3PV6A

Crystal structure of nkp30 bound to its ligand b7-h6
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
214
Chain Sequence
ADLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the activating natural killer cell receptor NKp30 bound to its ligand B7-H6 reveals basis for tumor cell recognition in humans
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21
total genus 43
structure length 214
sequence length 222
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv6A01
4NT6B 3QO1A 3TZVC 4RMQA 2X4SB 1OGAE 1A4JB 4N8VG 3RIFK 3IFLH 3QHTC 3SKOA 3GIZL 4E5XB 1R3KB 3DGGB 5H35A 2X1QA 4IRZH 1KULA 3JSSA 4NQXA 4PLOB 1KUMA 4APQD 4OGXH 3D85A 3WSQL 1KPVB 5GRXG 1AC0A 5B39G 3HHRB 3KS0H 3KPSB 1OL0A 4PJHA 4GKSA 4HT1H 4IHOB 2VZ3A 1NUFA 1JYNA 4N9OB 4GKZB 5CJQL 4TPRH 3DSFL 4OZHB 1ZAGA 4NN5B 4WTWA 1TETH 4JFFE 4X4XA 4P5TA 4MXVF 1C1EL 2PW1A 3U7WL 1HILB 3ULVF 5I8OL 4N5EC 2BHZA 4EI6B 3QQ4A 2YPKA 1HHKA 3CCHB 1CTNA 2IQAB 5IWLA 3O6ML 1H15B 2GQHA 5D70L 4YBQD 4H26B 3L5HA 3KPOA 3QULA 3AS3A 3HZYB 1MFEH 2GT9B 4GMTH 1S9KC 1IM3B 2LV4A 1J0ZA 5BO1L 4DWHA 3TFKC 4OD3L 1MIML 4YO0B 1KB9K 5HTSA 3CC5A 3IXTA 4C56D 1K85A 3HE7D 1LO4H 4FRWA 4KK8D 3PGCB 3TC9A 3KLAA 3DRQA 2FJGA 4G9DA 1MHEA 2X4RB 1FVCB 1YEJL 5IP4A 4MAUL 1U8OA 5HGDA 3CFIC 1MCSA 3KLSA 1E4XH 4LVHC 2EH8L 4HLZG 3OXRB 3E8UH 3TYFA 4NM4H 3L3HA 4XTRC 1W8OA 1HH9A 1U8HB 1Q94A 3O2VL 3MMEB 2GT9A 3K81A 3AM8A 3QQ3B 2UZIL 2AV1A 3DTXA 2WIIA 1YUHA 3I50L 4ENED 4QNPE 3A67L 4F80A 2RIKA 5KSAD 2XWJB 2AJVH 3FQWA 4ZOEA 2FH8A 5E2UH 3QFJA 4PJFE 1MJ7H 4LDEB 3QIBD 1XGUB 1NBYB 4OCXL 4P23B 1EK3A 1OPGL 3UX9B 2AJ3A 1HHIA 3VWJD 4P23C 5BS0E 3VXTA 4PJBA 4CAGA 1IL1B 4F7MB 3AS0A 1X4ZA 2FJHA 4NO5A 2V7NA 4OJFL 4ZYKA 5GS0H 2R1XB 3LKPB 1GGBH 4NKMB 2F15A 3BPNB 1V5JA 2ZCKL 4S2SA 4XH2B 4ZFOL 1VENA 2OJZL 4ALAH 4R4BA 3W11D 2MTPA 4FTVA 8FABB 2W0LA 4HG4J 3V0VA 1Q9OB 5EO1A 2L4OA 3GBNL 5TQ2L 4RGNB 2W91A 2GY7B 2EIEA 4U6VH 1NMCB 3U83A 2NXZB 4YK4B 1E6OL 5K9KA 5LG1A 1DE4B 2P7TB 4JZOA 1BBJA 2O61B 2J4WH 4QT5B 4Z77B 3PUCA 4HKJB 4YDIH 5D5MA 3AFLA 4FHBD 1UYWL 1KCUL 5JORB 4GJTB 1HK6A 2FHCA 3WLWD 3P9MB 5DS8B 3QJHA 4UIKL 1B4JH 1JL8A 2HT3D 2B7DT 2ICCA 3O2DA 4KY1L 1XGPB 3MO1B 5LGHL 4JFZH 1C16B 5BXFA 2V9TA 2MQCA 1OTUD 4M5ZH 3S96A 2WIMA 3GB7B 4EEEA 1RZIA 2NNAB 4M6OH 1NGZB 1DBKL 3C60B 1S9XA 4HGMA 5D8JL 1LEGB 4OAWB 3VFPA 2PTTB 4M00A 5IEKB 4RRPG 1UJ3B 4LASH 3TYGL 1R24A 5I8EB 4C56B 4PJDA 4XC3L 1U8KA 1UJ3C 3PWJA 1LHZA 1T7WA 4DW2L 1PKQA 4FQCH 4KPHH 1PYWA 4JO3H 1P7KA 2YPLD 4M43H 1G7QB 4JHWH 4F3FA 5M95B 4WHYH 4NSKA 4UQ3A 3UDWA 2BOCB 2R2BA 3MLYL 3S4SG 1TITA 4CN6A 2V2TA 1T4KA 1KG0B 4D94A 4R96A 3MV9E 1EUUA 1D3CA 2YKLH 1RVFL 3MFFA 4WDIB 5EB9A 2DQHL 4PLKC 3ECBA 5EFIB 3MBED 2VL4A 1MY5A 1GRWA 2ED9A 4J3WA 3G5VA 5IB1A 5J1TC 1N3NB 1NGYB 3OQ3B 2C3VA 4ELME 4KK6D 3ARWA 3VXUA 3DXAD 2QBWA 3W11C 1BJMA 5JW5B 5D7IA 2DDQH 4BFIB 4JCLA 4M48L 1CZ8L 4RMVA 1QR1A 3HUJB 1T5XA 4FP8H 3I3DA 3CDCA 3H3PH 5FM5M 1A2YB 1X5ZA 5GS0C 3KXFB 2Q8AH 4Y1AE 4PYGA 4PYHA 3MRDB 4LSRH 5J6HB 5KAQF 3UJTH 4HUWB 5EZOL 3N9GH 4LGPB 3BUYA 3KGRA 4HKBB 1SJHB 3HAEB 3QFDB 2M2DA 4IMLB 1YJDC 5L7XH 1W0WB 1MJUH 2J8HA 3W39B 1IGML 1S9XB 4HUKB 2EDOA 4D9RD 5EC2B 5F6IB 4HS6B 4LCYB 5T5NG 1ITCA 4XP1L 4CNIA 1JPTH 4AT6B 3GSQA 5F6IC 5TQ0H 4W6XB 3G5YB 4AG4L 2R29H 4MA3B 5I1EL 3U4AA 5D7LA 3ARPA 1YUHB 5ALBL 5F8QC 4JKMA 4Z7QE 3QQ3A 4MA1B 2F5BH 2QQLH 3SDXA 4DCQA 1XZ0A 3L6FB 1CDGA 1ORSB 3ZKMC 3OGCB 2HTKD 3PWPD 5C0AA 4JJ5B 4P5KB 3REWA 1JGUL 2FZ3B 2AAVA 4HH9B 4X8JA 2AKRA 3T77B 2BVQA 5C0ND 4C56E 2QR0A 3UTPD 3F12A 1CLOL 3S3PA 5IM7A 3RTQD 5BMFH 1XGYL 4LAQL 2X4OB 4LHUB 3FQUA 3CU7A 2W0FB 3QDGE 1E6JH 4R4BB 1A3RH 1TCRA 5JIIA 3OKLA 4IRJA 5HHPB 3WKNA 5ILTL 1BAFH 3ARDB 3EW3B 3TZVD 3ULUL 1G7MB 2VWEC 4A6YB 2NXYD 1V7NH 3T0AA 1UZ8A 4JFXA 4LPUA 1S5HB 2F5AL 3CXDL 2XZQL 5F7WC 4TUJB 5CJXC 5EUOE 4BH7B 3CFJB 1LE5B 4JG1L 1HHIB 4EIZC 3FO1A 4UTBH 3LEXB 5IFJA 4KHXL 4AQOA 4DN4H 1CE6B 3KAAA 4GG6B 4OB5L 3WNKA 1N59B 4PV9B 3EOAB 3U2SA 2F58H 1RSFA 2FYYA 3BP7B 1SEBA 1ZEAL 2ID5A 5ISZD 1OQXA 1II4E 3Q3GB 2ZUXA 1ACZA 1VFBB 4JPKH 5HDLA 5SV3A 3VXMA 1NSNH 4Q6YA 5TDPB 4JCMA 1MH5A 1R5VB 5DO2D 1FZKB 2GAZA 4U0RB 5KOVC 1S7VA 1CG9B 2HRPL 4RMSA 1OCWL 1DCLA 4MZ3A 3DVNB 3CK0H 2NYYD 3KXFE 4LPYA 4QCIB 5FGBA 4ORZC 4BFIA 5IEHA 2UV3A 1OPGH 1A6UL 5LWYL 2P5WB 3L3JB 1NEUA 5J57B 2A1WL 2EKSB 1KTDB 5FYJD 2CKBA 3LN5A 2ATPB 1NEZG 3MTRA 3E6FA 3QNZA 2C3HA 4JHZA 3H42L 1S7WA 2ZCLL 4U1LB 4DZBA 1YY9C 5DC4B 4RQQA 4PTTB 3B9KD 5C7XL 4LLDA 4NC1E 5DJZB 4OI7A 5C92A 4WFEE 1YN6A 2YXFA 1XR8A 3QBTB 5EUKB 3HG1E 4IRSB 1N7MH 4WUUE 3RWIA 3BEVA 2R1YA 1RUKH 5CHNA 3OAZH 1P4BL 1U0QA 3QUXC 5HYSA 2CD0A 2NW2B 4I18A 3D5OF 3NIGF 3MACL 3RUGF 5A2FA 1N6UA 1MAJA 1JNNH 2CUIA 4GAJH 1ZLVK 5I8CA 3PDDA 3TVMA 5B3NA 1FVDA 3LDBC 1DN2A 1GGBL 1HXYA 5LGJB 4ZPTB 4MAYB 5F1IB 2APBA 3MLSL 1J1XL 4M1DH 4YHOH 1YPZA 3K7UA 3FTGB 2BNQB 2G60H 2O5YL 5AUMB 5I1CL 2Q7YA 5GRJL 4PGBA 1VFAA 3IXAA 5HYJD 1WICA 5T5FH 2GUOB 4BZ1H 4G6KL 4FFVD 5LXGH 4PJIB 4YHNA 1P9MC 3TESA 3I6GB 5IHUL 3QCUH 1P84K 4OQ1A 5F9JB 4C55A 1ZANH 4V1DD 3S35L 1KXVC 4ZTOH 4H1LH 4N68A 2F53E 1BZQK 