4ZXBD

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
182
Chain Sequence
b'DIQMTQSPSSLSASLGERVSLTCRASQDIGGNLYWLQQGPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKVLNSWTDQDSKDSTYSMSSTLATHKTSTSPIVKSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
total genus 43
structure length 182
sequence length 209
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbD01
2CDEB 3RA7H 4ZOCA 1AQKL 4K3EL 3H42L 1UXWB 3QIWA 4G42B 4JO2L 4Q0XL 1ZLWK 2H41A 3MJ9H 4EBQL 1IFHL 3DVIA 4CJ0A 5F72S 1ROWA 3P4OA 3UJIL 4V1DE 5GISL 1T1WA 2YRLA 4WEUD 4WWKD 1U2HA 4AEHH 3F7VA 3F8UB 3MZTA 3HCVB 4FXKA 2XWTA 3H7BB 4PJAE 4YGVB 1NAKL 1WGOA 1MIEH 1U3HC 1HK6A 5D70L 1T1YA 5AG9A 1G7HA 4ORGA 4P23D 4FFVD 4WTWA 4MAYA 1SVZA 4B7IA 3TA3D 3QNZA 1FNGA 1N7MH 5DMGC 3RL2B 4M93C 4P9MH 4G6AC 4QXGL 4RGOL 2CKBB 4J3TA 1G9MC 3DX8A 4YUEL 3U4BL 3PL6A 2R1YB 2JIXB 5FOJA 2HFEA 3Q3GA 5TF1L 2DF3A 3W0WE 4JFPA 4EUPB 5E08L 1MCPH 1T5XA 4JN2B 4RA0C 5MENA 4NZTH 4DQOL 3DX6A 1KFAL 4LOUD 1LVEA 4MMXC 4PJ9C 4Q9QH 2A73A 1UENA 4MNGB 3PJSB 2G5BB 1S7SA 3Q5OA 3RVTD 1IMHC 3MA9H 32C2B 4FQXD 3N9GH 1VFBB 4GSDH 3T8XB 3MFFB 3TVMA 1UYWH 3NAAH 3HS0B 1YN7A 3VFTA 3RQ3A 3V0WH 4CNIA 4TOYL 1KCSL 5IBTL 4HGWA 1Q9LB 2UYLB 2A9NH 3MMEB 4XNMA 1YYMH 4NP4L 3E6HA 4F9LA 4F3FA 4XMLH 3VRJA 2V7NA 3DNKA 1T89C 1F3RB 5SWZD 1QA9A 3MLSL 5IQ9B 3WLBA 1N8ZA 3QDGB 4R2GD 2A6DA 2EO1A 3TO2B 3BWAB 3LVEA 2ZUUA 3LKOA 5DVKA 4NN5C 1YUHB 1UJ3A 1OARH 4KK5C 5I19L 4HKXB 3MUGA 1F6LL 3S7GA 4KQ3L 4C59B 1QPXA 2AJXH 2IAMB 1KPRA 2GTZB 3RY4A 3U36B 4B53A 2V2XA 2HP4A 3J8F7 4LKXB 3CZFA 1QVOA 2KZWA 1N3NA 5HDQH 5CILH 2KQMA 2F54B 4M7KL 2NYYC 5BJTA 2R8SL 4CN6A 1DQLL 4LLUA 3VFPA 4WI9A 1A7QH 1HXYB 1R3IH 2IGFH 5CMAA 5IJKC 1RFDH 4OQTH 5J1AA 2HTLD 2PYEA 4MNHB 5L9DH 4N0YH 2ZZUT 3CIQA 3I6LD 1QFUH 5D1QB 1AIFA 3QFJB 1RK1B 1ZLSH 3TN0C 1QSEE 1SMOA 1XGYH 4RFNC 1ZHBB 3BOVA 2CUIA 3RI5K 3V9FA 5AYQA 5IIEB 2IPKA 3C9NA 1INDL 4YWGL 4ELME 5ICXB 3HI5H 5JTWA 3EOTL 1JYNA 4LKCA 2BMKB 3ES6A 1RVFH 2XKNA 4IJ3C 2IQ9L 4PJEF 4YPJA 2C3XA 4LNVA 5CJBA 3BD4A 3BP7B 1MEXL 4XBEL 4NKMB 1VACA 5DC0A 2ESVD 4HIHB 3E2HB 4D9RD 2VH5H 1JZ4A 4Z7UE 2AV7A 2AQ1A 3O4LB 1HIML 3ARQA 5J8OA 4GMTH 4OCMC 4AENB 5L2JB 5I1IH 1H9VA 1UACL 1AO7A 3VGDA 3MCKB 3BRDA 5ADOH 4XCNA 4LF3A 4H8WL 3PWJA 5GS2H 1ZLWH 3TO4C 2VL5A 1VERA 4U1MB 3K3QA 4XNYL 1IGTA 4NC2B 2YEZA 4OV6F 5KSBA 3JTSB 1OGAB 5DD6B 1WBZB 3O2DH 4PJBB 4LCUA 4BH8A 1WK0A 4PRDA 3O8XA 4F7PA 2PTTA 4PJCE 5IGXL 5HHPB 5EO9B 1A5FH 4R96B 3CK0L 1LDSA 3WN5B 3Q6FA 2APVA 4J4PD 3PABB 4YZFE 3EW3B 1KJ2A 3DARA 3QZWG 3S4SA 4JHAH 4PJ7E 5K9OA 1N0XL 3S5LB 1ZV5A 4RDQF 1WZ1L 4MNQE 1RZ8A 3SO3C 5EO1A 3UROR 4C4KO 1A6UL 4C55A 1I8KA 1Y6MR 7FABH 1LP9F 4M61A 2PR4H 1J0KA 4OZGF 3BD3A 3RGHA 2ZPKH 3VWKD 4JM2F 4U1HB 4KKCC 1IEBB 4ZODA 3RY6A 2WM0A 4RMUA 4LLWA 3EYSL 4MDJA 1ND0A 1QR1B 3HI1B 2C3WA 2Q7YA 2AJUL 4APQC 4YAQB 2ITCB 4A2LA 2ICEA 4MCZB 4RGNE 1A2YB 1WFUA 4FZ8H 1BQUA 1UCBH 4YHMH 4TVPL 4OFVA 2DMCA 2DWEA 4P9HL 2QL1A 4L8SA 1UB5A 2P5WE 1JUFA 3GBNL 4TSCL 2ZCLL 2NXZB 5HGDB 3HG1E 8CGTA 4Z7WA 4LQ1A 4LCWE 2CUMA 3DO3A 5F7WC 2ZOKA 3EOBB 2APWA 4V1DB 2X4SA 1JZ7A 4IOIA 1IGYA 2PXYC 4Y7MA 5E1AB 3E6FB 4NDMA 1AKJA 2OK0H 4UIMA 2YD8A 5GZOC 4Y1AA 3C2AH 2MFNA 4Y89A 5D7JD 3ECBB 4OLYL 1EHXA 3LN5A 4FQQB 4POUB 4DEPB 3T2PA 4CADB 2JLLA 5IOPA 3RWIB 5EU6A 4JGUA 2EH8L 2BNQA 3MLWL 4HGMA 2I27N 4TTDD 5DSCB 3AS0A 3DI3B 4Y4KA 2O61A 4OKDA 4RAUA 4U2YA 4ZSOE 5BQ7A 4H20L 2AXGA 4HDIA 2AK4B 1CI5A 3DPBA 4DGIL 2GSIB 1P7QD 2J8UA 4YXKL 4CVZB 3K1DA 1J18A 4IRSC 3E3QC 4OKVA 4M43L 2VC2L 1VEOA 2VLME 3EO0A 5GS2D 3WIFA 2VDPL 3AFLA 1E4JA 1OTTC 3VA2C 2EDYA 2H45A 3IJSB 3INUL 3STZA 5DFVC 5T3XE 4FQJL 1OSZB 3RGVD 5E24E 3L3JB 4F7EA 5JNYA 1TJGH 5F6IB 4Z7QF 3MOAL 4C4KT 3KPOA 2L7JA 2B1AL 3LZFL 3GBLA 5J1TC 3H0TA 4M7LL 2X6MA 1W0VA 1T22B 1XF3A 1CF8H 1MJUL 3KLAB 1I3GH 1FBIH 4NNXB 5FO7B 4HH9B 4EUPG 2XA8H 1MRFL 4JVUA 4BSVA 4Z7NE 2B5IB 2OQJA 4NZRL 4X6EA 4WW1B 5CJ8A 2EIZA 4JKWA 2DAVA 1FZJA 3RWFB 1WBYA 1T0MB 4HPOH 5EU4B 4MSWB 2VLRB 3KYMB 4UIKL 4Y19A 1HQRA 3MV7D 5MP6H 4FFZH 3L5HA 2BCKA 2P49B 3DUHA 4OZFH 5DMGD 5EUOF 1F4WH 3PL6C 4HGKC 3P0YL 4G6AD 2YSSB 2G75B 3JV6B 1TZHA 4KQ4L 5FYJE 3BJLA 3HHRB 4YHLH 2W0KA 3O11B 3UTSD 1GIGL 3TH2T 3JUZA 3VXMA 3ULVL 1WCBB 1BVLB 4J23A 3RWJB 1XIWC 1QLEH 1ZHKB 3BJ91 5ANMA 4CMMA 5I1LA 1JTPA 2VLKB 3QUMH 2FIKB 2O93L 4M5ZH 3TVMC 1MHHA 3IRZA 4L8DA 3RHWF 4P5MB 2AEIT 3GMPA 4DUWA 4PP2B 1H3PH 1JHTA 4XBPA 3L7FB 3W9DB 2HMIC 2HFFA 2R29L 2WWKT 3WFCL 4F9LC 4NNPH 3MJ7B 1CFNA 4ODVL 2VWEE 5DRZA 1LEIA 2F19H 2C3VB 3L3HB 2JK5A 3QEUA 3U2SB 1QBLL 3S3SA 3FN0H 4TVSa 5FF6B 3PQYE 3SDCC 1ORSA 2R39A 1UJ3C 2QSCL 4JFEA 3MV11 5KVEH 2ZP0T 4PV8B 2BVEA 3PXJA 3MLTB 3ZKQD 2F5BH 4X4YA 1QOKA 5IROA 3L5JA 5D71H 3KJ4C 4HS8L 1XR8A 1VPOL 4U1SB 3SPVB 5LWYH 2HT4C 1JRHL 5ILTH 4IEFB 5KOVC 4D0DB 5BRZB 5C7XH 1JGLL 1H0DB 3FONA 3LH2L 5ESVA 2HT2C 4TUKL 1TVHB 4NIKB 2BNRD 2VZOA 1O5DT 15C8L 2VSCA 1RZ7H 4LHQB 2NXYC 1A1NA 4KVNH 1Q38A 3GIZL 3TT3H 2FECL 3EDEA 3GBML 4WO4A 2BC4B 1KLFA 5L0QC 3SGDI 5D1ZB 3MR9B 5C08E 5I1DB 1G7PA 5IB5A 4JKPL 1PD6A 3B9EA 4LK4A 4K3JL 2HT3C 3HE7B 5F21B 