3PV6A

Crystal structure of nkp30 bound to its ligand b7-h6
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
214
Chain Sequence
ADLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21
publication title Structure of the activating natural killer cell receptor NKp30 bound to its ligand B7-H6 reveals basis for tumor cell recognition in humans
rcsb
source organism Homo sapiens
total genus 43
structure length 214
sequence length 222
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pv6A01
15C8L 3TN0B 2NY4B 3DRQB 1S7SA 4JY5H 1OWRM 2FZ3A 3H9HB 1P9MA 2GTWA 4ERSL 5FA4A 3CX2A 1ZVHA 5DF0A 4U33A 1NC2A 1ZS8B 4K7PX 2CIKA 4GMSH 2I26N 3MNZB 5E2UH 3L95B 1R5IA 4L8DA 4X7TA 2YPLB 3OZ9L 3VD9A 5LKNA 4LCIL 1EUTA 5D9SA 4YAQB 2H2PD 5BXFB 4ZTPL 1GGIL 3HPLB 1LP9F 3MV9A 4HKZB 1QFHA 3K8LA 4KJWD 4LDOB 3IGAA 2HN7A 2DM2A 4L4VE 5C09B 3BRFA 1DQLH 4PJHB 3C5ZA 1PVHA 3HRZA 5BS0A 2XNAA 3MX0A 4Z8FL 1GOHA 4ZOBA 4BYHA 4ONGL 2RCSL 4DAGL 1KPUA 2CUMA 3KXFD 3MRMB 2GUOB 3RVUD 3OB0K 5EC1A 4Y19E 5DUPH 3ARSA 1U3JA 1A1MB 1GPOL 3KYNA 3NIDE 4ODWA 1HQRB 4HUVB 1CE6A 3OKOA 5I8KL 1ZHNA 4BZ1H 1EFQA 5HHQB 4Z0XB 4JRXB 4ODUB 4U2YA 1NPUA 1A6UH 4LHQB 1SJEB 3WS6A 1I4FA 1BQHB 4NWTH 4OBRA 4P2QB 4Z77B 2PTTA 1ZE3C 3MJ7B 4ZUTB 1RZIB 4PRBA 4POYA 3LKOB 4MAYA 2D7QA 1U8OB 1LE5A 3LRSA 2YKLH 4QXWA 5A2FA 2R69H 1J86A 4PJHF 1NBQA 2BMKA 5EORL 1H8OA 1R0AH 4RA3A 3ULUC 2OI9B 3LIZH 3WDJA 2BVOA 5IVXE 2KZ1B 3ULVD 2E7HA 3OHXA 2SEBA 4G8EB 1SHMA 2WIIB 5KBNC 5TE4L 4PG2C 4U3XA 3FQUA 5C0DA 4YHOH 2EDXA 1NCUA 4OQTH 1RJYA 4Z7UA 4JFFA 4PJDE 4XB8A 4WO4B 1NDGB 4OZHE 5BZWA 1S7QB 1NUGA 3LOWA 5E08H 2WINB 2EIDA 1G9ML 5E9DA 1T03L 4XNMB 1QBAA 3UYOD 1DBMH 3TCLB 5J1SC 2HTLC 2EIZA 3FT4B 2FO1A 5GRXG 5LGHH 2BSSB 3MXVH 5KVDL 3BPNB 3JWDC 4BA8A 4KKBC 5FAAA 4J6RL 1JI2A 5HYQA 2W9EH 4RWHA 4Z95H 3PE9A 1J5OL 1B90A 1FL3A 1IKNC 2IH1A 3GKWH 3UDWA 3C2SA 4ETQB 1QLEL 3FO0L 3AS1A 5ANMB 3FT3B 4Y5VA 4JFZL 1CD1B 3MJ8A 1JNNH 1HHGB 3WO4B 4N0UE 3ZE1F 1MI5A 1YUHA 4U0RC 5BV7B 3PV7A 1KGCD 1UC6A 4KHXL 2P24B 1E4WL 4XBEL 1VA9A 1QYGH 4YBLB 3MUZ1 4KQ3L 1YJDL 3IDGA 2BRRL 4UQ3B 2Q20A 5IBLD 2YRPA 5DHVA 4L8SC 2CJUH 3CK0L 4P2RD 2F54E 2V2WA 3WL9A 5CCKL 5BRZD 1XIWC 4U6XA 1U8MB 4DGIH 4MXVE 5FKAA 3BP7B 1WEJH 5F1IA 2PXYA 3DMMC 3DGGA 4HCRL 3DX7B 4HGMA 2VZSA 5F7DA 5T3ZH 2VLKE 3L3IA 3MOAL 3PHSA 2GJZB 3RWEA 5K9JH 4B53A 1DL7L 1X5HA 3UZEA 5C7XH 2E6QA 5I1HH 4J3TA 1MAJA 3NN8A 3VXTA 3MPCA 5E4EC 3V5DB 3DJ9A 5E1AA 2ZCHH 2BHUA 5JTWA 2AQ2A 2RFXA 5H94A 3VGEA 4N9GB 4F7EB 5JO5B 4NWUL 4LPVA 3ZKMC 4PGEA 5FHAL 1JFQL 1VFAA 2VXQH 1NCBH 3D3VA 2B2XH 1ZK9A 3VFGL 2JIXD 1Y6MR 1E27B 1J05B 3SGDI 2XA8H 5DMJB 5IK3A 2A6KB 3KPQA 3TZVD 5I19H 2V7HB 5FKPB 3FFCE 3IXAA 4KK8C 4XX1E 1S8DA 2MQ3A 1G7MB 3V4UL 1JPTL 3UTTB 3PL6D 5FO8A 3WIHH 3EW3B 4PJBA 1NSNH 2R56L 3BISA 5IESH 3FQNA 5TH2A 3WIFA 3WDIA 4K3JH 3VRLE 5DT1H 4HIJA 2NXYB 3WEXB 3Q3GA 1LO0H 3QCUL 4PFEA 3EJZD 3E6FB 4H26B 5HJ3B 3QUYD 5KANI 2P5WE 3KPTA 3TNMA 2JELL 2NR6D 1KYOK 1ZT4B 4G3YH 4HC1A 1R3IH 3GMQA 3ZMRA 1IEHA 5HPMB 3LKNA 2HRPH 2V7NB 3PV6B 1QOKA 2R2BB 3GHBH 5GZOC 3UBXG 4QHNA 3ZTNL 5TPWL 1UWXH 4O4YL 4U6YB 2PYEB 2XPGB 2XI9A 3HMXL 3MV9E 3MUHL 1I7TA 2HVKA 3NIDF 3PNWB 5E99H 4EZMA 1D5XB 3O0RH 4HKBA 3QCTH 5F9WB 1J87A 1HYSC 4PJFA 5F93C 1IGCL 1UKSA 4ONHB 1AO7E 3ILQC 5MHSD 1T7XA 1J18A 4PY8I 2EO9A 3KPOB 3B3IB 3WFDL 1LMKA 1UQSA 4PREB 3KWWA 4HHAB 3TM6A 1S7RB 3B4NA 5JHDE 2CIIB 3ZT6A 4OZFB 2QJDA 2UZIL 3L3GB 1I3RA 3O41B 1FPTL 3E8UH 3I6KA 3FRUB 5MEOA 2DLFL 4RMRA 5DJXB 1PKOA 4I18A 1KCRH 4S1SH 4O2EA 3FO9B 3CSGA 4WY7H 1F4YH 4XNUL 1FNAA 2ZOKA 5IVXF 1TPXC 3L3JB 3MODL 5C0CB 5C0FB 4X4ZA 3HLAA 2ZCLL 4M6NL 2CSPA 3CVIL 1Q9WB 4R7NB 5CJXA 1L6ZA 3BPOB 5T5FH 4JHAL 4GXVH 4WV1B 5KTEL 4P5KB 5I1GL 4QT5B 3ARBB 2ADFH 4PJDF 3DO3A 2ZZUT 1B0RB 4L8CA 2XXMB 2AABL 2G9HB 4G8GA 1KENL 3UPCA 1RFDL 1M05A 3O3AA 4C55A 1MCWW 3QISA 3EGSA 4P2RA 2VUOA 1Y6NR 1WQVT 5BRZA 1YEEH 4Z7UE 3MUJA 4NM4H 5ALBL 4NO0B 1RJZA 4W70A 4PY8J 4CADA 3BIKB 2K7QA 4I3RH 1DQDL 3NGBC 2YOCA 5J6HB 1UWEL 3ROOA 1C08A 1I8IB 1FCCA 3V52L 1Q1JL 4P49A 1A22B 1FNFA 5BVJA 1Z3GL 3PWLB 2AV1A 3KNBA 5HHVH 3SDAA 5C2BL 4DVRH 4LSSL 1D9KB 2LTQB 3MV7B 5E00A 3FQRA 1QBLH 5I8CA 1VADB 2H32B 5MEND 2CLRA 3HI6H 3PWNB 3T0EA 3DV6A 3QP3A 5B38A 3LD8C 4PUBH 4ZUVB 4N5UA 1VEMA 2V6HA 2NY0B 5FGBC 5L9DL 1P4BH 4Z76A 4Q6IB 1W0VA 3WNNA 4MSWA 4MXVF 2JIXA 3PUCA 4JPWH 1RULL 4XMKL 4O51A 1IGJA 3ZT7A 4DZBB 4JPVL 5FUCC 4P9HC 2F74A 1GXEA 1CG9B 4RX4D 3L9RA 4RMTA 5I1IL 1HDMA 1UJ3B 2IFFH 3RWIA 2PETA 4Z7WF 4FG6C 1JTOA 3BQUC 3PL6A 5SWZE 1N64L 3F12A 1YEDA 3DBXA 3RQ3A 3CFEA 5A2IH 1ES0A 4YHKH 4YDIL 2ADIB 1JZ3A 5T3XE 5JW4Q 5DDHA 3QDJD 3FCTA 1NLBH 2XICA 2NY5H 3MA7B 1A6ZA 1DBKH 1HH6B 3U0WH 4EUPA 3SE3C 4HIHB 4GT7A 3LN9A 3RY4A 1WZMA 3WCYA 5DZLA 2EDNA 3MRQA 4GKOA 1DUYB 2Q1EA 4DKFL 3UTSB 4QHLB 1G0YR 4YDKL 4ODHL 4QTHB 4V2BA 3TN0D 5DQ9A 3IDXH 5F21B 5C1MB 1HXYB 3MOQA 2AP2A 4G9FA 3TF7C 3SOBL 1ZA6A 3UPRA 1MCSA 4PGBB 1UACL 4D0DA 4LRIC 2OTUA 4OGAC 3D3VE 3E6HA 3OKLA 3WS3A 3P77B 2YPLD 2PTUA 1V3KA 5DD0L 4H20H 4RMVA 1DUZA 5EO0B 2X4NB 2Y6SD 3MRCA 3TH3T 3DECA 3PGFL 1XF4A 5C09D 2VWEE 1PG7H 