4QHKJ 5E8NB 4CW1A 5LVEA 1Z3GH 3WHXB 3SGDH 1CT8A 2DTSA 2A9NL 3QG7L 5GPRA 4CBPA 3ARFC 2HFTA 1KIRB 4PRBB 3UTSD 3HKFA 1KPRA 5IBUB 5GRUL 1TZIA 2HJLB 5DRWB 2CUMA 5D2NC 1T7XA 3MNWA 2VUOA 1DR9A 3UPRA 3PP4H 2F54E 1MELA 4C83B 3H0TB 1KCRL 4GRWB 2X4QA 1T5WB 5DC0A 5DYOA 1Z5LB 5ISZE 4LRNH 4HCRA 5EZJA 1PSKH 4GSDH 4OLVH 5I71C 3FN0H 3TVMC 1URLA 2DIBA 4HWZA 5J8OA 4U7MA 3O6MH 3ZO0A 4EI5B 1AR1D 3EBAA 3KXFD 2IGFL 3L1OL 1F3JB 5KS9E 5TGBB 5D6CA 4LEOA 1HSBB 1WIOA 1D5ZB 2W59A 1AGEB 2D3VA 3RWFB 1XF4A 3MZGB 3CFDB 4XI5C 1HH9B 5ADOL 5C6WH 2CRZA 4YNYA 5E5MB 2HLAA 3WXVH 3B5HA 4OFDA 4QHLA 4OKVA 1QFUH 3OXRA 4PJXE 3TNNA 3AMLA 4GAGH 1VFUA 5L2JA 4S1SL 1IM9A 4M61A 5JMOC 2YC1B 2CLVA 5CJ5A 1S7UA 5DRZB 2IAMC 4Y4HB 2J5LC 4LL9A 5JXEC 2FX7L 2KKQA 4XP6L 5IW3A 1YMMA 4HC1H 3I02B 2NY5L 3HI1B 1GGIL 3CUPB 3ROLB 2YBRB 3P9WB 2FEDD 3KWWB 3OX8B 2EE3A 1O5DT 3WNOA 4F9PA 1F02I 1U8MB 2OYPA 4CN4A 1MVFA 3D18A 3U46A 2QQQA 1FFOA 1RQ5A 3F58L 3MCKA 4YHKH 4I3SH 4LSQH 3QJFB 2X89D 4P4KC 4TULL 5C2BH 3HC4L 1FFQA 3CFCL 2X7LB 5D93C 2JJUA 4NNPH 3SY0A 1T6VN 2P46B 3WS3A 1RZJH 3B3IB 1GCFA 4LSDA 1CD8A 4ZQKB 2IANA 2IFFH 5T1LB 1WQVT 4WU5A 1QLEL 3RZCA 2I60L 4FTVD 5F9OH 3WFHB 4UDUB 1J0JA 2UWEA 5ESAA 4LPTA 2GY5A 3QXAA 2MSPA 4GFTB 2HJLA 3MNZB 1T7ZA 4LFHG 4LNVA 1JZ2A 2ICEB 3QIUB 4OIIL 3V5KB 4GW4A 2VL5A 3ZZ1A 4OF7A 4KUCD 4ZSOB 3QT2A 1UENA 5DTFA 2NX5E 3BUTA 1EEYA 3FONA 4F33A 3FL7A 4L9LA 1PQZB 4Q2ZB 1J1PL 1LO5A 2YHGA 5GRVK 1X7QA 1PX4A 3RUGA 2YD8A 3IETB 4HH8A 3CAFA 5EZIH 1ORSA 4DEPC 4J2XA 5DMIL 5FFLA 1ORQB 4G8FB 3MCG1 4XXDB 1CS6A 1U8JA 1OM3H 3VW3L 2BNQA 3VGDA 4KXZI 2RHEA 5JW4Q 1QYGL 4J3OC 4QXGL 1CFNB 1H5BB 3AY4A 3O81A 1S9VB 3OV6A 4OZ4B 3VI4E 1BBDH 4U1HB 4MNHA 5BOZG 4Y2DB 1ZLWK 4ODXB 3VFVB 2V2WA 1QBLH 4MQ7B 4YE4L 4HKZA 3HRZB 4JRXE 3DETD 3ROLA 1J7VR 4IOIB 4NQDA 5C0DA 3RWIB 3K1KC 1EBPA 4G42B 5F93C 1AIFA 1YNLH 4ZO6A 5F21B 3ARBA 4W68A 3P0VL 1CLZH 2YA0A 1JYVA 4HFUH 1CLZL 4U33A 2EE9A 2NY6D 3ZSTA 1SMAA 5EORL 2AXGA 4KTDL 4R90L 3WN5A 2F54D 5J11C 1UB6B 3BFOA 1ZVHA 1UWEL 1AC6A 3WDIA 3RVVC 1EX0A 1AJ7H 1F45A 3NACH 3S3SA 5L6YH 3RWGA 4JR9H 5HHME 4PJBF 3IAGC 3DLQR 4YE4H 5DUML 3DVNA 3MC0A 2APXA 4POYA 1F58H 2R4RL 3GUTB 2FSEB 2K3TA 4OD2B 1T4KB 4HUNB 3U9PH 1YEHL 1MCQA 4ZUWB 1OY3B 5IOPA 5C07E 4HIHA 2QV2A 1A47A 1U6AL 4L8DA 4FFYL 4DAGH 4XGZB 4QOKE 4KROC 43CAA 5GGVY 3X11A 1MWAH 3ZHLA 1IE5A 1IEBA 1D5XB 1IC5H 5FF6A 5HGHA 3DX7A 3LPGA 4HWBH 1MCWM 4X6CA 5EOCL 3VD5A 3UJIL 1QLRB 3LDBB 3MA7A 4JAMB 4UU9A 1KIRA 5ANMB 4D9LH 4Z95L 4LCWE 3TPUB 3HZMB 4KZEL 3QEQA 5T1DH 3LRSB 2Z93B 1B88A 1EGJH 2X4PB 4QOKA 2B39A 5DUBA 1TMCB 4NM8H 4PJGE 1O0VA 5DVKA 5DGQA 3H0TA 5D2LB 1C08A 3O4OC 3IETA 4Y5YC 4GXUN 5ICXB 5SWZE 3Q5YA 4M1CC 1T3FB 3BGMA 1M7DA 1KN2L 4TVPL 3TJEL 2FO4B 4U6HB 3NFNA 4K07A 4WI5A 5FB8A 4QRTB 4FQ2H 1HKLH 1FCCA 1T7YA 1XZ0B 1WK0A 3L6FA 2C1PB 4S1QL 3RIAK 3TIEA 1DQQA 4XNYH 3D0LA 3U0TA 3QQNA 3V5KA 3ALPA 4XP4L 1A9BB 1KBGL 5EBWA 4M8QB 1X9QA 2XN9B 1TTFA 3O9WA 3G6AB 4DGVH 3I6GA 3FFCA 5D7JB 1JF5A 1IGIH 3OZ9L 1CXIA 1YEJH 5L0QC 1ZTXL 4M7KH 5IVZA 2NY4C 5F7MC 5DLMH 1MI5A 1PZ5B 4TULH 5C2BL 1TPXB 1C8PA 1JNJA 4OIAA 4I3SL 2ZZUT 4YR6B 5FECB 2OL3A 1HHHA 1F11B 3GSOA 5DK2B 1QACA 4JM2A 1HXMA 5GHWH 5ITFA 4W4NA 5BO1H 1AHWB 3ULUC 3A0OA 2XA8L 1ODAA 5LJYH 3FCTB 3QEQE 1RURH 2PO6C 4PJIF 1QUNA 3ILPB 4GQ9L 4GH7B 5BS0A 3O6FC 1EHNA 4ZFGL 5F7HA 4RGOH 4DZBB 3RWGB 2CPCA 1N5AA 3AU1A 3ZT6A 5IT2L 5D1ZD 5DVLA 2XZCL 4P46D 1ZGLP 5DMGD 5FHAH 5HI5D 4ZO7A 3QUYB 3B9EA 4Z7QF 1BQHA 1BLNB 2FBJL 3S6CA 3M17B 1OB1B 4KKBC 5DK0A 3QHFH 5HHMD 3RHWF 5MERA 3H9SD 3DO7A 1U92B 1P4LB 5EOQL 1MJJA 3UTSB 4WENB 4NBZB 4M03A 1QSED 1CG9A 4OV5B 1FYTB 1UADC 3EJZD 5T3ZH 1KN4L 1ND0B 1BZ9B 4LCWB 1CD0A 1FNFA 3IFNL 1BQLL 1RUPH 4IOIA 4R9HA 3SQBA 1E4KC 1RPQA 1G7PB 3DYPA 4B50A 3VWJA 4G7VL 4JO2L 4JY4A 2FL5A 3L3JA 3M1BA 4YO0A 3RA7L 5GS2H 1AQKH 1RFDL 1T21B 3L7FB 5F9AC 3RWJA 3SDCD 2RQ8A 4H20H 4MJ6B 5IBLC 3PDOA 5EZLB 3VMPA 5CLTA 2C3WA 3UBXB 5HYFA 4OI8A 2EXYC 2P5WD 3B43A 2I60H 3PWVB 2OSLA 1TQBB 3ZYZA 3CNKA 3MRPA 5CIPH 3QAZB 3L3IB 4Y5XA 1X5LA 4PUBH 2AW2A 2DD8L 4K3JH 3VXNA 4HWUA 1DSFL 2VIRA 1GGIH 1CLCA 3FB6B 1AI1H 5SWZD 3KNBB 4X6FB 5KSUB 1NGPH 1HWGB 1A1OB 2BSRB 3C2AL 3CX5J 5BW7A 1GYAA 5E4IA 3KPSD 4J3UA 5F88B 4L9DA 2DKMA 4LCCC 3VGAC 5J13C 2Z8VC 4LHUD 3C6LA 3T0EE 1INDH 1HN1A 2EXWD 3QB7C 4YHYB 4GG6F 2BVUA 5C0RL 3LH2L 5BZWA 4D8PA 3V4VL 3DI3B 3EDFA 5IW1A 2EIZA 3HZMA 4BSJA 2IAMD 2VN4A 5KVMC 4NQSA 3MA7B 4JAMA 2VLRD 3T8XA 4YDJA 4JZJC 4OCSL 5TDNA 3W82A 3GMQB 4YDLB 2I9TB 3RHWK 3RX5A 1J86A 2J6EA 3PHSA 4KV5E 2ESVB 5IBUG 5K9JL 4N1EA 4NZJA 1J1OH 2XQYK 5CSZB 4RBPK 3RIAF 3VH8G 2F74A 2DQIH 3UTTD 4WI6A 1PEZA 4WNQA 4MXWH 3QR2A 1A3LL 4OFIA 3F7YA 4V2CB 2P4AB 4NO2A 4G42A 4OLWL 3PWVA 1RIHH 4JY6A 5KSVA 2HKFH 1Q0XL 1ZHKB 3VCLA 2BOCA 2DOCA 3QPQD 5I15L 4UNTA 1CXFA 3SGDI 3L1OH 2JLLA 5DD1L 1NBVH 4MJIA 1BQSA 1MIEL 1EFQA 5DQDH 4NUJA 4KKAC 2JKXA 1HXYB 4FXLA 3ZHDA 4OZIB 3O9WB 3C9NA 3QUXB 2VXSL 5LCVH 5EBWB 1ZHBA 5DD3L 3D2UA 4UINH 4HK3J 4BK4A 3CU1A 5BW7C 1D6VL 4YR6A 1T5XB 4EOWL 3OF6A 1OAXH 4JE4B 1I9RH 3ZKXB 3DURB 1YQVL 1U8LB 1TQCB 3GSUA 5MENB 5DMJB 2HMIC 4FN0A 