2HLFD

Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Proton transport,membrane protein
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD01
3GM8A 5MENB 4X6DF 1R3HB 2FL5B 3QJHB 3WV0A 4KTYA 2R2EB 1S5IH 3HAEG 2BHUA 3S37X 2GKIA 2FECL 4HUKB 2ITDB 1XAUA 2G60L 1UWXH 3AMLA 4P99A 4W70A 4K94H 1F3DH 3ARRA 4ZUUB 3CPLA 3JTSB 4FFZL 5GGSB 5IIEB 2I27N 3UO1H 3SPVA 4UTAH 4MNQB 1TJGH 4KZEH 4JEGB 4NBYB 3AREA 5I1AB 3HE6B 2HAZA 4ZUWA 5FKPB 2AJYH 2VL5B 4P59H 5FGCB 4EUPG 1AHWA 1E6JL 4JANB 1AC0A 3B2UC 3D0LB 1PSKH 5ICXB 2VLLB 4UV7H 1X5FA 2QHRH 1IEAA 3HN3A 3LKOA 3WMSA 1IT9L 2YPVL 3IAGC 1KULA 3DUSB 3O2DL 4U1KB 4MS8C 3IS1X 5L6YL 2Z91B 3RHWK 5IWLA 2VWEC 1FV1A 3VDCA 4M1DH 2BSRA 4NFCA 5TH2A 5I73C 5I6XC 4KK6D 4POUB 3CXHK 3REVA 1ZTXL 3FFDB 1SJEB 1KCUL 2Q7YB 1R5WB 1GGIL 2P8LB 1F90H 5HYEA 4EDWH 2XPGB 4K8RC 3RNKA 4PJIB 1MI5E 5AUMB 1RY7B 1MQ8A 5JZ7D 4Z77B 4XPGH 2R23B 1KB5B 3TIEA 3F62A 4WW1B 1ZHKA 4XP5H 1H3UA 5E8EA 1N6QL 2CLVB 5JZ7C 4G6MH 4Y5VA 5HXMA 4QT5B 3OR7B 4UT9L 4RGMC 5F6HI 3HMXL 1BQLH 3N1FC 1F8TH 4AEIL 4IRSB 4JRYA 5IR1B 5JPNA 3N1PC 1S7XA 3ELAT 4PJEA 3S37H 3ZSTA 3R06B 1S7QB 2XZQH 3LKPA 3ARYA 4Z0BL 1MCNA 2WUBL 3KLSA 4FXGA 2DQGL 1UEYA 1RJYB 1DQQA 1D7FA 2K9UA 1SJHB 3FCTA 3PIQA 1FC1A 4X6DE 3PHQA 4NKMB 5I8CB 5D7LA 4S2SB 2DQCH 4LCWA 2B4CH 2F54A 3PWPE 1I9EA 3GO1L 4QNPF 2X6MA 5DMGC 3PDDA 5FM8A 3S96A 2MTPA 4YFLF 2YD7A 1MJ8H 2PYEA 5C1MB 1OAZH 5IB3A 4P9HC 2OYPA 3FAWA 4ZFFB 1RUQH 1IRAY 4MHHG 3EO0A 3CSGA 1ZE3C 4LSRL 1F13A 15C8L 1ORSA 5C0DB 3CUPB 3U4BL 1N4XL 1FL3A 1O5DT 3DV6A 1WAAF 3VWKD 1V3KA 3OKKB 4HDIB 1BEYL 1NLBH 1JHLL 4RAHA 3VFRB 1RI8A 2AJ3B 4G6FD 3VWKC 4NRYA 3O6KL 2FGWL 5DD6A 1B3JA 1RJZA 1WAAA 1ZA6A 1EFQA 3P0YH 4GJTB 4JM4L 4LRIA 5IB5B 2YPKB 5HGHA 3EYFB 1T3FB 3WO4C 4PV8A 1S9XA 4Y5XC 2GSIB 3O11A 3WJLC 2ZZUT 3S35L 1Q9KB 3Q5OA 5LBSL 3BDYH 4Y1AB 1B88A 1LP9B 1MWAH 6FABL 1HQ4B 5C7XH 4PGEB 4JG1L 1MCIA 4JKKA 1EV2E 1CZ8L 3LD8B 5I1GH 4HIHA 3INUH 4EKXA 5KSAC 5D2LA 2A9NH 2R69L 4HULB 2W9DH 3DVGB 1IAOA 4JRYE 4KRMB 3Q5TA 5JW5B 4JFZL 4LFHD 1YEEH 5JORB 3CZFA 4HC1L 4JQIH 1J86A 3ARGB 4Y16A 4LARH 4DAGH 2EDTA 5C07D 4OZHA 4LPVA 1F4WL 1OTSD 4KMTH 1MAMH 2WP3T 4GLRH 4OZ4B 2VXVL 4NQVB 5FM4A 1KCSL 4UBDD 5TE4L 3VXPA 2Y5TB 3D3VB 3M17B 3WIFB 4PJ9C 1CFQA 4HLZH 3PJSA 5J6GB 3QWQB 4UBDC 5ESVA 5CLTA 5D7LE 2O5XL 3EKCA 3FFCA 2F54E 3W0WD 3M07A 3WS3B 1V7MH 2A77L 2V7HA 3C8KB 3P30H 2BDNL 3O3EB 4M6OH 4NO3B 3WCYA 4BH8B 5HVFB 1A5FH 1U92A 1ZEAH 1ZHBA 2EZ0C 2FEEI 1EEZA 3MYJA 1JPGA 4PRHA 4ORZC 3FZUD 3MLYL 4YDKL 2H32A 1BVKB 2R4SH 3QDHA 4NZUH 3ECBB 2WINA 4XNQB 1U8JA 2FD6L 4QNPE 2AERT 3FZUC 5D1QC 3FO2B 1BMGA 1G7PB 2EC9T 3I02A 5KANG 5FV1L 4C4KO 1LE5B 1S7UB 4JFXA 1KN4H 1NGQH 1QSFA 4NCDA 4MJ6A 1F6FB 2VISA 4CKVX 1FH5L 4X9HA 1U8PA 3RRQA 3SDAD 1KB9J 1OAXL 5E6ZA 1XGUB 4PJFB 3OXRB 4AIZB 1WAAE 3GRWL 3SDAC 1LNUB 1MRDH 1A9EB 4Z7UB 1KUMA 1FFNB 3GDBA 3QRFM 4GXVL 4P23A 1GGTA 1RJCA 4U3XA 5CBAB 5IB4A 5I19L 5IBUG 4YC2B 1CICA 4PJGF 1D5ZB 5IFHL 4WW2F 4Q58C 1NCCH 4N8VB 1T22A 1RUPL 4Q0XH 5I0ZA 4F15C 2Y07L 2A9MH 1HHKA 3CH8A 3SQBA 5I15L 3OKLA 4WU5B 2X7LB 4WW2A 5DF0A 4A6YA 1PJ9A 4GG6B 1ZSDB 1V7NH 4UZGA 2GFBA 1H5BA 3SJVD 1KJ2B 5FCUH 3IGAA 3NZHL 2O5YH 3FRPA 2EE3A 1H15B 3SDXF 3BKCH 1A3RH 4G8EA 4MSWA 2N7BA 3HAEH 1G7IA 1NKRA 3MBEA 3BXNA 2C1OB 1T1ZB 4JKLA 2R8SH 2DKMA 2IPKB 4P2QB 3SDXA 1PG7L 2B1AH 3RDTC 4OGXH 1A3LL 2J3SA 1W72B 2BNRE 4UAOC 4MNHA 1DQLL 4L3EA 4WUKL 3RTQB 2VDPH 4JFQB 1K8DA 3VMNA 4JY4A 3RZWA 3UTQB 3SE9L 4NNPL 1E4XI 2NMSA 3C87A 3IDMA 1C12B 2ITCA 4OM1L 5JPMB 5HY9A 5H37G 2YBRB 3GSXA 2J2ZA 2MWCA 4DJMA 4EUPH 5ILTL 1HKFA 4PRHE 2VLRA 4CDGC 7FABH 3UC0H 4MAYB 3SGJA 1X9QA 2X4OB 3KXFE 5ESAB 4F3FA 3HPJB 3RWGA 5HHQB 5F7DA 3TWCL 5EU5B 3QG7L 2XZCH 2CIKA 5E1AA 1OGAA 4R9HA 1F4XL 5D7JB 1JNJA 5GRYA 4K9EC 3DURB 4U1GB 4G43B 5EC2A 1PLGH 1XIWA 2GAZB 4IDJL 1CLOH 1H3TA 1CYGA 5D1XA 3QHTC 1MRCL 3RWCA 1LO3H 1GZQA 3DHJA 5LGHH 1OP5H 3BWAA 3JV6A 4TSCH 2YD4A 4YBHA 1GGYA 2VXUL 5HJ3A 2H1PL 2OL3A 4YHYB 2A74B 4XVTH 3HE7B 3L5IA 5FXCH 4LF3B 1JNNL 1QOKA 4M6NL 3ARVA 1EEUA 1T66C 5HGDB 3AS3A 3FONA 2F74B 3C60D 1DBKL 3ETBF 4R8WH 1JMXA 3MLWH 5HDLA 4PJGE 5SWSA 5SWQA 3L95A 5CGMA 1OTTD 4K71C 4I0KA 5D6CB 2GJZB 1JZ8A 3CVHH 2NW2A 5JNYA 1OTTC 1XT5A 1CS6A 2Q8AL 3HUJF 4XNMB 4XZUA 1QBLL 4ZUTA 3IDXH 4QTHB 1S9KC 2EYSB 2ZCKH 4PRAA 4XCYA 3RKPA 3WFBH 5E4EC 2JJSC 4WCYH 3SDXE 1DTUA 5DEFA 1A2YB 1XEDA 3FQWA 1N0LA 2XTJC 5K9KA 5CD5D 1GGCL 1N8ZA 3V7AE 4HIIB 4MXVF 4UQ3B 1BFTA 4ZOBA 4YHNA 3VXQA 4Y5YC 5CD5C 5HYJE 4UOJA 5CP3A 3BDXA 4U6YB 1J8HD 4E41D 4KJQC 3HPLB 4M7ZB 5L2KD 4MLIA 2GTZB 2G60H 1BQSA 5DUBB 3TO4B 3VXUB 5C8JA 3QISA 1U3HA 5D7IF 4Q2ZB 4FFZH 5FYJL 3UXFA 3GMMB 4I48A 1ZVYA 3BPLC 3RKDD 4JFFE 5FGBA 1KLGA 5E24E 1AKJA 2VTFA 2BK8A 2HWZL 5D7IA 1EERB 3B5TA 1NGYA 2VDNL 1E6JH 1UVQB 5IKCA 4D9QE 2B20A 1A4JA 5DRXB 3IDJB 5B39A 3CFKB 3JV5A 1A6VL 1CDIA 2AEQH 3VWJC 5EBWA 4Q9RL 2VDML 2Y9RT 5ID0B 3D69A 1IT9H 2YPVH 4JRXD 5B4MC 1DN0A 3O2DH 1F97A 5L6YH 1Y6KR 3WIHL 3STZB 5DSCB 3ILPB 3AROA 3MACL 4W81A 2D7QA 2VZTA 2GY7B 5IG7A 4XWOD 3EJZC 4G9DB 1ZTXH 4HGKC 1KCUH 