1E4KC

Crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
DLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FC FRAGMENT OF HUMAN IGG1
publication title The 3.2A Crystal Structure of the Human Igg1 Fc Fragment-Fc-Gamma-Riii Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4kC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4kC02
4MX7A 3T3PE 5I8CB 1NLBL 4RMVA 5KSAD 1YEGH 1I85C 4DCQA 3BIKB 1I75A 3WCYA 3MV7D 4MQ7B 5E8NB 4XCYA 5IFHH 3FHQA 1R3KB 4Y88A 5BMFH 1HHKA 1RMFL 4FQCH 1R3LB 2AK1H 5MHSD 2CGRL 5HHPA 1IM9B 1LK2A 3ZL4H 1MY7A 4LVHC 4A6YL 4U1KB 5ADPL 2JTDA 1NGYB 4U6TA 5TE7L 3UTSB 3MYJA 2FLBT 2Y36L 5HYJA 1TZHB 4Z7WF 4HPOL 2EEBA 3STZB 35C8L 2AI0L 2VLKD 4LPYA 1HSBB 2W9LA 2VDPH 3IRZA 1EGJA 1CICB 4YPJA 1LO2H 3V6ZB 1H3XA 1OP5K 4BUGA 4UT9H 2EH7L 4OAWA 5JR1L 4HIIA 4LVNC 3SQOL 3CZFA 1HEZB 2D0HA 3VRLF 5HGHB 4YDLC 4QHKJ 3E8UH 2QHRH 1EAPA 4YBQC 2AJXH 2OTUB 5IFJA 2GI7A 3OG6B 4OBRA 2XN9B 3OJMB 3QFJA 4HV8B 2GK0A 4NZJA 1IGTB 3WFBL 5GHWH 1VGKB 1XCTB 4HX1B 4NQTA 1BGXH 1KIPB 3ZDYE 3QUZB 2LAAA 4OT1H 5KVEL 4NWUH 5KAQG 4Z0BL 5ID1B 4AIOA 4OF5A 3UPCA 1UWEL 2LQRA 3HE6B 1ED3B 2SEBA 4HWNA 1A3RL 5EU4A 5FDWB 1CU4L 2OMBA 3KPRD 2IADB 4PRIA 3F65A 1S9YB 1KIQB 5FA3A 5KVGL 2QADD 4LKXA 3C08L 1KJ3H 3BDYH 3VXNB 1MUJA 3BKJL 4OIAA 5F3HB 5T33H 4DW2H 3SKUD 1HQRA 2X4SB 2H1PL 1KEML 4EN3A 3IU3B 1A6UL 4ZDHA 4L8CB 1FP5A 1ADQA 5IGXH 3VJ6A 4XPHH 4WEBH 2FJFB 1HXYB 3ZT5A 2C3VA 3L7EA 5DRWB 5HPMA 3KJ6H 3QG7L 4BA8A 3SDAA 2D2OA 4Z77A 1N0XH 1NBZA 1F42A 2XNAA 4P2OD 1IT9L 4O4YL 4K94H 4KZDH 1C16A 4LPUA 4F80A 2R4RH 4Q6IB 3NZHL 4XVJL 3BHBB 2GEEA 4MLIA 3WIIL 4MXWL 3QXDB 5ICXB 4G3YL 4Z7UE 3RI5K 1IFHL 3V5KB 2FO4B 5T5FH 1TQCC 2DQUH 4M00A 3D87B 3QQ9C 5F7MC 1KCRH 3LKPB 3ZE0F 1DLHB 1AKJD 3V5DB 5FYJE 3ILPA 3KPMA 3B8SA 5J11B 4ONFH 4OUOA 4M6OH 2ZZUT 3K1DA 4F9LA 5JW4M 4DWHA 4ETQA 4O9HL 4I1NB 1XH3B 2P45B 1Y0LA 3NFNA 2MHAA 4KK6C 2PXYC 1FO0L 2DLEA 2WBJC 3QWOA 5K9KB 1KCLA 4LQFL 4XMPH 4XP6L 3HZYA 2CDGB 3TBVA 2XZCL 1DFBL 1LO3H 4RA0C 5C0CB 4LSVL 4UUJB 3NN8A 1MCCA 5T1DH 5JXAH 3T3MF 2CGRH 5HHMB 1IBGL 1YEIL 3UTZA 2VLRD 3K7UA 5DUBA 1IC4H 4MNHA 3FO1A 1MLCA 4UV4H 3TP4A 4JFXB 35C8H 1SMAA 4F7EA 3MOQA 5DUPH 2JJSC 3OAYH 2ZSVA 2MWCA 3C5JA 3FQTA 1M1SA 3CSGA 2JJWA 5BVJB 5CWSA 4BFGA 3FTGA 1IAOA 3PGCB 1DBAL 1A7OH 2VH5H 3N1MC 1QBMH 2ATPB 1FL6B 1MFBL 2IPKA 3QUMA 2BSTB 1NGZB 3WYRA 4Q9CA 3ARXA 4KZEH 4PJ8A 1D5BB 5CJQH 3LS4L 2I9TA 2WQRA 5MEQA 3P30L 2XTJD 2IH1A 1TETH 3ROLA 2R0LL 5C70A 4I2XB 4R0LA 1CLZH 4HBQA 1Q0XL 2V9RA 5IKCB 3KPSB 4DAGL 4XMLH 2F8XC 2FL5A 5GGTL 3QUXC 4DVRL 5L8LB 1MJJB 1CZ8L 3WO4B 3CFBB 1KELL 4P5TC 5C0AE 1IC5H 3IKCB 2KZWA 4WHTA 1RY7B 2E9WA 4QWWD 3SO3C 1WFUA 4U1IA 4XWOD 5J7CC 1R5WA 3X11B 2YUXA 4NBZB 3DVGB 4DGYH 3RNKB 1KF9B 1CQYA 1QG3A 4U6VH 2AV7B 3PL6D 1D5ZB 1FYTA 2ICEA 4KUCD 1RHFA 5IHZB 4XNMA 4L8SB 1AGDA 5E95B 1ONQA 4MS8C 3RWIA 3QH3B 1MAKA 1P84J 3MRNA 4LGPB 3M07A 4HUNB 3L3HA 4I9WE 1MJUL 3QG7H 4HJJH 5D1QD 4NT6A 1N8ZB 3HC3L 3WSQL 4LAJH 3EIFA 4LDEB 3SJVB 5JDSB 1OT2A 5TQ2H 4F7TA 3VWKC 1JHTB 3GSNB 3TM6A 1U42A 2OM5A 1IFHH 5GJTL 5LG1A 2BSSB 1XGTA 1IILE 1BX2B 5GGVL 1SJHA 3LEXA 3B9KD 3MRFA 1PG7H 3MV8E 1T2JA 2CK0H 1R0AH 4N5UA 1OARL 3BPOC 3LN4B 3ULSB 3RTQA 1ZA3B 4U7MA 5EO1B 5DMYA 4HCRA 1NMAL 3V5HA 2XG5A 3WXWH 1NH6A 3O6FD 1HIMH 1VFAB 2I25N 2PUQT 3DARA 1PKQA 2EIZB 4W81A 3FFCA 3RPIB 1RZKH 5INDB 1BQHA 5KN5A 4BK5A 4CMHB 3QUYB 1U0QA 3QI9C 1FL5B 4IHOA 5D1ZA 5DI8A 5LGHH 4D0CB 3ZKMC 1I9RL 4FZEL 4G9FB 1Q0YH 3SKJH 5I71C 4AYFA 2ILLA 4D9RE 3MBEB 3NCBB 5ADOH 1BIHA 5HGBA 1BM3L 3MZGB 3OF6D 5TF0A 5I8OH 5ANME 4KKCC 4XNZC 4NC1E 1K6QL 5IP4A 1MQKH 4FQQB 2C5DC 4LLDA 4ZTPL 1RIVL 4P49A 1LDSA 4BZ2L 1E4XH 2J12B 2EDTA 4PG9A 4Y2DD 3FB7A 3DVFA 4GXVL 5JMRA 5ISZB 1U8LB 4GAYA 3Q5YA 3GBNH 4OM0L 4CVXB 1HNFA 2MNUA 4QHNA 5LCVH 5KANG 2V5MA 4XP9H 3T0XA 3DTXA 3TIEA 2VISB 2X09A 1EMTL 5DJ8A 2W38A 3P30H 4OKVA 1V7NH 5GS1C 4QRSA 1IGFH 2OL3L 4AIZB 3H42H 2R0LH 4PJAE 2GY5A 1MCWW 2WP3O 3O2WL 3WIHA 1Q0XH 3MUHL 5IOPB 2DQEL 3O8XD 1MHCB 2NX5E 1G9MC 3PDDA 3KGRA 3EYFB 1DQML 1JGLH 1CZ8H 3K8KA 2YS4A 4FG6D 2C3WA 5F88B 1KELH 4G8GD 1J5OH 4ELMB 1EO5A 3ARDC 3MRJB 5JO5B 2VDQH 3NACH 1Q38A 2CDFA 4PP1D 4TTGA 1G7MA 5EOCJ 3VI3F 3IETA 1EUTA 4JDVA 1X6NA 4PTTA 3ZDZF 4F33A 2HT3C 3QUMH 3OKLA 2EXWC 3VFVA 3ZLQC 1NGPL 3WNNA 3U30C 2NY7H 1J0YA 2J88L 4KK8C 1B9ZA 4XPAL 1RUAL 3B2UD 3R0MA 1DL7L 4FQ1L 1A14H 4NP4L 3RWDA 3BIKA 3NCYS 3RWJB 4MQ7A 3AROA 2CO7B 5E8NA 1EZVX 4LSPH 1R3KA 2BOCA 3EOBA 2FGWH 3HR6A 3T4AB 1R3LA 5C7XL 3C5ZB 1IM9A 5CKAA 4IRJB 4U1KA 5ILTL 3S36H 4JHZA 3UTSA 2JB6B 3FCTB 2VXVL 1TZHA 4OM1L 1QBLH 3M17A 5JW5B 2O61A 2GT9B 5FO9A 3K46A 3STZA 2I07A 5IM7B 1JI2A 1LVEA 1HSBA 3V6ZA 1CICA 3ZTNH 1MRFH 3NCJL 1HEZA 5CIPB 3DI2B 3LN9A 5HGHA 1QYGL 2E6QA 1UKSA 5DMGD 1OVZA 5F9WC 4BKLB 2DMKA 4FZEH 1Q72H 2GK2A 3L3GA 4ZO8A 5IB5B 4UZGA 5IHUH 1T1WA 3WDIA 2XN9A 1IC7H 4OJFL 3SE3C 3K8MA 4LHQB 4YEEA 2I9LA 4OIIH 3U4BL 3QO1A 1BM3H 5C0DA 3LMJH 2ZUVA 1WITA 5C0BA 1VFBB 4WU7B 1XCTA 5CJOL 4HX1A 5GSVB 4DFHA 4NRYB 4MHHI 3QUZA 4GT7A 2ATKA 2XKNB 4HCRH 5ID1A 1CL7L 3MNVB 3K2UL 3BJ91 3MRLB 