2HLFD

Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD01
3P0YL 4N5EC 1WK0A 3UDWA 1CFSB 3MZGB 5IJVB 2BVPA 3W0WD 3S37L 4AEEA 3DVGA 4UTAL 2IQ9H 3DPBA 5F3HB 4O2FB 1HEZA 2VTFA 2XTJD 4JFFD 1KYOK 2CLZA 3T4AB 3IAQA 4Z0BL 4Y16B 4PJ8D 5KSVA 3LHPH 3ESUF 4GO6B 4XMKL 5ENWB 5F8QC 1NGPL 2PTVA 5ID0A 1PG7W 1MRDL 3FQRA 2AKRB 4HUKB 3KWWB 3SE3A 3VRLF 4JFQA 4LCCC 1RK0B 4ODVH 1IEAB 4JFHE 1NCUA 1YEHH 1ZS8A 4JM4H 5IOPB 2Y06L 5DFWH 5ICXA 1Z9MA 4MCZB 4Q0XH 4PRBB 5DYOB 3B8YA 2DQFB 3DX7B 2H9GB 3HRZB 4TSAL 1NANH 1WTLA 1PLGH 1RJLA 3KJ6H 4QEGA 5F7YC 3N1GC 3BZ4A 1UEMA 2ICWJ 4H0GA 2FB4H 3ZDYE 5TQ0L 3REVA 4NQVA 3U4EA 4Q97A 2PYEB 3MLSH 3TYGH 3QI9B 3L3GA 3CMOL 1J0HA 4F7EB 3QWOA 3MO1B 3V52L 3I6GA 1OAKH 4Y4HA 2D03H 4UB0H 3RTQB 5AWNH 3MLRH 5KVEL 1FBIH 4GW4A 2IAMB 4F57L 4X6CE 4TSCL 1A21A 2WUBH 1J1PL 1S7UB 1A6PA 5D71L 3IDGB 5ACMA 3B2UC 3IDJB 2LTQB 4R97B 5KSBE 1QSEE 2VLKA 2Q1EA 4I2XB 3HCVB 3ROLA 1EAPA 4HGWA 1K5NA 4CGTA 2Y25A 2ERJB 2A1WH 1MQ8A 1EGJL 1AP2A 2NW3A 4OD1L 1HKFA 3FO9B 5E9DE 3GJFH 3K8KA 2HLFC 2MQ3A 4G8IB 5IHZA 1PVHA 4UU9A 3QIBB 4DK3A 3P4LA 2ZCLL 4R96A 4TN9A 5DFVC 2JCCF 4MA8H 1I1AD 5H94A 1NUFA 2DRUA 3NCYP 4PS4L 4X6FA 4XPBL 1UZ8B 3PWVA 5FYKD 1UB6B 2CKBB 3QO1B 4QOKB 3QEQA 1JNHA 1K4DB 1DQQA 4WEMB 4S1QL 3HMWH 2HRPL 3E8UL 4QRQA 5B4MD 3JBG7 3C8HA 4ZUTB 5ICYA 2X4QA 4YO0A 5KVFL 2UWEE 4LIQL 4EKXA 1WBXB 4LSSL 4CADB 3IETA 3VA6A 2WWKO 3TV3L 3OJMB 1FE8L 3Q1SH 3L5IA 5EC1B 2AEIT 5IIEB 1PD6A 3MLWH 4NJ9H 5CMAB 5IW3A 3TO2A 1OWRM 3MRLB 3BZFA 2XG5A 4OLWL 1MFNA 2HVKA 4IOIA 5C0FB 3TCLA 3PNWA 4IMLA 3NAAL 1A9BB 5EU6E 5LG1A 3DETC 1F11A 4PRPE 4K23H 4AMKH 1AC0A 2XY2A 1CICA 1YYML 5JLZB 5JIKA 2ZP0T 2YA1A 3TH2T 3BZEA 3G6JB 4N0FB 3L3HA 1QO3A 3RI5F 4QLRA 1K2DB 1IT9H 3AXLA 4HJGA 3O3DB 1QPPA 2FEEL 4WUKL 35C8H 2GJ6A 4N90D 4K07A 5C0EA 3RL1A 5INCB 2HWZH 4JFYA 3WS6A 1G7HB 2ZKHH 2I9LB 3D9AH 4I4WA 3TT3H 3HUJE 1MFAL 2A6DA 3LV3A 4HUNB 3OB0H 5C92A 1A6AB 1N3NA 3PWUA 3TBVB 4Y1AD 4EN3B 4I0PA 3TO4C 1T3FA 2V6HA 1DANU 5DUMH 4R2GC 4RGNC 2MQCA 5TF0A 4LEXL 2BC4B 5BVPL 4I77L 4LVEA 4WJ5A 4UUJA 4LU5H 1T22B 4X7EC 4ZYKB 5C2BH 2ADGA 3K80A 3MYJA 1NBZB 1I85A 4GW1B 3ULVD 4MAYB 1JP5A 1Q9OB 1EZVX 2M26A 3FFCD 4PJBB 2GTZA 1GPOH 1MFEH 4RSVA 3ROOB 2P43B 2H41A 4KJWC 4QRRD 4JGMA 3KXFE 2F8OA 5HHOA 3O81A 1H9VA 1MRFL 2H26A 1KFAH 3FCTB 1R5VB 1K6QH 2V5MA 3W11C 1T4KA 4M7ZC 3U46B 2DMKA 5KVGL 4ZOEA 2PW2B 4K7FB 4NZRH 3D39A 4OQ1A 1NLDL 4PGBA 3DURB 4K7PL 1VEPA 1QLFA 1UKSA 1I1CA 2C7UB 3EO0A 2W9DH 3QFJA 3STZA 3SCMD 2QADB 5DEZA 3CLFH 3MRNA 4OFIA 2J5LC 1U8NB 5SWZA 4LLQB 4FZ8H 3QDGB 4F7TB 2W9EL 1RZJC 2P42B 5KVDL 3UJTH 3VFMB 3EDEA 2CR6A 5F72S 3OXRA 4HIXL 1RHHA 5D1ZB 2B2XH 4PRHA 2VDML 3FJTA 3QXAB 1X5YA 5D7IA 3BPCA 5I74B 4Z5RB 5IKCB 1Q38A 5EC2A 1X5HA 4OSUH 5CZXC 3DROA 3ARFC 2EKSB 2AI0H 4XH2A 2K1MA 4TVPH 4LPYA 2DQDH 1IGYA 1ED3B 1X6LA 4E0RA 1NCNA 1KJMA 4Z7QF 4LSTL 4Y5YC 5DRNB 4EIGB 5HHQB 3EYSL 5GGUA 5HHXH 3NACL 2DQUL 3DX6A 3GM8A 1V3LA 5EU5A 4ODUB 2F19L 4WDIB 3INUH 3MRBA 3JWOC 3RKPA 3RGVA 1ADQL 1XIWB 4GMTL 3AC0A 4Z7UB 1TCRB 1BIHA 3MMEA 1A3LH 4O58L 1KC5L 4RZCA 6FABL 4U0QB 1HCVA 5CP7B 1S7TB 3ZE2F 3RWEB 1J12A 5IWLA 2P5WE 3MREB 1FZOA 1GGIH 5DRZA 1IQWL 1ZVHA 2DAVA 1L7IL 4KJPD 3VJ6A 3HLAB 3W0WA 3TBWA 1CLOL 4FQXA 2YD9A 4S1RL 1CN4A 4HK0A 4Q6IA 4X6CB 5E6ID 4JFFA 1LNUA 5KSAD 4LCWE 3ZHKA 4Y2DB 4NC1E 5C09B 1JRHH 3CDGB 5IHUL 5EUKB 4U3HA 4PJ8A 2BY2A 3ARBC 3VFRB 2H32B 3GJFK 2VXSL 5I76B 3DUHA 4MNHB 4EQ3A 1CT8B 3D85D 1LGVA 4P5MA 2VLJD 3S3PA 2A0LC 1Q9LB 3PP4H 3D48R 2YEZA 4RGOL 4PLKC 2J4WH 4UT6H 2BNQB 4X4ZA 5E9DB 2XZQH 3V6ZA 5HY9A 4KVCH 3UTTE 3K4ZA 4D9RD 1DE4A 3VG9C 2G5BA 4HGKC 5CZVL 3E2HC 4XCFL 3TA3B 1LVEA 1TTGA 1CIUA 2VDOL 4LQFL 4MD4A 3TCXA 2JE8A 3IDUA 1EUTA 2GTWA 5DJ2B 5MHSE 1SY6A 3RY6A 3T2OA 2HKFH 5CJQH 3EYQD 3WNKA 1YNKL 4PJAA 2VDNH 4AENB 1E4KA 2VXQH 2LU7A 5HHOE 1AI1L 1GOFA 4MWFA 1RZ8B 5C07B 1RIUL 2DQHL 4JFPA 3IKKA 4O2EA 2PETA 4G6KL 4UDTB 3RJDA 3IFNL 3BDXA 4Y2OA 3QFJE 3UO1H 2AEQH 4KI5D 4HWZB 1NMBL 1KLUB 3PABA 5ID1A 2EE2A 1HINL 3WSQL 3MRQA 5FB8B 1YQ2A 5DGRA 1I1AA 5C0BD 5L0QC 4LPWA 4YXLL 3BOVA 4F9LC 1I3RA 5IG7A 3FO0L 2BVPB 1YY8A 1LP9A 3DVGB 1MFDH 5D7IE 4P2OD 3RNKA 1FNEA 2CUIA 2XOTA 1R3LA 2CLZB 3UCRA 3HUJB 12E8L 2DQTL 4PB9L 5J9PA 5KSVB 4MXVF 4JFOA 2HT3C 5EZIH 5ID0B 1FL6A 3ALXA 2Y9RT 3WIIL 3SN6N 1FZKA 3LH2H 3FQRB 1R3KA 3H9HA 5ITBH 1A3RH 3H3PH 4JFQB 3SDXE 2VAAA 1B6DA 4LFHG 1ZWIA 4RIRA 4AH2A 1ACZA 1ZS8B 3BIBX 1JJUA 3G6JF 5ICXB 4H8WC 1MIML 3OAZH 1DVFC 4LRNL 4JKKA 2UY6A 1G9MC 1RJLB 2IC2A 1RIHH 3F7PC 4JCMA 4PY7A 1U2HA 3OKKA 4YZFF 4OCXL 3REVB 4K2UH 4NQVB 3U4EB 4CAGA 4PLNC 1TTUA 2R39A 3QXDA 3L3GB 3W0WE 3QWOB 1S9YA 3I6GB 4Y4HB 2A9ML 1JUFA 5BJTB 3STBA 4GW4B 5F3BA 2XTJE 4JFFE 5AAMA 3H9SD 1NCWH 3HHRB 4AT6A 3AY4C 4JKMA 5GZOC 3HZVA 4HWEL 4JO3L 3ROLB 1EAPB 4HGWB 5CFHA 4WFHD 2OK0L 4RWYH 1AP2B 4PGEA 2AJVL 2NW3B 4PJBF 4TUKH 1F6AA 3L3DA 2Y23A 1PGRB 5IHZB 3FFCA 2A83A 2CH8A 4HK3N 4R96B 5D4QA 4I9WE 4QRRA 3UC0H 5H94B 2V5YA 1XR8A 4X6FB 1D5IL 5GRUL 3PWVB 3KYKL 4GRWH 3U9UA 2DTMH 3QG7L 1S78D 2RGSA 2B4CH 1JNHB 3QEQB 3MBED 4Q9QL 