3ESUF 4MLIA 4RAUA 3WE6A 3ZKND 5DA0B 2A73B 5TJWK 3G9VA 4LKXA 1TZGL 3BW9A 5LBSH 5DO2D 1JGEA 3T0AA 1PLGH 4JVUA 2MNUA 1OPGL 3VXUB 1SVCP 3AMKA 4PRHB 3VFOA 5GRVK 2X4OB 4XTRD 4HAFA 2P49B 3BD4A 4WI6A 4EI5B 2PYFB 5EN2A 1T89A 1QTYT 2M1KA 1MHPH 4NN6C 2O61B 1R5VB 2IADB 5DEGA 1U58B 4MNGB 1FO0H 4HDIB 2EXWD 4KJWC 1I75A 3FZUC 4JRXD 4PJIB 3EYVB 3QJHA 5IWLA 1U6AH 3JUZA 4WIQA 1F00I 5F8RC 4Z7NE 5JUEH 5HHXL 4ESKA 4MA8L 3BMVA 4L4JA 1T1XB 4M4RA 4P2QD 4KTEL 4V1DA 1KTRL 3SGEI 4OD1L 3WYRA 3MLSH 5ID0B 5IT2H 3GIVB 2AEPH 2DIJA 2QEJA 3BEVB 4UQ2B 2EYRB 3VW3H 3L5XH 1AJ7L 5B8CC 2W0FA 3GI8L 2AXFA 2AGJH 1E4XH 3V6FB 3D85B 2VZTA 2ENYA 1DSFH 4Y4FB 4D0CA 1KEMH 4NQVB 1C1EL 1UXSA 4M5YH 4N90E 3VFUA 1QSVA 1MCOL 2IQ9L 2E6JA 4MVBD 1IGIL 2XFXB 4QHMB 4Y2DA 5HI5C 4KVCH 2X4QA 4R4NC 4HKXA 3NH7L 1S5IL 2ESVA 1J8HA 4WO4D 4X6DB 5GGSY 3SJVD 1Z5LB 2NTFA 2HKHL 2XN9D 4FABH 1BP3B 1EJOL 3FN0L 5MENA 1IM3A 4DOHE 1T0PB 4K3GA 3NVQA 5JZ7D 2W0LA 5TF1H 4QOKB 5E8DH 4KROB 1BEYH 2IH3B 2EKJA 1GAFL 4BSWB 1NAMH 4XX1G 1KFAL 5HGHA 3HB3C 4U6VL 4X6CE 3T4YB 4DGVH 2NX5A 3Q5YA 1PEWA 2DL9A 4RX4A 1MCEA 4X7CC 3AAZA 4G8GE 4FFWD 4GW1A 3ELAT 1IEBA 1R24A 4X4YA 4LCUB 3INUL 1G6RH 3CFIC 2OL3H 4JCLA 3THML 1EMTH 4K23L 1JNJA 3FHQA 4XPGH 4WTXA 2Y06H 3PGCB 5F1NA 1U8NB 5LQBL 1G84A 3GSUA 3U4BH 1JTPA 2OX5A 3G04A 3NPSB 5ACZB 4M93C 2Y5EA 4FFVD 4NRXB 3SKJH 1MELA 5BW7A 5CP7B 4R26H 5HD8C 3QDJA 4PJ9A 1WISA 4ZO9A 2FIKB 5EBMA 4LK4A 4OLUL 4X6DF 5HYEA 3HZVA 1EO5A 2ADGA 3R06A 4QXUL 5DK0B 5DHYA 1ND0B 3MLVH 3LS4L 4WEBH 1KJ2A 2F8XC 1XR8A 1AR1D 4KZDH 1H5BB 3O2VH 4P23D 3TN0A 4HFUH 4O02H 3DRQA 5F7FA 4KPHL 1CU4H 3DSFH 3H9HA 5HHME 3SE9H 3IDJB 1KELL 1HINH 5DA4A 4DCQB 2GJ6E 4LEOA 5GGTA 1CGUA 3MNZA 1IGYB 2FH6A 1D5ZB 4ZNEA 3S36L 5FYJD 2OJZL 2YPLA 4L4VD 4KC3B 3KG5A 3QAZB 2VC2L 4PIRF 1CLYH 4PGCB 4WI5A 3IU3B 3T0XA 1FE8L 5I15L 1OW0A 4YAQA 1RZ8B 2IAND 3WKML 5D71L 1RUML 5BXFA 5D8JH 3SDDC 4HKZA 4Z7VB 5C09A 1L0YA 1OAZL 5SX5K 2DQTL 1FIGL 3U82B 4D94A 2MMXA 4FQXA 2ZCKL 1QSEB 3HC3L 1W0WB 3RI5F 5DD3H 4D9RD 1J1PL 3FAXA 3TVMA 3BJ91 4NGHL 3UTTD 4CU8A 3L3DB 3MRMA 1OAUL 2GUOA 5I2IB 1BJ1H 3MUY1 1A1MA 1OGAE 4K8RD 4EQ3A 1HQRA 3L7EB 3UAJD 4HUVA 1TJGH 4Z0BH 2VAJA 4P2YA 5HHQA 2V5SA 1OCWH 4JRXA 1QR1A 4ODUA 2NXYD 2VDKL 3TFKD 1EUUA 4G6KL 5HVHC 2FBJH 1SJEA 2B7DT 2DD8H 5FOBB 4G9FE 3TZVC 5D7LB 5CEXB 2C4FU 4P2QA 4Z77A 1XGRB 4ZUTA 3KPRA 1RZIA 3BDXA 4JKPH 5E8NB 3V6OA 3RX7A 3DO7B 5JW5B 4MD0A 3LKOA 1MIEH 1U8OA 4FQQB 1MPAH 4N9OB 1Q9OB 3HE7C 4M02A 2K7PA 1YEGL 2PYED 5D1QB 3BT2L 3ARVA 4OCRL 4FNLH 4ZTOL 2WIIA 3OKDB 5J89A 4QNPE 2YZ1A 4OLZH 4LCCB 4WO4A 1NDGA 2E27H 1S7QA 1N6UA 2WINA 4Y4HC 4XNMA 3TCLA 5F1SA 1RD6A 1HSBB 1TNMA 3RKDD 2FCBA 4M00A 2BSSA 1RUQL 1RURH 5GZND 1EGJA 4KVNL 1WCBA 1KSRA 4ETQA 3C5JA 2DJUA 4Z9KB 4XP1H 3W81A 4CL7A 4WWKB 3VDCA 5ANMA 3MLTB 4V1DE 3FT3A 4I48B 2VXSL 4Y5YC 1CD1A 5GJTH 3U46B 1J88A 3BKCL 3ARBD 2VXUL 1TNNA 3T77A 2IBZX 3H9SB 1NGQH 1K3ZA 5GRZA 2P24A 2VZOA 2F54D 2VLRB 1LDPH 1U9KA 2VXTL 1IAKB 2WZPD 5FA3B 4UQ3A 3MC0A 1KLFA 3B83A 3HHRB 3VFNB 3QUZC 2ZNWA 1G7PB 1A6TB 3FRPA 4GRWE 1U8MA 4MXWH 1VACB 3BP7A 2NY6B 4NO0D 4X6CF 2N56A 1OARH 2FJHA 1UB5B 3KVQA 3DX7A 1PFCA 2VDOL 1RZJL 2CMRL 4YQXH 3RAJL 4G6MH 2GJZA 4LQFL 4H8WC 4R7DB 1UH4A 5C9JB 1UM4H 5D6DA 2HMID 4I0CC 5F9AC 4HC1L 5AWNL 2IGFL 3PDDA 1D9KD 2UUDH 4MA3B 3MV7D 3V5DA 1ROWA 4GQ9L 3EJYC 4LFHG 4HF5H 1JHKL 5EOTB 2WBKA 2UVEA 3SKMB 3MRKB 1FH5H 5F3BB 3K7UA 1Y18B 4HPOL 4N9GA 3CSYB 5JO5A 2NY0D 3BKJH 3JTSB 4OJFL 2CDEB 3DUSA 2YK1L 1E27A 1J05A 3MRRA 1UADC 2A6KA 2ZPKL 5FKPA 1T1ZB 3ARYA 1QBBA 1G7MA 3MSPA 3D0VB 4M6OH 3BZFB 3UTTA 4GH7B 1PY4A 4JFQB 3MLRH 3NA9L 3AS3A 1RU9L 5IGXL 1RMFH 1A6WH 5IFHH 5JDJA 4UDTB 1NANI 2P5WD 2XZQH 1OAKH 4U7SA 1MCNA 4OCYL 1FN4B 3WFBL 2VRAA 3OL2A 3WEXA 3LY6A 2XZCH 5IB4B 4WUKH 2NYYD 1I85C 2V17L 3E6FA 4H26A 5HJ3A 2GSIB 1T20A 3I2CL 3WNLA 2V2TA 1M7DB 3T8XB 2CRZA 1ZT4A 2P1YA 2Z8RA 3BP5B 1T0NB 2BY1A 5HPMA 4QTIH 4AIZB 3UTSD 3NCYP 1P84J 2V7NA 4RWYH 4ZNEE 3PV6A 2YD9A 1QNZH 5GS1B 2R2BA 1TJIH 2WBJB 4OM1L 5C0GB 3HR6A 4PGZA 2PYEA 2XPGA 1CFTB 4U6YA 4YIQB 5FYLE 4MX7B 3VXRE 3CIQA 3PNWA 4YZFE 1D5XA 2EO1A 3OAZK 4NJAL 3SE8L 4M6MH 2AVGA 4ONHA 4OLVH 3QCVL 4MJIB 1ZHKB 3EO0B 3WV0A 4AEHL 3KPOA 4PJCE 3B3IA 1RZKC 4DQOL 3VWKC 4PREA 4GLRH 4HHAA 2C7UB 1S7RA 4XVSL 2CIIA 4OZFA 2EIBA 1A7NL 4QEGA 3L3GA 3OB8A 3O41A 1ADQA 5C86A 1C5CH 1F90H 2FHBA 5DJXA 3VXUD 4PRHD 5KSBE 4HIIB 3FO9A 4EI5D 1AHWC 1CQYA 3TV3H 2ZUXA 3BVNB 3L3JA 5C0CA 2D0GA 1Q9WA 1S9VB 3KPRE 4R7NA 2PUQT 5C6PB 3N85L 1RIVH 1CS6A 1KBGH 2VH5L 3A6CH 4WV1A 2CLVB 4P5KA 3RGHA 1MEXH 4QT5A 3V6ZA 3ARBA 1YMHB 1I3GH 3B9VA 5KW9L 1WBZB 2VAAB 1B0RA 2DBJA 2FEDD 4MA7L 5CILH 1T22B 3HFML 4XZUB 5CGYD 4NQTA 4X80L 2G9HA 3OG4B 3VFWB 2W9DL 2XA3A 3C08H 2DOCA 4JFYB 5JNYB 2Z8VC 5CLTA 5T33H 4HV8B 4NHCL 2O5ZL 4O2CB 4YXHL 3WXWL 3P4NB 5HDQL 1NGWB 1GHFH 1NGYB 4U1JB 1OGTA 3D85D 4XCCH 4ONOA 4NO0A 4Y4FD 5B38G 4PB9L 4GS7C 3TO2B 3UX9B 5SX4H 4IHOB 1J8KA 5J6HA 2A9NH 1UFUA 1I8IA 3C60B 3PGDB 1OT2A 1IKFL 5C0BB 3BKML 4YC2C 4HXBH 1I7UB 3PWLA 1YECH 4HWBA 2DQHL 1K85A 5D96C 4PRDB 5B3JE 1DDHB 1LILA 3IJSB 3LDBB 1V05A 1D9KA 3MV7A 