4ZXBD

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
182
Chain Sequence
DIQMTQSPSSLSASLGERVSLTCRASQDIGGNLYWLQQGPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKVLNSWTDQDSKDSTYSMSSTLATHKTSTSPIVKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor/immune system
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 182
sequence length 209
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbD01
5E00A 5LGKA 2QLVB 5CUSL 3EYVB 3TA3A 4M4PA 5B3JE 3WDJA 4XCYB 1DUZB 4LLWB 2V7NB 5D71H 1JZ3A 3FN9A 5D5ME 1CGSH 4OD1H 2FO4B 1XGUA 2FBOJ 3CVHB 2XA8L 2NY0B 5HHPB 1EEYA 4Q9RL 2ICWI 5IW6A 1CGWA 1EVTC 5DS8A 1S5HB 1NQBA 1RUPL 2AEQL 2EXYD 1I7ZB 5CP7A 3PDGA 1UJ3B 3DX7A 4Y2DC 5J6GB 4OGYL 4LRIA 1N6QH 1YN6B 3I2CL 4G8IA 5F88A 1SJVA 2VZUA 1K2DA 1A6ZB 5KSBF 3W82A 1SJEA 2DDQH 3VXRB 1X7QA 1Q9WB 43CAB 2C7UB 4JFZH 4HHAA 3V0VA 4LSTH 2FX7H 2VERN 1J8HB 2XV6B 3DX8A 4XZUB 3A67L 3UPCA 3MJ6A 1EFXB 4PLJD 4LFHG 3UJTL 5E2VH 1LDPH 3BDBA 5F9WB 3VGHA 3VDCA 1D5ZA 2O93L 2BY3A 4I18C 5J13B 4ODVH 4U6YB 1FVCB 4XNZC 3JV4A 4L3CA 3MACH 1Z9LA 4LLUA 5EUOE 4MSWA 4U6HA 1JPTL 3MNWB 2QHLA 3HCVA 1INQB 2V2WB 2OS7A 1MCHA 3AY4C 1FPTH 4YE4L 1T89C 1SEBA 4XNMB 4XPTL 2IBGA 1QNZH 4QHNA 3RUGF 4UAOC 3TYGL 4YWGH 1YY9D 3B9KA 1MFDH 1MSPA 1KLGA 3HNSH 1X6NA 5DVKA 1JNJA 1U3ZA 2DQIL 3CFIC 4HUMB 1P4IH 5CINH 3IFNL 3QWQB 4WHYG 3D69A 2NTFB 3P0VL 4PG2A 1NAKL 5D1QA 2BVYA 1NSNL 3UJIH 1C5BH 3VWJB 3MJ8A 3ULUH 3DBXB 3FB5A 3U4AA 4KUCF 5JXED 4DQOL 2XYCA 4IRSC 1X6LA 2VZ1A 4Y89A 3HA0A 4RMRA 4Y5YA 4PRHB 3O6FD 3VD3A 4NM4H 2E6QA 1HZHL 4HFUH 1MCRA 2PETA 3S4SG 4KY1L 1OOAA 4N1CA 1LO5A 1YQVL 4R97B 3HI6H 3ULSB 1AY1H 1QFWH 1M05B 3RGVA 3K8MA 4HXBH 5JHDB 3OKDB 4KK8C 5EBLA 1TVDA 2BDNH 5DQ9B 4HC1H 2DBJA 2JE8A 3TIDA 3OB0K 3SDCA 2R29L 4PGCA 1R0AH 2W65B 3QXDB 4NRXB 1ZTXL 2YKLH 3BZ4B 3TZVC 5BRZE 2HJFB 1N7MH 1AD9A 2HTKD 3UTTB 4X9FA 1I1AC 5L2KA 4RRPG 3U4EA 1IAII 3CMGA 4F15B 4YR6B 4ZFFB 2BJMH 3V5KB 5HYFA 2B1HH 5D1ZA 1ZVSA 1IGTB 5CSGA 1QRKA 1WBZB 4YK4C 2CH8A 1G7LA 4LPCA 4Y1AA 5TJWK 1T1ZB 3LD8B 3IFPB 3V7AG 3LPWA 1P7QA 3RWGB 1DQJA 1T80A 4LSRH 4OCSH 3LEVH 3MRRA 4K94H 4RDQF 4DKAA 1FDLL 5F9JB 2FBJH 2GJJA 7FABL 4JB9L 3EAKA 1UT9A 5MHSD 1KPUA 1M71A 3CFCL 2ARWA 3H9SA 1H0DA 3H3BC 4QHUA 1W8NA 5HHOA 3FB6B 1V8HA 3CCHA 5EIVA 5C9KA 5J1SC 4CUCA 4F33A 1FNSL 3QUMB 3ABZA 4OLVH 4WY7L 1JFQL 2CXGA 5JORB 1QHOA 6CGTA 3ARBD 1T5WA 1MCBA 12E8H 3H7BA 5E2WH 3PWNA 3ZKQD 4P49A 5FKPA 1QLRB 5F97E 1ZGLB 5DYOB 4KI5E 1R5WA 4TSCH 5EUKA 3GI8L 5CBAB 3FQNA 1KPVA 1UH2A 3ECBA 1SMAA 1HEZB 4X83A 1JF6A 1WFNA 3A6CL 3U7WL 2BX5A 4YHNA 3KPRA 2FDBP 1NMBH 4ODXB 4P5MB 3QHFL 2J8UF 1N4XL 3F58L 1ODAA 2AXGB 2MOVA 5CZVH 4CVXA 1HQRA 3DROB 4N90D 2H6PB 4MD0B 2R1WB 2LAAA 4BSVA 4FQQA 1BD2B 2VDQL 4IEFB 5I1GH 4NUGL 3RWIB 1V7NH 3N85L 3D39A 3CFBA 4IS6A 1ZS8B 1CU4L 1RIVH 1CL7L 1Z9MA 4KHXH 3P11H 1S7WB 5A16B 1DBBL 2E27L 1BF2A 1NAMH 3TCLA 4CAGA 2V7HA 3QNYB 4MWFB 4S2SA 5KZCB 3V0WH 5DFVC 4NIKB 4NO3B 3AMLA 4PJDB 1ES0B 2R0ZL 4M6AA 4RSVA 5DQDH 1RMFL 3NH7L 2Y5TB 3IF1A 2IALB 4JRXE 5TH2B 1VKXB 3V7MA 2DQDL 4QRSB 1MFNA 2BOCA 2FNBA 4KAQL 2VIRB 5DD5L 2DJUA 3L3IA 3U36A 3AGVA 1IQDA 4QHLA 4HUWB 2P7TB 2UVEA 3AM8A 5FAAA 5ANMB 3WXVH 4PJAA 5TGBA 2Z93B 4XP5H 2QADB 3HUJE 2DTMH 1NAMB 4WTWA 2XTJD 2CRMA 1LVEA 5IROC 1F5WA 4LRNH 4P23A 3P9MB 4EBQL 5DHYA 2EIZB 1AGFA 4MJ4A 3VXNA 4IBLT 3V6ZB 3BWAB 3NGBC 4OLYL 3ARUA 3BH9A 1DTUA 3BDYL 4P5TB 4PBWD 1I8MA 4H25B 4OV5B 1KNOA 2YHGA 5J9PB 4F7CA 5C0AD 4FTVD 3F7VA 2VLRA 4XCEA 4XVSL 4BYHA 3NBNA 1H8SA 1INEL 2VZSA 3PGCB 3QXWA 4LMQE 5LGJA 1I7TA 3ZKXB 2DMKA 4U1IA 1NMCB 3WSQH 2OTWB 1SYSB 2BP3A 5F3BB 3M8OH 4G7YL 3VE0A 3MA7A 3O3EA 3S35L 2A0LD 5F44A 4NUJA 2ZUUA 3NFNB 1H3PL 4Y16B 3AREC 4ESKA 3GIVA 1AXTH 1CD8A 5IHUH 2I9LB 2Z4QA 4E5XA 3UDWA 3MODH 4KKNA 1QFPA 3VJ6B 3NCFB 2NXYB 5FM8A 5I76B 5F1IB 5EO1A 1CLOL 5DUBB 2ICWJ 4XAKD 3ZTNH 5HVFB 4KRLB 4QY8A 1X44A 2VDLH 3TBTB 1RV6X 3MBEB 1MPAL 2ZUVA 2ADIB 4FFYH 1HXYB 3S6CA 3QEQA 3DXAB 3N50A 2WAHA 4I3SL 3TT1L 2D7TH 1RZGB 1ZT7A 4CRPA 1QTYT 3SOBH 3GIZL 4EXPX 3C08H 2PYED 4XGZB 5ILTL 2FGWL 3MRNA 5CBEA 4JFFB 2FIKA 2YMXH 1GGIL 1BAFL 2NY6D 3O8XC 1HK6A 4JRYB 4ZNEE 3S36H 2OQJA 5F1NA 3WEXA 5A43C 1Q9OA 4PB0L 4DKEH 1NUNB 2FEDC 3TVMB 4WEMB 1JWSB 4ZO6A 2YPVH 4ZPVB 4L8SC 3DMMD 3G5VB 1T7VA 5CEXB 3A6BH 1CFTA 3GFUA 2X7LB 2GTWA 5K9KB 5ACZB 1L7IL 4TUJB 2MSPA 1S9WB 5IBTL 1PX3A 3BX7C 1QSFA 4MVBD 1A7RL 5IIEA 4LEXL 2BERA 2ICES 3O6FB 1S9VA 2VH5L 4UTAH 5HPOA 3L3KB 1FG2A 3X3GH 2DIAA 3OB8A 2O5XL 5GSRA 5HGGS 3CH1A 3DGGA 1QEWB 4R4NC 5JXAL 4Q9QL 4P4RB 5GGSY 3H9HA 4LGRB 4UT9H 4ELKB 4LF3A 2KQNA 3NN8A 1Z3GH 2HT4D 2E7MA 2BNRB 1TZIA 3BEWB 5C0BB 2MFNA 5DFTA 1R5IB 3E6HA 4S1DD 4P3CL 4X6DF 3TT3H 3GHBH 4OD2B 3LV3A 1KLUA 1I7RB 3SQOL 5L7XH 4GRLC 4OI9A 2Y7QA 5IMOA 4MQXD 4AEHH 3CH8A 4MXWH 1NJ9A 2IQ9L 4S11A 1I9EA 5I19L 2WQRA 1XAUA 2J1KA 5T3ZE 3PDOB 2WLYA 4PP2B 1LO2H 3U0TB 3OL2A 3BQUC 4DW2H 3NZ8A 4ZUVA 3B83A 5CIPA 5KBNC 2HFFA 2JIXD 1GXEA 2JK5A 5D2NA 3MLUL 3V9FA 4A6YL 1B0GB 2AV7A 3OAUL 4PTTB 4ZO9A 1T7XA 2HVKB 4WEUD 1HSAB 3BJ91 3VG0H 4KMTH 1JV5B 1T03H 3FOMB 1BQSA 4P2OA 3QUZC 3BUTA 1GZPA 