4UIMB 5DHVB 5EIQA 3U79A 2A9NH 3IDUA 3C8KB 2RJMA 1OWRM 1FVEA 1AE6H 1J05B 5I19H 4HWNA 2DM4A 1EHLH 1DBML 5IVXA 4FQXA 3VG0H 1RUQL 4G43A 3D69A 3MJ9H 1S9YA 5IJVB 4Q9RH 1RUQH 3FB8B 4KROB 4CMMA 1S3KH 4O2FA 4ZDHA 2P49B 3S36H 5B4MD 1SJEB 1JGDB 3RGHA 3NAAL 4I5BB 4JG1H 5T33L 2G5BA 5GRJH 2JIXA 3VFTB 2R8SL 5D2LA 3C60D 5I1CH 5DDHB 4J23A 3ZE2E 2VLJB 4YGVA 3NH7L 3WV0A 3ZDZF 5CD3B 1BZ7A 4N90E 4G5ZL 1IGCH 3EYQD 3TT1H 3VDAA 5JXAH 3BHBA 1RY7B 2H9GB 1U93A 3HZKB 1KENH 2OXGA 3LMJH 4X0KB 3KPRA 2O61A 2E7MA 4J8RB 4NJAL 3ZDXF 4OD2A 5CJOH 2R23B 4HKXB 2YPLB 2DJUA 5CUSL 3NOIA 4PY7A 1JRHL 3HC3H 2X7LA 5HDOA 3OXSA 4K2UL 3V4UL 3MLVL 3HI5H 1P4BH 3HMXA 3JVGA 1XGPA 5EPMB 4DKFH 4YHPA 5DJDB 2ZG1A 4Q9CA 5I1HL 1J8HE 4IM8A 1GZPB 5F96H 3TH4T 1WEJL 1K9TA 3D39A 2EC8A 1XF3B 2Q6WB 3SKJH 1WAAA 1YEKH 1YEIH 1L7TH 2V17H 2OP4H 4OCRL 4L3CB 5I76B 2APWA 3IAQA 5KSUA 2FIKB 3ULVE 3QEQB 3UTPE 2E7CA 3TPUA 1JPSL 3PGCA 5D96B 4H8WC 2ICEA 4Q97A 3ETBF 4XVUC 3VFNB 2NY0B 4UZGA 4FQHB 1BJ8A 4QRUA 2FJFB 4O4YH 4YHMH 4JO2H 4X80L 3ULSA 5DK3A 5EZOH 4MSWA 1SM3H 4JN1H 5CEYB 4UT6H 2HRPH 2YD2A 5KAQG 2IPKB 1KPUA 1V7NL 3NCYP 1VA9A 2C7UA 1BVKB 3AS1A 2QSTA 4NO0B 4C4KT 3H2WA 5IHBA 3BP4A 3TBSB 4D0DA 2AP2A 4HJGA 3T0VA 1DTUA 5ICZA 2IWGA 2K7QA 3N50A 4P23A 1A3RL 2BC4A 2FJFA 3HI6L 2QJDA 1XGYH 4M62L 3EYSL 3DVFA 4MXQD 4N8VB 1FBIH 4BELD 5EZJB 3NBNA 4PRIA 3QFJE 4PJFA 5SWSA 2XZQH 1SY6H 4Y2DA 1BVKA 2RFXB 3C87A 4HK0B 4XNZB 1VHPA 4ZXBD 5KS9B 2CRMA 5BJTB 5C0NC 4MDJB 43C9A 1SY6L 3A6CL 5E99L 5HHXH 2CXKA 4PB0H 2XRAL 2YS4A 2WUCH 3T0EB 5CEZL 3T0ED 4G6FD 4EDWH 1H3TA 3QIUA 4YFLI 5HYEA 1CLOH 4RISL 4M7LH 3ME0A 4WTZA 4KDTC 2NY3B 2VQUA 2J6EH 3Q1SH 1SBBA 4EXPX 2Z91A 1KG0A 1DL7L 3NIDE 5L2JB 4BQ9A 5CJXA 1JNLH 5KTEH 1R3JA 4ZSOE 5FYKD 2V2TB 1TJHL 4R7NA 2R15A 1DN0B 1A1NB 4TNVK 3ARRA 1TJHH 4GW4B 3GMRB 2PR4L 4F2MA 2AV7B 2VISA 4JPWH 4XMLH 4XMKL 3TO2A 1Q72H 3T3MF 3LEXA 5E99H 4ONGH 4HDIA 4P9ML 3V6FB 1KCUH 1HHKB 1JGLH 1UJ3A 2W65B 3BKML 4N0YH 1QFWI 5IMKB 2CK0L 4GT7A 5D1XB 3D18B 3U46B 1S9YB 3HE6C 5INCB 1OT1A 1NGZA 1AKJB 4PRAB 2W60B 1CT8B 3N9GL 4FQXB 5GGUB 1MREL 3OKLB 3ZE0E 5I8CB 3MODL 2FIKA 2BNRB 2OLDA 1CL7I 4I0PD 3CFKB 3U1SL 1JP5A 5CMAB 5IFHL 3S88L 5DA4A 3THMH 1I3UA 4GBXC 1WISA 2ZKHL 3MGOB 4OSUL 3VXSA 2NY1B 3Q0HA 3X3GH 3WDHA 5I1JH 4JREB 4DK6A 3IDGA 4N9GB 5TF1H 2QSQA 6FABH 4FQPA 2PR4H 2Y06H 4OZGF 3MREB 3IDXH 4M61B 3AAZB 5C07B 1J8HA 4ODUA 1I7ZA 2WAHA 4DKEH 1PZUB 3O8XC 1CGWA 1MCHA 2JCCF 2VDOH 3Q5OA 2Y23A 4NKOA 4MNGA 4X7TB 4NQVA 5I16B 2EE2A 2YPLA 1OP9A 2WANA 3QUXA 3RWEB 8FABA 2DQGL 5CP3A 4XPGL 3MROA 1AGEA 2AEIT 2RB8A 4JFEA 5BOPA 5D6CB 3Q6FB 3F5WB 1UH2A 4RFEB 4KK5C 2Y6SD 2DLGA 4M8VA 4QGYA 5E70A 4DTGL 3STBA 3G5XB 5TFSL 4EN3C 4DVBB 2EO9A 2AJXL 1R5WA 5LGHH 3K46A 3EAKA 4M6ML 4GG6E 1BVZA 4HUWA 2IF7A 1PLGL 4RAUB 2VTFA 2GSIB 4L4VA 4LQFH 4LU5H 4R26H 4NNXA 4RDQF 4XWOC 2XICA 4ZPTA 5DYOB 4RWYH 3PL6C 4NN6B 3HG1A 1OP5K 2XQBH 1IARB 3ULSB 2F54B 2ZNWA 1S9WA 1YQVH 1E0OB 4KZEH 4MLIA 1L7IL 4H88H 1BWWA 2CDGA 4RA3A 1X5XA 5CZVH 3PE9A 1FRGL 3U0PB 3QDJD 5FDYA 3VG9B 5HI3D 2VZSA 1AXSA 4OLZH 2VLRB 3L7EA 5D7KE 1HYSC 5AWNH 2XZAH 4P59H 5HY9B 1NGWB 3LHPH 1NJ9A 1WWCA 4RGNE 3F12B 4KKCC 3SDCA 2UVEA 5CP7A 3WBDA 3V5DA 1ZT1B 3S36L 4HD9A 5D7JD 4KJPC 1JPFB 1KPRB 4Q9RL 4OCXH 4KMTH 2NXYB 1T66C 1UM4L 2N4IA 3B4NA 2P5WA 4N0UE 1S7RA 1DBBH 2OJZH 4ALAL 2AERT 5DQ9A 3OXSB 4D0DB 4FXGB 4R7DB 1KV3A 3RJDA 1KLGA 1YEIL 2K9UA 3QIBC 5L6YL 1LP9B 3BKCH 5BVPH 1MFAH 3RPKA 3I50H 2NLJA 5GS0L 3RVXD 5F9JA 3EOYG 1AGFB 2XPGB 1YYLH 4JRXD 5E2TH 5GGVH 1WFTA 3JWDH 4QEGA 1G7MA 5HHQB 1MUJB 4PLJD 3GB7A 3MRKB 3QZWA 3T65B 3JUZA 1VGEL 5IVOA 4NM4L 2PW1B 5IMMA 1FIEA 3HI5L 1QHPA 3M1BB 4X4XB 3UTQA 1IC7L 4JY4B 1ZVYA 4TSAL 1KLUA 1FZJB 3PL6A 2DLFH 1EEUA 1N2RA 1NAKH 1LD9A 1TZIB 1QLFB 1XGRB 3SGJA 4PIRF 3EFDL 2P8PA 1A6TA 3MSPA 3X12A 4X7FC 5JXED 3TO4C 5F6HJ 4HPYL 3RTQB 5K33A 1MPAH 5EU4B 1P6FA 4I9WD 4WUKL 2OI9B 4HJJH 5DD1H 5C1MB 1FG2A 2H2SD 5LCVL 3UTTA 4F37F 3F62A 3SKOB 4P2OB 1LEIB 5T33H 5IKCB 1TJGH 3WFZA 1MCFA 1IRAY 4FFWC 1A1OA 2BSRA 4KTYA 2NZ9C 1RU9L 3RDTB 3QXAB 3WCYA 4K9EH 1OM3L 3SDAA 3P0YH 2DMCA 3TNMB 2K1MA 3OGCA 3RX7A 1HSAB 1CQYA 4D0BA 2D9QB 3QUKA 1P9MA 3WNMA 1UEMA 5BZDA 1J0KA 1GGYA 4X4ZA 3A6BH 2KUTA 3D2UB 3TV3L 3HE7A 1I1CA 4RA0C 1V8HA 3BPOB 2BJMH 5GSVA 3QPXH 3FT3B 1AQKL 4LPXA 4XP5H 4JHBA 3GNMH 1DLFH 5JUEH 3MRLA 1R3HA 2JB5H 4QKXB 1BX2A 2NY4B 4XNQA 1BEYL 3QDHA 1ACYH 3U4EA 3MBEB 4FTVE 4O2FB 3K1DA 4M93C 4YK4C 3RGVD 3VXUB 3JZ7A 3QUYD 1UZ8B 4JFXB 4HKBA 3IRZA 5IHLB 1G7PA 2JJTC 4A6YA 2F19L 5JW4R 3OX8A 4PGZA 1XEDA 3I3EA 1NC4B 4PLNC 1YMHA 4K8RH 1KYOK 3V5HA 1TVBA 4L3ED 3QUKB 3EOAA 3U2SB 3VE0B 3ARTA 4WW1B 4R0LB 3TZVB 1B0WA 2Y5TB 1T2QH 3SGEI 4LCWD 4FZEL 5D1XC 4YQXL 1XGQB 3DYMA 2IFFL 2BY3A 5I0DA 4UQ3B 3O2WH 1FJ1B 3ROOB 1C08B 3VI3F 4Z7WE 1B6DA 5I1IH 4KDWA 5BZWB 2CDFA 2FATL 3HC4H 1ZHBB 4BJLA 5EO1B 1IM3A 1VCAA 1JVKA 2NY0D 4HUVA 3VFUB 2APVA 5GZOC 5F3BA 1INQA 4UTAH 3WS6C 3O3EA 4PBWD 1I1AA 2PCPB 1LK3H 2F53A 4NQCD 1P7QA 3MRJA 4AEEA 1WCQA 3SQOH 5EU6E 4XC1L 1LD9B 3PHQB 1DANU 3FFCE 3DROA 5ECJE 4U1IA 4S2SB 2BY1A 4MVBC 3EGSA 1IAKB 1RHFA 3MO1A 3CPLB 