJSA 3DWTA 3T65A 3G5ZA 3VD3A 5IGXH 2AXJA 1W0YT 3O6FD 4QTIH 4UDTA 1J0YA 1U95A 4KQ4H 1EFQA 1QBAA 2YD5A 2Y7QA 4FQ1L 1VA9A 3GK8L 3HUJB 2HTLC 3MYJA 4PJGA 1CFTB 4MQXD 5IKCB 1KCRL 4OZFA 1YPZB 4HSQA 2EXYC 4YZFE 2CK2A 5EUOB 4G6AD 2X1QA 1KGCE 2D0GA 4YLQT 1MCOH 3ZE1F 3KXFA 1CT8A 4JRYE 5MERA 2YZ8A 3Q0HA 2GITB 5GGRY 4C4KO 3VXRA 2Z4QB 4IJ3C 3HNVL 2ZUQC 3MV11 1CTNA 1BEYL 1HHKA 1NL0H 4UINL 5F9WB 3L9RA 1YEIH 3GI8H 4WW2C 3GHBL 1LDSA 2CO6B 1ED3A 2NY0D 1LP9A 4HULB 5I6XC 5EZLB 1J0IA 1OAUL 4F33A 4BKLB 4FQ2L 4OQ1A 1E4KC 2OTUA 2JCCB 3O2WH 4XCYB 5I0ZA 3MQIA 2FH8A 1SM3H 4Y4KC 5DHVH 3RWFB 2D03H 1M05A 3QEGL 1I85C 4QWWD 5C6WH 3M1BA 1MHEB 4LVNC 2V9RA 4LSQL 1NMAL 1CXEA 2VDLH 4WW2A 3WYRA 3LCYA 4RIRB 1EJOL 2E7LA 1DEEA 2A0LD 3TIDB 2HLFC 1Y0LB 5ESQB 1XGTA 1UENA 4H1LB 3K80A 2AV7A 1E4KA 4PJGE 3CCHA 4ISVA 4HCRL 1GGBH 3C8HA 2B0SH 4Y4KA 3HZMB 3TZVC 3B6SB 1FNEB 2OLDA 4GSDL 1KTDA 3GSRB 1FO0H 1I85A 5FB8A 4N0YH 1GC1L 2PCPB 2WBJD 3KXFE 2ADFL 1ZGLA 4K8RD 4OF3A 3Q1SH 1PKQE 4WWKC 4M1DL 3V95A 2DYPB 3QHTC 3VXRE 3DX8B 3GSVB 2VLJA 1TPXB 3I3DA 1KCVH 4WDIA 1N0XL 1H3WM 2OK0L 1RUML 4U6XA 3Q3GB 4I77H 1LP9E 3O3BA 4NHUB 1SQ2N 3TZVA 4YNYA 2I9LA 4H8WH 1FYTA 4KDVA 4LSUL 5DD0H 1W2KT 3DUSA 2R15A 4RRPA 5IMMB 1L0QA 1CN4A 2QSQA 1EVUA 5T1LA 4WWKA 4FA8A 3P0YL 1JHTB 3I6LE 4P3WA 5B3JF 3FB7A 4OI8A 1UWEH 3BIKA 4KVCH 3MCKA 1DQLL 4ONHB 5IV2B 1P9MA 2VDOH 3MA7B 1P84J 4NQVB 5J3HC 4K94C 5ANMB 2VABA 4MMXC 1JNLL 3WXWH 1Z5LB 3KR3L 3M17B 3MV9E 1CLYL 1MHPH 2Z31B 4JVWA 4PJFA 4X6BB 3MREA 2NY3C 5EC1B 2F5BL 1FCCA 2BNRD 1HK6A 2NCMA 1EEYA 2J88H 4NJ9L 2D31A 1G7IB 4UUJB 4K3JL 2HT4C 3W9EA 2BY1A 1P2CA 2EXWC 1C12A 2Y72A 1YEDA 1YYMH 4O9HH 3DYOA 3MODL 5T1DL 3CPLA 3G5XA 1E4XL 2FWOB 