5F7EL 4X7SL 1ZAGA 1C5CH 4L4TE 5A2IH 4PJCB 3PV6A 3SBWA 3WIHH 4HV8B 1EMTH 3BGMA 3QNYA 3TN0D 2IPTL 4KI5E 5F1IA 3U6RB 5IMLB 5TDNA 3W11D 4M9OA 2E9WA 1Q72L 5EO0B 5KVGL 3KPQA 3HI6L 4LQFL 2Z93B 2PCPA 4HUMB 2WIIA 4X99B 3LSOB 5ISZA 3MRCA 4GT7A 4ZDHB 1UM6L 5D6CB 4L8BB 2FO4A 3V79C 4PRNB 1EEUA 4DUVA 1IGIL 3V4VL 1DUZA 4RGMC 3K8LA 3ARUA 4HKJB 4KK6C 5ICZB 1S3KH 1A7OH 3QCUH 4OSUL 1BJ1J 3JWOC 4KUZL 1Z2KA 2QSTA 1KJMA 3CD4A 3OJ2C 1IAOA 1MFCH 5AUMB 1MHEB 5TE7L 1FO0H 1LEKB 1DUYA 2FWOB 4KDVA 1G0DA 4FZEH 4NQDE 1B88A 5JXEA 1CU4H 2BHUA 3L1OH 1KNOB 4KC3B 5D9SA 3S5LG 3KS0J 2IANB 2ZOLA 4ZFFB 4M8QB 1WFOA 3DIFB 2ORBL 1DSFH 5D5MB 4I5BB 5EZLA 3O8XC 4TSAH 4N1CA 5J12C 4HWEH 2CLZA 1XR9B 1KPVB 3ULSB 1FZOA 2ADFH 3U48A 3X14A 3O3DA 3K4ZA 1E4WL 4QHMB 3CFIC 3VXRE 3FFCB 1IQWL 3G08B 4NJAL 2ICWB 3CZJA 2R1XA 1AFVH 1F13A 3ARYA 4NSKA 4PY7B 1NC4A 4M1GH 1MFEH 3IDGB 5F7HA 5J3HD 3OAYK 1HYRC 5D2LE 4HLZG 1GC1C 4RFOH 4KTEH 4YDJA 5E8DL 1DN0A 5ALCL 4LL9A 2AJYL 3SDXE 1T6WA 2AJSH 3MFGB 1FPTH 3CVHL 1KBGL 3HMXL 1WVZA 3EAKA 5SWZE 3U1SH 1SBBA 4UU9A 4DZBB 3O2VL 3BPLB 1R3KB 5I1HL 1BJ1H 3LN4A 2QQLH 2EDQA 1FFNB 4KJQC 1HSAA 4KHTL 5I8KL 3F12B 3RWGA 4UB0H 1MFDH 4ETYA 5D72H 1T7ZA 2Y36L 1OD7A 5I76B 4KKCD 4U3CA 1RD6A 1Z6JT 1S7QB 3IJHA 4H25A 1NFDF 3OB8A 1AHWC 1MI5E 5I1CL 4X80H 3KWWA 4LSSL 5CZVH 5CJOL 3V5DA 4APQD 1CDIA 4X8JB 1KTKE 4ZPTA 5DK0A 1HILB 4PJFE 1CD1B 3KS0H 4NN6C 5F88B 3TIDB 1FHGA 4NUJA 3CDGB 2D0GA 1FFPB 5LGHH 2RHEA 4OCXL 1CL7L 2DICA 2WNGA 4OM1L 5L2KA 3CC5B 3FQUA 3GMOB 4XNZC 1X5HA 1TNMA 3FQWA 4ODXB 5ADPL 2VAJA 2PXYD 2I5YL 4PGCA 2J3SA 4UOJA 3IAPA 1D5MA 1CG9B 3UYOD 2QQNL 4XHJC 4OV5B 1EO8H 4NQXB 5GZOD 1EFXB 1P9MA 5MEOA 5C0BA 3ZSSA 3B3IB 4LAJH 3UTTA 1FG2A 2NTFA 5HGAA 1I9IH 5E95B 5H35A 2J6EL 2W59A 4BZ1L 4JFDA 3BN9C 1G0XA 5TE4H 4PJIE 4DTGL 3O3EB 2JTDA 1JYVA 2CKBL 2PYFB 5E9DE 3FB7B 4PRPD 1NGZB 3QUKA 4WGWB 5A2LH 1A6AA 5IWLA 1JMZA 4FNLL 3JV5A 4Y16A 3OHXA 1NLDL 4N8CH 3VFVB 3VXSD 2X4OB 3LCYA 1WEJL 2ESVE 3X11A 1W72B 1QQDA 1KPUB 3LRSB 1FL5B 4BSWA 3I6KB 1UT9A 2R2EB 3LEVL 2NY3D 3FRUA 3OKDB 5E99L 1OTTD 4R26L 4YDKL 5KBNC 3C08L 1YDPA 3UXFA 1YMHB 3VG0L 3QIUB 1KB9K 2A1WL 4LARL 4LCYB 5TF0A 2ENYA 3RIFK 1QSFE 5KSUA 3WJJA 3HPJA 3QIWD 2K3TA 4O51A 4HHAB 1HCVA 3DUUB 5E4EC 5EU5B 1YEIL 3TIEB 3QPQD 3VFNA 3UEZA 3MRJA 3QHFL 2G9HB 3TT1H 1YPZA 5K59F 1RURL 5J9PB 3U9UB 3UBXI 2FSEA 2DLGA 4K55A 1GHFH 5DDHB 4LNRB 5GRYA 3GSWA 5DJ8B 1QKZL 3KPSE 4QOKE 5DJDB 4LDLB 3TESA 4WHTB 1L4IA 1BJMA 5C0JA 1YMME 5SX4I 5BVPH 1AY1H 3PL6D 2XFXA 2DIJA 2FL5B 2F58L 5C0NC 4KRPC 4XPBL 4ZFOA 5GGQH 1AXSA 4OI8A 3JWOH 5MEND 2FJGA 5E8NA 1MJ7L 3NTCL 2ZCHH 4EI5C 3LY6A 2H2PC 2C4XA 2ZKHL 5CWSA 3MNVA 3OKMA 1TITA 1UZ8A 4PRBB 3LIZH 2V17H 4H1LH 4P46A 5GRWA 2JCCB 3GSQA 1PG7W 1MCDA 5JHDB 3TVMD 2ADIB 5F9JB 2GUOA 1CFVH 1CLYH 2ID5A 5FIEA 2CJUH 5BXFB 4J3XA 1QFWM 4L5FL 1I7ZA 3QEQD 1U8PB 4XP9H 5E8PA 3WMSA 1P7HL 1I9EA 4QGYA 2R4SL 2I07B 3E0GA 5F1KC 1SJXA 1OW0A 3QWRA 1BAFL 4QTIH 3ZYOA 3WNOA 4OFKA 3MLRH 4XCEA 3IDYC 1RUAH 1PDKA 5DEGB 5JOFB 3SJVA 1FIGH 2YK1L 3BKYH 4KUCD 2A2QT 3IAQA 4JO4L 3GEWB 1I3VA 5DFWH 2OZ4L 1GC1H 5D1XC 1DQTA 1F00I 3VFSB 1EJOH 1QBMH 5KSAA 5HHQA 3P4MA 5H94B 1QO3A 2YD2A 2L0DA 2IALA 5I8EA 1KSRA 3P30L 1ZEAL 1KXVC 5DD3H 5E8OA 4P23B 4OLVH 1A1OA 2HT4D 4Q2ZB 4NHCL 4TRPL 2YD5A 5KVDL 3TA3B 2W91A 3ET9F 3FOLB 1GGCL 2BVTA 1G7MA 5I71B 3WIIL 1TNNA 2P8MA 2XWBB 1I7TB 5D7IF 2P48B 1KB9J 4X8XA 1IC1A 4IMLA 5IB2A 1Z3GH 2DIBA 2V7HA 1ORQA 4L4VE 1QBBA 5KS9E 3UTZA 1MIML 4CJ1A 3RX7A 5ACMA 4G6MH 2GK2A 2PTUA 2BHYA 4FABH 3W5NA 1QEWA 4HZLA 1GH7A 1RZIB 2PYED 2YWZA 3DSFH 4FFYL 3SBWC 1R3LB 2HT3D 2B2XL 4ZMAT 4O02H 4OUOA 4FQPA 1K8DB 4FQXB 3RDTC 1E6JH 2J4WH 4GRWB 1CGVA 3OKYA 1LD9B 5CD3A 1J1OL 4I77L 2XG5A 2WLYA 1D6EB 4XC1H 5TH2B 2B0SH 5CEYB 2HYMA 3VRIA 3NABH 4QLRA 5FYLH 1OAZL 3WCYA 4JANB 1WBXB 4JPIB 2W38A 3MGTB 3THML 5DMIH 4TPRL 3KJ6H 1RMFH 1EERB 4PFEA 2VDNH 5E7BA 5KAQG 4PB9H 4R2GB 1NLBL 1H3VA 1CFSB 4LMQE 4DVRL 5I1EH 1G6RA 1BP3B 1DVFA 4WDIB 3RRQA 1G1CA 4MXWH 5EN2B 3V2AR 1NL0L 4OI9A 3ARBA 3NCYS 3WEXB 1AO7D 4PBXA 3HZVA 5KSVA 4ZTOL 2YMXL 4Z0BL 1JNLH 3VE0B 3DOSA 4NWTL 2WQ8A 3UTSE 1CVSC 1I1AA 1VEPA 5BW7A 4XMPL 3NIDF 3HC0A 3QHZH 4JPVH 3L3OB 2EDRA 4LVOB 2FRGP 3IRPX 1YEEL 4FQIL 2VERN 4KZDL 5DTFB 4JRXA 4GAGL 1D5BB 2UWEF 3O8XD 3HNSH 5DEZA 4QRRA 1I8IA 1WJ3A 3DROA 3QCVH 4P2OC 2AXFA 3ZTNL 1YC8A 4UTAL 3PHQB 1OWRM 1S9YB 4DAGH 1JN6B 5J6GA 4QYOB 4N9OB 1W2KT 5AZEH 3OJDB 4K23L 5TPWL 5B8CC 2HVJB 3O3AA 4Y4HB 4X5WB 5IG7A 4OD1H 4HS6A 4K3DL 3VXOB 4PJIB 1LO4L 3UZEA 3D5OF 3WL9B 5LAXB 5L6YH 2DLEA 1I9RH 1TZIB 1VFAA 1A14H 4L29B 4ODBD 1FV1B 1E4XH 4HWZA 4AIZA 4UQ3A 4JM4L 2V2TA 4Q7DA 2A83A 1QLFA 4HUWA 4JRYE 4LLDB 2OTUA 1ONQA 5K93A 1T3FA 1D5XB 5EU3A 4KJQD 2AJVL 2IMNA 4IMKC 5IVZA 1QD0A 3CSYB 4WFHD 4G8EB 1U8NB 5DJXA 2X1OA 1ZA3B 1MRCH 3NVQA 2AEWA 1ZK9A 4PRIB 5FO9A 2RBLA 3OKNA 4BFBD 3BRFA 2XWJA 1FAIH 1WZLA 3ALPA 1T4KA 4ETQA 3IKCB 1I7RA 5ACZA 4KMQA 1WZKA 4TQEH 3BN3B 3EIFA 4HS3B 1EEQA 5GS1B 1DEEB 2VNCA 4YHOL 4P57B 1AKJD 1TETL 1S7VB 5CBEB 3V8CA 1P9MC 1K6QL 1M6OB 3MV9A 2EDLA 1BFTA 1GAFL 1BVKA 4XHJD 1NGPL 5F93C 3JZ7A 