4BQ6A 4CMHB 4GG6A 5HDBE 2VXTL 3EIFA 1FFPA 2PETA 1FSKC 4PG2C 3LEYH 2FBJH 2SEBA 3MJ7A 1QVOB 1NMBL 4TSCH 1A2YA 2RCSH 3EYFA 1LP9A 3BQUC 1KN2H 2H32H 4ORGA 1F6AB 2QKIB 1NUNB 3WXVL 2IG2H 2QEJA 4FXGA 4R7DA 4I8DA 4RGOL 5C0BB 4OZFG 4IOFD 3CFEB 5FHAL 4F7TB 2ITDB 3CMGA 2Q8BH 5E9DB 5C8JA 4N0FB 3B9KC 5ICYB 5MHSD 4Y1AB 1TLKA 3PV6B 4WFHE 2ZUVA 4NRYA 3CDGA 2VXQH 3S5LG 3IDIB 5J89A 4YHOL 4BH8A 5TE4H 3EYFB 4PV8A 2VZTA 5FKPA 2VLKB 1DE4A 1PD6A 1MFAL 1CCZA 1A8JH 2SEBB 3MV9B 1N2RB 1OB1A 4HWBL 3QO0A 2VC2H 2HA1A 1H3PH 3MACH 2C4FU 4F7TA 4R3SB 3GJEA 2AXFA 2PTVA 5ACLA 3RVXC 3O6FD 4ODVL 3IYLW 3NPSC 3IFNH 1B0RA 1U58A 1LEKB 5EBMA 4U1SA 1YMME 1F3DJ 5EO9B 1TFHA 3V0WL 4FQ1H 4CU6A 5EO0A 5KZCD 3IKKA 3DUHA 4U6TA 4PBXA 4L9LC 1FYTD 2NW2A 1M05B 4IIQA 1UXWA 4NO0D 1WBZB 4WI8A 3KPQA 2YPVH 3S96B 3SGKA 4U6YB 2I07B 3C5JB 3ROOA 2FWOA 3G04B 3MA9L 5FOBB 3KPSE 3B6SA 5JW4N 4NWTH 4YXHL 4LLUB 3SDAC 3TWCH 3MYJB 1BZ9A 1A6AB 3VJ6B 5KVEH 4QY8B 4GQ9H 4JFQB 4TSAH 2MKWA 1OCWH 1H5BA 2VNCA 3HE6B 3OKDB 1LEGA 4OAWA 1VGEH 3HNVH 5GISL 5CZXC 2P43B 3RDTA 5EFIA 1LO2H 3QSKB 3PIQA 1KT2B 2GW5A 3ZLQC 5EWIL 5IR1A 1NQBA 5E03A 3V52H 5E2WL 5J9PA 2BNUA 1ZSDB 3WLBA 1V3LA 2MJWA 4XHJD 4MDIB 3CIQA 1CGVA 2F54A 4J3SA 3H9SE 1QBLL 3BPNC 1QFOA 3ZT7A 1BFSA 1A7OL 1CK0H 3GRWH 4HKJA 1YC8A 4EKXA 1BBJB 1G84A 4XP4H 2DQGH 5HYJB 5E00B 3V0AC 1J18A 4F7MA 4D9RE 3SDDD 2HH0L 4GUPA 1GSMA 4QRSB 3DHMA 1ONQA 3CLEL 3DX8A 3PWUA 1IGYB 2DYPA 4QHMA 3H7BB 5INCA 3L3DA 3CZFB 1EO8L 1T0NB 3WFDH 3TJEH 4K7FA 3QXUA 4MMZC 4LAQH 4KQ4L 1MI5B 1PZ5A 1SYSA 5D1QD 1LE5A 1YEDA 3D9AL 1P1ZB 4G6JH 4P2OA 2HTLD 2E27L 4WEUD 1JWUB 2AV1B 4X7EC 4NQVB 1IGYA 3D0LB 5MHSE 4LOUC 3SOBL 4JPIB 3FQUB 2ZUUA 4K3DH 2A83B 4D0BB 1CXEA 3T2OA 1T0PB 4M93B 3H6JA 1HNGA 4IDJH 2VABA 4X9IA 2CK0H 3QDGD 2BNQD 4PLKD 4ZUUA 1FDLL 3BEWB 4LQFL 5T1LD 3RDTC 3BH8A 3UTQB 1FFNA 4L5FH 5F7NC 3TT3H 1I85C 3MNVB 4JKLA 3TNNB 1QYGH 5EU5B 1I8MA 1F4YH 4NN7B 2BNRA 1T89C 3VGFA 3LHPL 2OI9C 4XMPL 5L2KE 3MV11 3STZA 1Q0YH 3LPWA 1WCBB 3MRNB 4WFFE 4QXGH 2MWCA 3P9LA 3RQ3A 3DBXB 1WBYB 1S9WB 1JK8B 1J1PH 2IH1B 3TH2T 3BN9C 3S5LA 4ETQB 3O9WD 4EI6A 5FYJU 2Q76B 1DANT 2R56L 5E1AB 1EHXA 3B9KA 3L5XL 4U1GB 1YNKH 2Z35B 4UQ2A 3NTCH 1U8IB 1F90L 1Q9WB 2DTML 3FO9A 2X41A 1CGYA 1R6VA 4O51B 2X4QB 1DJSA 4IHOA 4C83A 1F4AA 4HC1L 2QQLL 4RFOH 4TVPE 1VADB 3MODH 1DQDL 2VQTA 4AQ1B 3PV7A 3OKNB 3WFBH 1EHAA 1HQ4A 1KCVH 2C4XA 3TH3T 4TNWF 4IS6B 4OBSA 4Z0BH 4NRXA 1QLEH 1VB9A 1CL7L 2VLLA 5TDOA 2E6JA 1PY4A 4IOSD 1U2CA 5E0QA 1NH6A 2KL6A 3DETC 1A9EB 2DICA 2R9HD 4XP9L 4QHLB 2BRRL 5F9OL 3BH8B 1Q9WA 2BSTB 4XPHL 4OZFB 1GZPA 1NC2B 1MFDH 4Y89A 5EZIL 4G7YH 4KFZC 1RZJC 3RY6C 1H3PL 2VUYA 5FUOL 1CVSC 3F7VB 2P1YA 4NHUA 4X5WA 1FC2D 3OAZK 4FNLH 2I24N 4I2XE 4WO4A 4LRNL 4CRPA 1FNEB 5B38G 1EZVY 5ISZB 4KK9D 1FL3A 2AEQH 2ZOKA 2CO7B 2OP4L 4LBEB 3BP5A 3VRJA 5DJXA 4ZO8A 1UT9A 5IB4B 2ICES 3VRIB 4UAOB 1JUFB 2EDRA 1HCVA 1KJMA 5DUPH 2XFXB 4OFYD 1F6LL 4BZ2L 1NCWH 3FQNB 3D1MC 2HJKB 5BXFB 1UKSA 1ZLSH 1G9EA 4FXKA 3VRLE 4QHMB 3SY0B 3GSXA 5HGGS 2R2EB 3O4LB 4N0CD 5EC1B 5D5MB 4PP1D 4ZDHB 2F19H 3HCVB 1P7QB 4EN3B 3NCCB 3STZB 1PVHA 5CJOL 4UI2A 3IDJA 1NCDL 5B39B 1CD1A 5FGBC 4RFNB 3H9YA 3DPBA 3W0WB 1XGTA 5E8NA 5J06A 4PJIE 3DMMD 3SBWA 3KYKL 4RZCA 5HHNB 3QUZC 4O4YL 5IV2A 3V6ZA 3HPJB 1FE8L 4TNWK 4YXKL 1AQDA 2R8SH 1JTTA 4U0RC 4URTB 4OCYL 1UKTA 1YEKL 1B3JA 5DJCB 2ZSWA 2OZ4H 1T03H 2GJ6D 1F4XH 3MUGA 1R5VA 3DXAE 4PG9B 4ZOCA 1NBQA 3PNWB 4WV1C 5C0BE 4OZHE 2B1AH 4KRNA 4PRID 5SWSD 2J8OA 4MA7L 3JV4B 3GGWA 1E4XL 1JGDA 3EZJB 4CVXB 1MPAL 1WEJH 1CI5A 5FKAB 2VZVA 2AV7A 2VISB 5E6YA 3UZVB 5HVHC 4GW1A 4NFCA 3WLBB 3V79C 3LCYA 4S1DC 2BXZA 1T89A 2VWEE 4G6KH 3VXUD 5HYIA 1F2XK 1YEFH 1N0LA 3RWDB 2H32B 1YN6B 5CUSH 5DJ0B 3TN0D 4Z76B 1TQBC 4QXWA 5E8DH 4Z78A 2NR6D 3PGDB 3T3PE 2Z91B 4UT6L 1WUNT 3EZ8A 3HS0A 3MGAA 4MCYB 2Z92B 2CJUL 5C0IB 3AXLB 5HD8C 1S3KL 4OUUB 2JB5L 3VXPB 2A6KA 2NX5D 1DLFL 5FOBA 2H3NA 2ORBH 1NFIA 4L4TE 1J9CT 3VWKC 1QQDA 4YIQA 2EIZB 2YD1A 4YNYB 1M6OA 5E5MA 1TCMA 3BPCA 5IK3A 3O3DB 1J1XH 4FFWD 3C9NB 4CUCA 4MXWL 5A2IH 4P2CG 1T04A 3UBXI 1MVUA 2VAAA 3H9HA 2EDQA 4M7ZC 5C0BA 3O3AB 5JNYA 3O4LA 2JF1A 2DLHA 2HT4D 3QG7H 4XNXH 3WIFA 2AK4B 4L4JA 1NAMA 2FGZA 2EDYA 5SWQB 5FYLH 4WI4A 1FAIL 1JRHH 4PGDB 4W6YB 4Y4FC 3LY6A 1FGNL 2JB6A 3VFOB 1LK2A 3S35H 2ARJB 4MD0A 4YBLB 1S5HA 1KPUB 4Q0XH 4X5XB 1CN4A 2OZ4L 5HYJA 1WWWX 4DZ8B 4UNVA 1EA9C 2DM3A 5TE7L 3WIHH 1YN7A 5DD3H 1SJEA 4RMTA 5D5MF 3QEQD 1FV1A 4P57A 1MCOH 4PFEA 3GJFK 4I4WA 3VGGA 3L9RB 5FO7B 5C6TL 2AJSH 1ZGLM 4ISVB 4P3DB 3ARGA 4RFNC 4NJ9L 3LB6C 1OW0A 2O5XH 3LKRA 5GGVL 1A3LH 3QXWA 2F58L 1S7QB 4GKNB 2NPLX 1G9NC 5ESQB 1JNNL 4ZD3L 3QNXA 3GMPA 2QADC 1AXSB 4XAKE 4D2NA 4QYOB 3MR9A 3TA3D 5FEBA 1BLNA 2GITA 5DC9B 1YZZA 5CJQH 1MFBL 4LP4A 1AGBB 4KMTL 1T1WB 4J6RL 2BVTA 2YSSB 2AJYH 3RY4A 3CFEA 1LE9A 1CLYL 5BRZD 1OHQA 5BV7H 1JWSB 1TVBB 4G3YH 4IIQB 1BAFL 2HLFC 5JPNA 1IAMA 3MYZA 3DV6B 1GL4B 5INDA 4PJDB 1NCAH 4NQDD 5C0GB 2G75B 2AEQL 2GI7A 3X14B 3LS5H 3LKQB 1RIVH 4M48H 3VH8A 3TBWB 1B0RB 3EO1A 1DSFH 5IMOA 4L3EB 3MGTA 3ZKNC 2CR3A 1FL5B 3QDJB 1MNUL 1JTOA 4AIOA 3QEGH 3FO1B 3GO1H 1MREH 