2VLMD 1AR2A 1DQQB 1LMKA 4IRZH 1OPGH 4L8SA 4PJAE 1TITA 4D2NA 1S5IL 4ODHL 4FFYL 2ILLA 5EZOH 2X4QB 5DT1H 5ICYB 4YO0B 5ILTH 1U8LA 4EDXA 3OKMA 1QBBA 3SCMA 1U8OA 4JB9H 3IETB 1DLHA 1KN4L 2ADIA 4OQTL 1IC5L 3U9PL 3TO2B 4JFXA 3BZFB 2V5SA 3W81A 2VC2H 2EDTA 2HVKB 4IOIB 3TCLB 3PNWB 4IMLB 5LXGL 1BZQK 3S37H 4G8GE 4UTAH 1F11B 5FYKL 2F5AH 4HJJH 1NBYA 3FT2A 4JN1H 1BZ7A 5C6PB 1CICB 3O0RH 1ZSDA 5GGSA 4Z0BH 1CGTA 2IPTL 3T09A 5IFJA 4NP4L 4JG1H 2DD8L 5DHXB 4D9LL 3L3HB 2QL1A 4X6EA 3WFBL 1MRDH 1RU9L 4GBXC 2IADA 4HJGB 2GJ6B 3GZKA 5C0EB 4AEFA 3RL1B 3HE6D 1PG7X 2R1XA 7CGTA 4JFYB 1MAMH 3RU8L 5D1XD 4P48A 2Y06H 4Z7UF 5HJ3A 4I4WB 4JM2C 3V4VH 1S8DA 2A6DB 3LV3B 4OFYD 1N3NB 3PWUB 4UNVA 1PEZA 1GAFL 3BESR 3HI1A 5DMYA 5JXAH 1U93A 4I0PB 4X99A 2G75A 1T3FB 1W72L 5L2KD 4HG4K 3LKPA 1VEMA 1OB1A 1AJ7H 4UUJB 1CE1H 2WW8A 3CMOH 3OX8A 2ADGB 3V52H 3MYJB 4HUWA 3LS5L 4X6CF 2IPUG 4F57H 4TSCH 2GTZB 1J1PH 1ZA3A 4LSRL 5D71H 5E6IA 5HHOB 3MV9E 4LAQL 5KSAA 2P8LA 2H26B 3S5LA 2X1WL 1T4KB 2EH7L 2HFEA 1PFCA 5J1TC 2NY6C 1MY5A 3WKMH 3UBXG 4UAOC 1YC8A 3BXNA 3D85A 1Z9LA 1IKNA 2VLJA 1EGJH 3D39B 4C58B 2ZG2A 3DSNA 4PGBB 3STZB 3QFJB 1QLFB 3EO0B 1FGVL 3C6LC 1OW0C 2J6EA 3MRNB 4XXDA 1NAMA 3ULVL 5SWZB 4XPBH 5D7SH 5I1GL 4L29A 4GSDL 3ZHDA 1JV5A 3VGAB 3OXRB 3DV4A 1OCWH 1HZHL 1RHHB 4S1QH 4PRHB 3MRFA 3ULSA 3S3JA 5D7IB 3BPCB 4Z9KB 4QYOA 5EC2B 2BXZA 1U36A 4HJ0C 1UXWB 4LSSH 1BZ9A 4X8JA 4MQXD 4XH2B 4MJ6A 3TV3H 1FE8H 3K4DA 4LSVL 1FFNA 1KLGA 3P0GB 3KPRD 3UXFA 5I2IA 1IGYB 3ARDD 4E0RB 4JPVL 1KJMB 1OD7A 2YUVA 4M6NL 3D2UD 2DM7A 3CSBA 3HG1A 3OAZK 4KMTL 5GGUB 3DVNA 2YA2A 1YN6A 5SX4H 2AV1A 3DX6B 2DI9A 4XNXH 2WZPD 4DKFH 3C5ZC 4X9FA 1YYMH 1PZUB 3MRBB 3LQMA 2QSQA 4XNUH 4G6FB 4LHUG 2W0LA 3RGVB 1QRNA 4ERSH 3MMEB 1PBYA 2YN3A 4C59B 4JKWA 4RZCB 1IC7L 3B9EA 2RCSL 2D7QA 2QQNL 5FAAA 1UC6A 3Q3GA 1FZOB 5DRZB 1MREL 4XXCC 1RD6A 4Q58C 4DVBA 3BKJL 2VDKL 4P0DA 3VJ6B 3W0WB 5HYJD 3TBWB 3IJSA 1BD2E 4FQXB 4P2OA 3QISA 4HK0B 5D2LA 2XTJB 4JFFB 1LNUB 4Y4FD 1D9KC 3SGEH 5DD6A 3R8QA 2MJWA 2X4SA 1S7WA 2X4TA 4PJ8B 5E2UH 3Q48A 3EOTH 3QUZC 5AZEL 3MJ9A 1HNFA 1Q9KA 4NM8H 3N85H 1BLNA 2R0LH 4P5MB 5I1CL 4I77H 1IAOA 1T5WA 5I1JH 5KSUA 2YEZB 5F1NA 3T08A 1A7QL 4N0CC 4XBEH 3AFLA 3NPSB 3FAWA 4L8BA 2H2PC 4LSQL 4CN4A 4XVSH 4O2CA 2GK2A 3V6ZB 5HY9B 5GGRY 4U6HA 4ZFOA 1JYXA 1HE7A 4JFED 1DE4B 2DIBA 2G5BB 1R6VA 1NPUA 4MD4B 4HKJB 1RURH 1CL7H 2GTWB 5A2IH 4Y4KD 3KVQA 5A2FA 3HC4H 3BKMH 5FF6A 5GGTH 3F8UB 1KYOJ 3GMQA 2Y6SC 5J0BA 4K7PH 4PJAB 4X8XA 1M6OA 1CXFA 5JZ7C 1RUML 4MWFB 3F6LA 1X4YA 2EKJA 3H9SA 1XF2A 4IMKC 3KPQA 1NAML 2DM4A 3IDXL 1YJDC 4PJGA 2CIKA 4QXGH 4R4BA 5IHBA 4JFPB 4O2EB 4Y5XC 5FGBA 5B8CC 4HIXH 3VXSE 1ERNA 1BQHG 1YQVL 4QHKI 4LF3A 2VDMH 5C8JA 5F89A 1RZFL 4J6RL 3PABB 3GI8L 4NGHL 4KPHH 5ID1B 3NCYS 3MRQB 1HCFX 3GSNA 5EU7E 4N5ED 1I1AB 3O2WL 1FFRA 3NCCB 1I3RB 5IG7B 1IGIH 1ORSA 2Z8RA 4LSTH 3S3SA 3DX8A 1YY8B 1LP9B 4WI9A 2E7HA 4ZTPH 5DA4A 4JKPH 3RNKB 5A3ID 1FNEB 2VZTA 4K94C 1ADQH 3UTZA 3F62A 4GMTH 3FQXA 4ZXBA 1R3LB 4FA8A 3BEWA 5J9PB 4JFOB 1I1FA 3GSVA 1K4CA 1KTLA 3KS0H 1FL6B 1P7HL 2ENSA 1FZKB 4XC1L 1R3KB 3E6FA 3H9HB 1BVZA 3HG1E 4TVPE 4M5ZH 4PRNA 5A2KH 1A7RL 2VAAB 3D0VA 4HUXA 3QHTC 4AH2B 1ZWIB 4XCYA 3EJYD 3TLRA 4NT6A 1QRNE 1CXHA 3KDMA 5IHUH 5A2LH 2CLVA 4YHZH 3NA4A 4NQSA 5I8EA 4PY7B 3CLEH 3OKKB 3AM8A 3LEVL 3UZQA 3MJ9L 1XCQA 5K59E 3QXDB 4Y19D 3HE6A 1QR1A 4RGOH 2GAZA 4PJXE 1S9YB 1VB9A 2ICWI 1JUFB 5D1XA 2D7NA 5F3BB 1T21A 7FABL 3G6DL 2PO6D 4ZPTB 1OVZA 3B2UD 1NJ9A 5BV7C 4FQHA 1YEKL 1KN2L 4OFYA 4AT6B 5JOEA 2O5YL 1PW3A 5CZVH 2AJSL 3HZVB 3I84A 5L2KA 1T89C 3C8KA 1KXQE 1S3KH 2EYRA 1I9IL 3VDBA 2RAMA 2DBLL 2DIAA 4PGEB 4TTDD 4U0RC 1YNKH 2HLFD 4ZQKA 1F6AB 1DQJA 5HTSA 4EI5A 3L3DB 2X9WA 3W9DB 3FFCB 2C5DC 2A83B 1WFTA 2B1HH 1ODAA 3KHQA 1RIUH 4QRRB 4DQOL 1XR8B 2W91A 4D9QE 1KJ3L 3VWKC 3OKDA 1KEGL 1YDPA 3U7AA 3DJ9A 4G6KH 3IFNH 3MUZ1 4L8SB 2QSTA 4QRSA 2R29H 1RZJH 3P4MA 3BYYA 5D70L 4YX2L 4WY7H 2WIMA 4NWTL 1U8LB 4EDXB 3OKMB 3SCMB 4OI7A 1U8OB 4CRPA 4Y0GA 1FCCA 1N2RA 2BNRD 4OZGA 1DBBL 1DLHB 4X4YA 3V6OE 3LPWA 4BFEA 3HS0A 3GSNL 4JFXB 4LAJH 1WEJL 4U1HA 3BW9A 4HW6A 4HUMB 3FO0H 4UZGA 4X5XA 1LHZA 5D7IF 3MRGA 3H42H 5E1HB 2NY1D 2G9HA 5F97E 1NBYB 3FT2B 1BZ7B 2NX5E 1ZSDB 2AAVA 5F9WC 5GGSB 4O00A 1FRGH 12E8H 2DQTH 5IFJB 4PRIA 3H7LA 3U82B 1WFOA 4O51A 1CD8A 4NQCD 4X6EB 1MEXH 3BIKA 2ZOLA 2IADB 3KPRA 3CVHL 4YIQA 2C1OA 3ARDA 4I5BA 2R1XB 4G7VL 3JWNC 1AXSB 2E9BA 3D2UA 1ZMYA 4YC2C 3X12A 4U1MA 4AQ1B 5HJ3B 4APQC 4FQ2H 5BMFH 1S8DB 5C0JB 1MRCL 4MA7L 4OZFG 3HI1B 4GAFB 1N0LA 4F37F 1U93B 5FHBH 4X99B 4LRNH 3FN3A 1IE5A 1FVCA 1LO2L 4PJ5D 1NEZG 3LKPB 2OZ4H 1UH4A 3MACL 1NBVL 1OB1B 5L9DL 1CD0A 4HUUA 4OCXH 4D0CA 1OQOA 2BSTA 5K9QG 1K3IA 3LKOA 3OX8B 4HUWB 2A9MH 1MCEA 1BBJA 5ACZA 4XPTH 4XX1G 5HYJA 2LV4A 4KJWD 4KWUA 4G9FE 3ES6A 3QXWA 1ZA3B 3W11D 5E6IB 1EO7A 4M1CC 1OY3B 3E6HA 5I6XB 3JVGA 2P8LB 5DZOA 3S5LB 5KSAB 4F9PC 4JO3H 3VWJC 4HWEH 2HFEB 4JVWA 1TJGL 1CVRA 5T3ZD 5HI3C 5T3XD 5CILL 3BXNB 3D85B 4WW1A 3QR2A 2VLJB 4MGXA 3VGHA 5JPMA 4K8RC 5B38G 3OPZH 1IL1A 1MPAL 1VDGA 2BFVH 1B0RA 