2HLFD

Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD01
3BW9B 3HFMH 4U3HA 5HGBA 5I76A 1VCAA 1VACA 4K2UL 4U1GB 4F2MB 1IQWH 3O2DL 3QFDA 3T0ED 5EU4A 4JPVH 4AG4L 1YN7B 4BQCA 2NX5A 1MCIA 1DQDL 4F9LA 3RAJL 1ZANL 4PIRF 4UUJB 5FXCH 5DJ0A 2BY0A 1T04A 4J4PD 3OKNB 1R3KB 4ZUSB 2BXZA 1X5ZA 4Z7OF 1VESA 3CJJA 3PV7A 3K4ZA 3QDHA 5D2NE 1IQWL 5CKAA 5D9SA 5KSVA 3HAEB 3Q5YA 3VXPA 4N8VG 5HHOD 1CDCA 3RGVB 5J9PA 1FCGA 4R7NA 4XHQA 1UM4H 3T8XA 4P2RE 2WWKT 2VLJA 4YDLB 3VGFA 2ORBH 3TT3L 2X4SA 4M61B 4O51B 5D1ZD 2IAMC 1TNMA 5FGBC 32C2B 4XC3H 4YHKL 2YUXA 1PDKA 3QHFL 5J3HC 4CVWA 1FYTA 3QO0A 3MRGB 4KRNA 4YLQT 4LCUA 2OJZH 2DD8H 5DJCB 4KI5C 6FABL 1GGTA 4HIIA 4IS6A 4D8PB 2BDNL 1CZ8H 1U41A 3O3UN 4M8VA 2XACC 3KYOB 3OKNA 2YKLL 3CDCA 4LKXB 4LOUC 4OZFG 2Y25A 4CUCA 3SE3A 3GI8L 5AYUH 2ED9A 4HPOL 1RU9L 1GAFH 3NFNB 1U42A 2QSCL 4H8WC 2ESVE 4ONGH 5MI0B 1YNLH 5J12C 4S1QL 4AT6B 2VKXA 1JYNA 1CGYA 3MLWL 5ISZD 5SX5H 1G1YA 1PJ9A 2CKBH 4XBPA 1BVKB 4DWHA 3PWPA 4PRID 5E1AA 4HS3B 4ZTOL 2WINA 2PN5A 1FN4A 5DRWA 1X5HA 4ETYA 5F8RC 2ADJA 3TBVB 2ICCA 3PGDA 3RFZC 3DGGB 1PX3A 3BUYA 2FECL 2YWYA 3HUJA 4R8WH 5FB8B 2BHYA 2VMFA 1DDHB 2WBJC 2VR5A 1FO0H 4JM2F 5I1AA 3FCTA 4ELMB 4M48H 3HLAB 5EIQA 5CZKA 1I1FB 4NO2B 1NJ9B 1F4HA 4Y7MA 4IRJD 1H8OA 4CGTA 5IWLC 4QYOB 4GBXD 3VMOA 2DWDB 3AVEA 3S34H 1KJ2B 5DJ6B 5L2KD 2NY5L 3SDCD 4NKMB 3LDBB 3QWQB 2ZSWA 3FQXA 5DRNB 2RGSA 3VFVB 4WW2A 2CUMA 3PQYE 3I6LD 5C09A 4KZDL 2O61A 3SE4A 3FONA 3FT3B 2VLME 2OZ4H 1F6AB 1U8JA 4KRPD 5DA4A 1S5IH 1MH5A 3S4SB 1EHAA 2NW3A 4M6NH 2F8XC 4OCWH 3BP6A 3GMLA 3K8KA 5ADPH 3QULB 1WQVT 1HXYA 3CVHH 1FDLL 4LF3A 2WQ8A 3TIEA 1AR1D 2P42B 3BN3B 5B8CA 1HYSC 3RUGE 4LLQB 3K3QA 1AGEA 3ARFD 4UNTA 3HR5A 5J6HA 1BQHG 4G9FB 1FGVL 5KSBF 1E6JH 4LGPB 1JHTB 3JXAA 4N1EA 4NM4H 2X1QA 4WW2F 3MUGB 2FO4A 3WXWH 4YFEA 4Y1AD 4HCRH 2OMBA 2YD9A 5AUMB 3ROLA 5J1SC 2GY7B 4JDVB 3BYYA 4F7EA 4CVZB 3FT3A 1H5BA 4Y1AE 2YMXL 3VG9C 4FABL 3MV9A 2V7HA 1KC5H 3BH8A 3DIFB 2NR6D 4NC1C 4EIZC 1W72L 1AGCA 3MRMA 4ZFOB 3I2CH 2CRIA 3GMPA 4C56B 4PG2C 5D4QA 2A77H 1U9KA 5DQ9A 1JPGB 1KJMA 5FUCE 2IBZX 1TJIH 3HRPA 3LEXB 5E2WH 3KYNA 4JZJB 1OGTA 4FTVA 3BVNB 2IAMB 3O41B 2VDLL 1GZQA 3WNKA 2FX9H 3DTXA 1P7HL 1L7IL 2DM2A 1UKSA 3MTRA 4OGAD 4UOW0 1HOCA 1ZS8A 3ORJA 3T0BA 1J1OL 1LEKA 3SDDB 4FQJH 5BCAA 2VDNL 4Y2DC 4NZUL 3HE6A 2VLRB 1BQSA 2AEWA 4P4KD 1QSFE 4MNQE 4PJHE 4LHUA 2FDBP 3LKQA 4UOW1 1GPOH 4Y8AA 5IF0B 5IVOA 3EJZD 5T3ZL 3T2PA 5LQBH 1U91B 3UTSE 3QNXA 5CP7B 4MYWB 4E41D 1MQKH 4KRMB 1IJ9A 4RDQG 3IU4H 3CFCL 1T1XB 1HNGA 3ARGC 4HZLB 3FT4A 2DI9A 4WV1A 2R2HA 3MO1A 4AEIL 3KWWA 3C8KA 2GJ6D 2VDMH 1YC8A 4NHUB 3LQAL 4S2SB 3G04A 3KS0J 4HWEL 3V0AC 3THML 4QHUB 4I0PD 2Q6WB 4BQBA 4XNXH 3ZDZF 1DBJL 1PW3A 4PJ8B 4LLVB 3GEWB 4K3DL 5F7EH 3DX9B 1I1AD 1D6VL 4PJFF 1MFEL 4PP2A 1FCCA 3BFOA 3ZDXE 5C0IA 5IIEA 4X7DC 1FFPB 2C1OA 4P48A 1IM9D 1MCHA 4JB9L 2ITDB 4JQVA 3OPZL 1HSBB 3NZ8B 4JVWA 3SKMA 1CU4L 2DQUH 1KIPB 1YJDL 3KYNB 3DX8B 4HUMB 4N9GA 1PKQE 3TH2T 1NCDL 5DUMH 3STZB 1AI1L 4EOWL 5T1DH 5D6DC 4LSUL 4KRPC 4M62L 5DJ0B 1KSRA 3SE9H 1HHIA 4RMRA 4KDWA 1JF5A 4B7IA 5HVWA 4ZUSA 4ZXBC 5BRZE 1MEXL 3FTGA 5KBNC 4FFZH 1FGNH 1S7XB 3QEQD 4JRYD 4J1UB 4WTZG 1N5YH 4PJ8D 1KN4H 4R26L 1XZ0B 5TE7H 5DD6A 3EO9L 3MV9D 1VGKA 2Z4QB 1D5MA 4CNIA 4P9HC 3CVIH 5HGHB 1O7SA 3NIDF 4PJ9D 3HRZA 4X4MA 5JORA 3IFLH 3ULUD 1I85C 5IVXF 2AJSH 4G8IB 5E8PB 3AY4A 5LGJB 2K7PA 2HKFH 1YA5A 3JUYA 1UT9A 2ARJB 2MPAH 1I7ZB 3C60C 4OZGA 1NCCH 1JIBA 2G5RA 4RWYL 5KAQG 3SE8H 4TVPD 3PE9A 5I17B 5TDPA 4PP2B 3GMRB 4E9LA 4ONOA 4ALAL 2O5XH 3QIBC 2HT4D 4P5KB 4I2XE 3BD5A 3KG5A 1UYWH 1CD9B 1NKRA 2WK2A 5DMKA 2IPUK 5EU6A 4OFIA 1OB1A 3TO4D 2FB4H 3GZKA 3HE6D 4KMTH 3NABL 4DVBB 4RGMB 4OTXL 1UJTA 4S1DD 4HUVA 1TZIA 2EZ0C 1KYOJ 3CLEL 3LVEA 4NRYA 1QBLL 4DUVA 1HINL 5DJ8A 3SJVB 4Y2DD 4HF5L 3VFGL 1PSKH 3KXFD 4Y4KC 2BVEA 1TVHA 5IB2A 5E6ZA 3L7FB 5CD5C 3WN5C 3VI3E 4GMSL 3N1QC 2ZUQC 4XNMB 1IT9H 3HS0B 1BFVH 4P3CL 4YC2B 1JN6B 3MCLH 2AABL 3IKCB 3D85B 3PQYA 1ZLSL 3SDDC 3VGAB 4AEFA 4KK8D 4PD4K 5JDJA 1IFHH 2Q76B 3F62A 4YUEH 1YUHA 4OM0H 3T3ME 2VLLB 2V7NB 4PJ7B 1VEMA 2H26B 1M71B 4JZJC 2VQ1A 4PJCE 3C6LA 1K4DB 1AHWA 4HF5H 2C7UB 4IRSB 3SGJA 1ZGLM 3VXSD 4YJZL 5C07A 5HYJB 5J11B 2NX5B 4GAFB 4FQ2H 5FYJL 4UNVA 1S8DA 1CT8A 4JFFD 4PJBA 3DRTB 3MXVH 4TRPH 5E8DH 1A9EB 4HUKB 4LEOA 5TGBA 4YPJA 4YX2H 1WTGT 1DBJH 4OLZH 1G7IA 3RVTD 1GHFL 5IVNA 1C16A 3QEQA 4QRRB 1UWGL 1WICA 4XP6L 1S9VB 2CH8A 4GXVH 3GMQA 1OGAB 4PJ9A 4XT1C 1M05B 4MQXC 5IROA 5KTEH 3O3DA 1PG7W 4CN4A 4JGMA 3K80A 4AG4H 2LV4A 5JQ6H 5ACZB 1U8IA 1ZT4B 3B9KA 2GTZA 4YFLF 2EO9A 3CH8A 1NANI 5ITFB 5HYIA 2RAMA 1JGUL 1FORL 2FYYA 1CICC 4G8GA 2YC1B 5I71B 1P1ZA 5DURD 1OT2A 2CIIA 3TBYB 1KPVA 3FN0H 4H25B 4XZUB 3T2NL 4L3AA 2DQEL 4KMQA 1IGTA 3QDMB 2VQUA 5TJWK 4MJIE 1QFUH 2ZOKB 1X6NA 1PLGL 1KEGL 2BXYA 2JCCA 2AK1L 3H3PL 5KS9E 2LABA 1S7XA 1D5ZB 2NXZD 3P11L 4UUJA 4LGRB 4MJ5B 2EH8H 5IESL 3E6FB 3EJYD 1P9MC 3L3KA 4HIJB 3MACH 5EU6E 4HLZH 3ZL4L 5HYJA 1WIOA 2QTEA 1K8IA 2EXWC 3ZKND 1NEZG 3VFUB 1JFQH 3DROB 4X7SH 4PJIA 1FYTE 1LDPL 3LKRA 3GSQA 4BK4A 