5J89A 2R0WL 2XA8L 4PRAA 3HAEH 4G8IB 4PB0L 3VG9C 4Z76A 2JKXA 5DJCA 2EZ0D 3V4UL 3MOAL 1QP1A 2EC9T 3FQRB 4H20H 4OKVB 4UIMB 3QO1A 1FYTE 2KQMA 4HUWB 2WIIA 3Q5OA 1NFDB 3KG5A 1PEWA 2EIBA 4P5TC 2XWTB 4Z95L 3X17A 2HFGL 1D5XA 3EBAA 3QISA 1R3HA 1CLZH 4R90H 3AXLB 2C5DC 2DTSA 3VD9A 1HIMH 2DTML 5JW3H 3U4AA 1CFQB 2K9UA 5D1QC 5IFHH 1A7OL 1AGCB 2VB5A 4GO6B 4PJFE 4XP1L 3TO4D 4P23B 5EH1A 1VADB 1FORH 2GAZB 3WHXA 4BH8A 1HKLL 1UACL 4U1HA 2VLLB 4L9DA 4YFEA 2NR6C 5CINL 2W9LA 2FX8L 4WNQA 2D7NA 3DVGA 4P5TA 2DQTL 2EDYA 4I4WA 1GAFL 2BOBA 3MGAA 5T33H 3OAYH 4OLVH 2KKQA 1GCFA 1HXYA 2EECA 4BFEA 1R3LB 2HT2D 1X4XA 5DEFA 1JTOA 3WUZA 2Y07H 3QIUB 3MO1B 4JAMB 4ZFOB 5D1QA 4G8GB 5GGRB 1KG0A 3I6GB 4XBEH 1LNUA 1QTYT 2R1WA 3P9LA 3CX2A 5IGXL 2XN9B 1I3UA 1OWRM 4BUGA 3AAZB 3VFGH 3PV7A 4QTIL 4U1IB 1ZHLB 4KQ4L 2ATPB 2G5BB 4LRNH 4KH2A 4OSUH 4UAOB 2ZJSH 1A2YB 3QUKB 5DMIH 4CVWA 5F7DB 1A0QH 4FN0A 1YEGH 1G0XA 2K7QA 4YK4C 3L3DB 1IL1A 1U3YA 2PYEB 4UTBH 1MCOL 2Y5EA 1WIUA 1HDMB 5I1EH 5C86A 2AXGB 2EDKA 2X4UB 4JO2H 4U3HA 5E03A 4YDVA 1A14H 2DDQH 4KK5C 4PJIF 3RZCC 1QSEA 4BFIB 2VMFA 1OLLA 1NL0L 3HR5B 5DJ8A 1YEIL 3GI8L 3WN5C 4F9PC 3QUYC 3WLBB 1ZLSH 3RX7A 2DJSA 1ORQB 5IB4B 5TGBA 4ELKA 3O2WL 3UX9B 3IU4H 1QLFA 3GRWH 1SM3L 2AGJH 3MV7A 1MJJB 2D03L 1L6ZA 3C2SA 3OBAA 4IOIA 3BGFB 3L3JB 3UTZB 3RZCA 3D3VB 4GKNA 1YEHH 2VDLL 4S1SH 4P3CH 3WN5A 4F9PA 3CZJA 3QUYA 3ZTJH 3EFFA 4LEXH 2X4TA 3BPCA 2AERT 1NLDH 2OQJA 4ZS6C 2H3NA 3GSOB 4PP1D 2ZOLA 1FE8H 4W6XB 4L4JA 1GGBL 1IGMH 2IALB 4HWZB 1EEZB 2B0SL 2WINB 3QEHA 1NCBH 1A1NB 1FO0L 5SV3A 4N0YL 4N1HB 4XP9H 5SWZA 2AK4B 5HHXH 3OF6D 3Q1SL 3T3MF 4X9HA 4PJ5D 4RGND 2FZ3A 2O26U 2AJZA 3BN9C 2X70B 3U46A 1T83C 3FONB 2AQ1A 2DWEA 1QSEE 4ZPVB 