3LDBB 3SN6N 5FYLD 1OTSC 4DUXA 4HIJA 4MA3B 4KRLB 5DJZA 5H37G 4PG9A 2X1QA 5EU6D 1F4YH 3LPWA 2DQEH 5CINL 5EOTB 2BNQD 3HZYA 4JQXA 3X3GH 5JPMA 4WY7H 4XVSL 4Y4KD 1ZXQA 2Y7QA 1OQXA 1S9VB 2VITB 2DQHL 4LFHD 1LE9A 4ALAL 4CDHA 1UVQB 1JPTL 3T3ME 3VWKB 1UZ6E 2ADJB 3V6FA 2P8PB 3OAUH 1XF2B 3MUHL 2X40A 3VMPA 4G80A 1KEMH 1L7IL 1HHKA 3EOAA 5KOMC 3TPUA 4PV9B 2VZVA 3OF6A 1W0WA 4X9HA 4ZTPH 2I9TA 2HG5A 4UT6L 3MRDA 3Q2CA 1KN2H 5F7LB 1H3XA 4JDZB 1N5AA 3TJHC 3W2DL 5D7LA 1PKQE 5DJYA 1S8DB 3BDYH 1YECL 1F42A 3WS3B 1BM3H 2YD4A 5JR1H 5EBLA 1CFTA 1YN6A 3NIFF 1U91B 4LLQA 3D3VE 4PJGE 1VENA 3C6SA 1RUML 4RIRA 3SDDB 1CDCA 4EVNB 4YHKL 3IS0X 1RPQA 4U6HB 5C3LD 4Y19D 3RTQA 5DR5L 4HK3J 5D7JB 5D93C 4PJEA 5EPMA 4J3VA 4HXBL 5DC4B 2R2HA 4PJHF 5C0FA 5JQ6L 3GI8L 5DJ2A 3VI3F 1AJ7L 3HLAB 1H8NA 2BNUA 4L3AA 3VRLF 2CGRH 5IEKA 4X7DC 5C0ND 3D69A 1HHHB 1OLLA 1YQVH 2O5ZH 3B8SA 1OVZA 2WBJA 3P0VL 3VXMD 1BQSA 4UINH 3QZWA 3JWDC 1B9ZA 1UKTA 4G6JH 5HGHB 1BBDH 2H2PD 3K7UA 3ZE2E 2D9CA 4XNUH 1PLGL 1AGBA 3ROOB 3WXWH 4M3KB 3OL2A 1P7QB 1Q94A 1JV5B 4J3UA 4GOSA 4F8QA 3DV6B 1DN2A 1XGQA 3PDOA 2VXSH 4Y2DA 3GB7B 3QQ9C 3WUWB 4Q0XH 3DVGB 1V7NH 2ZG2A 3RGVB 4EBQH 1IFHH 3EGSA 3ZDXF 3IFOB 4PJXA 2QADC 1AQDB 2WWMC 1GGBL 4LSRH 3SDAC 3O9WA 3IFNL 2D0HA 3M07A 3RWCA 3O45B 1UKQA 3D39A 2CIKB 2DQCH 3WXVH 3OX8B 4NFBA 3MRBB 3O4OC 1IGML 4JFED 1C1EH 2HWZL 3PWLB 3REVB 1BQHA 4MJ5A 1Q1JL 1RULH 3GRWL 5KSAC 1MFAL 2HKHH 4L3EA 1ED3A 1KB5B 3HMXA 4HUXB 5KN5A 5C0IA 1SJHA 4LLAA 1R5WB 4RGOH 2O26U 2EKSB 3BIKA 4DOHB 1B3JA 3QR2A 1DJSA 3EYUH 3MV7B 4NKDA 4P4RA 1JWUA 2BDNL 5E08H 3PGFL 4E41B 4GH7B 3QT2A 3QQ4B 4L9LA 3SCMA 5KW9H 2CDFB 3AS2A 1GPOL 1R24A 1JWSA 2OMNA 2XA3A 4I3SL 4S2SB 3OJMB 1CGSH 3MO1A 3R06A 2B1HL 4O9HL 2VDQL 2C1PA 5GJTH 2Q76B 2FBOJ 3KR3H 3B4NA 5IMKA 4GW1A 2EYRB 3QUXA 3WHE1 4C56A 4TUOB 4U1LA 3RIAK 5HHME 4MLIA 1EVUA 3MJGX 2X4TA 1A6WL 1JGDB 2XI9A 1I8MB 1UKSA 1YA5A 5KJRL 2GJZB 3RDTD 2ADGB 1SMAA 2F5AL 4LSTL 4MMZC 1DANT 4LRIA 2R9HD 4WU7B 3R8BB 5DT1H 3RWDB 2VZUA 1CR9L 4KTYA 3HCVA 1RSFA 4ERSH 3H7BA 3FT3A 3CMOL 2VLJE 2CKNA 4HT1L 4WUUE 5I0ZA 1BPVA 1X4XA 4MA7L 4YJZL 5ISZD 2J6EA 5SWSD 5DZLA 5JHLH 3UJTL 3RL2A 4YE4L 3PUCA 1B4RA 1C5DB 3BKML 3H8NA 2I25N 1NCWL 2KQNA 4O5LH 1JGVH 2GJ6B 2JIXA 2R1YA 5DRNA 3ARBC 1NMAH 1KIQB 2DBLL 3GSUB 5IW6B 2IWGA 1MHCB 4EUPA 2X4RB 4JN2A 1YEFH 5DVOA 1NMBL 4F7MB 4MS8C 2VQUA 1TCRB 3MOQA 3BEVB 2XY2A 2XTJD 5B39B 5EIVA 2CDGB 2EYSB 2BNRB 2RB8A 3QXDB 2EIEA 32C2A 4BZ2L 1AD0B 3KPRE 4K7PX 5MENE 4URTB 1KTDA 4TUJB 1FVDA 3MLUH 2JJSA 4K94C 5FUCE 2AI0L 4N8PA 4XPAL 1DLFH 5IEHB 3QUYC 5HI3C 1Q9LA 1A6PA 2FLRT 1T1ZB 4JHWH 1VGEH 3MMEA 1QFHA 4JZJA 1DQDL 5DZNA 4D8PA 1XT5A 4KGJA 5SV4A 5IQ9A 1EUUA 1E27B 3H3KA 3QDGA 2ZUSA 2CPCA 4DGYL 3TN0B 3TO2A 2P42B 3BWAA 4RFNB 5FDWA 5EA0L 5AD0B 2EC8A 4YC2C 3T2NL 4FTVA 1YUHA 2W65B 4G6KL 5E2TH 1F90H 3LB6C 3RNQA 3LKRB 3I3BA 4LPTA 5JMOC 1CZ8L 4IJ3B 5EU7E 3U36A 1PAMA 3CUPA 4EKXA 3GNMH 1EXUB 2FGWH 4OZFB 5E94A 5CEZE 4FQHB 1HKFA 3G5ZB 4LRNL 3TYGL 4RMSA 4AEIL 3JWDH 2ZUTA 1K4DA 2ZSWB 2F54A 43C9A 5IT2H 1BEYH 1PGRB 1UWEL 3VW3L 1FH5L 1T04A 1FP5A 3ZKSD 3O6ML 4KKLD 3OKLB 1Q9OB 4X4ME 2VTFA 2M1KA 2XRAH 4G3YH 2OJZL 1EZVX 1RZGB 3NIGF 2NW3A 1KG0B 3QUMB 1S7RA 1CGYA 1JGUL 2EEBA 2AQ3A 3ZYJA 3QFJA 3B2VL 1MLCA 5HI4C 2Y25A 4QXUL 5JORB 2XN9E 3DYPA 3RBSA 4FQ2H 5IIEA 3BMVA 5HPMB 3QDJA 4JFZL 4NRYB 1AGFA 5EIIB 4KJPC 5EZJA 3QPXH 3BPNC 4WTXA 1OTSD 3OG6B 3ZT6A 2BMKA 2JJWA 1JJUA 4JQXC 5I75B 5FA3A 1EAPA 4JFDD 3ARPA 3BP7A 1MPAL 1NGXB 3DTXA 3F58H 4Y88A 4HIHA 1TVBA 2C1OA 3FT4B 2IBBA 1H3GA 3JSSA 5FFLA 1A9EA 2DWDB 4UDUA 4Y16D 2UUDK 3IU4L 3SO3B 3O4LA 1LO5A 2VZTA 4AENA 5FK9A 5L2JA 3EYSH 4X6BA 1JHLH 1QFWH 3GSOB 1CIDA 4NCC1 3DO7B 1OAQL 4XI5C 2WINB 1TLKA 2F74B 3CAFA 1QYGH 4TVPH 1NCNA 3P9LB 4F37F 3DSNA 1KCLA 1AO7E 3VGEA 3QEGL 2F9BT 3MLVH 3LKQA 4APQB 1OGAA 1C5BH 1RZFL 3M45A 5IVXB 3TJHD 1U8LA 3UPCA 4OZHE 2WUBL 2OTWB 5HHPA 5EO9A 4K7PH 3P73B 3TNMB 4F8TA 2GTWB 5C0DB 2ATPB 2DJ4A 3VMOA 3S88L 1MHPL 3WN5A 4IHOA 4EDXA 5I1AA 4CVUA 5F9WC 2WAHA 1F6FB 4KU1A 1BF8A 4MB5A 4OLYH 2PXYB 1FFOB 1NANI 5TDPB 3DVFA 1OM3H 4M48H 5IBLC 3EHBC 4XX1E 3SGJA 3KXFE 2JE8A 4FMFA 3WFDH 1YYLL 1NAMA 5ECJE 2Y5TB 5I15L 1G6RH 3GHBL 2IBZY 3GO1L 3W82A 3IFPB 4H20H 3HA0A 2G60L 2XZCH 1OGTB 3BW9A 1IEBA 5IVOA 3WUWG 2YN3A 4YXKH 4I1NB 4PRPB 3DRQA 1UH2A 1ZOXA 3HKFA 4CKVX 4XBGA 2Z4QA 2ITCA 3V4PH 3V4UH 2QLVB 3INUH 3VXSB 1FO0B 2GAZB 1WAAF 2OSLA 2QTEA 3PIQA 3V52L 4HFUH 4N90E 1RIHL 5HGDA 4WFHE 5T33H 3MACL 4R90L 4Z7VB 1VSCA 2EE3A 4MYWB 2NY3B 4K94H 3LZFH 4M1DL 2A77L 2XACC 3QQ9D 1U3JA 3O9WC 5DQ9B 1BD2A 1D5IH 3RKPA 3U7YL 4RWYL 4Z7WE 3IDXL 1Q0XH 1YNLL 5F44A 2E8ZA 3SJVD 5HYJB 3VXUE 1A7RL 1T1WB 3V6ZB 4FQQA 5EU7C 4CADA 1MFBL 1OAYL 4FXKB 4UIKH 3T1FA 4Y1AE 2FATH 5HHOB 1ADQH 1AP2B 3T04D 5KSAD 1A22B 5FM4A 2QR0A 3O0RL 4YLQT 4YH6A 1JZ3A 5KVFL 4ORGB 4ZQKA 2R4RL 3D2UD 5FYLE 5I18L 3AMLA 3DGCR 4FS0A 4YXHL 4JM2C 2VDML 2V9QA 5IBUB 3QNZB 1FNGB 3QIBC 4NCDA 3S37L 5EU6E 4YQXL 3KGRA 3IDUA 2GSIA 4G8GE 2XZAL 5CEXA 3PL6B 2H9GB 2W60A 5LG1A 5HYSA 1NFDA 3Q3GB 4QEGA 3EYQC 1T5XB 3EO9H 3VXNA 4QNPE 2X44D 4DVBB 4TVPD 