4XXDB 3O2DA 1NAMB 3A67L 4WWKC 1DBKH 1K8DA 1D5IH 4JDZA 1NUDA 2HFTA 4JO4H 3KYKH 4L29B 1JV5B 5GRUH 4C57C 4TNVF 4U33A 4MA1C 3TBYA 1T20A 4KK5C 4XP4H 4PJAF 3MRFB 1S5IH 3ULSB 4QYOB 4GAJL 1Y6KR 2Q8BL 5HI5C 4NHUA 2VISA 4X8JB 1BZ9B 2B8OT 4RMTA 5BVJB 4MJ6B 5I8OL 5HGHA 1UYWH 4OQTH 1IC5H 3U9PH 1FFNB 1KLGB 2YPLA 5I2IB 1EO8L 5KS9E 2VAJA 3HG1B 4WFFE 5DVLA 3DO3A 3DVNB 1YN6B 1MCPH 2AV1B 2YWYA 4GRWE 2JJVA 4RAUA 1U8KA 4C83A 4OF6A 2ICES 4ZAKD 1JF6A 2JJUA 2IPTH 4NBYB 3FOLA 1QRNB 4I48A 4D9LH 4XNYH 4PJDE 2CJUH 3SBWC 2IBBA 4QNPE 4NQTA 1RU9H 3WFBH 5I8KH 1G9EA 1JHTA 3Q3GB 1LP9F 4BSVA 4LPTA 3F6IA 4XMLL 5CD5C 5DZLA 2EDQA 3RU8H 4DVBB 4JCLA 2ZUQB 5C9JA 5DMJB 3IJSB 5E8EA 3QXVA 1QKZH 1JNJA 4PRIE 5D2LB 5T1DH 1JL8A 3ARBD 1MFBH 1GAFH 1S7RA 5DD6B 2X4SB 1S7WB 2X4TB 1W72H 4RISL 1MCSA 1MH5A 1Q9KB 2A0LD 1LEGA 5DS8A 1BLNB 4RFNB 2J8UE 3O6KL 4DN4H 4WU7A 5DD1L 1IAOB 2X5PA 5KSUB 3BUTA 4UOW0 3QZWA 4RFEA 5E2WH 1FL5A 5F1NB 3T8XA 2LAAA 2J88H 1GGBL 3QNZA 3U30B 4L8BB 5CEYA 4O2CB 5DHVH 4U6HB 4ZFOB 4LSRH 3UPAA 5CD3A 4NCDA 3P77A 1GZQA 3MNWA 5DRWA 3B3IA 1HDMA 4OLYL 4FP8H 4ODSL 1LQSR 1EHAA 1D7FA 4XWGH 5DJDB 5FF6B 3ZKND 1HYRC 3GMQB 4Y19A 4DOHB 4KZEL 1M6OB 4HH9A 3LEYH 2OR8A 3CPLA 2PO6A 5F9OL 2XA8H 4DKDC 4HGMA 3H9SB 1XF2B 3KPQB 3O2DL 5I1GH 3GBMH 1CZ8H 4NKQB 4PJGB 2CIKB 4R4BB 2XXMB 4JQVA 2EDKA 1NFDE 2IFFL 1JZ8A 43CAA 4DK6A 4XC3L 4GS7C 4Z8FH 3WS3A 1HZHH 2XKUA 4LF3B 3WKNA 5C8JB 3ULVF 5F89B 2CMRH 3MV11 1UM6L 4P49A 5GRJH 3VXRD 2DOCA 4OLVL 3ZKQD 2NX5B 1B9ZA 2COQA 1BVLA 4KQ4H 2DLTA 3HAEG 3T3MF 1FHGA 2CGRL 3GSNB 5FHAL 4KHXL 1KENH 5GISH 3ALWA 3WXVL 4JPVH 1NKOA 5LCVL 3HNVL 2D3VA 4M6NH 3C5JA 1ORSB 3DX8B 4F7CA 5ICZA 1DEEA 4WEUD 1SBSL 3B2VH 4P5TD 2BJML 3ARUA 1BGXL 3FQXB 4ZXBB 4OZFH 2OTWA 3I9GL 4QT5A 3BEWB 5FGCE 3RY4A 3MLZH 5CGMA 3LKSA 1I1FB 3GSVB 2NXYC 5J4MA 2YPLE 1K4CB 1KTLB 1E4WL 2BNRA 2RCSH 4ZD3L 5ADPH 3E6FB 1VACA 1MREH 4PRNB 3TZVC 3D0VB 4HUXB 2VLRD 1M71A 4AIZA 1T6VN 1TJIL 3SDAD 4XCYB 3LD8C 3O4OB 1FN4A 4NT6B 2RFXB 3MRKA 1LO4L 1DVFD 2CK0L 4G9FB 4HX1A 4ZNCD 3KDMB 5EWIH 2CLVB 1WCQA 4TNVK 2VL5A 3R8BB 4UILL 2N7AA 5CJ8A 4NQSB 4NQCA 5I8EB 3G04A 4PB0H 4I3SH 1TNNA 5B3JE 5CEXA 4OM1H 1ZT4A 3ZKMC 1XCQB 4M7LT 3HE6B 1QR1B 1A7QH 3KYOA 4HBQA 4JRXE 4LSQH 4Y5VA 2QSCL 5D1XB 2OX5A 3OG6B 1T21B 1DQTA 1NJ9B 4FQHB 2CIIA 3BMWA 4P9HC 2X1PA 2DL2A 2KZWA 5IVXA 3PQYA 3PGFL 3D1MC 1YEFL 2PF6A 5L2KB 4FABH 4PJ5A 3C8KB 1ITCA 4FQIL 3VG0H 2EYRB 1HWGB 1A8JH 43C9A 3W39A 1X5JA 4ZQKB 5CEZD 2Y5EA 3WHE0 1DQJB 1IM9D 5HHNA 1GRWA 4EI5B 3BDYL 1U2CA 1QLEL 2IPKA 3IU3A 1HILA 2JJTC 4NKOA 4HWNA 1BFOA 3IDXH 2EEBA 1JHLL 5GS1A 3P4OA 4QHUA 4BFBD 1G7JA 1OLZA 4LCYB 3OKDB 1YDPB 4NQXA 3NZ8A 1GC1L 2G60L 5IFHL 5ALCH 1AO7D 1YQVH 1G0DA 4QRSB 1EJ6A 1EVUA 3BH9A 4RGMC 4XPGH 1L0QA 1QFWL 3P4MB 1P5VA 1RZFH 1GGTA 3MR9A 1YNTA 4NUGH 2WSKA 4FS0A 3CX5K 1O7VA 4HG4J 3IXTA 1KELH 2RQ8A 2ZZUT 1N2RB 4QXTB 4OZGB 4X4YB 4PJDB 5DUBA 4WRLA 5E03A 3BN9C 4UT9L 5L8LB 4LHUA 4Z7NF 4JRWA 4U1HB 3BW9B 1X4ZA 4IRSC 4X5XB 2IH1A 1AKJD 1P1ZA 4RRPG 3MRGB 3EYUL 1JI1A 1OHQA 2G9HB 1UWGH 1P4IL 1DN0A 3R06B 1MCRA 1MY7A 4S11A 1IZKA 4E41D 4PRIB 1KCKA 1E0OB 2AK4D 5IB2A 3WJLC 4O51B 1IGCH 3N1PC 3BIKB 5JUEL 3HI5L 2ZOLB 3B9KD 5C0NC 3KPRB 1EJOL 4YIQB 2C1OB 3ARDB 4I5BB 4QTHA 4Y5YA 4FNLL 3T2PA 3G08A 5F70A 4LVNC 3D2UB 4LKCA 4FTVD 3X12B 4U1MB 1A2YA 2X42A 3GSXA 4KI5F 1QP1A 3H9YA 1VPOL 1N26A 1M7DA 4JFZL 3E3QC 3MLXH 5D7JC 1JYNA 3MV8E 2OSLA 4HLZG 1FVCB 2ZUWA 1FSKC 4K71B 1C12A 4HUUB 5HD8C 2BSTB 3K2UH 5BCAA 3PV6A 2IFGA 4DKAA 1SMAA 3LKOB 1BBDH 3BQUC 1W8NA 1XZ0A 5HDBE 2YOCA 3ZKXC 5D2LF 3SDCC 1BBJB 5ACZB 5HYJB 4JLRA 2OZ4A 3ES6B 5ADOH 2JIXA 1CLYH 5DURD 1V7MH 5C0CD 3ARBA 3E6HB 2MHAA 2AJSH 5D1QB 2NY6D 4TQEH 5GS0D 4GJTB 2VYRE 1QBAA 4KY1L 1A4KA 4QHMA 1JYVA 1EHLL 4MB3A 1FVEA 2BZDA 1I9IH 4WW1B 1HKLL 1T83C 2DBLH 1FNFA 4YFLF 4XGZA 3T0EC 5JPMB 2BNUA 4ONHA 3TVMD 3WXWH 1IL1B 5BOZG 3FQNA 5D6CA 1B0RB 2HA1A 5FYJD 5IVXE 3PQYE 3WDHA 4RGNE 1K8DB 4DQOH 4K55A 4JDZB 4G3YL 3NCJH 4M61A 1OSPL 1WZMA 1KEGH 1G0XA 2Y36H 1G6RH 3TBYB 1T20B 4M7LH 1L0XA 5T3ZL 2CXKA 1YJDH 2X2YA 4QXWA 5T3XL 4POUB 5SV4A 2X89D 4P4RA 3KR3H 1D5XA 5D70H 4YX2H 4WEBL 5F6HJ 5TDOB 4D0DA 4NHUB 2W0PA 3V9FA 2VISB 1GHFL 5HHMD 1IGTA 1OTSC 3ET9F 4M7JL 3FT3A 4K3HA 4MJIE 4PJGF 4OB5L 1DBBH 5HGHB 1NDGA 2XZCH 2FATH 3T0DA 3LQAC 2YPLB 5GGQL 4NO5A 4LKXA 1A6VL 2Y5TA 1AHWC 4RAUB 2XN9E 4BFGA 1TVDA 1U8KB 4C83B 5C2UB 2D9QB 3VXRA 1UVQB 2NLJA 3PG2A 4I48B 4NN5C 3CSGA 2Q7YA 4XP6H 4KROC 4K94H 4F9LA 1KV3A 3CVHH 5DO2C 1JHTB 1UEYA 3VXUD 4BQBA 4BSVB 4R26L 4HWBA 2B5IB 3I6LD 3WHXA 1WJ3A 3MUGA 3T1FA 5C9JB 3CJJA 1PG7H 5E8EB 1D9KD 4ISVA 3WJJC 2AABL 1MRCH 4GQ9L 4MA7H 4GOSA 3BAEH 1S7RB 1SBBA 1OAZL 4N8CL 1RZ7L 3T77A 3BMVA 3HC3L 1MH5B 5EO9A 4D3CL 3DX9A 1LEGB 4NHCH 1CCZA 3BWUC 4N0RA 5KBNC 3VFUA 3KJ4B 3MA7A 3T8XB 3QZWB 4RFEB 5EPMA 1FL5B 3V4PL 3S98A 1VEOA 3QNZB 5DUPL 2VLRA 4L1HA 2PKDA 3SDAA 3EFFA 2P47B 5CD3B 1DVFA 3P77B 1GZQB 3MNWB 4XPFL 5DRWB 1DANT 3B3IB 4LL9A 1HDMB 4RA0C 5DJ6A 4EZMA 2KQNA 1XMWA 3OGCA 4KK9D 1R0AH 2YD3A 1JNNL 2Y6SD 3RVTC 4X7DC 2ZCHH 2O5XL 