4JG0L 1L9NA 1WWAX 1C7TA 1HHGB 3QQ9D 5GGVH 1QRND 3P0VH 4JM2C 1FNAA 1N8ZA 2CLRA 4JPKH 2QR0B 4JKMA 3WKMH 1FG2B 5D1XA 2V9TA 3RL2A 3PGDB 4WFGD 1AJ7L 4WO4B 5IT2L 3TYGL 1U92A 3T2OA 3CSBA 3PQYD 4IM8A 1W0YT 2I07A 3K2MC 1MFBL 4ONFL 1FVDB 5J1AB 4XTRC 4DAGL 1U93A 1CXIA 3HZMA 4EUPG 2H8PB 5IBTL 4M7ZC 1YC7A 1MREL 4JFDE 4PJDB 2R2HB 4M4PA 1CDIA 5GSRA 4GRWB 1RMFL 4KK8C 4XAWL 3NTCH 4YHNA 3QJFA 4Q6YA 2UYLB 1W0WB 4N0CD 4ZOEA 2H8PA 5BMFH 4P23B 3UJTL 1KTDA 2D7MA 1G6RH 2BNRD 4DOHB 1S78D 4X4YB 5DYOA 4XP4H 2VC2H 4H1LA 3PGFL 1TJHH 1IRAY 4PJBF 5I1IH 5BXFA 1KIPA 3MV8B 3TJEH 3ZZ1A 5TE6H 3RDTD 1II4E 4FA8A 3GGWA 3P4MA 1JGLH 4P3DB 1MJUH 5JDSA 5HDOA 2W9LA 1FSKC 5IV2A 3WN5B 3GSNB 1OM3L 5D71H 4YQXL 3CCHB 1BEYL 3E6HA 3L7EA 2FD6H 4JJHA 3ZE0F 1G84A 7FABL 2LU7A 3OXRB 4Z78B 3F7YB 1FBIL 1HILA 1W2KT 4GSDH 1RURH 4WIQA 3ECBB 2ZG1A 1LE9A 3JZ7A 2UZIL 1SYSA 1IAIH 4HS6A 1OP5K 3U6RB 4JN2B 1Z3GH 4Y16B 4G42A 4C56D 2EECA 5FOBB 1TJGL 3F7YA 3MLWH 4AEHH 4C57C 5I1AB 3U1SL 3Q6FA 4UTBH 3KPOA 4MJ2A 3AS2A 2NY2C 2X4TB 5GGTH 1KJ2L 3OB8A 4MNQB 3QUZD 3ZE1F 5HHOE 5HYJE 2GI7A 4MCZB 4YEFA 5DURB 4E41E 1RIHL 4QF1B 1QRNA 4GLRI 4F3FB 4PJCB 4N90E 4PP1C 3MROA 1XGRA 3OX8B 4YPGA 3X14A 5IQ7H 3F7PC 5IBLD 1KYOK 4DKEL 4JFOB 3IJSA 2XZQL 3K7UA 4JDTL 4PRHD 3MBXL 3BGFB 5BV7B 1XH3A 3WJLC 5C6TL 1S3KL 4U6YA 2MMXA 5D7SH 4ZSOE 5I75C 4D0BB 5HD8D 4CVXA 4O02L 1DN2A 3E2HC 4C83A 3HCVB 5JPNB 2LAAA 5SWSB 1FVEB 1JWSB 2P49B 3JV4B 3ZYJA 1M7IA 4FTVE 4XAWH 4NT6A 4RMWA 5DXWA 4LSRL 3RA7H 2R2EA 4L29A 3S3SA 5SWZB 4IRSC 4J12A 5F7DA 1JHLH 2BOCB 4YDJA 5FYLE 4XP9H 5ADOH 4GAGH 4D0DB 5IR1A 3UTOA 3RNQB 1OP3H 3VJ6B 1LO2H 5DMYA 2YRPA 1CFSB 3T77B 4KH2A 4YDIL 3JSSA 2DQFB 1NCCL 3B2UD 3I3DA 4G8EB 5CHNB 3SGKA 3RDTA 3QT2A 3UC0L 5I1LB 5FDWB 5E2UL 3D3VB 1SEQL 2DQIH 4DFHA 5B39B 4RMQA 1R3IL 3QAZB 1FYHB 5BVJB 4CMHC 5INDB 5EBWA 4LP4A 1EGJA 3O9WD 2R8SH 1E28A 4AEIH 4DAGH 1FNHA 4PJAB 2YPLB 4YDVA 4XCNA 5GJTH 3CDYA 4Y4HA 3CFEA 4IHOB 5ICXB 1R3IH 3TBWA 1EO5A 1NGYB 5F9OL 2CK0L 3P3YA 4NHCL 1U58B 4LLYB 3LEYL 4Z7NF 5B38B 1PLGH 3G5ZB 3LKQB 2ERJB 1S9WB 3OKDB 5C0EA 1OLLA 4IHOA 5A3ID 4RBPK 1I9RH 3SCMC 3DMMD 3NFSH 6FABH 3B5HA 2EDKA 3FN0L 3T2NH 1BECA 2JF1A 4FQCH 2CGRH 4FQQA 3FFCE 4I3RL 2YC1A 4XAKD 2N7BA 4RGND 4EDXA 1PEZA 2QBWA 4WW1B 3WIIL 1MNUH 4YGVA 5EBMA 4NOFA 1I8LC 3TO2B 1MCKA 2E7CA 5I1KH 2EH8L 5IESH 1NGXB 1D6EB 2VABA 5KVGH 4HHAB 4G8IA 4EI5C 3B6SB 4KDTC 1A6WH 4UTAH 1JV5B 3C8KB 3ISWA 5K33A 5FDYA 4XCFL 1CN4A 3LN5A 2EE3A 1PFCA 5B38A 3BN9D 3GI9H 3Q6GL 5EOCJ 5H94A 4IOIB 5D93C 2W9DL 5FM5M 4UQ3B 2A1WL 2X1PA 3HNSL 5JA8B 5D1ZB 1A14H 1QHPA 1T1WA 1XF5A 2PYFB 1I8IA 2NMSA 1NGQH 4WEBH 3ARFB 4ZNCD 3STLB 2NPLX 2A9NL 3MUJA 1KB9J 5AZEL 3IAPA 3WS3A 2O5ZH 5LJYH 4G80A 4NZDA 1FLTX 5D6CA 4AL8L 4WO4A 3C6SB 2QQLL 4HHAA 3GBNL 3UTSB 5T33L 1A5FH 2VZ3A 3IGAA 1QSFB 3NZHL 1NCWL 3ARBC 5HDBF 2AI0H 4E5XA 1KCLA 3HPJB 1MI5A 3MRBA 1HI6A 3HAEH 5HY9B 3HC0B 4J3VA 4OFPA 1NLBL 4KGLA 3ESVF 1A7QL 3CDGA 4D9LH 5HVGB 4EKXA 1WFUA 1AO7A 5C8JA 3VRLF 4X7TA 1JWMA 1KB5L 4K7FA 4XNQA 1QQDB 4OAWB 1JJUA 3RVWC 3AREB 5AEAA 3UJJL 4OD1H 3PWNB 5C0JA 4XVSL 5IVZA 4YXHH 4IMKA 1M6OB 2I5YL 1FJ1B 1ZA6B 4HGWB 1EX0A 1CGWA 2D31B 5DK3A 3MMEB 5C0AB 3VXNB 5D96C 1XR9A 5K9OB 2ENSA 4XI5C 5KVEH 5C09E 5JW5A 2WP3T 3OAUH 1TZGH 1TLKA 3H8NA 1ODAA 4JHWH 4RFOL 2CRYA 3V52H 4LCCC 2NY1B 4LRIC 3ULVL 2IBGA 1NBVH 2H2PC 3ZE2E 3O2WH 2F53A 4X9IA 3MPCA 5DT1L 3KDMA 4X0KB 3V4PL 4QXTB 3CFBB 4HAGA 1ERNA 4HUWA 5FA3B 2F5BH 1ZMYA 3G5VA 5FHAL 3ILQD 1M6OA 3RUGB 2JELL 3EIFA 1UH3A 3DX6B 2CGRL 2O5XL 5E95B 1DBAH 2Z92B 2R4RL 3P9LA 4L8CB 4PV8B 1XGUB 1S7SA 1U3HD 2IPKA 3DRQB 4PJ5B 5EIIA 3RWDB 3IS0X 2G5BB 4RIRA 3NCYS 3UBXI 5DSCB 5JXAL 4KI5F 4G6ML 1E4JA 3VRIA 3NCYP 5F93C 1NGWA 2VLLA 1H0DB 3X13A 1S7UA 3S3JA 3DHMA 4LEXH 2FJGA 5MP6L 5HGBB 1M7DA 5IOPA 1I3GH 1SJVA 1X5GA 1XF2A 5DUBB 4RX4A 1CFTA 4WO4D 1CLZH 2W07A 4CJ1A 3GBML 4PJCF 4H5SB 5C08E 2PW1B 4YZFE 3SBWA 3RWGB 5MHSD 3MJ8B 4DOHE 2B0SL 2J1KA 3ULUC 4PGZA 4M93B 1KT2B 5IOPB 1HQRA 4XNYH 4ZYKA 3IJHA 2CMRH 1NC2A 1YNTA 3P11H 4IIQA 4TQEH 3DO7A 3WKNA 4HFUL 1KJ3L 4OIIL 5JORB 4PPTA 1PVHA 2XZAL 3E0GA 4OV5B 5J3HD 4OLXL 4RQQA 4RBPH 1BIIB 1AIFA 4MJ5A 4PJDE 3QCTL 4AQ1B 2DDQL 3MX0A 4X80L 5EWIH 4F80A 3OQ3B 3W9EB 4F58L 2ZCKL 2ERJC 4U7KA 3H9HA 4MZ2A 3RJDA 2DIBA 4V1DE 1CTOA 5DGRA 1AD0B 5GISL 5DA0B 3UBXA 3QZWG 3CXHJ 5E08L 2GHWB 1FP5A 3FOLB 1CGSL 4JO2H 1VFAB 4U4BA 3CXDL 3L3JB 5EOQH 4QXUH 1HCVA 3LS4L 3OJMB 1A1MA 2L7UA 4Z7OE 1PAMA 5JXEC 4OCXH 2HTLD 1MUJB 4P3DA 4QHKI 4KK5D 5TFSL 2F54D 1YEEH 1KELH 5DD1H 5L0QB 1XGYL 1TCRB 3OF6D 3QNYA 4NKDB 2I60H 3T09A 4Y88A 5FUCC 3QCUL 2IWGA 4M8QB 2JJVA 1LK2B 4ELMF 2YPVH 4XPBH 1QVOA 5DD5L 4M6AA 4RZCA 5GS1A 4WUUA 1HXMB 5KSVB 1MCJA 5F1NB 1FIEA 3IDIB 5E03A 4BUGA 3STBA 1J18A 5SX5K 5C0EB 4MD5B 5IFJB 3VFTB 4N90D 4OV6F 3MGTA 4Z7WF 4L9LC 1PEWA 4NNYA 4AMKH 3BW9A 3NMEA 4PJDF 4Z78A 4WI3A 2Y5TA 1WAAF 4WV1C 2VRAA 2A1WH 2WWMD 2XFXA 1A4JB 3HNSH 3SDAD 4GMSH 4KKAD 5EU5B 4HWUA 1XGQB 4X4XA 4GSDL 2ATPA 1Z9LA 4FXKA 4D0CB 3R06B 2XY2A 3QIWC 1RZGA 3CUPB 3VFGH 4Y89A 4EN3B 5KZCD 4JKPH 