1MHHA 3OZ9H 2MCPL 5F9OH 4DCQA 5I73C 3FO0L 4OQTA 1NGYB 4HKXA 3MMEA 4NC1E 2EYTB 2AK1L 4OCWH 3MJ9A 3EDKA 1MHPL 2HT2D 4P2RD 5HI3C 3RL1A 3MRLA 4DZBB 1CI5A 4X9HA 1MCWM 4JLRB 3MGOB 3GSRA 5D72H 4GO6B 5DEZA 5JPNA 5HGHA 2H26B 4NDMA 4BM7A 3L3JA 4WW1B 1OWRM 5BW7C 5EU6E 1FL3A 1EBPA 1FO0L 5ITBH 4P3DB 4XVTH 2VXSL 1S9YB 4KDVA 3T2NH 5TPWH 2MQCA 2CRZA 2R0LL 3WHE0 1C12B 3HE6D 5MI0C 1HHKB 3UZVB 4M8QB 1CFNA 3CC5B 3GBLA 5GGQH 4TOYH 2DQHH 5J57B 1MRDL 5CZXC 1XGTA 4EDWL 1TCMA 3W39A 2G2RB 1WBXB 3ALPA 4YLQT 3TP4A 5MEND 1TJIL 2LQRA 4Y5XB 4L3EA 4RMWA 3SKJH 4NO5A 4OTXL 2IANE 4YDVB 2I9TA 2UWEF 3UC0L 4J1UA 1S7XB 3CX5J 2AGJH 1B6UA 1ZHBA 4ODSL 4OZHB 4MB3A 2NY2D 4Z7WA 4CW1A 5C0FB 2VLKE 4CU6A 2HRPH 3CMOL 2E9IA 3HLAA 3UTQA 2EO1A 2PN5A 4O51B 1FSKB 2ZOLB 5KSAA 1JNNL 3QULA 2ZCHH 1BVLB 2IAMA 1FL5A 2PR4H 1FN4A 4HIXH 2CUIA 4J23A 4C4KT 3BPNB 1FZKB 5DMGC 3U46A 5H37H 1MREH 2RIKA 1DLHA 1PEWA 3VFGL 4LKCB 5D9SB 3WS3A 5TDNB 5T3XL 3CXDL 3VXTB 3HN3A 3DX9A 3DWTA 4A2LA 3GSVA 1TETL 5EWIL 1QFOA 2R8SH 1QSED 1CN4A 4EDXA 3EYOB 2G60L 3FOLB 3SE3C 1IRAY 3BSZL 4L9LA 5EU4B 5DJ8B 3TO4B 2IH3B 1OGTB 3G5ZB 5EBGA 1IGMH 2Y6SC 3EDDA 1RZ7L 2V5RA 2R4RL 1A14L 2UZYB 3X14A 1EHAA 4M6MH 3TO2B 1YEKL 3DETD 1D5XB 1WAAE 1JN6B 1UYWL 4F2MA 3WIHH 1SBSH 4PV8B 1LO3L 4C83A 1WSST 1FNFA 2AJZB 1NMAH 3I9GL 3WFCL 1WC7B 4WTXA 3DTXB 5T1KA 3V6OE 5GHWH 3OTTA 4LVNC 5L9DL 3O2DA 1XGRB 5FGSA 4LLDA 3KXFE 4LP4A 1BJ1H 1A21A 2C3GA 3PHQA 1TIUA 4LDLB 5D6CB 1C7SA 1KG0B 1P1ZB 5MERB 4LSPL 5E08H 4MA3B 1J0YA 5ID0B 5HI5C 3C5SA 3HMWH 1G9MC 4KI5C 2YXFA 1ADQA 2CR3A 4LIQH 3UMTA 5KVGL 1BEYL 2VOTA 4D3CH 1MAMH 1CGXA 2EEBA 3FL7A 3C87A 4Z7UA 5EOCJ 5IB2A 3F7YA 1EBAA 5I74C 2B20A 4OJFH 4WO4A 3P0GB 4UINH 5DQJA 5BOPA 4GAYA 4R3SA 4AK1A 2BC4A 1CIUA 2GTZB 3B9KD 3BPOC 4WI6A 4YZFE 2CKBL 1UB6A 4RZCA 1L4IA 2CPCA 1DEEA 2VQTA 3P77B 5KG9A 3FTGA 3T1FB 1CBVH 5LCVL 1JGLL 4M48L 2BY0A 1S7VA 3AXLA 5D1QD 2EDJA 4JDZB 2FB4H 3QQ4B 3O3DA 2BCKA 2HKFL 3CX5K 5F7LB 4PJFB 4PJEE 2ZJSH 1P6FA 2CDFA 3KYAA 2P42B 4KQ3L 4WW2B 1JPGA 1U8OB 3MRKB 4IMKC 4OFYA 1CDYA 2DQJH 5I1AA 5J06A 4MQ7B 5GGVY 5I1JH 2OTUA 2EXWC 5E9DD 4C56E 4G6JL 3VRJB 1TZHA 1BLNB 3QUYC 4JKLA 4Y19B 3QCTL 1OGAA 1YPZA 1TVHB 2EC9U 3FQUB 3Q3GB 5FV2A 2YS4A 3G08A 3MCLH 1S9XB 4UQ3B 1ERNA 4XHQA 4LCIH 5DVLA 5FYJD 4D0BA 1OP9A 3UTSE 3RZCA 4GKNB 3IDMB 3SJVA 4PLKC 5CMAB 1B0RB 3DRTA 1RFDL 4P5KA 3NIGF 5I75C 3RGVD 1KCVH 3VFRA 5EZIL 1VESA 1XF5A 2R2HB 3ESUF 5K9JH 2H2PD 4XPBH 4PRNA 4HCRL 4BQBA 1CDJA 1IGFH 1XIWA 4C55A 3F7RA 1CE1H 3MJ7B 1OW0A 2A38A 5KSBA 5L2KD 1I1AB 4WDIA 4NKQB 4FFVC 4KRMB 4OI8A 3T0EC 4HIJB 5IMMA 4YDLC 4KV5E 1KCRH 3C5ZC 4KZEH 5D1ZD 5KAQF 1SM3L 3PGDB 4EKXA 3O4OC 3IXAB 1Y6NR 4XMPL 5GGSA 4GKOA 4Q9CA 4G8FA 4Y1AD 4LCWD 2OR8A 1T1XA 2ZPKH 2FR4B 3PQYA 3CUPA 1P7QD 5J1AA 2J2ZA 3HI5H 3MRCB 4DTGL 1FFNB 1LGVA 2JIXB 4YDKL 4H0HB 1JUFB 4WV1B 3HC0A 2P8MB 2FLBT 2DWEA 3H9SD 2J8UE 5T1MB 1P4LB 1LWRA 3NZHL 1DBKH 4BQ6A 2HKHL 3ESVF 3QPQD 5CP3H 1QA9B 3I75B 2CJUL 4BQCA 1A02N 3OAZH 4LPUA 5F89B 2C1OB 3BIKB 3L3DA 4KKAD 3F6LA 3OKOB 3QDAA 5DJ6A 2MQ0A 2EC8A 1MCFA 3VMPA 3BP5A 3NVQA 2XN9A 4N8CH 3MZTA 1IE5A 2APXA 4QXTA 3EGSA 2GK0A 4G9FE 1G0DA 4Y4KB 4M6OL 4KROC 2BOBA 1C5DA 3N9GL 5E1AB 4HGMA 1NEZB 1TTFA 4JFQB 1RZKC 4ZQKB 4ODTH 3EDFA 1AI1H 4L1HA 3AVEA 3IS0X 3WUZA 15C8H 2CK0L 3VXOB 1C16A 5EC2B 2VXVL 5FO7B 5GZND 1GVIA 1FL6B 3T8XB 1KIPB 3L5IA 2JELH 3G6JB 5MEPB 1FV1B 3PIQB 3SQBA 3RVTC 3T0BA 3B5GA 3L7FB 3LS4L 5CS7A 5ID1A 2FHCA 1NFIA 5FECA 3NCJH 4QOKE 4QHKJ 1MOEA 2XICA 3JV6B 3O6ML 2KBGA 3WD5H 1IJ9A 4X0KB 5MENB 2CIKB 1QPXA 4XBEL 4ZAKB 3RWEB 1C08B 3QIWA 5D70H 2X1PA 4M9PA 4JM2C 4OF3A 3OQ3B 2F54D 1DDHA 1JNLH 2DQGH 3VH8B 3CXHJ 2NY2B 5HHQA 1IQWL 2NY1C 5GISH 5C70A 5BZDB 4X7SL 2LTQC 1OP5K 3IXTB 4FZ8L 2A1WH 1T0NA 5EZOH 2VDRL 4XNXL 1ZK9A 1CFSB 4NNXB 4HH9B 2VB5A 1K4DA 1RJYB 1ETZA 5JLZB 1IT9H 3DX6A 3MV9A 1DFBL 5E00B 2EECA 3S96A 3VWKA 2OJZH 3TA3B 3WJLC 4P23D 5IVXE 2ZG1A 1F4YL 5SX5K 4HXAH 1G7QA 5AYUL 3WNNA 4BELD 5FUOH 1A64A 5DT1H 2E7CA 3KPTA 1HYSD 1IC5L 1IFHL 3B4NA 1JPSH 1XGUB 3EW3B 4DVBA 1UH3A 1EEYB 4HWZA 4FS0A 2VLRD 5IW6B 1WFUA 1U8LA 1FJ1A 1KYOK 5CP7B 4H1LA 3W5MA 1OB1A 4HJ0C 5BO1L 1V3MA 1T2JA 1SQ2N 2VZOA 4X4YA 1X5IA 1RULH 1F6FB 4Z18A 4G8IB 5C9JA 5F88B 5KVFH 2VAJA 5LBSH 1NKRA 5HHVH 3ZKMD 1CFVH 2MKLC 2MHAA 4X80H 1SJEB 3Q1SH 1ZT4A 4OCNC 2RCSH 5FOBA 5HYQA 1AR1C 3D1MC 3N1FC 1MEXH 3L3OA 1X7QB 4I0KA 3S37H 4O2FB 3LIZL 3NTCL 3OG4B 5D93B 3FB8A 4HK3J 5L8JB 3V0VB 4QO1A 4NZDA 2XNAA 4N5ED 5A2FA 5C09E 2R15A 3DX8B 1MQ8A 4WFFE 3TN0C 1WZKA 5A3ID 4G8GA 5E6IA 1I9IL 4NT6A 1D5ZB 4B41A 4B53A 4NJ9L 3SDAC 1OF2A 2OI9B 3G6DL 1A6AA 1IAIM 3JV4B 4L3CB 2F8OA 4JKMA 1KGCD 3PE9A 4HD9A 1Q0XH 4MSWB 4U6HB 4Z95L 3RP1A 1KB9J 7CGTA 2BY2A 5JOEA 3NPSB 4NQEE 3GHEH 3TBYA 5D7IE 1ZAGA 1SEBB 5EH1A 1JF1A 4G5ZL 4NC2B 5E8OA 3RWDA 1U0QA 4ZUWA 4L4TE 3EBAA 4QHNB 1K5NA 5FYJH 2Y72A 1RAMA 4K07A 4BQ9A 4JPWH 3O8XB 2ICCA 3BZFA 3B9KB 3VXQB 1KLGB 4KQ4H 1GAFL 1OVZA 2WANA 4XI5C 1UXWA 1MWAH 2DQCH 3SDDA 4LAQH 3LRHA 5HHXH 1XT5A 4FQJL 5GS0C 3D69B 4UTBL 1OAYL 4BSWB 5D1QB 1TMCB 1LILA 2YA2A 2AI0H 4I4WA 3Q5TA 5B38A 3MJ8B 3FB5B 3CXHK 