3T0VA 1MQKL 4GBXC 1GGIH 5EBGA 4ODWA 2MHAA 1VERA 2BOBB 3WXWL 2NXZC 2IAMC 2I9TB 4OBSA 4K3DL 3S6CA 4ONHB 5CIPH 5JDJA 3F12A 1JGLL 5TDOB 3RU8L 4G8GB 1N2RA 2JJWA 4LEXL 1VA9A 2CKBB 3C2AL 5E7BA 1LK3L 5IJVB 1RK0A 4MA7L 1N6QH 4V1DA 3OGCB 5ESQA 3HUJE 2VN4A 4UT9H 1VADB 4NBXB 3MRHB 4EIGB 3DWTA 2CDEB 4AEIH 4X7EC 3FOLA 4PPTA 4WJ5B 4CU8A 1CGSL 4NSKA 1FL6A 4HUNB 2H2SD 3AC0A 4AQ1B 3T0EC 3OG4B 1HHIB 3KLAB 5FCSH 5C0AA 4Z0BH 1DQJA 3F65A 2WUBH 4WFFD 2X4QA 1RZKC 3CFIC 4FNLL 5IK3B 2H2SC 2K7PA 2DQGH 5EN2B 3MXVL 1D5MA 1F6AA 2ZSWA 5AZEL 3V0WL 4F2MA 4MXVE 2ERJB 2BVQA 4JGUA 4H1LB 2FHFA 3OKOA 4G9FB 4ZQKA 4D9RD 3ULVC 3C8HA 2Y36L 5TQ0L 5IHUL 2GTWA 4QRTB 1WT5C 2PO6D 3D18A 2UYLA 1BJ1J 3VG9C 4WHTA 2V2WA 4Y88A 5IHBA 3SO3B 3GO1H 4RFNB 3ZKNC 2YD2A 1MFAL 3OPZL 4IBLT 1Q72L 4CJ0A 1TPXC 5D7IE 3TYFA 1ERNA 3NFSL 3HMWL 1DUZA 3TT3L 3ZT6A 3C6SA 3WNKA 3MRRA 3X11A 3DX6A 4OTXL 3E6HB 4LSRH 4TRPL 15C8H 4OGYL 3KPRA 5TE6L 3U4BH 5FOBB 1J8KA 1N4XH 4OKVB 5D7KE 3SPVB 5E8OA 1QSEE 3KDMA 2OSLB 1T2XA 5EOCJ 1BEYH 2QKIB 5A2LH 1JHLH 3BN9D 5FO8B 4PLJD 4CL7A 2YPLD 3O6KH 4HWZB 3BJLA 4WFGD 5FOJA 1ZT1A 3CC5A 3HR5A 2EKSA 4NOBA 1BWWA 2YR3A 4JM4H 3QXTA 3UPCA 1IEAB 4U6VL 5IMMB 3PXHA 2BOCA 4PJAA 1LVEA 4JVPA 3S35H 3IDNB 5LBSH 4PRID 4PJ5A 6FABH 3DVFA 4JG1H 2XKUA 4UDTB 1FV1B 1CZ8H 5TH2B 3BQUD 3MV9D 4K3HA 3WNLA 4PJ8A 4KVCL 1CWVA 3TN0A 4R3SB 4K7PX 4V1DE 5FK9B 2XG5A 3BQUC 2R69H 4IRSC 2ZUWA 4OZFA 4H5SB 1O7VA 5KBNC 4LSVL 1P7HL 3QEQD 3VD7A 3SDDD 4JFZH 5DEZA 3P0VL 1NDGA 3T3MF 3T4YA 4KXZH 4OFPA 4HC1H 4J3WA 4HK0A 5H37H 3QDGA 5IP4A 4KAQL 4HS6B 4WVRA 2X09A 4S0TD 5C0AE 1VPOL 5GSRA 1F4WH 2C9AA 1ADQA 2P8PA 3GSRA 2PF6A 4U4BA 1ZHKB 1JF6A 1XGRA 1CXEA 2VXVH 2CSPA 2SEBA 1KCSH 3TBSB 2APVA 5TE4H 4UI2A 4XAWL 4CVUA 4FQXA 2A6KB 4PJEB 2Q1EA 1OSZA 1QNZL 3ARQA 1HSBA 5DMKA 2ZWLT 1NDMA 5BO1L 5SWZD 2O5XH 5GS2D 2A77H 2FX9L 3K46A 2BDNH 4FXGB 4KUCF 3RVVD 5FDYA 2PUQT 3D0VA 4JPVL 3MLYH 4YDKH 2CQVA 3FCTB 3SHSA 2FD6H 3QUXA 1A1MB 4YFDB 2EIEA 4ZUSA 3DXAA 1NFIA 4LCWB 3BKML 3GSOA 1VFOA 2IANA 3SN6N 1VEOA 1L0YA 4O2CB 5TDPA 5JHDA 1FH5H 2BY1A 3PDOB 3FT3B 1OAXH 2UUDK 1CL7I 1CFVL 3GRWH 3I6LE 3FJTA 1JPTL 5EUOF 4GXVH 3SE8L 1J0JA 4ZPTB 5F8RC 5I19H 4JZOA 2IFFL 3EYUL 1YYLL 5I8OL 1T20B 4Z7VB 4Z7WB 5EUOA 5IFHH 3TH2T 1RUPH 3IRPX 2HKHL 3W5MA 2Y07H 5DD6B 1CD9B 2OZ4A 1ZA6B 3W0WB 4FFYL 5I15H 2DQFA 2HVKB 2OJZL 1M71B 5HGHB 4OF5A 4DOHB 1IAKB 2CPCA 4JFYA 3ARGC 3E3QE 4P4RA 3NZHH 3SOBL 3WS6C 1CE1L 1FO0L 4ZFZB 2APFA 4Z5RB 3QDGE 2EDJA 2PW2A 3V7MA 1JYXA 2AK4D 4HIHB 4QKXB 4TTDD 2OM5A 3P4OB 3T3ME 4HJJL 1J5OL 4W4OC 5D2LB 1PG7H 4MJID 2H41A 1A3LH 5EUKA 5CSGA 3MRPA 4WUKH 1DQLH 1GIGL 3H7LA 2EYTA 1L9MA 4K8RL 3OHXA 4ELMF 5MEPB 3TVMD 3QIBA 4XNZB 4C54A 1J0YA 3SE9H 3AM8A 4NNPH 3T77A 2HT2D 4G6AC 4OM1H 2PYFA 3MUHL 4QXTA 4OZHB 4L4JA 5KSBF 4ELMA 5ILTH 2HT2C 1H3WM 4XNXL 3RGVA 2WBJA 3ZHLA 3PP3K 2BVPB 4WV1A 2R0LL 4LCUA 3VXPB 1BIIB 4HBQA 4Y4HD 5IROA 5KSBA 4IJ3C 3WFDL 1F3RB 2VRAA 3PJSB 5L8JB 1XCQA 3ZKXB 4I0PC 3TWCH 3QG7H 1EBPA 3WLBA 4NNXA 3FFCB 4O2FA 1F4XH 1QEWA 2P4AB 3QBTB 5HYSA 5FB8B 1MHPL 1ZHBB 2MQ3A 3IJYA 3MYJB 1JPGB 5JHDE 2BMKA 3UYPA 2DIBA 2Z31A 4IDJH 3RUGB 2H32B 5DVKA 3QDMA 2PXYD 4XCNA 2Q3AA 1U8JB 4WTZG 1MRCH 5I30L 3I02B 5C0FB 1ITCA 1S7RA 2PXYC 4G3YL 1RV6X 2H6PA 2VXUH 2H1PH 1QYGL 5IHZB 5F1SA 4ORGA 1L4IA 4HJGA 4M6ML 1JNNH 4M6NH 1NEZG 1UM4L 3IFOB 1Z9OA 4YHOL 4YDLB 4NC1C 5D5MF 5EUOE 3L3KB 4P9HL 3AB0B 2MCPL 1DBKH 4RMUA 4LK4A 4N68A 4LPYA 4H20L 3WLWD 3QUKA 2P43B 2HKFL 5D5MA 2YRPA 5D1ZA 1AI1L 3BGFC 2X05A 4P23B 1LDSA 1CG9A 5DJ8A 32C2A 2Q8AH 1UB5A 4KROD 5KS9B 1H3VA 1QBLH 2OXGA 5C71A 3TBTA 4RGNE 2AGJL 4KROC 2VDLL 4P5MB 3I50L 2DN7A 3GMPB 5DWUL 1A6AA 3OKLB 3MBXL 2YXFA 4HZLB 2M1KA 3TP4A 4HS8L 3HLAA 2OTUA 4IOIB 2A1WL 2G9HA 2GFBB 4L4VA 1GGCH 2AI0L 1EX0A 4MDJA 2CLRA 1WZ1L 1YYML 5IW6A 3Q6GL 1CTOA 5GRUL 4HWBL 3BGMA 4MSWB 5JW4N 3MJ8A 5C2BH 5CJXC 3I9GL 1G7IB 2D31A 3MBEB 5F88A 2DOCA 4S1RL 4URTB 4ELME 1U8NA 5EDXA 3SCMD 4FTVE 5GRJL 5ADPL 3O6LL 4GAYA 4K3EL 1G6VK 3BPOB 3IS0X 3KPMA 4MNHB 2VLKA 4L3EB 1X5GA 5KSBE 1A1NB 1K8DB 4YUEL 1CGXA 1WFTA 5FYJH 3C5ZA 3RIFK 1SEQL 5HY9B 5HDQL 4OLUL 3T0AA 1ZT4A 1Z2KA 1OQOA 4YFEA 2HWZH 3V5KB 2VDNH 1WFUA 2VLRB 5AYUL 5LCVL 1JYVA 5E00A 1AO7E 5CHNB 4YHLL 5KW9L 3QDME 1AR1C 4F3FB 3RWGB 3MSPA 3AXLB 1A6VH 4Q9RH 5DEGB 4P2RD 2VDMH 4ZO8A 5GGTA 4C56E 3OKNA 5KAQF 2OQJA 2CMRL 4MA3B 2DM4A 4KRNA 5E1AB 3VD3A 4GW1B 1F2QA 1OGAB 4P4KD 2ESVD 3WIHH 1ULVA 2LTQB 3MACH 5C0CA 1S7SB 5EC2B 2P5EB 3PWJA 2X2YA 4NT6B 4GRWB 2ARJA 1NC4D 5D1XB 1MCPL 1MQKH 4EDXA 5IFAL 5EBMB 2ATPA 3MFFB 3RWCB 3TNMB 5D5ME 1GZQB 1U8LA 2W9EL 3ZHKA 1J8HB 4PY8J 4EI6B 3FQTA 4JZJC 1X4YA 4K3DH 1OD7A 2OL3B 5L2KB 2ICWA 1B0GB 2NY0B 3O4LA 3G5XA 2DS4A 2W1NA 3WUWB 1MCEA 3W9DB 1JGLH 5IMOA 3RU8H 3IDIA 5C09E 4J4PA 1CXKA 3PABB 4LEXH 3VGAB 3C2AH 1LK3H 3DI2B 1OPGL 4MA7H 1PQZB 4A2LA 4PJXF 4XPHL 1EFXD 4HH9B 3VXRD 4DTGL 4XRCB 1MNUL 2HTKD 4S1QL 3MLSL 5SWSB 4PJCA 4CN4A 3V4UL 3L95B 1JCKA 4NDMA 2Y6SD 4QY8B 5DQJA 4DUVA 1S9WA 1CGSH 2HTKC 1X5AA 4DFIA 4L4VE 1AJ7L 2Y6SC 3K8MA 5FECA 3DRQA 1A21A 2WIMA 1EAPA 4FNLH 