3AS0A 2V5RA 2JJTA 2UZXB 5DJZB 3Q5TA 4X8XA 1JE6A 4JQVC 1Y6NR 4NYLA 2BY2A 4I18C 1JPST 1R24B 2NY0C 5C08A 3TNMB 5IB5B 3ULVF 1JK8A 3FO1A 3TIDB 5H37G 4NWTL 4TUOB 5DSCA 1Z5LA 4QOKA 2V7HB 1EEQA 3NCJH 3OR6A 3OKEA 2QQQA 2EIZA 4I0PC 4P2QA 3L3HB 3BN9C 1JK8B 2D7TL 3W9DA 3GMMB 1KTLA 3HZVB 4ENED 3IETB 3VFMA 1DLHA 4EDWL 4LSQL 4TUOA 3VCLB 4CVXB 2HYMA 1NSNH 2UUDH 4YHZH 3VXMB 2FHCA 3MFGB 2AK4A 1JBJA 2VLMD 1UJ3C 3HE6B 1CFBA 1I75A 4RFOH 3MLXL 3QXVA 5GZND 3O41A 4EBQH 5HXMA 3PXHA 4G8EA 5C3TA 4WY7H 5B8CB 4ONGL 3RX7A 4ZPVB 3PP4H 5HI5D 4Z5RA 4JAMB 4ZFGH 5HHMD 1ROWA 3QDGD 1NMAL 1YMMB 3CC5B 5C2BH 1ZHLB 1OCWH 5DEGB 2ADFH 3DUUA 3MRKA 3O3AB 1RZGB 4XPFL 1QLRA 4WI5A 2BDNH 1KB5A 4PJIB 1ZTXH 3DLQR 1E0OB 1W72A 3T4AA 1MNUL 4S1QH 3H9YA 4LCYB 5T1DL 4NRZB 3OBAA 2GCYB 4HGWA 1QNZL 3SDXE 1FFNB 1UZ8B 4ODVH 4BYHA 1RJZA 1U8NA 3OSKA 5IG7B 4F15B 1XMWA 3ZO0A 4KXZI 5EZLA 4OCMC 1KF9B 2GITA 5HHNB 5EU4B 3OPZH 1MFDH 1FRGL 1T83C 2LU3A 3SQBA 1T6VN 5CEXA 1T89A 1OTTD 4NKIL 4PRDA 1B4JH 3OKOB 5LGHH 5JPMB 4C59B 2FWOA 1UKQA 2BK8A 1FV1A 3BO8B 5DK2B 1T4KA 3G6JB 3PWUA 3GKWH 5CHNA 4Q9RH 1MVUB 4YHLH 3M17A 1KPUA 1DVFC 1OWWA 1MCCA 4M43H 4P4RB 4BSVB 2RR3A 1PQZA 3C8HA 3SKMB 1WCBB 1KCVH 1HDMB 5E9DD 1IBGL 2DRUA 3LRSB 4UV4H 3EGSB 2EDBA 3PIQA 2NY2B 1ZLWK 4Y5VC 3AREC 5L6YH 2NW3B 5EBLA 4U6HA 2DM4A 2VDPH 3B9DA 3QXAA 1QSFD 2W1NA 1MCFA 3X17A 4OZHA 1KCSL 1RUMH 5F3HA 5JO5A 3HI5L 5E2TL 4NO2A 1CIUA 2NY7H 4YHKH 4KAQL 3TM6A 3INUL 5HVHC 4P57A 1KLUA 1S5HB 2YBRB 3M8OL 3NN8A 4P2QD 3O9WB 3KXFB 3L5HA 1S78C 3PABB 5C0CA 5TQ2L 1KXTB 3W11D 2A9MH 4KHTL 1LNUA 2PTVA 2YD5A 5L2KA 4PJEB 1YPZF 3D3VA 4FHBD 2NY2D 3MNWB 5IROC 2DF3A 2VSCA 5ESAA 4J8RB 1DQJA 4Q9BA 5C0CB 2VH5L 4L5FL 4TPRL 3WS3B 1P4BL 3TA3B 5SWQA 2VDPL 3T0WA 1W8NA 1IFHL 1AQDB 4JFEB 4Z7NE 4MXWL 3ARUA 5HGHA 4P57B 2E9BA 2DMBA 1LO3H 4PBXA 2MQCA 5IJKA 1F4YL 3VI4E 3LV3B 1FLRL 4UU9A 4LKCB 4OF5A 2BVUA 1WBZA 3RNKB 5I1IL 4PJHB 1DFBL 3FTGB 5CINH 3BAEL 3ARFA 1EMTL 4KKCD 3K8LA 4YUEL 3QCVL 3WFEL 15C8H 5J4MA 2Y36L 4JFPA 3ALWA 1J88A 1OSPH 4MJ6B 4HIHB 3S4SG 5BZDB 2R1YA 3QXDA 3MLRH 2NY5C 4F9PC 4NCC2 1IKFL 5K59F 5KSAB 2MCG1 3WFDH 4FQPA 4KK9C 3MLPA 3L5WB 3MLTB 5FM4A 1KIQA 1VERA 2BERA 2LQRA 1D5XA 2ATKA 2HKHL 3OGCB 1CLZL 3FJTA 5IMOA 3UTPD 4GW4B 5D7JD 5FK9B 1LD9B 4JKWA 3P30H 3MLXH 4WI2A 5EDXA 4LGSB 1MF2H 4UI2A 2E8ZA 4X98A 5EORH 3V4UL 4EI6A 1J05A 2EDRA 2IPUG 4OZIB 2P5WB 2PTTB 3KPOB 2BOCA 4HG4K 2QADB 4MJ6A 1HH6A 4OD1L 2H3NB 1U3ZA 4R90L 4YHMH 2MTPA 5DMJB 5IM7B 2HJLA 2DWEB 4Z77B 4OF8A 2WMPA 1FL3B 1XGPA 5DWUL 2ARWA 2P7TA 1VFBA 5FUZH 5GGUA 2VXUL 1RV6X 1OAQL 1BQUA 1YMHB 2AQ3A 1R0AH 2A6DB 4KK6C 5DEZA 5BMFL 5IM7A 1LO4H 4KQ4H 2A73B 2FATL 3DHJA 4GRLC 3O8XB 1NQBA 4IRZH 4OAWA 1YEHH 3DJ9A 1OAZH 3DBXB 1OTSD 1JNNL 2OI9C 3E8UH 1N7MH 4UAOB 1CE6B 4WGWB 3IF1B 2B1AH 5HGDB 4MMXC 1TZGL 1RZ7H 3U7YH 1IC4H 2P8MA 2WLZA 2ZUYA 4OZFB 1H3PH 1MI5B 2EEBA 3JBG7 2QADD 3BVNA 2A38A 4LVOC 4LQ1A 4P4KC 3C87A 4QHNB 4BJLA 3LMJL 1SY6A 4NNXB 4HKXB 2HVJB 3PQYB 1AXTH 4XHJC 4D3CH 1CG9B 2IANE 1KLGB 1OF2A 4KQ3H 3T3PF 4OD2B 4F37F 3GUTB 3SKJH 3V95A 3P0YH 4K3HA 4MNHA 2DAVA 4U1KA 3QXUA 5C0DB 3P0VL 4XXDA 1RURL 4HKJA 3VXSE 1CT8B 4KJPD 3JWOC 4WU5A 3SE4C 1BJ1J 1EUTA 4FFVD 4ELME 5FECA 2VL4A 1U91A 2ORBL 2QEJA 5FF6A 4H1LG 2DWEA 5JOPD 1GIGH 3T3MF 4K3JL 5DJYB 3BOVA 4TOYH 2XV6B 1T0NB 4QRSA 3EDDA 3KPRD 3DOSA 4PY7B 2GQHA 4WI8A 5DMIL 2EH7L 5FYJH 3S97C 2ZNXA 4MD0B 5DO2D 3CC5A 2XZCH 3L3IB 4K23L 1UYWL 2F8VA 1FNSH 2GTZB 2Y06H 4IOFC 4Z6AT 1GGYA 2C26A 5GGRB 3VXOB 3K0WA 2WUCH 4HQQL 5JHLL 5C0IB 1G0XA 4UBDD 2WINB 1DQDH 5C70A 1QKZH 1FO0A 1CI5A 4OZGB 4JKLA 5HGDA 1A1MB 4NHCH 1FHGA 3D69A 2W65B 3L7FA 4XNZC 1RIUH 1R3KA 2C1PA 2Y07H 3BZ4A 3OWEA 4WNQA 2A74A 1D3CA 4ELKB 1E4KA 4HMDA 3I6GB 4P3CH 2NZIA 5BV7L 4OGYL 4K3JH 5GRUL 4QXWA 5EZIL 5IW6B 3PF2A 1EV2E 4MD5A 3VW3L 4ZFOL 3E6FA 2ICWI 3QFDB 2ZPKL 3V5KA 2XTJD 1OL0A 1FNSL 3WNNA 2NY4C 1FZKA 4KFZC 4R4BB 5F6HI 2XZCL 5DMGD 2Y6SC 3ARDC 3FB8A 2DBLH 4MQTB 1URLA 1EAJA 3AM8C 4ZOBA 3X3FL 2LAGB 3C60D 2YZ1A 4PRAB 1GGUA 1FQ9C 3DXAD 3N1GC 4G6AC 4I4WA 5LAXA 3HZKA 4NRXB 3MLSL 3O3EA 2MKWA 5T3ZE 5CFHA 5H8DA 5D2NA 1KGCE 3AB0B 4TTGA 4Y2DA 3L3OB 3GK8L 4ZFZB 1UA6L 4ACPA 1OWRM 1QNZH 4NJAH 2VIRA 1IC4L 4GG8B 1K6QL 3DURA 5J6GB 3MODL 3QULA 2L0DA 4K9EC 1XF1A 5DI8A 1VFAA 1I8KA 1QR1A 5C0AD 5IEHA 1AD9A 4X4ZA 3VFUA 1QRNE 5DYOB 5HHXH 5ERWB 3ARGA 4IRSD 2ITCA 4PUBL 4M6NL 2EDTA 5EUOB 4NGHL 2QV2A 4ZUTA 3UBXB 3LQMA 4I48A 3B9VA 4KKBD 4PRIB 5DJ2B 1T80A 1Z9SA 5FYKE 2VO5A 1BM3L 2AQ2A 4QYOA 1MAKA 3N85L 4WUUB 1KN4L 1MY7A 3GRWH 2FCBA 5B3NA 3S34L 4Q7DA 5C07D 4XGZB 2CRZA 4QRRD 5I19L 5M95B 4J8RA 5EUKB 3PWVB 5BS0B 3QPXL 4YDKL 3NACH 3FCTB 4ELMA 1U8MA 2I5YH 3QRFM 5AAWA 1MRFL 2CPCA 3MA7A 1ORSB 5D1QD 3ZTJH 3RTQD 3TA3D 4NN7B 4KJQC 3WIIH 3MRLB 5B4MD 1GGCH 3K81A 4JY4A 4WCYH 2ZCHL 2DQHL 4W6YB 3X14B 1CXLA 2Y06L 1UM5H 1U8PA 3QG6A 1DE4B 3BPNB 1T2XA 4NQTA 3KNBB 3DTXB 5E00A 2EE2A 1INEH 1J8HB 2VXVL 2ILLA 5C0BE 2R2BA 1SQ2N 3WJJC 4KDTA 2C3VB 1I1YB 1I1AC 3IXAB 5J06A 1BFTA 1CDUA 4X6BA 4FNLH 5C7XH 1G9ML 3P30L 2ZKHH 3EZ8A 2YSSA 5BS0D 