5EZLB 3EYFA 4W6WB 5D5MB 4WWID 1VADA 4L1HA 5JOFA 1JL8A 2H32A 3ULUH 3PWNA 2J2ZA 3GMOB 4N8PA 1URLA 4LPTA 4K94L 3O6LH 4WHCA 4ZUVA 5GGRB 4ZOEA 4QOKD 2D4DA 2VDNH 1AD9B 3P30L 3QUXB 4PJ5E 4K7PY 5DRXB 2YD7A 4HQQH 4Q6IA 4KMTH 4Y4KB 1TETH 5L0QB 1EX0A 5D70H 4DZBA 2Z93B 4JRYB 4EUPG 1CG9A 3IDIB 2E9BA 3RTQC 1C7SA 1UJ3A 2Y36L 5IEKB 3Q5OA 1LEKB 4WUUB 2KKQA 1F58L 5JPNB 2X70B 1KN2L 2RBLA 4PY7B 5KAQF 4UMGA 3GSRB 3JWDH 4F8TA 2GT9B 1U91B 1DE4A 1VGEH 2ADIA 3IDNB 3HN3A 3FO1B 4AG4L 1HH6A 2YXMA 1F4WH 1DLHB 2G60H 1O0VA 2E7LA 1CLCA 5D5MF 3UO1L 4W81A 1H3TA 1INQB 4LPYA 5IB5B 4J4PD 4XAKE 5IFJB 2OR8A 3HI5H 4JM4L 5CEYB 3VD3A 5DSCB 1PJ9A 1DUYA 3UTSA 3QQNA 1J0YA 2VLME 3QI9C 3BIBX 2VO5A 4QHLA 4JKWA 1JZ4A 2AK4B 2G75B 5D7JC 5L2KE 1BFVH 1H3PH 1J1OL 1CGSH 1HXYA 5FM4A 1T5WB 4LIQE 1BBJB 2LQRA 4FFVC 1KN4L 3F7QA 5TE6H 2FGZA 4PTUB 4FTVB 3K80A 3QIBB 1JUFB 4PGBA 1NBVL 2FDBP 2H2SC 5GRJH 1SBSH 1YMMB 3D0LB 4NUGH 4OZ4B 3P77A 5ALCL 5EBLA 3GB7B 4CNIB 4XH2B 4U1MB 4MGXA 2KQMA 1CICD 5FYKD 5EO0A 1AR1C 2X4NA 1NDMA 4WU5B 4M8VA 3DTXB 3EDFA 4D9QE 1A8JH 3QULB 3TGXA 1IM9D 3BDYH 1QSED 2I24N 1V8HA 3CNKA 3QDMB 1CI5A 3VXUA 1X44A 2L7UA 2X4OA 1Q0YH 4QRPB 1UM6L 2PYFA 4EI5A 2Q87A 1EO8H 5AD0A 3N1PC 1IC1A 2V5YA 4HD9A 5E2TH 4PLJC 3VG0H 4Y7MA 1R5VA 4RISH 2IADA 1MCJA 1ZLSL 2HJFB 1HSAB 5EUOE 5LAXA 1X5LA 1BBDH 4HDIA 5FUZL 5SWSE 3RPKA 1IBGH 4HSQA 3DURB 4PJIA 2XG4A 3EYVA 3O4OB 2YSSB 4U7MA 2Q7NA 1MRDL 1UVQB 2D7MA 3PXHA 4M5ZL 4NT6B 4RFNB 5E6IB 3KJ4C 4EBQH 2GK2A 5D7LD 1T1XA 5CEZE 4PJAE 4KUCD 5ID0A 1QA9A 4NO5A 1NBYB 3BEVA 1N3NB 4X7SH 5DRWB 2EYRA 3AM8A 5GRYA 4K8RC 4D3CH 5IROA 1ZSDB 4ORGB 5KSBF 1FP5A 2RAMA 3V6FA 1FG9C 1U93B 1ZEAL 1BIIB 3UZVB 2CLZB 2AEQH 3L5WB 5ICZB 1MVFA 4Y4FA 5GS2H 5DJZB 3MA9H 3F6LA 3MRBB 1MFEH 5MERB 2BCKB 4ZUSB 3ARFB 3RHWK 5MEQA 4QHMA 1MLCB 2XFXA 3V4PL 3MRGB 2NPLX 5EZIH 3TWCL 4HIXL 1UCTA 1NFDE 1MCQA 4S1RH 3GMPB 2YN3A 5K9KB 4CU7A 1SMAA 2OR9L 2X4RB 4X6DA 1KJ2L 3QUMH 3U7AA 3QFJE 1Z5LA 1W72H 3AY4C 5F71A 3QHFH 3QA3B 1V5JA 2IMNA 4LAQH 3UC0H 3CMOL 4M7JH 4PRPE 3O6KL 1HHJA 3SKOB 5J11B 4OGXH 5DWUH 2IH3A 5E2JA 4TQEL 5C2UB 3MRPB 5GGTL 2HLFD 2YR3A 3HNVH 3V0VB 3QQ3B 3K1DA 4ZYKB 2WWKO 4CVZB 3T4YA 4WWKD 4CDGC 1EXUB 4LCUA 4R0LA 1F3DH 1GYAA 2QSQA 1Z9MA 4MB5A 3MRJA 5D1ZC 3BUYB 1YEHH 4UILL 1JWSB 4OKDA 1U8NA 5B3JF 5DJ2B 1A7QH 5JR1L 3ZE2E 4TULH 3S35H 5A40E 3H9SD 5ACZA 4G5ZH 4NRXA 9CGTA 2VLRD 4Q6YA 3K2UL 5CP7A 5GZNC 3ARDD 4CMHC 2FIKA 3A6OA 4NQSB 3FOMB 4S0TD 3V0WL 4QRRB 5DK0A 8FABB 4S11A 5CP3H 3RU8L 1EAPB 1Q94B 5LVEA 5I8OL 1EZVX 4WFFE 5CJQH 4JANB 4NCC1 5DEFB 1C8PA 2HH0L 2PR4L 1H5BA 2GJ6D 5E8PB 3AS0A 1S3KL 1DVFC 1ZTXH 3I6GB 4NN7B 3IDJA 5DMIL 4OCXH 3I50L 4WCYH 4O5LH 3W82A 4U1GC 1RY7B 3RP1A 4YHYB 4XPAH 5DYOB 4NSKB 4PS4H 1NL0H 1D5ZA 4OCSL 4PRIB 4C58B 1JIBA 1TQBC 4PGCA 3IU3A 1I3UA 1RZ8A 3MREB 5D7SL 1IZJA 2EECA 3VGBA 3V7AE 4Z7VA 4E41E 5D2LB 4JO1H 1QZ1A 3A6BL 3KR3H 2YD8A 4KTDL 1CFQA 5C0RH 2A83B 3MLUH 1QSEA 1IVLA 1W0WA 5C0ND 4XNYH 5FCUH 4LQ1A 4GBXC 3PP4H 3P4MB 4WFEE 4OM0H 1MWAH 2R39A 4XXDA 5DD5L 3L3DA 1BZQK 1M71B 3HG1B 5I2IA 1ZOXA 1PKQE 1L0XA 2YD6A 4X5WB 3L7EA 4TSBH 3DXAA 3H3KA 1Z0MA 1TMCB 3JTTB 1A7PL 4DKEH 4HUKB 5BQ7B 1UWXK 1EGJL 5CINH 4HFWB 4P9HH 2JJSA 4L4TE 3LH2L 5CEXA 2C4FT 5D7LA 1XGRA 3AREB 3R1GL 3O2DA 2YWYA 1OL0A 5HI3C 3WUWA 1FRGL 4L9LC 4UINL 5E8NA 1P69B 3DO7A 4OFPA 5JW5A 5TDOB 5BV7L 5I1CL 4P2OB 1Q9OA 2LVEA 3EFFB 4UIMB 2EZ0C 3FN9A 2NZIA 3SGJA 2D03H 3T09A 3SO3C 2WBJD 4I2XB 4LLWB 3EIFA 3BEWA 5D1QA 2LABA 2H41A 2BY2A 3BKYL 5EUOF 4PP1D 4EQ2A 2HKFH 3IFLL 3OKDA 1KXTB 3SDXE 3V6BR 1RIUH 1A7RL 4TVPH 1A7OL 4LCCA 4MJID 4HAGA 5BVPH 4TSAL 2NNAA 3N9GL 4PJAF 3MV8E 4DN4L 1HXMB 3F7VA 4A6YH 4M7LL 1I8MB 2FX9L 5MEQB 1HSBA 1JN6B 4KV5E 3GMLB 4UOJA 1KYOJ 1MRFL 1NAMB 4ZS7H 3WHXA 3EYUL 1HCVA 4JG1H 4JJHA 4LDEB 4WWKA 1UB6B 4Q9RH 1G6RB 3MLTA 5H35B 4DWHA 2Y25A 4I48A 1I3VA 4ZFGL 2OL3B 3C87A 1NGPL 1CLZH 4KHTL 3U46A 3RRQA 4R8WL 1FLTX 1NFDF 2QADB 5LXGH 2NLJB 4XRCB 3H9SA 1MFDL 1OQOA 5CZXC 4KI1A 3SQOL 2VLRA 5ICYB 1NCNA 5JOPE 5CAYB 1IAKA 1CGTA 1T2QH 2Y7QB 5KVGL 4OZIB 4R3SA 2ZUQB 3HE6C 1QBMH 5CLWA 1XGQB 5F7LB 1CE1L 1TDQA 4PR5B 1IFHL 1AKJB 3FQXA 3VFNA 1NMCB 1G7PA 1MJUL 1A6TA 5HI4D 3B9AA 5I17B 1VACA 3QXVA 2R0LL 4MNQB 2R0KH 1OAYH 5T3ZD 1K6QH 2R2HB 4G8IB 1IAIH 2QSCH 5GRVL 3BWAB 4JO2L 3C60D 2ZJSH 3LQAH 4I9WE 1NBZB 4R7DA 5CGYC 4C56B 5JORB 1AQKL 3JVGC 1PDKA 5EZOH 4DUXA 4FMKA 3QNZB 2XXCB 4YPGB 1WZ1H 3ZE2F 1LO2L 1INEL 1X6NA 4W68A 4M1GL 1JGVH 4FQHB 3PWUB 5ITBH 1CZ8H 5ADOH 2VITB 3QR2A 2HT2C 5EOTA 4LLQB 3SKMA 3MRKA 5F3BA 2YN5A 4GQPH 4KKAC 1JHLH 1D5IL 1Y18A 2EC8A 4MD5B 3RL2A 4DGYL 5CEZL 3STZB 4ENEC 3T2NH 3B8YA 3JTSA 3RVWD 2GQHA 4JDZB 4OZIF 1MFBL 2CDEA 3GMMB 3LMJH 1GC1L 4Y4KD 3E1F1 5HYFA 3UDWC 3C8HA 2FATH 5MI0C 1T1ZA 5IBUB 3D0VA 3BZFA 2VZVA 4HS3B 4JFQA 5A43C 5EFIB 5DC4B 1OSZB 3D39E 4OQ1A 3RX5A 3WFEH 5A16B 3VRJB 5ERWB 2XQBL 5DJDA 1FN4A 1P4LB 3CFJB 5E1HB 3VI3E 1ADQL 4OB5L 1KB5H 5IB4A 3HR5A 5L7XL 4JO4H 3LB6C 2GSIA 3O2WL 2VXVH 1J0HA 1GZPB 1M7DA 4JZNB 3STBA 3T8XA 5A2JH 2HG5A 3HNSH 4OLXL 1T0NA 2A1WH 3DI2B 4X4MA 1T2XA 4AIZA 2L4OA 5FYLD 4OZGB 3VXRD 5K9QI 2AK4D 1G6VK 