4KHXH 4U1NA 1NGQH 4HMEA 5KAQF 4HXAH 3DMMA 1AE6H 4U1JA 4OSUH 4LMQI 1LE5B 2X4TB 3B9DA 4M5ZH 5E6ID 3WNPA 1FNFA 4KKBC 4N0YL 1KIQA 5EULV 4NQDD 2EDLA 4ODSL 1YMMD 4L9LB 5JW3L 5F3HA 3ABZA 5C8JB 5D6CA 4YXHH 2R2EB 2X4SA 1JPFA 3IU3A 3QPXL 4OCWH 5TH2B 1OQXA 3QG6A 3N1QC 3QISA 2FJFA 5A16B 5DRWA 1T6VN 3VFNB 1JE6A 4HWUA 1D5IL 5AZEL 1R6VA 4G8EA 1HDMA 2VXTH 4GBXD 4Q6IA 2VDRL 3WFZA 3P0GB 1ODAA 3O3AB 1F3DH 3MV8A 2ADFH 2HFFB 4YXLL 3QXDA 3V5KA 4EBQH 1S7VB 1JHLL 4OCYL 2GQHA 5GGVY 4XNYL 3LB6C 4KKLC 5FAAA 4UAOC 3V5DA 1K9TA 3C8HA 4QNPE 3T0DA 5TPWL 2NR6C 3TA3A 4TULL 3EYQD 1XH3A 1AJ7L 3CDYA 3OGOE 1F4XH 1TJHL 3CK0L 1T1ZB 1NEZB 1G7HB 4RISH 3WIHH 4OTXL 4YBLB 3U1SL 2K7PA 5DEFB 3R8BB 2PW2B 4WHYG 4E41E 2APXA 5E2WL 2CDGA 5C0AD 3WLBB 2Z9TA 2Y6SD 5DRZB 4N0CD 1AD9B 1TQBB 3RI5F 4UUJA 1O7VA 1ZS8B 3FQRA 1J1OH 3OKMB 2F54B 4I13B 1T03L 4K8RC 4G6AC 3JTTB 3L1OL 3RGVD 3TBWA 3IKKA 4JJ5B 4PV9A 1JZ2A 5ANMA 1WQVT 1VACB 5FYJH 2IPUK 2IGFL 4ZOEA 1FIGH 5KSAB 3NGBC 1JGEB 2D03L 1JGVH 1MHHA 3ET9F 1RVFH 3MV7B 3T1WA 2X1PA 2VJXA 4XX1G 4OZGE 3DJ9A 3OKDB 3PGCA 3ROOB 2DBLL 4YDJB 2AJZA 5IW1A 1FL6A 3AB0C 4Y4HD 4TYUA 4L8BA 3N9GH 2FECL 1OTTD 1YNKH 1NGZA 1OSZA 3FB5B 5HHVH 1PYWB 2Q8AH 3JWDH 1VPOL 4RIRB 1XF4B 4PGZA 2VLKB 2A2QT 1MFAL 2JE8A 2OMNA 2QQKH 4JFZH 4AEHL 4U1GC 4ZUWB 3U0WH 2VL5B 2NX5A 3MLWL 5TGBB 2GTZB 3DETD 1T0MA 2PN5A 4KDWA 2GJ6B 7FABL 3V4VH 4P57A 3LDBC 3KPSA 3D48R 4HFUH 5EO0B 4KRLB 2VKXA 4NPYB 4PY7B 5JXED 5J89A 4WEMB 2UWEE 4OCRH 4A6YB 3MRHB 4ZTOH 2EDNA 2XA3A 4LIQH 4WDIB 1EBAA 1SJEB 1HXMB 1W0YT 3DVGA 3L3DB 2XYCA 4EQ2A 2G2RB 2AV7A 1D5ZA 2O5YH 5E8OB 4Q9QL 3I50L 4HIHB 4LSRH 1SQ2N 4JR9L 1RIUL 1HYSC 5DQDH 1J0ZA 5JIKA 3RKDC 4XZUA 4ODWA 4XP1H 3RZCA 2DIJA 4NHUB 5D6DA 4ONGH 3QCUH 4HHAB 4LFHG 1N8ZA 5ICYA 5JZ7D 3KPRB 1SHMA 4NUGH 2QADB 1JHTA 3GSNA 3CVIL 4KV5E 4L3EE 3T1FA 1NL0L 1OAKL 2ZKHL 2BSSA 5EUOB 4EOWH 4N68A 3RX5A 5A2FA 4HKZB 1J8KA 5IV2B 3V0WH 3OAZH 3LN4A 3ULSA 1HHJA 4HS3B 5EO1A 4M48H 4OGAD 4NRXB 3WE6B 4JZJB 1FGVL 3RGHA 3U46A 2NPLX 3NA4A 4RFOL 5CSGA 3VH8G 1S7UA 1NANI 1VFAA 4RGMB 5GRJL 1INEL 2DN7A 2EIZA 5K59F 3R0NA 3RPIA 3RVVD 2WWMD 4CU7A 5INDA 2NXZC 3ZHKA 1I7UB 3QUYA 1I8MB 3V4PL 4FN0A 1FL5A 4QHMB 1IEAA 3VD3A 4D0CA 3UYRL 1UCBH 2PTTB 4O02L 3HN3A 3ARVA 3AREB 1PW3A 5C0JA 3S5LG 3SGEH 1MIMH 1BAFL 3P0VH 3MLXH 1WWBX 4OB5L 4OZHE 4KROC 3MBEA 4ZXBB 4LHJB 3SE8H 3G08B 3MX0A 1DBKH 1U8QB 1BJMA 1JWMB 4YDKL 3ARBC 3QB7C 5I1DA 1S7QB 2GY7B 5DHVB 1RU9H 4JPWL 4LBEB 4NQXA 4YIQB 2BCKA 2H32B 1U8NB 1MCWM 4MA1C 4GMTH 4ENED 1CE1L 2WUCH 2AGJL 3O3EA 1YY9D 5ISZA 1U8LA 1J7VR 3TVMC 8FABB 2VLRB 4KXZI 3REVB 5JDJA 4CVXA 2V17L 5D2NE 5FOJA 4CRPA 1E6JL 1Q1JL 1MH5B 2GUOB 2VISA 3TF7C 1BZ9B 2IF7A 4V1DE 5AZ2L 1FO0B 1U8IB 3MLWH 4FNLH 3SGJA 3RVUC 3D39E 1YEJH 3F7YA 3W2DL 5IOPA 2PTUA 3MLSH 1MHCA 3J8F7 1ZT1B 4YX2H 1NMCB 4D94A 1F5WA 4FABL 4P46B 2QSCL 2R8SH 3V6OA 1C12B 4YNYB 5F88A 2J8UE 2BSRA 5F72S 3P3YA 4MJIE 3MRJA 5IEHA 4K3DH 3TC9A 4WWKC 3IVKA 3H8NA 4M6NH 4Y5VB 2XTJB 1MCPH 2A73A 1FNHA 4XBEH 5FYKU 1SYSB 4UDUB 1P7HL 3QDGB 4R4FH 2ZCKH 4LCWE 2VRAA 5A2KH 1PSKL 4JFDB 1H8NA 1JWUB 1CF8L 1MNUL 4PRHD 2R23A 1Q8MA 2CQVA 1IAIM 2ZJSH 3DX7B 3LAFA 4E41A 3VXME 5I19H 5I9QC 1BD2E 5HY9A 4Z7WE 3GSQB 5HDLA 2B1AH 4MD0B 3KR3H 2IWGA 4KVNL 4X6CF 5A3IC 4HPYL 3LS5L 4PJIF 2DJ4A 2QEJA 3RZWA 1FFOB 5FUOH 1W72L 3C5ZA 2XY1A 1JF6A 3GSWB 4IRJA 3VRLE 4WW1A 2JB6A 1P2CB 2WBKA 1EHAA 3L95B 5SV3A 2GT9A 3ZTJH 4R8WH 3ARZA 3W0WE 1F90L 1CVRA 1RULL 2IC2A 3A6BL 3MJ9A 1BPVA 2QHLA 2D4FA 4BQBA 1MHEB 2WW8A 3HG1E 1RZFL 5IBLC 3QZWG 2X9XA 1D5XB 1H5BA 5CIPA 4OZ4A 5JQHC 1VDGA 3HUJB 3B9KB 2B1HH 2Z8VC 5ENWA 4BKLA 4NKDA 2OJZL 1JHKL 1P9MA 1UVQA 5GRXG 5IB5A 3GSNH 3S37X 1YNLL 4OB5H 5EA0H 4IOFD 4GG6A 2IAMC 1VFBA 5GSVA 1BBJB 4OCXH 4H88L 4K94C 4PR5B 4DKFL 2BXYA 1Y18B 2ZNXA 3HB3D 3I75A 5IB3A 4ZOAA 3AM8C 3MRLA 4OCSL 4M7LT 1T20A 1FN4B 1A6WL 1CGXA 4R7NB 3EYVA 2W0FB 1E27B 4KI5F 1QUNA 1BF2A 1J10A 1QVOB 1FFPB 1IGCH 3TPUA 4WHCA 1D6VL 1QO3B 3EYUH 4P23B 3P4OB 4MNGE 2AJYL 5E8EB 5DA0B 5C8JA 2A6KA 2AJUL 2ESVD 5F7NC 5TH2A 3PDOB 4KKNA 5C9JA 4R26L 3ARGB 3O3BB 4K3EL 4UINL 1PY9A 4AENA 5DT1L 4Y2DB 3J7HA 1VCAA 3GK8H 1VADB 2UUDH 4M3JA 5I0DA 5CP7A 4JFYA 1VKXB 3ZE0E 4UNUA 2MCPH 2X44D 4FQPA 4HLZH 4UT6H 5B38B 1AXTL 2EEAA 1FDLL 3QXUA 4PB9L 5DUML 3WKNA 4JPIB 2R2HB 4Z6AT 3O3AA 4EUPH 2HFFA 4H8WH 4LLMA 1KLUB 3CFKB 1S7VA 4NJAL 5CBAA 4L4TE 4M62H 5CMAA 1FAIL 2ZCHL 3LOWA 5FHAL 3K8LA 4U1SA 3JV0A 3T3ME 4G8GB 3G04A 1AXIB 1NEZA 5BXFB 1NCDL 1TDQA 3VWJA 1KXQE 5DEFA 2YKLL 1DQQB 1JPTL 3D25B 4Q0XH 4W70A 3LS5H 3WLBA 3TO4A 1TVBB 3O4OB 5GZND 1FPTH 1ZS8A 2D0GA 4LCYB 3OKMA 2F54A 5DFTA 4JG0L 3JTTA 3C87A 4ZAKD 3SE9L 1NC2D 1WBYA 1NCWH 1VACA 1ETZB 1NGWB 2B0SH 2KDGA 4P2OC 3VXUE 1RULH 1JGEA 2VLLA 3HE7D 4RGOL 3S3SA 4QO1A 2WINA 2Y23A 3QDMD 4GOSA 2EEDA 2W59A 3JVGA 5D7IB 2UZYB 3CJJA 2HTLC 3OKDA 1FNSL 1LP9F 4H0IA 1BWWA 4YDIL 1SY6L 3BKMH 4YDJA 1ZGLM 4YZFF 3WO3B 2CLZA 1OB1B 1MF2H 1OPGL 3VFMB 4L3ED 5C3LD 2BY2A 4V1DA 3C9NA 3FB5A 1PYWA 4OFPA 3NFSL 4FP8H 2ADGA 4RIRA 2EC9T 4HJ0D 5ESQB 1CFBA 4HBCL 5DD6B 4Y1AE 1DZBA 2ZPKH 3GGWA 4ZUWA 4BM7A 1PZUB 