2CR6A 3QNZB 1D5ZA 1YY9D 4OFYD 1ZHNA 5F88B 2YMXH 1JGDA 4NQCD 3BWUC 4H0IA 3V6ZB 4GT7A 3FFDB 1KPRA 4MA8H 1DBBL 4S1SH 3UC0H 3J7HA 1INDL 1DANT 5ACLA 1XEDA 3MRGA 2VR9A 4Z5RB 1QRNB 2NLJA 2JKXA 3GMLB 5HYJD 3CFJB 4HWBL 4L4VB 5DUPH 4OZGF 1OOAA 3B9KB 3ARDD 3GK8H 3MCG1 4KVCH 5E0QA 3EOBA 4YHIA 1NMCB 3FO0H 4PTTA 5DK2A 1RZJC 1D7FA 3CXHK 1A6WL 4UTAL 3Q5OA 1LK3L 3VRJB 5ADPL 3ARXA 4LPCA 4QTHA 2C4FU 1YMHA 2QKIB 2PO6C 4Y4HB 4DZ8A 1UM6H 3IXTA 1N6VA 3WUWA 4M7KL 4ODSH 1MLBA 2NQCA 1W8OA 1RIVL 1ONQB 2IAMD 5AZ2L 4G5ZL 2FD6L 2E3VA 2HJFB 4OCNC 5EU7C 3ARSA 4OZHF 1RULH 3EFDL 4R2GC 2IFFL 2C4XA 5IGXH 1T21A 1UM4L 1E27B 4H0HB 1BLNA 2LTQB 4F7PA 4MD4B 2LVCA 4HEME 5AAMA 3H7LA 3ARBD 1MJ7H 3QO1B 2M1KA 3ABZA 2AV1A 2WAHA 3WYRA 5F21B 3GJEB 3SDAC 1YMMA 4NM4L 3BPNC 4H20L 4JZJA 4RAUA 5DD0L 2UWEB 3TA3A 5KSAC 2BNRA 1VFUA 4M6OH 2Q7YB 4OZGE 2V2TB 1AGBA 5CMAB 3UPAA 4YBLC 1QSEE 2LE9A 4D9QD 4E41B 3U2SB 4U0QB 3BP7B 3LIZL 1FNFA 3ILPA 5ECJE 5L2KB 4DUWA 4LCIL 5KS9B 4S2SA 3BKCH 2M8XA 4R3SB 4ZTOH 2VDLH 1SBBA 3GJFB 4LNRA 1SEQH 2DQIL 3O45B 3BISA 2FBOJ 4M1CC 3VGGA 1MSPA 1CDYA 1AH1A 1UQSA 3PJSB 1QR4A 3CSGA 3TBWB 1LEIA 1QYGH 3KLHD 2DS4A 2D4DA 3QUKB 3MRPB 2PYEA 2CJUL 1AO7E 4O2CA 1Z0MA 3GSRB 4W6XB 4LNRB 4Y2OA 4CN1A 1A2YA 4HLJA 1P6AB 1CICB 3LB6C 3HNVH 2WBJB 3LEYH 4NZJA 4WHCA 4F57H 4PJEE 2Z93B 1AGBB 1R6VA 4ZD3H 5F97E 3U46A 3F6LA 2X4RA 1RZJL 4Z0XA 4ZAKB 3UPCA 2R56H 1N6UA 1FO0L 3KXFE 2VDML 3WFZA 1MWAL 1IVLA 3G5ZA 1HWHB 8FABB 4FS0A 2NX5E 3RWIA 1A1NA 4Z8FH 3VXUB 1MQKL 5J13C 3V9FA 1JCKA 1MFCL 4JFYB 3B3IB 1P9MA 2GT9B 1CDGA 5ITBL 4JKPL 1TETL 4MVBD 3TVMC 3MLZL 3ULVH 1OGAD 4BH7A 1QFUL 3KPSA 3WBDA 3DETD 3MNVB 4PGEB 1RSFA 1EHXA 1Q9WA 1U8HA 5EA0H 1HEZB 2E7HA 3MCKA 2VLJE 4JM2A 5CJ8A 3O3AA 2RJMA 5I30H 3EO1A 1ZWIA 4U0RB 1WZLA 4HPOH 1RUAL 2PO6D 2ZWLT 3BHBA 4APQB 1W72B 4ZMAT 2FECI 2FEEI 1KOAA 4L4VD 4X5WA 5CGYC 2YKLH 1R3JA 4G9DA 4Q0XL 4NN5C 1KULA 1EVUA 1WCQA 1KTKE 5A2KH 5I8KH 3VWJB 1FBIH 4FOMA 5A2JH 1SVCP 5AZ2H 4BQ6A 1J0HA 7FABH 2DQFA 4HIHA 1MCRA 5EC1A 1KBGH 5ICYA 5T5NF 3SEPA 5JNYB 1PX4A 4GKNA 2HRLA 4G8GE 2RIKA 5FGCB 1HHJA 4MX7A 5TQ2H 4GQ9L 2DQCL 4M7LL 3TN0A 1LK3H 3VGBA 4I2XB 3P9WB 5A2IH 5GS1C 3IDXH 3JTSA 1WBYB 2OXHA 2PETA 3RWDA 5EU3B 1KNOA 3EDJA 2JCCE 4DK3A 4XWGH 3L3GA 5JPNA 5E6ID 5DZLA 3OHXA 4XP4L 1DUZA 4S1RH 3CVHA 1MWAA 1BVZA 3GFUA 3CXDH 4F15C 5I66B 3GJEA 1AGEB 1BD2E 2IQAA 4MS8D 5BV7C 4DUXA 1A6AA 3GSOA 5FCSH 2VN7A 5CEYB 3FB6A 2ZCKH 3GSQB 5CJOH 4UIMA 3Q6GH 1S5IL 5F7UA 4GKOA 4JJ5A 4F7MA 2ZUSA 3OJDA 5D7LE 4YHLL 3F58H 1T0MB 4P9HH 5B21A 3BZDA 5B4MC 3IF1A 5JPMA 1GHFH 4X6DB 1BAFL 3V5HB 5D6CB 1SJEA 5TH2B 3DIFA 4O58L 1REIA 1BF8A 1QBLH 5JLZB 4ZDHA 4DKDC 1ZLVK 3MJ7A 4BQ8A 3F7RA 5IBUG 5T3XD 1DP0A 3EO0B 3RY5A 5DGQA 3WHXA 1MHCB 4FP8L 4JFED 4OBRA 3MLVH 5GSVB 2GK0A 5I76B 1IQDB 1KCSH 1RUML 5IB3B 3PL6D 2GYSA 2FYYB 3EHBD 4QHMA 1IC7H 5F71A 3RPIA 2UVEA 1Q0XH 4TNWF 3RUGA 1KPVB 3EYSH 3NZ8A 1MRFH 3RVXD 3TJHC 4ODBD 1EAPB 4QRPD 1V7NL 4X6DE 1MUJA 4GUPA 1BFVL 3N0PB 1QBBA 3H7BB 5EFIA 2V5SA 4P5TA 1JRHH 4TVSa 5K9KB 4ZUWB 3SHSA 1LDPH 1N8ZB 2CLRB 1NH6A 2OR7A 5F1SA 1LE5B 2P5EE 4F7CA 3HAEA 5DJYA 4APQC 1A9BA 1J1XH 3N1PC 2XN9B 4HUUB 3WD5H 1Q72L 4NDMB 1GGBH 5FO7B 1X4YA 1YEGL 5JMOC 5T3ZH 3FOMB 5IT2H 1Z9MA 1A6UL 1I7UA 4WWKA 3VWKB 3V5KB 4EUPH 2PTUA 3DPBA 5HJ3B 1AKJA 2BMKB 3SQOL 5TH2A 4R2GB 4MJIA 3SJVE 3WEXA 4IOIA 3ARPA 1YEDB 2WSKA 1S7VA 5EZJA 2QSVA 5MERA 3NCJL 1Y0LA 3QXWA 1CD0A 3BDYH 4JPWL 5D2LE 5IBUB 1UEYA 3GIVA 4XP9L 5FYLD 4M5YL 5I0DA 3RDTC 1T89C 3IKCA 3TT3H 4BSJA 2F5BL 5HHVL 1FL6A 2Z8VC 5GGQH 2MJWA 1WWCA 3BXNB 4YXHL 1FVCA 1V7ML 3SKUD 5JOFA 5JXAH 1B88A 4PJIE 3MRRA 3GSWA 4GRLD 4FQXD 5I1EH 2VZ1A 4N8VA 3R0MA 4MNQA 3QWRA 1KLFA 3WV0A 3IGAB 1LP9B 2R0ZH 4OLVL 4KVCL 3QIUC 1YN6A 1RIVH 1T3FB 4XPTH 5C86A 4DEPB 5FHAH 4LSVL 5EZJB 3VFPB 4N0YH 4OKVA 5DJXA 1BZQK 4L3ED 2BJML 1A3RL 4HUNB 4B7LA 5DD6B 4O2CB 1F4XL 2VLKA 3VXRD 4DN3H 3BZEB 3NH7L 5ETUB 3S5LA 3SDDD 2XWTA 4Z7VE 3MCLL 2D7QA 3OKEB 4PJAF 3CNKA 1HILB 4NDMA 1CFVH 2J88H 4M62H 3QPQC 4WENB 1CLCA 1T6WA 4X99B 1ADQL 5EIIB 3R4DA 5D70L 2P47B 5FV1L 4CDGC 4JM4H 5IV2B 4OD2A 3GUTA 1I8LA 2IPTH 2VOTA 4M61A 3V5DA 5C08B 3BGMA 4M6MH 1N7ML 1JMXA 4JFFE 5ITFA 5MEND 3SDAB 3HC4H 3F6IA 5F6IC 3OAYK 1YNKH 1YUHB 2NLJB 4OLYL 1MCSA 3KPMB 4X4XB 4Y19D 2IADA 2BSTA 2BC4B 2FATH 4P46A 5I71C 1NCAH 1I9IH 3C2AH 2Q8AL 1KBGL 1F6AA 1U8JB 3QBTB 3HPLA 3C5JA 3IAGC 5C7XL 4RX4D 3TV3H 4PJIF 3HI6L 4LASL 3U82B 2C3WA 3QYCA 3TFKC 3UTZB 2DQJH 1AGFB 1X5YA 5F44A 1JHKH 4QXUL 1U0QA 3HA0A 4TNVK 1UZ8A 1C5DA 1RK0A 1MLBB 5FAAA 3PL6B 3QDJB 3ZTJG 1Q0YL 4BH8B 1PGRB 1BIIA 2QSTA 1T5WA 1IGJB 3ECBA 5F1OB 1IAKA 1WBXA 1TJHL 3TJEL 4APQD 1H3WM 4JGUA 3NIFE 1HN1A 3PNWB 3S36L 1VACB 2C3XA 1KGCD 2GUOB 1EFXA 2AXGA 1Q94B 4HX1A 1F3JA 4Y5YB 4OZ4B 2HAZA 2H9GA 4K8RH 1UB5A 3CK0H 4N0FB 4PJ7A 3V4PH 1DDHA 4FQLH 2XPGB 5C0AE 3CFKA 3TNNA 5A2FA 5KSBE 4HJGA 3S35X 2WW8A 2DIAA 5KVDL 5DHVA 2UWEE 1BM3H 1CFSA 2H9GB 3T77A 5A43C 1F4WH 4EOWH 1C5CL 3I6LE 5E1AB 1K3IA 2ICES 4FQ1L 3SKNB 3U4EB 5D7IE 3G6DL 4LSDA 1CVSC 4U1MA 3SE8L 4HS8L 3IDUA 3WS6A 