5AZ2L 3EOTL 1WT5C 4OBSA 4NQCE 5B8CA 4OZGF 3LHPH 4LPYA 1EAJA 4DJMA 3W0WA 4U1LA 2ZG3A 1U95A 4PREA 1DANU 3GMPA 1CZ8H 1F02I 4XP4L 3P0YL 2LV4A 2X4OA 1LO5B 1RUAH 1CFQA 5EU3A 1CGYA 4PJ8A 3RGVB 5GS1C 4TNVF 3FT4A 1G9ML 1QFWI 3V4UH 3TIDB 3VFNA 3SDCB 3IJHB 2I60H 3QAZC 3KYOA 4PGCB 4XC1H 3LEXA 2DRUA 5DMKA 1CICA 3O4LA 2CMRL 1AD9B 3N0PB 4NCDA 4E41E 5L2KB 1X5JA 4LNRA 1I3GH 4J8RA 1CQKA 4ZO8A 1OT2A 3QQ9C 1ZVSB 1VADA 2EE3A 3LKSA 5HDLA 4Y1AB 5ICZB 2H32H 3LZFH 4TTDD 5IF0A 4E0RA 1RUKL 1PKQA 1ZHNA 4CU7A 3BN9C 3ARFD 3DV4A 1P7QB 1U41A 1DBJH 4I13B 5IWLC 1DQJB 1KJ3H 4JDTH 3MRRB 2H8PA 4XNUL 2DQFB 3IDUA 5IB1B 4L3AA 4PB9L 3CZFA 1KPUB 3H9SB 1H0DB 4NWTL 4HULB 5HHOB 3QO0A 2HWZL 5J4MA 3U79A 3AREA 4PGDA 3CCHB 3FO2A 3X17A 1PW3A 4F33B 2I5YL 5DF0A 1FFQA 4BZ1H 4P2OD 5EOTA 1F90L 3IKKA 4ZG1A 4JKPH 4Z8FL 4LLQA 4KMQA 4NC0B 4TULL 5I73B 4DK3A 3MLYL 1T5WB 3H7BB 3PWNB 3OBAA 3S97C 5FKPB 2ZUSA 3CDFA 3IYLW 3T3PF 5EUKB 4Q2ZA 1R5WB 1MFBL 1F3RB 3FQNB 1KPVB 5GRJH 4YNYB 1CK0H 3V6OC 5KVDH 2N56A 4K7FB 3TJEH 2VDML 4BH7B 4YHNB 5I1KH 1YMMA 3KPRB 1T1YA 3TYFA 1UWGH 4PJXB 1LMKA 5HDOA 5DJDA 4WTZG 1T4KA 4L8CA 1A7PH 2B5IC 4YXLH 1K6QL 2XRAH 4RA0C 4PRAA 4PBVC 4FQQB 4JPVH 2NZIA 3D39B 3CFBB 3HI1A 4IS6B 3HKFA 4XWGL 4JPKH 5I17B 3SDXA 2D7MA 1NEZG 2C1PA 1OD9A 3TCLB 1MCLA 2I27N 2V7HB 4XXDA 4JY5H 1CE6A 4L3ED 4J3XA 1XH3A 3ZL4L 1ZGLP 1IKNA 3JV0A 5C0CE 3WIIL 3K0WA 1CXLA 3IF1B 4M43H 4KJWD 4KJPC 5E94B 4C57C 2WINA 4EN3A 1OTTC 1TNNA 1NFDF 4RAHA 2PYFA 3TBSB 3V5HA 2VXQH 5I30L 4ENEC 5DC4B 2BOCB 1UM4L 3L3IB 3U36B 5A2JH 1IQDB 4QHLB 2Q6WA 2DM4A 3MV7E 4X6DA 3QT2A 5EC1A 2A6KA 3MCG1 2VAAB 4U0RB 5KSAD 4PJAB 5TGBB 3BO8B 5FM4A 3BPCA 2Q8BL 3ULUF 4JQXA 5E99L 5JDSA 4XVUD 3GK8L 2IAMD 3D0LA 5F7WC 1RZKL 4KTEL 4P9ML 1U8MA 2DYPA 4P23B 2OR9H 2I07A 5DHYB 1FYTE 1AGFB 3VXNB 3RTQC 4LLYB 4K3DL 4Q7DA 1P84J 3MFFA 3BH9B 1I8MB 4YBLC 3BKMH 3GB7B 4JCLA 4F7CB 3F7VB 2VLRB 4XCEB 1F11A 4DGVH 1QLFA 1I7TB 1FCCA 1KJ2A 1AGEA 4U1IB 4U1JA 4WU7B 2BNQE 3OJ2C 4MHHG 3IVKB 1QBMH 4LOUD 1EERB 4OFPA 3VE0B 2HFGL 3MA7B 5BZWA 3O3EB 5C0EB 2VITA 4NUJB 1QFHA 4J3OC 5DJZB 2E8ZA 4WFGD 3MOQA 4NN7B 3GIVB 4XP6L 5FKAB 2Z4QB 2BVOB 4E5XB 3QUZA 3TNNA 4AEFA 4YGVA 3CAFA 3IFLH 5DJXB 1RUPH 4P4KA 5T1KD 1ED3B 4G6KH 1RI8A 1UWXK 1A1NA 4LVOB 5DEFA 3I2CH 5FGCE 2FGZA 1ACYL 5E8DL 3H2WA 1IEBB 2DD8L 3Q6GH 1KN4H 2Y23A 3QEQB 3P4OB 4MJIA 5F1KC 5HXMA 2ZCLL 2M2DA 1ZT7B 4NQDA 1M4KA 2IADA 4KZDH 3S36X 4ETQB 5BW7A 4R7DB 3H8NA 2AXFB 2QQKL 2FIKB 1D9KA 3GSNA 3MNZA 5MEOA 3UJTH 2OQJB 2UWEA 2BFVL 3JWDC 4PJDF 5F1NB 5GGTA 3WEXB 2ENSA 3QWRA 1YMHA 5LJYH 5KVMC 4NSKA 1EMTL 5T3ZL 3NIGE 1CDIA 2GITA 1Z0MA 1A7OH 1CFTB 2GTWB 3QFDB 1HQ4A 4JFXA 4RCAA 1T3FA 1FE8H 2AJUL 4NNPL 4YE4H 2GHWB 2KDGA 1QSFB 3BJLA 5FCSH 5IIEB 4OFYD 4TYUA 5ISZA 1S9VB 4DGYH 4U1KB 1FG2B 4Z76A 2UYLA 4GQ9H 5GSRB 1W72L 3JWOH 1QSVA 3CH1B 1FFOA 3QUXC 1P5UA 4B5EA 3I02A 4XAWL 3H9HB 5CIPH 3SJVD 2NNAA 2VDPH 4LF3B 3KPMA 3MLXH 4JDVA 1LHZA 3HC3L 4J4PC 4NQXA 1NSNH 4G7VL 3NN8B 1YA5A 1DQDL 2Q3ZA 3GSXA 2X70A 5IMLA 3V4PL 3W2DH 1XIWD 4LSQH 3U4BH 3PL6C 1RZJC 3C9NA 4FNLH 3E6HB 5E7FA 2QJDA 3LV3B 1KLUB 3ETBF 5ALBH 35C8H 1MCJA 4IJ3B 4APQB 4TNVK 2Y7QB 4OQTH 3T0EB 5IMOB 3QHZL 5F7YC 1AFVL 5EFIB 3VW3H 5DUMH 1NJ9B 3MJ9H 4MNQE 3VXSD 4HZAA 2CUMA 2KQMA 4JO2L 2UZXB 1OAUL 2OXGA 3IU3A 3MLWH 4H88L 1AHWC 3PQYD 5HI4C 5GS0L 4HQQH 2OL3A 1U91B 3NZ8B 2FJHA 5B4MC 4LQFL 4UT7H 1Z6JT 1HILA 4MCZA 2A6JA 1A6WH 2JK5B 2FL5A 2R29H 4P2QE 5D2NB 3WNKA 4X7CC 1NCNA 2AV7B 3UROR 4FA8A 4N68A 3HG1A 4PYGA 2NY4C 4H0GA 1Q72L 4GUPA 2GJ6A 5I18H 4P2OB 4ZTPH 1GZPB 1MHHB 3QUKA 4DCQB 4HKXB 3MMEB 3O2WH 3ZO0A 3FZUC 3MGTB 5JA8B 4LDEB 4WFED 3RL1B 1UVQA 3MRLB 4UOJA 2DQEH 2XN9D 5E2UL 2PKDA 4JB9H 3KPQA 4YH6A 3GSRB 1VCAA 4MA8H 4FQCH 1CDUA 1FFRA 2H45A 3ARGA 4LK4A 3D18A 2X44D 2AJXH 4NDMB 2Y4SA 3L3JB 3QIBC 1JP5A 2DQUH 4Q6YA 3QNZA 4PJHF 3WL9A 3WLWC 5CD3B 2NXZD 5HYJE 5KJRL 1LEIA 4OIAA 4PGJA 1FL3B 3MUY1 3KNBA 1WIUA 3UAJC 2RR3A 4P59H 4RMTA 1G9NC 3GMRB 1W0VB 2NX5D 2GY5A 3MXWH 3V7AE 3H9ZA 3B3IA 1CFNB 4POZD 3JZ7A 5IFHL 3IU4H 3MCKA 1XGTB 4GS7B 2ED7A 3W39B 1IGCL 4ELMA 3B43A 1FGNH 2NW2A 5DJCA 3QBTB 2G5RA 4L3EB 3QHFH 4NO5B 1OAZH 2I9TB 1QKZL 4J1UB 4IIQA 4IRSD 1ZHBB 4F9PC 3VFUA 2ATPA 3MUGA 4X6CA 5EPMA 1RHHA 4Z7WB 4CW1B 1G7MA 4UUJA 2NY1B 1KCSL 3QJHA 5F7FA 4PV9A 1U6AL 3QEUB 1KXTB 3HLAB 5CEZE 2IMMA 3WBDA 1HH6A 4KVCL 1BFVL 2E27H 5HD8C 3SO5A 5KSAB 3VI3F 4LPXA 1J1PH 3QULB 1FL5B 4ETYA 1FN4B 1FVDA 3MV9D 4KK8D 1AC6A 4MS8D 3U6RA 1B2WL 4NBXB 3HZKA 5ADOH 1NCDL 1DLHB 1IZKA 1F8TH 4LKXA 3RA7L 2EH7L 4K71C 3EYUH 4OCRL 4PY8I 1I1FA 3L9RA 1K8DA 2XWTA 5LGHL 2X4TA 2K9UA 4V1DA 2ZUWA 4BZYA 3GZKA 2XY1A 3O2DH 4GKSA 3GSVB 4U31A 5DGQA 5KS9F 3AS2A 1OARH 3PP3H 4EDXB 1BZ9A 4DKDC 3HB3C 5GSVA 3U83A 2C4XA 4L9LB 5CSZA 3ZYOA 4XPAL 5IM7A 4W4OC 3GJEA 4GW4A 2YD1A 1ADQH 4GXUN 5IW1A 1M6OA 5J3HC 1B9ZA 3OHXA 3RWJA 3X14B 2XZAL 5MEQA 5C6PB 4F2MB 1RIUH 4C83B 2X4NA 4WENB 4R9HA 4WJ5B 5T1KB 1J86A 4LLDB 2B0SH 1GYAA 2AKRA 2VC2L 3PHQB 3NIFF 3L3GA 3OKKA 4HUNB 5LKNA 3S35H 4D9QD 1IC4L 4F9LC 4M7ZC 4LVHB 1DUYA 2AABL 3IDIA 4HLJA 4Z7UB 3F7YB 2EDEA 4Z7VE 4OZGE 1PSKH 4JR9L 4WO4B 