2AJVH 1G9NL 5GS1A 2F53B 4G7YL 4AL8L 4YWGH 3JBG7 3RPIB 2WBJA 5C0GA 5JQHC 4LLYB 2FEEL 4YIQA 1CFTA 1KC5L 1SYVB 2HT3C 4FTVD 3QIBD 4MX7A 4QXTB 3KS0J 1YMMD 1RIHL 2VUYA 1AY1L 4OQTA 3GSVB 1OY3B 2BNQB 5EO1B 4B7LA 4MJIA 3HZMB 1C16B 4L9DA 1ZHKA 3S6CA 2YPVL 1S7WA 3EO0A 4FFZL 4YEEA 5LGJB 2AJXH 5IW1B 5ADPL 1GGYA 2Q8AH 1JF5A 2VLJB 2C7UA 2B1HH 1MRCL 3BGMB 2FNBA 5EWIH 1LHZA 4RMQA 4WFHE 4RMWA 3ABZA 5DGQA 3QDMD 3DXAE 5IFAH 5I18H 4CVXB 2Z4QA 4HWBL 4ZFFB 3WO3B 4HIIA 2FD6H 2VWEC 1N5YL 3OAYH 4JKKA 1CGWA 4OZGF 1YEFL 5BOPA 3BVNA 1I9EA 3L6FB 1CICC 1IAIM 4Q0XL 1S9VA 3N1MC 4HUXB 3SDXF 2CK2A 2OCFD 1BZ9B 2CLVA 1M7IB 3RGVB 4NN5C 1YMHA 3KYKH 2DIBA 3QDGE 1WBZA 4XZUA 5E6ID 5I1KH 3VFWA 1DLFH 4LRNH 3BYTA 5T1DL 4KV5F 4GAYB 5AZ2L 4O2CA 5I1DB 2I07B 4OF8A 3P4NA 5F9DC 4U3HA 1NGWA 1NGYA 4G43B 3NCMA 4U1JA 2I5YL 5DFVD 4UV4H 3MLYH 4H1LH 4NC1E 4R90H 5I71C 3T04D 3TO2A 2JTDA 5KVFL 4IHOA 4BFBD 1BF8A 1I9JH 3C60A 3PGDA 1P4IL 1EA9C 4LF3B 4XVUC 5C0BA 1N4XH 1CXHA 1F6AB 1I7UA 2BJMH 3D1MC 5J6GB 2BFVH 4M1DH 2VQTA 5A3IC 4PRDA 1DDHA 3IJSA 4LARL 5GGQH 3V7AG 4JHWL 1QFWH 2FEEI 1FDLH 3L5HA 3GMOA 2W91A 3C09B 1KJ3H 4LL9A 1JPSL 1F8TH 3ISWA 5GGRA 5T1MB 5HYJE 1HIML 3BE1L 3E2HB 3MJ9H 2HFFB 3QUXA 1AD9A 2APBA 5DRXA 5JPMA 1A02N 2FX7L 4U1SB 1ZLWH 4LVHB 1D7FA 1T4KB 2DICA 4Y4KA 5C0IB 3RVVD 1LE9B 1ERNA 1FHGA 1YEIL 2X9XA 2LE9A 3TH2T 1ORQB 3MBEC 4L3CB 2Z93A 4Q74A 4JRYA 3IDIA 2KUTA 5IEKA 1Q9KB 2OSLB 3P0VL 1QPPA 1LEKA 1IQWH 3QT2A 4WUUA 3TA3B 3WIHA 1NCAL 1MIML 1C5BH 3W0WB 5JPNA 2X70A 4PJXA 2QKIB 4DJMA 4KZEL 4PY7A 3WNOA 4YDVB 1G7LB 4MJ6A 3GSRA 4JFOB 4KK5D 5LG1A 4KWUA 2GT9A 1U91A 4UTAL 3IDNA 4OTXL 2NXZB 3QRGL 3B9DA 3FO1A 4LEXH 4XPFH 2QQKL 3SBWC 1A3LL 2QQNH 2CR6A 2VLMD 1CLOH 3B6SB 4UV7L 1QSFE 4NZUH 1BWWA 1INQA 1UEYA 5IB5A 5IFJA 1UJTA 2BSTB 4C4KT 3DX8B 4ZFOB 5CEYA 5DSCA 4ZUWB 5ILTH 4O00A 5I75C 2G75A 1BPVA 1JCKA 1T5WA 1BBJA 2R0WH 3HUJE 5DVMA 3ALPA 4PTUA 4FTVA 3QIBA 4H25A 1JUFA 3ZHDA 3SDAC 4KI5D 4IMLB 4ETYA 4MJ5B 3ZDZF 1FAIL 1YMMA 3D0LA 3GK8H 4LPXA 2YUVA 4OZ4A 4PRID 5ITFB 3SN6N 2YMXH 4C83B 3GB7A 1JRHH 4CNIA 3VI3F 4K7PH 4WJ5B 2C5DC 1GGIH 4XH2A 5SV4A 4U1MA 3TT1H 4D9QD 3PQYB 1EVUA 2C3VB 1P5UA 5I30L 1Z2KA 5B21A 3WIIL 4WU5A 3DTXA 1X5JA 4QO1A 4P59L 2BK8A 4H8WH 3W9EB 1DANT 3LKPB 3QULA 4ONGH 2KPNA 4DAGH 3QDMA 2BHYA 1LK2B 4FA8A 3W5MA 3BD5A 3WBDA 4M3JA 5SWSD 2HAZA 3FHAA 4QRPA 3M17B 3MRFB 4L3EB 2XKSA 2XWBB 3HG1D 3NMEA 4G80B 1I1AD 4R96A 2FR4B 2HJFA 1HSAA 4UIKH 3VXSE 3JV6B 2DWEB 2W0PA 3MCKB 4TNVK 3SDYL 1FZOB 3DURA 4JFHD 2YSSA 3T4AA 4E9LA 5I74B 4YUEL 4LASH 1Q0XL 1UVQA 3CDFA 2DBLL 4NT6A 5E6IA 1OP5K 2FSEA 4HT1L 2BP3A 1QFWM 2P46B 5C71A 3ARED 1KF9B 2B4CC 4NQCE 2VDQH 1HEZB 1WTLA 1NBYA 2BDNH 1YNLL 1N3NA 4NPYB 5DRWA 4DKAA 1QKZH 4KJPD 3MZTA 5B4MD 3MV01 3K0WA 1M4KA 5JIKA 1ZSDA 4ORGA 4K94C 2IBZY 1U93A 2IFGA 4NZTH 1F42A 2VKWA 1BIIA 2CLZA 5DRZB 3EYSH 3A67H 3L5WA 5ICZA 3G9AB 1K8DB 5JA9A 1BD2D 1FNEA 3FMGL 3MRBA 3IRZA 5F9OL 4M03A 5MERA 2BCKA 3CLFL 4ZUSA 3V9FA 1JPGA 3ARFA 1ITBB 1F3JB 1MLCA 3ZYIA 1LK3L 3LZFL 4PJ8D 3MRGA 3EOYG 4YX2L 3NIGF 3GMPA 5K9KA 2X4RA 3C9NB 2J1KA 3ARGA 1F4XL 2X09A 4OI8A 4RBPK 2EH8L 3V0AC 2RHEA 3QA3A 3REVB 1DBAH 1I8LA 5KVDH 4YHNB 3SKOA 3QZWG 1I9IH 3OV6A 4PJEB 5FK9B 1J5OH 5FGCB 3QEQE 1J11A 2BNUB 3RVXC 3MRPA 3OBAA 3QQ3A 4ZYKA 1M7XA 4CVZA 5F96H 1RZKH 4JGJA 2J6EH 4C57C 1EXUA 2EC9U 3U9PL 3EJJX 5JXEC 2QADD 3BUYA 1FG2B 4XBEH 4YBQC 1JWSA 4JFEE 5DJ2A 2DQGL 1F4HA 1GSMA 2I60H 2A0LC 1FNLA 4WFFD 3MOBH 4NQSA 2R4RL 4YHZL 1OLZA 3FOMA 4QRRA 8FABA 4GMTL 1N7ML 5B39B 4U0RB 2OXGA 3CXDL 1Q94A 3U4AA 1DTUA 4MNQD 4JANA 2DYPB 3G5VB 5DEFA 4PJEF 2WUCH 4I77H 4HKJB 4JDTH 1PX3A 4M8QB 5E8PA 3KLHD 3HS0B 5DI8B 4OUOA 4Y2DC 4C56D 1KXVC 3I6GA 1NJ9B 1UZ8A 4L8SB 1OD7A 4YXLH 3VI4F 2ITCB 2XY1A 3O2DL 5EBWB 3BN9D 5DYOA 3MBXL 4CDHA 5F7WC 1ZLVK 3B9EA 4PRIA 1Q72L 1QFUH 5E2VL 4E41D 43C9B 4HPYL 2AJSH 1FQ9C 3QG6B 3DMMB 3FQTB 3MREA 4RDQG 4XMPH 3IYLW 1FNGB 1JFQH 1JWUB 4AEIH 5B3NA 1T66C 2J4WL 5D2LA 5KSUB 3B9KA 5KZCD 1U8HB 3OJDB 4PJXE 4KK9C 2A83A 3KPSE 4POZD 1CGVA 1YPZB 4N8VB 5E4EB 2NY7H 2JF1A 3GJFH 3O6MH 3S37L 3HUJF 3P4MA 3HPJA 4P9MH 1FLRL 1DBJH 2Z91B 1M71A 3WUWG 1NKRA 4QXGL 4KDTC 2AI0L 3SCMC 4OLYH 1JMZA 3TJHC 4X5WA 1U8JB 1LO3H 3MUGB 4G7VL 3N50A 4KUZH 4L4TD 5E0QA 3KHQA 5BW7C 4HK0A 3BD3A 5GGVY 5BQ7A 3BAEH 3G6JB 2V2XA 4HFWA 1MHCB 4UT9H 3ARQA 5IJKC 4YE4L 2XRAH 3SO5A 5DJCB 1BOYA 2LU7A 3UTQB 3VGAC 3NCCB 3OGOE 2DQIH 1U2CA 4Y5XC 5CSZB 2K1MA 4J12A 4P2OA 2NZ9D 2NY4C 3EFFA 4UIMA 2F53D 2K3TA 4N0RA 3HMXH 4I2XA 4LLWA 4QRUB 1YPZF 4Y1AB 2B8OT 2IG2L 4NBXB 2CK0H 1UH2A 1F3RB 1FORL 2P8MA 2MWCA 4FQLL 1ACYL 4IOFC 4PLKC 5E6YA 3WLBB 2BNQD 5KOVC 2BVYA 3FOLB 1M6OB 3QUMB 3OMZA 2R29L 1W72B 2ZUVA 3GNML 4LP5A 4PGJA 4BZ2H 1HXMA 2VLJD 4JY5L 1I8MA 4FQXC 5T1LB 3G6JF 1FPTH 3FB8B 3MRIA 2MTPA 1JN6A 5JDSB 1OSPH 3GMLA 3VFVB 4GMSL 1LWRA 5E2UL 3TVMC 2MCPH 4XNUH 4OGZA 3RNKB 4OCNC 3KLAA 5LCVL 2DF3A 4FP8H 1UB6A 1G6RA 2FHFA 5H35A 3HZKB 4JFDE 4GRLC 1SJHB 3RHWF 5I1EL 3S3SA 1DQLL 3RGVD 4K55A 3GSNH 2C1PB 1BVZA 3R4DA 2NLJA 2AABH 3CCHB 2HTKD 5MEPB 1KENH 1G7QB 3OWEA 1TFHA 2Y7QA 4OZIA 1EO7A 2BRQA 1TPXB 2KQNA 3CU7A 5GHWH 