2VL5A 4PJBF 3RJQB 1G0YR 5TGBA 2GTZA 3ZYZA 1UADC 3B8YA 3I9GH 2GJ6A 5C08A 4N1CA 3FB8B 4LPVA 2AEWA 3NIGF 2XWBB 5IG7B 4MJIA 2VC2H 3WNLA 1O7SA 2DKSA 5EO0A 3MJ9H 4Z7UB 4NPYA 3SPVB 5GS0L 2EH8H 2Q76B 1U8HB 1YEHL 3WKMH 5CIPH 3MRHA 2ZUWA 4WDIA 1SJEA 4MNQE 4FQIH 4HZLB 4EN3C 2OR9H 3O9WC 3SDDD 2VLJE 4AG4H 2G2RA 3JWOH 1RZKC 4XI5D 5E8OA 3LKQB 4G7YL 4M6AA 4PJEF 1ZA6A 3MOAL 2QQNL 2OX5A 4K55A 4EIZC 4MAUL 4D3CL 4L4VD 4DGIL 4P4KD 4NHUA 5T3ZH 3HFML 1PEZA 3QJHB 4IMKA 4LHUG 4MZ3A 2VWEC 2P44B 3CFJA 3ORJA 3PHOB 5E6IB 5GS0D 4PB9H 1U8KA 2V5RA 4NQDB 1FZJB 1G6RA 1YMMB 5AD0A 3EJZD 2Y1VA 3FJTA 4Z7VF 5IBTH 2RAMA 3CX5K 5EUOA 3BAEL 2Q3AA 5D70H 3PIQB 4NJAH 4C4KT 4HKZA 4PBXA 5IV2A 4F9LC 3MRDB 3SGDH 1C5BL 5AAMA 4HFWB 2DLFL 3DUUA 4NRXA 2DQIL 5DD3L 3ESUF 4PJGF 1KXVC 1MI5B 4P4RB 3D39D 3BD5A 5KS9F 4ZUVB 1EEZB 2FSEB 4P9HL 2HLAB 4FTVE 5ALCL 5JHDE 3RL1B 2HT4C 4GBXB 3PGDA 1VGEH 4J3UA 1JPTH 1I7UA 4C56E 3PL6C 1FH5L 1QSFA 1QEWB 4WI4A 1I8MA 5J1TC 2CJUL 4JFEE 4JFFE 3BKCL 1T2QL 2J8OA 4QHMA 3S4SA 4FXKB 2PTTA 3PDGA 1N5YH 3AREA 5DF0A 4P2RB 4PB0H 4WCYL 4KMTL 5FGCB 3RAJL 5E2TL 1S8DB 4ZXBA 1RZIB 3BRGC 3G08A 5IMOB 4QXTB 2BRRH 1U8QA 1A6AB 5I15L 3MBXL 1N6QL 1S7QA 1KTDB 2FJGB 5DHVA 2RCSH 5C0AB 3VXMD 5F7UA 4OI7A 4X80H 4XT1C 1Q9WB 1H3VA 3P9LA 5F7DA 5BQ7A 1BD2D 1KJ2L 1ZMYA 2DL2A 2FBJH 2I26N 1F4WH 2ZSWB 3H9HA 4PJ8C 2A0LD 3RGVB 2OR8A 4KDTA 4CMMB 3REVA 4MNGA 3UJJH 1E4KA 1SEQH 2GUOA 1MH5A 3QEQE 1KC5L 4JN2A 4BQ6A 4Y4FB 4DN4H 1BZ9A 3QDJE 3OR7B 4R0LC 3EAKA 1S9VA 5JORB 1U8IA 5DTFB 4POYA 2FYYA 4H20L 5DVKA 2JF1A 3W0WD 1QP1A 1DN0A 3QAZB 5KJRL 5CS7A 3VI3E 1AR1D 1ZTXH 5E4EB 3ZDZE 1A7BA 3KPNA 3HG1D 3MLRH 2AV1B 4P46A 4M1DH 1GIGH 2HTKD 5GS0H 1C12A 4G9DB 1BQUA 4ALAH 4HMDA 2X4QB 3P4NA 5BZDB 3MA9H 4RX4A 3BGAA 4L4TA 2BVYA 1LEKB 4ODTL 2CRMA 1CR9L 2LTQB 4UDUA 1F13A 3QDGA 3VGEA 2NW3B 4HXBL 4N8VA 5H35A 1BBDL 4JFDA 5ACMA 4NSKB 2NY3C 1OAXL 2ICWI 5GRVK 1FVEA 1G7JB 4IDJH 5SWQB 3DX7A 3BE1H 4NKOB 3OAYK 4MQXC 2VKWA 4MGXA 3VDBA 2YRPA 2OJEA 4DOHE 5L2KE 2X70B 1ZOXA 4URTB 5E56A 3O8XC 3RTQC 1FFOA 3LEVH 4BSWB 2AK4D 3FFDB 5HGAB 3GSWA 1B88A 3TWCH 2FH8A 1X5HA 2I5YH 1CDBA 1J1XH 3VDAA 1P2CA 3D18A 3RX8A 3L95A 3OKOB 1HK6A 3QPQD 2F15A 1AGBB 2V7NB 1GAFL 3NH7H 2AKRB 4TUOB 5C07D 2NY0B 2G5BA 1EIBA 1MHEA 5D1ZC 4JDZA 1ZWIA 4UTBL 5CINH 1JRHH 2DKUA 2OR7A 5SV4A 4M7LH 2RR3A 2CJUH 4N5EC 5FO8B 2PNDA 3HUJA 5DS8B 3UCRA 1IZKA 1H3TA 4ORGB 4PJ5D 1JPST 3V7AG 3V4UL 1QFWI 1E6OL 4KHTL 1XF2B 1G6RH 1P4BH 1IGIL 3DYPA 4PJAB 3H9SE 3N06B 1B2WL 1RUML 1L9NA 4WTZA 3QBTB 3UBXI 4KH2A 1QSEB 1BBJA 2W9EH 4HK0A 5FHBH 2J6EA 1N6QH 1NCAL 2G9HA 1H3PH 5F9JB 2DJUA 1NC4D 3HHRB 2A1WL 4C83A 3PHQA 5F9OL 12E8L 1JYXA 1KCSH 1RK0B 5HHOE 4NFDA 4JZNB 1CFTB 1E27A 2P43B 2VMFA 4RAVB 2WIIB 1NFDF 3OKKB 5D5MB 1QVOA 5EZIH 1KC5H 5EOQH 1QO3A 1UH3A 1NAKH 4P23A 1HWGB 3B2VH 4JPKL 5I73B 1DBJH 2Z35B 4JB9L 3OKEB 3QFDB 4LRNH 2P5EE 3VXUD 3WUWG 1KG0B 3ARGA 5KJRH 3Q48A 3O3BA 4GXUN 4M6MH 5F7EL 1F8TL 1RZJH 1T7ZA 2DI9A 3K4DA 4FQJH 4M4PA 2HA1A 1VKXA 1U2HA 1A47A 3MLUH 4TSCH 1RJLB 3KLHD 4YE4H 4P3WA 1I3RB 3MRBB 5DHVH 1MJ8L 3TBTB 1CGVA 3NTCL 3EGSB 3FQUA 2E27L 2XXMB 5BV7L 5E99L 1KLUA 3CFKA 4HXBH 5FUZH 3HNVL 3Q6GH 3MO1B 5DGQA 1G9NH 2YC1B 1B0RB 1GGBL 3TT3H 4Y1AD 3FZUD 1YEDB 2AP2A 2X2YA 2ZUXA 4ODVL 1ACYL 3G5YB 5DEGB 4C56A 3UTQB 4ONHB 3JWDC 1P4IH 3FQNB 4CGTA 3MGOA 3RDTD 4WRLA 5E2UL 5HI5C 1TVBA 5L6YL 1XF5B 5ETUB 5IESL 4MNQD 1QFHA 4LCYA 5HGDB 1NLDL 3EO1B 1Q9KA 4PRHB 1S5HA 2VLJD 3BD3A 4LLVA 3HC4L 5FYLE 3LSOB 4U0RB 5DD5L 1FAKT 1CFQB 2BOBA 1QRNE 1U9KA 3VXRE 1G7QB 3CXDL 4OLVL 3TT1H 3WV0A 5D7IA 2VN4A 2Q87A 4WNQB 4S1QH 2NZIA 3GHEH 4OZIF 3QEQA 4JHWL 1E6OH 2FX8H 5GSRA 4BSVB 2FATL 4WW2C 4R2GC 4YJZL 3IDGB 4NO5A 4R90H 4OZFH 2XA8L 3MUGA 5ESQA 3DX8B 3QUZC 4I3RL 1QFUL 4APQD 5E0QA 4NWTL 1AC6A 3HLAB 4W6WB 1IEHA 1RUKL 1ZHBA 2EDDA 4N0CC 3QIBA 2XQYK 3C6LD 5KOVC 1A7RL 3FB8A 4U1LA 3DMMC 2A1WH 1TXKA 5JHDD 2XWBA 3BSZL 5IG7A 3BPCA 5J9PB 3UO1L 1FCGA 1JNJA 1UKQA 2ZCLL 1W72B 3SPVA 2XQBL 5DSCB 1DUYB 4JFFD 1A4JA 2E7BA 3PQYE 4BUHA 4XBGA 3S88H 4FMKA 4XWGH 4X7DC 4FQHA 5FKPB 3BO8A 3MNWB 3MRCA 1JK8A 1MCEA 1U8MB 2R0KL 2XQYG 4KY1H 3LKQA 4KRMB 4PJHF 5EC2B 3GSRA 4PJXB 1RFDH 5EG6C 2XZAL 3QJHA 1J1PL 3GM8A 3MRQB 5L2KA 2VQTA 2F74B 4JFPA 3PHOA 1P7KA 1U6AL 3NTCH 2IQAA 2JB5H 3W9EA 4JO1H 3MCLL 4TRPH 4PJDF 1MIEH 5BV7H 4K3HA 1T0PB 1CBVH 1FVDB 2ESVB 2B4CL 4WY7L 4XCFL 2R69L 5K59E 1RJZB 1CK0H 4NKIL 2H26A 2NCMA 1CD8A 2E7CA 1JV5A 3QDJD 3TA3C 1BFOB 5EBLB 3TN0D 5GGQL 3ALWA 1KPRB 3PWPD 3T0EB 4HFWA 4S1SH 5FUCE 3CVHA 3OXSA 3CIQA 1ACYH 4PLNC 5MEPB 1MI5A 4G8FB 5JA8B 5E9DB 1D7FA 5HDQL 4LCIL 1T0NB 5A43C 2FSEA 2JK5B 2P4AB 2Y5EA 2HLAA 1FJ1B 4GBXA 5T3XE 3VCLB 5E8DH 3D2UA 5CEYA 4OGYH 4CDHA 2MKWA 2PCPA 4OLZL 3KYKH 2C4XA 4NC1C 4PS4H 4P2RA 2VUYA 3IFOB 5FCUL 5IVZB 1RZGA 4WUUE 3X13B 1S8DA 3HZMA 1RZIA 2D0FA 1FSKB 3EOAB 4XH2B 5IMOA 1Z0NA 2EDBA 3DVNB 4H25B 5DR5H 1A6AA 3CX5J 4HD9A 4XPTH 3BGMA 4WI7A 3GRWA 4HH9B 3CH1B 4O2CB 2FJGA 4U2ZA 2CLVB 4KU1A 5HHOA 3GIVB 1FL3B 3SCMD 5C2BH 4JQVC 4X7EC 4Z76B 3S3JA 1MCRA 2FJHA 4RGNB 3NFPA 4JAMA 4ZAKB 4OGAC 4M5YL 1AIFB 1NC2B 1YJDL 