5EUKA 1T22B 4LLMB 5K9QI 1SEQH 3QWRA 4P2QB 1IFHL 2G75A 4LVEA 1ZT7A 2BRQA 3KHOA 2CUHA 3GRWA 5D1ZA 3HNTH 1S7QA 2HKFL 3RL2A 4HLJA 3L95B 1CBVH 4OLWH 4JDTL 4ELKA 1RIUH 4G8IB 1OW0C 3C5ZA 4TQEH 5GHWL 1TXKA 5EOTB 4N0UB 4OB5H 4G7YL 4M3JA 5TQ0L 4AG4H 3F65A 5I75B 3VXQA 5J1SC 3Q2CA 2E3VA 1MAKA 2AKRB 3T77A 5I74B 1RD6A 4XCYB 4PRIE 5SWSE 2DQEH 3KPRD 3MUZ1 1ZTXH 4FQLL 3REWB 1FL5A 2XNAA 2VLKA 4AEHH 2X89A 3BYTA 5K9KB 3KJ4B 3RNKB 2YRPA 4K7PY 2YUXA 2XN9E 1QO3B 1BQLH 1RUPL 4JPIA 3FT4B 1KB5L 4XXCA 4RSVA 3F7YB 1S78D 4P3WA 3KPPA 4RISH 4XCEB 1MFCH 2FD6H 1FYHB 3KR3H 4G80B 3SEPA 1U8QA 4M4RA 4E0RA 3OJVC 2DLEA 6FABL 1XF2A 5CSZA 4ZPVA 2NY1D 2YOCA 3ZTJG 1LNUA 1PJ9A 2NXZD 1HEZB 6CGTA 4X6CF 1LEKA 5JW3H 3DX7B 2LQRA 1RZIB 5BV7C 1UYWH 2NZIA 1RVFH 2DN7A 3BN3B 1R3HB 2I9TA 4Y19E 3ZDYF 5IFHH 5JO5A 1B4RA 1KEGH 1K5NB 4MMXC 1Q9KB 1IAOA 5GXBB 4NZTL 1HE7A 1V3JA 5B8CA 3T0DA 3GBNH 1WZ1L 5DQ9B 4QRSA 5KG9A 3L5XH 3BIKB 4Y4HC 5DHXB 3NGBC 3RNKA 3UJJH 4NRZB 3BKMH 3TA3B 4L5FL 1D9KB 5CP3H 4GXUM 5DI8A 1JGEA 3GSNL 4KU1A 3H8NA 2FB4L 4HJ0C 3TZVA 1Q0YL 2ATKB 2VE6A 1UJTA 4WIQA 3IXTB 2I26N 4Y88A 3OKNA 2VLRA 3L7EB 5EOCJ 3WN5C 5DLML 2IANE 2Y25A 5CINL 4I9WE 1YN7B 5DK0B 1Y18A 2VITA 1RUAL 3S36X 4WDIA 1HKLL 2HAZA 4E41A 43C9B 1G9NL 1XAUA 3I6KB 4UNUA 5HJ3B 1MCNA 2EYRB 2ERJB 1H0DB 4PJFB 4LOUD 5C09A 2WV3A 4HFWB 4ODSH 4M5ZL 4H5SB 1B90A 3ISWA 1EFXA 1B4JL 4PJEB 2Q1EA 3QYCA 3LAFA 4YWGL 3H9SB 2X05A 1C5DB 4DUVA 3JV0A 3O2VH 4E41E 2NY1C 1MAMH 2GJJA 3ULUE 5F7UA 5DFWH 3LN9A 1JNHA 4GRMA 1YPZE 2XPGA 4RDQG 5SX5K 3OSKA 1X5IA 2J4WL 3HZYA 4G6JL 1S78C 4N90D 2KZ1B 1RV6X 1BOGB 4JB9L 4LSUL 3WIHA 1P4LA 5TQ2H 1XCQB 3QXVA 2R56H 1JWSA 5CAYB 2ZCKH 3OJMB 4WY7L 3BWAA 2B4CC 5C0CD 1CXLA 4F9LA 1JV5B 4G6AC 4YDKL 2A73B 2ATKA 3K2UL 3UBXG 4AIXA 5MEPA 3L3KA 2HG5A 3OKYA 5H8DA 1W2KT 2GK2A 4BUHA 3DI2B 4XB7A 3BZEB 3U6RB 1LO0L 3NZ8B 4EI5D 1XR9B 5B22A 1HH6A 4XCFH 5FA4B 4V2BA 2NTFA 4YDVA 1ZMYA 3NAAH 4WHYG 1AFVL 1REIA 5AZ2L 4NRYB 1F4YL 3WHE0 4I2XB 1B2WH 2IAND 3MX0A 3PABA 4JFDB 4HBCH 1M1SA 2NY7H 5F3HB 4WW2C 1WBXB 5IV2B 4CDGC 1ADQH 4UT9L 3O41A 4PGJA 4Y16C 3VI3E 2QSCL 2FBOJ 2QKIA 3WEXB 1I8IB 5HPMB 1TENA 2IFGA 3FO0L 3BISA 3X12B 2XN9A 2V5SA 4HHAB 4CU7A 1MSPA 5GSVB 3C60A 3VFPB 4PJDE 1YNLL 2DI8A 1IQWL 2AJ3B 2FRGP 4J1UB 2BY0A 5FAAA 4GUPB 5IB5B 2BVOA 1J8HB 1NGQL 3UJIH 2YPVL 2JELH 1A3QA 4R4ND 2YD5A 4IRJD 2PNDA 2QHRH 4KDTA 2E6PA 2Y6SC 4PRNB 3RNQA 4L3EE 4TVSa 5D72H 4A2LA 3R06A 1R3LA 4L29A 3D48R 3BP5B 3MUJA 4D3CL 5JOFA 4PJAB 1FL3B 3CVHL 4LLVB 3UJJL 1A7NL 1VFOA 3ARSA 4JY5L 4U3HA 4LVNC 3X17A 5I6XB 4X4MA 3U9PL 4LVNB 1NCUA 4QRTA 3IU4L 3RI5F 4MNQB 4PY8J 5J12B 2P42B 2W65A 2DI9A 4EVNB 3QWQB 1XIWA 3GHEH 1RAMA 2LAGB 2EDHA 3RAJL 4FMKA 5DQJA 3E6HB 2UZIH 1JGVH 3BESR 4GBXD 5IGXL 4ONOA 3I9GL 5CMAA 3C5JA 4Z7UE 2YZ8A 5FO9B 1LO2L 3ZE1F 5EORH 2VDRH 3P77A 4OM1L 5TPWL 3R0NA 1YMHB 2VDLH 4HMDA 4HUXA 3SJVE 4QWWD 1EVUA 3CZJA 1NLBH 3G6DL 5IHZA 4ODHH 3IVKB 1R3IH 2ITCB 1HSBA 1ETZA 1GOFA 1KLGB 4JQXC 3KPMA 3MRBB 1MCWW 4X6DA 1NGXB 1C5BL 1NUDA 1Z2KA 2G5RA 2H1PL 2ZSVA 3I6LD 1K8DA 2V2XA 2HT4C 4Y19A 4Y16B 2R2HB 2WUBL 4L3AA 1WCBA 1GGTA 3BQUA 1ZOXA 4Z7WA 4YHIB 1MIMH 1U42A 1B0GA 3GIZH 1IT9L 3GJEB 3PNWA 4WGVB 4AMKL 5LGKA 5B4MC 2WWKT 1AR1C 4JY6B 5JIKA 2XG4A 4PJGF 5IROA 4PJ9B 4FQQA 1QRNA 5L8KB 1T6WA 5SX4H 5DMYA 4OTXH 2FSEA 7CGTA 4PJDF 3T08A 2JIXD 1T1ZB 1GIGL 3TO4A 4YZFE 3R0MA 4NO3B 4TRPL 1FVCA 1DQMH 5EIVA 3EYVA 3EO0A 4G9DB 2GCYB 2XWBB 5D7SH 3T4AB 4N0FA 3B2UC 2EH7L 1OAZH 4JHAH 2MFNA 1RIHL 3UTTB 2ZCHH 1CU4L 4OLVL 4HAFA 3C8HA 4APQC 3MUHL 1XGTB 2A74A 5IVXF 2OCFD 1UKQA 3QDAA 5I66B 1FN4A 4HT1L 5DJ2A 4GAFB 4CJ0A 4QRRD 1T0MB 4UOW1 1J11A 2F8XC 2X4UB 1X5KA 3HCVA 4LVHB 1T83A 4MD0B 4LLYB 4NQEE 5CWSA 1KN4H 4QRQA 4OT1H 1ORQA 4G8FA 3VDCA 3EO9L 3VMOA 4QOKD 2W0PA 4X98B 4UDUA 1MFBH 2HN7B 5MI0C 2ADIA 1MHPL 4YXLH 4KJQC 1R3JB 3NABH 3I9GH 3MLZH 1HINL 3O3EB 3LKSA 3ARGD 5IHUH 4I5BA 4X7TA 2F9BT 5AZEL 4NIKB 1DLHA 3ILQC 2VL5B 3P11L 2Y9RT 5EU5A 1I8MB 3MV8D 1MCLA 5C6TH 5HYSB 3O3UN 4P2RA 3WL9B 3FN9A 1CGTA 3SQOL 1KJVA 3WNLA 4KI5C 5TE7H 3FN3A 4JO1H 3WIHL 4XHQA 4DVRH 5CD5C 3OKDA 5FYJE 3ARED 2WP3O 1ZGLA 4IDLA 4ZAKB 4M4PA 2RFXA 32C2A 5LBSH 3QUZD 1FGNH 1U3HD 5GGUA 1KTLA 4KRPC 3UPAA 4HZLA 4J3VA 5EPMA 1NLBL 3MRCB 3PP4L 3ZMRA 3WO3B 1AGCA 3VXOB 4XNYL 3P4NB 5JZ7C 1CGXA 5L2KD 1X3DA 3SE9H 5GJTL 1WWBX 3TBVB 3D69B 1R0AH 3PWUB 1U8MA 3WDJA 5LXGL 3ET9F 2A9ML 5GRYA 1EJOL 1OTTD 3VGAB 5J13B 4BQ8A 1ZANL 4JFFA 4QO1A 1QSEE 4K9EC 3VFNA 4BFBD 4Y8AA 4YJZL 2AS5M 5DJ6B 4OD1H 3G5XA 3S5LB 4ETQA 2PUQT 4PP1C 1WBYA 4RFEA 1ZLVH 2Z31C 4NKQB 4TUJA 1UM6L 1T5WA 1RURL 4PTUB 2D7PA 3NIFE 1NCNA 4OKVB 4RGMC 1MCRA 2IADB 1S8DA 1VGKA 3ZDXE 2XTLA 3IU3B 1MLCA 4G9FD 2D7QA 2DQCL 3KS0J 1IGTB 1SMOA 2JELL 5HGBB 1DBBL 5E9DA 4NGHL 4YAQA 3FQXB 5J11B 3QQ9C 1A6TB 2YD4A 4K9EL 3NFNB 4LLUA 2VDNH 4CW1B 1S5IL 5F9WC 3V4PH 1CFSA 5CBAB 1XF3A 3FO0H 5E24E 4PJ9A 1BF2A 4PY8I 4XPFL 4PRNA 2X4PA 5IMLB 5E8EB 1P4IH 3BX7C 5CZVL 1Z5LA 4KDVA 3LSOA 1HOCA 5EULV 1K8IA 2W60A 5DDHA 4M6MH 1A6UH 2AJXH 4I0PB 2XKNB 3NZHH 5EBLA 4CNIB 3WFCL 5IFJB 3TBTB 2Y72A 2BP3A 3MRMA 4OZHF 5L8JB 4WFGD 3P4MB 3DUSB 