4Y19B 2CKNA 1MPAH 2GY7B 1MCDA 3ILPA 1NCBL 4G6ML 5K93A 3RVWC 1L6XA 3CPLB 2PO6B 1GGCL 3AY4A 1J1OL 2M8XA 1FDLL 1H8NA 1IGJA 43CAB 5E8DH 3DARA 2FX7L 3OF6D 4P57A 5C08D 3WS3B 4ZODA 3ULUD 5ABDE 2VZSA 1D6VL 2F8XC 3O4LD 4GAJH 1WFUA 5TF1L 1IM9A 1BVLB 1J10A 1EERB 2KKQA 3LRSA 5I8OH 4JY4A 2ARJA 5TPWH 1J1XH 4L4VD 4HEPG 4A2MA 2YRLA 3C5JB 4R8WL 1NCAL 4FMFA 3CD4A 4OD3L 4F7CB 1F3DH 5ICZB 1DEEB 2FHCA 2OLDA 2C9AA 5E7BA 3CFBA 3BH8A 3IU4H 4W68A 1OGAD 1HOCA 3JZ7A 2X4UA 3SPVA 4OZGF 5D2NC 1T0PB 2OTWB 4QT5B 2IMMA 1MHPL 3X17A 4YBQD 1FCGA 1MI5E 5DC9B 1MJ7L 3LKSB 3O6MH 4HLZH 2BNRB 3RZCC 2R15A 2DQGL 2YPVL 5GJSL 2F53E 4AEIH 2W65A 1Q72L 4XMLH 1VACB 5F8RC 5DTFA 1U8PA 2AXFA 1M71B 4AIZB 1AKJA 4G5ZL 4HWBL 4JDVA 4RMUA 4BSJA 1NEZA 1TQCB 4XNZC 3M07A 1ZHNA 1FN4B 3HNTL 3O3BB 3MRKB 4NM4H 4XP1L 1Z9OA 1JMZA 4LDLB 4E41A 1J86A 4G6AD 4PBVC 3S8WA 2AK4A 1NQBA 2VL5B 2YK1H 4ZO8A 4NQCB 5JIIA 1VFUA 1KOAA 3G04B 1EFXD 3O6KH 3B9KA 5CEXB 5DD1H 1ZT4B 1ONQA 2JTDA 3FB7A 4L3CA 4PJCA 2GW5A 3X3FH 3KYOB 5CS7A 5EU4A 5FUZH 2NY4C 4Y5VB 4FTVA 3MRHA 2YD6A 3TNNA 5FECA 1IC4H 5DJYA 3DMMC 3UTPD 4OLYH 5IVXB 3PQYB 4R2GB 4ZNEA 2P5EE 1YEEL 5TE7L 1F8TL 4PJ5B 4NBZB 2OJZL 5CUSL 1UZ6E 2FBJL 4YNYA 5KZCD 3W39B 4GH7B 4KZEH 5HHNB 1W0WA 2IPKB 2X9YA 3IU3B 3QDJD 4ZS7H 5F9OH 1HILB 5HVGB 4BSWA 3QIWC 4NKOB 1BFOB 3BEVA 4K8RH 4JFDD 3VWKD 5C0CA 3P3YA 5GS1B 4PY8J 4M7ZB 3P4OB 2XQBH 4MA3A 4QHUB 3I3EA 1FJ1A 2IFFH 1I7ZA 1U8JA 1G7JB 4YHPA 1JCKA 4XC3H 4NQXB 3NZ8B 4WO4C 3WE6A 1F4YH 3DGCR 2AEPL 1JWMA 3BH9B 3QCTL 1HK6A 3UROR 1UM6H 3C6LA 3MGOA 3MR9B 4EDWL 4OLVH 1YNTB 2H6PA 2J5LB 2FSEA 4GMSH 3IXTB 5CEZL 1HWHB 2CGRH 4KHXH 5J1SC 5DUBB 3CZFA 1MCOL 5J13C 4LHUB 5DJ8A 3VXTA 4I18C 4M6OL 2VLLA 3CXDH 5IBTH 4KKLC 4P23D 2IH1B 1P1ZB 3WMSA 3WNOA 3DRQB 4U6XA 5HVFB 3GIZL 1OAYL 3OSKA 4PJIE 3VH8G 1DN0B 2X89A 4HS8L 1A0QL 1D3CA 4G7YL 4OZHE 2E9IA 2MTPA 1F2XK 3RX7A 5IB2B 1KSRA 2NR6C 1E4WH 3KLHC 4OIIL 4UBDC 3H9ZA 4HKBA 1SVZA 3GI9H 1CQYA 3GMMA 4S1DC 5F1OB 3QO0A 4KXZH 2MNUA 4Y5YB 5LBSH 3G08B 5ACLA 4APQD 4X7SL 3W2DH 4LKCB 1N0XL 4WTZG 1A2YB 3GSXB 1WWWX 4KKBC 3BVNA 1KUMA 1M7DB 4OZIA 2W9LA 2YKLL 4DWHA 4DGVL 4QF1A 3V5HA 5DWUH 1OL0A 1G1YA 4N9GA 3PWNA 5GGRA 1C12B 5CP3A 3ZT5A 4XXCA 3KS0J 3PV6B 3VXUA 1AGBA 1B4RA 1XZ0B 2ZG1A 2DMBA 5EU3A 1X9QA 4FFVD 4JLRB 4YJZL 1KJVA 4ZUWA 1T03H 1VFMA 1D9KA 5DMIL 1MWAA 3GHBH 3RVVD 2JIXB 4OBSA 4MNQE 3ARBB 3BN3B 2MHAB 2LAGB 4XX1E 3G9AB 3PGFH 4YHYC 4OF8A 3D18A 4CMMA 2E9WA 1A4KB 1X5AA 3LDBC 4QHMB 3I50H 1BHGA 3IFOA 5E2TL 4PJCE 1FVEB 4PYHA 4XGZB 2BNUB 4ONHB 4KK6C 4EI6A 4TSBL 3C2SA 3FQNB 3BDYH 3V6BR 3OZ9L 1GH7A 4CDGC 1QLEH 4WWKD 5D6CB 32C2A 3ZSSA 4YUEH 3VG9B 1AFVH 3E2HB 1Y0LA 3IDYC 5I1EL 3WFDL 4B0MM 1CLZL 4M61B 4AIXA 2PYFA 3HAEA 5GS0L 4PREA 2YS4A 5HI5D 1JPSL 4P4RB 1D5XB 3AUVA 4D0DB 3HE7C 1WLHA 2HT2D 1IGTB 5AZ2L 3FT3B 4IMKA 4R7NA 4NNPL 1IEBA 1NDGB 2WQRA 2AQ1A 1QOKA 4Y5XA 4NO5B 2DQIH 2F53B 5B8CA 5FYJL 5B39G 3BRDA 4LKXB 1P7QA 3D87B 2Y5TB 3OF6A 5C08A 3V7AG 2AJXH 5GIRA 1J0ZA 1P4IH 4LDEB 4MYWB 5E2JA 4NQDE 3MLPA 4IOFC 1T7WA 3VXRB 3U4BH 3O4LA 2NLJB 2Q7YB 5AEAA 3VFPA 3HI5H 4MQTB 5L0QB 4JQXA 3CFCH 5C86A 1EJOH 4L4VA 3X3GH 1Z9SA 3ZDXE 3FT4B 3MRCA 4FNLH 3BPLB 6CGTA 4QRPD 3WHXB 3MUGB 3T1FB 5HDQH 3A6OA 3OJVC 4ISVB 3LCYA 2XT1B 4DW2L 1D5MA 1OGAA 3QRGL 4J3UA 3QXUA 3T77B 3GSUA 1CFBA 4JR9H 2IGFL 5EO9B 3DX9B 4J2XA 4V1DA 1S9KC 3VFUB 5DSCA 3MA7B 5AYQA 5EPMB 3MJ6A 2VLRB 1TNMA 3SDAB 3WNPA 4JHZA 3FKUS 3EFFB 2LABA 3QA3A 3QCVH 5ISZA 1SEBA 3KHOA 3L3IA 4F2MA 4HFWA 1DVFB 1ZANL 1MWAL 3G5YA 1DQMH 5DJ6B 3BGMA 3OGCB 4KY1H 1QSFD 2HAZA 1JTOA 4P46D 3CU7A 1HKLH 1T66D 1C5CL 1XF1A 4G6JL 1XGYH 3MLVH 4FXLA 1AQDA 1PSKL 3JV0A 5L2JA 4P2YA 4NWUL 4WW2C 2ZOKA 3HMXA 3ILPB 3MUHL 5IVXF 2EDDA 3U2SA 3SY0A 1ORQA 3RDTD 4HCRH 2C3HA 1UCTA 1OSPH 1IGJB 5JMOC 2YRPA 5JTWA 3K1KC 4P57B 5IMMA 4XVUD 5FYLD 5T3ZH 1HNGA 5T3XH 3ZYJA 3QDME 1JFQL 5IGXL 2XWBA 4WEBH 4ZSOE 1PX3A 1IM9B 2I27N 1GHFH 3OKLA 3U0PA 4EVNA 3LRSB 3QDJA 4OB5H 4JY4B 2WWMC 2ARJB 1BOYA 4OGXL 4AEHL 4JFDA 3THML 3VI4F 3VWKA 1KACB 3V8CA 4JDTH 1CIDA 3MV01 5TGBA 5IQ9A 4LMQI 4PJ7E 2B20A 3SGJC 2WQ8A 1B0GA 3EW3B 5CIPA 4H88L 3CFBB 3BH8B 2XY1A 3S35X 1HOCB 2ENYA 2X4UB 3K8MA 3SPVB 3ULUL 1UJTA 1J8HE 4H20L 4J3TA 1MJ8L 2FO1A 3SKMA 3S9DB 2W59A 3C87A 4O5LH 2W65B 1S7SA 2GK0B 4JQIH 3TZVD 5E00A 2ORBH 4R26H 5DTFB 1U8PB 1MCWM 2AXFB 1KT2A 2NY3D 1AKJB 4JDVB 4UIKL 4LCIL 1VKXA 1NEZB 1ZHNB 4RDQG 2AABH 1KJ2A 4JO2L 2AW2A 1QBLL 3PHOB 1OAZH 3R1GL 4E41B 5JW4M 4M8QA 5CJ5A 2AK4B 3C5SA 1A1MA 3LN5A 4WCYL 3HC3H 2X05A 3ZKMD 4D3CH 2YXMA 3B9KB 1ONQB 3BRGC 3FB7B 4L3CB 3V0WH 3P9MA 4PJCB 1WCBA 4ZFZA 1JZ6A 4APQA 5DUPH 4HXBL 5EU4B 2AXHA 3WEXA 1EA9C 5E8PA 4FTVB 3QPXH 3U6RA 1F90L 1TVHA 3UZEA 3TNNB 5FECB 4X9BA 4OZ4A 3RWFA 4DN3H 5DJYB 2PN5A 3M8OH 3T0XA 5T1MA 3CK0L 4WUUD 4HT1H 2VDRH 4NRXA 3RVXD 4V1DE 3JV4A 4I3RH 1OTTC 5HHPA 2R1WA 3LS4H 5JA8B 1JNNH 4FFZH 1BAFL 1NMCC 4HC1A 4OKDA 1ZLWK 4FXKA 4JHWL 4AG4H 1RAMA 2O5XH 4ORZC 4MVBC 1Q0XH 1JRHI 5IHLB 5FCUH 4KK8D 1N6UA 3NGBC 1W0WB 5ISZE 2EDBA 4XI5C 4FQLH 3A6BL 1GGCH 5TDNA 3CFDA 3LKQA 4BSWB 