4CMMA 4EXKA 4CJ1A 3VXQB 5B4MD 4WFHE 4ZS6D 1UJ3C 5KSBF 1OAUH 4X4YA 4Y4FA 1E4WH 5KSUB 3OR7A 4QGYA 2WWMC 3REWB 3QDMB 5JORA 4BZ1H 2IANB 4HW6A 1AGCA 5E7BA 1PG7X 3ULUH 1IAKB 3SBWA 5CEXB 4OLYL 3WO4C 2IBGA 2HN7B 3ARPA 2AV1A 2ZCLH 3GMNA 3PABB 1CD0A 1YEEH 4OD1H 5FK9B 3GUTA 4QEGA 1GZQB 1I3VA 4QHLA 2X4QA 5BZDA 5EOCH 1LEKA 1H0DB 1XF3B 1CGTA 1YYML 1MREL 3BVNB 3H9SD 3BZFA 2NW3A 5KOMC 4KQ3L 3DO3A 3RZCC 4GMSL 1HCVA 5D6DC 2GSGB 4X6CE 5BS0D 1R5IB 4PJIE 1WEJH 4LSDA 4E5XB 2XZAH 1A7QH 5SWQA 1V3LA 1JFQL 3P11L 4NKOA 4YHNA 5DO2C 3U0TB 4KPHH 3B9AA 1WLHA 5DJYB 1FZKA 1CIUA 1PG7W 4W4OA 4DUXA 5ALBL 3SDDB 5L9DL 5DXWA 1JPSH 2BNRE 2R29L 4OZHB 4XCFH 4UU9B 4XHJC 5CD5D 2R0ZL 1QNZH 4BSWA 4Z7QF 3U48A 3FFDA 5HGAA 4FXGB 4L4VB 2VDLL 1INDH 4WV1B 3VXRA 5I74C 2P5ED 5FF6B 5LJYH 5TE6H 3ZDXF 5KG9B 2V7NA 4IS6A 4H1LG 2HJFB 2OZ4L 3N85L 2X7LB 4IRSA 1SYVB 5C0NC 5IVXF 2YK1L 1MCQA 3PXJA 3JTSB 4MAYD 4RFEA 5I30H 2W1NA 3CXHK 1TNMA 4ZSOE 3CLEH 5DS8A 4Z95L 5KVFL 4RMUA 4HEME 5CP3A 3G6AA 1K4DB 3RU8L 2CKBL 4GAFB 2DIAA 2BVOB 4JY6B 1QSEA 4KI5E 4XC3H 1C5DB 3CDCA 3CVHH 2J8UB 2M26A 1MRCL 5F9JA 2BY3A 4H8WC 4G6KL 1NPUA 3PQYA 3EYOA 3QSKB 1JMXA 2F5AL 1RK0A 4U6HB 1CG9A 4WU5A 2IPTL 4JZNA 1V05A 4YK4B 1OP5H 2PYED 3L3IB 5D5MA 2AEIT 3T77B 3PWVB 4J1UB 5GS3A 3SGJC 4QRQB 1D9KD 5HI4C 2WUBL 1LEGA 5CSZB 2Z35A 5DJZA 4Y8AA 3VXMB 3WFDH 1E28B 3QFDA 4UB0H 3DURB 3ULVH 1KG0A 4ZYKB 1N5AB 1RIHL 4NO0D 2BVPB 4Z7WB 3S36X 2W92A 4CADB 1JUFB 3MV9D 3T8XA 1S78D 3GRWH 1LGVA 5EN2B 4I0PC 4EI6A 1U8OB 3MRBA 4MA7L 4CW1B 2NY6B 5TF1H 2NY1D 3EGSA 4I8DA 2DI8A 1A3QA 1N6VA 3L5XL 2QQLL 2R4SL 2IBZX 5DVOA 1A9BB 5DK3A 4FFWD 3AS1A 4Y19E 3LKOB 3UBXG 4J4PA 1B0RA 4OQ1A 3I3DA 2FHFA 3GJFB 1QHOA 1BVZA 1ZHKA 1T21B 3HG1B 2EC8A 3BN9C 3G5YA 3D3VE 5IQ9B 3VFSA 2AXHA 1CGWA 3P11H 4WFED 3UTQA 4R4BA 15C8L 3HI6L 5LBSL 3FO9B 2AJSL 1EDQA 1YEFL 3ARFA 4OV6F 3C5ZC 3BESR 3GMMB 5E4IA 2GHWB 1NMBH 2NNAB 4U05A 1XF5A 4XAWH 5I1KH 4WUUA 1I7TB 1LE9B 2AXJA 3OZ9L 4HIXH 5FEBA 3QEUB 5HGDA 3RHWK 3DRTB 2EDOA 2DL9A 1RUQL 4PRHA 1IAIH 3NPSB 4JHAL 3LQZB 1LP9E 2C9AA 5LWYH 3LSOA 1ZGLA 1NQBA 4YZFE 3WLWC 4XNXL 3FRUB 1CFQA 5I2IB 4UV7H 2B8OT 4K23L 1H5BC 2X4UB 3N85H 2ZG3A 2EDFA 1G7QA 1CDGA 4J3WA 2FHBA 4YXKH 3JXAA 4ZO9A 1T7XA 4LVEA 5T3XL 4GRMB 2VZ3A 3FONA 1P9MC 5CZXD 4WNQA 3JWOC 3I84A 4PJBE 2AK4B 4X7SL 5CJXA 4E42B 2IBBA 3UPAA 5DD1L 3RU8H 4YEFA 1QPPA 5E70A 4EDXA 4BSVA 1N64H 1CGUA 1EO8H 2IH3B 2Z31A 3NIGE 3GI9H 5J0BA 4TTDD 4EDWL 1CLCA 1ND0B 2Q7YB 3S6CA 5I1HL 1I1RA 2FX9H 3DX8A 4HJGA 4X6DF 5FYLH 5C07B 3RIFK 3V6FB 3VMOA 3VFGL 1OCWL 5EU5B 5I1JL 1X44A 3HLAA 1UC6A 5SWZE 1EHLH 2ZUQB 4Z0XB 1F3JB 2J5LC 4HUVB 2V2TB 4LAQH 1G6VK 4PJ5B 3CLFL 3VFOB 1JGUL 1FZMA 4M1GL 3OPZL 5T3XD 3HAEG 5J9PA 2F5AH 1DR9A 1W72A 2Y25A 5DSCA 1DUYA 4JRYA 4UIKL 4KGJA 4WFGE 2ZP0T 4KGLA 1FLTX 3HE7C 1F6LL 3DIFB 2DQFB 5FKPA 2IQ9H 4HWZB 5CP3H 3MNWA 1U8MA 1DEDA 1LK3L 5DC0A 1QLRB 1XZ0B 4CN4A 3T65B 4JRXE 3V9FA 1NC4B 4IOIB 4Z7VE 5EC2A 5HYFA 3IF1A 4PJXA 3BH8B 4KTDH 3QXAB 1ZGLP 2EYRB 3MRGB 3NA9L 4TOYL 3MRQA 4Y89A 3LRGA 1RK1B 4TUKL 5BRZE 1VEPA 4KVCH 4ZFOL 2HFGL 1CXEA 1DDHB 4MA7H 4LSQH 4PJGE 1HZHH 3IJSA 4X8XA 4YBQD 5KS9E 3TYFA 3HI1A 2BFVH 4CDGC 1FVDA 4DK6A 3MMEA 2ESVA 2Z8WC 5C6WH 2UZXB 3PWNB 1RJZA 4LF3A 1FV1A 4G43A 5ESAB 1CE6B 3H6JA 3QZWB 1BFOA 1KPRA 1LMKA 4NM4L 3T0EA 1NAML 2K7QA 3VWJC 5MEPA 4G8FA 2ARJA 5E9DA 3H7BB 5JIIA 1JZ3A 2WZPD 2JK5A 2HH0H 4J6RH 1CFNA 4XCCH 5LBSH 1P7QD 3TO4C 4XPGL 5IB4A 4N8CL 3BP4B 2VYRE 4YLQT 4PIRF 5JW4Q 2ADJB 4TVPE 3D6GA 4KFZC 4GKZA 4YBHA 1X5LA 4GUPB 4DKAA 5MEOA 3QNXB 4Y1AB 1A1MA 4GAGH 4P4KC 1AGEB 4K7PY 4OF8A 2C3HA 3IFOA 25C8L 2VLME 1EZVY 3X13A 3D69A 2MMXA 3TZVA 4L29B 4XNXH 5GS0C 5ELIA 4RWYH 3EOAA 1KENL 3JVGC 4K23H 3RVWC 4PGBB 3DVNA 4LLWA 4U3HA 4YHMH 4H25A 2HFTA 1IAMA 3T0BA 1MQ8A 4HH9A 3RDTB 3IXAB 3UJIH 1DBML 1L0XA 1OW0C 5D2NC 2CLVA 3KYMB 2HVKB 1VFMA 1D3CA 4YHLH 1ZXQA 4JREC 5AYUH 3GIVA 4Z76A 3UPRB 2NYYC 1C7SA 5DJCA 1AIFA 1NC2A 1J9CT 2BNRD 2JKXA 3G6JA 4Y4KA 3WEXB 4HGWB 5KZCD 2FB4H 1PFCA 4UILL 3SDXA 3VXQA 4X6BA 1SBSL 5DEZA 4XPFL 5I1HH 1BFTA 2Y72A 2BX5A 4QF1A 3OB8A 2XWJA 2IANA 1X4YA 2PR4H 4D0BA 1PBYA 1IAKA 2DMCA 3ZKNC 3WN5A 4KK6D 2PXYD 5KTEL 3L3KA 2LVEA 1BJ1H 2O93L 3PABA 5C0EB 5HYSB 1CFSB 2WV3A 5AAWA 4ZODA 3IDJB 5FK9A 1XGUA 3DSNA 3O6MH 1S7RA 1MCBA 1TZGH 1UWGL 4DZBB 3DGCR 1HYRC 1S5IH 5FM5M 4ZQKB 1IARB 5CEZE 3MFFB 3QDAA 1P69B 1H0DA 3IU4L 3KNBB 3LKRB 3BVNA 4NQCE 4S11A 3I02B 4I3SL 1DSFL 3C6LB 4IMKC 4KI5D 5JHDB 2DQCH 1YQVH 1AH1A 2H9GB 1XGPB 4E5XA 1GRWA 4QRPD 2FLRT 1IE5A 4IIQB 4JFFB 3N1PC 5J1AA 5DJYA 4IDLA 4DQOL 1WVZA 4GO6B 2D3VA 4FQLH 2O5XH 2CIKA 1A0QH 4M43L 1ORSB 3ESVF 1T3FB 3BGFC 4NGHH 4OUUA 3P73A 4PV8B 2CMRH 1ZT4B 4XCNB 4GKOA 4M9PA 1CIDA 4K71B 1K85A 1S9WB 5C71A 2HTKC 1FLRL 3MROA 4RGMC 2DQHL 3NCEB 5LXGH 5EC1A 3NIFF 5FF6A 5E08H 4JO2H 1U3HB 5KG9A 5F7LB 4DFIA 5DHXB 3IXTB 1NGXB 2B5IB 2E7LC 2HJFA 2X7LA 4PJBA 1SYVA 3QUXD 2HVJB 4M3KB 1EA9C 1Y6NR 4NZRL 3JTSA 2F5BH 3AREC 5HHNB 4P5TD 1LD9B 4PRPD 3LZFH 5INCB 1BFSA 5C6PB 3UZQA 5BW7A 4GLRH 3TN0B 3RP1A 1K4DA 3PWPB 4ZFZA 1BFVL 4B7IA 1KB9K 5J13B 3PXHA 3S8WA 