1IGFH 5KN5B 2C1OB 4PR5A 4S2SB 1AKJA 3D9AH 4I9WD 4BZ1L 5I17A 4MNQA 2P8LB 1A6UL 1A9EB 1T5XB 1IL1B 2R2HA 4G8IA 5GGSB 1TQCC 1Z3GH 2Y1VA 4XC1H 4NWTL 4C56A 1NBZA 2XWTB 5JORA 5CZKA 5DRNA 3QNZA 1T6VN 2PO6B 1YY8A 4YPGA 1ZT7B 5I1LB 5I9QC 3S4SB 4Z18A 4XB7A 3HA0A 3PWUA 3LHPH 4KRMB 4K8RH 4OF5A 2YKLL 4MMXC 2VITA 1JZ5A 2R69L 3X14B 5C0AB 1B6DA 5DFVC 1R0AL 4LLQA 4P4RB 3LIZL 3NGBB 4MD5A 3STZA 4X6EB 1SEBB 3R8BB 4JDZA 3GMMA 2EE2A 2NY1C 4JPVH 4UAOC 1QRNB 1FJ1A 4OQTL 5D7IB 4I0PC 2VERN 2EE3A 4K9EC 2V9RA 2OP4L 1MWAB 3I3DA 1K4CB 2ZP0T 3TA3D 4HS3A 1QLRB 3F7RA 3W0WD 5EFIA 1DBML 4MQ7B 1RPQA 4Y0GA 2WANA 5A16A 1F2QA 5LGHL 4E42B 3B2UD 3MXVL 4JKMA 3VRJA 5ERWA 4YBLC 5GS0L 1P4LA 3CFJA 1NEZB 3IDUA 3ZYJA 2W9EL 1F2XK 4Z95L 4PBVC 5CSBA 3GKWL 3Q6GL 4KKCC 4LVOC 3GSQB 4LBEB 5ESVB 1SY6A 2OK0H 2EDYA 1GZPA 4FXLA 5D1XA 3BQUB 4JZNA 1T04B 3VXQB 1AGEB 3QSKB 1EEUA 1JNNL 2YD1A 4YDKH 4ODHH 1F5WA 4LVNC 4MCYB 3FB7B 4OZGA 4JZJC 4NQDB 2J8UB 3SPVB 1V7NH 2F53A 4KK5C 5DMGD 4FQJH 1NFIA 1OAXH 3RPIA 1T1WB 4U1HB 1QYGL 4ODTH 2FBOJ 2YRLA 4LLYA 1U8IB 4AIOA 3S5LB 1SYVA 4UDUB 3REWB 4X0KB 5IMKB 5D6DC 1WIOA 3K1KC 4QXTA 4OLWH 3O3BB 4KH2A 1YEJH 2B5IC 5DD0H 1H8SA 5D2NE 1BFTA 3GSVA 2F58H 4GG6B 2BNQA 5EO1A 2WLZA 4TUKH 3WJLC 1C16A 3RVTC 3C2AH 1GGCH 4CVWA 3ROLB 1WEJL 3PQYD 4JREC 3QYCA 5LGJA 1K5NA 3QXWA 5IW1A 4A6YB 4RAHA 2X89A 5T3ZL 3C6LC 2VLJA 1KACB 5K9JL 1KNOB 1TZGH 3VGFA 3BGMA 5C7XL 1AC6A 4GXUN 3GBNH 1SQ2N 2RGSA 2IALB 4XC3H 5I1HL 1WITA 4Y89A 4CVXA 1LD9B 3O3UN 3CGTA 4ZFFA 5F7NC 5FM8A 3BP4A 4L3ED 4TPRH 3L6FA 3PJSB 4HUXA 5F88B 1IC4H 2GY5A 5EU6E 2W59A 4ODBD 2VXQL 1NCBL 3MLZH 3RGVA 2B2XL 2X1PA 4MA8H 2XA8L 1L7TL 5I19L 4LGRB 1FYTE 1RJCA 4RQQB 4HUMB 4NN6B 1NCDH 3QXDB 3WIHL 4GAYA 1CDCA 1H0DB 3DLQR 1MJ8H 2YUZA 1NSNL 5JIPA 5I1DA 2I07A 5IESL 4OT1H 4G43A 3IU4H 4K3JL 5DT1L 2PKDA 1C1EH 1KCSL 2FB4H 4Q97A 1XF2B 1LO0L 4F3FB 5JMOC 1ZAGA 2IQ9H 2QR0B 1GC1C 4KMLB 4IS6B 1KLGB 4OCMC 3NH7H 4OF6A 1F6AA 3KXFB 4XXCA 1NUDA 1BM3H 5J6GA 5IJVB 4G3YL 5B8CB 1R3IL 2C3WA 1EZVY 3FN0H 5HYJD 2HRPL 4IRSC 4ISVB 3U9UB 4NBYB 2EEDA 3JV4B 4KY1H 4PJGB 3GHBL 5ID1B 2CDGB 1WT5C 4HWUA 3ARTA 5T1MA 4N0CC 2HFFA 4M1CC 3CXHJ 1KFAH 3O0RL 3QCTL 1T4KA 3G6DH 5C0IA 1LE9A 3AS2A 3GBMH 4ZMAT 1RHFA 4PJ8C 1JE6A 4GW4B 3RNQB 4N1EA 4L3CA 4MXQC 2JE8A 1Q9KA 1LNUA 4QRTB 4XP6H 4TNWK 4O58L 2HTLD 4WI7A 4YNYB 1UYWH 3W0WA 4IM8A 1RAMA 1MOEA 2QKIA 1NAKH 3LCYA 1G9NC 1WBYB 3SHSA 4YDVA 1G7LA 1YNKH 2EXYC 3E0GA 4KKBD 4Z7QE 4JFOA 2Q86B 1ETZA 3SY0A 1QSFD 4HH9B 4RGNE 3ZO0A 3OQ3B 4HWEH 1KCRL 4S1SL 4L5FH 4WY7L 1F4YL 4K2UH 4LCWE 3H9ZA 3VU2A 5C0EB 3B6SA 2CGRH 3U79A 2BSTA 3DX8A 4ELMB 4ZFOA 4I1NB 2ERJC 2ADFL 4ZUWA 1L4IA 4PLOB 2DYPD 4M93B 4H88H 2BNRE 3BXNB 1P1ZB 1ZVYA 4I8DA 4P3DB 1KELH 5A1AA 1EHLL 2VL4A 4K71C 4ODVH 3L5JA 3M07A 3TYGH 3ZTJG 2X5PA 2IBGA 5I73C 4IMLA 1IMHC 4MJ5A 5ITFA 4MHHG 2AXGB 1XIWD 4C83A 2FLBT 2CH8A 2ZG2A 1YEKH 1YEEL 3CX5J 1CL7H 3DMMD 2VKXA 1MF2H 3PWPD 1OAZH 3PQYA 2Y72A 4NM4L 4YJZL 5J8OA 2C3VA 4KJYA 4YXKL 4I3RL 3I02B 3HC3H 4Z7OF 3KLHC 4F7MB 3LKPA 2VE6B 2AAVA 1N0LA 1WTGT 2HP4A 5D7KD 1LK2A 3QWRD 4DVRL 3MXWH 1AGBB 3M17A 4IRZH 1QBLL 3UTPD 3IF1B 4L3EA 3SDDB 3HI6L 5J13C 2P5EB 3G5YB 4G80A 4GFTB 2FR4A 1U0QA 2H26B 4JN1H 2AJUH 4P3WA 4XHJC 2DWEA 4O9HH 3MCKA 1P4BL 4ZAKA 1FZOA 2AK1L 2UWEB 1S7VB 5DK2A 3GGWB 4FXKB 32C2B 4KK8D 4AIXA 3U7YH 2R8SL 2IFFL 2EDHA 1HEZA 2MKLC 3LRHA 2D0HA 1T1YB 4N8CH 3ARUA 4PBXA 3S34H 1A6VH 5HHOE 5IHUL 1KCLA 3KPNB 1P84K 3MNWA 4H1LB 1OP9A 5DFTA 5GS2D 5HVHB 5C70A 4Y1AD 1NLBL 2NY5L 2OMBA 12E8H 1DBKL 3U0WL 3TZVB 1DQMH 2HJKB 1OB1B 4ZXBC 1F3JA 4S1DC 2LFGA 3QPQC 1CBVH 1DZBA 3VA2C 3OGCB 5T3XH 2D0FA 4EN3C 2X1QA 5IQ7H 4G6JH 1A3RH 3C9NA 3HE7B 1U92B 5GZOD 1T7YA 1C12B 3QEQD 1ZLUK 4RMSA 5KS9B 3IJHB 4DEPB 1KULA 4YHNA 3DOSA 2XTJE 1RUQH 4XWGH 4OSUL 1U8LB 4PJEA 4PG2A 4Q7DA 1HYSD 5FK9A 5C07B 2NQCA 4XMLH 4I5BB 2BNUA 2E7CA 3ILPB 3P0GB 3ILQD 2E9IA 1CDIA 3P4OB 4U1KB 1ZVSB 2P48B 3LSOB 4H20L 4W6YB 4Y4HB 1MQKH 1BQLH 5IBTH 3K46A 1PG7L 2NY2C 3TT3H 4OFDA 1WIPA 5CBAB 1FG2A 5EOCL 1TITA 2BVUA 4UBDC 5LBSL 4JHZA 2APFA 1PLGL 4TUJA 1HWGB 5FM5O 2R2EA 1IKNA 4RGMC 3WHE1 5E2WH 4F9LC 2EDQA 4Y5YB 1MHPL 1GGBH 2BXYA 3VXME 4HK3N 1PZUB 4XT1C 1SM3L 2MCG1 2VTFA 1MNUL 2CMRH 3QEUA 3G6AB 5FCSH 2DYPA 3G5VA 4ZOAA 1S7UB 1U6AL 1VCAA 4LQFH 3CFBB 2JK5B 4M8QA 2CD0A 1JGUL 5JUEL 3ZYOA 3HS0A 3U7WH 3TYFB 5IB3B 1NJ9A 2C4XA 3MLSL 4HC1H 5AWNH 2AEPL 2IGFH 3TO4D 2DIAA 5GGUB 2ITCA 4FZEH 1FL5A 4Z7QF 5EBWA 3QUZB 1PEZA 3VW3L 2YD4A 1ZMYA 2HT4C 1JHKH 1MCCA 43C9A 5FF6B 5HBBA 2AGJL 4NQXB 1E4XL 4TUOA 3QG6A 3FQTA 3QIWC 4Y16C 3G5ZB 1N0XL 4UT6H 3UCRA 2ID5A 1JWUA 1UZ6E 3P9MB 3K4AA 4WI9A 1KEML 1MCKA 5KSUA 1U8HA 3OJDA 4M5YL 1N8ZB 4S10A 2QTEA 4JFPB 1B2WH 2ZPKH 4YDJB 1QRND 1YPZA 3MRHB 4N8VA 5C6TH 2D7NA 1KUMA 3QWRA 1EPFA 2IPUK 5DEZA 4FABL 5B22A 4R0LC 4LHUG 1XFPA 4M6AA 2Z91A 4YHIB 5CSGA 2OZ4A 4MNHB 3P9LB 1U8JA 4ZO6A 5TF1L 3MUGA 1XGYH 5E8DL 3JUYA 1BEYL 4GRMB 4TTDC 1Z9OA 2EH7H 1V7MH 4PJ7F 3G5XB 3ZE0F 3G6JA 4BFIA 4KRPC 3RFZC 1MHCA 3DRTB 5IG7B 4DGVL 4WHDA 5DGRA 3BQUD 5DJCA 3UTQA 1G6RL 3JWOC 4JR9H 5CSZA 5HDOA 4XPGL 2Y06L 3PABA 4XNQB 3WHE0 4HJ0C 