3HMXL 4NKIL 3BEVB 1FDLH 4XVTL 5C0CB 2ARJQ 4MA3B 1KPUA 2NY6B 3IB4A 4OTXL 1FJ1B 4YHPB 1I7ZB 1U8JB 3ZYOA 3VFOA 4PD4K 2R2CA 4LDOB 2FX7H 1BFSA 3WE6B 4M1DL 3ARWA 2PYED 4B5EA 3QI9D 2X70A 1JWMB 3L5WA 1FNSL 3C6LB 3MGOB 4G8FA 2H6PB 3ESVF 3EIFA 1IAKA 3NTCL 2WUCL 4OCYL 2FSEB 4WWKA 3BN9D 2CD0A 4KRMB 4Q6YA 3LIZL 1P9MC 3RVUC 1NKRA 4EBQL 4ZUVA 3CZFB 2WLYA 4IRSD 1F6LL 2PTTA 5DJ8B 3VXTB 1N5YL 2VLLB 1CR9L 4R8WH 1T1WA 4O9HH 5K9OA 3Q6FA 5D7KD 1JPFA 3DXAE 3LQAH 4U6XB 2NQCA 3T04D 5TE4L 4HZAA 1FAIL 3U48A 1BQLL 3EDFA 1HHIA 1MJ7H 5DJXA 5HHMB 5C0ND 2DQGH 2YPVH 4NDMA 5GJSH 4HKBB 3GMMB 4RMQA 1JZ5A 3QO0B 1OT1A 5MEQA 3RIFF 4RAVA 1QPXA 1KB9J 5L7XL 3C5ZB 4CN1A 4JGJA 1BP3B 5D7JD 1OP5H 3VD5A 4PRDA 3HNTH 1MHCA 4ONFL 3QNYA 4OZIB 1JGLH 1X44A 3SBWA 1KJ2L 1FG2A 3MV7E 4OD2A 4QF1B 4I0CC 3V5HB 3LRHA 4N9GB 1IGFH 3PWNB 5GGRB 4W81A 3PDDA 4Z78A 3VXUB 1AGBB 4XCNA 2VIRA 3PXJA 3QCUL 5T33L 4QRPA 4MX7A 1ZTXL 2HJLA 5EU3B 4YDKH 2APBA 4J4PC 1KJVB 4ZUWB 1KGCD 1IAIH 4CVUA 3FB8A 1D9KB 1MWAB 1YZZA 2L7JA 2E7LC 2H1PH 3T2NH 1TFHA 3D18B 4CMMB 1F8TH 1J88A 4PJFE 1PDKA 3VW3L 5ESAA 2OJZH 5CUSH 3T0ED 3Q5OA 1IVLA 3ZE0F 5K9KA 4MNGE 4JHAH 2Q8AH 1F4XL 4EI6B 2OP4L 2J12B 1A7NL 3L1OL 2R0WL 2A9NL 32C2B 4JANA 5C0AD 1HYSD 1Y0LB 1XAUA 1BJ8A 5HVWA 2WP3O 3S34L 3O2VL 2PYFB 3HAEB 1W0YT 3SDYL 1QSFA 3L95A 3LZFH 4PREB 2EDRA 4P46A 4NZDA 1IEHA 1N8ZA 2WBWB 2ICWA 4WFGE 4EDWH 5L6YL 2VDLH 3DOSA 4MAYD 4WV1C 1INEH 3QQ9D 4QXUH 5T5FL 5MEOB 1PKQA 4JY6A 4NIKB 3DV6A 4R7NB 3CXHJ 1IEBB 1H0DA 1MCOH 4Y5XB 5KTEH 2EO9A 3A6CH 5B8CB 1P7QB 4DKEH 3X11A 2H2SC 5C08B 3RX5A 2BVOA 2HN7A 4AK1A 5GIRB 2MCPL 1EEUA 1OAYH 5FYKU 1NEUA 4PG9A 1A0QH 3O4LB 1A7PH 2MWCA 4KROD 2V17L 3HPLA 3C9NA 3SGKA 2QKIA 1FV1A 1HH9A 5EH1A 3QDGD 1EIBA 3PV7A 4LP4A 5DO2D 3VFPB 1U95A 5F7EL 1DBML 1AY1H 4LVOC 4WVRA 4ZTOL 4L4VB 3K1DA 4HPOH 5HSFA 3MRCB 3ARPA 5CJBA 3VFGL 2I9TA 1UENA 4YGVA 3H2WA 4M6MH 4NYLA 3BT2L 5ERWA 3BE1H 1ZV5A 3NIGE 1D5MB 1OGAB 5I0ZA 1DEDA 2YKLH 4ZFFA 4LGPB 2Z92A 3GSUB 3NH7L 5I71C 1JZ4A 1J18A 4V1DB 2EYTA 5CBAA 5D96B 5L88L 1DQDL 1U3HC 3LB6D 3TZVA 4RMRA 1OT2A 3RBGA 3U7WH 4DZ8A 5DSCB 2ID5A 2GCYA 3GMLA 4JFHD 3TPUA 4XB8A 5FO9A 1MHHA 2IALA 1JK8A 5DMIH 5CJOL 2OI9B 1KB5H 3QA3B 5ISZB 3L3IB 4F2MB 4HFWB 1AR1D 3G5YB 1P84J 3VXMA 3BGMB 5FGRA 3NN8A 3RVTD 1RUKH 2ICCA 4MXWH 3RQ3A 4BK4A 5ANMA 1AQDB 1AC6A 4JJ5A 4TSBH 4XCCL 5EULV 5BV7B 2ZOKB 5CLTA 3TWCH 3MX0A 3U2SB 3T4AA 3SY0B 1ORQB 4Y2DD 5IESL 2FJHA 1PY9A 1R3IL 4WHDA 1I8KA 5CAYB 4WUUA 1I9RL 1QSED 5E08L 1UADC 4U0RB 5IMMB 1ZLSH 5KJRL 3H8NA 3GO1L 4FXGB 5KZCB 2XWBB 1RULL 3RRQA 3QUML 3V6FA 1WUNT 1YN7A 1U91A 5JA9A 3OKLB 3U0PB 5I75C 3G5VB 3U4AA 4EVNB 3QDJB 3MOBH 4WWID 5DJZA 1OP5K 3TA3D 4JFDB 3VWKB 2VRAA 3JUZA 5TGBB 3DECA 5IQ9B 2VXVH 3RKDC 1B0GB 2IAMC 4EXPX 1MQKL 5EORL 5CIPB 1RUAL 2FHFA 3B9AA 3WUZA 1OARL 5FYLL 5BO1H 2LTQC 4R97C 3RZCD 3S35L 1KNOA 3SKMB 3P40A 5KANI 4ELMA 5IM7B 1S7SB 3BKCL 3OHXA 4IRSA 5E00B 3F58H 4F15C 2DDQL 4BZ2L 4OM0L 4L8CA 1KT2B 5EU6D 2YC1A 1VKXB 4PRPD 5F9WB 3MBXL 2XRAL 3DYOA 2XWTA 1KJ2B 1U0QA 4RCAA 2AS5M 1HIMH 4TPRH 4M8QB 3ILQD 3SQBA 3C5SB 1ZGLM 5SX4I 1A1MB 3LN5B 4EUPA 1PX4A 1NC2D 2A6IA 5BS0D 1OTUD 1UQSA 5IMKA 5AG8A 3P0VL 5FV1L 5IROC 1WCBB 4ZFZB 1XH3A 4APQB 5CLWA 3PIQA 3WEXB 5E8PB 4OLZL 4P9ML 3U6RB 4OZIF 1I7RA 3DWTA 3BWAA 1TVHB 1Q0YL 5D7JA 4OZ4B 3RWFB 2P24A 3DVFA 5T1MB 25C8H 1ZANH 3FB6A 5DHYA 2DS4A 5FUCC 3MFGB 4NRXB 2EDWA 4KHTH 3JV4B 5E7FA 5HHPB 2R1WB 2WINA 4FXKB 1IARB 1C5CH 1KTRL 3SGEI 5F1IA 5JW4R 3FN0L 1WWBX 1L6ZA 1PSKH 3NVQA 1F4AA 4NWUH 2VQTA 1G1CA 5JLZA 4DGIL 2VJXA 2C3GA 5TDNB 3GKWL 3LKQB 4KAQL 2HP4A 3KXFD 3Q5TA 1QBMH 3VXME 1BEYH 1KPUB 2OTUA 2EXWC 3VFOB 4ETYA 1T83A 3T0EA 1BPVA 2X70B 2AJ3A 5D8JH 4PY8I 2LVCA 3L5WB 2UZYB 4LSPL 4N0YL 3EYFA 2BSRA 2I9LA 4G8FB 1JFQH 2DWEA 4X6DE 1IAKB 2X4OA 4WWKB 2W07A 2E6JA 1DLFL 5ALBL 4ZUVB 4OGXH 5C0AA 5JQ6H 3THMH 2PTTB 3QUXC 5C6WH 3FONA 3P2TA 4I0KA 4KV5F 2AGJH 3GEWB 4ALAH 1T1WB 5K9OB 3MNVB 1G7PA 3Q6FB 1JPFB 3FN9A 3O6FC 2R4SL 1KPVA 4H88H 3LN4A 1RZIA 4GKZA 5AYUH 3EJJX 2H8PA 4BA8A 2QHRH 4GW1A 5ESQA 3EHBC 3KLHD 4NJAH 4UBDD 1HHIB 2PCPA 5DJXB 4PG2C 4DUWA 4E42A 3SKJL 4A6YA 4NDMB 3HFML 4IDJH 4WENB 2HFFA 2BERA 5EUOA 5MEQB 4RAVB 3BSZH 4UTBH 3ARRA 5JHLL 3ULUF 4X6BB 2EC9U 2V9QA 4LCIH 4HFUH 5D5ME 3V7MA 3Q6GH 4PRDB 4WHCA 1F3DJ 4JO2H 1MHCB 1UKTA 3K3QA 2HMIC 3QNYB 1QBLH 4I13B 2FX9L 1FG2B 2B4CC 4NO3A 1RFDL 1CWVA 4KQ3L 4OD2B 3TFKC 4U6VL 4LSUL 4RFOL 5TFSL 3L5XL 2HH0H 2VSDA 4Z78B 2P5WD 4Z76A 5I74C 4DZBA 4BFIA 4WI5A 4QRPB 4MX7B 2HJLB 1BFVL 3STLA 3QXAA 3FB8B 3VFNA 4P2QE 2R2BB 2VL4A 5MENE 5IQ7L 3GJEA 2XZAL 4W6XB 4LCWD 2EDNA 3GGWA 3GMOA 5EB9A 1A64A 5ESAB 4OGYL 4W4OA 3P73A 4JHWH 5ITFA 3UP1A 4DTGL 5K9KB 3O9WD 3JV5A 3E3QE 3RPKA 2O26U 1FLRL 4ELKA 1DR9A 3FMGL 3UBXI 4DAGL 4JANB 3UTTD 2HT4C 2R0ZL 4XVTH 4YE4L 5FFLA 2NYYD 4YXKL 4OTXH 3FL7A 4EEEA 2Z93A 5CINL 1QSFB 1XF3A 3L95B 3QUYC 5MHSD 4P46B 1N8ZB 2ICWB 4ZS6C 1BWMA 1A02N 3U1SH 1KCLA 2APVA 3D25A 2WUCH 4NRZB 3WIHA 1PKQB 4JY6B 2IQAA 1S7XA 1KCUL 3DV6B 1P7KA 5CGTA 5HHOD 2YN5A 2E8ZA 4EBQH 1H0DB 4Y2DA 2CK2A 