5FHAL 2FR4B 3MXVH 4JRXB 4XCYB 1X5ZA 5AZEH 3V0WH 1S5HA 3TO4C 3JSSA 4ETQB 4IIQA 3S3SA 2Y36H 3FQWB 5IHUH 5D93C 1EO8L 1N8ZB 2GJ6A 4JM2F 1I1AC 4NJ9L 3VXQB 1E28A 2JE8A 3OPZH 1MFAH 2VH5L 1QR4A 1Q72H 4POYA 2E9IA 3EJYD 5EIIA 3OX8B 1UJTA 1QRNA 3O6FA 3F7PC 3NFSH 4PLNC 2KDGA 3HMWH 5AZ2L 3TT3H 2XQBL 3SKOB 4PGDB 1JV5B 3WKNA 4OTXH 1NANH 3HNTL 4TRPH 4OGYH 2JKXA 3CFCL 4LLQB 1U3HB 1YN7A 5TE6H 3GBNL 2F15A 5LAXA 3PG2A 1IBGL 1JWSA 3QB7C 4YHPB 3BO8B 4LFHG 2FHCA 2KZWA 3PP3H 4EBQL 3MUJA 4BZYA 5I76B 1W2KT 4LLDA 1CL7L 1GVIA 4LVOB 1SY6A 1TTGA 3JVGA 4U6VH 5CS7A 3D69B 5J11C 5KG9A 3BX7C 1LE9A 5FYKL 4HXAL 4EVNA 3O4LE 4K9EL 3GKWL 4PGBA 3OBAA 2XWJB 2PO6B 1RJLA 3WFHB 5T1KD 4KVCH 5F7NC 4FP8L 1MI5D 3WN5A 1K6QH 2XKNA 4ODWB 3UCRA 2MHAB 4LSVH 5F21B 4D0CB 4IMKA 4O58L 4U7SA 3OKDB 3P0VH 4PJXE 4BJLA 4PRNB 3F12B 5CMAA 3KLHD 4IM8A 4KAQH 4YNYA 4XVUD 3I6KA 1VPOH 4U6HA 5J13B 4MCZA 4C57C 1RK0B 4ODXB 4XVUC 4NJAL 3ZZ1A 4AG4L 5ESQB 1QLFB 5GSVB 1RZJC 2JCCF 4PG9A 4MJ4A 1TQBB 3G5ZA 4XAWH 2OLDA 1N64L 1QFUL 4RAUA 4NSKB 2B39A 2DWDB 4N90E 1QNZH 2GJ6E 5BO1H 1DQJB 2NXYC 3ZO0A 5JXAL 1A6TA 2FX9H 2F8XC 2X4QB 3OKEB 2HN7A 5DJYA 5A3IC 3L3JB 2NY6B 1JTTA 3GUTA 5BOZG 3S4SG 4JPVH 4BELD 3DMMD 4F2MB 1QRNE 4PRIB 1NFDF 4H8WC 3N9GL 3PWPD 3OKOB 4DN4L 1KCLA 1I3UA 3O3AB 5DZNA 1D3CA 2C3VA 4PJ7A 3BKYL 4X4XA 1K9TA 1REIA 3LS5L 4FZEL 4WHTB 5DJZA 3BKMH 4WI8A 3AREC 1T7VA 4X0KA 4P0DA 4HG4J 3G5YA 1TDQA 4KJYB 1V05A 1AHWC 3SDDB 1KACB 3TYFB 1CFVH 3IAPA 2E5EA 1DUZB 4OF3A 1VESA 4JHZA 1JP5A 3C6SB 3ZE1F 2XZZA 4D2NA 3MRRB 5ITFA 4JPIB 1J1XL 1TCRA 1K85A 4HUUB 1JPTH 4H88L 2DWEA 3P73B 3KPRB 3SE8H 2AKRA 1QO3A 3ILQC 3FO9B 5IWLC 2IFFH 3EYUH 3O3BA 3KDMB 4X6CB 1I85C 1HQRA 1YYLH 5J7CC 5I8OH 4MD0A 3VFGL 2P5WD 1P69B 3OMZA 1MCQA 3LOWA 4ISVA 4AH2A 1NUFA 1TCMA 4WWKD 5HI4C 4OGAC 2HKHH 4CU7A 5HPMA 5SWZB 4OIAA 4PP2B 3CC5B 1NFKA 3HR5B 4FFYH 4GRLA 4Y19D 1FNSL 3CH1B 5DZOA 4ONGL 5JLZA 2OJZH 4LEOA 4M00A 3ULUF 1ZHLB 1HHGA 3WL9A 4QXUL 3SOBH 1CE1H 1FO0H 4U7MA 5JDSB 1HIML 3WJJA 4QHLB 2FLBT 3MRKB 3ZSSA 1KG0A 3H9SA 4Y5VC 3VFPA 4L4TE 4PJ8B 4FFWD 4HJJH 1J5OH 1HOCA 2D9CA 2WBWB 3MO1B 4QWWC 1GJIA 4OZFB 2PCPA 4D8PA 1P1ZA 3FT2B 1GIGH 4H26A 4K8RH 1FYTA 1KBGH 1MH5A 1MHEB 2FJFA 1KJVB 3QNXA 3UTTE 4WFEE 2JCCE 1S9YB 2W60A 4XMKL 3PF2A 2MNUA 3GSRB 2G75B 1NGZA 1XGRB 4XNXH 3QUZD 4NGHL 1DUYA 4K23L 1GRWA 2CR6A 2R0LH 1C7SA 1NCBL 2HMID 3H3BC 3WFDH 3QUZC 4B7IA 5DJXB 4ZSOA 4N0CD 3MNZA 2HTLC 3MLVL 1NFDE 1RZKL 4N0CC 4GS7B 4O5LL 4R7NB 4U05A 3MZTA 1LEGA 3QNYA 1MHPH 3ALWA 4KKBC 4NPYA 2ZOLB 4HSQA 4BQ9A 4UB0L 4QHNB 5C0GA 4NQEE 3ULVL 4MQSB 4RMTA 2NY5C 4ZUSB 1H3GA 3MJ9A 4L9LB 5I30H 1G7MA 4F7TA 5F7WC 3RWDB 1NFIB 4G3YH 5GS0D 4XBPB 3GMRB 1QYGH 2GITB 2ICEB 2IANB 4HG4K 5DDHA 4M6MH 3ZE1E 1UM4H 5GS0C 4YHOH 1I8IB 2XKSA 5D72L 1G9MC 3IAQA 4P9HH 3TVMB 1IQWL 5K9QI 2I9LB 2MCPH 1HHHA 5E5MA 4H20H 4LRIC 3ZYIA 2XTLA 2HKFH 3T04D 4HMEA 2ZKHL 4D0DB 4OT1L 4JHAL 3T3PF 1A47A 1BZ7B 1QLEL 1AI1H 4ZPVB 1J87A 5EU3B 4LCIL 3MTRA 4P3DB 1D5XA 3BT2L 4M7LL 4JZOB 3MGAA 1PAMA 4Y4HB 4QRPE 5A2KH 2CIIA 2Z8WC 1J7VR 2AGJH 2VDLH 3ULUE 4ZS7L 3I50H 4LSTL 3THML 2Z0BA 3VXSE 4XTRC 3MRGB 2VUOA 3KVQA 3MBXH 4LLWA 2JELL 1KNOB 5TF0A 4HS8H 5KVMC 2A1WH 1IM9A 4JFYB 5CWSB 5IMLA 2AI0H 4Y16C 1FYTE 1WV7T 1T2JA 1UXWB 1WZ1H 1YYMH 3H2WA 4CJ1A 3OAZK 1INQA 3Q6GH 5GRUH 3O45A 1CBVL 2BNRD 5BS0E 3I9GH 5HSFA 5L8KB 2H9GA 2W92A 4S1RH 5GRJH 5ADPH 1BD2A 4KJPC 4U1JB 1UCBL 3O6LH 4K3EH 5EUKB 5HI3D 4ZO9A 5E9DD 4CMMA 4YUEH 1EXUB 3FHAA 4PBWD 5BXFB 3T77B 1SEQH 1WFNA 2A6DA 2AK1L 1SHMA 3KXFD 1WLHA 4PTUA 5HDQH 4OLUH 3EOTL 5D2NB 3VCLA 4A2MA 1UYWL 1XF5B 3RNQA 2AABL 2E9WA 5AYUH 5IB1B 4MB5A 5F7MC 2WBJB 3D2UD 5LCVH 5IW1A 3KPQA 4PJHA 5F9JA 1N59B 4YHLH 5KW9H 2MQ0A 4OLWL 1RULL 2CMRH 5CEZE 3PV6A 4NNXB 4O2FB 2R1XA 3KYKL 1YDPA 4PR5B 3VFWA 1MFEH 4MDIA 5EPMA 4YZFF 1X6LA 2Q3ZA 3QZWB 2Y23A 1ZGLA 1NMBL 4J8RA 1MCPH 4JHWL 5IFAH 4P23C 5A16A 2W9EH 1RHFA 2FCBA 1S7RB 5C0NC 4C83A 4XXCA 3O9WA 5MI0C 3SCMB 1ITBB 1CICC 5FYJE 3HCVA 1LO5B 2DLFL 3T3PE 5KVDL 1CDUA 5IUSA 2OMNA 1OPGH 1OLLA 4EXPX 4XPHH 4K7FB 4DTGH 4WW2C 4FXLA 3V0VA 1MNUH 4JKPL 4S1QH 3ZTNL 3QUKB 3MLSH 4R2GC 3V4UH 1CT8A 1H5BC 1R3KA 4I18C 1MLCA 1M7DA 4OZIF 4PRPA 1AJ7H 1UB5B 1EUTA 5SX5K 1FSKC 1TVDA 3EHBD 3MBEC 1ONQB 3B6SA 1Y18B 5FHAH 1E4KA 4P2RB 4LHUA 1A9BB 1L7IH 4OZIA 2BZDA 2P46B 4P4KB 1BD2E 4U1MA 5HYJD 3MV7D 4NCC2 2GUOA 3HLAB 3TBWB 1JUFA 1EO8H 4HWEL 1UJ3B 4MDJB 4NJ9H 2CLRB 2BY2A 5KZCB 2CXKA 1PDKA 1B6UA 3CSPA 5A40E 1MCWM 4OIBA 5I1HH 3BGMB 1T6VN 5J9PA 2VH5H 3SGJC 4G80B 3UPAA 1VFAB 5AZ2H 2XQBH 4GAYB 3GJFK 3QIUD 4JFFD 4AQOA 2VLKB 4MVBD 3HNTH 5EFIA 2EDBA 4AT6B 3CFCH 2YWZA 3VXRB 4Z78A 3BMWA 2V6HA 3RWEA 5J1SC 3GBNH 1I9IL 4D9QD 1EO7A 1IBGH 3MOBL 4KI5F 1ZT4B 5AG8A 1K5NA 1XIWC 2OR7A 1CD8A 4EBQH 4LU5L 2KL6A 3VXOB 4EOWL 2GYSA 2I60L 3MJGX 2AQ3A 1TITA 5DGRA 4YZFE 2XRAL 2O26U 2OQJB 3E6FB 3O6ML 1TNMA 2GCYB 3CSBA 4LIQE 4MQXC 3OGOE 5C6TL 3HG1E 5FYKH 4HXAH 4K9EH 2R0ZH 3GKWH 5BZDB 3L5WB 5C0CB 4HFUL 4OUOA 3MRFA 1FAKT 3IJSA 2J4WL 5SX4I 4FP8H 4EDXB 4JGJA 4LAQL 1WCBA 1HHJA 3T2PA 4L8SA 3D5OF 5T1LA 1U8LB 