5DQJB 4GAYB 4NZTL 3MXVH 2VDKL 4YHIA 5JO5A 2DLEA 3MRDA 3QG7L 4O9HL 4O4YL 4JG1L 4JY6A 3AUVA 1UB6B 2HA1A 3BKYL 2VXUH 1GZQA 4RZCB 5E2TL 1DEEB 1DCLA 3SDDD 4KK5D 1M7IA 3FTGB 5GRWA 1E4XI 4M03A 4BFEA 4ERSL 5DEGA 5DFVD 1S7VB 2NZ9C 1X5AA 3TT1H 4HLZH 3RNKA 3AXLB 4NM8L 4W68A 3VXUB 1KXVC 1MLBA 8CGTA 3O3DB 2BCKB 3BKJL 2JCCF 2CDFB 1ZA6A 4I3RL 2FGWH 2NR6C 4PJ5A 1JPGB 4CDGC 4IMLA 1A0QL 5I1AB 4WUKL 2I24N 3C2AL 4NYLB 2WUCH 4PJCF 3QRFM 4NN5C 2ZCKH 3VD7A 1OGAB 3TM6A 3B8SA 2MJWA 3G08B 3VXRE 3RZCB 4D0BB 1VSCA 2EZ0C 5F72S 5HY9B 3SGEH 1DL7L 5BS0D 3SJVB 3DRTB 1YEEH 4P5KB 2VLKB 3E2HC 3V2AR 4PJ8D 1J8HE 5LQBL 3VFRB 3C60A 5GS1B 3BRGC 4UB0H 4HS6B 4OT1H 2BHZA 4R8WH 4PRNB 1A7RH 3QAZB 1XIWB 1CICD 3O4LD 4LEXH 1INDL 4JFHD 4NP4L 5KSBB 3VMOA 4WDIB 4XTRC 1J05A 3JWDL 5IMMB 1SJHB 5E5UB 3MLZL 4OI7A 3TV3L 1MFCL 1FZOA 5JXAH 2WMPA 3FRUA 2IC2A 3VFOB 3PQYB 5DJ2B 1U2HA 2XY2A 3CUPB 3QCVH 2AEPL 5BOZG 5J1AB 2RHEA 1ORQA 4AH2A 1PJ9A 1ZVHA 4GMTH 5ITFA 4OD3L 4NKOA 4TPRH 4Y5VA 2DWEB 1F3JB 4JZJC 3K3QA 4Z5RB 4FABL 5C07A 3ARED 3UPRA 4LPTA 2NQCA 4QWWC 1AP2A 3KLHC 3ROLA 1S7UB 2P5EA 5J11C 5L0QC 3MV11 1MFAL 1IGIH 3EYSL 4Z0BL 3SCMA 5E70A 3BMWA 4TUOA 4OSUH 3QXTA 2Q86A 4P9HH 2Q7YA 3FT2A 3L5HA 4ZFZA 2G75A 1CXEA 3L3DB 3RUGB 3VFPA 3MLRH 5KANG 2EE9A 3BP5B 2XN9B 5FA4A 4PJ9C 4QXTB 4PRHE 3EGSB 4I1NB 3ILPA 1YZZA 4HT1H 2EDQA 3P4NA 1OSZB 3PV6A 1C5DB 1YMMD 1QYGH 1PY9A 1RZJL 1NCAL 4KHTH 3JUYA 1EHNA 3UTPE 1K9TA 2BZDA 3RVXC 1C16B 1Q94A 2B5IB 4Y4HA 2NXZB 3ZYZA 3WKNA 5IT2L 1TPXB 1WUNT 3RZWA 1NFDE 3MRMA 3MFGB 4U7KA 5JHDE 4QYOA 4RWYH 2EDOA 3LH2H 1UFUA 3LRSA 1MIMH 2ADJA 3IDXH 1AKJA 5L6YH 3HNVH 4GH7B 4XMKH 1XF1A 4WW2F 1MHPH 1X4ZA 4HUKB 3UTTE 2VLMD 4QKXB 2C3WA 1NFIB 5FECB 3ULUE 3F8UB 2O26U 5JQ6L 2VL5A 2ERJC 4KUZL 25C8H 4MD4A 4LHQB 3KG5A 5E03A 1UM5L 5F71A 4YBQC 1S7SA 3QIWB 3RY4A 1FNHA 5K9OA 4JN2B 1DDHB 2HN7A 5F1SA 1T20A 1FO0H 2XKNA 3WN5A 1TJHH 3JBG7 4MLSA 4H8WC 2D7PA 4H1LH 2R0LH 3P30L 5E5MA 3PHOB 1T0NB 4FFZL 2DWDA 4MA7L 1UKSA 3AB0B 4FQXA 5J6HB 4WCYL 1DQML 3SE8L 1MRDH 1K4DB 1ETZB 2OSLA 3UO1L 4LU5L 1DSFH 2AJSL 5TF1L 1MRFL 1TJIH 1FZMA 1YYLH 3DX6B 3MV9B 1C1EH 4OIBA 3WKMH 3S96B 3VWKB 3UTSB 1MLCA 2AJYH 2APBA 3TWCL 3BOVA 3PNWA 1U36A 1RPQA 3G5XA 1OP3H 2B8OT 3U1SL 2AS5M 2XI9A 1RJCA 1BQHA 4I0PB 1PZUB 1IBGL 3OPZH 4X5XA 1G9NL 3B2UC 2ICWB 4D9RD 4OZIF 3SGKA 1F4XL 3HMXL 4R4BB 2YRLA 4HX1A 1FJ1B 1JK8A 1MFEH 5HHNA 1FCGA 1F4WL 4I9WE 4Y4FC 3HE7A 3EHBC 5EIIB 5IWLA 2W9DH 1BD2E 4M1CC 1L7TH 2J8HA 2MHAB 5HYQB 1ZT4B 4BKLB 4M7JH 3L3OB 3VFGH 3JTSA 3FQXA 1I1RA 1T83A 3RJDA 1UA6L 2DMBA 4NRZA 1ORSA 4ZS6C 2GCYA 3STZA 4YHYB 4PY8J 2YOCA 4HF5L 2JJTC 2EH8H 3DRQA 3QUZD 2UZIL 2J8UB 3OKMB 4NFBA 5EWIH 1QFWM 4PJDE 5GJSL 4G8GB 4G3YL 4P4KD 5E6IB 4MAYA 3WHE1 2O5ZH 4S1SH 2M8XA 2Z31C 4YHKH 2JJUA 5AWNL 3WXWL 1DQLH 3GSQA 4HWBA 5B39A 4G6AC 4GAJL 3CLEH 3VXMA 4IRZH 3RDTC 2ID5A 4G6FD 4YHZL 4OAWA 1FAIL 1LP9F 4O2CA 4X7TA 1SY6L 4PJ7F 1EEZA 2J5LB 2R1YA 3WJJC 1ND0A 1UYWH 5ANME 1JF1B 1FRGH 5FB8A 4GBXC 2X4RA 5E8OB 4O5LL 3RWDB 4FXGA 4FP8L 1D9KD 5B21A 1X5FA 1K5NB 3QDGE 5IK3A 3KYNA 4WUUA 3BZFB 4TVSa 4I8DA 3D9AH 1E6JL 1NKOA 3BKCH 3BN3B 4G9DA 4ONFH 1UXWB 3QWRD 4AQOA 2LU4A 1YEGL 3SDDB 3PGFL 5FYLL 4AENB 1BQLH 5ESVB 2AJVH 4RGOH 4FQ1L 2WBJA 1OAXH 2YRZA 1OM3H 5GGVH 1MQKL 5EO9A 1BJ1J 2AEIT 4I4WB 3EO9L 2D7QA 5CD5C 2OK0L 4U49A 2AK4A 4LDOB 1RJLA 4BFBD 1VFAA 5I6XC 4MJ5A 4YUEL 3T09A 2EKSA 2HT3C 5B8CB 4XCCL 2J8OA 3W0WB 5GRZA 4U1LB 2W9LA 3NOIA 1YYMH 1A5FL 4R2GD 2J12B 4QTIL 2PUQT 3O2VH 5D2LA 4M3JA 3QUXB 2X4OB 4X8JA 4ZD3L 1E4KA 1XF2A 1CFQB 4JFDB 4M48H 3VRIB 4F7MA 4PJ8B 3UPAA 1KBGH 4W81A 4AMKH 1YJDH 5DMGD 5EB9A 3VFNB 4KQ3H 5DK3A 3RTQA 3KYOB 3QFJA 1OCWL 2W91A 3LEXB 4K3JL 3F5WA 5K33A 5JIKA 1CICB 3O4LB 2QQNL 4BUHA 1EPFA 3PL6B 3WMSA 4LNRB 2F58H 1MIEH 4R26L 4J8RB 1RVFL 3DXAE 3QI9A 3MOAL 1WZ1H 3FONA 4B0MM 2GY7B 1Z2KA 3LKSB 5DD3L 4YGAB 4FHBD 5IF0B 4E0RB 1QRNB 1JGVH 1NGPH 1PKQB 1ZHNB 1RFDH 2J88L 4HLZG 5TE6H 4ONGL 4XCFH 1G6RA 1RURL 3RVVC 1F13A 4JFFE 2Y6SD 3CIQA 5FGRA 2H8PB 1V3KA 2CGRL 3MUHL 4XWOC 4JRYE 5BQ7B 1JNHB 3AFLA 3CZFB 4PRBA 3T65A 3QO0B 3HNTL 4GSDH 3LOWA 2NY7L 3P4MA 4PGDB 1U8HA 3JVGA 1YEIH 5I2IA 3LN5A 3OX8A 3FO2B 2EDNA 3HG1D 1AGDA 3FCTB 2P8PA 2NY4B 2GJ6D 1KIUA 2YN3A 3ZKND 5EOTB 4XMPH 3WFHA 3D25B 2WIMA 1DVFA 4DN3H 2VABA 5IV2A 4DKFH 2G5BA 4JZNA 5CJXC 1OPGL 3S98A 3U0PA 4QLRA 4MAUH 3O9WC 1EFQA 3D87B 1I8LA 5D7LA 1AXSB 4M7KL 4WGWB 1T1YB 3K2UH 4N0RA 3KPLA 4KI5D 1QG3A 3TYFB 5E4IA 3ARGD 4D2NA 5DJDB 1T4KB 4K9EH 2QQLH 3GNML 4HK3N 4G9FA 1PAMA 4JO3L 3MGAA 4HMDA 2VMFA 4U3CA 4I2XA 5C08A 3H7LA 2HFEA 1GIGL 2BNRE 5C0ND 3SDXB 5C0BE 3HR5A 2C1PB 3H3KA 1G6VK 5DD6A 4DEPB 1RJZA 4Z7QF 4RFOH 1D7FA 1MCOH 1LO0L 3HAEA 1N64L 4XXDB 2X4UA 4OIIH 2FATL 2ZKHL 4LSSL 1CE6B 4K2UL 3DO3A 1XH3B 4KJQC 1LK2A 2NW3A 3FAXA 5ADPL 3TFKD 3CU7A 1BM3L 4JHWL 5ESAA 1A7NH 2WINB 4EN3B 4OB5L 2VWEE 2EXWD 1U8PA 1HIML 2OTPA 1R3KA 2W0FA 2PYFB 2YUWA 4NOFA 1ZLVH 3V5HB 4OLUH 2P8LA 1UJ3C 3IJSA 1KJ2H 4JRXD 4MNHA 2D0HA 4X6DB 4EI5C 1U2CA 2OP4H 3LVEA 2A6KB 4PLKD 3EJZC 1V7ML 2OZ4A 2CDEA 3BPCB 5K9QG 5JDSB 3BW9A 3D0LB 4OLZL 2EE6A 1U8MB 2DYPB 3BZDA 