4DKFL 3IJSA 5FDYA 3R0MA 2J8UE 1OSZA 4NYLA 3KLHC 2A74B 3MLXH 2A73B 2BOCA 2YXFA 3EJYC 3IFLL 1S7SB 4S0SD 1J9CT 1LO0L 3BP5A 4PJBF 2WUCL 2R29H 3TVMB 4LRIC 1PYWB 2VKXA 3AB0C 3VFTB 3RA7L 5IESH 3I3EA 4NNXA 3SKOA 4HGWB 5FO7A 4DW2H 5SWQB 3MJ9L 3QEQB 1VA9A 4OZIE 2CLRB 1PVHA 4XNMB 3E6HB 4JQIL 1T0MA 2X9XA 2V7NB 1H3WM 4AQ1B 4AEHL 4MSWA 2X1WL 2UUDH 1QA9B 2HKFH 3RUGA 3WLBB 5B39G 1N8ZB 4P0DA 4QRPA 3T0DA 2A6DB 1MIEL 3MV8E 4HS8H 1X9QA 4WI7A 3LKOB 2DDQH 1JRHH 2YSSA 1UJ3B 4PS4H 1N7ML 4U33A 3P40A 4Y19E 4HWNA 3MUGB 5LQBH 3ARBD 4X9FA 2WIMA 3KJ4B 3O3BA 2EO9A 3FFDA 15C8H 1ZANH 1H5BC 1KPRB 1JL8A 3GIZH 2V2XB 1ZHKA 1MCPL 2FEDD 2FD6H 5HYEA 1U0QA 4AG4L 3MRHA 2FIKA 4NZTL 2YKLL 3VXME 5L8LB 1RY7B 1QVOB 2IJ0C 1IM9B 4BQBA 4M6MH 4Q9QL 4X6CF 5BJTB 4K3JH 2NXYB 5DUBA 4JRXD 4LLUB 3W39A 4X7SH 3MA9L 1NFKA 1L0YA 3L7FA 3N9GL 4MQSB 2AEPH 5L0QB 1NCBL 3LPFA 2XIDA 4GSDL 1EEYA 1UYWL 4XPHH 5J1AB 2NNAB 3EOYG 1MOEA 2PYEB 4DKDC 1JHKH 2CIIA 4Y5VA 3V0WL 1A3RL 3O3UN 4PJAF 1AIFB 2OL3A 4LPYA 3C5ZA 1PW3A 4OZFG 2C3VA 3L3HA 3C09C 2R23A 4N0UA 3U2SA 3I85A 5FF6A 3HI6H 4RFEA 1WIUA 4J1UA 3V7AG 3HR6A 1PEZA 3C9NB 1MCIA 1UM6H 2AQ2A 2CO6B 2KPNA 4N0RA 2OXGA 3PDGA 3G9VA 4WW2F 3UCRA 3U0PA 2YN5A 4LKCB 3NPZB 3TCLA 3PF2A 3ES6B 2XKNB 5D6DA 3UC0H 1OARL 1CD9B 5BRZA 4JGMA 4M62H 2FR4B 1SJVA 1HHIA 5I73C 4I13B 4X9GA 5D2NE 3BSZH 4KV5E 3FB6A 2DB8A 3QG7H 4RGMB 4UOW1 3BAEH 5TE7H 5I9QC 2AV7B 4I4WA 1JPGA 1H15A 4OF8A 3T2OA 1OCWH 1JFQH 1FL3A 1KENH 4XAWH 4LLMB 5D1ZA 1HHGA 1AO7B 5A2FA 5HDQL 2E7LA 5CILL 4TULL 3PWJB 3V0VA 3KPPA 1G84A 2VL5B 4H1LB 1A7QL 1R3IL 2IGFL 4DZ8B 4HV8A 1CGTA 2YEZB 1RFDL 4OQTL 5KSBB 3X12B 2C3GA 3N0PB 3SQOH 4ONOA 5L9DL 4N0YL 3MV9D 4Q9RH 4LCUB 1Z9OA 3RHWK 1QFUL 3O8XB 4PRDB 4F7PB 3UAJC 1ZLSL 1M4KA 4M6AA 5J12B 4KJPD 4EEEA 3ARDA 3H7LA 3Q6FB 2AJYH 1EHAA 5D6CA 3GRWA 1BQLL 3HI5L 1KBGH 2ED9A 5K9OB 3HMXH 1FYTD 4PRNA 5FHBH 4F7TB 5CBAB 1ERNA 2PKDA 1RVFL 1CGWA 3OKKB 4K8RC 1TPXC 4LHUD 1G7JB 3I3DA 3QDAA 5ISZE 2P1YA 4AEEA 1RZ8B 1T66C 1A7PH 2XY1A 2X4NA 1HWHB 1I8KB 3T0XA 2K1MA 4QXWA 2Y36H 1AC0A 4M61B 4GW4A 5CSBA 4GUPB 2VH5L 1LEKA 2FWOA 4KTDL 2QQKH 4XMKH 3OF6D 4GMTL 5H8DA 4YEEA 1N5YL 1MAMH 5I1IL 3BPCA 1KNOA 2WQRA 1ND0B 5ADOL 5AZ2H 3PGCA 5FXCH 2IANA 2Q7YB 4JFYB 1AHWB 3DIFA 3I9GH 2RIKA 4EN3C 3IDNA 2ICEB 1A1MB 2VXVH 2HH0H 1YEJH 3QH3A 4OCXH 3LS4H 4OM1H 5D7LD 5F3HB 1CLZH 1MCSA 2DWEB 3C60A 1KPVA 2Z91A 1JUFB 2UZYB 2VYRE 1FDLH 4POYA 3ZKMC 5GGSB 2ICWA 4M6OH 2W0FB 3O2DL 4AL8L 4XNQA 4ELMF 4CGTA 4IOIB 3HE6A 4FG6C 1D6VL 3QAZB 4XNZB 3VGGA 1RHHA 1AKJB 3CX2A 2E7MA 3T1WA 1YEGH 4N1HB 3F62A 4KFZC 3SGJC 4KHXH 1KB5L 1P69B 4JHAL 3EHBD 5IBLD 3LN5B 4YHYB 4Z7UF 5IOPB 1R3KA 2N4IA 4LVHC 1HNFA 3B9KC 2BNQB 5K9QI 5CD5C 2WBJD 3B6SB 4EUPH 3F12A 5DZOA 2H2SC 7FABL 2PR4L 4Y4KB 2ARJQ 4LDOB 2ZPKL 2BY2A 1B2WH 4RAUB 5HDBE 2F53D 4LCIH 3VFMA 1E4XI 2JJTC 2DL9A 3RJDA 3U83A 4RBPK 1NPUA 3QQ3B 4ZXBA 1CD1A 1K2DA 2NY2C 3MLYH 4OKVB 3TIDA 2BZDA 1F3JB 3EO0B 4LARH 5DHVA 4JREC 3CDGA 2ZUQC 1MAJA 4Y2DD 4XP5H 4YHML 3NZ8B 4PJCF 3CC5A 3STZB 2UWEA 1QLRA 4K2UL 4ODXA 3ULUC 3FZUC 4GRMA 1U8OA 2VJXA 1O7VA 3O9WD 4OZ4B 5IBUG 4YZFF 2NX5D 1CG9A 3H0TB 3D39D 1W0VB 4PJ7F 1XF3B 5L2KE 4XB8A 1FNHA 1DANU 5E4EB 2OK0L 4Z18A 3WFBH 3WS6A 5SX5K 4L3ED 4X6EB 2E6PA 5C0BE 3DRTB 1FZJB 3UTTE 3O3EA 3SKNA 5CZXD 2PYFA 3FB7A 1TVDA 5DGQA 1X5IA 1U8IB 4JM2D 5C6WH 1UWGH 2BCKB 5T1KA 1RZKC 3MTRA 3SCMD 1TZHB 2J12B 1DBAH 4HKZB 2BVQA 2ZKHH 5IW3A 4H0HB 1KPUA 4PJDB 2NY6C 1ZWIB 3I6KA 3VXMB 3OKDA 5MERB 5BV7C 3V5HA 3QUXD 5E6YA 4EI5B 2MQ0A 35C8H 3ORJA 4C56D 5I1LB 5ANMB 4LCYA 3KLHD 3AY4C 5T5NG 2XG4A 4PD4K 3O2WH 1C8PA 1DBJL 4PREB 1IQDA 4WFFE 1MHHB 4L8DB 3C8KA 3K8KA 1TJGL 2VXQL 3DUUA 4L4JA 1S9XA 3GMPB 3TIEA 5FECB 1JHTB 2XXCB 4I0PC 2HFFB 2G9HA 1RK0B 3T0EE 1CF8L 4C83A 4HJ0C 4G8IA 1U95A 3U9UA 1CFNB 4UV7H 1LE5A 2B4CC 3DXAE 1I3GL 4NKIH 5DRZB 1FBIL 1LEIB 5DDHA 4G5ZH 4JVWA 5EOCJ 2XA8L 3QEUB 1RUPH 1YPZE 1ORSB 3IDYB 1YEDA 4HPOL 3TP4A 3ESUF 4JFEB 2ZNWA 3DETD 3G04A 5B3JE 1MFNA 5E7FA 4X4YB 5MP6L 4K8RH 4QRSB 2HJKA 4FFZL 1JBJA 1F4WL 1S7UA 43CAB 1LK3H 3QO1A 5J1SC 4JFOA 5ESVB 4YHLL 2V2WA 4QWWC 3BHBB 3HC4H 1XMWA 1NGQH 3E8UH 2AJZB 5DWUH 2JCCA 2FCBA 1EUTA 3TGXA 2ADIA 1A1NB 1QLEL 4O58H 4OTXH 2W9EL 5C0CD 2QEJA 5FYKU 4K9EC 3QUML 4M5ZL 2IADB 1A8JH 1G7PB 1U8KA 1JCKA 5IB5B 2MCPL 2R0KL 2FZ3B 4PJ5A 1XH3B 4P2QD 2NY4C 4KAQH 2C9AA 4NBZB 4Z7NF 4LAQH 2DN7A 3QNYB 3RDTB 4QRQB 3TV3H 3WSQL 4NNPL 5TGBB 5DEGA 5JOFA 3GI9H 5TDNB 2VXUL 5DVNA 4LGPB 5EOCH 1XCTB 2F19L 4FTVD 1QHOA 1UM4H 3KPQB 3VFSA 3FN0L 4XWOC 2EIDA 4ZAKA 2PCPB 1NAMH 5D6DC 4D0BA 5KVEL 3MRCB 5SWSB 4P23A 2F5BL 4Q2ZA 4RBPH 1FGVH 2VXTH 3MRMA 4XB7A 3S36X 4H1LG 5D71L 4P59H 1I85A 4YHIA 5TE6H 5LWYL 1E4KA 1DUZB 5ILTL 2XWBA 2FX8H 2AVGA 2F54D 4TSBH 4PD4J 3NFPA 4ZTOH 5IR1A 1KJMB 1NJ9B 5AYUL 1J0ZA 3GMMB 4K3HA 1RZ7L 1DBKL 3QJFA 4QRTA 4KVNL 3TT3L 1YEEH 1XCQA 3LEYH 3STBA 5C2UB 3JVGA 4HC1L 2XTJB 4GAGH 3MX0A 4XXCA 1F3DJ 4U31A 4FQXA 1K8DA 4JEGB 1FGNH 2ZOLB 3IAGC 1GGYA 2ARJA 4TVPE 1X5XA 1DLHA 5SX5H 5EZLB 1C5CL 3QDJD 4B41A 1HOCB 2CLZB 3N50A 4JG1H 4PJ8C 3ARDC 3WIHL 1FZOB 1EMTL 1D6EA 3UTPD 4JLRA 5TH2A 