1KCVL 1P4BH 3FOMB 2H26A 2YUZA 1U8NA 5C0CE 2YD3A 1UXSB 3VXOB 1ZA6B 4I77L 2EE2A 5GRYA 4NSKB 5E8DH 1A9EA 4DKAA 5IUSA 4H8WL 1J0KA 3OJDB 3F7YB 4NOBA 2O5YH 5DD0L 2BC4A 1I7TB 4Y4FC 5FGBA 4JRYB 3MV7E 1AXIB 1LO4H 1WLHA 4X9BA 1RJZA 1NGXA 3LZFH 1J18A 1TLKA 1UWEL 1KJ2H 1T83A 2JK5A 1S78C 4KVCL 2FX9H 3MLTA 2VDOL 3TBTA 1JYXA 1U8OB 3NFSH 5JHDD 1CLCA 5C0BE 4X6EB 2X10A 1KNOB 3WXWL 4OFDA 1ZLWH 1MHPL 4ZFZB 2M26A 1U8QA 3BPNC 5CGYD 5B39A 4YHIB 1F90H 3O9WD 2J88L 2X9YA 3K81A 1FBIH 1L9NA 5GPRA 1LD9A 4N8VG 4Y4FA 4ZUWA 3WS3A 5KSUA 1X5IA 4LKCB 1BIHA 5KSAD 4HW6A 4LDLB 5T1MA 3T65B 1JGLH 1YYML 2CUMA 4O9HL 4KDTC 3HUJF 4OGZA 4QO1A 3WCYA 5GSVB 4X7EC 4UDTB 1U95B 1YPZF 3HPLA 1ZSDA 3BD3A 3VWKD 5HHPA 4OQTA 2CLVB 1IFHH 4HMDA 5EUOF 3EO0B 1U92A 3MYJB 1CD9B 43C9B 4PJGB 1CYGA 3VFRA 4H20L 1F4XH 1KXVC 3MLZH 5IVOA 3WL9A 4OUUB 2CXKA 3U36A 3BP4A 3KXFB 2F58H 1CT8B 3IDNB 1PKQB 1KB5A 4JZJC 5C0EB 1RHHA 4GW4A 3VXRB 2ARWA 2JJSC 4KDTA 4R90L 1CLZL 1YC8A 1HIML 5JW3L 5ICZB 3I85A 3B43A 3L9RB 5IFHL 3SQOH 3MNVA 1QKZH 1EA9C 2DM3A 2NZIA 2JCCF 1ED3B 5ISZD 1LP9B 3CFDA 1FORL 1JE6A 4F33B 4HJ0C 4IRJC 1IQDB 2OTUB 3N50A 3QA3A 3V0VA 5JOFB 1YDPA 5FYKE 3L5WA 5C0FA 1M05B 2FJGB 4OLVL 5T33L 1L9MA 2ZUUA 4J1UA 4FQQB 2E7MA 1IVLA 4XTRC 1MI5A 2JJSA 4IJ3B 5ITBH 2Y07L 4NJAH 2X2YA 4I0KA 3BP6A 4YAQA 3NCFB 4XBEL 4DK6A 3MV9B 1N64H 3AB0C 4WFED 5I6XB 3W5MA 1LEGA 3VFGL 2AV7B 5LKNA 4IRJA 1LWRA 1MCNA 4EOWH 3CCHB 4HLZH 3HS0A 4ISVB 5ADPH 4LLDA 4LRNL 4PJHF 4Y4KB 5L2JA 5J11B 2LABA 4XPFH 4OSUL 1MOEA 1C7SA 4XVTH 1KTDB 2R4SH 4IMLB 2ZJSL 5FB8B 1QFUH 5DMIL 1ZGLB 2DYPD 1A0QL 5D6DC 1YEGL 2E7BA 4LVNB 5ESAB 4QGYA 4UTBL 1F3JA 3ZE2F 1G7JA 5F6IC 5I1EL 3NCBB 4JO2L 3TCXA 1A14L 4U6XB 3HI6H 2DDQL 