2BHYA 4J8RA 1JMZA 1M71A 1I1FB 5JHLH 3QPQC 1EGJL 4HUVB 3KPPB 5KSVB 1N6QH 2QLVB 5FM4A 2C26A 1YC7A 1T21A 3O41B 2NXYC 4FZ8H 5E00A 1OF2B 1VEMA 3B2UD 1MWAB 4NN5C 2BSED 5CS7A 5B38A 3DRTA 4JB9H 4LSUH 1CDBA 5JOPE 3GMQA 2V9QA 2VLJD 4RAHA 3KDMB 3E3QC 3VXNB 2V5RA 3VXMD 1JZ5A 3CJJA 1CGSL 5AUMA 1MJJB 3UTSA 3ULUH 1JHLL 2I9LA 4JM2F 1F6AA 1BIHA 5C09D 3M17A 1J5OL 2VDPL 1LDPL 2HG5B 5DUPL 1A0QL 2AK1H 1KJ2H 3C8KA 3DGCR 4PJ8A 3S9DB 1KEGL 1R3LB 2AJUL 4DEPB 4PJIA 4H0HB 2N7AA 1CDUA 1DVFC 4P2QA 2X70B 3GSUB 1EPFA 4FNLL 1EZVX 1IC4L 1JWMA 4R4NC 4J4PD 1E6JL 2UYLA 1G6RA 2NY6B 4JPWL 2FL5B 4KV5F 3QUMA 3MRHB 4AJ0A 5KW9H 2CIKB 4KUZL 4YHLL 3NMEA 3O4OB 4RX4D 1PYWB 3RDTD 5D1QC 1RZ8B 3CK0L 3K8LA 5GJSL 2W92A 2YWZA 4QXUL 1H9VA 4XPHH 5EU3A 4PGEB 1I75A 1BGXL 5ALBH 5T3XD 1U91A 4OV5A 3P73B 2YKLL 1S7SA 4AEHL 3RGVA 3MROB 2EEDA 3MRNA 2NX5A 4R26L 5C0CB 2X40A 2BZDA 5HYJE 5JPNB 5EBMB 1CL7H 4UBDD 2WNGA 3SN6N 4ZXBA 1IGMH 3WNPA 1UACH 1KTDA 3H7LA 3D6GA 2NW3B 3PQYE 4I2XA 2OR7A 4AEFA 4MX7A 2ENSA 4OGZA 2CXGA 1MHCA 4XPGH 4FA8A 4XC3H 3AY4C 3KYAA 1KJ3H 4EIGB 1ITBB 3VXSB 4BH8B 2DQFB 4U1JA 3V5HB 5TDPA 4N0CC 3ULVL 2QR0B 4K3GA 4CDHA 5DTFB 5L8LB 4LSRL 3MXWH 5GGRB 4HH9A 4X8JB 1MCPH 2A73A 3C08H 3NGBB 3SDYH 2DLTA 4YHPB 5DJDA 2VIRB 4AM0A 4F9PC 5CEZH 3VXRD 1OP3K 2OS7A 4KY1H 3RWCA 2W0KA 4TSBL 1K4CA 4UIKH 2G9HA 4V1DA 1JGUH 3UCRA 1EO5A 2DDQL 3GKWH 4OGYL 4XBEL 3VU2A 1I7RA 1ZS8A 2V6HA 4KK9C 3U1SH 3TCLB 3GSQB 4FQIH 1QLFA 1U93B 3HZKA 4NN7C 4OLEA 3WUWG 3DYOA 1F5WA 3S35X 2VDPH 1MCEA 1CLYH 5D96C 5IMMB 4G80A 1OT2A 1KNOB 1OLLA 3BE1H 5GGRA 3ZL4L 2ESVA 5ADOH 2XWJA 3FQWB 2HVKB 2VAAB 3H9HB 3HN3A 3Q6GH 4LLYA 1LVEA 5C0AB 5JQHC 3OHXB 3N1QC 4WO4C 3L3OA 3C5SA 3NPSB 5B3JE 1FGVL 3MLWH 5DRXB 4TOYH 1XIWD 3BXNA 4OF3A 2IGFH 4FQCL 2FH6A 1DQLH 1I1YB 3C6SA 5KSAC 4QF1A 3BAEL 5JA8B 4NWUL 1AO7B 3GSWA 4LHUA 3CH8A 3BD5A 3QH3A 4JFZL 5D7LB 4DKFL 3H9ZA 4NQDE 4MA3A 2Y1VA 4BSVA 1MCOL 5D8JH 4HJ0D 2APFA 2W1NA 3AXLA 4ZTPL 4RGMB 1MHEB 4HF5L 3MV7E 4M6OL 4BZYA 4U1JB 1UA6L 4IOFC 4MNQE 1OF2A 3U36A 1KENL 3R8QA 4X4YA 4P46B 2DQJH 4LCIH 3VXRE 2Y7QB 5DD5H 5IG7A 3ZDYE 1FPTL 3DXAB 1RJLA 2AJYL 3GHBH 4JKPH 4XPBL 3E8UL 3WXWL 4XNXL 3B8SA 3V4UH 5FCSH 4O00A 3V4PL 5EUOA 4GXVH 3G6JA 2CGRH 2ADJA 3C09B 3CMOL 4GAGL 3FFCB 1NMAH 1QFUL 2YA1A 1T1XA 3FCTA 4W6WB 4H25A 1VPOL 5C08E 3RI5K 5HDQH 3EYUL 2EYSA 2EDLA 5BZDB 4XXDA 5JHLL 3BD3A 2PYFA 5CCKL 1DVFA 2A6IA 2B20A 1DBKH 1MCBA 2CLRA 5E8PB 1JWMB 1H3VA 1FIGL 1F00I 1EAPA 5C9KA 3LB6D 3V6BR 3KLAB 4PJ7B 1KCLA 2DIJA 3TGXA 3B9AA 4GRLB 4QHNB 3OKEA 2YD3A 4L8SA 3TF7C 3GIVA 4LF3A 3FONB 4ZXBB 3K8KA 3PP3K 4RZCB 5E2UL 2X4SA 3B2VL 3SGEH 3RKDD 4YDIL 5FYLL 4F57H 2A9MH 5LAXB 2WINB 4PTUA 4HGKC 3S97C 4R96B 2OM5A 1IQDA 1C5CH 1U2HA 5SWZA 1PG7H 5AAWA 5FYKE 1CGUA 3F6IA 1DEEA 3R06B 4U1KB 3SE4C 3MCLH 1W0YT 4XI5D 3EUUA 5EC1A 4OLUH 2WWKO 4WW2B 5D6DC 2ZPKH 1BZ7B 4Z0XA 2LTQC 4I48B 4NOFA 4MA7H 2NMSA 3CPLA 1MHHA 2FJHB 4PRDB 4ODTL 2GK0A 3QEUA 2ZCLH 4MAUH 5T1KB 1AXTL 3CDFA 1G9ML 4PRAA 5F7YC 2F53B 1QEWA 1WJ3A 4P2RD 3FB8A 4CMMB 1WTGT 3LQZB 2DQIL 5HHOB 3TT1L 5HBBA 5JXAL 3VFUA 4Z7OF 1G0XA 5KSBB 4WO4B 2I9LB 1E4KA 2MQ3A 3BVNA 1A02N 1S7TB 1I9IH 5I15H 4OIBA 3GI9L 4YXKH 4FTVB 5E95B 4NUGL 5I1DA 5I71B 3QO1B 3CX2A 3NFPA 1AY1L 2VSDA 3FZUC 4MWFA 4MDJA 4HQQH 1G7HB 2YEZB 3BSZL 5BQ7A 3QDMB 4QOKB 5DUBB 2WK2A 5HGDB 3SDAD 2JJVA 3DSFH 1BMGA 3DO7B 3DRQB 4LRIC 3WL9A 3HS0B 5EN2A 2VXTH 2PW2B 2A38A 3EJJX 1T1XB 4X83A 4K3JL 3U4BH 4MJ5B 3ARFB 1QFPA 1FFRA 5JDSB 1I9RL 3DV4A 5I1KL 2MHAB 2FO1A 5HHMB 1ZV5A 1OAKH 3OKOA 5BRZA 2DL9A 5KS9A 3DOSA 4P9HH 1HYRC 5MEND 1WT5A 4NNXB 5DSCB 1MH5B 4IEFB 3PP3H 4LLWA 2HVKA 2VXSH 2K7PA 4X4YB 1BQHG 4OFVA 3W0WD 4KRMB 5GGTL 4HZLB 4PUBL 2VQ1B 4KQ3L 3QHZH 4BM7A 1J0HA 5E9DD 2P24B 1NCDH 1E4WL 2KQMA 4XP9H 2C7UB 4NCC1 5A1AA 1IEHA 1XH3B 1G7HA 3T0EA 3MJ8B 1CD9B 4HLZH 4POZC 4PP2B 5IJKC 4XVSL 3KHQA 4WV1A 1D5BA 1AP2A 2CIIA 4MS8D 2E7BA 2WZPD 4G7VH 3WFBL 3V7MA 1D5ZA 4WFED 1NCWL 3KYMB 4PRIB 1WTLA 5SWSB 1QKZL 2H1PH 1CVRA 4Y0GA 4NQDB 4OCSH 5C0DB 4JQVA 3LKSB 3KPLA 5C71A 4Q7DA 3QXDA 4XX1G 2ZUYA 5IBTH 3D39B 5DJ0A 1DEDA 3GMMA 3UPCA 1IEAB 3RVWD 2BJML 4Z18A 4Y4KD 4R6UA 5TPWH 3PL6D 2VDLL 1YNKL 2B8OT 4P9HC 4WO4D 2GJ6E 3SKMA 4JKWA 1GH7A 3UBXA 4O58H 4WU7A 3ULUD 5SX4I 4MSWB 4DFIA 4YFEA 4TRPH 5HHVL 5J12C 1AH1A 1EXUA 3OZ9H 3V8CA 1KJ3L 1T0MA 3QDGA 1S7RB 2AGJH 5LAXA 2DYPB 3A6OA 3MOBL 1IAIH 3PWLA 3RY5A 4HIHB 2I25N 2PYEE 5HSFA 2W38A 4O9HL 2HRLA 2VB5A 2OMBA 4DN3L 5I1AA 4FQ2L 1T2JA 5GS1A 4KPHL 4YHNB 4N1CA 3C6LD 5D72L 4LCCA 1RFDH 2ED7A 3PQYB 4KJWD 3WNNA 3ZYJA 3VXSD 2QHRL 5FCUH 3RTQC 1R3KA 1KBGH 4D0CA 1MQKH 2AABH 2LAAA 2B2XH 3BZEA 3BRDA 1S7WB 3OL2A 4U1LA 4JFED 2VLLB 1INEH 1CD1B 1FVEB 3IDJB 2X4TA 4FP8L 4HEPG 4Z95H 4D9LL 1EO7A 4UIMA 4Y16A 5DHVA 3QHFL 4I3RL 5FYLD 5I2IB 1DQTA 1NMCC 3RL1A 2RR3A 5D2NB 5GS3A 4XXCC 2QSCH 4KQ4H 5AD0A 5C3TA 1MWAL 3EYOB 1F11A 3GSOB 5DK2A 1A0QH 3OPZL 4UDTA 3TJHD 4FQQB 1QSEA 2HJFB 5CWSB 4HBCL 3BP6B 3BP4B 3TBSA 3TEUA 2Q20A 5B21A 3UP1A 1EFXD 4ZUTB 3TLRA 4X7SL 2R1WA 4F58H 5E4EC 5CCKH 1FDLH 1WV7T 3ARFA 3I84A 3P9LB 3D2UD 4FQHA 4QRUB 3HMXL 5E7BA 1ZHKA 2DI7A 3CSPA 3SE8H 