5JNYB 3WNMA 1B90A 5IBUG 2QQKH 4JZNA 1V3MA 5KSBA 4GS7B 1QSEA 1B4JH 1CR9H 5CZKA 4FQJH 3CVIH 3X11B 1F6FB 4CVZA 2CRYA 2BVOB 2HN7B 4IOFD 5CCKL 3QFJD 5HYIA 3L7EA 5TE4H 4KH2A 4NC0B 1R3JA 4PG9B 1NGQL 3BRFA 3N0PB 3V7AE 1BQLH 3EAKA 1QNZL 3L7FA 3HPLB 3C9NB 5EN2B 5IFAL 5I18H 2QKIB 4L5FL 1FV1B 1QFPA 1HH9B 1U95B 4GG6E 4A6YL 1YECH 1H15A 5C1MB 1MFCL 1JWUA 2I9TB 4YGVB 5L7XH 4GXVL 1GXEA 2K7PA 1TETH 2B39A 4NYLB 1DQLL 5ERWB 1YEIH 4ONFH 3MA9H 15C8L 1NL0L 1RUQL 3EFDL 3RZCA 3LPFA 2UWEA 3T65A 1PJ9A 4ZFFB 3EOYG 2Z92B 2RBLA 3MLYH 4PP1D 2EYTB 5CBAB 5GRWA 4GKNA 4B53A 2IANE 1IBGL 3TZVB 2ZUTA 4DZ8B 3QCUH 4S10A 1MNUL 5T33H 3ZL4L 3HC0A 4CU7A 1ZTXH 2GCYB 3GMLB 3TPUB 3O6LL 2NY3B 4OLXH 4M5YH 5EU6A 5FM5O 3OAUL 2VN4A 4PRPA 5FO9B 1MHHB 2IALB 1JK8B 3RA7L 2V9RA 3IDNA 4GAGL 1BM3L 1MELA 3WL9A 2AK1L 1IFHH 3VXMB 4O4YL 3NN8B 4MAUL 2IBZY 3VW3H 1NC2A 3TJEH 5BS0A 5ANMB 1TLKA 1F4XH 5TE6L 4JJ5B 5GHWL 1SJVA 1YEJL 5HVHC 2WBJC 4FQXD 3LMJL 3NZHL 2A9NH 2VDQL 3DMMA 1JN6A 2NNAA 3HUJA 2WBKA 2FJHB 3KPPA 2WANA 1NCTA 1I8KB 2ZNWA 4WUUB 4XWOC 3SE9H 3F12A 3GMNA 4YHKL 1SYVB 3CSPA 4WTWA 4POZD 5I66A 5L6YH 3S36X 1CYGA 1R24A 1H8OA 1FORH 2LQRA 1YN7B 2WWMD 5T5FH 3V6FB 1U91B 4KVNH 5GS2H 4H1LA 5DMKB 1EHNA 3B83A 2JJSC 3WIHL 4YGAB 3EJZD 2OR9H 5DJZB 1NAKL 4CW1A 4I9WD 3KXFA 4FQCL 3BGFC 4NOFA 2OL3H 4Q74A 1Q8MA 5H37G 2KZ1B 2VN7A 4Y4HC 3MLUL 4K3EH 4RGMB 2KPNA 3P30L 3GRWA 2F54E 3MGAA 4OFPA 5D5MB 2YUXA 3J8F7 3CDFA 1QA9A 4M8VA 5BJTA 1YNLL 5C0RH 1LO3L 1KNOB 4ELMB 5F7EH 1DBMH 1XGRA 4I18A 4NKDA 3OHXB 4IRSB 4ZTOH 4F8QA 5KAQF 5F71A 4PJHA 1YEGL 2XA3A 4LPCA 3UYRH 4L8CB 1N6QL 3IYLW 4G8GD 1Q1JL 3S88H 3VMOA 2PNDA 2YC1B 1WZLA 4O02L 3NIGF 1PEWA 3ZDZF 1A6UL 2XWTB 4LASH 4NSKA 3T3PF 2N1KA 4CMHB 1MCIA 4L4TE 1S7QA 1U6AL 2AJYL 3NH7H 4EUPB 1M1SA 3MJ8A 2A6IB 3SJVE 1UQSB 3R0NA 5IMKB 5E24E 5IB1A 2GITA 1XH3B 2X4NA 3PIQB 5D2NE 1WV7T 1I7RB 3BWAB 5D7JB 4K7PY 2CRZA 3BYTA 3L6FA 2P24B 1OTTD 3FB6B 3MOQA 5DHYB 2FYYA 2FHBA 2R56L 1FSKB 4MD5A 3K2MC 5IF0A 4MVBD 2WINB 3I85A 5JHDE 1DBAH 1CICC 3G5XA 5F1IB 1MCQA 1T2QL 1ITBB 2P5WA 3ZKXB 1JPTL 4R90H 5EIQA 4KRPC 4XI5D 2CDGA 5J12C 5EOCL 3JWDH 3ZTNL 2KH2B 3MCG1 1TCMA 5IESH 2FGWH 1F58H 4N0UE 1YYLH 3MV9D 4U2ZA 4LCWA 3HI6L 1I9RH 1IJ9A 1E6JH 2OTUB 4QTIH 3NIFE 4NPYA 3MXWL 5BS0E 4X7TA 2E3VA 2FEDD 4KTYA 3T0EB 5KJRH 2AJ3B 1CS6A 3EYFB 2BSRB 1MUJA 2OXGA 5HHVH 3MCKA 3BD5A 2DWEB 1RULH 3BD3A 4PGCA 3O9WA 2XTLA 3QUMH 2AV7A 4GXUM 2X4OB 4I0PC 1CFVL 3RVUD 4XP9L 4UINH 2BK8A 1I7TA 3UTTA 4HS3A 5C0AB 5KG9A 5EOTA 2GSIA 1F02I 3FONB 1FIGL 4QRTA 5F88A 4URTB 1S7VA 5DLMH 1T2JA 1G7PB 1T0MA 1KPVB 5EORH 1UACH 3LEXA 5BZDA 2UYLA 1RUAH 3LN4B 1RZIB 4GKZB 5J11C 2H8PB 5ESQB 5FYLH 4M4PA 4K3JL 1HSAA 5EA0H 5GJTL 3R0MA 4CUCA 3S35H 2HG5A 4YDIL 2PCPB 4AYFA 1JTPA 4E42B 4A6YB 1MAJA 4YR6A 3WFCL 2HFFB 5EUOB 4QHNA 4FFWC 2MFNA 3CFJA 5DD3L 2P44B 1RZKL 3C09C 3EGSA 3FZUC 4OJFL 1JGUL 1RUPL 4NN5B 1J0YA 4KROB 3T1WA 5I1KH 4YLQT 4NO3B 4GLRH 4JY5L 3VMNA 3MODH 4PJHE 2D7MA 2PR4L 4Z76B 4DZBB 4OV6F 5FO7A 3C8DA 4BFIB 3VMPA 4LARL 5FO8A 2V2TA 5C71A 4GRMA 2BHZA 4OLZH 2VSCA 3STLB 5A2JH 2Q7NA 1BD2D 3VFNB 1YPZA 2DLGA 3JXAA 4KTDH 3GJEB 2E7CA 1LO0L 5K9QI 3KPSA 1UXWA 2EXYC 5J8OA 2R69L 2FX8L 4J12A 3GGWB 3GMOB 4YPJA 2ADJA 1L7TL 5DC4B 2B1AH 1FNGA 4Z7WF 3RP1A 3P73B 5HPOA 5ITFB 1KG0A 2VXUL 3DYPA 3V4UH 3SE8H 5LQBL 1RV6X 2F9BT 3SDXA 1JHKL 2YD7A 4MS8C 3RHWF 4PTUA 4S0SD 4DGIH 4ELKB 3PUCA 4ONOA 2VR5A 1XEDA 2DICA 2FRGP 1V7NL 3EO9L 4JRYE 1QD0A 3BPNB 1N64H 2Z93B 3RAJL 5H37H 1G0YR 1XF3B 3VGDA 5SWQA 2DTSA 3UJJH 1A7OL 1INDL 5F7DA 1J0KA 4N0YH 4R9HA 4Q6IC 3ETBF 3D25B 3AROA 2CR3A 5IP4A 2IQAB 1S7XB 3M1BA 1P7KB 4HQQL 3N9GL 2ZUVA 2X9XA 4NCC2 3IKCA 4GKOA 1DFBL 2EDEA 2FIKA 5EOQL 4JZNB 3KPTA 1OAUH 5KSBB 1QSEB 2BVQA 5BW7C 1UT9A 3I3BA 1LK3L 3EO1A 5DEGA 4HIEB 4AM0A 1KCRH 3CC5A 3QQ4A 4HXAL 3VXSD 4CVZB 3K0WA 2XWJA 1NUGA 3WN5A 4YHOH 3IFLL 1UA6H 3F7QA 2E27L 1WBYA 3L7EB 1C7TA 4IRJD 1R3JB 1G7MA 4LOUC 3L7FB 4C56E 4S1SH 4BZ1H 4UT7L 3VI3F 1D6EA 2W0FA 4NQEE 1H15B 4HKJA 1JWUB 3GKZA 3SGJA 4GRLC 1WZ1L 1UKQA 3KLSA 3OAYH 2CDEA 2NY5L 4PV8A 3VFVA 4ELMF 2FX9H 3RI5K 3RZCB 1RFDH 2UWEB 3T65B 4KQ3H 2BRQA 1WAAE 1U3HD 4LSUH 1FO0A 4G80A 4RFOH 5TFSH 4NRYA 3ZE1E 4GKNB 2ZPKL 2PTUA 3HG1D 5TDPA 5J6GA 4TVPD 4LPXA 4Y88A 5C6TL 2QV2A 3HC0B 4XNZB 2CKBH 3CMGA 4BH8A 3NIDE 4G8GA 5EU6B 1BFVH 5IT2H 4PRPB 3IDNB 5M95B 5IQ7H 3K8LA 1QRND 4ZO9A 4M3JA 3WL9B 5F7WC 4MD0A 4YWGH 5BRZA 4N8VG 4D94A 3GBNH 3MRRA 2F5BL 4OGYH 3H3BC 1NC2B 2A2QT 5BS0B 4WI7A 1P53A 2NY4B 5B4MC 4FQ1L 2O61A 1G9NL 5KANG 1NFKA 1NFIA 1YPZE 3HNSL 4G42A 5D93C 4ORGA 3FMGH 3DMMB 1JN6B 2NNAB 2DLIA 3KPSE 1AXTL 1S9VA 3KPPB 4X4XA 4QY8A 2MQ0A 4YE4H 4PUBL 2K9UA 4YXKH 4XMPL 3F12B 3GMNB 5CINH 1A6WH 2HYMA 4EQ2A 3LY6A 1TJHL 1U3YA 1K85A 5HGAA 4FRWA 4PBXA 3ZKSD 3WO3B 3TEUA 5I66B 4L8DA 1ZE3C 3PWPE 1R24B 5E0QA 3VFTA 3VGFA 3OXSA 4H1LB 3S36L 2ZUXA 3N50A 3ZT7A 4P59L 4CW1B 3OMZA 1IKFH 3KXFB 3MV9A 3N1QC 3RKDD 1AGFA 4D9QD 4Z7OF 2UY7A 1H3UA 1NBQA 3O3EA 1I4FA 3KYMA 4EOWH 1QA9B 4XPAL 1WITA 4OIAA 1CF8L 2OJEA 1QNZH 4KZDL 1P9MA 2JF1A 1YMMD 4ZPTA 