4ZXBC 4LKCB 1RZJC 1U2CA 4EVNA 5BJTB 5SWZA 4P2QD 5J6GA 4U1MB 4Y19D 5T5NG 3AGVA 2BVOA 2G5RA 4LARL 3E6FA 4F58H 2VB5A 2J4WH 1MPAL 4WO4A 3HNTL 3QJFB 3NCMA 1NFDE 3GBML 3MXWL 1WCQA 1C5DA 5FB8B 3D3VD 1DBMH 1K8IB 2VXUL 4PJEA 5DJAB 2IMNA 1YPZB 2H45A 4UQ2A 1G9NC 2Q6WB 1NCCH 3VWKD 4ZUUB 2H2PD 4U6HA 4PGDB 3DXAB 5BVPH 4KK5C 2QKIB 2YRLA 5DMIL 3L3IA 1SBSH 5FKAA 3GM0A 1ROWA 3T77A 4J1UA 4LHUB 4TSBL 5I66A 1MEXL 5IFAL 4QRQA 3T4YB 1ULVA 3CXHJ 5C09B 5CSZA 1Z5LA 5HBBA 1UM6L 2AQ3A 1UWXK 4IMLA 2YMXL 2YUWA 3DVIA 3EYSL 3QCTH 1B3JA 2FX7H 3S37L 2JJTA 3DURA 32C2B 5E5UB 1N5AA 1DLFL 2BVPA 4PRAB 3VFPB 2Z93B 2PYFB 1JUFA 4LOUC 3IFNH 4DOHB 4ERSL 4XP5H 3H9ZA 1ZVSB 1BREA 3VG9C 5E24E 2BXZA 5EN2A 2BK8A 3QI9D 5IQ7L 1HKFA 5DD0L 4CW1A 1ZKAA 1UWGH 1CGSL 1X5AA 2D7TL 4JPVL 3ZKMD 2AXFB 3CFEB 5AWNL 3VH8A 4K2UL 3O6KL 4S10A 2HMIC 4F15B 1B6DA 1A9BA 4OGZA 4JKLA 4ZD3H 3GJFA 5MENE 2AJVL 2F19H 1T21A 5FGRA 4KKCD 2DJSA 3HMXL 1MCKA 3DI3B 2RFXB 3C60B 3VGHA 1G1YA 1KUMA 3MRIA 5I6XB 1G9ML 5IB2B 1UYWH 4XXCA 1V7MH 3S5LA 2NY5H 1H3WM 2GFBB 5K9JH 2NW2B 3FMGH 3FO9A 4G6FD 1X5KA 1AO7E 2ERJB 4OFIA 3X12B 4R6UA 3H9SB 4X4XA 4GW1A 2YD3A 4WFGD 1KSRA 3MYZA 1Z3GL 1I7TA 4LLUA 3PJSA 3QEUA 3RBGA 2P5WE 4FHBD 5BS0B 2DQGL 4FFYH 3DRTA 3B6SB 2DYPA 5IF0B 2BY0A 5IBUB 1V3MA 4Y5XB 3UAJC 4NO2B 1KXTB 4X83A 5A40E 1CDJA 4JRXD 3FRUA 5I2IA 5GGUB 3OAUL 4QRTB 5D96C 5DVNA 1JZ7A 4WHYH 2V9QA 1CFVL 1NEZG 1BIIB 4NZRH 2MJWA 5FXCH 1H8SA 5BRZD 5D1XB 4JM2A 3BH9B 3AS0A 4HEPG 4DZ8B 3FZUC 3ARDD 1EXUB 4TVPL 4E42A 4NHCL 2LABA 2R9HC 5EU7C 3RHWF 2IH3A 3TO2B 2P5EB 4OBSA 4AEIL 5F93C 2HT3D 2HRPH 3OR6B 4Q97A 4Y16B 2XICA 2BDNH 4O51A 4Z0XA 1F3JA 5BV7C 1IL1B 4I18A 2V2TA 4GRLA 3NAAL 3ARSA 1FZOB 2YPVL 3QIUB 4WI6A 4J8RB 3VFOA 5HVHB 3OX8A 4FA8A 3TNMB 4PJHE 3GI8L 3EO9H 1JF5A 2A74A 3KJ4B 4NQCA 2X89A 4NNYA 1F45A 1WAAF 5IFAH 1TJIH 2DQFA 2VR4A 2H6PB 4HWZA 5C0RL 2VLMD 1AHWB 1UM6H 2DQDL 2MOVA 2OI9B 1R5VB 5E2VL 5IW3A 5E5MB 3RIFF 1KGCE 1CL7I 1OT1A 1TZIA 1QLRA 1XZ0A 5FYKH 4PJDE 4QOKB 5DWUL 5IT2H 1NFIA 2PO6A 5C6TH 5BCAA 2R1XA 4LSSL 3T08A 1UZ8B 3MRGA 4N8PA 3JBG7 5I75C 5IWLA 3BJLA 1RK1A 2PYEB 3O45B 2MSPA 4POZC 3MCKA 2CKBB 1DDHA 3QULA 4B50A 4JPVH 4NN6B 1MHPH 3VD5A 4PJCB 2APBA 2C1OB 1D9KB 2YZ1A 3ECBB 4LLYB 2P8PB 1A7PH 1MFDL 5CEZL 1J18A 2EDRA 3GB7B 4LSUL 1KB5L 2JCCB 3PF2A 4F57L 5ESAA 3UEZA 1A8JH 4NO0B 3QZWA 3BUTA 3MV9B 3PGFL 5D93B 5E8PA 4JG1H 1A4KB 2JJVA 2G60L 3BQUA 3LKNB 5DJXB 1MFEL 3PE9A 2DBJA 4AT6B 4PJ7A 5F3BA 2NY1B 2Z92B 1I1FA 1HINL 1KJMA 4Z78B 1U41A 5EWIL 4J12A 2ED7A 4PTUB 4GUPA 1Z3GH 3CU1A 1WSST 4IRZL 2DAVA 3ZHLA 3QNXA 4KKBD 5CEZD 2EYTB 3ULUC 5GRWA 3PWLB 3P4LA 4L29A 3IJYB 3V95A 1HKLL 1OY3B 1Q9LB 3CMOH 1N0LA 5CZKA 4YAQB 5D71H 5JHLL 3RX7A 1I7RB 5JPMB 4OFYD 3GJFH 2VUOA 1B90A 1X3DA 3L6FB 3UTTE 5KSBE 4HIEB 3IXAA 2W0KA 3KYMA 2HVKA 4OIBA 1FORL 1CQKA 5MERB 1WICA 2DTML 4XMKH 1KFAH 2DB8A 4MJ4A 5T1LB 5SWSE 3BRDA 4TVPH 4HK3N 3VRJA 3O2DA 4HT1H 3WUWB 3WDJA 2CUHA 4N0UE 3VA2C 5DVLA 1TVHB 5T1KA 3ZSSA 4ODUB 1CTOA 1BOYA 1R3IL 1PX3A 3AS2A 4K8RL 3LB6D 4KKLD 4N90E 4XP4H 3X3GH 4HC1A 4NNPH 2E8ZA 3MOBL 4IBLT 3GHBL 5HJ3A 3LQAH 3QIBC 5M94B 2A6IB 2P8MA 1UXWB 3DUHA 1I3GH 2NR6D 4PGCB 5EUKB 1KYOJ 5IVNA 5KVDL 3D9AL 3TJEL 3KVQA 1F6AB 2FECI 1A64A 2R0WL 4L9DA 4ZO7A 1XR8B 3IDJA 4P99A 4Q9RH 5C0FB 1OD7A 2WBWB 4DZBA 3NABL 3RVTC 4ZQKA 4JKWA 2O5ZH 3NZ8A 4G5ZH 4N0RA 1CXKA 3KNBA 4K8RD 5C0RH 5TFSL 1OGAD 3I02A 4D9LH 5IHBA 4ZMAT 3ZYIA 3K3QA 4OLEA 3T0AA 4OFKA 2H9GA 4KJPC 2W65B 1ZHLA 4Z7QE 1HHGA 1YN6A 3QQ4A 1OP3H 1RURL 1KT2B 5B4MC 3G5ZA 5BZWA 3U9PL 2AABH 3O2VL 1AD0B 1XT5A 3TCLA 1N2RB 1J0HA 1QBBA 1KN2L 1S9XB 5KW9L 4KJYA 4CU8A 1HH9A 3ZDXE 3GIZH 4LVHB 43C9A 3QEHB 5K9OB 1ORSA 1T3FA 5DJDA 1I7ZB 1DEEB 4PV8A 5IVXE 4ELMF 4F57H 4JFHE 4OZIA 5EZOL 1ZT4A 4XCNA 5D7LE 4C58B 3VGAC 1DVFD 4KK9D 4LVNB 3WL9A 5BO1H 4PJFB 1NSNL 1U3HA 1DQLL 1ZANL 4G80A 4YDLB 3A6CL 2RJMA 1NGXA 3IXTA 3K4ZA 3ZKQD 4X9BA 4R97C 2HVJA 5EWIH 2E5EA 1J11A 1A6VH 3SEPA 5DC4B 1ZV5A 1ZEAH 2ZUSA 3GO1L 4JO4H 5INCA 4NFCA 1OAYL 1RPQA 4NO3B 3ULVC 4JKPH 5HYJE 5F9AC 1PVHA 4LASL 1XAUA 4JZOB 4DEPC 5BJTA 4YGAB 1HKLH 4F7CB 1J0IA 5MEND 1FG2B 1E0OB 1HYSD 1DUZA 1W2KT 5CJ8A 2GAZB 4ZFOB 3RKDD 1NEUA 5FB8A 1U58B 4HF5L 1XCQA 4X99B 5T5NF 1K8IA 5CD5C 1JMZA 2ZOKA 1FHGA 3TYGL 4KUZH 1T22B 1UCTA 3MXVH 3EO0B 3CUPB 3WFCL 2FEDD 1A3LH 1TTFA 4DTGL 4NJ9L 5FCSH 3RY6A 1AO7D 4ZUUA 3OJVC 3DXAA 4FFZH 4PGDA 3QFJE 2QKIA 2V2WB 1AY1L 3CDGB 1I1AA 4UIMB 4M7KH 4JFQB 1CDHA 2EIEA 4HWBL 3VFTA 5GS2H 2P5WD 3MOBH 4LHUA 4KMLB 3T4YA 4HLJA 5I8EB 5C09A 3QAZC 3SBWC 1KPUA 4MAYC 4DKEH 3H2WA 1EEQA 4YQXL 3X3FL 3H3PH 4L8DB 1M7IA 1GGUA 1KB9J 3EDJA 4PRAA 3C09C 5I18H 4GG6F 4AMKL 2A38A 1L7TH 3DOSA 1ZVSA 2YD7A 3PV6B 3D0VB 2NXZD 2R0WH 2VDKL 2GCYB 4PRIE 3VD4A 1TQCB 1MRDH 4M8QB 1K5NA 1XIWA 4O58L 5CD3B 4ZG1A 1A7NH 2AXFA 3NCYP 1X5XA 1OWWA 4I77H 2P24B 3O2DH 2D31B 2K1MA 4HQQH 2ZOLB 3VXTA 5DJ0B 2W0PA 4KROD 4F7MB 3SN6N 2PXYB 4P5KB 4HC1H 4NDMB 3WD5L 4PRNB 1FBIH 2WBJB 3IDNB 4QY8A 2VDOL 3C60A 3ARBD 1JTPA 2Q86A 5BMFL 3FT2B 4W4OC 3RWCB 4FQCL 3G6DH 2AK1L 5B38G 3DGGB 1RJYB 2GFBA 1KN2H 5GRUH 1MWAB 2NW2A 4KTEH 