3FO9B 5A16A 4UMGA 4AM0A 3EOYG 5JR1L 2BZDA 3OKMB 1QBML 1BFOA 4D3CL 1WK0A 1A6TA 5F3BA 3HCVA 3UEZA 4NO3B 2AEQH 3D69B 4Z76A 4QO1A 5EULV 3LRSA 4NZRL 2NTSP 3BWAA 3FQUA 2GTWA 4RGMC 4NC1E 1B3JA 2QSQA 3FO1B 1CLOH 4AH2A 4YR6A 1WZ1L 3IAQA 5KVDH 2C3GA 1P2CB 1FGNL 3F5WA 5F9OH 4YGAB 1CS6A 2D0GA 3RVVC 4N8VB 4YAQB 2OTPA 2D0HA 4AENA 3ULUH 3BKCL 2ATPB 3DX7B 4O2EA 3G5YA 3ULSB 1Q94A 1T21B 3FB5A 1QFWM 4Y19A 3W11C 4U7MA 1YPZA 2J6EL 3KHQA 3W2DL 4IOSD 1RUPH 4N0FA 4Q6IB 5FYLH 1FL5A 3VCLA 3KS0H 4I3SL 5E5MA 4JDTH 3BH8B 5F6IB 1AQKL 1UXSA 3MBEA 4DGVH 2VYRE 1FORH 5IHUH 4JFQB 1ACYL 1AGCB 4WV1B 4YHPB 3RA7L 3WDIA 3PWPD 1NC4B 4UV4L 2KZ1B 4U1SA 4G9FD 5DEFB 2Q87A 3UZEA 4BKLB 5HI4C 1UXSB 1WT5A 2IFFH 1RJCA 3QH3B 3ULUE 5FYJU 2FGWL 5F89A 3JWDH 1PY9A 4PJFE 2H32B 2Z31C 3FO2A 2GT9A 2AV7B 3EYFB 4G5ZH 3WUZA 3W82A 3BPLC 4G6JL 4ONHB 2J3SA 1JL8A 5B39A 2VNCA 2PTTA 4ZO9A 5HYSA 1BZ7A 4UV7L 4CAGA 2IALA 5CUSH 4K7PY 5A40E 4IIQC 4N9GB 4NP4L 3LQZA 5MI0C 2J8UF 2DKUA 4QRTA 5B39G 4Y5XA 5FO8A 4QHUA 5HYSB 3RDTB 1HH9A 4P4KB 3QDGB 3SDCA 4KPHH 4BZ1L 3F58L 4P9HL 1A5FL 1YNLL 5C09D 4PS4L 5C0NC 1VHPA 1NLDL 5EOTB 5FKPA 1CBVH 2ADGA 1Y0LB 2B1AL 5F9JB 4Q0XH 4WJ5B 2X4NB 1BBJA 4JPVL 3MNVA 3L9RB 4CU8A 2X70A 4L29B 3DYPA 4JRXB 1OCWL 1KCKA 1ZGLA 3ET9F 4HWZB 3MV7B 3NBNA 1OB1B 1FFNA 3PP3K 5FIEA 1A3RH 1HHJB 4HKZB 4PRBB 4M43L 4P5KA 2YD3A 1MCPH 2NY4B 1Z2KA 3RRQA 3QAZC 2DN7A 1Q1JH 2J6EA 3HMWL 3CSYA 3C5SA 4XI5D 2HFTA 1U8QB 3KPRB 4LP5A 4KPHL 1IEBB 1A7QH 4KXZH 5I8KL 3IFOB 4YBQD 4MQXD 1D9KC 4ZFFB 2EDEA 1TVBB 3KJ4B 9CGTA 2P43B 2I60L 3OGCA 1B0RB 1M7DB 2PKDA 5SWZE 4L3CA 5F72S 5EU7E 2OX5A 3HC4L 1EZVY 2ZUWA 1CGVA 3PHSA 4XMLL 4F33B 4HC1L 3QXDB 2A73A 3QEHA 3AAZB 1G9NH 4U6TA 4LPUA 2XA8H 4J1UA 5K93A 5T1LB 1NGYA 2Y6SD 2F15A 3MRCA 4TVPE 3H9ZA 4LEOB 1A3QA 1F97A 4LRNH 1DEDA 4L8SB 2X4OB 1J0ZA 2XNAB 3NA9L 4I0KA 5FO9B 1Q9OA 2IPKB 2UV3A 3OXSA 3EOBB 1TXKA 3C6LB 4JFZL 1RJYA 2YUWA 3FMGL 4POUB 4X7SL 2PR4H 4EBQL 4F7EB 4MWFA 2XWBA 1DQLL 3ULVC 4R26H 1UVQB 4Y4FB 2JJTC 1MCNA 4MA1C 2X4UA 2HFFA 3ULSA 3CFBA 5I1EL 4ZPTA 3PWJA 4CADA 1DR9A 1CFTB 3QDGE 2XXCB 5I8EA 1TPXC 1A3LL 1NEZB 1D5IH 5ESVA 3MODH 5D9SB 2X7LB 4HH9A 4NBYB 2R15A 3D3VD 4MXVF 4O4YL 1C8PA 3MLVL 2XOTA 4I0PA 1IC1A 4LEXL 1RU9H 1C08B 1ORQB 3RJQB 5EPMA 1RJYB 1K3ZA 1BMGA 5DTFB 5JR1H 1LDSA 4LSPH 1AXSB 4GKZB 1I1AA 4N8CH 1VKXA 1MCQA 3BYTA 3VG0L 1IAMA 4FXGA 1NFIB 2X1OA 5J1TC 4HUUA 4IBLT 3S37X 2X5PA 1NAMB 1KTRL 4RDQF 4X5XB 3THMH 4XNXL 1IL1B 4KK9D 5KOMC 4D8PA 4RFEA 3DO7B 2I24N 4XP6H 3T65A 2CJUH 2C1PB 3BZ4B 1YECL 1OARL 5TDNB 3KDMB 1QYGL 1IKNC 3FZUC 1OLZA 1DQQB 4ODSL 3CFCH 4U3XA 5GRJH 3MV8E 4ODUB 4HH8A 4JZOA 2Q3ZA 5I18H 4JO2L 2JLLA 4EXKA 3WLWC 4PLNC 4NFCA 1RHFA 1S7WA 4RGNB 2RHEA 1SMOA 4PJ8A 3O81A 1SJHB 2NY7L 4PG9A 2ESVA 2P4AB 2DQGL 3QJHA 4HZAA 2FSEA 4K94L 5L7XL 5HJ3A 1U3YA 1DSFH 2ZSVA 4K23H 5E24E 5EO9B 3CLFL 2XQBL 1XR8A 1YEJL 4LCWD 2AABH 5E94B 3LS5H 2D4FA 2DMKA 4LOUD 2CDEB 4UT9L 4GKSB 1FFOB 4O2FB 5J13B 1OPGH 4LMQI 4L1DA 3NFPA 3TO4C 5GRJL 3E2HB 4JQIL 3GBMH 5SWSE 5HTSA 2XXMB 3A6CL 1BAFH 1EHLL 5E6IC 1UWGH 3EUUA 4JN1H 1I3GL 3HMWH 2ENYA 4ZYKB 1EHNA 5KVMC 3H7BA 5JDSB 4XBGB 3NGBB 2VLJB 2IH1A 5IB4B 2BC4A 5LCVH 4P23D 1H8NA 3MGOA 3U36B 2VIRB 5TPWL 3S6CA 5IMOB 4PJFA 5E08H 2Z91B 4H88L 3BRDA 4PV9B 3WMSA 2R69L 1DQQA 1DBKL 1RK1B 3BGMB 3TA3C 1DUZB 4X80H 4GRWF 3RGVA 1CBVL 1NC4D 3DGCR 4RISH 5HHOB 1UH2A 3BT2H 4UT7H 1XIWC 1UJ3B 3HE6C 2R0LH 2J88L 1J7VR 3LCYA 4L8SA 4NSKB 5F89B 4MJIB 5FOBA 4BZ1H 4F7TA 3KYAA 1HINH 4GOSA 1ND0B 1N2RA 5DC9B 1N6QH 2GIYA 5IFJA 1A7PH 4PJBE 1M71A 2WIIB 1WSST 2AW2A 3HLAA 4E0RB 2FB4L 3MRIA 3MUGA 1F42A 4XP1L 2V9QA 5K9JH 4NO0D 4PTTB 2CDGB 3I6GA 3WFHA 4DK6A 5CD3B 4G3YL 2PR4L 3CMOH 2FJHA 3FHAA 4FXLA 4R0LA 3TZVB 3PDDA 3B5GA 5MP6H 1LK2A 2JJSC 2E8YA 3U83A 4DZBA 5HYQB 3N50A 1FH5H 5E99H 4YHZL 5GGVY 3EHBC 4UT6L 4EDWH 2OYPA 3BMWA 1U6AH 3FRPA 3CPLA 2AGJH 5D8JH 5LKNA 1T4KB 3DI2B 4NQDA 4YZFF 3NACL 4GXUN 3TGXA 2QQNL 4X99A 3L5XL 4RMVA 5HHQB 2NY6D 3JTTB 1DLHB 4I3RH 3GSVA 4WHTA 4CU6A 1N2RB 1QO3A 4PTUA 1NPUA 2VZOA 3MGAA 2EIZB 4P2QB 1X5JA 1U95B 2BNRE 3CVIL 1DQTA 3FO9A 2VTFA 5A16B 4OQTL 1Z9OA 4J3SA 5DC0A 5E8DL 3EDKA 3IDIA 2EDOA 2NY4D 4FFZL 3BPOB 4J4PC 5I1DA 4PJ7E 4PTUB 2CR3A 4LVNC 4XNYL 1AHWB 1S7QA 1WF5A 4G8GD 1UWXH 2YEZB 3P9MA 5GJTL 2Y36H 1EMTH 4NQDB 3D9AH 4X6FB 3ILPB 2PYEE 2DQEH 4OI7A 1MFNA 4ODHL 2NR6C 4YNYB 2UZYB 1G7PA 3F7VB 4Z7UA 5EZOH 3AY4C 1YEFL 3C5ZB 3QI9D 3K4DA 4X7FC 1P5VA 5CGTA 2GUOA 3C60A 1ZXQA 3UTSD 1A14L 3DXAA 4GS7C 2EIEA 5T3XH 3G04B 3SE9L 3DNKA 2FLBT 1F58L 3IFNL 5JHDB 4QHMB 3HNVL 3O6FB 1XCQB 3BIKB 4O9HL 1JF1B 1U8OA 1NFDA 5IK3B 1MJ8H 1NLDH 3I75B 4FQXC 4HX1B 1F11B 2R4RH 3QFJD 2QQKH 3PUCA 3O0RH 5MEQB 4LVEA 1NC4A 5HPMA 3VD7A 4EVNB 1ED3B 4BZ2H 1WBXB 3A6OA 3RWEA 2B39A 4PGCB 1B0GA 1R5VA 4G6AD 2F9BT 5D1XD 4JO3H 3ROOA 2XWJA 4JQXC 1IE5A 1U95A 3I6KA 3KLSA 4JG1H 4WRLA 3L7EB 1XH3B 4OI9A 4XCCL 1RIUL 1BBDH 2Y07L 2PXYA 3QWOA 1KXQE 1EJ6A 5AUMA 4L3EB 3TWCH 3INUH 4OCXL 3W39A 3C08H 1TCRA 5CBAA 4Q2ZB 3ARBB 2X4RB 5ENWB 1CGUA 1F58H 3IFNH 4U33A 2X4SB 5IQ7L 3RWHB 