5MEPA 5J13B 5LVEA 1A14L 1VGEL 1XGRB 4I18B 4NKDB 3QBTB 4TRPL 2ZSWA 2EEDA 3VU2A 1UFUA 3UTOA 3BIAX 4PJHB 1KCSH 4DVRH 3RHWK 1DZBA 3TN0D 3ZTJG 3ULVC 1I3GL 1SY6L 2Y07L 1KTKE 2KUTA 2NX5D 3PL6D 3RNQA 4NSKB 2RIKA 3P11L 1NL0H 1RUQH 3EFDH 2MPAL 4FQPA 4MB4A 3P9WB 3W9DA 2ADFH 1RJYA 1S7QB 2HFGL 5EUOF 3AU1A 1EZVY 4HEME 5GZNC 1DSFL 5JMRA 3MJ8B 3OR7A 2VH5L 3GJFA 3QPQD 1IBGH 2KQMA 5F7KC 5DXWA 5IB1B 2GITB 5FUOL 5FM8A 3F7YA 2X4NB 4P2RE 4U6YB 5GSVA 3K46A 4HF5L 3SCMC 3RA7H 4ZXBD 3L6FB 2ITDA 3M17A 3V79C 4ZFGL 1BM3H 1VGKA 1EEZA 2R0KL 3I02A 2FYYB 4O4YH 4K9EL 4MAUH 1MJUL 4MD5B 5IF0B 2C4FU 4GW5A 3P0YH 3G5XB 2P5WB 4LNRA 5FM4A 2FECL 4PGJA 5GHWH 2CDGB 5T5NF 3NZHH 3B8SA 5FA4A 1FZMA 2VDQH 1BD2A 2I24N 3ARVA 4G9FD 4I3GA 4B7IA 3FTGA 4MQSB 1KBGL 2Y7QA 4P2CG 3RGHA 3QH3A 5BRZE 2V5RA 4LCWB 5SWSA 4XMKH 3LDBB 2VMFA 1E4XL 1NGPH 2VR4A 2IQ9L 4YHKH 4NPYB 1CGSL 4RQQA 4X7TB 1QEWA 3MTRA 2BVUA 1AXSA 1MUJB 3MCKB 4PGCB 5FM5M 3LHPL 3O9WB 1WWAX 2X4RA 2AV7B 3MUY1 5C0JA 3IDYB 1R5WA 4Q7DA 1I7TB 3UTTB 4HS3B 4TSAH 3OAYK 3MJ7A 5KG9B 4FQCH 5EOTB 1KIRA 2GSIB 3DI3B 3VRLE 1YEHL 3O6FD 3ZDYF 4R7DA 4QRTB 5F88B 3MLUH 4TYUA 1S7VB 4JM4L 2H32H 4KJPC 4KTEL 4FZEL 5TQ0H 1N5AA 3P30H 1T0MB 1DDHA 5F6IB 2NMSA 4Q0XL 3LEXB 4MMZC 2UYLB 5BZDB 4WV1A 1BMGA 4CJ1A 5E6IC 4EI5D 5KVEH 5BZWA 5KSAC 1YNLH 1PLGL 3VA2C 1HSAB 3EYVA 1MIEL 2HG5B 4CDHA 3QAZC 1CGWA 5DVKA 4XBGA 4YEFA 5KSBF 4UNUA 4OT1L 2D0HA 3MLSL 3TYGL 3QULA 1NGYA 4YR6B 5C0DA 4QHNB 4C54A 2M1KA 1OAKL 2YZ1A 4ENED 4UB0L 1I8LC 3MLRL 1YEGH 3CFJB 3BP5B 1FBIL 4WFFD 1Q1JH 4ZUSA 2WUBL 3VXSA 4KKCC 4YDLC 4OD1H 5D7LE 3EGSB 3EBAA 1A6UH 4IRJA 5I1AA 4LEOA 1A1NA 2ZCLH 1XFPA 3X14A 3VFWA 3BP6A 5H35A 4PS4H 4QKXB 3ZO0A 2Y72A 2ZWLT 4YFEA 3VXQA 3HB3C 3V5KA 4N8PA 5FO7B 2V2TB 5FO8B 3EDJA 4GRMB 4LVHC 1KIUA 2HRPH 3E8UH 4MA8L 1YPZB 2UWEF 2JCCE 5KVFH 4PRID 4LIQH 3BPOC 3KPSB 5J89A 5DMGD 5BVJA 2R56H 2ADJB 3GSRA 3NFPA 4MJ4A 1ZLUK 1U3HA 4OLWH 3HMWL 5E5RB 1FNGB 2ESVA 2BX5A 5IVNA 3UYPA 2YUWA 3NAAH 1KG0B 5EOCH 3SDXB 1NSNL 2JK5A 2D4FA 4PTUB 2HT4D 3Q1SL 4HK3J 3MLWL 4YBLB 5LGJA 5HGGS 1OD9A 4OUUA 3UX9B 1JGEA 1SMOA 3QUYD 4LPUA 4UQ2A 4K23L 2ZUQC 4AMKL 4WUKH 4Q9CA 5SWQB 5FKAA 1CXIA 4HBCL 4ZS6D 5F7DB 4P2OC 3ARSA 2VUOA 1P6FA 4XAKE 2P1YA 4PJXA 3HUJF 2QQLL 1CFVH 1XF4A 4XP9H 3ARTA 1MFAH 2YUZA 3L3JA 1KIPA 3M1BB 35C8L 1MF2L 5D1QD 4WI3A 5SWSE 3IKCB 2FIKB 5E2VL 4PFEA 2HWZL 3CUPA 4PYGA 2BVQB 3EO1B 4LEXH 5BVPH 5DEGB 3U30C 3D9AL 4AM0B 3CC5B 2XPGA 3QQ4B 4JREC 3VFSA 2V7HA 1T7VA 1FYTE 2XWJB 3WN5B 3ZTJH 1ULVA 3CZJA 1X5LA 1WBYB 1EAJA 1CTNA 5DUML 1G7MB 5GJTH 2E9JA 5EIVA 3V5DA 5IBLC 5E6ZA 1MRFH 1INQA 1D6EB 3WFCH 2W0FB 1TVBA 5C2BL 5A40E 1VESA 4TTGA 2DYPD 5KVGH 3F65A 5DJDA 4M00A 1GPOL 1MFEL 3D6GA 1NLDH 4XBPA 4P2RB 2CDEB 1KFAL 1RUPH 4PV8B 3VFVB 4MLIA 1JGVL 3FHQA 3ARQA 3X13A 2UZIL 4XZUA 4YK4C 1YMMA 3AS0A 1L9MA 2J6EL 2F15A 2YPLD 1FO0B 2W9EH 4G80B 4NRYB 3L5JA 5KVDH 3V6OA 3IXAB 1UWXK 2FWOB 2PR4H 5TDPB 3QEHA 5J6GB 3FO2A 2OMBA 3SKUD 1W0VA 4LARH 2EIEA 3UEZA 3CLFL 4BH8B 2VR9A 4G8GB 3TN0A 1HHHA 1HXYA 4FZ8L 1QR4A 2NX5A 4GAYA 5JR1L 3PL6A 4KXZI 2KL6A 4WU5A 2F8VA 5IMLA 1WSST 4LFHD 2R69H 4MD0B 1S9WA 3DNKA 3AREC 5B22A 3OGOE 5BRZB 3S96A 3S97C 3MRRB 3ORJA 1L7TH 2B2XL 3QNXA 1S78C 4MCYA 3MBEC 3KLDA 4LMQE 4XHJC 4HH8A 5GRVL 4IEFB 2VXUH 2X10A 3EYSH 4Y8AA 3NACH 2DQUH 2O61B 3CDCA 4CU8A 3MZTA 1JHKH 3D3VE 1NFIB 4JRXD 3TGXA 2F19H 4TVPL 4G42B 2CUMA 4ORGB 3ZLQC 1EEQA 3V8OA 1S9VB 4X4XB 1I3UA 4XWOD 3EO9H 3U7YL 4O58H 3ARXA 4QY8B 5JW5A 1KC5H 4NN6B 1Y18A 4LLDA 4Z7QE 3RAJH 2NXZC 6FABH 1D5BB 1NMCB 3JSSA 2YD1A 2C1PA 2ESVE 2P48B 5C3LD 2DBJA 1INDH 5HGAB 1N4XL 1IQWH 1L7IH 1VENA 4L8DB 3NGBB 3PDOA 4PGZA 5EO1A 1CLOH 3QB7C 5HPMA 4U7MA 3VFTB 4XB7A 1X5IA 4S1RH 2RFXA 3OXSB 2F74A 3N9GH 4G9FA 4RMSA 3ZE2E 1GGIL 4MXQC 3MV9B 5IVZA 3GFUA 1AGFB 3RPIA 3HE6C 2VXSH 4PV9A 1BQSA 1PZ5A 4XCEA 4EJ1C 4HXAH 1H3TA 3O3EB 1I4FB 3KYMB 2OJEB 1H5BC 3MRJA 5GS3A 5K9JL 1OP3H 3RWJA 5MEPB 3UYOD 3DVIA 4UT7H 1VSCA 3KAAA 4GQPH 1CDGA 3BHBA 1OP9A 1QFWI 4ZFOL 1A7BA 3PP4L 1KEML 1RVFL 4XCFH 2MCG1 4Q9RL 1MHEA 2ZSWB 2J4WL 1T1XA 2VDOH 4LQFH 4UT6L 3O3AA 3NPZB 1K8IA 3O6FA 5MI0B 5CHNA 1VERA 2XZQL 1WZ1H 1J7VR 2DLFL 4KVCL 1SEQL 2NY5H 3ABZA 3RNQB 5DFVD 4PG2A 5IK3A 1AI1H 1RJYB 3ARYA 1NCCL 3AU1B 5DZNA 3AGVA 2DQHH 5CJQL 5F7NC 2EIBA 5H2BB 3OR7B 3GJFB 4LCYA 3RX8A 2HJKA 3MPCA 5KS9A 5LWYL 3F7YB 5GSVB 3VRIB 3OR6A 2JELL 1HHJA 4L9LC 3HZKA 2ITDB 3M17B 3QSKB 1RK1A 1NMBH 1VGKB 1EEZB 1YMME 1HINH 3WSQH 1V3JA 3MV8D 1EXUA 2CDFA 1EMTL 3I02B 4QXTA 5IEKA 4PRAB 3BISA 4PJDA 3T0BA 3OKEA 2FJFA 1UJ3C 4YXLH 4AJ0A 2R1YA 4GW5B 3DETD 4KRPD 3UO1L 2AEQL 4KDWA 1SJEA 4LNRB 4MMXC 3HNSH 3TC9A 5FA4B 1FZMB 3O11A 4MQXC 1BD2B 2X41A 3FTGB 2O5ZL 2YZ8A 3R06A 3DUSA 1AXTH 2Y7QB 4QOKE 4Q9BA 3QH3B 4PB9H 5J56B 4PUBH 3ARDC 5SWSB 4XMPH 2Q6WA 2EICA 1J0IA 3WIIH 1MFDL 4RQQB 1TJHH 3IRZA 1QEWB 4ODWA 3SDXF 3DTXA 2J8UA 1ACYL 3EDKA 1P5UA 1WGOA 4J3VA 4F58L 2HRLA 4KDVA 1GYAA 2BSSA 2X4RB 4RBPK 5GXBB 1M05B 5FUCE 1C8PA 2ZCKL 4L9DA 3S36H 1GOHA 3TO4D 1MIMH 1R5WB 1UB5A 3ARGC 3PQYD 4R2GD 4RGND 3MJ7B 1A3RL 3H3PL 1KIRB 