1GOFA 4KTYA 3TVMD 4DVBA 5I1GH 3BW9B 3QQ3B 1CLOH 3WS3A 1A9EA 4U6XB 5D2LB 5BS0A 1LO2L 5ITFB 4UT9L 4X6FB 3VGGA 1FC1A 4QRPB 3B6SA 4NN7C 3HS0B 3N50A 1KGCD 2NY0C 2X4OB 4IRSC 4EI5A 4NKMB 5GGUA 5DK2A 1ZANH 3E8UL 4FQXA 2QHRL 4JDTH 4OI9A 1NDGB 2AJXL 3GSUB 3P9WB 2RGSA 5FA4A 4TNVK 4UTAH 2JELH 3IJHA 2R56H 2EDWA 4X6DE 1T1XB 5D1XA 1MLBA 2NY2C 1BZ7A 3DRQB 3BH9A 2LFGA 1T7YA 1FNEB 1SJVA 4DZ8A 3IDIB 5GHWL 1EXUA 4S2SB 1UZ6F 1JPGB 5ECJE 3VG0H 1BGXL 5CZVL 5IJKC 3TO2A 3WJLA 4OT1L 4NWUL 1IEBB 4BYHA 3M8OH 2XIDA 3TNNB 4TN9A 1P6AB 2PF6A 4Y16A 3OHXA 4RAHA 1MCOH 1TENA 1WCBB 3KWWA 3QUXB 1UFUA 4HIJB 4P5TB 4PRPB 1IKNA 1I1YB 5DK0B 3D5OF 1P6FA 3QIUA 1KJ3L 5JIPA 4OGXH 5FM8A 5T33L 1X5YA 4DW2L 4RZCA 3IYLW 3WNKA 4P2QB 2A83A 5A3ID 1UA6L 1F4HA 5IGXL 2HKFH 4WEBL 1M71A 4MXVF 1RQ5A 3DX9B 3FN0H 1QOKA 2H6PA 3RKPA 5J57B 1XGQB 3KJ6L 1AHWA 3D3VB 3QUKA 3QRGH 2X4NB 3Q5TA 4KKAC 5E5MA 1K4CB 4QOKA 3S9DB 4ZUTB 4K94L 5ABDE 4KZDL 2R4RL 3UTTD 1UZ8A 3VWKB 4LCCA 4EXPX 2YRZA 3MRPB 3LCYA 1DQJB 3ZSTA 1QQDA 5IBLD 1IM3A 5T5FL 1ZE3C 2DWDB 2DQUL 4RFNC 3O45A 1KCRL 2RIKA 1WC7A 5SWSD 3MGAA 4XVSL 4K7FB 4S0SD 3BPOB 1FYTE 2LV4A 2BNQE 4M6OL 4ONFL 2P8PA 3T2NH 3LIZH 4UI2A 4H1LB 4UT7H 4ZFGH 4U6YA 2X41A 2JCCA 1QSVA 4N90D 4JGUA 3QHTC 2IAMD 2DMBA 3OJDB 1QKZH 3BEWA 3MV9A 3WD5H 4XMPL 1A4KA 2VDOH 4LPTA 3I2CH 4MCZB 5TDPB 2MQ0A 1LO3L 5DJXA 1U36A 2NXYB 3QI9B 2WWKT 3ARFC 5JLZB 1HWHB 5T1DL 4X6EA 1V8HA 5JXAL 4HS8H 3ES6A 5IK3A 1RAMA 3L5WB 3MJ7B 3O4LA 4Z78A 2OLDA 2Y07H 1IC4L 5I71B 4PGEA 5HHQB 1J8HB 4UV4L 1F3RB 2ICWB 2YD1A 3HR5B 5D7KD 4CVWA 1S7WB 4DK3A 5DUPL 4HGKC 3BP5A 2FEEL 4XNZB 2X4PB 1EEUA 4LLQB 1BEYL 1PKQE 1Q9LA 3FFCE 1UXSB 5EUOF 4YAQA 5EU6A 5HDBF 1A7OL 2VH5L 1FGNH 4G6FB 1JNHA 1QBML 3L6FA 3VXSA 3GNMH 4GKNB 3HTLX 4QHUB 4KZEL 5MERA 2DQJH 5CJQL 5D9SB 1YMHB 5T1LA 4Q2ZA 2Z31C 3L9RA 4NBYB 1UACH 2FD6L 5CZVH 1R24B 1TETL 2YPLA 3WUWA 5GS1B 2EDXA 1KTLA 1CLZL 1S9KC 1CD9B 4JRXB 4Z7VB 4JFHD 2CO6B 5GGSY 1G7PB 3GSOB 2QSTA 5D7LD 5DZLA 1BVKB 4XMLL 5JNYB 1K8DA 2A6IA 4B7LA 4NQEB 3LHPH 1UXWA 4FMFA 3BRFA 4GW5B 5BRZB 5AUMA 1IC5L 4R3SB 3CC5B 1GZPB 2RBLA 4DGVL 5IJVA 3ARDB 1X5FA 3OSKA 3V2AR 1JGDB 3HMWH 1F6AA 4DGYL 3WXVH 4U6VL 4MYWB 3UBXB 1LNUB 2CDEB 4RDQF 1OAQH 1YUHB 3AUVA 5C0FA 1UA6H 2AQ1A 5JPNB 1JYWA 1C5CH 4MDJA 4ODHH 2GJZB 4HKJB 3ME0A 1OF2A 5HYJD 3U30B 2WQ8A 1ORQA 1QD0A 1P53A 3O3UN 4KC3B 4U7SA 5CBEA 4HJJL 1OLLA 1NANH 3TBYB 5JW4N 3EJJX 2HWZH 4X98A 4AQOA 2KKQA 1KULA 5TQ2L 3QEGH 1L7IH 4XBPB 3GSVB 4TUJA 4D8PB 4LPXA 1AD0A 1KN4H 1N2RA 2A77H 2HTLD 3L3OB 1PG7L 1S9XA 2CK0L 1R0AL 3NIFE 1ZLSH 4JM4H 4XVSH 4DJMA 3FB6A 4XHQA 3QFJD 5LQBL 4MB4A 4IJ3C 3WXWL 5K9OA 5E7FA 1HIML 1DEEA 2EKJA 1YY8A 4YHYC 2Z4QB 1RZKL 3BPNC 1GGIH 5EBWA 4YFLI 5I1CH 2NTFA 1U8PB 5GISL 2Q1EA 5LGHL 1N4XH 4JVUA 1ES0A 1FVCA 4X6DA 5FYJU 1AXSB 5F9WB 1VERA 4KXZH 1Q0YL 4F8QA 3SKJL 2BMKA 1FYHB 3STLB 3P9MB 2DLTA 3U6RB 2J3SA 4PRID 4NNXB 2UYLA 3RL2B 4OD3H 5ADOL 6FABH 3IFLH 4KI5C 3C2AH 4K7PH 3UTSE 4UDTA 4NKQB 5I8OL 3TZVC 4EN3D 3O9WD 4KAQH 1MQKL 1KPVB 4B0MM 1OSPL 1F4AA 4JZOA 1BEYH 3HAEB 4F7CA 4KUCF 1Q94A 1E4XL 1FG2A 2GAZA 4ZFOA 1WIUA 1U58A 4GH7B 4LIQE 3GBNL 3IFPB 5EFIA 4X99A 1INQA 4QHKI 3LEYH 1WISA 5LCVL 2FWOB 2EXYC 3GKWH 1T22A 4XP9L 4HAFA 4Y4KC 1A5FH 1X7QB 1WZ1H 1YEKH 2XN9E 2A6JB 5GGRY 4OCNC 1KB5B 1V7NL 2FD6H 1IGFL 3H42L 5D7JA 2X9YA 3T09A 5I1IL 2AXGA 4GAJL 2Q8BH 1S7SA 5C0BE 3FOMA 3HUJF 1NJ9B 3KXFB 1HHHA 2NY5C 3B83A 1EGJH 5FO7A 1JGLL 4CU6A 3SY0B 2Z8RA 3WN5C 1AQDB 4L8DA 4I3GA 1J5OL 3RWFB 4NZDA 1LDPH 4DGVH 2VDQL 3U36B 1R3JB 4MDIB 3NACL 1T80A 2HT4D 5DZNA 3AXLA 3D0VA 4M7ZC 1XR9B 2GCYA 2VR9A 2BNQA 3RWHB 1CD1A 3QUML 3VFWB 1EFXA 4B41A 4L1DA 1QACA 4UAOB 5CD3A 4PUBL 2NY7L 3RIAF 4JLRA 5H37G 2D31A 5FOBB 5DURB 1X5IA 2ZOLA 3TV3H 2YEZB 5EO9B 1S7TB 1A14L 5TDNB 4P5KA 4YGVB 3SOBH 2H2PC 4JJHA 2WBJA 3IDNA 3OGCB 4LSPL 3FT2A 5IMLB 1C1EH 2FGWL 1BQLH 3DGGA 1RJYA 4B53A 3OJ2C 1WBXA 2NLJB 1MWAA 2IALA 4I5BB 3W39B 5IEKA 2XFXA 3S36L 4ZPTA 2N1KA 4QYOA 1I9EA 4PJ8D 1OGAB 2Y06H 1QBLL 3DBXA 4FS0A 5LQBH 4LQ1A 2CLRB 3BW9A 3BYTA 1MCFA 1ADQH 1XGYL 4JY4A 4NRZB 3NGBB 5ITFA 1WT5C 3RVXD 2R1YB 1NCBH 3ZTNL 2X1XR 1XF1A 1MRFL 5JOPE 2CIIA 2GW5A 5GISH 4PY8J 2CUMA 2X4OA 3KPPB 5MI0B 3TJHC 1KBGH 2BHUA 3RUGB 1JN6B 4P3DB 1Q72L 4XC1H 3S96A 1ZK9A 3JV6B 4TNWK 5IHUL 1IC7L 3AC0A 5BW7C 4JVWA 1T1XA 2OP4H 4OIIL 1FNEA 2ZUYA 3QO0B 5HPOA 4P59H 3LMJL 4S2SA 3QIWA 1JPGA 3K81A 3QP3A 4PJ9A 1FYTD 4U1GB 3F8UB 1ITCA 5DQ9B 4RNRB 1OSPH 4CUCA 3QA3A 4HCRL 4WO4C 3DV6A 2XZZA 4CJ0A 1EH9A 3K1KC 3VRIB 1K2DB 3LDBB 3BDXA 4KHXL 2NY3D 5J6HB 1NGQL 1WAAE 4HXAL 4HIJA 4GRWB 1AE6L 1G7LA 4MMXC 1HE7A 2CXGA 4OSUL 1O0VA 4PRPA 5I76B 4WI9A 4M5ZL 5ERWB 1I1YA 4QRRA 3ULUF 5DK0A 1TIUA 4R4NC 4TNVF 1N3NA 2NY4C 4MQXD 3IDMB 1XGRB 1A21A 3C8DA 4YXHL 5I1IH 1A1NB 4GAJH 4OCWL 3UZEA 5D7IF 4ZS7H 2UVFA 1WZMA 2ZUUA 4QRUA 3RTQD 4N9GB 5MENB 1HH6B 5I16B 4WI2A 2X4RB 4I2XE 1I8LA 5DA4A 2QR0B 4Z8FL 1FNAA 1M05B 2FDBP 3R06B 5J12C 4HDIA 3KPSE 2F53B 3FFCD 1HSAB 1I9JH 1WJ3A 2P7TA 5C2UB 4OCLC 4J23A 2VXTL 1YC7A 3FQXB 1F2QA 1AO7B 2ADFL 1BP3B 3MRPA 5D1ZD 1CLYH 2R39A 5T1MB 2NZ9C 4EBQL 2DWDA 