1A6WH 2VLKE 3S37X 1HOCB 5D2NA 5CEZE 4WEBL 4MCZA 3D0VA 1EV2E 3SO3C 3AGVA 3KPRE 3VG9C 2D7NA 4WWKB 5ICXA 1ZHNA 5HYQA 1MWAA 4PTTA 3FFDB 2R4RH 2KQNA 2DL2A 4QNPF 2IAMB 3O45A 2AJVL 3BDXA 4K3HA 5E08H 1MAML 4LU5L 2B0SH 1O7SA 3GMLB 1PLGH 1CE1H 3BWAB 2VLMD 4YC2C 3GSWB 1GOHA 4KJWC 5IB5A 3HZVA 1XCQA 2DRUA 3DECA 4ODSL 4OCWH 2DBJA 4R4FL 3DUUA 1BFTA 5B8CB 4POUB 1F97A 3IU3A 1C7SA 1YDPB 4WV1B 4YH6A 3HR5B 2W07A 4HFUL 4XHJC 5BRZE 4I3RH 1CFBA 4JQXA 3GRWL 4PJ7F 2ESVD 4O5LL 3WFHA 5FK9B 4LSPL 4ZS6D 1RUAH 1DUYA 3WJLC 1PFCA 1IEAA 5MENE 3LV3A 5KVFH 5MEOA 2ADFL 3QCVL 4ZFFB 2H8PB 4HFWA 2ENYA 5JXEA 7FABL 4QRQB 3W9EA 4F7EA 3MRJB 3O3AA 5EBLB 4I18C 3TCLA 1YYMH 2XXCB 2Q86B 5F1IA 3HZVB 5C0FB 1UM6H 1U6AH 3THML 5EZLA 4K94L 2VXQL 5IW6A 4D8PB 1FZMB 1Q9LB 1BHGA 4KZDL 3ZKQD 3IJYA 1KCKA 3BPLB 3CX5K 5F1NB 3MNVA 4TUKL 1UWGH 4JM4L 4EUPG 4PJEF 4S0SD 1TDQA 2KH2B 3FT2B 1IC1A 4L4VD 12E8L 1W8NA 1DBJL 1P5UA 1OGAB 3ARBB 5F1SA 4HK3N 4MQXD 2VZUA 3S34L 4P9MH 1AJ7L 1KNOA 4X6FA 5CLWA 4HBQA 3FB6A 2FJGB 4YDVB 1IAIM 3WFEL 5DRZA 3TA3A 1FYTA 3HE6A 1Q72L 5DJZA 4NC1C 5JDJA 1MCDA 4UOW0 2A83A 1R5IB 4WI9A 5KG9B 4ODWA 4R90H 4AZ8A 4JFPA 3WSQH 1BIIA 5H2BB 5FO8B 5CINH 3MLUH 4XVJH 5I8KH 3J7HA 4NYLA 3KXFA 5AEAA 3MJ8A 4JM2D 4UAOC 2HTLC 5GS1C 2IPKA 2DWDB 2FEEL 4QHKI 1WBZA 4ELMA 4FQJL 2PXYA 2IH3B 1FQ9C 1DDHA 2DQDH 1LNUB 2HFEB 3W39A 3ZKND 5BS0D 5BS0B 3I6KA 5TE4L 3RVTC 2GAZB 4BKLB 2HP4A 2J8UF 1ONQB 3ARDA 5INDB 4TQEL 1AO7E 3HE7B 4NCC2 4P46A 2Q8BL 5IF0A 4UB0H 1MFEL 5SX5H 3HE7C 4GS7C 3GMMB 2DIAA 5FECA 2ZWLT 2Z31B 3OWEA 3O2WL 5DD6A 4OFKA 3VW3H 5HHVH 1KGCE 3E6FB 1SEQL 1N4XL 3SKNA 5JOEA 4LSQL 5DI8B 4HIEB 3SDDA 35C8H 3GK8L 5C3LD 1ULVA 3C6LC 3GI8H 4M6NH 4X9FA 3QIUD 2WBWB 4C58B 1L4IA 2X1XR 2R0ZL 3GEWB 3C6SB 4KVCH 2ED8A 1Q9OA 4R2GB 3QWOA 32C2B 5D1ZB 4ZAKA 5HHOA 2X4OA 3EO9H 3KDMA 4HULB 5IROC 4JFQA 1WFNA 2DJSA 1RHHA 4WHTA 4MQTB 3ESVF 3W9EB 5CKAA 2VH5L 2X09A 5CD5D 4QRRA 2GJZA 3GSXB 1FG9C 4NKDB 1AGDB 3CDYA 1GGUA 4LLAA 2D7TL 3FJTA 4R97C 3L3IA 2NY3D 3QPXL 1UVQB 3BKYL 1KFAH 5AYUL 3FAXA 5JQ6H 1CFTA 5SV4A 2W9EH 1HIML 2R4SH 4HGWB 3O11A 1FFOB 3MCKB 1IQDB 2P48B 5SWZB 2DQTH 5EO9A 2ZOKB 4S1RL 1J88A 3V6OC 5CGYC 5D4QA 1PW3A 3GO1L 1K8DB 2V2XB 3DROB 3JTSB 5DFVC 2G9HB 3L7FA 3DUUB 3RWJB 3QHZL 3ARDC 5F96L 2AXJA 1RZJL 1U41A 4I0PA 4OTXL 1XF2B 2AXFB 5DZOA 4XGZA 2CDEB 1UZ6F 3LSOB 3RPIB 3BH9A 1A64A 3BUYB 4PJ8D 4NDMA 4K2UH 4G6ML 4OLXL 1UEYA 1OP3H 1OSPL 3JWOC 3ULVD 3EDJA 2VSCA 3LZFH 2YA2A 2AEPL 3OR6A 5D1XD 1T1ZA 4UILH 5IUSA 2YC1A 3VXME 2XTJD 4P2QE 4NO5B 3EFDH 3QCUL 5EUOF 2M1KA 1X5AA 4RNRA 1MEXH 1IGCL 1G9MH 4OLYH 5HI4C 2VERN 3HA0A 4HCRH 3LRGA 3AREA 3U4BL 3QUYA 3QUML 4OGAD 4XP5L 3UO1H 1FNSH 3KVQA 2JCCE 4XP6H 4M5YL 1UB6A 1ADQA 2WBJC 3B9VA 4JJHA 2P5EE 4M9OA 1NDGB 2ZPKL 3IGAB 4ZTOL 1L0QA 3TP4A 3RVWC 3CVHB 2VQ1A 3QIWD 1F8TH 1DP0A 2MMXA 1AY1H 4H26A 4LGRB 2V5TA 2IQAA 1QO3A 5CSGA 4QRPB 2Y07L 3QQ4B 1UVQA 2YN5A 2YSSA 5IMOB 4U1IB 2FLRT 4WNQB 3HRZA 4UV4H 4QLRA 5TH2B 5L88L 4PRHB 4HJJL 4LDLB 2MHAA 4H5SA 4IRSC 3R8BB 5IVZB 4PD4K 1YY8A 2FGWH 1JK8A 1U3HC 3EDKA 4PJHE 4D3CH 2ITCA 5DT1H 5C2UB 4DKAA 1I1AD 4X8XA 1PSKL 1ZWIA 4PJ5E 4PJHB 2E9WA 4N1HB 3PQYD 4WWID 1YQ2A 1ZA3B 1IGFH 3WKMH 4EUPB 3DX9B 4CADA 5ANME 2JK5B 3EYUH 4PJAE 4K71B 4NPYA 1K4CB 1CR9H 1NFIB 2EDFA 5IVXE 3SE3A 4R2GC 3L3OB 1T22A 4LLMA 2D9CA 3LVEA 3DRTB 1WFOA 4XB8A 3VFGH 1HYSD 4OLUL 3MCLL 2J88H 1NBVL 2X5PA 2WBKA 4R0LA 1F6FB 5IB3B 4GKNA 4RWYL 4JZOB 5BVPL 1RJYA 5DEFA 3RP1A 4F33B 2Z31A 1P7HL 1PKQB 4LSVL 3L5JA 1NCTA 1JPST 3B2VH 4ELMF 1U3YA 2P5ED 2R2EA 4Y5VC 1WGOA 4MX7B 3NFSL 3B83A 2R9HC 2NY7L 4D9QD 4LLVA 3TPKA 1NAMB 1G7LA 3NCYS 5ETUA 4LEXL 2FGWL 4S10A 3V6FA 1N5YL 4MA8H 2A77H 4KKBD 5FYKH 4QGTA 5FF6B 2IH3A 4EBQL 3JWDC 2DF3A 2QADB 1HILA 2XZAL 1B6UA 5AWNL 4HX1A 4ZYKB 3ZE1E 5I66A 3TM6A 1V05A 5EU3B 1OWWA 4NWUH 3RWHA 5HDQL 4R7NB 5C0RH 1KELH 4EDXB 5J6HA 4OQTL 1KXTB 3JTTA 1CDHA 2Y4SA 2JTDA 3VWKD 3IDXL 1MCIA 3B5TA 4GXVL 4X6BB 4KHXH 5E6ID 2EYTA 5FUCC 3ES6B 2DM2A 1NGPL 2EIDA 4NO3A 4I3GA 5KS9F 2CLVB 4JZNB 3BE1L 3ZL4H 3DGGA 2ARJQ 3S37L 4M1GL 3DNKA 2VLRE 1Z0NA 4ESKA 3GBML 4NPYB 3OMZA 5DD5L 3RWDA 2ZUQB 1KT2A 4PP2A 3RKDC 5KANI 1A7PL 4LCIL 3HG1D 3OB0K 2DKUA 3MRGB 2BVYA 4BZ2H 3MV8E 1T03L 3QIUC 4GG8A 1BM3H 2OXHA 3UTTE 3CUPA 5TFSH 3BDYL 2OZ4A 5ITBL 5CGTA 4DTGH 2XWTB 5C0FA 4DGIL 4HF5H 4N8CH 3MV7D 3GKWL 4OGYH 4ZTPH 1TVHA 5J1AB 1TZHA 3QDJE 4QRRE 5C9JB 2P8MA 5F9DC 3F8UB 3W9DA 1D5MA 2XTJE 4P2QD 4XZUA 4K7PH 1EFXB 3OAUH 4O51A 4JEGB 4KHTH 4P2RE 1XMWA 2J1KA 5JNYB 3C08L 1NFDB 1BJ1H 1CE6A 4PLJC 2I5YH 3PWJB 1V3MA 4RMUA 4LPWA 1R24B 4DFHA 5D7JA 4RX4A 4BUGA 3QULB 3OKOB 1FNEA 3QISA 1QG3A 2X6MA 3DVIA 3T3ME 4E41B 3DUSA 5EOQH 4Y2DD 4M7JH 3Q6FA 4K3EH 2ZKHH 1TCRB 3QUZB 1KIQA 1IT9H 1JE6A 2X2YA 1UQSA 2LTQB 3CH1A 5E8OB 1G9MC 4WUUD 1BOYA 1RULL 1YEEH 3EOBA 2F5AH 3L5IA 4CU8A 2ILLA 5GGQH 2PO6B 3SJVB 5JOFB 4K8RD 2BFVL 1HDMA 4Y4HD 1EEYB 3G08B 5KVGH 2XA8H 5CILL 2BXYA 4NNYA 3CXHK 4ZUUB 4U1GC 4ZSOA 4PRPE 2DTMH 3EHBD 4QXUH 3NTCL 1Q9LA 1BFOA 1ED3A 3KYOA 3JV6A 3BZDA 4AH2A 3I3BA 3L9RA 1U9KA 3O8XA 3HPJA 4ZO9A 5DMGC 5HI5C 4MD5B 4N0UA 4QWWC 1BF8A 5HGBA 2F53D 4NQCA 