1A6UH 2I07B 4M5ZL 1Q0YH 1NL0H 1BGXL 2XIDA 2V2XA 2F53A 3PP4L 4K71B 2YZ8A 4TRPL 3MFFB 1MJ7L 3RKPA 4FFVD 5GGRB 1IQWH 4EIGB 1H5BA 5F9WC 1VFUA 4I5BB 1VENA 4FZ8H 1F11B 1QPPA 1I9RL 1XZ0A 3SBWC 2VSCA 3VFMA 5J13C 1QLFB 3OR6A 4WHDA 1KJ2B 1AGEB 4U1JB 1PDKA 5INCA 3DYPA 2ARJB 1GH7A 2QSCH 1DFBH 4ONHA 4RDQG 5FHBL 4S10A 5BZWB 3IDYB 2VITB 4KTDL 4IHOA 4YHLH 3CX2A 5GZOC 3VFVA 3QA3B 4MJ6B 3BFOA 3E6FA 1D6VH 5HTSA 1TLKA 1ZXQA 1DN0A 3KPSA 4RNRA 4H8WL 3LKPA 5I1HL 1E27A 5GGTH 2DI8A 1SBBA 1J1XL 3M1BB 3DECA 1S7QA 5I8KL 4K8RC 4P4KB 1WISA 2EDXA 3SGJC 5C09A 3CDYA 1A1NB 4PJHA 1Z5LA 1H3WM 3NCBB 4KK9D 4OZHE 4NZUL 4JQIH 3GSWA 3VWJC 4MJIB 1W0WA 4NCC1 4KROD 2X1QA 4ODHH 1TQCB 3BGAA 2R69L 3LIZH 4UILL 4NQDB 1T22A 2OCFD 3O6KH 5AUMB 4HG4K 2JCCE 5DK2A 1FIGH 3CLFH 4KRPB 2ESVB 2LU7A 1J5OL 4ORZC 4KPHH 1D9KB 4HZLA 3GSNB 1MJUL 3MNZB 5MEOB 2UWEB 4LASH 1JHKH 3HMXA 4R97C 1KEGH 3RY6C 2JF1A 3MYJA 4QHMA 3LMJH 1YMHB 3H3PL 4I77L 4QRUA 4NSKB 3OAZK 4D0DA 1JF5A 3I6GA 3WFBH 4Z95H 2GITB 5BJTA 1HQ4B 1UZ6F 2HYMA 4C58B 1FQ9C 1T3FB 1YEJH 3S34H 5FK9B 3ULUC 4RGNC 4F15C 5DWUH 5HGAA 3W9EA 1DLFH 4G5ZH 1S78C 4HBCL 4PJ5D 4XC3L 5SWZA 2ITDA 4PJAF 3S3PA 5ISZB 4HBQA 1XCTA 4BZ2L 3ULVD 4U6VL 5JR1H 3IAGC 4MXVF 1TQBB 5C0CB 1MY5A 4R2GB 3LD8C 4Z76B 2UYLB 5IESL 4NQCA 2OL3H 1FFOB 4LSVL 2X41A 4YDIL 5TQ0H 3I02B 5JHLL 1A3RH 3RHWF 2NNAB 3KPMB 4CVWA 5KS9A 4UTBH 4OUOA 3ZT6A 4PUBH 3QPXL 2Y07H 3IJYB 3ARDA 3AU1A 3GSXB 5HDBE 1CGUA 4JZOA 2X70B 5IMLB 4N8VA 3EOTH 4XAKE 3HR6A 3GDBA 4HAGA 3RX5A 1KC5L 3GGWA 3HS0A 2ZNXA 2B2XL 4P46C 5CILL 4KVNH 3ARBA 1JCKA 4XP4H 1QFUH 5K93A 3P0YH 5HVWA 1YUHA 1I1YA 3CFDA 2MTPA 2PYEE 3QJFA 3MO1A 1UEMA 1MJ8H 3IU3B 4P57A 5DURD 2OL3B 1RUML 3BP6A 5DTFA 4UMGA 1G9MH 4K94C 3C8KA 4PY7B 4MCZB 2OJEA 2A6JB 3FJTA 5GPRA 2FL5B 1AR1D 4KDTC 4W6XB 1CF8L 4M61A 4JZJB 3S3JA 3KJ4B 5C07D 4HPYL 4UT6H 1EJ6A 4DVRL 2FYYA 3HG1B 5FXCH 2P5ED 4GUPB 2GJ6B 4RIRA 4XMLL 3BD4A 3QUKB 5E0QA 3SCMD 1Y6KR 4M6NL 2E7LC 1EJOL 3SDAD 2PTVA 5D7JB 5L8LB 5CEZL 2BVPA 3BEVA 1UVQB 4UQ2B 3WIFA 4MB5A 3MJGX 3DARA 3V5DA 4ZOCA 4BQ8A 4Y19E 4L4VB 5HBBA 1SEQL 4UV4L 4NWTH 1UJTA 2VSDA 2P4AB 3EUUA 4EI6A 3PWVB 3NMEA 3D18B 1J1OL 1GHFH 4NKDB 4N9OB 5FCUL 2I5YH 2HLAA 3LEYL 3WL9B 3RVUD 4Y4HD 1LEIB 1O7SA 3QCUL 4LGSB 1YEHH 4XNYL 2X9XA 3KNBB 4XHJC 2VXTH 3CJJA 3B6SB 5IFAL 1KENH 5EU6D 5F96H 2QADC 3B3IB 1KFAL 1MFBH 5DUPH 1TTGA 4NWUL 3PJSA 4PJCA 3RQ3A 1HOCA 2WK2A 3MCKB 5GS0D 4JPIA 4ELMB 3ARVA 1NUGA 4WVRA 3ZDZF 5DJCB 5T1DL 3VGFA 5I1EL 3SKNA 3GMNA 3NCCB 4P5TC 1B4RA 4OM0L 1EGJL 3TNMB 3HRPA 3L5WB 4IIQB 4F7PA 5C0AA 4YXHL 3VFUB 1X3DA 5IG7A 1GC1H 2ATPB 1HHIA 4X6CB 1FBIH 1RHHB 5DHXB 5EPMB 1G7MB 4UUJB 4OZIE 3QJHB 4PJIF 4WFHD 2GYSA 4PV9B 5DR5L 1NMCC 1MVFA 4TN9A 1N8ZA 2AXJA 4HIHA 4FQXD 1CL7I 3CDCA 1GRWA 4Y8DC 3IETA 5JMRA 4CVZA 1AE6L 3Q5OA 4OLWL 5LG1A 2XACC 3ZSSA 4UNUA 1NCCL 3C5JA 4Y16C 3HZKB 5IB3A 3RJQB 4LKXB 4M00A 5EO0A 1I1FB 1T04A 1K8DB 2XWTB 2X4TB 4PLJC 4V1DB 1KB5A 2VDNL 2PO6A 2DAVA 5F7EL 4GKSB 1UM4H 1NC2A 3KYKL 1A9EA 2P49B 5BVPL 5F7KC 4LQ1A 4UI2A 4NPYA 1BZ9B 3BXNA 3MBEC 2QKIB 3G6AA 1ZANH 3G5YB 3GK8H 3MV01 4G6MH 3HE7D 2QSQA 5TFSL 5IM7B 1MHCA 1B6DA 4S0TD 4JN1L 3RWHA 4GW4B 4YAQA 2WIIA 5EBMA 5IW1B 1TCRA 3G6JE 3QIUA 4K3DH 4DZ8A 1LP9E 3H42H 3CVHL 4G43B 4XB8A 5F9AC 3RWJB 4BA8A 4F58L 1MCPL 1BJMA 3DURA 3VRLE 1YY9C 1NC4A 2X4NB 1VACA 5TQ2L 1ZLSL 2IPUG 5SWQA 43C9A 2B7DT 1S5IH 5MENE 2IGFL 1ZHKA 2XWJA 3WFEH 3TVMC 3QDMA 4EOWL 3BP4A 2YD2A 4X98A 2XKUA 1KTRL 2EEAA 1IAKA 4GAGH 1G1YA 3U9PL 3S35X 1QZ1A 2BNUA 2DJ4A 2IBZX 3T77A 2E9WA 4RFNB 2AKRB 2N1KA 3MBXH 3GMLB 4PJ9A 3L3GB 4XRCB 5MP6L 3VXMD 3ARTA 2ENYA 3D3VA 3V6FA 1XR9A 5F6IB 3MUJA 3WLBA 3KXFD 1EEQA 1FGVH 4JY4A 2BRRH 3QNXA 5JXEC 1UZ8A 1NUDA 4ZUTA 1HSBA 1PZ5A 1CGSL 3O6FC 4UIKH 3ULVH 1DUYB 3IDIB 4DGIH 2GQHA 4GBXB 2VUOA 4NQVA 1PBYA 4WUUD 4YHIB 3GJFH 2YUXA 4MNGA 3MRDB 1HHJA 3MTRA 3SKUD 4JY6B 4HGWA 1N6QL 4KJYA 4JAMA 1GZQB 1MUJB 1N0LA 1UCBH 4DK6A 1DBAH 2DD8H 1BX2A 2DDQL 2WBJD 5DEGB 4DAGL 3UYRH 1HCVA 5DHVA 4LCCC 4JFZL 4K23H 4LSTL 4PPTA 1ZA6B 1QOKA 2FX7L 4PJ5B 3NABH 4KJPD 4XBGB 4IMLB 5IHZB 2COQA 2QQKH 1OTTD 3H0TB 5I6XB 5D6DC 4K8RL 1I3RA 5E2VL 3UP1A 4ENED 1A6TA 4ISVA 3CDGB 1P9MC 4ODVL 3TGXA 2VWEC 3SDYH 4C56D 4K7PL 1EMTH 3MACL 4QRPB 2YPLA 3T2OA 5F7MC 2KUTA 4XBPA 5T5FH 5ACMA 2CLRB 3SGEI 4QT5A 4N0YH 4CVUA 3C60B 2AQ1A 1YNKH 1CVSC 1U8IA 4NNPH 1FPTL 1UADC 3RTQD 4OLXH 3QFJD 2H9GB 1PKOA 1QNZL 1BHGA 1I9JL 2FO1A 1J05B 1MFDL 4CBPA 2HMIC 1W72H 4WU5A 1FZOB 1P7KA 4KC3B 4CN1A 3ES6B 3FRUB 1P4IL 4KI1A 2MCG1 5ETUA 2R2BA 2GAZA 5DURB 2D7OA 4X4XA 1XMWA 2P44B 2VISA 1ORQB 4G7VH 3P40A 5TDPA 3V8OA 1KIQA 3WHXA 3PWJB 1C5BL 3ULUL 3NPZB 3QEGL 5ITFB 4NKOB 4Y5VB 5F7DB 3D85A 4WGVB 3X11A 2KPNA 2R2EA 2BVUA 5C07B 1CFBA 2CLZA 3UPRB 2YD5A 2A6DA 3VGAB 1M7XA 4NM4L 3ROLB 4L5FH 4PTUA 4HFUL 3LS5L 1K85A 2HLFD 3BT2H 2J6EA 2GSGA 3SCMB 4TUOB 4JO2H 3HI6L 2Q86B 1AY1L 1QFWL 4AL8H 3FT2B 1CS6A 4ZFZB 2G75B 4HXBL 3BE1H 1MI5A 4OUUB 4OZ4B 5FEBA 4EQ3A 4JANA 1AXIB 4Y5XC 3RBSA 5C0RH 2BDNL 4HC1L 3T3ME 5D7LD 1R0AL 3ILPB 4ZS7H 2YKLL 3P4NB 2IPKA 5M95B 4HUXB 5FYJE 1DR9A 4LCUA 1FVEA 2F74A 4J3VA 2BJML 