1HZHH 5BV7H 4KTYA 4R6UA 4OQTA 3QIBB 5BJTB 1MVUA 4XCCH 4JFXA 4KQ3L 2BFVH 2FIKB 5BRZA 4ZS7L 4K2UH 4PD4J 5DQ9B 3RIAK 1FZOA 5IHUL 1A2YB 5A3IC 1HQ4B 5J56B 3MV8A 5IGXL 1IM3B 1ITCA 2VISA 3RTQA 5IQ9B 5DHXB 1P53A 4AT6A 5GGTL 3QHZH 2G60L 4LVHC 1OW0A 4LLWB 1BF2A 4LARH 5DVLA 1YYLL 1CL7H 5CEZE 1X5FA 4HFUH 1JF1A 2R9HD 1E4XL 4JDZA 4L4TA 5SWZD 5DJ6A 5EUOA 3GMNA 5DRZA 4HKBA 5IG7A 1IGIH 1T03L 4NUJB 4XC1L 4OSUH 5T1MB 1EPFA 1E28B 2XYCA 4NKIH 4YHIB 5L2JA 4OT1L 1ITBB 3BUYB 2NY1C 2F19L 4GRWH 1CE1L 1O0VA 1DQJB 1I4FA 5LXGH 2E27H 1E6JL 2WBJD 5DJZA 4FG6D 2EC9T 2BCKA 5EOCH 5GGSB 1AQDA 4YHYC 1JI1A 3H6JA 3ESUF 4G7VH 4NO5A 3BPCB 2QJDA 5C0BA 4M5ZH 2A9NH 5D7LB 3T3PE 5DVMA 4ZNEE 3BPOC 1Q9LA 4JZNA 4X83A 1N64H 4RMSA 5I19H 5TQ0L 1JPTH 1UH4A 1FNLA 4HAFA 3UTSA 1CICA 4N68A 4Y5YC 4HKBB 1RZ8B 4KU1A 5J7CC 5IBLC 3HZYB 3V52L 2YWZA 4KROD 4RNRA 1B90A 2EE9A 4PP1D 2YHGA 2ZG3A 3PL6C 1JF6A 5H2BB 5DEFA 3JUZA 3ARDA 1UC6A 1AFVH 1CDBA 2HJLB 1IEAB 3REVA 1NSNL 2H1PL 3HZYA 3BP4A 1MFCH 3QQ4A 3SO5A 1WC7A 1J0YA 5FGRA 3V4UH 4RAVB 3BQUC 3QA3B 3D18B 4GKNB 4P59H 3W0WA 1I8MB 1X5LA 4PJXA 1NBYA 3WXVH 1JMZA 1ETZB 2UY6A 4FQJL 1HXYB 2GAZB 2ZOLB 3RWCB 3GB7B 4NN7C 4OUUA 5K9OA 4JRYB 3MFFB 3MR9A 5I1HH 1I8MA 3D87B 2B2XL 1V05A 1HKFA 1DQMH 3BZFB 2WQRA 2EC8A 4MS8C 3T0AA 4R96A 3WFDL 5C71A 1CZ8L 2Z9TA 3JV6B 5DVKA 4JCMA 1KEMH 2EYTA 3X3FH 1WUNT 2X6MA 1K5NB 2CO7B 3GMQB 1OD9A 5IVZB 1YMMD 4EVNA 1DVFD 3LD8C 5C0FB 3KPQA 4NZTL 2FHBA 4KTDH 2DLFL 4AJ0A 1FAIH 1QHOA 4DJMA 3GI8H 4UDTB 4DEPC 2CDFA 3KVQA 1HHKA 5CIPA 5GZOC 5JZ7C 5GIRB 4OFKA 4QY8B 3AS1A 5DQJA 4OCYH 3WXWL 3U9PL 1DSFL 4HLZG 3G6AA 4PJ5D 1H3VA 1MCBA 4UDUB 3LOWA 3BZFA 1Q0XL 2V17L 3NCBB 4WWID 4LSUH 3VJ6A 4NBZB 5DUML 1IGYA 4ZPTB 2WBJA 4LSSH 1A6ZA 4Y4HD 3ZHLA 1NDGA 2W0FB 1S7RB 2C1OB 1A1OB 2Q76A 5FYKH 2EDDA 1K8DB 1MELA 4MDIA 3LKNA 3MA9H 4YHYB 1ETZA 4PJXF 3QCUH 1IGCL 2HRPL 5C0BD 4URTB 3MRJA 4HZLA 3LPFA 3MJ9A 3QDMD 4PB9H 4QWWD 3Q1SL 2A6KA 5J0BA 1T04B 3QPQD 5I1DB 2Y9RT 4MNGA 1YEEL 2NTFA 4KI1A 2IANA 3TVMD 1ZK9A 1B2WH 4R97B 5FCUL 1F3DH 1WGOA 4U1KB 3BDYL 4M7KH 3FRUA 4PGDB 2GW5A 3SGEI 4CMHB 5DMGC 1GXEA 3PHOB 1RZKC 2MSPA 3JWOL 5I1JH 4WU5B 4JVPA 2Y7QA 1FFQA 2VQ1B 3O2DH 3LDBC 1KG0B 2NXZC 4U2ZA 2YD4A 3BH9A 1ZGLP 5BVPH 3R1GH 1ZLUK 4NN5B 3KPSD 1MHHA 3MRJB 2DDQH 5EWIL 4IS6B 4NQXB 4YGVB 4HT1L 3CD4A 2EYRB 1F5WA 1ZT4A 4P2OD 5GRVL 4AYFA 5CJXA 1L7TL 1CFNB 3NPZB 4JM2D 1IL1A 4OIIH 3LZFL 3W0WE 4YBQC 4MVBC 1FC2D 3C09C 5L9DL 5E8NA 2PO6A 3MXWL 3UO1L 5DMIH 4CN6A 3X11B 5KSUA 1AR2A 3A0OA 1KEGH 2IBZY 4WFHE 3ROOB 2CD0A 3RI5K 4JFPB 4O00A 2I25N 4LQFH 4MXQC 1U2CA 5LGKA 1L7TH 1GSMA 2X1XR 4M1GL 1ZVSB 5DFVD 3WHE0 4E42A 3KR3L 1MRCH 4G6FD 4OCSH 5BW7A 4LLMA 2ITCB 3HE7C 4S10A 5E8OB 1YY8A 2BSRA 3KPSB 3GSNA 1RUQL 3U0WL 5DHYB 1U93B 1MI5D 1NUNB 4F33A 5IUSA 1I8KB 1INEL 2VXVH 3LN9A 5DJCA 4MA1B 3T2QA 2SEBB 3ALXA 4GG8A 2FIKA 1V8HA 3D25A 2UUDK 4WDIB 1P7QB 4X5LA 5F7YC 3SDXF 4ZO7A 2XIDA 2OP4H 2E9IA 4FP8H 3RL2B 3BKYH 3GDBA 4OLZL 3RZCC 3MA7B 1MPAL 4K7PH 5CLWA 3SGKC 2FZ3A 5FO9A 3C6SA 3MRHB 4EEEA 4XBGA 2F53E 1XR9B 1YEHL 5EO0A 1A4KB 5EG6C 4NQEB 4JY5L 4HEPG 5CCKH 1LP9F 1JWUB 5GGSY 3VD9A 2XWTB 2R1YB 1S9XA 1OAQH 1ZT7A 1NJ9A 1CQKA 2KDGA 3O4LE 1UB6B 4HPYH 3WIHH 3HB3D 1DEEA 5C0CE 3H2WA 1GC1H 2F74B 4BFIA 2APWA 1YQVL 5C3LD 2AK4E 1JWUA 4Z7VF 1VEOA 2X2YA 3TNMA 5EC2B 2FIRT 3RVXC 4GQ9H 1D9KB 4OCRL 3UJJH 4PGBA 4JO4H 3WIHA 2FX7L 5LCVL 5ISZB 3T0XA 3QG6B 3FAWA 4S11A 3N9GH 2JIXB 4JN1L 1YJDH 1N4XH 2HN7A 2CDGA 3WFHB 3CU7A 1B6UA 4UQ2A 3Q6FB 4X6FA 4Z18A 2EKJA 5JOEA 1IGIL 4QRPA 1T03H 3QUXA 3LKPA 3SO3C 4I48B 2Y23A 5I1HL 3FFCB 3M8OH 1XGYH 1IEAA 3REVB 5EC2A 1ZEAH 4P5TD 3W9DB 1RQ5A 4OLUL 1A22B 4LARL 1BZ9B 4QT5B 3B8SA 3RWEB 2DQHH 3SDYL 5DC4B 1I7RA 2QQLH 3U7WL 1S8DB 4EJ1C 5K9QI 4X8JB 2X41A 4AL8H 3BDXA 2X4PA 1HHHB 3VFSA 4TSAH 5F9WB 3L5JA 4R2GD 2F5AH 1TQCC 1JZ3A 5IHBA 1F90H 3VGEA 1NEZA 3C5JB 5ACMA 4PRIE 1SJHA 1WV7T 2MWCA 4FZ8L 3O4LB 3ZT6A 4FZEL 5JW4M 5IVXB 3Q3GB 4H25A 3CU1A 3O6MH 4QEGA 3IFLL 2YUZA 2JJWA 4FQHA 1EJOL 3VXUD 1H3UA 1E4XI 5IBTH 4OLXH 4NQEE 1CXHA 2R2CA 3QIBA 1JNLH 1YECH 4GAJL 3UJTH 1U8LB 1D9KA 3QO1A 5IHLB 4GLRH 5EB9A 4XCFH 1EO8H 4M1DH 3T8XB 2FJGB 2VDQL 4LHQB 4LAQH 5T3ZD 3T0EA 3ZTNH 3G9VA 3VFSB 1L4IA 4TN9A 3MRMB 2YSSB 3MO1B 3NABH 5SX4I 3UYPA 5FA4A 2FGZA 5KAQF 1AC0A 1MJJA 1A6VL 5F96L 4UV7H 5GJSH 1Z0NA 1X44A 4UDTA 3RIAF 4ETQB 4G7VL 3VDBA 4XPHH 1MFDL 1Q8MA 5CSZA 1BVLB 5CEXB 1TQBB 4LLMB 4ALAH 2YA1A 1Y18A 4MCYB 3WE6A 3JWDL 1T20A 3FFCA 1XCQA 3BIKA 4MAYB 2VZTA 2F54A 2R56L 4PJGE 3ARYA 5F7NC 5FYKD 1MCOH 4HMEA 1MJJB 1IAII 2VISB 3KPSE 3RTQB 1KENL 1RVFH 4UB0L 2PF6A 2ZCLL 4QT5A 1INDH 3DVNB 1P5UA 3DMMB 5IB5A 3IU3B 4TSBL 4NRZA 2Z35A 5CMAA 4MB3A 1DBMH 3HR5B 5J6HB 3SDDA 1NFDB 5IK3A 1F8TH 4XAKE 1PQZB 3TF7C 3BP5A 3ZHKA 3H0TA 1A0QL 1KCVL 5CJBA 5IR1B 3HMXH 1J1XL 3KYKL 4PREB 3GGWB 2DQTL 1SY6L 4NZRH 3QHZL 1BVKA 5JW3L 2JELH 4KKBC 1XF4B 2WWKO 3ZL4H 3W39B 3AU1A 1NUFA 4QHLA 1JNNH 2PXYB 4QGTA 1KEML 2H6PB 3PGCA 4Z7VA 3BWAB 3FQUB 2BVOA 2ZCLH 3CSYB 3I02B 2XQYG 3L9RA 5D1QC 5H94B 1VGEL 3Q2CA 1I7TB 5E4EC 4HFWA 