2XKSA 4N5ED 4ZUSA 3HNSH 4PUBH 3UDWA 4K7FA 4LU5H 2B39A 1Z9MA 3O0RH 3QHZH 4Z7UF 4H1LA 1F4XL 5I8CA 4BH7B 2QV2A 1CDUA 4RISL 3WIHL 1A1OB 3GEWB 4XAKE 5CCKH 1AP2B 4O2EB 4XXCC 4C4KO 4HWEH 2NXZB 3SDCC 5C92A 3TEUA 4ESKA 5TDPA 3DSFH 5JLZA 2ZNWA 4DKDC 1J1OL 3AVEA 1NGYA 3CGTA 3W9DB 3MLYL 1LO0H 5GGSB 3LQAC 5FYJL 5CGMA 5HHQA 3V0AC 1J8HA 1B0GB 2N7AA 4X4MA 2OK0H 4KROB 2ICWA 1WIPA 1FIGL 4L5FH 5JUEH 1XGYH 2YD6A 1JGVL 4H0GA 2YPKB 5IB1B 1GYAA 1RVFL 2ZWLT 3TLRA 3ARBB 5EU3B 4LLQA 4LCUB 2IG2H 2HJLB 3RNQB 4MA1B 2F58H 3D1MC 3ZYOA 4JM2C 1JZ8A 4P3CH 3NCCB 4PJHB 2OTUA 3ZHDA 3U7WH 1JBJA 4H5SB 3N9GL 1YNKL 5HHVL 2GYSA 2Q8AL 2COQA 4QHUA 3JWDL 3AMKA 4HV8A 5D9SA 1DE4B 1YMHA 1IGTA 3R1GH 2QQKL 4W6YB 1UM5H 5FYJD 4XNUH 1VGKA 4JFZL 3PP3H 1IGMH 4NCC1 1KIPA 4X8JB 3U0WL 3RFZC 1R24A 1MWAH 3OMZA 4QXGH 5GS1A 4K07A 2HKHH 3V4VL 5C1MB 1YN7B 3U4EB 3F5WB 3GSOA 2XT1B 2ZUQC 1BVKA 1B4JH 3HE6A 4HFUL 4IEFB 1YECH 1ED3A 4I18C 4J3OC 5ACZB 1F97A 4NQEA 4GRLC 5FDWA 3PP4L 4OCRL 3JSSA 3P2TA 4ZTOL 3ULVF 2IADA 1GZPA 2WNGA 3MJ6A 4LIQL 4RWHA 5ISZE 1S9YA 3RBSA 4WWKB 3VXNA 3NMEA 1JGDA 5GZOC 4YHOH 3UBXA 2CDEA 2XWTB 2O5YL 4CNIB 3X14B 4PYHA 4L8CA 5CLTA 3T04D 5HI5D 1IM9D 4LSRL 2GJZA 2XRAH 4HKJA 4EJ1C 5DQDL 1HXYA 2L4OA 4XP1L 4Z8FH 4ONGL 3JV5A 3QCUL 4JKKA 4MVBC 5E94B 2PO6C 3TBYA 3EKCA 1CICD 1M7DB 5I9QB 3E2HB 4C59B 2AEQL 4YHZH 4NUGL 5IWLC 1SVZA 5IHLB 3V6OE 3BHBA 4XBPA 3LH2H 5CGYC 5ICXA 1IJ9A 4ELME 3GSVA 4WGVB 2FO4A 5DJ2B 4NFBA 4EOWL 1IC1A 3LKPA 4IOSD 1DLHA 3L3OA 3DROB 3ARWA 3MSPA 3V0WL 2J2ZA 4GKSB 2BVQB 4M48L 3GJEB 2W07A 4R2GD 2O26U 4X7CC 5C0BD 1I4FB 4JQIH 4R96B 1NBVH 1A6PA 3HZVB 3BQUC 3QUZD 3MC0A 4YR6B 5K9KA 2IBZY 5ICZB 4NYLB 5C0CA 5GGRB 1UCBL 2QSQA 4O2FB 1UB6B 1F4YH 4YDVB 3DMMD 1IKFH 1FE8H 1GGTA 1MIML 4F7PB 4N0UB 4G7VH 1IQWH 3P0VL 3MLYH 5E1AB 3MLXL 4NNXA 4JFXA 1RZ7H 1WFTA 3SE8L 4WI3A 1DBKL 2IAMB 3CCHB 2DWEB 4I9WD 5F6HI 1KPVA 3BXNB 2EE6A 1RU9L 1U93B 4CVZB 5BVJA 1WAAA 3HAEA 1RUPH 4H1LH 4NCC2 2VQ1B 4GMTL 4BSJA 2Z0BA 2WUCL 5AYQA 5J8OA 1W0WB 1AQKH 2LU7A 4TQEH 1ZT7B 2ATPA 3HA0A 3IFPA 4X5WB 5MP6H 2BSTA 4WI5A 3MGTB 1D5BA 3S34H 1T66C 3MV8D 5LGJB 4ISVB 1DVFC 3HPLB 2P1YA 4KK9C 4UNTA 1CXIA 5L8KB 1R3HB 4FNLL 4I2XA 5J1SC 4GG6E 3V0VB 1YEJL 3MLSL 4HUUB 5T3ZE 3ZT6A 4YWGH 4RCAA 5IKCA 2HRLA 1NJ9A 3KXFA 4YX2L 3TA3D 4XPBL 4OLWL 4HUWB 1MJJA 2R8SL 5JOPD 1PLGL 2ENSA 3CFBA 3SY0A 3PP4H 4U2YA 3PG2A 2AEPL 3IKCA 3BDBA 5E6YA 3EZ8A 4I4WB 4K3DL 3U36A 1OL0A 4M6NL 1MCPL 3X11A 5C0GB 2BC4B 3AAZB 4XBEL 4WFFE 3RNKA 2D4DA 3DWTA 4R4FL 1XR9A 2ZCKL 4G6MH 3VFWA 4D9RD 5IHZA 1MCSA 3VD9A 4L8SA 3SKNB 4PRDB 1MCHA 4PRBB 5D7LB 4GSDH 3QH3A 2YSSB 4WENB 5TQ0H 4MX7B 4JY5H 2ZJSL 5I19L 1PY4A 4DCQB 2FEDC 4R9HA 2VAAB 2H2SD 5D5MF 5ACLA 5JDSA 3SJVA 4MD4B 1U8JB 2AEQH 1HHKB 2B1AL 3KR3L 5E03A 1BX2A 3GJFK 1LK2B 4N0FB 3WHXB 5FUOL 1QFWH 3MYJB 3F7PC 3BIBX 2NLJA 5HYJB 4I5BA 3W39A 4JN1H 1ZA3A 4QGTA 4UNVA 1CN4A 2CLRA 4R8WL 3VE0B 4Y0GA 4P2OB 2BY1A 1F00I 1LO4H 4HIIB 2NX5D 3CZFB 3BEVB 1U3HC 2M2DA 4FZ8L 3MLTB 3UROR 4PLOB 1UZ6E 3KPSD 3KPPA 3BI9X 1N7ML 4XVTH 1CT8B 2B1HL 1AKJB 1JN6A 5IFJB 1CXLA 3W5MA 2DDQH 3RJDA 4GS7C 3JV6A 4G9FA 3QFJB 3GSNL 1EV2E 3WHE1 5EA0L 1TJGL 4RQQB 2Y5TB 2F54E 3QO0A 4U7KA 3IAPA 4OCXL 2N4IA 1NFKA 3BT2H 4FQQA 5DQ9A 4RNRA 1JYNA 2CR3A 4OQTA 2SEBB 4XAKD 3RZCD 3F58H 3Q0HA 1C7TA 5J6HA 3OKNB 2UVEA 2CUIA 4MXVE 4PRIB 3RY6C 1TPXC 4TNWF 5ERWA 1IGCL 4LKXB 5DO2D 4ELKB 4M7JH 3IDMA 3EYUL 1XGRA 1OP3K 1HQRB 3IDYC 3ZKSD 4EN3B 1I1AC 3O9WB 4LLAA 4ZDHB 5H94B 4AIZA 4YHKH 1X9QA 1A1NA 2VLKE 1KCUH 4XHJD 3L7EB 1UM4H 1HH6A 3EYFA 3GK8L 4XPBH 2X4RA 3BUYB 4OLWH 2MCPL 4UT6L 4MJ2A 1PLGH 1NBZB 1BJ1J 2GJ6E 5C08E 3ARRA 5HVFB 3R06A 2AEPH 4ELMA 2F53A 4NBXB 1HSAA 3KPOB 5JO5A 3HAEH 3PV7A 2EECA 3SKOB 3QUYD 4S1DC 5DGRA 4KWUA 3FQXA 3RA7H 1GL4B 3MPCA 2C3GA 4OLUH 4H8WL 4OLXH 1XIWC 2H8PB 3GKZA 5C0ND 4HMCA 5T1MA 1DTUA 2ITDB 1PD6A 4QTIL 4E0RB 5IMKB 3KPMB 1TCRB 4M62L 2DM2A 1IQDB 3TH4T 2Y7QB 5A2LH 3MBED 1RI8A 1Y0LB 5C3TA 5D8JH 2MHAB 2N56A 4S1RH 4BH7A 3QWOB 1A1OA 1FIEA 1AP2A 1CVSC 3RWJA 4QNPF 3TBVB 4Q0XL 3KPRE 3PL6B 5D4QA 3NN8B 7CGTA 3T4AA 4D9QE 5ISZD 4UBDD 1FPTL 3P4MB 3UTZB 5DUBB 3IAQA 4PJXF 2BJMH 2XZQH 4MNHB 5EH1A 5EUOE 3TIDB 4HUXB 3W9DA 2YZ8A 3FCTA 5D1QB 1NCWL 3RPKA 5JW5A 4F7EB 4F37K 2B0SL 1B0GA 3S98A 4Y2OA 5IM7A 4HKBB 1AI1H 1CTNA 2YPKA 2ZSVB 3C5JB 2OSLB 4EI5C 4FZ8H 4P9MH 5HI4D 5DLMH 4FQXC 1GPOH 3FTGB 9CGTA 1IAOB 2GTWB 5JQ6L 2B20A 2HP4A 4QXUH 1N7MH 3UTPE 4LRIC 1N26A 4TSAH 4M4RA 3ZKXC 3BKML 3QUMB 2M1KA 5D1XC 1QSFE 3IB4A 1MF2L 2R1WB 1ITBB 3BP6B 4PJ8B 4H5SA 2I9TB 5HHXH 1TJGH 3O6FB 2YN3A 4FP8L 4I0PD 5I1LB 5MEQB 4ODXB 1DE4A 5IR1B 1NCNA 1X4XA 3ROLB 3WJLC 2HLFC 4WU7A 2ZPKL 4R0LB 4X8JA 4WWID 4NRYA 4A2MA 4NCDA 3I9GL 2XKNA 2HG5B 4Y16C 2NQCA 3MLPA 1YN7A 1KEGH 3MNVA 2DM4A 1I3UA 3F5WA 3U4EA 4F9PA 4MCYB 2VC2L 3MJ9L 4E41D 1PZ5B 1IKNC 1DQDL 3BN9D 3MJ8B 4HULB 2EH8L 2YA0A 4U1IB 3WKML 5F21B 1LE5A 2X4TA 3KYOB 4C54A 3FRPG 4FQIL 5CJBA 2VLRE 2OR9L 4L9LA 4WWKA 1JF1B 2ICEB 4AG4L 2R2EA 3JWOL 3FT4B 4CNIA 3C5ZD 3MRNB 1NKRA 3RRQA 5I1AB 5A16A 4NT6B 3O3DB 5T3ZL 4BK4A 4FOMA 5E94A 4PP2B 3VFNA 3G6JF 3ZE2F 