1GCFA 1BM3L 4O58H 4LLVA 3FQTB 4HS3B 2ICWB 3LB6C 4PRPE 1MCHA 2QR0B 3IJHB 5IMOB 4JPKL 3IDIB 1A6ZA 3R8QA 1IC4L 3UPRA 4Y4FA 4Q7DA 4OZIE 4NJAH 4R26H 5FYKU 4AG4H 4CADA 1CDBA 3T09A 2CDGA 4UDUA 2IFGA 1XZ0A 2VOTA 4UUJB 3VH8A 3CFBA 3E1F1 1N64H 1QFUH 1U41A 2UV3A 3DRQB 4M1CD 4IRJD 5JXAH 4KK5D 1CE6A 3GSNA 1QLRA 3T65B 1QUNA 5F9OL 3DGGB 4KK5C 3N9GH 1N0XL 2E8YA 3VMOA 4LVHC 4DN4H 3EDDA 12E8L 3BP4B 3C2SA 2H26A 2VZUA 2E6JA 3BKYH 4WI9A 5T1KB 3OAZH 4QOKD 3LS5H 4FZEH 5FGBC 1MI5B 3HZKA 1NUDA 4Q9QL 3EOYG 1U8QB 5EORL 4AZ8A 3EFDL 5BCAA 4G8IB 3PHOA 4DEPB 3O6FB 3DNKA 1T04B 1PKQA 5D7KD 1QSED 4KI5E 3N1GC 3T0BA 3AY4A 1J1XH 4LQFL 4H88H 2ADFL 1YN7B 2FWOA 2CD0A 4IS6A 1J1PL 4WI5A 1FZJB 3GKZA 3LN9A 2OX5A 1JWSB 3KYOA 3R0MA 3VFGH 5J8OA 3Q5YA 5CJBA 3VFVB 1SQ2N 4GAGL 3NPSB 5LXGL 1TJIL 1C5DA 1FNSH 2NTFB 4MD4B 4ONGH 1KTLA 4JRWA 2EE2A 4FZ8L 3MLXL 5DD5L 4PBVC 1KCRL 4KKCC 4PTTB 2R2HB 3K3QA 5KG9B 3DMMB 3TT1L 4QXUH 1BBJA 4ODVL 4V2CB 4EVNB 3LRHA 3PWPB 1HIMH 3R4DA 5J13C 3A0OA 1UENA 4PGBB 3LKSB 5E5RB 5DK2A 1X44A 2AEPL 1CTNA 1WTGT 1Y0LA 4WY7L 3PWUA 1U93A 1YPZF 4HUMB 2EDQA 2NY3C 4Y2OA 2PETA 2ENYA 5GZOD 3WE6A 1LEIA 4LSUL 3CDFA 3VFOB 4YNYB 1P4IL 1S7TB 4PJDA 2JK5A 5I9QB 4MX7A 3IDYB 4PRBA 4KVNL 4XMKH 3R8BB 4U6HB 4EQ3A 3WHXB 4MCZB 2X89A 4TVSa 5LGJA 2DRUA 4NGHH 2ZUVA 4K23H 2GEEA 5FF6A 1U8HB 2ADJA 2P5WB 1K3IA 3G5ZB 5E2TL 1I7ZA 5SX5H 4WWKB 2FX7L 3KPOA 5DYOA 3MLVH 4LCCB 1G1CA 4Y19B 4OQTL 1RZKH 1A6TB 1UZ6F 4JVWA 4O5LH 2HN7B 4P2OA 4BYHA 2VWEE 3NA4A 4U1SA 3H7BA 3BD5A 3GUTB 3MMEB 4Q6IC 4UB0H 3ULVH 2DD8L 1QACA 4TNWF 2H8PA 2ZP0T 2YZ1A 2WSKA 2NY4C 3IF1A 3S88L 3QWRA 4PJ7B 5F3HA 5HHMB 2D03L 4WI6A 5F3BB 1BQHG 4YGVA 2BSTB 1ZLUK 3QWOB 5D72H 5IGXL 2J8UB 2XFXB 2OTWA 3FB6B 3SY0A 1IQWH 3GJFH 1IARB 1CD1A 4KHXL 5JHLL 2ZKHH 4QEGA 2OJEB 4Y4KA 5DHVA 4OT1H 3OV6A 1TCRB 4JHAH 4RMRA 1QLEH 3UBXG 4N9GA 3KPSD 1U2HA 1NUGA 1QO3B 4LCIH 1DEEB 1OSPL 3BT2H 4M7LH 3Q48A 1IJ9A 5EZJA 5T1DL 5T5NG 4M61B 4CNIA 5B8CA 1KTDA 5F9WC 4MD0B 4UU9B 5D9SA 1FNEA 3WDHA 4ISVB 1D5IL 4PJ8C 3J8F7 3TN0C 3QDJD 3CXDL 4ZS7H 5GHWL 2V9RA 4LSTH 4JFEE 5DMIL 3THMH 5HPMB 4XC1L 2W9LA 4GRLB 4NC2B 3DRTA 2CUMA 2EDLA 3BP5A 2OP4L 5I0DA 2JELH 4MMXC 1SEBA 1R6VA 2M26A 4X8XA 3C8DA 5ISZA 3NCCB 4MA1C 1HHGB 2CKBL 2BSED 5GGRY 4F9LA 2XNAA 2LU4A 3L6FA 2HP4A 1YPZE 1CBVH 1UH3A 2N7AA 3N0PB 5IEKB 3ARDD 3H9SB 1KLUB 3VFPB 1WWAX 1KELL 4QCIA 4D9LL 3U46A 3WD5L 3MV8E 1MHHA 1UCBH 2ZPKH 3LZFL 4LLUB 4FQXC 4F9PC 5F9AC 3LSOA 4S1SL 1XGQA 1IGIL 2UY7A 5E94B 1MH5B 2FJFB 3OB0H 4LPTA 5E99L 1BJMA 3MRMA 2AK1H 3P2TA 4HCRL 1FNGB 1A4KA 1J10A 3NCEB 3PL6D 4CBPA 3EOTH 4YAQB 2VR9A 1UYWH 5EO9A 2A38A 2AABH 5DVMA 5J12B 4P46D 2AV7B 3QUYA 3RQ3A 1WGOA 5DD3L 3QUXC 3DX7A 4HH8A 5DJ6A 1UZ6E 4PJBF 4P46C 2OR8A 1NGXB 3LEYL 1RULH 4OLWH 3TFKD 2FEDD 3MNZB 4RRPA 1PYWA 4XWGL 3KYKH 2VQ1B 2FEDC 1B0WA 2HJFB 2MSPA 2FH8A 3C09C 3QULB 2X1WL 5E8PA 1WZKA 4I4WA 4H8WL 1K2DB 5T3ZE 2NY7L 5C0GB 1NMBH 4JHWH 3LMJL 2XWTA 4GW4B 3UTZB 2BNRB 2P7TA 5KSVB 4N8CL 5CFHA 1G7MB 4F7TB 2LVEA 4OCMC 1EMTL 2WBKA 5CZVL 4DKAA 4PLKC 5DDHB 4GT7A 5FGSA 2DLFH 5INDA 3D85A 1NBZA 5E9DB 5KVDH 1R3JB 3W39A 2NY1B 3HC0B 2QTEA 1I1YA 1HHHB 4JKPH 4QRUB 3ZTNH 1NAMB 3QAZB 1ZLWH 2E7BA 4BZ2L 4MD5A 1Y6MR 4YEEA 1T1WA 4RGND 1I75A 1PEZA 3OR6B 3PNWA 1CGTA 4PGZA 1K8IB 5CD3A 4DQOL 3EW3B 3EYVA 4GKSA 2HRPL 2CIIB 3U7YL 5E08L 3KJ6L 3QIWD 4Y7MA 5DRZA 1BJ8A 2G2RA 3BZFB 4MZ3A 4XCFH 4UQ2B 3BH8A 4R4BB 1A6WL 2HRLA 4RNRA 1KT2A 3QIWC 4LLWB 4YBQD 4QGTA 1KJMB 3QIBC 4XGZA 1KLFA 1Z9LA 4EI5A 3AM8C 4HWEH 4NQXB 5HTSA 3ARUA 4FTVD 3RGVD 2AXFA 4J3TA 1INQB 3OKYA 1NMCB 2EECA 5J4MA 3L3OB 3RGVC 2WBJC 2X42A 3HC4L 5B38G 3LCYA 4WV1C 3SDCA 2UZYB 1A6UL 1UACH 1JVKA 3U36B 1AGDA 4PJGB 4YHIB 4JAMB 3QNZA 4ZAKA 3VFSA 2AJZA 3V6OE 1Z9MA 2KBGA 3QCUL 4P5TD 4LPXA 1I9IH 2A6DB 1AO7D 3B3IA 3MOBH 4J3XA 5A1AA 4PJBE 1JGDA 1CFTA 2BXZA 2Z31C 1C1EL 1Z3GL 4LSSL 3TPUB 1MIEL 4C56D 1JWMA 5HGBB 4I5BA 2DQUL 3FOMB 4EOWH 2D4DA 2I60H 1JZ2A 5K9OB 4LVNB 2VSDA 2UZXB 4KY1L 3VRIA 4U31A 2XRAH 4U1LA 2WWKO 3O6MH 1IGJA 5C6TH 2X1XR 1P7QD 1B0RA 5C08D 4UILL 2R1XB 3OJ2C 4LGRB 5E8DL 3MV7B 2XACC 5EPMB 3ARXA 3RVXD 4HFUH 4HWNA 4JFDA 3WKML 4BZ1L 2APWA 2J4WH 4X6BA 1U3YA 2VL4A 4L29A 1I8KA 4P5KB 1T0MB 1ZGLB 3MLPA 5IBTL 4LAQH 3IKCA 4OD3L 5D1ZC 5C09D 3PQYA 2VABB 4NO2A 1BM3H 1JIBA 4RMQA 1ZVSA 1WISA 3DUUA 1HDMA 5ETUA 1KCVL 4R4NC 4H25B 2ZOKB 1ZLUH 1HZHL 5GS0L 4TSBL 2VQUA 4KRLB 5E6ID 3HCVB 3VD5A 3QIUB 4JPKH 1G9ML 1IC4H 5IOPA 2E7LC 2X1QA 5ID1A 2BHZA 5IMKA 5BRZA 4YR6A 3V0VB 1S9VA 1B2WL 1A7OL 1CT8B 1MOEA 3S5LB 3IRZA 1BAFL 2YD3A 1R3KB 3H8NA 4JDTL 1HYSD 4J3SA 2ZCLL 1G0DA 2AXGA 2VITB 3DETD 3LV3B 2EXYC 5DJCA 1IKFL 5F9OH 4CN6A 3UTOA 2BVOB 1N0XH 5DA0B 2BNUB 4U1MB 4KQ4L 3ZHDA 1RU9L 2HJKA 3F8UB 5CSZB 2X4NB 3C5ZC 12E8H 8FABA 4Y2DA 2AJVL 5EOTA 1HEZB 4OF0A 3E2HB 4Q9QH 3O3UN 4X99B 1BX2A 2RR3A 3X17A 4TVPL 2ID5A 2O5ZL 5EORH 5J9PB 1J9CT 3EFDH 4HZAA 1SYVA 1FRGL 2BSSB 4IOFD 2ZNXA 4UNVA 1YUHA 3ALXA 4FG6D 4LQFH 1JHTA 1KPVB 4O02L 1A6PA 2ADFH 5EZLA 2OTPA 1YMME 1JPST 1J1PH 2IADA 4IOFC 3VFTA 2PTVA 1A7QL 1IAIL 3ARPA 2HH0L 3W81A 4Z78B 