1NCDH 4M6OL 1NCTA 4JFEE 3GNML 1EZVX 3QQNA 1UEMA 5KJRH 4EZMA 3A6BH 3TBTA 1HH9B 5JIHA 3SDCB 2FX9L 4HIEB 3QO0B 3B9KC 2GSIA 2ICWA 3MXVL 25C8H 4CBPA 8FABA 1TDQA 1TJIL 2RBLA 4AIZB 4HBCL 2X89A 2VXSL 5EBGA 3OTTA 1F3JB 1IKNA 3BHBB 1G6RA 4APQA 1JYVA 1KJVB 3ARTA 3RBSA 4NC2B 4HS3A 3BP6B 1KIQB 5E70A 2NXYC 3CZFB 2EEAA 3LQZB 3UROR 1EFXD 1R3JB 1H15B 4G9DB 4IDLA 5JIKA 2APFA 2WIIA 2OR9L 4GW5A 1IMHC 4G80B 4JCLA 3L95B 4WW2B 1OAXL 4MA8L 4L3EE 4ZFOA 5C92A 3TCLA 2VE6A 1A7OL 3FT2B 4P9MH 4HG4J 1T0PB 1GJIA 2BNQE 1VADA 1AR1C 3JWNC 5ICXA 2Q8BH 3QFJE 3S98A 3UTZA 4TUKL 2HG5A 5D70H 35C8H 1QD0A 1SYVA 4MQSB 3D85D 4MXQD 3ELAT 2VN4A 1TZHB 3V0WL 1D5BB 4MSWB 2H3NA 1L0XA 4H88H 2NNAA 1HSBA 2XG5A 5IB1A 4OSUL 3QIWB 5TPWH 5I73B 1IT9L 5KSBA 1DQML 2R1XB 2APXA 5DLML 3IDJA 4L8BA 4HC1A 5IFHL 4NO5B 4DVRH 2ARJA 1N4XL 5TFSH 4WW1A 4AH2B 5K9QG 2P5WE 4OLEA 4Z7WA 5HVFB 4K55A 4MJ4A 5FDWA 5JXEA 3OAZK 1ZA3A 4GJTB 1KXVC 4Y1AA 5B3JE 2OJEA 1MQ8A 5C6PB 1H9VA 2RCSL 3QQ3B 1XZ0A 4NQDE 1LEIB 3LHPH 4M7JL 1NCWH 3N1FC 3QPXH 3MRCB 4YDKH 1U2HA 4NHUA 2X4QB 3DV6A 4UQ3A 3UAJD 4LIQH 2O5YL 2VDKH 1JZ8A 3TO4B 1HCFX 3PHOA 2NW2B 4IRJB 3QQ3A 4I3SH 1QA9B 5D5MA 5KSAD 1G6RL 1OF2B 2Z31D 3T4AB 4K8RD 4TNVF 5E9DA 3NCCB 3D2UA 3O6FA 3MYZA 2Z8SA 2HFGH 4XVJL 1T2QL 1QOKA 1QZ1A 3EYQC 1RZFH 1HSAB 3O6KH 1J86A 5D96B 4JJ5B 4W6WB 1PYWB 4Y4FD 4MCZA 3WFCL 5HGGS 5GPRA 4KRPB 2B1HL 3I84A 1QSFA 3BKYL 1U8IB 3EAKA 4X5WB 2ED7A 5LWYL 1P2CA 1XGRB 2Y4SA 4MDJA 3QIWA 1MIEH 2WBWB 3UXFA 1GZQB 4XB7A 1HHKB 4PR5A 3O4OC 1CU4H 1DZBA 5D7KD 2AJZB 4KUZL 3NFPB 4KKLD 1DBKH 1XF2B 1QBMH 3KWWB 4PLOB 1JNJA 4ZD3L 3P0YL 5KVFL 4U31A 4FQIH 2ADIB 3EYSL 4HFWB 3P9LB 5KN5A 2I26N 5GGVL 2AJUL 1J8HD 3CGTA 2GJ6A 4NKOB 1IC5H 3O8XD 2NX5D 4HWEH 5L88L 2HLFD 2DLIA 2ICEA 3K4AA 2P1YA 4XPHL 1SM3L 1A3LH 4J4PA 5LG1A 5GGRY 4HK0B 3SQOH 3D39B 5DS8A 1RHHB 1ZT1B 5CBEA 1IM3A 5IMLA 4HH9B 1NMBL 1OAKH 3MUZ1 4OGYH 1J11A 1RZFL 3O6KL 4FQLL 5E2UH 4IRZL 2DKMA 3O3DB 1EBAA 4JZOB 4PJGA 4YXLH 1U8KB 3ARWA 3BEWA 4PLJD 3LSOA 3ZMRA 1OAYH 2HT3D 1CXEA 4LLVA 4B0MM 4OD3H 1CR9H 1QPPA 4GUPB 5D7JC 3QDJD 1B9ZA 5J9PB 4PY7A 1S7UB 3OXSB 3L3JA 1WC7B 4TSCH 5EZIH 4I4WB 5LAXB 1G7JA 2DI8A 4KKNA 4NKOA 3WS6C 3UJIL 1VPOL 3G5XA 3QA3A 3VFOB 3P77A 2A6JB 2OL3H 4NN6B 3KPPB 1QLEL 1FZKB 2RCSH 4R4BA 3WNPA 3DRQA 4HW6A 4JFDD 4L8CA 3ZDXF 2VDNH 1OQOA 4OUOA 4BZ2L 5M94B 3X11A 3NIFF 4KKCC 4PRPA 3L1OH 1QTYT 5ALBL 2AEPL 1JHLL 1IEHA 2YD7A 1GOGA 1QVOB 2Q8AH 4WEMB 3FQRB 2BX5A 3TBVA 4NQXA 1F3RB 4FZEH 3SDXB 2DQCH 4M7LH 3LD8B 5F1KC 3X3GH 5I6XB 1T1YA 3FQWA 1QFHA 1HK6A 1T1ZB 2PW2A 1QUNA 1U8PB 3FO0L 4GXUM 5F7KC 4FRWA 3TC9A 2AJVL 4M6ML 1UVQA 4Y4FA 1YQVH 1T22A 1UG9A 4NWUH 3HS0A 4YQXH 5D71L 5EU6D 2JJUA 3HZKB 5JUEL 1NAMA 1MFAL 4X5XA 3ILQC 5TDOB 2CLVB 4FABH 3ME0A 4OCRH 5AYUL 3V0VB 1D5MB 1I1CA 3FQXB 3GMOA 4P9ML 4JY5H 2AAVA 3GIVB 4PB0L 3OGOE 1KIRA 1XGPB 3QUZB 4KJQD 4IRJA 3HFML 3PP4L 1P4BH 1OW0C 2V2WA 2YD8A 2C4FT 3G5XB 1A4KA 5EA0L 3N06B 5I15H 4OBSA 1OTUC 1F00I 4LK4A 2ZUUA 4MNHB 3JV6A 2APBA 1INQA 4ELKA 3MLZH 3TYFA 1CQYA 2I07B 2IBBA 4FFYH 5E1HB 3CFJA 2HFEA 4QRQA 2GFBB 3RWJB 3TBYA 4RGOL 3I3EA 5CD3A 5I9QB 3B2VH 1G9MC 2WV3A 3BE1H 5JMRA 3WHE1 2XA8L 4M48L 4NQCB 3PWPB 3SDXA 4RCAA 1BX2A 4OF6A 3F7QA 2VKWA 4XXCA 1G1CA 1KUMA 1MLCB 1XGQA 4LPTA 4JANB 4WHDA 3PWLB 1I9RL 3O2DA 3QDJA 4NRXA 1A7RH 5C9JB 1OHQA 3RY6A 3PNWA 1FZJB 2NXYD 2F8OA 1Q9KA 1YN7A 5KANG 1A64A 1UZ6E 2WUBL 5GGTA 5KW9H 1R3LA 4MCYA 1L9MA 3NTCL 3GHEL 1MF2L 4JANA 4POZC 1SYSB 1RZIB 3VFTA 4KJYB 2VC2L 4DCQB 1EFQA 2ZOKA 4FG6C 3T1FB 3MOBH 1YQ2A 2ESVD 1RK1A 5I15L 3ARFC 3BEVB 5FA4B 5I74C 3GHBH 4PRPD 5HDLA 2PCPA 4MQ7B 4XMKH 5DD3H 3HHRB 3HE7D 1TETH 3NGBC 1U8OB 2OSLA 2H2SD 4HIXL 4F9PA 1PG7L 3T0EE 2FEDC 2XKSA 2D9QB 1NMBH 1OAKL 3MOAL 2EXYD 3RVUC 3BQUA 4PY8J 4OZFH 2PW1A 3VE0A 3M17B 3D0VA 1NCUA 4OZIF 2EEDA 4ODWB 3C09B 3QSKB 3WNMA 4LCCB 5IKCA 3MNZA 1RUKL 4CRPA 2AEIT 4OZHE 3RWJA 4O4YH 5ADOL 4PRAA 4YE4H 4F7PB 4E0RA 1AD0A 4JPIA 3GSUA 1FLRH 3EYUH 2AJ3B 2F19H 1WEJH 4Q9QL 4ERSH 3MREA 2X42A 4P23A 4IMKC 4KROB 3DSNA 1ONQA 3CX2A 1N5AA 4RQQB 4G6MH 1JNHA 2Z8RA 1DJSA 1CVRA 3WE6B 1ED3A 4C56E 2VXTH 4OZHB 3CFEB 4QLRA 3U4EA 1VFOA 3KPNB 2JB5L 5SWSA 1RK0B 3VH8G 4ZQKB 2B8OT 3U2SA 4E41A 1EGJH 4GW1A 2A74B 2YA2A 5ALBH 1P7KB 3QIUD 3T0EB 1HOCB 4KKAC 4LCCA 5IKCB 3MRRB 2OMNA 2VABB 4JZNB 1T1ZA 2CO6B 3H9SD 2P8PB 1LP9A 5LQBL 4LLUB 2DICA 5BQ7B 3R06A 3K1DA 4LCIH 2OL3B 4OF0A 1P84K 1PY4A 5T1LD 2R39A 2Z35B 1LHZA 2P45B 2J7LA 4JHWL 3VXPB 4DW2L 4WFED 1NUGA 5TF0A 4TSAL 2GSIB 5DDHA 1OTUD 3BP5B 4HJ0C 2JTDA 3LH2L 5EUKA 2XKNA 2YEZA 4IEFB 4Q9RL 4WFEE 4JN2A 4Y16A 1EGJL 4JRXE 4IDJH 4BKLA 4XX1E 4R7DB 1FG9C 1L0YA 1T66D 1ZVYA 1AGDA 3HG1B 4MAYA 3ES6A 4ZUTB 1JHKL 2F58H 3WNLA 1IAOB 4U1MB 2AJXL 2FR4B 4BFBD 2WWMC 4C4KT 3I2CL 3MQIA 2ZUTA 3UMTA 4GBXC 3SO3B 4EI6B 3RGHA 2DM7A 5GS3A 2AEQL 4DKFL 4OM0L 3ZHDA 3MV9E 3O2VL 3FB5B 4X7CC 3DVGA 5K59E 1YY9C 2FX7H 4XWOD 4KGJA 4YDLC 3UTPE 5FO8B 2VITB 1LO5B 4J2XA 5DFWH 1J5OH 5KANI 2FBJL 2COQA 3FAXA 4H1LB 3BQUD 2ICWB 3I6KB 1MFAH 1GC1L 2HFFB 3PHQB 3GBNH 5BS0A 2Z0BA 3NCMA 4Z9KB 3HG1D 