3GMPA 3QUYA 4R7DB 4LLUA 1N5AB 4U1JA 3U0WL 1DDHB 3G6JE 2Z91A 1WF5A 4WV1B 5BZWB 4Y4FC 2WP3T 3JVGC 4KZDH 2YD2A 3EYVB 4ZOAA 4MJID 4NUJA 2N7BA 4OCMC 4XBGB 4K2UL 5D6DA 5GGVL 1B88A 1VGEH 3EYOA 3QULB 4YZFE 1NGYB 5D1QA 3I2CL 5C0DB 1A22B 4MZ2A 1NFDA 1A47A 2OK0H 1CI5A 4LRIC 4ZUSB 3VXSB 2AJVH 1SY6H 4WI4A 2XN9D 1A5FL 3P11H 4IRJB 4BELD 3F7VA 2QQQA 5I1AB 4LEOB 4MJ2A 1A1NB 1EGJA 4HMCA 3X14B 3VFWB 3BP6B 4LVOB 5H35B 4LHUD 4M93B 2AJUL 2BCKB 2EZ0C 4R4NC 4Y4KC 1TPXB 1ND0A 4LBEA 2EDJA 3EOAA 3VXQB 3QG7H 4PJBE 2MSPA 3V5KB 4UI2A 4Q9QH 2DYPA 4KJQC 4N8VA 5DRXA 4JG0L 2R23A 4HF5H 3ZMRA 2R2EB 5E99L 4WNQA 5CZXD 4DGYL 2UZXB 1T5XA 4ODHH 3ARFD 4FFYH 1QFOA 1T0NA 2EDYA 2EXYD 4WFEE 4ZFGH 4WHYG 5TDOA 4M02A 2DTML 2SEBA 3EZJB 2DKUA 1L4IA 2R0KH 4IIQA 5E4EB 3KPMA 5I71B 2JB5L 1KN4H 4K9EH 4IRZL 1OPGL 3GSRB 3NFPB 1U3HB 1FLTX 2AXGA 1I75A 2ESVB 5JXEC 4KDTA 5DT1L 5LXGH 3IJHA 2EEAA 2R4RL 2XXCB 2M2DA 1SYSA 5ILTL 3DI2B 5FYKH 4JB9L 3CDYA 2JK5B 3KYNA 5J1AA 1CBVL 5LGJB 2CO6B 4OUUB 2VC2L 4NP4H 1UVQA 2NCMA 2DD8H 1JGEB 1L0YA 1E4XH 1IAIM 2B5IC 4UQ2B 1CGSH 2F5AL 4HJJL 2GSGA 2VZOA 1OP3K 3PGDA 4JN1L 4NFCA 3O0RL 5FKAB 1QZ1A 2DQJL 5A3IC 3DLQR 1FZJA 2GHWB 2WBJA 1C1EL 3AB0C 4JG1L 3VCLA 3IS0X 4PJXB 4JRXA 1XF4B 3L3JB 1KIPB 2JIXD 2K3TA 2WAHA 4DEPB 4J3WA 2CXGA 3KJ4C 1MAML 3CUPB 2GT9A 4KTEH 4FZEH 2XPGB 4Z7UE 4PLKD 2V7HB 4LCCA 3VFSB 4IBLT 3V4VL 2FJGA 2A77L 2RHEA 3EJYC 2IMNA 1U42A 4LOUD 5JXAL 3LS5H 3MOAL 8FABA 5HYFA 5I75B 4OCSL 3GSQA 3LKRA 1MIEH 2JJSA 3W5MA 1QSVA 3GB7A 5T1LD 3V5DB 4LAQH 4OT1H 4EIZC 2PXYC 1AJ7L 1INQB 4IJ3C 1CE1L 1TVBB 4MDJA 4QWWC 2EH7H 2EDLA 4GRLD 4S0TD 2GY5A 4M9OA 5KOMC 5C09E 4XBPB 2PO6C 2EO1A 1FGVH 4EXKA 4Z95L 2BOBA 4JQVC 3X13B 1GC1C 1MI5D 4XZUB 3ULVH 1YMMB 3WKML 5GGTA 2D0GA 1TQBC 2F53D 4GSDH 2BNQE 1JPGA 4F15B 1J87A 3H0TA 2EC9T 4TTDC 3QEHB 4QCIA 3FO2B 1ES0A 2L4OA 1W0VB 1ZA6A 2NTSP 2P8PA 3GDBA 4BYHA 3IRPX 3TN0B 1UG9A 1HHHB 1HXYB 4N9OB 4OV5A 5D7SL 5E70A 2EDXA 4GAYB 3PL6B 4F37K 4WU5B 4LLMB 5IMLB 1S9WB 5FA3A 4LSVH 1OCWL 3S96B 3QNXB 2IEPA 4MCYB 3TNMA 4KFZC 4ZPVA 1AH1A 4KMTH 2NTFA 3SKNB 5C07E 1NSNH 1MOEA 3ZYIA 1XF5A 4W6YB 5C0IA 1WC7A 4F80A 2HT3D 1JF1A 1T7ZA 2NY7L 4HIHA 5JW5B 1ZGLA 1JI2A 1Y18B 2VB5A 1KIQA 4LLDB 3MV8A 1IC7H 2P5ED 2XKNA 1ADQA 2C1PB 4LIQE 1IAII 4XNXL 2QQNH 4DKFL 4MLSA 1HQ4A 1XGPA 4HBCH 1TQCC 5DD5L 2NY1C 1PY4A 2DM2A 4XNUL 1M4KA 1NGZA 2OXHA 3BKJH 2VDKH 3PDOB 4ERSL 4YBHA 5EO1B 2QQLH 4OFVA 5HPMB 4X4ME 3O3BA 2GUOA 5CJXC 2F74B 2ITCA 4OF7A 1MF2H 2XYCA 5DR5L 5E2VH 3HA0A 5IVZB 1A9EA 4JN2A 1V8HA 3JTTA 5AZEH 3RPIB 5M7QA 2D31B 3QHFL 4PV9B 1PAMA 1PZ5B 2EE9A 5I1CH 4XCEB 4Y5VC 3GSWA 3VRJA 4NN7B 4D0BA 1WZKA 3FOMA 3KYAA 5E2UL 3EOTL 3CFKA 3MRJB 3UBXA 3BP4A 1GGYA 3ZYZA 3RWJB 4NM8L 3N85L 1P4BL 1Q94B 2R0LL 5GZOD 3TO4A 5I1JL 2JKXA 3BHBB 3QUXB 2KDGA 2WV3A 4HAFA 2HTKC 3VGEA 1MHEB 3I6KA 1T1XB 4XBEL 3O3AB 1HSBA 4XVSL 1K8IB 3O6FB 5CHNB 5HXMA 1T1ZA 5GRYA 4WHYH 3SEPA 5I73B 2ED7A 1AQKL 4YDJA 1JGVH 5GS1C 5GZND 5IK3B 2UZIH 1RURL 1RUMH 2E5EA 3E0GA 1CL7L 1J5OL 2J6EH 1NH6A 4MJIA 4KGJA 3HC4L 1NAMH 3BKML 4M03A 3EUUA 3U36A 5GGTL 5EBGA 1DL7L 1SJHA 2HJKB 4CU6A 3IAGC 5KS9B 1NMAL 4NC2B 3OR6B 2R2HA 2VLKE 4GRWB 1HHJB 3HZKB 2XN9A 1J9CT 5JR1H 1RK1B 4J6RH 4QXGL 3NABL 3GI8H 4NGHH 4OUOA 3VXPA 3CAFA 1EXUB 2CDFB 3MRIA 4HPYL 4OAWA 5IEKB 5JW4Q 2Q3ZA 2W0KA 1VCAA 3OKEB 2FJFB 3B5GA 4U1NA 2FR4A 2DB8A 1Z2KA 3O2WH 2R1YB 1CGUA 1SJEB 4KPHL 4LLVA 3DRQA 2VUYA 4S2SA 3QWQB 3O11B 3C08L 3ARFA 4HULB 3DUSB 3JTSA 2V5TA 3U7YH 1OSZA 2GEEA 3QEQE 2Z9TA 4MNQD 1IGIL 4GBXD 1LDPL 2Q6WB 2V9TA 4ZTPL 1JBJA 4XC1H 4JKPL 3HPJA 1F4WL 4ODWB 1N4XH 4UIMA 3DTXB 2J8UB 1YMHA 4OKVA 1A7RH 3RZWA 4JM2D 4MHHI 3NCMA 2BSSB 4ZAKC 4KRNA 2P7TB 4KKAC 4MQ7A 2FGZA 2VZ3A 1UB5B 4M5ZL 1SVCP 1AGDA 3B5TA 4U3XA 5FXCH 1I9JL 3GMPB 3TYFA 3QUYB 4LLUB 3HR5A 5K59F 3LEVH 3MJ9H 4U1JB 1WIUA 4PJXF 3V95A 2Z91B 1CDHA 1IAMA 3PWJA 1AD9A 3VDAA 3CNKA 4U31A 3UAJC 4ZOCA 3NCEB 4YHZL 1VHPA 7FABH 5K9JH 3G6DH 4XNQA 2GJ6E 5DFTA 4KC3B 3CLEL 5HBBA 1YEKH 4NUJB 1KN2H 1OOAA 2YMXL 2O5YH 3EYOB 1KEMH 1RVFH 5BW7A 4Q9RH 4KKCD 1NFDB 4QGTA 4HSQA 1XCTA 2WLZA 3M45A 4NFBA 5DK0A 1TIUA 2DLFH 1FPTL 3QQNA 2VQUA 4BUHA 3C6LD 5JOPE 4YHLL 1SEQH 4NQDD 2DF3A 3O45A 3F7VB 4M6AA 1XR9A 1RJCA 1KPRA 1BQHA 2Q76A 1NCCH 1ZEAL 5T1LA 1C5BL 1S3KL 4C4KO 5E1AA 3HB3D 4Z77A 4FN0A 1BF2A 1ND0B 4WTXA 4LBEB 1KJ3H 3EOAB 2BOCA 3ZKNC 4TVSa 4GRLA 2DYPB 3BFOA 4N8VB 5LWYH 5DRXB 4F7MA 3FB5A 2R23B 2B1HL 2ARWA 4WNQB 4WIQA 1T5XB 2JELH 3IS1X 3PWLA 4IS6A 4XP5L 1T0NB 4HJ0D 1UGNA 4NWTH 3KPNA 5ELIA 2SEBB 4IIQB 1EMTH 3KPMB 5I16A 5FGCB 1LEKA 3D39E 1MI5A 2R29L 2OTPA 2DQEL 3GSNH 1JZ2A 1RZJL 2AXGB 2F53A 1WEJH 2GFBA 3IJHB 4WY7L 1SYSB 4ESKA 3C5ZD 4HKXA 3VXOA 5SWZE 1BOGA 4OQTA 3KYNB 1RQ5A 5J1AB 2XQYK 1IZJA 2VZ1A 2O5ZH 3CSYA 3OB0K 4PRHE 3BPLC 4PLJC 1P2CA 3H42L 4FG6C 2FNBA 3FAXA 2GSGB 3LOWA 3PGDB 4JPWL 4PPTA 1KXVC 1HEZB 3FT4A 5E5UB 1ACYH 4N68A 4G7VH 1FRGL 5HVHB 4F58H 1FZJB 1EO5A 1Q9WA 2WBJB 2XFXA 4P5TC 2A74A 3VCLB 1FNLA 5AG9A 4JRXB 4M7KL 3TP4A 1MEXL 1TZHA 2ZCKH 4CKVX 2HTLC 3JWOL 3QUZD 3MXVL 4J1UA 3NFNA 2GT9B