3QA3B 4KK9D 4ODTH 4K23H 1WFTA 2J5LC 2R1XB 3OZ9H 4JPIA 3QRGH 4K3DH 1T7XA 3DV4B 2EDDA 4YDJB 4HW6A 2OCFD 1DN0B 1A02N 1CFSA 4NQCB 4JM4H 1CXEA 5C2BH 2EEAA 4K8RD 3U30B 1YY8A 1C7SA 3VA6A 4UZGA 3O4LD 3QO0A 4PRHD 5EORH 4NKOB 5CIPB 5HVFB 1A7OL 1RZKH 1IJ9A 1HSAB 4XPGH 3CVIH 1MFCL 1G6VK 3FO2B 3MBXH 2FIRT 3IJHB 4H25B 1T83C 3V95A 4X6FB 1FO0L 3JUYA 3VJ6B 3KWWB 3ROLA 5BV7H 1KYOJ 4FZEL 1OGAD 5C9JA 4ZPTB 3TCXA 4EN3D 1CU4L 1F3DH 5DK0B 3C60C 3IDMB 1D5BA 2FHCA 1LO2H 2BRRH 1TENA 3L1OL 5E6IC 3WKMH 1BGXH 4PGEA 3F7RA 1A64A 2RFXB 4KI5F 4NRZB 1DSFL 2IFFH 4GQ9H 3KHQA 5FKAA 5F7FA 4TSAL 3F65A 3HE6C 4HWEL 2C7UA 1S9YA 3FQUB 1JN6A 4YHPB 2ADFL 3FQWB 3P77A 5EOQH 4I18C 4QRRE 4H5SB 3OJDA 4PGCB 5ETUB 2HVJA 4Y4HA 1AFVL 1I75A 2B4CH 4U1GC 5ID0A 5MEOB 4M1GL 5CINH 1MFEL 3WL9A 5LAXA 4MD4A 2NTFB 4LFHG 4RFOL 4KTEL 5H35B 2QKIA 1F11A 1FV1A 4GG6E 1HQ4A 1T21A 5F7KC 3KAAA 5C0AE 1QUNA 1FPTL 5FCUH 4BUGA 4JFDB 2K9UA 4NZJA 4PG2A 3X13B 3U1SL 1D5XA 1OQOA 3P0GB 3B9KD 5CD5D 1NMCC 5F9OL 4X6DE 2H2SD 4ALAH 2QQLL 2HN7B 4JVPA 3QUKB 1U8NA 3LV3B 1N0LA 3E1F1 1CFBA 1ZA3A 1A6AB 3GKWH 4M4PA 4RMQA 4UB0L 1MFDL 4ZXBC 4PRIA 5D72L 3S36H 4Y16B 3QXUA 1L7IH 9CGTA 3TC9A 4ODHH 1M7DA 5DMJB 4XVJH 3EBAA 5INCA 1KT2B 3X11B 3ULVE 5CZVL 1X7QB 3IKCA 4BSWB 4IBLT 3FRUB 1FCGA 4K9EH 1YDPB 4HS3A 3S97C 2EDBA 3T4AA 1BD2D 2DBJA 2AKRA 3OGCB 2A0LC 4P57A 3NCJH 3FZUD 1CD0A 1L0QA 5KSUB 3QEHA 1S7VA 5CBEA 5LGHL 2OL3H 1RUMH 5D2LF 4MJIE 1JI1A 1U41A 5ICYA 3BPOC 1U93B 3KPMB 4OT1L 3SDXF 5DS8A 1EO8L 4HK0B 1YPZB 4OCLC 1SHMA 1I9IL 1PZUB 3AS3A 1KXQE 3LHPH 5JQ6H 2FEEI 3TPKA 4Y5XC 5L8KB 5TE4L 1TTGA 3FO0H 4MA8H 5D93B 1S9VA 3OSKA 5C0JB 3P0VH 4OCYH 4LPXA 3MZGB 4NPYB 4ZO6A 3I50L 4I2XB 4ZFOB 2P8PA 4FQ1H 4P2RE 1MCJA 4PJFF 5CGMA 2FJGB 2NY6D 5E8NB 4N8CL 4MJ6A 4P9HC 4KJYB 5CWSB 3MNVB 3FCTB 1BWMA 5GS3A 1UZ8B 3B2UC 4OD2B 2X4UA 1EV2E 5D7SH 4HIIA 3GIVA 1QBAA 2OI9C 2YA2A 3D0LA 4JN1L 5DQDH 4UV4L 4HUKB 4Y0GA 4OQTA 4I0CC 3IFNH 3EJZC 1QSVA 1I7ZB 5H2BB 5A1AA 4ZO9A 1G7LA 1J0JA 3SDDA 5D7LE 4P5KB 4S0TD 4X7TA 5E8EA 4HJ0D 4W4OA 1E28A 1MQ8A 3SKMB 2QADB 4U6HA 3TT1L 1FQ9C 4QRPD 5T1MA 3I75A 4PJIF 1MFAH 4XCEB 4OCNC 5D7JA 3SJVB 3SGEH 3K81A 3O4OB 4OM0H 1VKXB 1MJ8H 4X5LA 3HLAA 5KSAB 3P4MB 1S5IH 4RWHA 1JYWA 4UNUA 4GG8B 1CDJA 5I8EB 2X1PA 4BJLA 3D2UB 4OBRA 5GGQL 5HGHA 1G7MB 5IB4B 1KGCD 4HAFA 3JWOL 2B1HH 4O9HH 3VCLA 2ZCHL 1K9TA 4F33A 4IMLB 1IEHA 2V7HB 1P2CA 2Z9TA 1JV5A 3UTZB 3LIZL 2V17L 5EWIH 3BE1H 2Q8AH 2DMKA 4JR9H 3GB7A 4OCWH 4NNYB 1U8JA 3AMKA 3NA4A 1NQBA 1QEWB 1CLYL 2BJMH 4HZLB 4OF6A 3IFOA 5C0EA 5E1HB 1AQDA 5A3ID 2CJUL 4PLKC 2NY4D 4YHZH 1D9KA 3O2DA 3C5ZD 4XP9L 3O45A 1R6VA 5ERWB 4MWFA 4X83A 3MRBA 1DL7H 3IDJB 1MCOH 4HT1H 4DK6A 4PJXE 5CD3B 4G9DA 3ZE1E 4QTIL 5F7YC 1X5GA 3VGAC 1GVIA 3MLRL 1NH6A 1CS6A 3UJTH 3KG5A 1RUAL 1KB5A 1FIGL 2D7NA 4XWOD 3HRPA 1GC1L 1R5WA 1U3HA 4YBHA 1I85C 3P9WB 1EJOL 1QBML 3MV7A 3HUJB 2GI7A 2ZJSH 3NN8B 3NPSC 4L3EE 2R0LH 1O7SA 3AAZB 1G6RB 3QXWA 4FXGA 5DD3L 2HAZA 4E41A 4OLVL 1MVUB 5LCVL 5GXBB 3FJTA 5IW1B 3DBXA 3GGWA 1IC5H 4KKBC 4S2SA 3ARBB 1AI1H 4LIQH 5D1ZD 1SYSA 4HIEA 1S9WB 1J12A 4B0MM 4BZ2H 2BVYA 1Z3GL 3UDWC 3U0TA 3JVGC 3P9MA 1WAAA 3W9EB 5DHVH 4TUOA 5EC1A 3LKSB 4PJ9A 4G6ML 1JGDA 4FABL 2ADGA 3CNKA 3CFCH 1IGFL 4JRXB 4WU7A 4O02L 3ARFC 3RWDA 5I6XC 1E6JL 2FNBA 1I8IB 2D9QB 3ARDD 3DROB 3NFNA 3V6OC 2V5YA 2AXFB 5HDLA 5J6GB 4H26B 4R6UA 1FJ1B 3NABL 1HKLH 4ZOAA 1T2XA 5I1KL 3VDAA 3OR6B 1YNTB 5DMIL 4JB9H 3KJ6L 2GJ6A 5C07A 4YBLC 2VDNL 4YC2B 2XQYK 4G43B 4PB9L 4DWHA 3DI2B 4XPTH 1MHCA 1KLGA 1VFAB 1NUGA 1FC1A 5FGCB 4UQ3B 3T08A 2OBGA 4ODWB 2V2TB 4GRLC 4MXWL 4AEIH 2OTUB 1ONQB 4YR6A 3RPIB 4F7MA 1T3FB 3N1MC 5KS9F 5EU3B 1JRHI 3TZVA 1YNKL 2Z0BA 5EH1A 5IMMB 2EYSA 2H8PB 3P4LA 5IVZB 3MXWH 4PUBH 3MBEA 3PP4H 1HHJA 5DJXB 1ETZB 2OJZH 5FO9B 3H9HB 3OKNB 1G9EA 4MNGE 3S96A 4LLVA 1NUDA 3C60D 3EYFB 4LGRB 3QHZL 4JPVL 5E6ID 4NKQB 4O00A 4ETQB 5ACZB 5IJKA 4HMCA 1DR9A 3O81A 5LVEA 3TLRA 2VMFA 3HE6D 2PN5A 1FNSH 5F6HJ 4I3RL 3QCVL 2MOVA 4LEXH 4OLXL 1JTTA 1CDBA 4BFGA 3TN0A 1VGKA 5AD0A 2YRPA 2Y72A 3MV9B 4HZAA 4DAGL 5BS0A 1BVKB 1IT9H 3WDJA 5L88H 3GHEH 4EOWH 5AZEL 2BY3A 4NC1C 4HUVA 3BPNB 2LVEA 3QDGE 4HIJB 3OJVC 1CLOH 4OD1L 3HFMH 1MCBA 5DJZB 1HSBA 4P4KA 5L6YL 2QHRH 1ZSDA 5JPMB 3AM8C 1FYTB 1HNGA 1A14L 1EXUA 1J0HA 2ERJC 4AT6A 3T09A 3IT8D 3CXHK 3G5ZA 2CO7B 1GJIA 4LHUB 2D4FA 5DJCA 1MUJA 2ZSWA 2Y7QB 4UTBH 1OAUH 4ZXBD 1LE9B 1A7BA 4KY1H 4P48A 3A6CL 2YUVA 2PW1A 3V6FB 1MRCL 3DWTA 1RZGA 3B43A 4G80B 4JFFB 1HHKB 3TPUB 2F54E 1HEZA 3C6LC 1KG0A 3QUMA 2I9TB 3TO4A 3CMGA 4R4FL 5IK3B 5C6TL 3MRDB 4F80A 2APBA 2WUBH 3TBSB 4ZUVB 4Z8FL 1SBSH 1N5AB 1CDYA 4TQEL 5HPMA 5D7LB 2RAMA 5DJYB 5FKPB 5EIIA 4PJAA 4MXVE 3HNTH 3G5XB 2DLFH 3QFJE 2XYCA 5EBLB 1CFTB 5ESQA 1HH9B 1CIUA 2HLFC 2Y07H 4LLQB 1WIOA 3C6SB 4RIRB 3UZQA 5F9WB 3NCMA 1WTGT 5JPNA 2ZWLT 5I0DA 3ZKXB 3GHBH 1F4YL 2DQEL 2KZ1B 1OAKH 4PJEB 5EPMB 4Y2OA 3X3GL 1XF1A 3W0WA 5LGKA 5T1KD 2G60H 3AXLA 5C0FB 3SDYL 4QHNA 5FYJU 5HDOA 2AGJH 5DJ2B 2FHFA 1SVCP 3CFKB 5IEKB 3OPZL 1QFPA 3GSOA 4I8DA 2WBJB 5JW4Q 1S78C 4R3SB 2WINA 2F74A 4W70A 3O4LE 1JF6A 1WSST 2F53B 3OAUL 1RIHH 1KEML 3MACH 