1AQKH 2Y36L 4CADA 4G9FD 1IC7H 1Q94B 4Y4HB 2B1HL 2XWBB 3MRMB 4QRRB 4QYOB 2XQBH 3LRSB 5C08D 2A9NH 4O58H 1FSKC 4E9LA 1DBMH 1AKJB 3SE4A 3ZKSD 1EH9A 1KN2H 1U58A 4OFIA 3K4DA 4JE4B 4PGZA 4LSRL 4OCSL 3LEVL 3WO4B 4K94L 1OQXA 5L2KE 2JB5H 3BPNC 5E2UH 2FBJL 2IPTH 2BSED 2VL5B 1XGQA 4MD4B 1CDHA 5CGYC 4U7SA 1J8KA 1YPZF 1S7SB 1N5YH 1J10A 4XP9H 4Y1AE 5K9OB 2Q7NA 1D3CA 5KJRH 2HN7B 2X09A 1JRHH 2W07A 3HZYB 1T20B 4J3SA 3JSSA 1KELH 1HCFX 5HHMD 3GKWH 4LCYA 1JGEA 1QSEA 5JUEH 5E2WL 4MXQC 2E7BA 3W81A 5E5MB 3H9SE 2GFBA 5HHOE 2DWDB 4TSCL 3TO4C 4EI5B 4FQXB 4DFIA 1IARB 1GJIA 2OSLB 3GMMA 4J4PD 3C6LB 4WI7A 2BSSB 1NMBL 3QDJA 4JFEA 4AIXA 5IFJB 1MHEA 5CZVL 3R06A 3PNWB 3K80A 3G5XB 1T0MB 1QLEH 5D7KD 5DRNA 2F53D 4Q0XH 5I1GL 1BQHB 1V7NL 4Z78A 4X5XB 5IJKA 2UVFA 3EFDH 4JQVA 1N59A 3WE6B 1RIVL 2BXZA 5KAQG 4HX1B 4KHXL 1A47A 3P11L 5EG6C 3TPUB 2EYSA 3KPRE 1JK8B 1X4YA 5HDQH 4KVCH 5HHNB 1NAML 4PJXE 4HWBH 1NLDH 1NBVH 2ICEA 3P73A 4UDTB 3HE7B 1SYVB 3V0WL 1ZA3A 5B4MD 4HIEA 2Q76A 4X4MA 3PXHA 5DQDL 3PF2A 3D39E 3RA7H 5I8EA 4UDUB 1XGPA 3EJJX 3FQXB 3ZLQC 4UU9A 5LGHH 5T1LA 2NY6C 1Y18A 2DLTA 4NRZB 4KU1A 3KPSD 1ORSB 1HKFA 4ZTOH 2IF7A 3L7EA 3DRQB 3DV6B 5I16A 3I6KA 5C7XL 1QHPA 5EORH 3WXVL 1JGUH 4MAYB 3E8UL 2DJSA 4LLMA 4XP5L 4ZDHA 5C09D 5CJXA 4JJ5A 4OFVA 2DTML 2C3VA 3GSQB 1WZMA 3VXMB 4LRNL 2F15A 5J1TC 3ORJA 3UYPA 4MVBC 4WW2C 1L0QA 3VDBA 3VG9B 1HWHB 1J0JA 4OAWB 2V9RA 4X7TB 4PRPA 3A0OA 4OBRA 3QIBD 5TE4H 2E6JA 1JHLH 2L7UA 5F70A 5E9DA 5A2IH 4PJAE 5FB8B 4ZFOA 2X4RB 1VEPA 5DJ0A 4NQED 4FXGB 3UAJD 5IK3B 3KYNB 4NQTA 2X9YA 3CFKA 2XZQH 1A4JB 3WSQL 4Z7VA 4G9DB 3IDGA 2YD3A 4JEGB 4DN4L 1MWAA 2AXHA 1NFDB 2HT4C 4YHML 3EYVA 2WBJB 3FQWA 4OCYL 4YPGA 1F2QA 1LK3H 4XCYA 1WWWX 5F6HI 3RWFA 1I8IB 4PJBA 4LLWA 4QTHA 2VLRE 3RKDD 3D6GA 5EO9B 2C9AA 1E28B 3DNKA 4YHOH 4S1DC 3HFMH 2FX9H 1AXTL 2AK4B 5I15H 4YFLI 5IHUL 4Q6IA 4RGNB 3ZE1E 4MQXC 1UC6A 1IL1A 1MNUL 1YN7A 1VFAB 4MJ5B 5SWZD 3MODL 5FO9A 2P5WA 3LSOA 5FDWA 5SWSA 1OLZA 1S7RA 5GJTH 1I7ZA 1V05A 3M17A 4LCWA 4NZJA 4M5YL 3WS6C 3ZTNL 4R6UA 3BKYH 2X1WL 5ECJE 1G6RH 5D2LB 5E2TH 4FXLA 4NQCD 1K3IA 4ODUA 4QRTA 5HD8D 4X8JB 1D5IH 5HVGB 4FFYL 1XF2B 2PW1B 4WV1C 4F7MB 4NBZB 3RVWD 3GRWA 3SOBL 3Q0HA 4XXCC 3ARDD 1Q38A 3BZEA 5GRUH 3QFJB 4FFWD 3N1MC 3F5WB 2WP3T 1J8HA 2W60A 1A0QH 2YBRB 2YMXL 5KW9H 1KGCE 4P46B 1PGRB 1GPOL 2DLFH 3QEQE 3QI9B 4PJGF 3FONB 5D96C 1RQ5A 2YPVL 4E41D 2HT2C 2FWOA 4Z9KB 1DL7H 5J89A 1N5AA 2H32A 2X6MA 3GMOA 3A6BL 1PG7L 3MNWA 4Y4KC 4L9DA 4Z7OF 5DD0L 1YC7A 2FEEL 4PRBB 3RPKA 4QEGA 5J3HD 3T65B 1F6AA 5C0DA 5K59E 1U8HB 5I2IB 3LN5B 1ZVYA 1OAQH 1P2CB 3MLVH 5I0ZA 1QQDA 5GRVK 1AGDB 1AO7A 2P8PB 2LABA 3HE6C 3R1GL 2FJFA 2OBGA 4TSAH 1E6OH 4YDJA 3WFHB 1DVFB 4NFDA 3JXAA 1A3QA 4UT9L 4NOBA 1QSFE 5IV2B 2G5BB 3PP3K 4JZNB 2ZUQB 3UTZA 3HAEH 3U0PB 1Z3GL 5CGTA 4ZAKC 5D7LB 2HJLA 3EFFA 1T66D 3RPIA 3KPLB 3TBVB 2VN4A 3K4AA 2F54A 3MV8B 5DRXA 2IH1A 2NY2C 2F5BH 4NHCH 5ICXB 4F80A 3C8DA 3EYSH 2DLIA 4Z0BH 1T21A 5IR1A 2VR5A 1L6ZA 5C08B 4CMHC 1X5ZA 3ULSA 2HFEB 4P0DA 1CGTA 1LO2L 1MF2L 1NDGA 2OZ4H 1M05A 5IQ9A 5IB5A 3KDMA 1Z0NA 3HR5B 1TTUA 1GGCH 1KEMH 5DD6B 5DD1L 1RJZB 3QDGB 3I6LE 1H3GA 3LDBB 4OCXH 3LY6A 3TA3C 2MPAH 3HAEB 3T0EE 2Z91A 1C7TA 4P2YA 1Q9LB 3UTTA 3KLAA 1ROWA 1LK2B 3HPJA 2M26A 3VG0L 4X6BA 1MRCH 1IAOA 4KMTL 3B8YA 5ACLA 3V6BR 1WBZA 1U8PB 3OZ9L 2Z9TA 5HHMB 5F9OL 1L0XA 2E7HA 3QB7C 1R3KB 5I1IH 2C26A 1T1ZA 3OSKA 5D2NE 2P8LB 3IJSB 4OCWL 3OWEA 3BGFB 4ZPTA 4M62L 4LRIC 4R7NA 2LVCA 4ZXBA 3T1WA 2WWMD 4YFLF 3CU1A 5JQ6H 2XXMB 4KUZH 3PHSA 2DI7A 3EKCA 5D93C 3OR7A 2D31A 3RNQA 2V2XB 3QUMA 2F53B 1NFKA 1JYVA 5ITBL 4XVTL 3DVIA 3B9EA 5LAXB 3T2NL 1NCBH 5TPWL 5LXGH 1H15A 1H5BB 2PO6D 4H0IA 1NC2D 1XZ0B 3VFMB 2OI9C 3FT3A 4TOYL 4WCYH 3OR6B 4XH2A 3UO1H 4S1QH 5INCB 5JW3H 3NPSC 3SKJL 1RU9L 1BQHG 2CRIA 2ZUTA 3V52L 4ONHB 1QBLH 2AXGA 1CQYA 2FX8L 5JIIA 3TWCH 1A1OA 1B88A 4IHOB 4PS4H 3OKEA 2V6HA 4NKIH 3VFVB 2AGJL 2R1WA 3QIUD 4F57L 2IBZY 4FQLH 4NGHH 2X1OA 1IBGH 4WWID 1N0XH 2D03H 1DN0B 4NJAH 1Y0LA 3KPSB 4RNRB 3KLHD 3LKPB 3MOBH 2HRPL 1KJMA 1E27B 1U3HA 3B9KC 1NC4D 3HMXH 1DN2A 4R96A 3ZE0E 3K1KC 1HYRC 1S7WA 3QDMD 1S7QB 4L3EE 1JYNA 3I50H 4PJHB 1Z5LB 5FO8A 3TESA 2PR4L 2VKXA 1OLLA 4HIXL 4PG2C 1T1WA 5D1QC 2VN7A 2DLHA 1I8KA 4PJ9D 3GSWB 5FYJU 1OAKH 1MREL 4Z7WE 2WBKA 3D3VD 1W0WB 4CDHA 2VDOL 2R9HC 1R3HA 1T2QH 1WTGT 1T22B 5CFHA 1EXUB 4ZSOA 5DK2B 1JWUA 4HMCA 3SDXF 1UA6H 4Y5YC 3R8BB 3RL2B 3OXRA 4QRSA 3MREB 4HZLB 4X8XA 2D7NA 4HUWA 5ALCH 2P7TA 1TDQA 2R8SL 4WIQA 5D7SH 3MPCA 3MYJB 4WI4A 2QL1A 4QHMB 1NGQH 5AWNH 1S9KC 3RGVC 4IDJH 1BP3B 1IGML 5ENWA 3I6GB 3L5XL 4PJIA 5BJTB 2EIZA 3SDCC 3X3FH 4LCCB 1D5BA 4OCMC 3MX0A 4P5TA 5J9PA 1LQSR 5HGAB 3WIHL 1SBSL 4Z7NE 4O5LH 1NMAL 5SWZB 2ITDB 1XR8A 1J7VR 2KZWA 5D1ZC 3RI5F 2A73A 2YEZA 3PGCA 5E6ZA 5D1XA 5F8QC 1X5HA 1QACA 4OFDA 3DHMA 1A7BA 3L3HA 5KSVA 2Q1EA 4N0UA 3ARFA 1NUFA 1R3LB 4LFHD 2DIBA 4WFGE 5I0DA 2EDLA 4D9LH 2FZ3B 5EOCH 2YPLD 2IG2H 4FQ1H 5AD0A 5KS9B 5B3JF 3HMWL 4IOFC 3C2SA 5DJYB 5DA0B 4LIQL 5FM5O 1NCWH 1OTSC 1LNUA 1MAML 4JZOB 5F6HJ 3UXFA 4N8VB 3NACH 4CMMA 3ZDYE 3GGWB 4MMXC 4OJFL 3K7UA 3QPQC 5HVHB 