5I1DA 4FS0A 3IB4A 5GPRA 4OD1L 3UYRL 1K5NB 4U7KA 2EC8A 1I1CA 3V8OA 5ICYA 4GAGH 2BNQA 4DVBA 3IU4L 2Q20A 5LXGH 1TJIH 1JK8A 3IFPB 2B0SL 2F58L 4XT1C 3V6ZA 4FZ8H 3MLXH 5DD5H 2YRZA 3FQRA 1KCRH 5L8LB 2PTUA 5MENA 3TT1H 1R3HA 2FL5A 4ODVH 4J4PC 3QJHA 2VLJD 1AH1A 3TNNA 3V9FA 3ULVF 4M93C 3T4AB 2QADD 2AEPH 2ITDA 4QOKB 3RVWC 1EHLL 5DR5L 3U1SL 4WY7H 2VE6B 2J88L 1OQXA 1WCBB 1WITA 1YC8A 4L8SB 4OCLC 4ZUUA 2QADC 5T1LB 4WI3A 2R0KL 5GGSA 5IIEA 3FO1B 5MHSE 4LLVB 3X3FL 4ZMAT 4MNQA 1XF4B 5I75B 5CKGA 3QQ4B 5I1AA 2X70B 1QBAA 3TZVD 1P4IH 4Q74A 5FKPA 4QHKJ 1A6ZB 4KVNH 1F5WA 1E4WL 5FM5M 3KPLA 4JANA 1T5WA 5FA4A 5GRZA 4A6YL 4H0GA 4N90D 3GMLB 5ICXA 4IIQC 2CDGB 2VLLA 3PGDA 2HG5B 3HR6A 3O8XD 4Z8FL 1ZGLM 1DANT 1NEUA 4MAUL 4U1KA 5E2TH 3CMGA 2FX7H 3WO3B 4JM2D 2Z91A 4M9OA 5KOVC 5ALCL 1JBJA 1U6AL 4OQTH 4WUUE 3HFML 3EGSA 3N06B 1EK3A 4WO4A 5ANMA 3GSNB 3FFDA 1QLRB 5E1HB 1SJEA 3ZDXF 1SJXA 1R5WA 4PJIF 2P8LA 3S36X 4BK5A 4YJZL 6CGTA 3MGOB 2XPGA 3UP1A 2F8OA 2V7NB 1KPUA 3S88H 1JNHB 4PS4L 2ZJSL 2H26B 4PJIA 1W8OA 2D03H 5HYQA 1KB5A 4WW1A 2C4FU 4N1HB 5IGXH 2CLVA 4W6XB 3NPSC 5ECJE 1A14L 3OR7A 4QT5A 5CJOL 4FQ1L 1PKQB 2BNQE 2D9QB 2FZ3B 3JVGC 4KHXH 4L8BB 3QI9D 1YY9D 2DIJA 5JHLH 5D6DC 3VXME 2NQCA 3MLZL 3TA3D 4NBZB 1EZVX 3R06A 1U2CA 1TQCC 3K0WA 1S7QA 4LNRB 1LWRA 3ARBD 1OSPH 5T1DH 4KTEL 3TA3C 2B5IC 3KYOB 2OI9B 4DGVL 1RJYA 2IMMA 3U4AA 4XPTL 1DN2A 1MWAB 1EEYB 3L7FB 1D5IH 1SJHA 4GKZB 4B50A 3CXDH 5GHWH 2WUCH 2G5BA 1VHPA 5DMIH 3WN5C 4NKMA 4XC1H 3L7EB 3W11C 1QKZL 1F11B 4IMKC 3IU3B 2OP4H 5I8CA 1KTLB 2OL3L 1JMZA 3ULVE 4S2SA 3TBVA 3BHBB 4L4TD 4MNQE 1BBJB 2CKBH 3O41B 1D6EA 3C6LD 5EU6D 3BPNC 5FGCE 3AUVA 4ZFFA 1KELH 2VDQL 4D9LH 3UTTD 1BFSA 3WD5H 4WDIB 1OOAA 1Y0LB 2QQLL 3EYQD 4WFED 3LZFH 1LGVA 3UJTL 5IHLB 5C0DA 3OXSB 1BHGA 4S1SH 1CVSC 3CUPA 3EYQC 1IGIH 2FSEA 4JHBA 1LO0L 3WE6B 1LEIB 8CGTA 5E99H 1Z5LB 3OKKA 4XHJD 4HDIA 4HCRH 4PJDB 2JK5B 4MX7B 5CJ8A 2AJ3A 5J1TC 2WW8A 4XHJC 3KPSB 4F57L 4H1LH 1T89A 3T1WA 3CDYA 4I9WE 1LP9F 5DD3H 4JQVA 5FF6B 1HSAB 3EYFA 3UMTA 3S98A 2GSIA 2NNAB 3LEYH 4MNGB 3QDJB 3ZDXE 4F37F 4Y1AA 5FO7B 1X5HA 4PJIE 2XN9A 1HQ4A 4KKLC 3FRPG 2FATL 4XX1E 1M7IB 1YECL 4XWGH 3PP4L 3ROLB 4NQED 5E6YA 5CLWA 4ZTOL 4P2OB 3HZYB 4DZBB 2W07A 4NWUL 4U1SB 3H7BB 5BW7C 4H8WH 2NY7H 1XF2B 3G6AA 3LMJH 5IM7A 2JB6B 5JW5A 2R0WL 2H8PB 1HCVA 4N8CH 5JORA 4OFVA 3F7YB 4POZD 3ARDB 3IF1B 5F3HB 3MRIA 1DVFA 1EMTH 4YIQA 1F3DJ 5CZVH 4POZC 2X4TB 5HHXL 3N85L 4YGVB 4HK3N 1XF3B 4OZ4A 1A7NH 3SY0B 1L9NA 2YUZA 1EEQA 2Y5TA 3D3VA 3M17A 3WIFA 4XC3L 2VR4A 5J6GA 4QRPD 4BZ2H 4X98A 3BYTA 4N9GB 4RISL 3ULUD 1AXSB 4Y8AA 3GMQB 3QXVA 3MFGB 5EZJB 3VXSD 3C8KA 4M8QA 3O3EA 4YBLB 3WJJC 2R2CA 4BH8A 4DQOH 1DL7L 1IGYA 4WEUD 3ULUC 4HV8A 1WBZA 4APQD 2HRPH 5IQ9B 1QFWL 4P9ML 1DR9A 3U7YH 4BK4A 5E08H 3KJ6H 1BVKA 3REWB 3HAEB 5F7YC 2Z92A 4X9FA 1A6WH 2EEAA 2QLVB 3C9NB 3FO2A 1Q9WB 2VLME 3BP5B 1U8OA 4JFHE 4UMGA 3UZEA 5BS0D 3X3GL 1GC1C 4JREC 5ISZB 4PJFF 1EUUA 2XNAB 3L6FB 4KRPC 4Z7UF 4UOW0 3RPIA 4GXUN 3RWFB 2YD5A 1XGUA 2E7HA 3MCG1 4QCIB 3HC4H 3OXRA 4O00A 3U46B 4AIZA 4EUPB 4NQDD 3DSFL 1A6UH 1A9EA 4Z7UA 1X7QB 4MZ2A 4DFHA 5L0QC 3KYMA 3QEHB 4ELKB 3LSOB 1YA5A 4D3CL 1QVOA 1MFBL 3QCUH 2Q6WB 4Y1AE 1D5ZA 1LP9E 2FIKA 3MJ6A 4GG6F 4KK9D 4HT1L 3ES6B 3JWOL 4LQ1A 3RL2B 1C1EH 1Z3GH 1D5BA 4LSSH 1MIEH 2VJXA 2DQUH 2X7LA 4KK9C 1RURL 3ZE2F 3DX7B 4HW6A 3VMPA 5DJ6B 4GG6A 1NC2A 2IBBA 3U9PL 4ZXBD 1K4CB 1KJ2A 5M7QA 3HZVB 4KY1H 5IVXA 3KG5A 2EE6A 4KHTL 5DO2C 4ODUA 1H15A 3VRJB 1ZLVH 4UILH 5DGQA 3I3BA 1BGXL 4IMLA 2X40A 4OFYA 5E8DH 1T1ZA 5JOFB 2GIYA 4E9LA 1Z9SA 4BZ1H 3WKMH 2KUTA 5E8PB 3WDJA 4I4WB 4AENB 1W72A 3D3VE 4YDIL 5FYJD 2XWTB 4PRDB 5IBTH 4JFQA 3RTQA 1UWXK 4OD3H 4OI8A 1MCOH 4MCYB 3KPPA 2X4SA 1X3DA 1DDHA 5JPMA 4KZDL 1C12A 2BVUA 1BQUA 1KCVH 2BCKB 1HZHH 5GS0H 4TSBH 1LO4L 5IBLC 1DBJL 1EZVY 3CDCA 1G9MH 2WWMD 3W39B 5ABDE 1G7JB 3QPQD 1I1YB 4P5TB 2NW3B 1IM9D 3OF6D 5T5NF 1I1FB 1M4KA 1XGPB 5B39G 3HPJA 1AQDB 1QQDB 2ICWI 5HHQA 1B2WH 1A7OH 3QPQC 1I7RA 1P4LB 5EU5A 2EDYA 5F1OB 1BAFH 2MOVA 4JDTH 4C56B 2ZCLH 3RVUC 4NHUB 1NCWL 3MODL 4O9HL 1VGEL 4NWTL 5CD3B 2FIRT 4R97C 1VENA 5D7JA 3DURA 5DFVC 3EYVB 1YNTA 3ME0A 1FNAA 2HLAB 4EIZC 5DHXB 4ZOAA 2IALB 4PV9A 4NN6C 5F97E 4B7LA 5DRZB 1FVEB 4NRZB 2G2RB 4PJFE 1IKFH 2N56A 1MCKA 5C08B 4RNRB 3AGVA 4Z7UE 4KQ4H 1RU9H 4XGZB 3I2CL 4MMZC 5F93C 2A74A 3ET9F 4OLEA 3DIFA 4EI5B 3HE7A 4Z7QF 2AJVH 4J23A 4HF5L 2NX5A 5JIIA 5HGDA 1QFPA 3UAJC 5I17B 1ADQL 4U6XB 5C09B 4TVPH 1G6RA 4NC1E 2O5ZH 2UVFA 4X4ZA 2XOTA 2BHYA 3H0TB 3SDCB 1NPUA 1CLCA 5C3LD 1FRGH 1CD0A 2JIXD 1HWGB 1FL5A 4MB4A 5E6IB 3MZGB 1GOHA 4GG6E 2GJZA 1N3NB 2EXWD 2AJZB 4O02H 4XNMA 1N7ML 3JUZA 1A7QH 1IAIH 2HH0H 4KK8D 3ZE2E 1OWRM 5CEXB 4IDLA 4QTHA 4OD1H 2EH7L 3HB3D 3UYRH 3QHZL 2H32H 5I18L 4Z76B 4KK8C 3VD4A 4P2QE 3BJ91 1BVLB 3IU4H 4MQ7B 3SQOL 3HG1D 1A2YA 4QXWA 2B0SH 1CGYA 2F58H 4XPAL 3RY6A 3G6JF 3K1DA 3GMOB 4F7EB 3VRIB 4XXCC 4HIIA 2ILLA 4U1LB 3O9WC 5ADOL 3BSZL 4UQ3A 1YN6B 4FHBD 5DXWA 1B0RB 5GISL 3TGXA 4U6YA 5CIPB 2UWEA 3HPLA 1CDGA 1AD9B 2KPNA 1UEMA 3QJFA 2DQIL 2GTZA 3F7VA 4L29B 1I8KB 