1AGBB 4HC1A 3SOBH 4APQA 1MCCA 4AIXA 3BUYA 4ZTPL 5FA4A 5IVXA 3REWA 4M1DH 2A77H 1P4IH 2OTWA 1KN2L 2Z92A 2OLDA 3CLEH 3D85A 3TNMA 5C0DA 2GTWA 4RWYH 1XGQB 3PDOB 2VN7A 4Y2DB 1OGAE 3Q6GL 3EJZD 3BDYL 4HWBA 4D0CA 3QQNA 1YNLH 1BM3L 2DQDH 4HIXH 1KUMA 1U8MA 2PXYA 3O9WB 3LS5H 3WJLC 3RWCB 1J8KA 4M1CC 2NX5B 5HI5C 3D39B 1KCUH 2OR9L 1ZHLA 1SY6A 3L3IB 4W6XB 1DQJA 3CXHJ 3SGKA 2R56L 1QRND 5CUSH 4YX2H 4YXLH 5KVFH 1HYSC 1EAJA 5EFIA 1BQHB 4MJ5B 5ACLA 2R4RH 3MRFA 3QXVA 1ED3B 4L3EB 5MEPA 5KN5B 1OGTA 2LQRA 2PO6C 4WUKH 1CDHA 3T3MF 1LP9B 3HRZA 1UZ6F 3IXTA 2CGRL 4OZGB 2PETA 4J3SA 1SEQH 2B8OT 1JWUB 4JM2B 1YQVL 2O5ZL 3KHOA 4UINL 1A6TB 1IKNC 4G6JL 3AVEA 4L9LB 5FEBA 5IJVB 3VXSA 3BO8B 1JWMB 1R24B 1JWSB 2GAZA 1BBDL 5CP7B 4IRSA 2F8VA 3MO1B 3WXWL 4Z7VA 4NQEB 3VH8B 2C1PB 4S1QH 4WENB 2UZIH 1GRWA 2E6QA 1UFUA 3UO1H 4PJ5D 3QUXB 4C56B 3RJQB 1I7UB 5HPOA 4KK8C 4PJGF 2APFA 2X4TB 3TEUA 2VXSL 1CWVA 4F37K 3QI9C 1V7NL 3KYKH 4ELMA 3BDXA 4K3GA 2CUHA 5HYJA 4LSRL 3ARZA 4JQIH 3AB0B 3V6ZA 1MF2H 5GGVH 3VFOA 3OGOE 3KNBB 3MA7B 2OYPA 2DQCL 3JBG7 3WXVL 4GAJH 4ZAKD 5HHOA 1AP2A 4YFLF 1CXKA 3FT3B 1Z5LA 1C1EL 4Y5YC 4LEOB 1I8LC 4Z9KB 2DQFB 1RULL 2IAMC 4QXTA 1V3JA 2HKHL 3C2SA 3S98A 1QG3A 2BK8A 2CK2A 1BX2A 3IJYA 2MWCA 4KKAD 4EXKA 5I66A 3FT2B 2YPLD 1HI6A 1F97A 3EYUL 2H9GA 3OQ3B 2VAAB 5DRNB 4B5EA 3ZE2F 2LU3A 4QHKJ 5HVHB 2ED8A 2FJFB 3FTGA 4KKBD 4HEME 2AK4E 4AG4H 1N6UA 4ENED 4DVBA 5T5FH 4QTHB 5KW9L 1P6FA 2FB4H 2YKLH 2A74A 4NZUH 1H5BB 2P5EB 4PBVC 1CGSL 3H9SB 1XIWA 5HYIA 3UYPA 5SV3A 3BISA 1H3TA 5GJTL 4YDIH 3KR3L 1NCBH 1PSKL 1A7NL 1KTDB 1FVDB 2XPGB 5GGSY 1PYWA 5C0CB 1AD9A 1N2RA 4GXVH 1K4CA 2EIBA 1J11A 1X5KA 1A3RH 5SWQA 3QEQA 2VDOH 1IAKB 4N5UA 2CLRA 1I1YB 1F2QA 3F6LA 4JZJB 4P2QB 2OR8A 5DI8A 1INEL 1PZ5A 5DT1L 4D8PB 3OG4B 4XXDA 4D9LH 5JDJA 4ERSL 4RAHA 5F1NA 3P3YA 3C09B 5JW4M 4IIQC 4UILH 5EBWB 5E2UH 5FDWB 3SDCA 4FTVB 4U6TA 1GZPB 1WWCA 1MWAA 5JHLL 2VLRE 1XGPB 3RUGE 4QRPE 5J6HA 5EUOB 1WLHA 4XCCL 3RNQB 3RX8A 4O5LL 3ARSA 4R8WL 1JGVL 4ZS7H 3TZVC 1NMAL 2R15A 4FP8H 3CUPB 2VIRB 3MNZB 5E94B 1JI2A 5I73B 3MBEC 4ODUA 1YEFL 5I8CA 1FRGH 5I8OH 3WNLA 2P5WA 1K4DB 1IM9A 2E9BA 4TULH 5C71A 43C9B 1L7TH 1PBYA 3EDDA 1T04B 4LCWA 3PWUA 4P5TA 2VLKE 5ID1A 4WTZG 3MXVH 3X3FH 4KZEH 3L3GA 3MLUL 3BIBX 2NNAA 2NW3B 4LSQH 1DLFL 1S7RB 5JXAH 4IRZH 2DYPA 3A6OA 1MLCB 4JHWL 1VGEL 2W07A 3UPRB 3PV7A 1JPST 2HJLB 1Q8MA 2Y6SC 4LHUG 4Y4HD 1IC7H 3HNVH 3QDJB 1AGFB 5EZJB 3VU2A 1BQLH 3L3KB 2XNAB 2YPKA 1TTFA 1NFIB 4EIZC 3PG2A 5HHXH 4P4KC 1DP0A 1GOHA 5FA3B 4LSPH 1DZBA 1EAPB 2FR4A 3G6AB 4NOFA 5E2TL 1F90L 1S7WB 3DTXB 4HBCL 3GMRA 1JZ2A 1TVBB 2C1OB 3I2CH 4ZFOL 2DM2A 1A9EB 3GNML 1ES0B 2FGWL 4PRID 4UDUB 5BRZE 4KTDH 5FYKH 5HXMA 1B0WA 1LO5B 4LLMA 1N5YH 5FK9B 4PRHB 4X6BB 2Y06H 3JWDL 5IM7A 1KC5H 5IT2L 1BEYL 1XAUA 4YBQC 5AWNH 2H32B 4H1LA 3C6LD 4DZ8A 4MQTB 2XRAL 4G3YL 2DTML 5HHNA 1CD8A 3LKQB 2VDRH 3NGBC 3X12A 3UTQA 3DMMA 1F6AA 3G5VA 4EN3B 4AL8H 1QZ1A 3QDMD 1U8LB 3B5HA 1D6VH 2R1WB 5BO1H 1R3HB 2GIYA 4J12A 4FQ2L 4IHOB 4EDXB 5I1AB 2HLFD 2CRMA 3QPXL 2B7DT 4FHBD 4WW2C 1OSPH 1KB5H 2FEEL 1NDGB 2WK2A 4F7TA 4DN4H 3X17A 5CBAA 2YWYA 3OKKA 4JFHE 1G7JA 3MLZH 4JQVC 4LBEB 1NAMB 5DC9B 4KMLB 3F58L 1OY3B 1B0RA 4GUPA 1G9MH 3KPLB 3RZCC 3BW9B 3FRPA 3B9KB 1EEZA 2H1PH 3I02A 3NCCB 1IGJB 2EKJA 3CFDA 1JHLL 1QFWL 2RGSA 3DRQB 1W8NA 4JFYA 1AHWA 4XBGB 2Z4QB 1VB9A 2AABH 5IFJB 1A1MA 5F3HA 1QYGL 1PX3A 3MRRB 4FA8A 2OSLB 3PIQB 4K2UH 5DURD 5I2IB 3MLVL 1BQHG 2IANE 4RDQG 1CGXA 2D7QA 5GGSA 1C5BL 3RVWD 4XHQA 4A6YB 2X4PA 2W0FA 2ZUQB 3B9VA 5D5ME 1EGJA 3SDDD 2C4FT 5J13B 4K7PL 3PQYA 1BD2B 1MCNA 1BZ9A 4CVXA 4CU6A 4ZO8A 3FFCE 4HX1A 1BZ7A 3VG9B 3LN9A 2P47B 3NCEB 1I3RB 4HMEA 2H6PA 4M1CD 1DCLA 3SGKC 2E7BA 2D7PA 5FOBB 3UTOA 1JNNH 1OM3L 3BZFA 4M48L 1NC2B 5E2WH 3T1FB 2FX9L 3WFDL 3VH8G 2QR0B 4PB0H 3B6SA 4X0KA 2PF6A 4ZQKB 1G6RL 5C86A 5F9DC 2PO6D 1CQYA 1AE6H 3GJEA 2I9LA 1KOAA 5DJAA 2NZ9C 2XZCL 5FYKD 3G6DH 4O4YH 5F3BB 4NO2A 5CEXB 3QQ3A 5JA9A 5C08A 2W60B 3G6JF 5HYSB 4XWGH 1MSPA 1NFDB 2FJHB 5IVNA 1F3JA 1HE7A 5GS0C 1EX0A 1WC7A 3GK8H 3VXNB 3N1GC 3V4PL 4MA1B 2NY6B 1DBJH 3V4UL 3NZ8A 4E9LA 5EBMA 4OZHF 2H26B 5T3ZH 4NYLB 2FHBA 4HFUL 1N64H 2BOCB 2VXQH 5BV7B 3CPLA 4RQQB 4YGAB 5T33L 2X42A 4OFPA 4OZ4A 1D9KD 4ISVA 1NCCH 2XOTA 3BP5B 4K94L 4FQLH 4R0LC 4KK8D 1MCWM 4N9GA 4GMSL 4DFIA 1J1XH 2QSVA 3QI9D 4Q6IC 1D5IL 2E6JA 3LRHA 1NEZB 5BOPA 4EDWH 3SKOB 1Q0XL 1IZJA 4I0PB 1WIPA 3ZSTA 4XCFH 4IRJA 1N59A 4XAKD 4BQ6A 3Q5YA 3DRTA 3CDYA 1U3HD 5I30H 2JB6A 2D0FA 2VOTA 2E7CA 2FATL 3RUGB 2LAAA 1ADQL 3I84A 1U8IA 4QRPB 5GGRA 1BLNA 4E41D 2QBWA 1RI8A 4X4XA 5KZCD 3NFSH 3LPGA 4HKZA 4GAFB 1OP9A 4YDVB 4PJDA 3O3BB 4C54A 1ZWIA 3FFDB 1CICC 5MERA 1CK0L 4EI5A 3HE7C 2W9EH 1CFQA 3EO9L 4PJ9D 1PG7X 3MRHB 5F89A 3UYRH 3MOBH 4PREA 4ONFL 3O41B 4EQ2A 1KCVL 3K0WA 4HKBA 3MLXL 2MCPH 3VXRA 2R0KH 2P44B 5DUBB 3W39B 4Z7WF 3FB5A 5FECA 1GL4B 4DJMA 3R4DA 1PX4A 1ACYH 5DK2A 1EEYB 1RK0A 1G7QA 1FNAA 3WSQH 4OF7A 4M7ZC 2CIIB 2VXUH 4Y5VB 3OKOA 5IESL 2NY4B 2VDLH 4MB4A 2LE9A 4BFEA 4DW2L 2OL3B 3C5ZB 4IM8A 3GFUA 3D6GA 2R23B 4N0UB 3WNNA 4U1NA 4RFEB 4J1UB 5I1GH 3VGFA 3ABZA 1N4XL 