1CF8H 1KPVB 3SKJL 3GSWB 4R26L 4QRUA 4PPTA 4Y1AA 1EV2E 2HVJB 1X5YA 4YHLL 1VDGA 2VSCA 1U3HC 4WTWA 5C08B 4TVPD 3QCVH 3WLBA 4M62H 1GIGH 3KPMB 1SVZA 3MLVL 4WEBL 5E5RB 3FOLA 1M6OA 3QUMA 4K3EL 4KZDL 1W72A 1T6WA 1WAAA 5T1KD 3I9GL 5C0JA 1LP9B 3IETA 4HFUL 1A7NH 1CU4L 5DMGC 5T1LA 3FB8A 3SE9L 1DFBH 1HINL 4R2GC 1AQDB 5JDSA 4WTZG 3RZWA 4EXKA 3BMWA 1JNLH 1E4XI 3UPAA 1L7IH 2WP3O 1CLYL 3RNKA 1DJSA 1BF2A 5EC2B 5GGVH 1UG9A 2ICEB 3LEXB 5D8JL 4TOYH 3VWKB 4Y2OA 3HZKA 5DD6B 2W60B 1SJHA 5EOCJ 4KRNA 5KW9H 4EVNB 1CYGA 2MQCA 2C1PA 3HFMH 2EDEA 3BDBA 3VMOA 5ISZB 3CCHA 5DD3L 5MEPA 3N1QC 4JO3H 1G7QA 2JCCE 4WFGE 4IDJH 1R5WB 3B2VH 1AHWB 3EDJA 4GXUM 3W5NA 3WXWH 4YXHH 4AEEA 5HDBE 1IQDA 2C26A 3P11H 5E5MB 5KN5A 2C1OA 2P4AB 4S2SA 5CP3A 5FO9B 1JGDB 1UWGH 3FZUD 2DI9A 3SGJC 1TJGL 4Z0BL 3SGKA 3I6LE 4LKCB 1OCWL 2P8LA 5D1QC 1VERA 1A9EA 2PW1B 4KJQC 1T5XA 1IL1A 4EUPH 3KYOB 3ET9F 2FBJL 5GGSA 5IHLB 4XP5L 2DD8L 2XWTA 1SY6L 2X4UA 2B4CH 5DC0A 2YEZA 2ATKB 4MZ3A 5JW3H 4LCCC 2PO6A 4S0SD 1JI1A 1ZT7A 4NC1C 1I1FB 4JKPL 3S4SA 5I1LA 4LSRH 4JQIH 1MIEL 1MAMH 1A2YB 3N1FC 4Y8AA 1E4JA 1MPAL 4K94H 1O5DT 2P47B 2WQRA 4AENB 3X14A 3QQ4B 5C0AA 4GS7B 4NKDB 4P4RA 2DN7A 2VDMH 3PWJB 2WUBH 4X6EA 5EA0H 1DBBH 2JJUA 4FNLL 1SEBA 5HI5D 2R2CA 3UTZB 4YC2B 4AYFA 4R4ND 2EYTB 1S5HB 4HS8H 1QRNA 3GJFB 2Y36H 1CFSB 4OLZL 5D7IA 1PW3A 5IEHB 4XCNB 2AJZB 4QYOB 2E27L 1MWAA 3UBXB 1K4CA 4F37K 3QJFB 1RI8A 5HYSB 3X3FH 4KDWA 4MQ7A 1J0ZA 1FVCB 5FGBA 5DZOA 4E42A 2DI7A 5KVEH 2X44D 1RURL 3ESVF 1NEZA 1A4KB 3HB3D 7FABH 3O4LB 2FJFB 5CKAA 4OI9A 3I3EA 3RTQB 4QWWC 1RZFH 3GSQA 4LBEA 5ESVA 3SJVB 1A14H 2XN9B 1EDQA 5E8OB 3BQUA 3KYAA 4E5XB 1OP3K 4DTGH 2O5XH 3VXQA 3MROB 5GJTL 2JJWA 4KGLA 2NY6C 4P3CH 4MCYA 3WN5C 1J1OH 3FB7A 3IAPA 1TVBB 2ADJB 1R3KB 4NQDA 2J8UA 4X5XB 2YC1B 3SPVA 3F58H 4TVSa 5HD8D 1NGQL 4KKLC 1LDPL 3TBYB 1T1WA 4U1HA 1KXQE 1NBVH 2ZUUA 1U8IA 3VMPA 3S5LA 4UDUA 2G2RB 4GUPB 4X0KA 2G5BB 5IMKA 2DKMA 3REWA 3MLXL 3QEHB 1QQDB 1HN1A 3O3BA 2PTVA 1IT9L 5E5UB 4U7KA 4WW2C 2DLHA 4GG6A 4X9BA 3L7FB 4NZRL 4ZSOE 1GCFA 4MXWL 3ROLA 4IRJA 4ELKA 3FFDB 2YS4A 4J3UA 4XNXL 1OARL 1WVZA 3ZSSA 1N2RB 4A6YA 4OGYL 3F6IA 4G6ML 1KNOA 3QH3A 3VCLB 4LRIA 1HHHB 2KDGA 1JF6A 4GRWH 4NDMB 1UM4L 2IALA 1XF3B 3NFSH 1E4KC 2B1AH 1RUKH 1LD9A 2X05A 5FV1L 5BO1L 1GOGA 2AEIT 4HF5L 3SDDD 3CH8A 5JIHA 2P5ED 3PJSA 3RY6C 5KANG 2NTSP 4P23B 1FH5L 3JV0A 4LCYB 1HK6A 4NQEE 5F88A 1ZT1B 5IB2B 3BKJL 3GSNB 5IIEB 3DX9B 1IGML 4JN2A 5ENWB 2M2DA 1NLDH 3PDOB 3NCYS 1FZMA 4QRSB 2F5AL 2F5BH 4L4VB 1FFNB 4RQQA 5KG9B 3P2TA 4M6OL 1BJ1J 2IANB 2ARWA 5EIIB 3S3JA 3MLRL 3QXDA 3EFDH 1H0DA 1P6AB 4OIIH 4CBPA 1RMFL 1A6WL 2YPKB 5IFHL 1ZEAH 1OQXA 3ARZA 2XZQL 2QQLH 2NY3C 5LWYL 1CVRA 2EDOA 4PRAB 1WAAE 2A6IA 1XF2A 1EEZB 3KJ4B 4U0QB 2XTLA 2QR0A 4H0HB 4XWOC 1DR9A 1KLGA 1S78C 1EEQA 3TWCH 1JMXA 1T7VA 3RUGE 3TEUA 4GG8B 3KXFA 1CFVH 1EK3A 5IJVA 3NABL 4JQVC 4QTIL 4FRWA 4ZFOL 3VFPB 4RWYL 2JCCF 3HE7D 4ISVA 2DQCH 1KIPB 5CGTA 3U9UA 3JV4A 3O6KH 1CVSC 4OD3H 1QNZL 5CKGA 4PJGA 5ID1A 2CDGA 2G5RA 1TJIL 3BPLC 5HDBF 2EKSB 3QRFM 3LRGA 5GS0C 5F7KC 1A4JB 5C07D 4HXAH 3P3YA 3DVFA 4DFHA 3BH9B 2ZSVB 3UJTH 3PIQB 1RJLB 4GW4A 4M6ML 3RNQA 5FB8B 4OLVL 3MRNA 4NIKB 5IVXB 4Y4HD 5FYLH 3FB6B 3NACH 2E7MA 4M3KB 4QRTA 4YNYA 4UILH 1QHPA 1YDPB 4P5TC 4PJDB 4OZHB 2FL5B 1U8KA 2Q86A 4HH9A 4YFLI 1C5CL 1F90L 4M7ZC 5BS0E 4PRNB 3K81A 5F44A 1F02I 3TV3L 3ZHLA 3RU8H 5C0EA 4HZLB 4LLMB 2BNRD 1RIVL 1KBGL 5IKCB 3A6CL 3RWHB 1AXTH 1JV5B 1LO5B 5D1ZB 2PR4H 1MEXL 1XGTB 4ELMA 3RDTC 1I3GL 3O81A 5I76B 1JBJA 1S3KH 1CWVA 3BXNA 1P1ZA 5CILL 4P3DA 4NOFA 4CMHB 4N0UB 5DR5H 1AD0B 1MFNA 3C08L 1RZGB 4OCSH 2IBBA 2D9CA 3QUZD 5T33L 2FLRT 3MJ6A 2AXGA 4LOUC 2D3VA 1GHFL 2VN4A 2JB5H 2VZ3A 4OZHF 5T5NF 3C8KA 3A6BH 3I02A 2F54B 1AP2A 3TBSB 4KTDH 1DVFB 1BIHA 4F7MA 2A9NL 4U1GB 2I25N 5IW6B 1X4XA 1C5DA 4HXBL 2VE6A 3TO4C 1YECL 1TQBB 5IQ9B 2VLKB 1MFAH 3SE4C 3EJYD 1AGBA 4Z7WB 2YD5A 4JFFE 4WGVB 1IAMA 4HG4K 1ULVA 3IF1A 4JKLA 3SDDA 3ULUL 3ZL4H 3G5YA 3W9DB 2NCMA 4HGKC 4G8FB 5E9DE 3O6LL 2H26A 2LAGB 4ZO8A 2H9GB 4ZDHB 4ZPVA 2EEAA 1EGJH 4HQQL 2J5LC 2UWEA 1S7VA 4YHMH 3GGWA 4KMTL 4FXKA 5F97E 2AJYL 32C2A 3MNVB 4HS6B 2X9WA 4NM8H 4GAJH 4Q2ZA 4XP9H 1H3VA 4GBXB 4K9EH 4S1QH 3GJEB 5ACMA 1T1YA 2OMNA 4KAQH 3S9DB 3WXVH 3D18B 3V4VH 4FQCH 3LVEA 3U4EB 2ZWLT 3PXJA 3FFCB 3JWDL 1MI5E 3KPNA 2BY3A 4H1LA 1VGEL 3MLPA 1EBPA 4EDXB 4D8PB 1FCGA 3BKYH 3RA7H 3GO1H 5DLMH 3TBWB 4UT7H 1QFPA 3TZVA 1Q9LB 3Q1SH 5K93A 1A7RH 1LO4H 3KS0H 4R9HA 3M8OL 2HJKA 4TRPH 1HKLH 1OB1A 2G60L 5C08D 3UJIH 4LNRB 4QGYA 4L9LB 4AH2B 4NKOB 4JB9L 3HI5L 1RHHB 3HE7A 3AU1B 3DYOA 1S7SB 4HBCL 1U92A 2P5WB 3ARXA 4XVTH 1H3PL 1CGSL 3VGGA 1T80A 3CAFA 5KS9A 1PYWB 4CW1B 3MRLB 1FNSH 3IJHA 3UROR 3DGCR 5TE6L 4ONFH 2CIKB 3VWJC 3MJ9A 3OF6D 2VZUA 5C92A 1KV3A 2F8OA 3QUYA 1KJMB 4L8DB 4X7TB 1U8LA 5GRJL 5C07A 1SBSL 1MH5A 4I5BA 4MD4B 3ILPA 5TQ0H 2ZG3A 3P4OA 4U1KA 5FDWB 1ZVSA 5GJSL 3I3BA 3U0PB 4LIQH 3LSOA 4X8XA 3IGAB 1NGPH 5SX4I 3O6FC 1BQUA 3VWKD 1TTUA 1KLUA 2WW8A 3RUGF 5JHLH 3TBVB 1O7SA 2Y9RT 1AO7B 5TE7H 1K3IA 3STLA 5CBAA 1U95A 1E28A 4ODSH 5EU3B 3BDYL 2A38A 4JAMB 1INDH 2YBRA 3WMSA 5ISZD 