1FVCA 2WWKO 4GW5B 1A3LH 3O3BB 5DUBA 3QXTA 2HYMA 3TZVB 4YNYB 2I9LB 4NC1C 5A1AA 1FYTB 8FABA 2HA1A 4RA0C 4EVNA 1ZLSL 4FZEH 1CICD 4P5MB 5A16A 5D6DA 3PHSA 4WWKB 2XNAA 3OTTA 2R0KH 3FB7B 3BIKB 1MI5E 3RDTC 3IU4L 3MCKB 3GRWL 2Q20A 4C56D 3QRFM 2AGJL 1I1AB 1LMKA 1B0RA 2VABB 5GGSA 2Z31D 5LXGH 5CEZE 4RMRA 1GGIH 1NSNH 1K6QH 4PJFB 1IAOA 4IMKC 2VDPH 3V52H 4WU5A 5E8NA 1YEHL 2E6JA 3DRTA 4P3CL 1JMZA 4S1SL 3QUXB 5EBWA 1EEYB 4M8QA 4Z7QE 3VFMA 3FB6B 3UP1A 1NLDL 3W9EB 1FE8L 4QF1A 1WBXB 5BW7C 3RDTA 1IGML 3P0GB 1P53A 1JWUA 1T5WA 3MRPA 1P2CB 1QBLH 4ZOAA 2O61A 2YC1A 1NCBL 3OAYK 1C12B 4XP9L 5HHXL 5BVJA 4H0HB 3CPLB 5DMGC 3TPUA 3TBYA 3G5XB 4KQ3H 1OTTC 1FJ1A 2J3SA 4PRAB 2NY3B 3T0DA 5DJZB 4Z76B 3X12A 2QQLH 1NFDF 5DJCB 1CGVA 4HIJA 1P4BL 2FYYB 3QO1B 1V05A 2FBJH 2WIIB 3WFCH 3NCJH 5BW7A 2Y9RT 1F11B 5E8DL 3H2WA 4EUPH 4ORGA 3DBXB 3ZDZF 1MRDH 2O5YL 5K59F 5E8PA 1R3HB 4XNQB 4LMQE 1EHXA 1LO4L 3U83A 1OP3H 1ZHKA 3BUYA 5DXWA 3QEQA 3LZFL 1S7WB 4LCCC 1KJ2L 3RX8A 4Q9BA 2FX9L 3VG9B 3AMKA 3NFSL 4BH8B 1BF2A 4G9FE 4NC1E 4X7TA 4POZD 4WJ5B 4OI9A 1URLA 4D9RD 4WNQB 3DVGB 4P5TB 2BOBB 4JFEA 1F90L 1FBIL 2GW5A 2V5TA 1HXYB 4HJJH 5FA4A 3QIUD 1RJYA 2DQJH 2IPUK 2FEDC 5D1QB 4LCCA 1NC4A 1LNUB 2XN9D 4UDUB 4G9DB 2R1WB 4ZAKB 3PQYA 1JGLL 3SE3C 4LPYA 1SY6H 3DXAE 4NIKB 3FB8A 4QGTA 3DV6A 3X3GH 1SJEA 5EZOH 1IFHL 4P99A 1AKJA 1OQOA 1GZPB 2DJUA 1F4XL 3DVFA 3MLZL 2EDTA 1IAIH 5HVHC 2LU3A 2PYED 2CIKA 1BF8A 2IFGA 3C9NA 2F58L 4XGZA 3L3HA 3BDXA 4YEEA 1AC6A 1ZS8A 3O2DA 3SE3A 4MAUH 4M1GH 1HQRA 1QSEB 4POYA 5D7JC 5DJ8B 3SQOL 1QKZL 1K5NA 5C0CB 4RWHA 1J1PH 3V5DB 2VLKA 1FAKT 5ECJE 3LSOA 3RNQA 2GSGA 1MHHA 4JFEE 5TGBB 4ELKB 4YK4B 5E24E 4FMFA 1QLFB 5BS0A 2VR4A 3MV7B 2E8YA 2DQFA