3MREB 4WI4A 5JZ7C 2HKFL 2GJ6D 5C07D 4ZPVA 4MVBC 5D1XA 3CSGA 4QRSA 4KK5D 5CSGA 4XZUA 3KDMB 3LKNA 1TZGH 2OMBA 3U0PB 1I4FB 2Y5EA 3TCLB 2DDQL 1JPFB 43CAA 4JPWH 4PS4L 2DQTH 3WHE0 3SGEI 4RGNC 3TZVD 1G9NC 1HHIB 5LQBL 4QNPF 1I9JH 3BHBA 3TBVB 4KROC 4PJFA 2AJZA 3DYOA 2J8UF 5AYUH 3SE4C 3MBED 3FB6B 4IS6A 3KYOA 4XTRC 5TQ0H 1ZGLM 1ZANL 1DBKH 4G8FA 4I4WB 4XVTH 5HBBA 1JPGB 1H15B 2FD6L 4P5TC 2NYYD 4HC1H 1FL3B 5GHWH 4HFWB 2GSGB 2F15A 1HHGB 2C26A 2IADA 5T3ZD 1AXIB 4MAUH 3SE8H 4IDLA 3LKPB 2JCCE 4M6ML 1B0GA 2FZ3A 4KWUA 3V0VB 5JHDE 1XH3A 3TBTB 3KPPB 1YJDC 5A16A 5FM5M 3D25A 4GKSA 1Z0MA 2AEPL 4OZIF 4XPFH 4HWBH 2NTSP 4OIBA 4XPHL 3RDTA 4QRQA 4X9BA 5TGBA 2GHWB 4PJ5E 1JHKL 2Y6SD 2DQGH 5BS0D 3PWPB 1XCTA 4HULB 1F8TH 2ICWI 1SY6H 4PJ8B 3ARDB 5M7QA 4WFGD 3PNWA 4PLJC 3R8QA 4OCRH 1UQSA 2X9YA 1KACB 4P4KD 4R7DB 5SWSA 2J5LB 4PTUA 2BVUA 3JV4A 4CU7A 1C08B 1ZGLA 4Q74A 4F58H 1KEGH 5JOPD 3FMGH 1J05A 1KELH 3NZHL 3UC0L 4WGVB 1SJEB 1VEMA 4JHBA 1FZMA 4M62L 1X5FA 2X4NB 1NCAH 4DKEH 2GK0A 3K8MA 3S6CA 3BH8A 4GXUN 1EJ6A 1NJ9A 3BSZL 1LWRA 2HRPH 3GMMA 4GW4B 3EUUA 3M1BA 3QG7L 3ALXA 3BAEL 4G9FD 4HCRA 3AU1A 5AAMA 2EDOA 4N0FA 3FB8B 4JJ5A 2ARWA 1QSFA 1JZ8A 2DMBA 1OCWL 1JFQL 1KENL 4XAWL 4YBQD 5GS0H 4M3JA 3TO4D 1V3LA 1OF2A 5DMKA 4RMVA 2DM4A 3BPCB 3PGCB 1U8QA 2FX7H 2CRYA 4XP4H 3DMMC 3GM0A 3IDNB 4YK4C 3QH3B 3T77A 5F70A 1HOCA 4ZFZA 1PG7H 1WV7T 3C60B 4W4NA 2Z91B 3G9AB 1CE6A 4WEBL 4BH7B 2CR3A 5E6IB 2IQAA 1FL6A 3QA3A 3GMQA 3ULUF 4GRWE 3SQOL 4Q9RL 2RCSH 4P2OA 4XNQB 3KPSA 5E5MB 4NBYB 3UJJH 1XFPA 2A6KA 3HE6B 2EE6A 3DLQR 3VWJA 5BMFH 3LQAC 1RHHB 1IZKA 4GKZB 3DV4A 3QXAB 1YMMA 4I18B 2APXA 4NQCA 5B8CA 4NO0A 3W0WD 4U1GB 5FHBL 1U58A 4W81A 4QHLA 3WE6A 3MODH 3L6FB 3FQRA 4KV5F 3QJHA 5F9OH 6FABL 1T0PB 1FYHB 4NKOA 5CIPA 1A7PL 4WCYH 1PKOA 3U46B 1BBJB 3HMWH 3RZCD 1CBVL 1EIBA 3FO2A 1NMCB 1FG9C 3P2TA 4PTTB 2X70A 4X6FA 3QIUC 4IMKA 3VFMB 3VJ6A 2QQKL 4XMKL 4YDLC 4ZXBB 1F58H 1MAML 1Y0LB 3IDMA 2BOBA 3PP3H 1K2DB 5AZ2L 3SY0A 2VWEC 2RFXA 1OL0A 3I9GL 3D85D 1VCAA 4NRZA 5DHVB 2VXVL 2HH0L 1YEJL 3LS4L 2UWEB 1CLZL 4K7PY 1QLRB 3CFBB 1YEHH 3BKCH 4YHPA 1ZA6B 5EB9A 2DM7A 4GRMB 1FDLL 1U8OB 4QRUB 4H5SA 4Z76B 4OT1H 5ETUA 4M6OL 1BOGA 5F9AC 4MQ7A 1MNUH 1RU9H 2N56A 1B4JH 3I6LE 5C1MB 3PHOA 1CLCA 4PIRF 1KIUA 3V7MA 5HYSG 5DHYA 1YEGL 3BPOB 4KHXL 1MWAH 3HAEA 1QSZA 3P11L 4ZD3L 3X13A 3SKNB 4ZS6C 3BVNB 1JNHB 2VQ1A 3MJ8A 1SYVA 3CJJA 3I50H 2BX5A 4KI1A 2HN7A 4L4VA 3LV3A 5KS9A 2R0WH 3ILQC 5T1KB 2NZ9D 5ITFB 2JKXA 2O5YH 1X6NA 4GBXA 5D96B 3KYAA 1B2WL 1NEZG 2J88H 4Z95L 4LCIL 1N6VA 2BVQB 1KT2A 4IRSD 3TH3T 1M1SA 1X7QA 1NBVH 4D9RE 5GS0D 3D9AH 4PRIE 2Z8RA 5FM8A 3MLYL 4KI5C 3V5HB 1C7TA 3AC0A 4JN1H 1M7IA 4UV4H 5DFVD 3OGCA 2UZXB 2YUXA 3ARTA 4XP5L 1IQDB 4U6VH 2VISB 1YJDH 1RUKH 2OI9B 3C8KB 1X5JA 1ZT7A 3WHXA 1S9XB 5HYJD 1EZVY 1OWWA 1U93A 3KPMA 2VR5A 4WWKC 1JYXA 1X5LA 4IRJC 4HK0A 5HHOD 4C83B 4NHUA 4G8IB 4D3CH 1U95B 5FUZH 2ED7A 1LE5B 1MCFA 2UY7A 2X2YA 4FFVC 3WFBL 1EBPA 2OTPA 3L7EA 5I71C 1YEDB 1JTOA 1I1RA 1FLRL 4XC3H 4NWUH 5FUOL 1QRNB 3G04B 5HDBF 4NPYA 1WWWX 4I2XA 2FH6A 3MGOA 2HJKB 1UWGL 2P43B 1S7UB 1JZ5A 2AEQH 5EC2A 5T3XH 4KJYA 1DBAL 2ATKA 2EH7H 1CICD 1VFOA 3KVQA 4LOUC 3QO1B 4JO3L 4OIIH 4XP1L 4JFOB 4JRWA 3FCTA 2V2WB 1XIWD 2AV1A 2J7LA 3FQXB 4OD2A 2GFBA 1U36A 4YFDB 1N26A 5J11C 5F71A 4LU5H 1TJIH 1J0YA 3BP4A 3H9YA 1IC4H 35C8L 5F1SA 1TTUA 3O2WL 1CXFA 1ZE3C 5H2BA 3ZL4H 1U8KB 2HMID 2J8OA 4P5KA 4PJ5B 3O6KH 4AK1A 3SKMA 4MNQD 3SDAA 3MRNA 4IDJH 4I48A 4U3HA 4UV7L 3ZLQC 4NKIL 1KJVA 3SDCD 2Q86A 2DQUH 3LOWA 1VKXA 4G5ZL 4BYHA 5FYJH 1BVZA 1AH1A 1BECA 4JRYA 5INDA 4I9WD 4RMRA 1TXKA 3VGAB 1RUPL 4ZAKB 4U6YB 2EDJA 4MVBD 5IV2A 4GG8A 4D0BB 1VDGA 2IFGA 4PJHB 4LVEA 3D2UA 3MRMB 4K8RL 5LCVH 5GZNC 2Q3ZA 3ETBF 4RGND 4YHIB 3WKNA 5IB4A 2HT2D 3ZDZE 1C16A 4Y4FC 2P5WD 4KROD 2YPLB 1A3LH 1LK3L 1UJTA 4LVOC 1IM9D 3M8OH 3HG1D 4XTRD 1AR1C 4ELKA 3NFPB 5C92A 5K9JL 1P1ZA 5IR1B 2NXYD 3HC4L 4LCWD 4MHHI 1J5OH 1NGQL 3E8UL 5DWUL 4P5TD 4JDVA 3ZZ1A 4LASL 4HUUB 4W6YB 4NNYA 3QJFB 4QRTB 4O58L 4XCYA 4OTXL 1XCQB 2P45B 5MEQA 1NGWB 3SQBA 1IGFH 4JAMB 3VXQA 2A38A 2DYPD 1EGJH 2PTVA 3U7WH 2ARJB 2MHAA 5ERWA 1TJHH 4J6RL 1DLHB 4KAQL 3IDJA 2HJFA 3RAJH 3KYNA 5F7UA 2X4QB 12E8H 3T65A 1YPZF 1R5IA 2E5EA 4LAQL 4JLRB 3TV3L 5I6XB 2VR4A 1AXTH 3GI9L 5B3JF 5EOCL 4M4RA 4PLJD 5CJ5A 2MKLC 5I1KH 3VD7A 3MNWA 3ZTJH 3MYJA 1UM4L 4M02A 3HUJA 1IKFL 1CXIA 1NAML 3NN8A 2LV4A 4YHNB 3AAZA 5IUSA 1XF4A 1P4LB 1NDMA 1FGVL 1MVUA 2VXTL 1YY8B 2VLMD 1P4BL 4KK6D 4DOHE 5IW1A 3L95B 4P59L 3DURA 4YBLB 1YNKH 3MV7E 1CDUA 3QO0B 5TE6L 5T3XD 4OLEA 1S9WA 2FX8L 4E41E 3BYTA 4TSBL 3CDFA 1J8HB 4UNTA 3W9EA 3WUZA 3BX7C 4RAVA 2HFGH 2WANA 3FAXA 3LKSA 4KRMB 1BIIA 3L9RA 4KVCH 1PKQA 1TMCB 2LU7A 3NH7H 3ROLB 3T0VA 3LEYL 5C9JB 3JXAA 3DMMD 4A6YL 4PJGA 1FGNL 4PGEB 1RIVL 2Q7NA 3HTLX 3QUYA 4I3RH 1NEUA 4OLXH 5CJQH 5FKAB 2YHGA 2C7UB 2C4FU 2MNUA 4J4PC 4JG1L 3VWJC 1K3IA 3ZDYE 4H26A 3P77B 3BGFC 2BSRB 1FJ1A 4ODTL 2GW5A 5SX4H 4XP6H 2W0LA 1J1PH 5KTEH 2FBJH 5FYJD 3OZ9L 4UOW0 3QRGL 3CFJB 5ID0B 3OR6A 1ZHNA 1YNTA 2E9JA 2VO5A 1ADQA 3EFDL 1QFOA 4JG0H 4MD4B 4G43A 5DK3A 3MSPA 2QKIB 