1UENA 5F1IA 4J6RH 4NO2A 5DUBA 3CFEA 3ARBB 1Y6MR 4JKWA 2GUOA 5KN5B 3L1OH 4KKAC 1YUHB 1I1YB 4ZD3H 3CFDB 3QJFB 1CBVL 1WIOA 3MO1B 2ADIA 3GBMH 4Y4FD 4P57B 2DN7A 5T33H 4EVNA 4XPGH 4Z7UE 3BP6B 2G9HA 3E0GA 2IFFL 3GI9H 5DTFB 4EUPA 2HTLD 2HJKA 4OM1L 1MH5B 1CDCA 3C8KB 2OJEB 4NRYA 2ZJSL 4QXWA 1I85A 2XTLA 1OCWH 5FYKD 3D85D 4M61B 2DQJL 1EO8L 4H20L 2NTSP 4YX2H 5GZNC 2FHFA 4TVPD 2FYYB 4CNIA 3RX8A 1OP3K 3K8LA 2OLDA 3TVMA 3MCLL 5TE7H 3PWPA 4LCIL 2Q8AH 3VXUE 4ZPVA 1ZOXA 2IEPA 2J88H 1PLGH 4XPHH 5EUOF 3LB6D 4QXGH 1KCVL 3O6LH 1MI5D 2BVPB 3BEVB 3WIFB 3OAYH 2CGRH 5FA3A 3V5DB 3RDTD 5K9JL 5IUSA 1ONQA 2EC9T 2XOTA 4XPBL 4O02H 1IGFL 1OGAE 4MD5B 5FGBA 4J3UA 3E3QE 5H94B 4EI6B 4CL7A 1A1MB 3MLPA 4POYA 2CQVA 3SJVE 5C0JA 2HLAB 1KCRL 4KZEL 2H1PH 2KH2B 2XXCB 2XQYG 4GG8A 4RISH 2JCCB 2ZPKL 3AM8C 4WEBH 1D5MA 4M7LH 4U0RC 2HG5B 4HS3A 1BPVA 5HYJD 2X1XR 3A6OA 1WICA 5B22A 1OPGH 5IGXH 3HI5L 3PJSB 4PJCB 5KSBE 2XTJB 1HOCB 4P23C 4JPIB 2D4FA 1R5IA 3SKNB 1EDQA 4OD2A 3EYQC 2JJSA 1HYSC 1KB5H 4F7PB 3PQYE 5C0AB 1YECH 4OKDA 2HT3D 3BAEH 4HS8H 5D6DA 5IG7B 4AEEA 4FTVB 4NO0A 3ELAT 1HHIB 5TF0A 5BXFB 1AJ7L 2R23B 4PP2A 2VR4A 3HAEG 3U0TA 1I1CA 1WF5A 2MQ3A 5I8CB 3F6IA 1M1SA 3OKNA 3QXVA 3DHJA 4HIHB 2X40A 4N8CL 3ZKMC 4EIZC 1UB5B 1A2YA 1PFCA 1EIBA 4CVZB 1B0GA 4LMQI 2VUYA 5FM5M 2Q87A 3QDJD 4JFED 4K2UH 3GSOA 4GLRH 1AI1L 3C5JB 4M93B 2Y25A 5IB3B 4MX7A 15C8L 3Q6FA 4NN7C 2PW2B 1LD9A 4N5EC 1T04B 1C5CL 3UDWC 4YO0A 1AC0A 3RUGE 5A3IC 3EIFA 2JELL 2XN9E 5F8RC 2PO6B 3P4LA 2EYTA 4JJHA 1NC2B 1VPOH 4IRJA 1A9EB 4LVOC 1IGJA 2ITCA 4MDIA 4YJZL 5HYSA 1QVOB 3CZJA 4W70A 1XGYL 3STLA 4F7EB 1E4JA 2VNCA 3NCJL 3BXNB 1T7WA 3ZE2F 2NLJA 3WD5L 5C3TA 5BV7H 1JPFA 1MHCB 2QSTA 4Z0XA 3RWHB 4XWOD 4GW5A 4YAQB 3SE9H 2H26A 2WIIB 5D70L 5EBMB 3S9DB 4M5ZH 2PYEB 4GW1A 4WW1A 1TCRB 3QIUB 3RAJH 3T4YA 4TRPH 1JNLL 2DQGL 3OJVC 4YC2B 2A83A 3DURB 5T1LD 1S9YA 3ARRA 2NY6B 5J12B 5GISL 4JRWA 1NLBH 2PXYA 1NC4B 2QR0A 1VACB 3B2VH 1HHKA 2ATKA 2A1WL 1ZHKB 5EZOL 1ZSDA 4BH8A 3QDMB 2B4CH 2V9QA 3BP4B 2RBLA 3TJHD 1E4XH 4KI5F 1WEJH 4X98B 3RU8H 1IAKB 2XPGB 3DMMB 2BNUB 2G2RA 3T77B 1IT9L 1WBXA 2R0KH 4GOSA 3PWUB 5DHVH 1AD0B 4WWKA 1BECA 5FHBH 2OJZL 3V6FB 1EUTA 1XR9B 3MZGB 4LLAA 3WLBB 5BV7B 4HXAL 3RFZC 5SV4A 3QNXB 1UZ8B 4R0LA 5FUOL 4OZHA 5DT1L 3CK0H 4ZUTB 1HSBB 4PRPD 1HXMB 1P69B 1PZ5B 5C0FA 3INUH 4H8WH 3SN6N 3ZT7A 1ZHLA 5FUZL 4ELMF 1J1XH 3MV9E 4NQVB 4O51A 2WZPD 3OGCA 3E1F1 4MNGB 1HHJB 4HGWB 4KJYB 4JAMB 1RULL 2OXHA 2FD6H 2CK2A 1F58H 5KVFL 5LBSL 1A9BA 1GOGA 5HHVL 1CFVL 3Q1SL 4X6CF 4WNQB 1MEXL 5DHVB 3B9VA 3S37L 1JI2A 1ZEAL 4KJQD 3MRHA 4U6XB 4DFHA 3ILQD 4AM0B 4LHUA 5IKCA 1JWMA 4IJ3C 4JG0H 4APQC 2NY0D 5CAYB 2P5WD 4FQPA 5SWSD 2P24A 4ODWA 4I3GA 2ILLA 5EU5A 5CKGA 3VXSA 3ARPA 4TTDC 1BQUA 1J18A 3CSYB 1A6TB 4ISVB 6FABL 4FQIH 4ZFGH 4Y2DA 4N0CC 3JWOC 2IH3A 3H3PH 1KYOJ 4I77H 3HUJF 1X5GA 1WZLA 5HGBA 3EJZD 3U9UB 2YPLB 2XZCH 4OZIB 1Q0XL 4XBPB 5D2NC 2AW2A 4XVJH 5FYKH 4B50A 2H41A 3TO2A 4BFGA 3GHEL 1BBJB 1CLZH 1U8IB 4JHAL 4TVPH 4G8GE 4M8VA 1JN6A 4YEFA 1BWMA 1FC2D 3LKQA 4HBCH 4U3HA 5LWYH 4XC3H 1J8HD 4LARH 5D4QA 2VZVA 4P2OC 2M1KA 5FYJL 5C2UB 4JPWL 1U93B 2J6EH 1XGRA 2Z8RA 3VXPB 4KQ4L 5IESH 4KXZH 5D96B 4I18A 4WU5B 2DQCL 1P7KB 5DLMH 4LAQL 3UBXI 5E4EB 2HH0H 5HHXL 3DIFA 4P2RB 1ZLVK 1KG0A 5ETUB 2R2BB 2GAZB 4X4XB 2IPUK 4N8VG 5ID0A 4AIZB 1CLYL 4UV7H 3Q48A 1H3VA 2VISB 2A6IB 1VB9A 5TDPB 5EOQL 2AI0L 1KIQB 3AAZA 3WHXB 1T7YA 4CN6A 3BYYA 3AY4A 1T89A 1VERA 3BD5A 3X11B 1HDMA 1DQQA 2CLZB 1KC5H 2A6DB 3EOYG 3PWLA 4AG4H 3SKOB 4PTUB 1AO7D 1KOAA 1RD6A 1CZ8L 5JZ7C 3HE6B 2NX5A 3LKOB 1LP9B 2GSGB 4K8RD 4PJ7B 2OMBA 3RWCA 1RUAL 4AT6B 5E2JA 1YNLL 2R2CA 4GS7C 5L8KB 1RUMH 3THMH 4ALAH 5EBWA 4JANB 3QQ4A 2F5AL 1PYWA 3Q5YA 4PJFA 2EE2A 3W0WE 1DANT 2I60L 1A3LH 1VEMA 3QQ3A 4XC1L 4RGMB 4A6YA 3MRKA 3MRBA 2ZWLT 4KJWC 3QH3A 1KT2B 3FN0H 3O0RH 3OXSA 4IRSA 4MQ7A 3UJJH 4LCUB 2F74B 4PRHD 3CPLB 4FQHA 1BLNA 1I3GL 3ARQA 2PF6A 4JFDE 3FQUA 1S9XA 4YQXH 4XMLH 5M7QA 3LZFL 1AR2A 2YR3A 4M6NH 4CMHB 5CMAA 5KSAC 1SMOA 2A77H 4LBEA 4C59B 1II4E 1ZMYA 2CD0A 4XVUC 5AZEH 3TPKA 1CT8B 2IAMC 1FLTX 1KJ3L 4JDTL 5JHDD 3O4LE 4OLEA 4D0CA 4JFHE 1QBBA 4KKLD 2I25N 3LKNA 2WP3O 4OQ1A 1XGQB 3ULVF 4M1GL 1AIFA 1KJVA 4HJJH 1MELA 1CR9H 3TZVA 3UTTD 1HINH 1I1AA 1RUQH 1KULA 4NFCA 1QRNE 1S78D 2W9EH 1PKQE 4OGXH 4UNTA 3S5LA 3QCUH 5E1HB 1FO0A 2Z35A 4LCYB 1JRHI 1QSEB 5DS8B 3DX7B 2GFBB 1KFAH 4L9LC 4HH8A 4EQ2A 2NY3D 3MRCA 5GRJL 4ZXBD 1CK0L 5KVDL 4LOUC 1K2DB 3MLTA 3KR3H 3GMMB 2P8MA 4S1RL 4B7IA 4PJGA 5JOFA 1IVLA 5HPMA 1UWGL 4JFEB 2DL9A 1MHEB 1UKTA 5IBLD 1CTOA 3P2TA 4HHAB 4YXLL 1OSPL 2XRAL 1H8NA 4W6YB 4G42A 5DRNB 1JZ5A 4JPVL 3VFTA 3I75A 4Z78B 1U3JA 5EZLA 4GMSH 1N59B 1JL8A 1H3XA 4MB4A 2NYYC 5DR5H 2VTFA 4PRIA 2GT9A 2EYSB 4HW6A 4BFIA 3UX9B 1VDGA 4JFYA 4U1GB 5H37G 1SHMA 2ICEB 3P73B 5JW5A 2BHYA 4LLUB 1ZA3B 4HIEB 5E1AA 4DWHA 2Q76B 2X42A 1GGBL 4DUVA 3HCVB 1WV7T 4FG6D 2EYRA 4I9WD 1REIA 4LVHC 4M43L 1FG9C 1R3IL 4LVEA 1XGPB 1RZFL 5FO7A 3MR9A 3SDXE 1BD2D 4UU9B 1FL6A 5T1LB 4WO4C 2FH6A 1Y18B 5KVEL 1KIPA 3D5OF 4L8DA 2VDNH 2VXQL 3G6JA 3L7EB 1U3HD 2JJWA 3BUYA 5DGRA 5BVPH 5I16B 1LO4H 