1EHLH 5DUBA 5DR5H 1TXKA 5A2JH 3U1SH 2J88H 3VXUA 3IKCB 1FPTL 5LQBL 3PQYB 4QRRE 2IMNA 2R0KH 4Q2ZA 4N0UB 5F7LB 2BRQA 1UCTA 1ZVSB 3BWUC 3X3FH 3B9KA 3U6RB 4BQ6A 1VGKA 1DZBA 5ETUB 2EDXA 5HYFA 25C8L 1E4KC 4U0RC 2OZ4L 1E4WH 1LO2L 5AAMA 3CU1A 5ID1B 5ACZB 2VZSA 5DRXA 4A6YH 5BRZB 3IDJA 4NQTA 2X4PB 1M6OB 4YHKL 1PY4A 5ELIA 3CFKA 4Z8FH 4F33B 4F8TA 4MAUH 1EHAA 4RFEB 4YPGA 5GGQL 2O61A 3L1OL 5DSCA 3ILPA 4JLRA 5ALCH 1U6AH 5CBEA 1NEZA 4KC3B 3E8UL 3TIDA 3BPCA 3HFMH 4JFOB 4BUGA 2F9BT 3Q0HA 1CFBA 4Q9BA 1RUML 4NN7B 2CKNA 3MX0A 4Z7QE 5GGVL 1YNKL 2HT4D 2VLJB 1BREA 2EDRA 1XFPA 4Q97A 5DMYA 2I9TA 4G42B 2HJKB 2HT4C 1TZGL 3SDYL 4OAWB 8FABB 4PS4H 2ZJSH 3BZ4A 4LRNH 5D96B 4Y2DB 5C0EB 5EOTB 5DURD 3ARFD 5IBUB 1T2QL 5HI5C 2VDRH 1C16A 4KI5D 2VKWA 4Z9KB 3F6IA 3QH3B 1NCTA 5HHPA 3OGCA 5EBLB 3BRGC 4C55A 1VADA 4MJ2A 5CJOH 4KI5C 4WJ5A 3TZVB 2J8HA 3RPKA 2A83B 3MLZH 4UNUA 1IM3A 3HC3L 3FB8B 3QEUA 2IADB 1HHIA 3VFTB 2NPLX 4MQTB 5I1DB 4KTEH 1VFUA 3O8XB 5IK3A 4DGVH 3G6JE 2ZG1A 1NGWB 3GJEB 5EN2A 3ZE0F 1I9RL 4GAJL 4W68A 4XPTH 1INDL 4RZCB 1S78C 2X41A 3TH3T 1KIRB 4X4YB 4Z7NF 4DVBB 4L8SC 2K3TA 1IE5A 3BD4A 1QKZH 3V95A 4XPBL 2OL3H 1B6DA 2D4FA 2EO1A 3NIFF 5BV7C 1RK1A 4FQPA 1C8PA 1MCCA 1OAQL 4U1NB 3TNNB 1EJOL 4Y4FC 3GBML 3VFMB 3ZYZA 5I8EB 4RDQF 3KYAA 5GS1B 2CR3A 3DX8B 4Z0XB 2VDQH 2HFTA 2QQLH 4YFLI 1HNGA 5CEYA 3E6HA 4N0FB 1OB1A 3TO2B 1R5IA 3WNMA 2P45B 4LBEA 3EOAB 5FOBA 1UM5L 4OKVA 1LO0H 4YK4B 4BSWB 5JXED 2OSLA 4B0MM 2QKIA 5FO8A 3B2UD 3QI9B 5JXEC 3ISWA 3IYLW 3O4OB 5E70A 5FYLL 4HWZA 3KPLB 1T5WB 4F57H 5FA4B 3BUYB 3ARBB 4DCQA 2ICCA 3PGDB 1KEMH 4MS8D 5IMMA 1JZ6A 1RHHA 3QQ3A 3HNVL 4OCNC 2K1MA 3IDNA 4BQ8A 3MNVA 4YO0A 1MVUB 5CP3H 2FATH 4UDTA 1YECH 2FBJL 3PP4H 4G8GE 3KLDA 3OJVC 4ZTOH 4FMFA 3EGSB 4WO4B 4NWUH 5ANMB 3QUMA 4RAVB 4R3SA 5FK9A 4L4TB 4H5SA 4K8RD 2RCSL 2HJLB 3MREB 3AY4C 5AD0B 5CCKL 5EU6B 4PG2C 2EH8L 2R0WH 3GGWA 3K1KC 1KPUB 3KYNB 4XVJL 1LK2B 1OT1A 5FIEA 4HS6A 3GIVA 1CGVA 2OI9C 5HYQB 4G5ZL 4WU7B 1LILA 5HHXH 3N85H 2WP3O 4PJEF 5I66A 1B9ZA 3TBSA 3VWKA 4TNVF 3VA6A 4CMHC 3CK0L 4XC3H 4G9FE 5GGTL 2A6KA 4J1UA 1W0YT 3ZE0E 1GH7A 2KZ1B 4QHKI 3LQAC 4RISH 4Z7NE 2HLFC 4JFED 1FG9C 1F6LL 1DL7H 3G08B 4UT7L 5HYSG 1NMAL 5GJSL 1QFWH 4P9MH 3NIFE 2G5BB 3L5HA 5HVGB 1A1MA 1F4AA 3HRZA 3TESA 3B9DA 5DMGD 3TBVB 3X3GH 3NVQA 1OP5K 5M94B 4RBPH 4BM7A 2AJUL 1TIUA 3FHQA 3MV8D 1BIHA 5J1AB 4O2CA 1D6EB 3ZDYF 5I71B 3PDOA 3CD4A 2V5RA 3FT3A 4KJWD 3LDBC 2D0HA 3OL2A 4I2XB 1I3RA 4HEME 3O0RL 3DSFH 4DUWA 3GBLA 5C07A 4Z7VF 4KJWC 5CJ5A 2NZ9D 1PGRB 4ZPTA 3U79A 2FSEB 4D3CH 4BSVA 5I1CH 1MFBH 3NN8B 1T20A 2NZ9C 4Z7WA 4Z7VA 1K4DA 5HVHC 3H9ZA 5F8QC 2FO4A 2C4XA 5F1KC 4DK3A 1BP3B 1MCSA 4HT1H 1JYNA 3JWOH 4P49A 4GKNB 4AMKL 2YHGA 3H3KA 3W0WA 3RZCD 3MRJB 2FB4L 2HVKA 4KMLB 1M71A 1RURH 2IH3B 3KNBB 2IEPA 3U9PH 3RZCC 4CGTA 4APQB 1IAKA 2Z4QA 4LKCB 2DLGA 4ZFZA 4KHTH 4Z5RA 4BA8A 2XN9B 5D2LF 5KSAD 4NKOA 1MHCB 3DYOA 1BGXH 1D9KD 3UTSD 3LS4L 5BS0B 3BP6B 3P4OA 5IV2A 5F6IC 1D9KC 2GY5A 2UY6A 4YDIH 3G6AB 4Y4KC 5IM7B 3VD9A 4OZHF 5FAAA 3SDAA 4CU6A 5MEPA 4PJEE 3DV4B 5MEOB 4NZJA 3MRIB 3LKRB 4X7DC 1DVFB 2FBOJ 4KZDH 1ZANL 4NQDB 5B8CC 4YIQB 4GMSL 2ZUXA 1AXIB 2G5RA 1LO4H 1DBJH 4PJ9D 3NZ8B 5IQ7L 3L5XL 3PXJA 2Z93B 1NBQA 4HUVB 1AE6L 3SGEI 1SY6L 4M9PA 2BVPA 3WFZA 1BIIA 4CUCA 4N0YL 3D39D 4X98B 4XCCL 1R3IH 4CRPA 2EZ0D 4LCWE 4B53A 1QA9A 1NCWH 4O9HH 1VGEH 4M8QB 4R0LB 4NWTH 4FQIL 5FB8A 1L6ZA 2W38A 1IGYB 4ONFL 3MUY1 3EYSL 4HV8B 5DVLA 4ZXBB 5KAQG 1WBZB 1MELA 3SJVA 5D1QD 1P4BL 3RUGA 1OTUD 2PYEE 1CGUA 1TVHB 4FQ2L 1MJJA 2Z92B 1T6WA 1KXTB 1A7PL 3ZDYE 1OTUC 1U8OB 3OJMB 1AFVL 5C0FA 3I2CH 5BMFL 5IHZA 3ZKSD 2LFGA 3IFOA 4HF5H 1GSMA 3CLEL 1FCCA 3P9WB 4Z7VE 1ADQH 2J6EA 5H94A 3L3KA 3D9AL 2X4RA 3RPIB 3VGBA 4ZYKB 2C7UA 1NSNL 3QUYC 3W0WE 5KS9F 2XWBB 3MUGB 1BZQK 2YOCA 3V6OC 3KYMB 2DYPD 4DOHE 3EO1A 3L5JA 4OF7A 1L7TL 1QVOB 3BN3B 4K7PL 5KS9A 5ITBL 2J1KA 5DQ9A 1N7MH 2XV6B 2C3GA 3PGFL 4MJ5B 2FIKB 3MA7A 4HPOL 2YD8A 2EH7H 4P5MA 3QHZH 1CXLA 5I18H 3GMPA 3CFJB 1D5BB 2ARJQ 5D2LE 1I7TB 3SQOH 1U8KB 4HZLA 3NGBB 3I75B 1NC2B 4XPAH 5FDWB 4IOIA 1XR9B 1KJ3L 5IVXB 4N5UA 5ADOH 3BSZH 4ODUB 5F1IB 5GISH 1QBML 1FAIL 4IMLB 5I1JL 5TPWL 3RDTD 4OZHE 3NCYS 4M7JL 4XNUL 3H3PL 2NTSP 4AJ0A 4GXUM 4TVPE 1HK6A 2DQIH 4JDVA 4NN5C 1AY1L 5GJTL 5J57B 4AM0B 1A1NA 1FPTH 5LQBH 4NO0D 4FMKA 2FDBP 1L0XA 3C60A 1E4JA 3KPPB 3MROB 1R24B 4PREB 4XXDB 2X4SB 1DDHB 4I8DA 4Y89A 2R56L 3FFCE 3TJHD 2JIXB 25C8H 3QQ9C 1ACYL 1JI2A 5CZKA 3V5KA 3BH9B 1VKXA 2OZ4H 5TE7L 3TJHC 5HPOA 4HKXA 1LO2H 1WCQA 4LOUD 2EE9A 1R5VB 4U0QB 5CHNA 2R15A 4YHKH 4LVEA 3H42L 3AXLA 4XAKE 5DEGA 2JJSA 4LOUC 5FYKD 1I7RB 3F7RA 4MA3A 3ROOB 1YEDB 3K4DA 4GW1A 4XCEB 1QSFE 5GGQH 3OKMA 3L1OH 4GRWF 2BERA 3HG1B 1IL1B 1AGFB 3ULUL 5FO9A 5DJAB 4HK3J 1S7SA 1T7WA 5F89B 3E8UH 1YNTB 4HAFA 2P5EA 3FAXA 3RVTD 1ZHNB 5FFLA 4NT6A 4PV9B 1RUMH 4NQCD 5GGVH 1YNKH 1NKOA 5EBMA 3RVTC 3MFFA 3TNMA 1J1OL 2CH8A 1H0DB 1J8HA 4ZAKC 4EI6A 5DUPL 1T66D 1GC1L 1TZGH 3SDYH 5L88H 5L2KA 5INCB 1B0GA 3G9AB 1Q0XL 3DIFB 3WUWA 3W9DA 5KS9E 2NX5B 3PABA 1T2QH 3K7UA 1G6RB 4BQBA 1PQZA 3U83A 