1F11B 1HQ4B 1T21B 1A6VH 4ODWA 3TNNB 5C2BL 2G2RB 3BEWA 3RPIA 2GJ6E 1LK2A 1VADB 5M95B 4F2MB 1TCMA 5IMMA 2H8PA 2ERJB 5GSRA 5EORL 2E27H 3K2UH 1RZKL 3A6CH 5E00B 4XPGL 1ETZA 3CVIL 1JF1A 3TM6A 3V5KA 1JMXA 3H9HA 3MBXL 4BQ9A 5T1LD 1M7DB 3CX5J 5D8JH 5INCB 2BNRE 3EYFA 4OAWA 4R4FH 5C6TH 1HINH 4AH2A 5BV7L 1QACA 4CAGA 1EHNA 2FGZA 4Z8FH 1RIUH 1FNEB 3OMZA 1MCLA 5DRXA 4KRNA 4JHZA 1LO2L 2BRRL 2QV2A 3C6LB 3WKML 1BGXL 3T4AB 2EYTA 3PQYD 2M26A 2AKRB 3BIAX 4M7LT 2IFFL 4GQ9L 5BVJB 3QEHB 3WFEH 5DA4A 3QDMB 1T0NA 1NCDH 1IL1B 5EOQL 1QRKA 5DRWA 5ICYB 2J2ZA 4WTZA 4HXAL 5DS8B 3DHMA 2B4CL 3HZMA 1V7MH 3BT2H 2I60H 1A9BB 3OB0K 1L9NA 3BN9D 1FYTA 3SDYH 4ZS6D 2LU4A 4LHUA 5FCUL 3OPZH 3TBYB 1Y6NR 4YNYA 4GBXC 1WTLA 3ILQD 5C08D 2IH1A 5DUMH 4LSUH 3A67H 3PWNB 3V7AE 5C0GA 2LTQC 3GKWL 3F5WA 4L4TD 3S36L 1MAKA 4JFFA 1SM3H 2L4OA 2VDKH 4X5XB 4ODHL 1CYGA 4ONGH 4WHDA 2PW2B 4MJ6B 4XVJL 5BZWA 4EI6A 1VESA 4QY8B 5IK3A 5JIKA 5FO8A 3TBSA 4ZUVA 3ARWA 2X4UB 5T1DH 4HIIB 3GIVB 3WYRA 4PYGA 4PGBA 4K9EL 3U0WH 2WMPA 3D0LB 3Q6GH 5FKPA 3G5XA 3CFEA 1FAKT 4WUUA 5DURB 2VLJA 3NCJL 5JDSA 1V5JA 5E0QA 4X4ZA 1Q9WB 1HH9A 2EDNA 2OL3L 5MHSD 1G7LB 1CT8A 2OR9H 3OTTA 4IRJD 4GJTB 4LLYB 4X7TB 5E8EB 1WUNT 4GG6F 3Q0HA 1E28B 2R56H 2YUWA 3N1FC 5FV2A 1L6XA 5DD1H 5T1MB 3I75B 1MCRA 4PGZA 3GJFB 1CE1L 2BVOA 4ZYKB 4X6DF 2IMMA 3IVKA 2KKQA 1ZT4A 3LHPL 1HZHH 3CFKA 1WWBX 4NQDD 1T2QH 3FO0L 4KRPD 2NW2A 4MA8L 3EYOA 4M8VA 4OCYL 5CGTA 3KPRA 4R3SA 3ULVF 2PO6B 5K33A 4HCRH 3LEXB 4EI5D 2F53A 1CN4A 1M71B 4FQ1L 3VFGH 3VXPA 4LPUA 5J7CC 4Q97A 1K8IA 3VCLB 3RWEA 2E7HA 2R69H 4F33B 3VXRD 4FMKA 1P2CB 3BQUA 2CQVA 1GYAA 3IF1B 2D03H 4HLJA 5D7SL 3M17B 5LXGH 5E5RB 5DQDL 1U8JB 1WZMA 2GQHA 5IVXE 5C0EB 5J89A 3S35X 1LDPH 1S5HA 2EXYC 3HC3H 1D9KB 3WDHA 3DX9A 4HG4J 5F97E 3MROB 4G6FB 2NX5A 3ZHLA 4MWFB 5EBGA 3R0NA 1FFRA 3HPLA 3L3IA 3QI9B 1ZVSA 5ENWA 1E6OH 4G9DB 3ILPB 2AERT 5D1XD 1UXSA 2DJSA 4UT9H 1WFNA 4OM0L 2XQBL 3RU8H 1U3HB 1MJ8L 1MI5D 4Y5YB 1PJ9A 1LP9A 4OZGA 1JK8A 4QT5A 5CIPH 4OUUA 1FN4A 1MCWW 1S5IL 4JM2A 5GZND 3QUZA 3QIBA 4FXGB 4M93B 1A6TA 2P24B 4X4MA 1WCQA 2GCYB 4Y4FD 5IJVA 3BO8A 5KZCB 1JWMA 3DBXB 3GGWB 5CP7A 3K1KC 5CCKH 4PRPE 1AR1D 1VFMA 5JW3H 4NQEA 1SYSB 4HIEB 3VH8A 5J0BA 1AGDA 1FFQA 4BM7A 1CTNA 1PSKH 3T3PE 4NN7C 2VZ1A 1A7NH 3HZKA 3QWOA 4N0CC 3U0TB 3P9MB 4FRWA 2XQYG 3VXSE 3ZE0E 4MDIA 3MRQA 4FQCH 5EC1B 2XN9A 4PJ9B 2YC1A 1I7UA 5EWIL 3BE1L 2Q8AL 4JR9L 3E3QE 1BFSA 3QHTC 4Z7VE 3GSVB 4OCWL 4P3CH 4BQCA 1GGIL 3ARRA 2BJML 5FHAH 3FOMB 5I16B 4HF5H 3W11C 5C70A 3OB0H 1INEH 4YHZL 2P8LB 3KNBA 3MA7A 4MD5A 3NFNB 1PQZB 4NM8H 5HSFA 5ITBH 3BMWA 1DL7L 3H9ZA 4PR5B 1MCOL 4MHHG 5DVMA 4JY4A 4LEOA 5E9DD 5HYJE 5LJYH 2BVPA 3U4EB 2Y9RT 2DQFA 2I24N 5GRUL 3HAEH 5AEAA 2CMRL 5HHOE 1INQB 2YPVH 4ZNEA 5K9KB 2MPAH 4XCCH 4IIQB 3FT2A 5DD5H 4R8WH 5JW5A 4F7CA 5C07B 2VAAA 2AXHA 4NN5B 2ZJSL 2QQQA 1KLGB 1B6DA 1T7WA 2R0LL 3SO5A 2FJFA 3VXTA 3T2QA 3CXDH 4QTHA 3G6JA 4YR6B 4UUJB 1OAXH 1REIA 1IC5L 3TZVB 1IEAA 1QSFD 2EICA 5B38B 1H5BA 2P5EA 4UT7H 1AI1L 3H9SA 4PP1C 4LIQL 1KCKA 3MBEB 1HHJB 1IAIM 4OZHA 2P7TA 4P3WA 5J56B 1TFHA 2JJUA 2XPGA 3U4AA 5C0CA 1HN1A 1FE8H 3S96B 4LLVB 3H6JA 4OLWH 1IAKA 3CFCL 4PJXF 1G0YR 1I1YA 3ZE1F 4P2QA 4JFQB 5DA0B 1F45A 4P2OD 3DX7A 5I75C 3GMLA 3KPSD 2V9RA 4QOKD 1EO7A 3R1GL 4ZUWA 3VWJD 3KXFA 1ZT1A 1AGCA 5J3HC 3QEQE 4WI8A 1VGKB 2VE6A 1YMMD 3P4NA 5EBWA 2AJ3A 2V6HA 3ARXA 4MZ2A 3U9PL 2MMXA 4NQCD 3S35H 5BS0B 2MSPA 4GS7C 3EO1A 4NO0D 1GZPA 2EDWA 1JVKA 2BSTA 1XGPA 2N7BA 1HKLL 4HUVB 3N06B 1Q0YL 1MCKA 5JLZA 5EUOA 3CSBA 1HSBB 4HBCH 4JB9L 4P4KB 3GUTA 5FGRA 3V8OA 3TWCH 1ZSDB 4M5YH 5I1JH 2VIRA 4XPTL 4E5XB 3MNZA 4I9WE 4AT6B 2VZ3A 3WV0A 3Q5TA 1NSNH 5DJCB 1MUJB 2V5TA 4MCYB 3WD5H 2MCG1 3B9AA 4BUHA 4DN3H 3MXWL 4PUBL 2JB5H 1P84K 1J86A 3PP4L 2PW1B 2CLVA 2R0ZH 4S1RH 4G9FB 2DTMH 5CSZA 4X6CB 5F1OB 4MJ4A 2ICES 1HEZB 5KG9A 1LGVA 2JJVA 3TO4B 3I6GB 3QWQB 2APTA 2KUTA 4JJHA 3VXUA 5TJWK 1U8HA 1ZTXL 2RQ8A 3UPRA 2HJLA 4ZFGH 4OGXH 5I74C 3NGBB 1WF5A 1XF5A 2PYEE 4HSQA 5JW4N 3QFDB 4PJAB 1EDQA 1FNSL 3RP1A 4LEXL 4NBXB 3L3KA 2XNAA 1NFIA 5ESQB 4LP4A 5DYOA 4QCIA 1IT9L 5EDXA 5L88L 3QDHA 3GHEL 4WV1C 4EOWL 5JPNB 1DFBH 3G6AA 4X98A 4WW2B 4G8GA 1CLOL 1S7WA 3D0VA 3HFML 2WWKO 2QHRL 4L4VD 5HY9B 3SE3C 3W0WB 2XZZA 1ODAA 5B3NA 1ES0A 3ZMRA 4E0RB 3AXLB 4R4BA 5HD8C 5CAYB 4QHNB 4GBXD 2X05A 4PRHA 4JE4B 4UTBL 5DUPH 2XT1B 1OAUL 4H0IA 3VFRA 1H8SA 3RZCB 2NY3C 2H32A 3EDFA 4KY1L 5A40E 4ESKA 4BQ8A 3GSNH 4U49A 1NCTA 4U1JA 3QYCA 1T20A 2VN4A 2Z31A 3QIWC 2FO1A 1A6ZA 1G1YA 3BUYB 5FA4B 4EN3A 3REWB 1QP1A 4OCSH 4OZIA 2R1WA 1R3HA 1BOYA 2Z92B 3D85B 1SBSL 3QG6B 3QPQC 5ALBL 2NY1C 4N68A 1A47A 5KSBE 1CXLA 1QTYT 4D0CB 3HNTL 4H88H 2DLFL 3MV8A 4NM4L 1U8MB 1NDGA 3BD5A 2Y07L 4MAYC 4AQOA 3VMNA 5ELIA 1ZHLB 5F7DB 1GOFA 2FX9H 1J87A 1UA6H 4LBEA 1DQJB 3VD4A 3DUSB 3U7AA 1Y18A 1GGTA 5EFIB 2NY5C 3MRFB 1OAKL 2ZCKH 3KPLA 5MEPB 5E5UB 3STLA 1RV6X 1HH6B 2Y1VA 3B9KA 1P84J 2AGJL 3HRZB 3IXTB 1IGJA 5FUCC 4U7MA 4RRPA 4UMGA 5IFJA 3EKCA 2JJTA 5GGTL 3BQUC 1PFCA 3MRRA 1JGEA 4JZOA 3MRIB 4IRSB 5I2IA 4ZUSA 1LO3H 4NUGH 2XZQH 3SOBL 4YPGA 4A6YA 4MXVF 5EG6C 1LEGA 1P4IL