5DQDL 5CZXC 4OFYA 2NY3C 3D1MC 1ZTXL 3M1BB 4JFZH 2B1HH 3SJVA 2DWDA 1YJDC 2NY0B 2D31A 1P7QD 5I8CB 5TQ0H 4Y5VB 3TO4A 2J4WH 1Z5LB 3OB0K 2XTJB 3HMXA 4OTXH 2BJMH 2XN9D 3BKJH 4OM1L 5F9JA 3WNOA 3FL7A 5CIPH 4N0YL 4B50A 1JPFA 4R7DA 2EDWA 3WIFB 1A1NB 2P5WA 5SWSD 4L3CB 5BW7C 1I1YA 3I50L 3UCRA 1JUFA 4FN0A 1KFAH 4N0UE 3BIAX 4HC1H 4RFNB 3HC0A 3VWJA 4V2BA 2EZ0D 4N8PA 25C8L 2GAZA 4WU7A 1LNUB 3CUPA 5E6IB 4GW4A 3H9SA 2MPAL 1UKTA 2QHLA 4ZSOA 1K2DA 3JVGC 4PLJC 3T04D 1F6FB 4EN3C 5LGJA 5ID0B 3GNMH 5D2NC 2IQAB 2E7LC 4HXAL 2RFXB 1XIWA 4WFFD 4DQOH 4ODUA 1GZPB 2IAMA 5FGBA 3KLDA 3U7AA 3S7GA 1ZGLB 4GBXB 3IDNB 2Q86B 1I9IL 3C2AL 5EN2B 2I9TA 4JHZA 2R2EB 1T5WB 2XNAA 3EDFA 1MCPL 1J0JA 3PV6A 1A8JH 3C6LD 2VWEE 4HKZA 4TTDC 4CJ0A 3WHXB 3KPNA 4NJ9H 2Z92A 3F65A 3KYMA 3VXTA 3ULUL 2BFVL 3ARQA 4AMKL 5MENE 2OJEB 3HTLX 5EC1B 2CKBL 3V0WH 1EVTC 1I9EA 1NMCC 4JFFA 3QDJE 1ZA3B 1CLOL 3RWIB 3MV7E 1Q9LB 4R96B 3I9GH 5J11C 3GSNL 4X0KA 1NBZA 5GS2H 3VDAA 5ID0A 1DL7L 4JFOA 1MFBH 4ONFH 5D1QB 3B5TA 2DJUA 1A7OH 3D39E 4M7ZB 2CIIB 3QEQE 4W70A 5C0GA 5F96H 5FK9A 4QRRE 3BPLB 4PJEA 4N5EC 2OTWA 2BVTA 1NDMA 4ZPVA 4NQCE 2BVPA 5JIIA 1XT5A 4TPRH 4PYHA 5DS8B 3MCKB 4PBVC 2GY5A 4JO1H 3DUSB 4YWGL 4UINL 2X10A 3DBXA 3HB3C 3O0RL 3ZYZA 4JFFB 4KROC 4W4NA 4XC3L 12E8H 3DMMC 2G9HA 3EO0A 2R9HC 2XRAL 1NL0H 3HG1A 3MRQA 4L4TE 2DLHA 5ICZB 1WIPA 3QUXC 4RA0C 2VXTL 3QH3A 2R0KH 4PRHB 3CZJA 1OAUL 3Q1SH 3WJJA 4JG1L 1UQSB 4R97C 4K3DH 5F7EL 1XGUA 5I1KL 4FQ2L 4RRPA 3RX8A 3IDMB 4ISVB 3KLHC 2I9TB 5GISH 4Q9QH 5ESQA 1CICD 1UJ3A 1FNGB 3FRPG 4X9BA 5KS9A 2XN9A 3DYMA 3LQAH 2ZP0T 3SY0A 1JNLL 4WGVB 2FZ3B 1VFMA 2EYTB 5DUPL 4ODHH 4QXTA 1NFKA 1CR9L 1EEUA 2Y5EA 4YWGH 1B0RA 1DLFH 2XTLA 5K9KA 1EEZB 4M9PA 2YPLE 3WSQH 1KPUB 3VD5A 3OR7A 4C55A 2R4SL 1LD9A 1LO0H 5E8EA 3WFBH 1OGAA 1E4WH 5IMLB 2W0KA 1WZ1H 2VZVA 3RKDD 3LY6A 1TQCB 1I3RB 4U1JA 3W0WD 2YOCA 4ORGA 4XNMA 2K7QA 3QB7C 2R8SL 3GSXB 1U8MB 3VRIB 4LU5L 5BZWB 5FGCE 2OCFD 5DK0B 3NPSB 3QR2A 4KI5D 5I74B 5E4IA 1OP3K 5IMMB 1WITA 1QO3B 4N8CL 2DI7A 5MHSE 4OIBA 1N0LA 1H5BC 4KI5E 1K4DA 5ICYB 3WO4B 2CXKA 3GMOB 2EDXA 2EIBA 5F9WC 5HI3D 5C07E 2HTLC 2R2BB 5A2LH 1BQLH 1NGZB 1OTSC 5L8KB 1QFWI 1DVFA 1H3PL 5ERWA 3MRBB 1NAMH 3IJHB 1S7WB 1YPZE 4YHOL 3CMGA 2B4CH 1CE6A 4ZSOB 1P4LB 5CD5D 2JIXA 3WLBA 3MNWA 3SGEH 1FYTB 3LKOB 5EO1A 2VL5B 1IGFH 4PJ9B 4NQUA 5ANMA 4XHJD 3P40A 4J6RL 5DD3L 1NBVL 4DZBB 4O02H 5HYQA 4DGYH 1MWAB 3V4VL 4JY6A 4HWBA 4RFNC 4PY8I 4WTZA 3TBSB 3O3EB 5DJAA 5FM8A 1PBYA 3CFDB 1MHEB 4LMQE 3NFNA 1FDLH 1KJ2A 2M26A 1I3VA 3JTSB 7CGTA 5IW6A 3CLEH 1RZIA 3MLRL 1AC6A 4EUPA 5DJAB 4X7TB 4XNQB 5HHPA 4Q58C 1MPAH 2AJYL 3O4OB 3QCVH 3WFEH 2QL1A 2P44B 5ILTL 3LKSB 1Q9KB 4PR5B 3OAUL 1YEIH 5GRWA 4RISL 1J9CT 1C5BH 4UTBL 4U1NB 4A2LA 4IIQB 4PYGA 3TNNB 3BSZL 2N7AA 1NCAL 2A83A 4OCLC 4RGOH 4OT1H 2JK5A 5CWSA 3TZVA 4Y5YA 4JPKL 1NKOA 4U1NA 5IJKC 1W0VB 4H0GA 2HFEB 5FOJA 5E9DB 3MLYH 4U1HB 2AJSL 3RNQA 1BLNB 3BI9X 4FMKA 4HK0A 4GG6B 4L1HA 1U3HA 5T1KA 3IXAA 5TE7L 5D6DA 5IF0A 4JO4L 3HMXL 4DW2H 1JTTA 3V6OE 1LVEA 2KQMA 2NTFB 1CFQA 1S7TA 5D7JB 5GHWH 3WLWD 1RJZB 1U8NB 3QIUB 2DJ4A 5E00B 1GPOL 2AJ3A 2IGFH 1CK0L 2MQ3A 4IDJL 3ROLB 1N0XL 3MRDA 1NAKH 4XCYB 3OV6A 4H8WH 4DKFH 4QRPB 1X4XA 3OKKB 3MSPA 2DQGH 2HMID 2XQYK 3PGCB 1YDPA 1GRWA 4GAYA 1ORSA 4JFDB 5I2IB 4EI5B 2OL3A 4BQ9A 1EUUA 2ADJB 2OI9B 5DZNA 3IDYC 4WWKD 3MRLA 4XH2A 1M05A 1CLYL 5HVHB 1GIGL 4MJID 1T7XA 1RD6A 3ZE0E 1KV3A 1OGTB 3V6ZA 4TULL 3D39A 4JREB 1OT1A 2R0WL 2OZ4A 1TMCB 3O9WA 2XWJB 5L8LB 2J8HA 1RZKH 1BVLA 3ARGB 4RRPG 4DZ8B 4G9FE 3QXAB 5IW1B 4G7YH 4NKQB 4R4FL 2VLKE 4NO0B 1SEBA 2J5LC 3TN0C 2HH0H 4OV5A 1HXMA 4TVPH 5CGYD 1X7QB 1F4AA 1VPOH 4DFIA 4Z7QE 3RU8H 4PRNB 2HP4A 4JFHE 1QLFB 4KUCD 1MIML 3M45A 1WCBA 3GSUB 3DV4A 3QUYB 2W9EH 5CS7A 3S35L 1AQKH 3NIGF 3W5NA 1E6OL 5IVXE 3UTTA 2FL5A 2MHAB 5BVJA 4XVUD 3GHBL 3NFSL 1LO5A 3KAAA 3B6SA 4KV5F 1RUPL 4XNZB 3SDYH 1JZ5A 4W4OC 3QUMA 4Q74A 4Y5XB 5JOFB 3MACL 4W68A 32C2A 3WFCH 4QXGL 1B4RA 3EOAA 1F02I 1MRDL 2XN9E 4XPFH 4Y2DB 4ZFZA 3BUTA 3P73A 3EZJB 3L6FB 2HJKA 3VG0H 5ENWA 1NCBH 4FQQB 1E27A 4WUUD 3LIZH 2IQ9L 1ZWIB 3AMLA 1DQLH 5HYFA 3VG9B 1J0IA 4PRHE 3O4LA 2EIDA 4J3OC 4GKSA 3IETA 4L4TB 3GKWL 4YO0B 3OKOA 4YE4L 1IC5L 3VFMB 1BFOB 2DBJA 3FMGH 3GJFK 1QLFA 5HDQH 4PRDB 5CP7A 5KOVC 1CWVA 1J1PH 1OGAE 3LPWA 3X12A 4EUPB 4CU7A 2W38A 2FR4A 1JGUH 2X1WL 4I8DA 4U1LA 3IXTB 2YA0A 5SV3A 5LGHL 1JP5A 1WFTA 2HVKA 3F8UB 3HC3H 4LVOB 2HH0L 5HPMB 1MJUL 4LSTL 4XCNB 1I9JL 3DETC 3RI5F 2YD6A 1QQDA 4FFWD 2W92A 5SX4H 4GAGL 5I75B 2HJKB 4NN6C 5E8EB 5BS0E 1S3KH 2VDOL 4PV9A 3DUUB 3MRKB 4MA7L 5HYSG 3OZ9H 4JHBA 2CK2A 4WU7B 1QG3A 5HY9A 4BUHA 5BOPA 4F3FA 1C7SA 2H32H 4DN4H 5CWSB 3UPRA 1EJOH 3EJJX 3QDAA 1G6RB 1EK3A 4AZ8A 3OL2A 1SMAA 2DYPA 4JY4B 2ADFL 2FEDD 5ESAB 1JUFB 4FXKB 4YXKH 4D0CA 5BXFB 3OHXB 3IJYB 5H37H 4XPGH 4U6XB 3DVNA 6CGTA 3HN3A 1Z6JT 3QP3A 3L3HA 5E7BA 3JV5A 1A7RL 3BD3A 1KN2H 4MSWA 2K1MA 2VAJA 5BZDA 2OQJB 4QOKD 4PGCA 3IFPB 3GO1L 3HUJE 4TUKH 2N56A 4NBXB 1T1XA 3TN0B 3ALPA 1D9KD 3V6FB 4PUBH 2X44D 4X6BB 4YFDB 1CK0H 1Q0YH 1ZLVH 2EDHA 1TIUA