1IFHL 4HH9A 4PYGA 4XRCA 4WHCA 1YMMD 5EWIL 2IQAB 4GH7B 4X7TA 1R0AL 4QY8A 1FL5B 1JFQL 3KPTA 2JJUA 2QQNL 4OCYL 2F5AL 2Q76A 3HC3H 3DI3B 4GFTB 5BVJB 1F42A 2FR4A 4JRXA 1I9RH 4GAJH 1INDH 4LSQL 2NR6D 2XTJD 4NC0B 5EZIL 2A6JA 4OGZA 4ETQA 1HH9B 3MJ9L 5C0BD 5CEZL 2B1HL 4L3EE 2NR6C 4RX4D 4EN3D 4XPBH 3QDAA 3VXTB 2ARWA 4KJQD 1ORQB 1OAQH 4EN3C 5BQ7A 2EDNA 1BFVL 3UZVB 2CDFB 1EJOH 3OX8A 3GBMH 2UWEB 3V5DB 3QJFB 2VLRE 5MHSD 3F7VB 2D3VA 4JGMA 1HNFA 4L5FL 5F7FA 3ARFB 3SKOA 2DMKA 4PGDA 1JV5A 2EEDA 1KIUA 4QHMB 4LLQA 1OP3H 2A73B 3B9KB 1UM5H 3L3IA 1VGKB 1IGML 2DLTA 1OGAE 1PX3A 3GSVA 4YHPA 3BO8A 3DECA 2XZAL 3U4EB 2LV4A 5I76A 2P5EE 4GLRI 5FYLH 2PKDA 3VWJD 3K2UL 4GRWE 5B4MD 5FUCE 1EIBA 4WUUD 3MLRL 1PY9A 3PWNA 1J8HE 2P24B 3HNVH 4YPGB 2NY2B 5L7XL 3TJEL 1QSVA 5F6HJ 2O61B 3EJZD 1TFHA 1IZKA 4JLRB 4B5EA 2FBJH 5CBEB 1NEZB 2XWJA 3TIDB 3BPCB 4GBXD 2PO6A 4X7SL 3RA7L 3WFHA 1IC1A 2NXZD 2IAMD 1JZ4A 5JIKA 4DK6A 5SWSE 2XIDA 2RCSH 4D0CA 1KIPA 5CCKH 2EH8H 1CDYA 3OKDA 2BX5A 3I6GB 4L9DA 3H9YA 4PRNA 3K80A 1P2CA 1U8MA 3BZ4B 4XVJH 1J0ZA 4JVUA 1GGBL 4G5ZH 1T7YA 1C16B 1ZV5A 2ED8A 4J3VA 4ODXA 3CX5J 5GGVY 5HHPB 3VXMD 4LCYA 1RUKL 1KC5L 3MCKB 3NFNB 1QLFA 5GSVA 1ZXQA 3HMXH 3LHPL 2RFXB 1IGTB 3CK0H 1WTLA 2IPTL 2RBLA 5GGTH 3T0ED 3TYGL 4HIXL 2PNDA 4JKMA 2YPLA 1T83A 2DWDA 5GRVL 1IM3B 3QEUB 2Z35A 5DTFB 2ICES 3MNWA 1XH3A 3FTGB 3OKEA 3SKMA 4TUJB 3L3JA 1IC5L 4UT7H 1FO0B 1NMAH 5GJSH 3ULVD 1AGBB 1FN4B 5I73B 4PRIA 3ARWA 3X14B 4HUWB 1GOFA 3HNSL 4LIQL 1W0VA 2DL9A 3O3AA 3BQUA 1C7TA 3MV9A 3QPXL 3HE6D 3ZKND 1AQKL 1RK1B 4NYLB 1FC2D 4I0CC 2AJUH 3GSQB 3HE6C 3EDFA 3QEQA 4KJYA 1FFPB 1T21A 3SDDA 1JF1A 2FEEL 5BZWA 5E03A 5HHOD 3HI1B 3O0RH 4X6CF 3OJDB 1K3ZA 1WQVT 4JPIA 5CEYB 4X4MA 3MRBB 4YHML 4RGMB 4HUUA 1OB1B 3P73A 3QFJD 1R5IB 2H2PC 4LBEB 1WFOA 3FO9A 2DBLL 2DICA 1UKTA 3DO3A 4X6CA 5I16A 4PJAF 4AMKH 2FGWH 5SWZA 4PP2A 2EDDA 2DTML 3BEWB 3CH1A 4JFEB 1BWMA 4DCQB 2FB4H 3BP7B 3MXWL 2OR9L 1RHHB 3JWNC 3QQ3B 1ZHLA 5I1EL 4BFBD 3SKJL 3MNVB 4YO0B 5JDSA 4ENEC 4QHLA 3DROB 3MRKA 5GRXG 4IRSD 4LPCA 4I13B 1A0QL 5B22A 1DQML 3LS4H 3QUMB 1WZLA 2ZG3A 1OVZA 4LL9A 2FO1A 2VZVA 3MO1A 3S97C 1EDQA 2R9HC 3M8OL 5EIVA 1AP2B 3FT2A 3T8XB 5ALBL 3GGWB 1MHEA 1KJVA 2X4UA 4XP6L 4NUJA 1ZANH 5DJ0A 1S9YA 3GIVB 4GMSH 3C5SA 3GHEL 3CX5K 4PGCB 2Q8BL 2IGFL 2G75A 3V79C 5JQ6L 3WXVL 5IQ7H 3L5XH 3ZYJA 3D48R 4OF6A 1A1OA 1F4YL 1SY6H 5I66B 1JGUL 2C1PB 3VWKB 2FRGP 4PRIE 2DMBA 1XR8B 4N0YH 5DJXA 2VSCA 1T5XA 4J1UB 4G6FB 4UIMB 2DMCA 2J12B 4XCCH 4F7CA 4OCRL 3WO4B 5H35B 4Y5XB 1I7UB 5DS8B 4Z6AT 1E4XL 4OD2B 4FQIH 4R7NA 4ONFH 3EYSH 5LGKA 4JFHD 2ZOLA 1P4BH 4TUOA 4QHNA 4FQ2H 1CN4A 3LPFA 4OIIL 3L9RB 5KSAB 1A7PH 2AK4A 1BQLL 4L9LA 4X4ME 1IQDB 1AFVH 2I26N 3HRZB 3RWDA 3UTSB 1OGTA 4S0SD 5BV7L 4XBPA 3GMRA 3KPRE 1PEWA 2GITA 2ICEA 5BMFH 4ERSL 4ZTPL 4MXWL 4MJIA 5C0RL 2AV1B 4X6CE 3CLEH 1I8IA 1LD9B 3FL7A 3D9AH 3TVMA 2I9LA 1T89C 4MHHI 1WSST 1NSNH 1I3RB 4E42B 4LP5A 4JQVC 5SWZE 5AG9A 4D0DA 5C07B 3P11L 1BZ7A 4ZPVA 5I8KL 5EU3A 2D7TL 4PJ9B 4P3DA 4PJAE 1L7TH 4OV6F 3JUYA 4BSVB 4K7PH 1CDHA 5ITBH 4PJ5E 4Y4HA 1FJ1A 1K4DB 3LD8C 3PGFH 3LRSB 3QO1B 4YXKL 2FO4B 3D39B 3GSNL 4HPOH 4OSUL 1I9JL 4LHUG 5BOPA 3MRGA 2XT1B 3MOAL 1IKNA 2C5DC 1KENL 1V8HA 3DARA 3ARGD 1KNOA 4FN0A 3CFEB 3MRDA 5KVGL 2Z4QB 1KJ3H 5CWSA 4NQUA 5D1QB 4FXKA 1UXWA 2PXYA 4JY6B 5F44A 1QBMH 4NKOB 1FAIH 5I1JH 5TPWH 3AS0A 3SGDH 3UDWC 4M7JH 4XNUH 2OS7A 3H3PH 3VGGA 1BVZA 5IV2B 4U1JA 3FN0L 2VO5A 1AY1H 5GJTH 4LLYB 1BOGA 4G6AD 1EXUA 3HI6L 3SDAB 1NLDL 3BRDA 1FG2B 1YQ2A 4JJ5B 5BXFA 2GI7A 2R56H 1MFNA 2MKLC 5D2NA 1XCTA 5T3XL 1WVZA 1ACYH 5EU4B 1XF5A 4OLZL 4X5XB 1MAJA 1INEL 5TE7H 1ZS8B 5IB1A 3UJIL 2VDOL 1FGVL 4R7DA 4I0PD 3S4SB 1N59A 4J2XA 4F15B 1UKSA 3H42H 1U8IB 4NKIL 1QSZA 5IF0A 2FYYB 3BDBA 3LQAL 3DXAE 2IG2L 1BLNB 1IC7L 3QXWA 3ABZA 3VU2A 3BEVA 1CVRA 1QA9B 4PR5A 2IANE 1ZVHA 2Q86A 3ULUH 3HI5L 1BQHA 1MUJB 1X5KA 3QZWA 3SJVB 1J05A 1CQKA 2D0GA 3RI5F 1MJJB 3JXAA 5KANI 1J1OH 5HGGS 3RDTB 1JGEA 2E9JA 5DUPH 3WNOA 4FA8A 4UAOB 4HHAB 1GC1H 2YUXA 4YC2C 3UBXA 2GJJA 3SCMA 2ED7A 3P77B 1LO5A 1DBAL 4NO0B 5H94B 2X4RB 4YDJB 1IFHH 4K7FA 2C7UB 4O2EB 3QFDA 5EWIH 4N1EA 2VYRE 3VH8G 1R0AH 1AGEB 1JFQH 2DM7A 2QQNH 2GT9B 3EO1B 1A02N 1FLTX 4OCYH 2Y25A 3BVNB 4NHCL 5DQ9B 2AQ1A 4P2QD 1TJHL 3MA7B 3HS0B 1ONQA 1Y18A 4LSDA 5K9JL 4P2RA 1A9BA 1O0VA 4LSQH 5EC1A 3EZJB 4P4KA 1CCZA 2ESVA 5EZIH 3RTQC 4FQHB 3MJ9H 5CEZH 2B1HH 3TBWA 4K7PY 3RX8A 1UJ3A 2Y5EA 4J3UA 4NQCB 4MAYD 3BYYA 5MERA 1BFVH 4CW1B 5D2NE 4N8PA 5T3ZL 4MAYC 1CLYL 1NUNB 4G80A 3P0GB 4QRRD 4DUXA 1VFAA 4JDVB 4L5FH 1QFOA 1FZOA 2VAJA 5DK0B 4G6KL 3LQZB 4AT6A 3STLB 2AS5M 3C60B 1FQ9C 4KXZI 1EFXA 4K71B 3VXRA 2DM2A 1G7LA 1S7VB 5D7JC 1IGMH 4U1GC 2XZAH 1CDCA 1OF2B 1AR1D 1VKXB 5DA4A 2HFFA 1BZ9B 4HKXB 3VXOA 3RJDA 3TCXA 4OJFL 4LHJB 1QZ1A 3K2UH 3K4AA 2W65B 2V2TB 5E4EB 3MLRH 1Q94B 4YHYC 3E6FA 2GCYA 3HE7C 4UNTA 5L7XH 3MRQB 3TJEH 2XTJB 3OKMB 2CO6B 2IQ9L 5BZDA 3L5WA 4M6AA 5FO9B 3ZDZF 5C0BB 5C0IA 1B4RA 4Y5YB 5FYJU 5EB9A 3RA7H 3NFPB 5TFSL 5E2UL 4JDZB 4GOSA 3WXWH 2YC1B 2PW1A 4ZD3L 4ZFOA 3G04B 4E41B 3W2DL 3AS2A 