3I6KB 4GKZA 2CIIA 2NY5C 4LLMB 1WBYA 4ZDHB 3EJYD 3ZHDA 5J56B 4PP1C 5KZCD 3EOAA 2C3VB 3CFJA 4JN1H 3RWEA 4XNQA 2A2QT 5CJ5A 2OR9L 1TJGL 3MNVA 3OG6B 1MCPH 1CG9A 3QRGL 4X6DE 3VH8A 1JIBA 4PRPB 3VA2C 3BKML 2H2SD 1K8IA 3ZMRA 5FHAL 5E9DB 3CSPA 1WJ3A 4Y5YB 1WVZA 4ZFOB 5DJ0B 1ZLSH 2Q20A 5I8OH 3E3QC 2RQ8A 5CJOH 2FCBA 2IGFH 1X5YA 1XF3A 2CUHA 4DGVL 3W11D 3RZCC 4UBDD 3U9PH 5IEKA 3NFSH 3CFKB 5BS0A 5I9QC 1WFOA 4JO4H 2YD8A 4QGTA 4HWEH 1OTUD 1MWAB 1H3UA 1P4BH 1QBML 3GRWH 4YXKH 5MP6H 5IROA 5EBLB 4GG6A 1JGDA 3FQWB 4D9RE 4YPGB 4TSBH 3GBNH 2YWYA 1XIWC 3RWFB 4PJBB 4QTHB 3CSBA 1OW0C 1H3TA 4P5TD 1MCEA 2IWGA 3U4EB 1VFOA 4Q6IB 5DDHA 1IL1B 1YN7B 5FDWB 4KTYA 2P5WB 3LSOB 5FO9B 5SWSB 3IFLL 5D1ZB 1S7RB 3M17B 4QCIA 5FYLE 4G6KL 5D1XD 1G7LB 2WUBH 4LCWB 4J3WA 4OF7A 5DRWA 2CKBA 2XKSA 1TZGL 3FFCA 4ODUB 4QRTB 1Z9OA 3Q6GL 1VGEL 1KN4L 1SVZA 4DAGH 5CCKL 4O2FA 1M71B 3V8CA 4GRMA 4QHUB 2WLZA 4Y16D 4KZDL 5CJBA 5J0BA 5KTEH 4R90H 3BZEB 3QG6A 3FFDA 2W60B 4U1MA 2DB8A 4HIIA 2YD6A 3DYMA 2WV3A 2NXYD 4K8RH 2NMSA 4CJ1A 5I1CL 4MJIE 3BGMA 4NQDE 2FWOB 3LPFA 5C71A 4J7RA 1A7QH 4K7PH 3MBED 1N5AB 2H32B 2ESVE 3ECBB 3GMOB 3DXAD 1A7OL 2EDBA 1PG7W 3BH8A 1FE8L 2Z0BA 2UWEE 5KSUA 5ESQA 4CVXB 3LQAH 1HQRB 4HCRA 2F19H 1WAAF 1F6AB 5C0DB 4JFFD 2ED8A 2NXZC 1TPXC 4BSVB 1I9JH 4DGYL 3I3BA 3O8XA 4JRYD 1QQDB 3VXQA 1AO7B 2BVEA 3B5TA 4PYHA 4GQ9L 2FJFB 3D48R 3JWOL 3TVMD 4POZC 3PWPD 3LPGA 4YDJB 3RRQA 4L8SA 4P9HC 2VDPL 3TC9A 5KOVC 3MLXL 4GXVL 3UTZB 4BSWA 4S2SB 4AJ0A 3FAWA 3CVIH 3QYCA 1UQSA 5ISZE 2ADFL 3QIWC 2E9BA 3W2DL 3QEGH 2HJLB 3EFFB 2ZZUT 4L8BA 4PGBA 4LSQL 3RPIB 3U4BL 2Y06H 1ZLUH 5JPMA 2F54B 4FNLL 1HNGA 5AEAA 1BWWA 5DRXB 2IH1B 5ALBL 35C8L 4X7DC 4RX4D 4OQTL 1P53A 3LS5H 2VO5A 5D8JH 3VW3L 5DUML 5GQBA 4YZFF 3MJ9L 3WDHA 1T21B 3T2QA 1WIPA 5IR1B 4NQSA 3AB0C 3MLWL 4NKMA 1NDGB 4HQQL 5IB5B 5IQ9B 3KDMB 1KACB 4UT7L 3LKRA 4MS8C 2VLJA 3VWKC 1A6WL 3IJHA 2YK1H 2BNRD 5E8EA 4N0FA 5BMFH 4PJEF 2Z91B 1EHLH 5C0BD 3QUMH 2HVJA 4Z77A 3KLAB 3NA9L 4I0PC 3HPJB 5D2LF 3BDXA 2Y36H 4X6BB 3WNOA 1IAOB 1KNOB 4GRLA 2A9MH 5I18L 3DVNA 4ZTPL 4WI8A 4QNPF 4NO0D 2B1AL 5ICZA 3T4AA 2FJGA 2V5YA 3O2WL 2ZUXA 5D5MA 5LGJB 2DQTH 4ZPTB 1UACL 2DKMA 3BQUA 4R7NB 2NY3B 4XCNA 4ZXBB 2ORBH 3GJFK 5IB1A 2DQFA 3U30B 1MCKA 2DQEL 3ZE2E 4KKBD 4KK6C 4X9BA 3HG1E 5JW4M 5CUSH 2UY7A 4MA8L 1IGYA 2GJ6E 4FQCL 2QQQA 1TENA 2AJXL 1UM6L 3OR7B 5GIRA 3R8QA 2D31B 3RNQB 2DQUL 1FH5L 1Z9SA 4YHYC 1KF9B 1UEYA 4KV5F 3DUUA 2XA8H 4PGEA 1CXHA 3MRPA 3DUHA 4Q9RH 3BRFA 4P59L 1H15B 5E6IC 2AEQH 2HMID 1MJJA 5I1LA 1HWGB 2PTUA 3MXWL 4L4VE 5EO1B 4IRJD 1G1CA 1T7ZA 3AS3A 4OGYH 4QY8B 3IU4L 3FT3B 4YNYA 4K7FA 4XH2B 5DI8A 4BH7A 5H2BA 1FGNL 1EX0A 4DOHE 4PJXA 1OAZL 3I3EA 5FIEA 4PD4J 1A1OB 2J5LC 3OKEB 5EUOA 3D0VA 3MRNB 2RAMA 5CBEB 1I7UA 1DEDA 4ZOBA 3A67H 1Y0LB 4RAUA 2EDHA 2BHUA 1KJMB 1U3HB 2PXYD 4ELME 4R96B 5I17A 3SO3B 1Q9OB 3FN3A 4C4KO 5JIPA 1CD1A 3SDDC 4ZUSA 4KK5C 5FO8B 1J1PL 4ODBD 3WNPA 2ED9A 2CSPA 5C2BL 1HKLL 1JPTH 1T1WB 4WWKD 1I8KB 4X6CE 5ADOL 1F8TL 5DC9B 5GRVL 3EYUL 1R3HB 5E94A 3GO1L 4XX1G 4ZSOB 2Q3AA 4XPTH 1JWUB 5B8CC 3OXRB 3TBSA 3TYGH 1I3VA 4M02A 3O2DL 2EIBA 1OARL 4OGAD 1A4KA 5C7XH 3FHAA 2DQIH 3SGDH 3DGGB 2VAAA 2AAVA 3E8UH 3BO8A 3IFNH 4PJ8C 5C6TL 2FSEA 3P0VH 2ZSVA 1NAKH 1ADQL 5ENWB 4PJIB 4X6FA 4V1DE 1U8JA 3FQTA 1A6PA 4LLYA 5CGYD 1NANH 1I75A 1D5BB 1TZIB 1VFBA 1CICC 4DQOH 1PX4A 5AAMA 1TXKA 3GB7A 1RIUL 4LHUD 1XR8B 1HZHH 1QR4A 5CJQL 5BRZA 5JOPD 2A73B 2YEZB 2ZG2A 4R4FL 3KYMA 2NY5L 5D1XB 4KY1H 4MXQD 1YQVH 3N06B 4WU7A 2B0SL 3SE3A 4WI5A 3L3HB 4Y2DD 5KSVB 4N0UB 3TO4D 4DN4H 3ARFB 3IVKA 1AGBA 1O0VA 5ABDE 5F21B 4ZUVB 4EUPH 1R3JA 1WWBX 3FB7A 5E6YA 4YHMH 1FNLA 5CIPB 5C0EA 2HFFB 4OCYH 2QV2A 5AD0B 1CXIA 3BPLB 5DJZA 5IVXF 4F8QA 3V0AC 1ZTXH 4JO1L 1YJDC 1J0IA 1SVCP 1W2KT 1LNUB 5FKAA 5C0IA 4CMMB 2BVOA 1MNUH 1HNFA 1PSKL 5T5NF 4FXKA 4J3TA 5DJXA 3MXVL 1ED3A 3O41A 3M07A 4M5YH 3CFEB 4NO2B 3C09B 1F42A 2VXUL 2GUOB 4U4BA 2C4FT 1IEBA 1QSZA 4HV8A 4Q58C 2SEBA 3P4OA 1FDLH 3AROA 4EVNB 4PD4K 7FABH 2D9QB 2G9HB 3CFCH 3ME0A 4EUPB 1IMHC 3LN9A 2HJKB 1KTLA 4NRYB 3CSGA 5JPNB 4ETQA 4R7DA 5HGHB 2AXFA 3OJDA 5EDXA 2YD4A 4MA1C 1FNSH 4WY7H 1JFQH 2KZ1B 2WUCL 4CNIB 2ZCKL 5I1DA 1GPOH 3PWPB 4TTGA 3GI8H 4DEPC 5FFLA 1YEEL 1DJSA 1PG7H 4PJ5E 2QHRL 3QFDA 3A6CH 4U6TA 3U7WH 3KVQA 4UB0L 4OT1L 5DD0H 2MMXA 5FA3B 3ULVE 4R8WL 1ONQB 1IKNC 2W92A 4O2EA 5D7IF 1N4XH 3F58H 2DM2A 4JFOA 4Q74A 4IMKA 4EN3C 2VDQH 4K9EC 4NUGH 4QRPE 4U1KA 5C0JB 4Y19D 3QUYA 3N85H 3L5JA 3G04A 3R1GH 1CU4H 4JRXA 1CL7H 4GG8B 3K81A 3UTQB 5ICYA 1FNAA 1DBBH 5EA0L 1D5MB 4HS3B 2CDGA 3UZQA 4JQXC 3QCVL 1ZWIA 2IAMB 3HHRB 2P1YA 4O00A 4GMTL 3VD9A 2R0ZH 2V5TA 4D8PA 1FC1A 3TH2T 5IOPA 3MA9L 4TPRL 5ERWA 3U46B 1RMFH 2EDRA 3NH7H 2BXYA 4N5UA 3HUJA 3TZVD 5IQ7L 2DMCA 1I1AD 3WS3B 2DQDH 4APQA 3T0EA 4RMQA 1UCTA 5EFIA 4KWUA 3DX9B 3C5ZA 1IGIL 4X4ZA 2E5EA 4KAQH 4NO0B 5DD5H 3LRGA 4HKZA 4OSUL 2LVEA 3HRZA 1H9VA 4P9HL 1MF2H 1U91A 3OKNB 3MLRL 5C07E 5DD1H 3SKMA 1A2YB 3IGAA 3UYOD 3IDYC 4HT1L 4E42A 4EBQH 2P5EE 1T5XA 1QYGL 3ZSTA 1EA9C 1B90A 3GSOB 4KHTL 4OLYH 4MX7B 3BDYH 3Q6FB 4GLRI 1BBDL 1LD9B 2V17L 4WI3A 1FNGA 4YO0B</