2H26A 5CIPB 5KSBA 1JUFA 5EDXA 4ZFFA 4ZUVB 4ZPVB 1ZA6B 1W72L 4RIRA 3K8MA 1I8KA 3IF1B 4PG9A 5T1LA 1SYSB 1WF5A 2W9LA 2VLJA 4PG2A 5I18L 1VFAB 3F7VA 4YHML 1IAII 1Q9KA 2BVOB 1QNZL 4FG6C 5D7JC 1ZT4A 3VXUE 4JFFB 4JFDA 2OBGA 2BNRD 3HR5A 3VI4F 1YYML 1CWVA 1A1NA 1V7MH 2EZ0D 4V1DB 1HQRB 1KACB 4U1KA 4R0LC 4MNQA 4XCCL 3PG2A 2NXZC 3QDME 2A6JB 1DBAH 1DFBH 1I8IA 5A3ID 4K3DL 1NBZA 4U6VL 4HG4K 2I5YL 1AD9B 5GJSH 4FQXC 5BVJB 3STLB 3QRGH 1K6QH 4MXVE 2ZNXA 3P4OA 4FMFA 4Z7VA 4B7LA 3MFFB 4HPOL 1Q1JH 3OB0H 1IC4H 1FJ1A 1HI6B 2A6KB 2WW8A 3DURA 5AG9A 3D0VB 1XGQA 3FB5A 1JPGB 4G8GD 3SJVD 4JG0L 3N85L 4NJAH 5FA4A 4YAQB 4L3EA 1BM3L 4XMPH 2BX5A 2UVFA 1Y6MR 4JFYB 3WD5L 1JF6A 1XF5A 2LU4A 3FRUB 4U4BA 5IF0B 1JHLH 3WMSA 5F89A 5EU6D 3VFMA 1NEZB 1Z9LA 2HH0H 4CMHC 3OJ2C 1SYVA 4J6RH 3X14A 4DOHB 2G2RA 1KIQB 4MNHB 4Z7UB 1S9VA 4OZ4A 2ERJC 4Y4FA 5E94B 15C8L 3U82B 2NY2B 3KPNA 1CK0L 2M8XA 2DBLL 1EEQA 2Z4QA 3IJSA 3V7AE 3EJYC 5KVFL 3JWOH 4FZ8L 3RZWA 5AD0B 1GAFL 4HS3B 1RZGB 4U0QB 3ZE2F 2MOVA 9CGTA 2Y7QA 5EWIH 4LASL 3TYGH 2AJSL 5FO9A 2WWMC 4HUUA 4TTDD 4PJFF 1D5MB 1PQZA 3LD8C 3G5ZB 4Q2ZA 5GGTA 2X44D 2AJZB 5GQBA 2ATPA 3AUVA 3FQRB 3QNZB 4IS6A 1AKJD 1JHTA 4HS8H 3UTZA 3NCMA 1QSVA 1G6VK 2BERA 2CH8A 1CE1L 2OMNA 5IW1B 1CICC 1P4IL 5HI4D 2A74B 3O4LD 3VFRA 1A6AA 4J4PC 1S5IH 2VDNL 3J8F7 4K7PX 4OZFH 5E2JA 4GAYA 1JHTB 3FZUD 4PJHF 4PGDA 3SE8L 4WFHD 1QA9A 3PHOA 4HMEA 4JFOA 2DYPD 2AJZA 1W0WA 2BDNL 1MQKL 2GYSA 3B3IA 3JTTB 3V95A 3CZFA 3VMNA 3HMXH 1SJHA 3HAEA 2DQCH 3QFDA 4IMLA 2IJ0C 3UYRH 5JHDA 5MEQA 4KKAD 1GPOL 4WJ5B 4Z6AT 5L9DL 2OSLB 3HNVL 4GW5A 3DBXA 3WKML 4JQIH 3MV8A 3WJJC 3TJHC 3VD4A 1NPUA 1IAOB 5LBSL 5I1GL 3BRGC 1KIPA 2VDMH 2OTUB 2NY0C 4DJMA 1KTKE 1FN4B 2DS4A 5DJ2B 3IJSB 5IMLA 2B1HH 4NQCB 4WHCA 3RWCB 5T3ZD 1I1AB 2PCPA 2WLYA 1RJCA 4TYUA 2C1OB 4JRXB 1N3NA 2OR9L 4UV7H 3GSVB 2N7BA 5IJKA 2HMID 4QXTB 4KI5E 3MRQA 3T0BA 3A67H 3QEHA 3PXHA 5F89B 3ZYOA 5I76A 1JI2A 3MRRA 4F8QA 2FNBA 2AEWA 5DRNB 1QFWL 4YFLF 4Y7MA 3TIDB 4M9PA 4YUEH 5GJTH 5D1QB 2RAMA 4ZNEA 1I85A 2UUDH 4Z9KB 1VGKB 1FNLA 3LEYL 4IRZL 3VXSE 3RU8H 1JV5A 3QXTA 4HV8A 4EQ2A 3MLXL 1ZSDA 5EOTA 4YHYC 2LFGA 3IFLL 4OUOA 4CVZB 2CKNA 5IBTL 2H3NB 5T1MA 1I1RA 3LQAL 3MOAH 4KI1A 3JVGC 3HC0B 3G5VB 4NZRL 3TN0A 3CFCH 4XC1H 5BVJA 1FLRL 4ZODA 1LO4L 1F4XL 3FQTA 2GHWB 3KJ6H 1I1AC 4BQBA 4LLQB 5C0CE 1YEGH 1J1OL 1KEMH 3H7BA 1NAML 4WTZG 4Z7OE 3LZFL 5C08D 4JGUA 3UMTA 1OSPH 4J3TA 3O3BA 1D5IL 1KC5H 5I1IL 1A1MB 2NY3C 4JFYA 2FWOB 3G04A 2AGJL 1B0GB 1T1WA 3FB7B 1LE9B 2G5BB 3E6HA 3O0RH 4ZFOB 2E9IA 2IG2L 2J2ZA 3P4NA 3DV4B 2NZ9D 3WO4B 3MRBA 5I2IA 2GEEA 2FHFA 1UCBL 4S1RH 5C0GA 4MJ5A 1QSFA 4YLQT 1W72A 2ZG3A 3LS4H 3SDXE 4NKIL 3C5ZB 4PJGB 2YD6A 5IHZB 2N1KA 5D71L 1OP5H 5ALCL 4ZUSB 3WUZA 4AEIL 3NCJL 5CIPA 4KI5D 4KRPB 3U9UB 5EBGA 2IQ9L 3V0VB 5JOPD 1G6RL 1ZLSL 4OCMC 4I4WB 5GGSY 4P57B 5D2LE 5DHVH 1CICB 4KKLC 1NCAL 2VH5H 2P8LA 3IDGB 4N9GA 3U7YH 3B6SB 5EU7C 4ZFGH 3R1GL 5DURB 1ZT4B 4JLRA 4HIIB 5L2KB 1P7QD 1NCCH 1DVFB 4J3XA 5E56A 3V6ZB 3L3GB 2QQKH 2QQNH 1PAMA 2PYFB 4KJPD 2NTSP 1D5IH 1KC5L 5D1ZC 1CU4H 3EOBB 3PWLB 3T3PF 2ZCHL 1U8NA 3GFUA 3BH9B 4WFGE 5TE6L 2EDJA 3TV3H 1DQJB 4NRXB 4IRSD 1A6ZB 4NUJB 4O02L 5DJXB 4LSSL 4AT6A 1MQ8A 3GZKA 1FVDB 4U1SB 5FGCB 2MPAL 1SBSH 1FZOA 1GIGH 4S0TD 4OFYA 5EUOB 2DQUL 5T3ZE 5MP6L 4X5WB 1T04B 3BJ91 3RBSA 1ETZB 3OR7B 1L9NA 3AROA 4CVUA 3FHQA 2Q3AA 2VDQL 3HTLX 4LHUG 4HUXB 3FT4A 4WUKH 2Y36L 4JN2B 3VGBA 1DEEB 1M4KA 1TIUA 5DMKA 1AGDA 3EGSB 4P9HL 5IT2H 1HZHH 5FOJA 1OAQL 3HFML 3JWNC 2NCMA 5ISZA 2P8MB 1R3IL 3LEVL 5MEPB 3T8XB 1E28B 4ETYA 2CKBB 3PGDA 3UTSE 3CC5B 3QUZA 3ZTNL 1EUTA 3T4AA 5I8KL 4GKOA 4ELKB 1A7RH 1IQWH 2BSTA 4M1DL 1QQDB 2IALA 3I6LE 4J7RA 1YJDH 2P8PB 3EOTL 1OAUH 1PG7L 3BT2H 4PJAA 1XF1A 3IJHA 4PREB 3INUL 3OHXA 1WAAE 3KJ4C 1U8OB 5ID1B 1K2DA 2BHUA 3OB8A 4XBPA 5DJ8A 3UXFA 3K4AA 4JPVL 1SQ2N 4KAQH 5F1OB 5DJ6A 3ARDD 1EEZA 3K80A 1SEBB 5C0JA 3BPOC 5C08B 4XRCA 1N59A 3ZE0F 4P49A 1BD2E 3X3FH 1D9KC 1RZKH 4U7KA 3RIFF 3VDBA 1A7NH 3MXVH 2OL3B 3WD5H 4PREA 5HJ3A 2NLJB 4GW1B 4HHAA 4DQOL 2O93L 1ZS8B 4GMSH 3DV6A 4PJ7E 3LN4A 1UFUA 2DLFL 1P1ZA 4LRIA 3OKKA 1U58B 4P4RB 3P4LA 3UYRL 1HEZA 5H35B 3ZTJH 5GSRB 5ABDE 4R97B 3W9DB 1E28A 3SOBH 1FAKT 3TN0C 2V7HB 2D03L 1JIBA 1KB5B 4MCYA 3SDXF 4AIZA 3NIDF 3T2NH 2P45B 1P84J 1MRDL 2Y5TA 1FL6A 1XCTB 2X42A 3EJZC 1I7UB 4QRPE 4X6EB 3SCMB 3BKCL 4UOJA 5EOCH 2H32A 3LIZH 2VKWA 5D7LE 1KF9B 4KUCF 4PJ5B 4JPKL 4R4FH 2VXUL 1FO0B 2P5EB 2UZYB 5DD0L 2DQJL 1ADQL 4P2RB 1EO8H 1RUMH 4UT9H 5IKCA 2ITDA 1X44A 3ARUA 3KLHD 1JMXA 4L4TA 4MHHI 1B2WL 4X9HA 4P4RA 4F9LC 2NYYC 3RNQB 4Y2DC 1M7IA 5E4EB 4XWGL 4IJ3B 1FIGH 1OLZA 3H3KA 1LP9E 4MB4A 2Q86A 4H8WL 1U8QB 4E0RB 1GC1H 1HQRA 3IDYC 3BHBB 4FFZL 5CZXD 1GHFL 4P2YA 4GKZA 1FZJA 2XI9A 1ZVSB 2FECI 4HIIA 3MRHA 4MAYD 4Z7NF 3N85H 2XQBL 4JREC 3TBWA 1M7IB 4QRRB 4WW2A 3LKQA 5TF1L 3VD7A 2IMNA 4ZUVA 5ETUB 1T0NA 2BVPB 3GHBL 4HPOH 4JKPL 4XPBH 5HI3C 3T1WA 1YDPA 2EE6A 3SDDC 4JFEE 4NQTA 4PJ5A 4WGWB 4XPTH 1NANI 4A6YL 2H6PA 2MCG1 5L2KA 1KCSL 4OIIH 4W4OC 1ZT7B 2HT2C 3WN5B 3VJ6A 4L1DA 3MR9B 4ZAKC 1Z9SA 3PF2A 1MCKA 4MB5A 1EERB 1JCKA 5KN5A 5IESL 4M7Z