2E8YA 1M7DA 3SDXF 2ID5A 3WLWD 1J12A 4LCCC 2VE6B 3P77B 4OQTH 4AQ1B 4TVSa 1UH2A 3MLVL 5HSFA 5C9KA 1FFQA 5IBTL 3ILQC 4QTIH 5D70L 2XTJE 3Q1SH 5HYSG 3O8XB 1OP9A 3DROA 2EO9A 3QDGE 4P0DA 5E6ZA 3GJEA 1H3GA 4MHHG 3WJJA 4JFDE 3WDHA 1PKQB 1T1ZA 1I4FA 3FFCB 1G7HA 5T3ZD 3H3KA 4NM8H 1F02I 4LP4A 5CUSH 1VGEL 3O6LH 4YR6A 2PW2A 4M8VA 4IHOB 5D1ZB 5DI8B 5ICZA 4M9OA 4NYLA 5DRZA 2LU3A 1VEOA 1AD9A 2OL3B 1N5YL 1UB6A 5ITBH 4YDVA 1JI1A 5F1KC 3TFKC 4PB0L 1BHGA 4JJ5A 5H8DA 4C57C 1HCFX 5EIVA 5L7XL 5KSAA 5EZLB 2CSPA 2IAMA 3CCHA 2BRRL 2DWEA 4ODBD 3MV7A 2F8VA 2RCSL 3MV11 5JQ6H 4X80L 3FB7B 2I60H 3ROOA 2MPAL 2FBJL 3AM8A 1F4WL 3IDXH 1W0WA 1ZT7A 1TLKA 1LILA 2EE9A 5B22A 3HUJE 3DTXB 3UJJL 1SEQL 4K3GA 1XF4A 2VLKA 5B39G 4DN4L 2UZIH 1ZLWK 5HI3C 3HPLA 3HKFA 2Q3ZA 3HPJB 4NZUH 1R3HA 5EU7E 3BX7C 3V0VA 3WIFB 1H15B 3BKYL 3NCFB 1ZTXL 2ITCB 2WSKA 5ID0B 1NBQA 3H3BC 3MLRL 4M1DL 4PY7A 1DQDH 1GIGL 3VWJD 5F96H 1T7WA 4A6YA 4ALAL 1JVKA 3PWUB 3MA9L 1HXMA 4ACPA 2IFFH 3IETB 3GMRB 4JDVB 4PLKC 2BC4A 3AAZA 5C0GA 4F33B 2AJ3B 5DFVC 3OKLB 3TO4D 3L3DA 3EW3B 3ALPA 3KDMB 1QTYT 3WUZA 4HIHA 2AVGA 2F54D 1BF8A 5LKNA 4PRDA 3SDAC 2YXFA 2YSSA 2W9DH 3VGFA 2DS4A 4IDJL 4HHAA 4LSTH 3BE1L 3RWDB 3KPRA 2VAAA 4U3CA 4MD4A 5EORL 1U8JA 1I9IL 3O81A 3SDYH 3RVWD 2BOCB 3EOBB 3MLVH 1IGYB 1PAMA 2CR6A 4N0FA 3LEVL 3WHXA 1UWXH 1EAJA 5K33A 3TWCL 3BWAB 3EFDH 2V5SA 4V1DD 2I5YL 2NYYD 3BPLB 3M17B 6CGTA 4HS3A 1CDIA 1J1XL 3VGBA 2O61B 5FO9B 3WE6A 2I07B 1XFPA 4JZJA 2YUVA 4YUEH 3VE0A 2B7DT 4W68A 4P2OA 2CRZA 2XG4A 3ARQA 3NH7L 2IJ0C 2OYPA 3BEVA 4G8GE 3MLTA 2GJ6D 3A6OA 5CINL 1JRHL 5C08D 4M7LL 1T89A 3B9EA 3V52H 4PPTA 4MJID 1CT8A 4PG2A 1AKJA 3L3GB 4AJ0A 2PTVA 3ZKND 1T1WB 3V79C 1G6RL 4NQVB 1JNNL 1P4BL 1VEMA 2I9LB 3MZTA 3QO1B 5SX4I 4WW2B 5C0DB 4LCWD 4R2GB 1YZZA 5F7WC 5C0BB 2Y9RT 4LK4A 4RQQA 2Y5TA 2A9MH 5L7XH 1GGCH 2W9EL 1JWMA 4LEXH 5FHBL 3VDCA 2ATKB 5DMKB 3ULUE 1H3PL 4LBEA 1KCVH 3FO0H 4YIQA 2H32A 1U8NA 2FH6A 2VXQH 5IBUG 4U1NB 1MCJA 2MPAH 4K3JL 1EJOH 3DMMB 1I8IB 1EFQA 4U1JB 5D7IE 1EHNA 1KCSL 3OKNA 8FABA 2VLRA 2VQUA 1MAMH 5I1EH 4MJ6B 4BZYA 1MJ7H 4D9QD 2DIBA 5EZIL 5EOQL 4ELKA 2APVA 5D7JC 3RVXC 5D6CB 1NAKL 1T6WA 4AEEA 3ZE1F 1JPFB 3B2VL 3O9WA 4BQ8A 2MCG1 5H94A 1FO0A 2BNUB 3UC0H 1DBJL 3QG6B 2DM3A 4LRNL 2MKLC 4JM2F 4M6ML 4XB7A 3BKYH 4GQ9H 1ZT1A 1RZJL 1GC1L 1FFRA 4FQJL 3BUYA 3BFOA 3MLUL 4Y4HB 3B4NA 4G8EB 4TSCL 1HDMB 1BOGB 3BP7B 4YNYA 4YE4L 5FECB 3UTPD 3KPOA 5IMMB 3MV8B 4FQ2L 1ZLVK 1QLEH 4KRPC 3SKOA 5L88H 4Y5VA 4YC2B 1QSFD 3MLZH 1SYSA 2H8PA 2EDQA 2ITDA 1MFCH 5FUZL 4GFTB 3ARED 4E0RA 3Q6GL 5IMKA 1G9NL 1TCRA 4AL8H 3TT3L 1DBBL 1JWUA 3TA3B 3UJTH 1IQDA 1WBZB 5CJ5A 2Y7QA 3ARUA 1NLBH 4ZXBD 4MB3A 2FO1A 5EORH 1I9IH 1P4IL 2QQQA 1RMFH 3GSQA 4MD0A 3WHE0 3PL6A 3FQRB 4NQDE 1REIA 1YMME 1PEWA 4A6YH 1PJ9A 3P4MA 5ADPH 3TBWB 5TE7H 4PV9B 4JRWA 2Y36H 5ANMB 4HPOH 3TIDA 4HUXA 5D1QA 3K0WA 2AI0H 4KK5D 5GGTA 2X6MA 1MHHB 1WTGT 4HKBA 2EH7H 5JR1H 1OAZL 3SQOH 2OSLA 1MI5E 2I24N 4KJWC 3EJYC 3TT1L 1OTUC 1D5XA 5LGKA 2GTWA 3NVQA 3DX6B 2BSED 2AJZB 4S1QL 3B9KA 5IW1B 1W0VB 3GHEL 4P46D 4L8BB 1U91B 1OSZB 1ZHNB 2FX8L 2R1WA 1JNNH 3BP6A 4LOUD 5DMJB 3QIWC 3WFBH 4PJ9C 3O6FA 5I1LA 4R90L 4HG4K 4ODXA 2E3VA 4L4TD 4RX4D 5IR1A 4P2RE 1UJ3B 2NX5B 4F37F 1G9EA 5FGCE 3KPQB 4PJ7F 3QDGD 4CKVX 1T0MB 5KVEH 3ULVE 3LN5B 4Z0BH 4PR5A 2J7LA 2BVUA 4P57B 3MTRA 2HMID 1G0DA 1Y18A 4JFDD 1UWEH 2HG5A 1F2XK 1ERNA 1A3RH 3H7LA 4K3JH 4MCYA 1U95B 3U9UB 1FN4A 1PZ5A 1CU4H 5HD8D 4R7NA 4HKXB 3MJ8A 2W0FA 1HOCB 1TVDA 2CXKA 5KVGH 3KYOA 1FFPA 3C08H 3S88L 3OF6A 3BKJH 3EOTL 4XWGL 2H1PH 5F7KC 1KEMH 3P4OA 1A6UH 1JF1A 5E8EA 3QWRD 4KY1L 3D85D 3FT4A 3PDOA 4XZUB 1I8LC 4ODWB 2KPNA 3RZCB 1J86A 5I1AA 4Y2DA 1GC1H 1RFDL 1VADA 3O3DA 5ICYB 5B38A 4KDVA 4PP2A 2J6EL 1IT9H 1J87A 4O4YH 1QBAA 4WI8A 1T2XA 5F89B 3UAJD 3NZHH 4XVJH 2H32H 2VE6A 3P77A 4MXWH 3WIIH 4FQ2H 2JB5L 4G3YH 4JO1L 4JPIA 3T1FB 2GITB 2R2HA 4GG8B 1B0WA 3X17A 4TRPL 1MIEL 1CBVL 1IVLA 2APFA 1UGNA 3UDWC 1CK0L 4M93C 3BN3B 3O8XA 1HHJB 3KS0J 1EUUA 5L0QB 4ETYA 1DBBH 1OLZA 4O9HH 3U46B 4S1SL 1S7UB 2R9HD 2VZVA 1FO0H 4G8GA 3CNKA 5I74B 1VHPA 1J05B 1MVUB 5BXFA 4LQFH 5E5RB 3QXWA 1O5DT 4XP6H 2NXYC 2XZCH 1DQQA 5E8DL 1DFBH 3D25A 3WFEL 1IEAB 4OGYL 1YA5A 4LSVH 2DI7A 5C0JB 2OL3A 1IBGH 1YEIH 3KYKL 3JV4B 2DRUA 4PS4L 3AMLA 5IVOA 3L7FB 3FN3A 1CICC 1ETZA 1NGWA 2UY6A 2KQNA 4P23D 4JANB 5EZLA 3QYCA 1OAZH 5I1DB 3DNKA 4NQUA 3G9VA 5DR5L 4NQXB 3O41B 2BCKB 4XPTL 3BZEB 1ZSDB 3E6HB 3ARGD 1DBAH 3QXTA 4EUPB 1J0JA 3O3EB 5C2BL 3VMPA 1BMGA 1MFBH 2DLGA 1OD9A 4X0KB 1OB1A 2VO5A 3VFMA 1OOAA 3Q3GB 4F8TA 2ORBL 3LS4H 1L0QA 3OQ3B 43CAB 1OAUL 1E4WL 4POZD 1QR1B 2QL1A 3SHSA 5DD6A 2L0DA 4BZ1L 3BISA 3HPJA 3F7YB 3S35X 3WS6A 3W81A 3HE6C 1QSEE 4DAGH 4RMTA 3ULUL 5GGTH 4DVRH 3WIFA 1H15A 4FTVD 2ITCA 5ID0A 3LD8B 2BSRB 4C56D 1NKOA 4Z7UA 1LO5B 4RMSA 1YEEL 4OD1L 5IEHB 1M6OB 2Q76A 4JFED 1U8HA 3IVKB 4I0PB 2A73B 3PWUA 2X05A 3EOTH 4HZLA 2CD0A 3GMRA 5EOCL 4P2YA 2AJ3A 3DUSB 4XTRC 4KJQD 5D5ME 3KDMA 3ARTA 4XVUC 1F58L 2R23B 1MJUH 3QR2A 2OS7A 1YPZF 4I48B 1WEJL 4E41B 3ULUD 3HC3H 1PDKA 3WSQH 1A7QL 3FO2B 2VDML 2J6EH 5HY9B 4Q6IC 3CH8A