1QR4A 3LPGA 2JJTC 5T5NG 4NRZB 1K9TA 3VRLF 1B6UA 3QG7H 4FFYH 1Q0YL 1Q38A 2DTSA 5DK3A 1FFRA 5JHDB 1EO8L 1IFHH 1MCBA 4GOSA 5E2TL 4AY0A 4Y5YA 4URTB 3VG0L 1RK1B 2OZ4L 1BBDL 4RFOH 4M43H 3DETC 1CXFA 2CRYA 4PJBE 1IBGL 5TDNB 3G6AA 1S7UA 2HFGL 3CFBA 2JK5A 1DN0B 3WFZA 4EBQL 2PW2B 3HE6B 3TYFA 4TNWF 5IB3A 1LO2H 5FUOH 2VN7A 2VDRL 5GGUA 3HTLX 4X7SL 1HKFA 3QUZA 4N8VG 5BZDA 4BUHA 3ARGC 4XBPB 2BMKB 2D2OA 2Z31C 4GSDH 2M26A 5FF6A 3TCXA 4NQXA 2CRIA 1YNTB 1D5IH 5CEZH 2GIYA 3G5ZA 1X7QB 3P9MA 3O45A 3MA9L 3RIAK 1TTGA 5C0DB 1P7HL 4XPTL 5M94B 1N8ZA 4Z7UB 4MS8C 3ULVE 1T21B 2VYRE 4YDJA 1KCVH 5EZIL 4IMKC 3MRHA 2BSED 4J3XA 3IDMB 4S1RL 4PJFE 4FQ1H 3QUML 3UJJH 1W72L 3S96B 3QHFL 5BOZG 2VNCA 3WFCH 5FGRA 5CWSB 4LAQL 4YHIA 1L6XA 3UC0L 4BQCA 4MNHA 4GKNB 3P9LA 4OGXL 5DWUL 4UB0H 4GRMA 3HNVL 2P8PB 4GJTB 3O4LD 5MI0B 3G5XA 3RTQD 3DRTA 5IG7A 1TCMA 1UA6H 1XF5B 2VDLH 5BMFL 2ZUTA 2PN5A 4HEME 1G9NH 1X5AA 4J23A 4G7YH 4XNQA 1CTNA 1UM5H 5IM7B 1A7QL 1G7HB 2IAMD 4TULL 1KPVA 3S35L 1LEIB 4G5ZL 1Z0NA 4Z7UF 1IC7H 1TIUA 1LDSA 1KGCE 2LAAA 3GSWA 1I85A 4GAFB 5SWZB 3BRGC 2CR3A 1BZ7B 2HVJA 2AV7B 3ZDXE 4F2MB 5HHPB 4LPUA 5I0ZA 3CPLB 5C08A 4AT6A 1ZKAA 2YPVH 3JV5A 3T0WA 3DGGB 4P2RE 3QI9D 2AKRB 1WF5A 5CJQL 5D7JD 1XGPB 4LLUA 1LP9A 5BRZE 1MRCH 3CDCA 3B9KC 1UH3A 5ICXB 5D2NC 4WEUD 1ZTXL 3OF6A 2H2SD 3X12B 4OCXL 4WCYL 1AQDA 3EYQD 4PS4L 5E1AB 1NL0L 2UWEE 1S7XB 1YEFH 5JMRA 2RFXB 2RR3A 1FVDB 3NFPB 3MMEB 4PGEB 5EC2A 2ICEA 2J6EA 3WSQH 3LEXA 3D3VB 3VWKA 5ESAB 3S36X 5DD6A 4KKNA 2W60A 3T0EE 4JO1L 5J7CC 4U2ZA 3RZCC 4XPHL 3KR3L 5IK3B 3KPQB 3MLUL 1ZS8A 1AH1A 5ISZA 3L95A 4DUWA 3O8XC 2Q8BL 4XNYL 5FCUL 1R5WA 1WLHA 1AHWA 3BRDA 1OVZA 2YZ8A 5DMKB 1VB9A 4YDLC 4ZS6C 5AZ2H 1A0QH 1MWAL 2HA1A 3HAEH 1CICB 4PLJD 5SX5H 1MFCH 1JK8B 5E5MA 3HPLA 4YPJA 1MREL 4JPKL 5FO9A 4P2OC 4TSBL 1JGDA 2B0SH 1WFTA 3Q3GB 4PJHA 2APWA 3AUVA 4FZ8H 3CSBA 3U30C 1IM9B 4LKCA 3ZZ1A 1AE6L 2PW1A 4Y19D 3EKCA 4DKEL 3KYOA 5CINL 4F57H 1P4IH 3C6SB 3E3QE 4K7FB 3W2DH 2R1XB 25C8H 2UV3A 2VDPH 3NTCH 4XP4L 2DQEH 2J3SA 4LARH 1OAQH 1AC0A 4XPBH 2B20A 4R4FH 1I1FA 3NFNB 4YR6B 1A2YA 5F7EH 1CFNB 3GUTB 2NW2B 4Z0XA 4AENA 3QQ4A 1OOAA 1I7TB 5I71B 4NKDA 2P42B 3T65B 2XIDA 4ZODA 3EOTH 2AQ3A 3PWJA 1NKOA 1BQHA 2ZKHH 3UTZA 3WDHA 2HKFL 3MJ7A 1XGUB 2EYTA 1AXSB 1I8KB 1S5HA 1RIUL 1X9QA 5E4IA 3GJFA 1CFSA 3P0VH 5IEHA 4XCNA 2ED8A 3FTGB 2ITDB 5BVPL 3UBXA 3QJFA 5MHSE 2H3NB 4M7KL 1JNHB 5HYSA 4A6YL 1FVCA 4Q58C 4UTAH 4I3GA 2GI7A 4G8EA 4WHTB 3QRGH 4U1LB 3X17A 4JQXC 5ETUB 4KXZH 1N6VA 3R0NA 4DK3A 4ZS7L 1A4KA 3O4LA 3MBEB 2FJFA 4DOHB 3S5LG 4Z7NF 5LJYH 3ARPA 3LKSB 3SJVA 4CUCA 2XN9A 4QLRA 2H1PH 5E8OA 1F3DJ 4P46C 4E5XA 3LN4B 3W11C 4Q9RL 4BQ9A 3F7PC 3MROA 5D1ZD 2DQJH 4RGNC 3FT4A 3SDCD 1VFUA 4KMQA 4F58H 4X6CB 4XI5D 1TVBA 4PJFF 5LXGL 2ADJA 1MY5A 1R3KA 3NCJH 5MP6H 2YC1A 4JG0H 3TBYA 3O3AB 5GIRB 4EKXA 1W8NA 1AGFB 1T2QL 4O2FB 1OM3L 3WLWC 2G2RA 2R1YB 3B5HA 2G5BA 4GUPA 1F45A 4FMFA 4MAUH 1H3WM 1CDUA 1AFVH 1QQDA 3ZKSD 4IEFB 3DYMA 1ZA3B 4PGDB 1HHGA 3L7FA 4NNYB 3OJVC 5I75B 3ALWA 5TFSH 4RGOH 3FFDA 4P59H 1CTOA 1OAYL 1G0XA 3ROOB 1K6QL 4N5EC 1IAIL 4LP4A 1DVFD 1CDHA 3ARDB 4F8QA 2ZJSL 1BWMA 3LQAL 3VCLA 3SDAB 1HHHA 5FGSA 1CD9B 1XF3A 2Y4SA 1WZ1L 2VLKD 2EDBA 1JGVL 4NQED 2Q6WB 5ITBL 1ZHBB 1CZ8L 3LKQB 2ESVE 5HHMB 1J8HE 3BN3B 1WV7T 3ZDXF 4P23A 1BAFL 2GJ6B 4LCYA 1KB9J 1D6VL 5AZEH 3TJEH 5IMOB 1N5AB 1RUPL 1ZT1A 5MENE 5IB2A 2M8XA 3T2NL 3GSNA 5IIEA 4YUEH 1HZHH 4W4OC 1Q0XH 3DX9A 1XAUA 3LMJL 3M1BB 5KSAC 2KZWA 2PCPB 4NFBA 4XNZB 3PDOA 4LSUH 5FM5M 3RWIB 2WMPA 4QRSA 2FATL 4TYUA 5DUMH 4GBXD 1OD9A 1FFNA 4L4VA 4NOBA 5D1XC 2N4IA 3WNMA 5IF0B 5KG9A 3DVIA 3MGTB 2IANA 1I9RH 5EIIA 2WSKA 2NX5E 1KTDB 3JWNC 4F7EA 2YPKA 3FFCD 3WFEL 3ULVL 1P5VA 3FMGH 4PRAA 4EUPB 3QQ9C 4EJ1C 3CLFH 4OCWH 3K4DA 1EEZA 2BVPB 4NBZB 5CBEB 1OGAB 2V7HA 4JO4L 1LK3H 2VXVL 4AMKH 3QDJE 3TBTB 4YGVB 5HI3D 2VB5A 3RI5K 3HKFA 3IJYB 1JYNA 3JWOH 3HNSL 1F4XH 4N68A 2A1WL 3EO1B 1A5FH 5DQ9B 1P53A 3VFPA 2DM3A 1B4JL 2EZ0D 1KG0B 1KIPA 4G9FB 1NCCH 2AJVL 2DDQH 2ICES 2GY7B 3L5IA 3SEPA 1OTSC 4D0DB 1FV1B 2EKSA 5DQDH 3WS3B 3HRPA 1A4JA 4RMUA 1FSKC 3D48R 1Y0LB 1QEWB 4APQC 1PQZB 1DUZB 3PIQA 2MPAH 1NMBL 3MR9B 1RJLA 1G9MC 5FB8A 2IPUG 4LSQH 2HYMA 3MV9D 3UYRH 5IVXA 3AY4A 2YPLE 3BGFC 5EU4B 1IAII 2XTJC 5CUSH 3FB6A 1JYVA 3U9PH 3S8WA 3WE6B 3A0OA 1CFBA 2AXHA 2P44B 3MACH 2Q8AL 1EBAA 1YDPA 1AO7D 4NZJA 1JGEB 3OAZH 4PJDA 5IOPB 5C09E 5IP4A 2FL5A 4X5LA 1KEGH 5JXAH 4PJHE 1XT5A 1UENA 3GEWB 5IFAL 3OX8B 5I18L 4PRNA 3TIEB 2FD6L 5JHDD 2WWMD 1N7MH 3L3KB 4NO2B 4HZLA 4LLMA 1G7JB 2YXFA 2Q3ZA 1MLBB 2V5TA 5IKCA 3RWHA 2A77H 1JV5A 3QJHB 1LO5A 5D1ZA 1XGTA 2APXA 1Z9LA 3O9WC 5DZNA 3KYKL 1T3FB 5I76A 4JVPA 5CZXD 1YJDC 3FRUA 4LU5L 4V1DB 1X5XA 4JRXE 3JSSA 5DHXB 3HE6D 4N0UA 3SQBA 5I1KL 4G6FB 3PP3K 1A7BA 1AD0A 1DLFL 3H7BB 4BFEA 4LRNL 1RZGA 1SJVA 4LSPH 2DQDH 5C0FA 4MAYD 1JVKA 1ZGLP 2VOTA 4P2QE 2JB6B 4QNPF 1XF1A 1E6OL 4ZPTB 4CN6A 4RCAA 5EBGA 1A3QA 3V6OE 2J4WH 4UUJB 3OPZH 3MLYL 4RFEB 2E9JA 4R90L 5FYJU 3VFUB 2F54A 3TBSA 4Y2DB 1NQBA 1DVFA 1FFQA 1T0MB 3Q0HA 1I9JL 1CD8A 4GRWB 4I3SH 1ZHLB 2EDKA 1N4XL 1D5MB 5IW6A 2BJML 3TLRA 2BFVL 5HHNB 4M1DL 