4HS3A 1H8NA 2QR0A 3IJHA 4L3CB 2CO7B 1GGBH 4PJCF 1JRHI 2DJUA 3BPLB 5CGYC 5KVFL 3IETA 4P2RE 1RUKH 3LKQB 1IEHA 2BFVL 4YXLL 1TTFA 4UUJA 4TN9A 5FYLE 1T1XB 3LHPH 1MY5A 4X7TB 3RY6C 2IPTH 3TYGH 3STBA 4HIXH 1LO3L 3VWJB 2Q76B 2YKLL 2R1WB 2HT3C 3TV3L 1F2XK 2F53D 2D7PA 3TO4D 1IC5H 4M7ZC 3T65A 3DGGA 3L3DA 2JB5L 3PWVA 1UGNA 2A6JB 1TVBA 1JJUA 1I1AD 3OB8A 4CDHA 5JMOC 3HNSH 5AAWA 4LIQH 5TQ0H 5CSBA 2VLKE 3T0XA 4R4FL 4GBXB 3QPXH 4UIKL 3BP4A 1AQKH 1X5JA 5T1KA 2W91A 2NXZB 2IAMB 4R90L 1I8MB 3BIBX 4OBRA 3VXRE 1MI5A 2ZUUA 4NFDA 5BQ7B 1TTUA 1ZT7A 1U8QA 4G8IA 5D8JL 1T04A 4ZFGL 3KGRA 4WNQB 3C5JA 4XBGB 1VEPA 1KPRB 4YHMH 5EU7E 1FIGL 4X6FA 4RMVA 3EOBB 5D7SL 1RIUL 1FZJA 3L3IB 2DBLH 3PE9A 4OM0L 4GRMA 3GSVB 3EJJX 2CLZB 3T0EB 5C0CE 5EULV 3UZQA 4LMQE 3VFVA 2WV3A 4M1GL 4QHUB 2DTMH 2NTFA 4MD4A 4X6DA 4EJ1C 3MXWH 2OR9H 3ZDZE 4G8GD 4M8VA 1TMCB 3PWNB 4PTTA 2R2HA 5I1EH 4N5ED 2X5PA 3DMMA 3SKJH 2DLIA 3VG9B 3PWPA 3U0TB 4DKFL 5E0QA 3QO0B 5EZOL 1CFNB 4N5EC 4TNWK 3LKSA 4OZGB 3UTPE 1A0QH 4NKDA 1DQMH 3KHQA 5LG1A 2Q87A 1TPXB 4QF1A 3NBNA 3M8OH 4PJCE 4DKDC 3GJFB 1KIPB 3NCYP 4YHZL 2AEQL 5ALBH 4HX1B 3MJ7A 3FT4B 5HHOB 4XP6H 5M95B 2V17L 2GSGB 2VZOA 1P2CB 1U8MB 3VFOA 2J8OA 1S7TA 2MKWA 5LKNA 1I8LA 2WIIB 3FQUB 3GHEH 3HRPA 4G9FD 3WHXA 2Q8BH 1I85A 1TZHB 2IGFH 3QFJB 4NO5B 4XMLL 5JQ6H 2ERJC 3WXVH 4LCYB 1F4YH 1JGUH 1U8HA 2P5WA 4TQEL 4LGPB 2APBA 4KK6C 1Z0MA 2DQTL 2Y7QA 3LN4B 3F5WA 2NXYD 4WWKA 3VFUB 2YPLB 1KF9B 4OCRH 3SO3C 5A3ID 4RFNC 4LCCA 4RRPG 2Z35B 4Y19A 2I25N 4HKZA 3MNWB 1XH3B 5KSUA 1B4JL 1E4XH 3G5VA 3ZL4L 3SKMB 3MMEA 4JZNB 4XH2B 1YEFL 4PJ7F 1RSFA 5DVNA 2OCFD 4OIIH 1U3ZA 1Z0NA 1W0VB 1NBYB 3BQUB 3ARED 3MV9B 4I3GA 1GHFL 4KDTA 4WRLA 4EQ2A 2L0DA 2J8UF 5BV7H 2R29L 3MC0A 4ZNCD 1U91A 5F3BA 4FQJL 5ERWB 4ERSH 4ZTPH 5EO1B 4MXWH 5C0RH 1RZFL 2BSTA 3U7AA 3SE4A 3QWOA 3QEQB 3V6FB 4F8QA 2R1YA 43C9A 1CQYA 1T21B 2J8UA 2XFXA 3FB6A 2R2BB 1JF1B 3GI8L 5BZWB 2Y1VA 4LP4A 3PDGA 5K59F 3ILQD 3JV4A 2OJEA 1EGJA 3P11H 1NCDL 5I8KH 2D7TH 2EEBA 3QUZA 1DEEA 3K74B 4NZRL 4ODHL 5JTWA 4M61A 5EA0L 5HI4D 4K55A 43CAB 4UU9A 4OGAD 3QA3A 4WI4A 4YXKH 4OSUH 3GSNH 5I16B 1CIUA 1Q0YL 3TBYB 1I9JH 1CU4L 2VIRB 3MOAH 2OMBA 1KENH 1DFBL 3QXAA 1N5YL 5KVGH 4MWFB 3HZMB 4N0RA 3WNPA 4OUUA 2ADGB 3VE0A 1IEBA 3P9MA 4JRYD 4QWWD 2DI9A 5IEKA 1KLUA 4S11A 2CJUL 2YK1L 2Z8VC 3LRGA 3FN0H 4LLUA 1FFQA 1FBIL 2X10A 1U58A 2P5WE 4FQLL 3WUZA 1GYAA 3HI6H 2PTTA 5E2JA 5E94A 1NLDH 3U0WL 2X4UB 4NUJB 1JN6B 2BXYA 3UJJL 4KFZC 5DJ0B 1FNGA 4Y19E 3C5SB 1DCLA 2FJGB 5T3XH 4YAQA 1WBXB 4FQCL 4XB7A 4OLZH 1NJ9B 4FQQB 1INEH 1KXVC 2AV7A 5D7LD 3UJIH 5IVNA 1A1OB 2VDOH 1FGVH 2WZPD 4LCWD 2F54D 5FKAA 4CVXA 2HTLD 2JLLA 1T5XB 4NKIH 1NGXA 1BECA 4H0HB 1QBBA 4BKLA 3LQAH 2IG2H 4PJ7E 5HHME 3S3PA 4F7CB 3IDGA 1IC7H 3RAJL 4KKBD 1I4FB 2PYED 5A2FA 3P40A 2OK0L 2VQ1A 1YEGL 2VNCA 2DAVA 2HJFA 1G7HB 3HI5H 1OCWL 3LPGA 3QULA 2J8UE 1TLKA 2IBGA 3B4NA 3ESUF 1K2DA 4TUOB 3GEWB 1X4XA 1UZ8A 4GW4A 5TDNB 2EIZB 4KGJA 3UTZA 2DQDL 1OTSC 3RX5A 2BNRA 5KSVA 2AK4B 3CCHA 3FQNB 1OHQA 1OGTB 1RZGA 1PZUB 4MJIB 4DN3L 5K59E 2FJHB 4NM8L 1PZ5A 1DBAH 4PY7A 5E9DA 2ED9A 1R3JA 4RSVA 3MGTB 1NQBA 3HC0A 3ZTJG 3ULSA 4QRUA 3KXFA 1NAMA 3LVEA 1UKQA 1NANI 3ZKMD 3OR6A 3GB7B 4IJ3B 1ZA3A 5IW3A 1K8IA 4U1IB 3D2UA 3B5HA 3ZKMC 4I0PB 4NHCH 3IXAB 2V2XB 1FJ1B 1TJHH 4XTRD 5K9JH 4RQQB 1CXFA 2XXMB 3B83A 1JRHL 4NQSA 3H9SE 3BZFA 2WLYA 4UQ2A 5DWUH 1HILB 2E9BA 4R4BA 1P9MA 3LEXB 2GK0B 4Y16D 4MYWB 4P2CG 1KJMA 4XNZC 2WQRA 3MRDB 3W9EB 1FFOA 4NQXA 1X4ZA 4FXKB 4TVPD 2PXYB 1KB5L 4WHYH 4OI7A 4HWBH 1MJ7L 4GUPB 4PB9L 4KJPD 3L3OA 5T3ZH 1CLYH 4OV5B 3QRGL 1MLBA 4P57A 1FVCB 3U2SB 1DSFL 5DC4B 3FFCD 4PJGA 3U36A 4YHIA 5DHVH 4JAMA 3ZKXC 4G6KH 1BOGB 3VXNB 2A6IB 1S8DB 3D6GA 4ZSOE 2IBZX 4LASL 4PRHD 1OAYL 3BGFB 4F80A 4PIRF 4I18A 3NIDF 4PJHF 1XCTB 3KS0H 3ARZA 4XAKD 2XI9A 2EYRB 4X5LA 4BH7A 3TPUA 5HGBA 1I3VA 5F96L 1P84J 4NFBA 2VAAB 3FOMA 3DOSA 1BFOA 3KWWB 4OJFH 4KROB 4R7DB 1QSFD 4LSPL 4JO2L 1JZ5A 5K9OA 2YS4A 5IF0B 2O93L 1SBSL 3PV7A 1TETL 1SJVA 3BEVB 4YDLC 2IQ9H 5HYJA 2Q86B 3MV7A 3B5GA 5IVOA 1BQHB 4P3WA 3AB0C 1QR1B 2WMPA 5E9DE 1J05B 4P23D 4JN2A 5TFSH 4P5KA 1T0MA 5E2UH 5C0ND 3ESVF 3K8KA 1CICD 1ETZA 2I07B 2VABA 5DJDA 1HH6A 4ZD3H 1FZKB 1JGEB 1PVHA 3W2DH 4QRRB 3UBXB 3DX9B 4H25A 2ZOKA 4I3RL 3QIUA 4JFFA 3GI9L 4ZDHB 2AVGA 3FKUS 4R2GD 5KVFH 1EHXA 5GIRA 3DBXB 4LLMB 5SV3A 2GQHA 3QFDB 3P4MB 2BFVH 4YXLH 2XA8L 3P9LA 3S5LA 1AIFA 3AU1A 3MA9L 3MBED 1HXMB 4NM4L 2YKLH 4C4KT 1TZIB 1N26A 1FP5A 3TV3H 3GIZL 2VITA 5ICZA 1X6NA 1WWCA 3V6BR 4L3ED 1KB9K 3LV3A 1FFRA 5EC1B 3BPOC 2JB5H 2BVOA 2ESVB 2W0FA 2ADIB 2BNUA 4E0RB 1SM3L 4OCWL 1S3KL 1SYSB 5C0JA 3C60C 4R4FH 5CSZA 2X4NA 1S7WB 4NRXB 4UIKH 1HEZA 4R90H 1NC4B 2VLRD 1C08B 4XX1G 4JZJB 4L8CB 3LN5A 4X99A 1XGYL 5MERB 4Z95L 1RZ8B 4JG0L 5D8JH 2LAGB 4HFWB 3UROR 2BSSA 4CVZB 3HUJA 4ZFGH 1OGAD 1FZOB 3NIDE 4PJHE 1UC6A 1M7XA 1KPVA 3VFNA 1FIGH 4JCLA 4GAFB 2P5ED 1EFXB 1XIWD 5D7SH 1RIUH 1G7LB 4OM0H 4JO4L 2LTQC 1UQSA 4JY5L 4Q9CA 5D1XD 1XMWA 3MR9A 5DC9B 3LKNB 3V2AR 3MV7E 1P84K 5J06A 1I1RA 3DSNA 5C2BL 3G6JB 5I1IL 3O3DB 4X6EB 3SE3A