5IQ9A 3OAUH 2VLKA 2HT2D 4IIQC 3IFOB 5GGQL 5KOMC 4Z7WA 4QXGH 4LGPB 1QFWL 1B3JA 4XCFH 4BZYA 4KKAD 3W9DA 3BIKA 4LAJH 4G8FA 4ENED 1KJ3L 1F8TL 1R3JB 2H9GA 1QUNA 4ZDHA 2D7TL 1EHXA 3ECBB 5E7BA 2OLDA 1J1XH 3K4ZA 4AZ8A 3PHOB 35C8H 4OFKA 1MCHA 4YK4C 1ORSB 3MNVA 4HS6A 2FYYB 3AAZB 3CFKB 4NC0B 3GHEH 4DW2H 4GBXA 4RIRB 1MI5D 1ZANL 3GJEA 1IQWL 2EYSB 5F1NB 1C5BL 3SCMB 4P4KC 5ANME 2VQUA 4AQOA 3U4EA 3HNTH 3FFCA 4GRWF 1FBIH 3U83A 2Z92B 4EDXA 5DUBB 4D8PA 4U3CA 5SWZD 3TBWA 3LB6D 2ADGB 4LEXL 3R06B 5F7YC 1JZ8A 1Q9LA 3VD7A 2QQNL 3VGAB 1CLOL 4LNRA 4NZUL 2J8OA 3QIUC 3GNMH 4L9LA 4Y5XB 4P57B 5T3XD 4AH2A 5DD1H 4NKOA 1RHHA 1VPOH 5ILTL 3AU1A 1KT2B 2P5WA 5FHBL 2IAMC 1AXIB 1GL4B 3IFNL 4B0MM 2HT3D 1PYWA 2DI8A 3MRLA 2R0WL 4CW1A 3MA7A 4LEOB 2ATPB 1KJMA 4HIHA 1CR9L 1YYLH 3AB0C 2W92A 4NNPH 4MD4A 1U2HA 4QCIB 3GK8L 5LCVH 3V79C 1E6JH 2YMXL 1BOGB 3NOIA 1JRHL 3TNNB 5FDWA 1OTUC 4K7PL 3U0PA 3TT1L 1X5FA 4JEGB 3MRDB 5FYJE 3VXRB 4QTHA 4UTBL 4OKVB 4PG9B 1M1SA 2OJEB 3D3VD 5I1EH 3F7YB 5ACLA 2R4SL 2IANE 2APVA 4FQXB 2IMMA 3L3HB 3TBVA 4ZAKC 2QHRH 4H8WL 3RWFB 1AO7A 4W6XB 5EU3A 5I74C 1EAJA 4JAMA 3TVMB 3IS1X 4GW5B 4OFVA 4PJCB 3VH8B 4NRZA 4LFHD 3EYQC 1QFWI 3H3BC 3DROB 3QXAB 3WD5H 2XZAH 3IKKA 4D9RE 5JHDA 2FJGB 3QWQB 4XAWH 3UZQA 4GRLB 5HTSA 1RK1A 3UTTE 4D0BB 4UIKL 2BOBB 1QR1B 5KSBB 1XZ0B 1PAMA 1J0JA 1R6VA 2A73A 5TDNA 3CVHH 3CFCH 3GM8A 1YY9C 4LASL 1DN0A 2ED7A 3KPRB 1NC4B 4PRHA 2PW2A 3HE6A 6FABH 5J3HD 2A9MH 2BSRB 2FX8L 2VDQL 2BDNL 2H6PB 4MD0B 2O61A 4YZFF 1QKZL 1U58A 4MNGA 4XBPA 5HDLA 4U6TA 4R97C 3L1OL 1YNTA 1YC8A 3PHQB 1EERB 4NZTL 3EYSL 3A67L 8CGTA 3DARA 2R0ZL 1X7QA 4PJCF 3LEVL 1TQCB 2A2QT 4X6BB 4XVUD 3JVGA 2PYEE 3EO9H 3K3QA 4TSCH 1X6LA 3GIVA 3Q2CA 3CXHK 1T21A 4UQ2A 5I9QB 5A3ID 2OP4H 4GAGH 3IDMA 4UU9B 3AVEA 4R6UA 3RWCB 3S96A 4N90D 3D85A 5CWSA 1DBAL 1HILB 4GKNA 4MWFB 3H2WA 4NQVA 1I9IL 5GS0H 3QUKB 5IV2B 2NY1B 4UAOB 1JRHI 1WCBB 3GRWA 1WWAX 3Q6GH 3ES6B 1GVIA 3C5JB 3KYMB 4I0PB 2P8PA 2D9QB 3MBED 4EDWH 4P0DA 4OCLC 5D93C 3MQIA 4DK6A 1WK0A 5EIQA 5F96L 4PJ5B 1RZKL 4HUUB 1XF5A 2J6EL 4KTYA 1BECA 3NPZB 2X6MA 5C0CE 3T77B 4DN3L 2CKNA 2IPTH 1A6AB 4QOKA 4KU1A 5IM7A 1G7HA 5D72H 1LEIA 4G8GD 1AI1L 4ZFZB 5L2JB 4BSWA 1D3CA 3UYPA 3EAKA 4JM2C 2I60L 4LVOB 5SWZA 1S9KC 3BHBB 2OBGA 3QXUA 1BZ7A 2AV7A 2WM0A 5IB1B 4F2MA 5HHPA 3MOBL 1N59B 3CPLA 3RBSA 1T7ZA 4LVNB 5F6IC 4PV8B 2FJHB 4JZJB 4AM0B 3PGCA 2AKRA 3SDCC 2H45A 3LEYH 2D31B 2WUCL 3CX5K 1XGPA 4I77L 4XI5C 1MCPL 4JDTL 4Z7WE 4YFDB 1FFPB 5ICXA 1LEGB 3C8DA 3SDAD 2E5EA 3X12A 4YXLL 1FGVH 2B5IB 5L2KB 1ND0A 1S7XA 1QFUL 3CLEH 4J4PA 3T0ED 5DTFB 2AJSL 4KK6C 5HHMD 3NFPA 1FVDA 4BFGA 4JREB 5CZVH 4XMPL 4EI6B 3MMEA 3MCLH 3MV7E 4AEIL 5ESAA 3C6LB 1Q8MA 5GISH 4K3DH 3DUSB 4MQSB 3V7MA 3RWGB 3MRRB 1WFUA 1L7TH 4N0YL 1XH3B 4DCQA 1NFKA 1IGYA 1ONQB 2NY7L 2N7BA 3GFUA 3HMWH 3O6ML 1MHEB 5DMKA 1MVUB 5KJRH 3Q5TA 4NRYB 4P9ML 4CVUA 4JHBA 4F7TB 1CICA 1PSKH 2DKUA 1DBJL 1JK8A 4LSVH 2D7PA 4OLYL 2QSTA 1LO3L 1KCSH 4PYGA 4KUZL 3ARRA 4RAVB 2W0KA 1JP5A 3GMRB 1IM9A 3HC4H 1BVLB 1T20B 2V2TB 2LU4A 4MCZB 3BAEL 1OGAD 3C6SA 4K7FA 5EUOB 4UT9L 1BQHG 3JXAA 5SWSB 2R1XA 5FOJA 1UCBH 2XRAL 4NP4H 5KSVB 4QHUB 4HJJH 3HCVB 2AEWA 2DQIL 1I1AB 5EOQL 1FO0B 4XCYB 3P0YH 3NFNA 4YR6A 5J12C 1CFNA 4G9FD 5FDYA 4PJAB 3GUTA 2NW2A 3UTSE 5HYSG 2Y5TB 3T65A 1X5GA 1U8QB 5CD5C 2CK0L 4FQ2L 5ABDE 5FOBA 2HWZH 1XGUA 1AXSA 1I8KA 1QHOA 4QRQB 4P2CG 4IRSB 2ORBH 3FTGA 4O58H 2ITDA 1VENA 2XV6B 4FQQA 4BZ2L 2DTMH 2H3NA 1P9MC 1JNHA 1YZZA 3DVGB 3FKUS 1NFDB 1BD2B 3ZTJH 3KJ6H 2AW2A 3KDMB 1JHTB 4WHTA 4U1LA 1OSPL 3RVXD 3QFJB 5ETUA 3KPPB 4NJ9H 4IBLT 1XCTB 4PJ8B 2MCPL 1SMOA 4PRPB 3MBEA 1RUAH 3MZGB 1ZGLM 3H0TB 3VFMB 3VXUE 3LKSA 4PRHE 5GXBB 4FP8L 4ZD3H 3RIAF 3LS5H 3LN4A 3V6ZB 1FGNL 4K3HA 2BXZA 5JXED 3S3PA 1G0DA 3SGKC 3C5ZC 4YBQD 5AUMB 4BKLB 3GSNL 4X6CA 4MNGE 1EHLH 1MCFA 1YYMH 4V1DD 2W38A 4PJIE 4CU6A 2A0LD 3UBXI 5FO7B 5GIRA 4G6FD 5FYJL 3QNYB 1AGFA 4O2FA 3SBWA 2R1YA 2QBWA 2PO6C 1MJ7H 2J88H 3GMNB 1NEUA 3GZKA 5GHWL 5E95B 1IGFL 1OTTC 2WWMC 1JGLH 5I1JH 3BUTA 1ZA3A 3X3GL 1OGTB 4PGDA 5I8EB 2ERJB 3FRPG 3D9AL 4NNYA 3KLSA 1OWWA 2E8ZA 4YXKH 1J9CT 2EDRA 5TQ2H 3GIZH 2AERT 3WS6C 4K71B 4WI4A 4Y2DD 5L6YH 2C9AA 3ARDA 5FA3A 2F9BT 4XC1L 2ESVD 1J8HD 5FYKU 2XKUA 5I73B 3IVKB 5I16B 4MAYC 3EYFB 4X9IA 3S88L 4YBHA 5JOFB 1CDBA 2Q6WA 3LHPL 4K8RL 1ZHBA 3LKQA 4X99B 4X6DE 1DQJB 1T66D 2X40A 1P7KB 3GSXB 3NA4A 4OF3A 4I4WB 1CDYA 1UB5A 2GJ6A 5EZJB 5IMOA 2AK1H 4NKIH 1N5AA 4KK9D 5CHNB 5C9JA 2Q3AA 5SWQB 3M1BA 4EOWH 1U42A 2ZG1A 4QOKE 2NX5D 2PCPA 5K9QG 2R8SH 4E41B 4MA3A 5IF0A 4OLEA 3HAEB 1WWCA 1IC5L 3MGTA 5J13B 1T83A 3SCMD 1KTDA 3GI9H 5IHUH 3TJHD 1YQVH 1IZKA 3CSYA 1DE4B 5HVFB 1RZ7L 5KZCB 4XHQA 4PJ9D 3H6JA 1BVKB 2GCYB 1VKXB 4M48H 1PKQB 2BVPA 5CBEA 1OGAA 2FGWL 4HG4J 2OK0L 3TBTA 4Y5VC 3QO1B 4YGVA 3UMTA 3IJYA 4BSVB 1KCUH 1GGTA 1NMAH 5ECJE 2XWJB 3EO1A 1CK0H 4IRJC 4UDTA 2NY4D 5IW3A 1RVFL 4L4TB 1KG0A 4NZDA 5EH1A 1V7NL 1BGXH 4FQJL 4OSUH 1OAXL 1RV6X 4ODTL 1FV1A 3O3EB 3HI1B 1JPFB 4ZXBB 5M95B 4OLWL 4IOFD 5EBLB 4PLKD 1Y0LA 1TJHL 1QEWA 1YEJL 1PQZA 4PD4J 3MLWL 2VSDA 4EN3B 2F58L 3BP5A 2L0DA 3MR9A 1NDMB 4TUKL 3VA6A