2HLFD

Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Proton transport,membrane protein
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfD01
1FHGA 1LILA 3MNZA 4UT7L 5D7JA 4MDJB 5D96B 3T0XA 1EFQA 1RD6A 4MNGE 5T1DH 3OJVC 5IQ7H 2Y06H 5ACLA 5IHZB 3LY6A 3VGAC 4PV8B 4TSCH 3TN0D 4U6HA 3TVMD 1DQJA 2ZCLL 1ED3A 4N8VB 3TBWB 1MCRA 1XCQA 3QUZC 1NUDA 5JQ6L 3HI6L 2BVQA 2BFVH 5F96L 5IWLC 3EYQD 3GKZA 4U1HB 2W0FB 3QO1B 3QQ4A 5HHVH 3AMLA 3MLXH 4LAJH 2YPLA 3NFNA 1KJ2B 1D9KC 1CDUA 3CC5B 4XGZA 1L6ZA 3CLFH 3MBXL 4UQ2A 3ARDC 1IAOB 4JO4H 1T1YA 5F1NA 1V3KA 5TDPA 5GS1C 3T4YB 1BHGA 2XA3A 2CLVA 2GAZB 3QWOA 4M62H 1N2RB 4FS0A 4JHAH 3W11C 3MO1A 1RZ8B 2P7TB 4KRNA 5EUOF 3O2DL 3WIHL 4QHKI 1J87A 1DBJH 5C0DA 4EI5B 3OQ3B 4Y4KA 4OGAC 3I3BA 4XPTL 2A2QT 3WDIA 1B0WA 1YZZA 1R5VA 3OKDB 4XAWL 3ZL4L 1UENA 4Q7DA 4R4NC 5DUML 1BREA 1NMCC 1NEZB 3TBVA 2MNUA 4HK0A 1JNHB 1NCTA 4AZ8A 5DJCA 5F21B 5T1LA 3V2AR 4TQEH 4G8EB 1K9TA 1A9BA 3Q48A 3QEGH 1MLCB 4UDUA 3NFSH 4Z0BH 1J8KA 4KZEL 4CW1B 4XTRD 4ODHH 1UH2A 1E27A 3HG1A 4KKAD 5J7CC 5T3XE 5EG6C 1BGXL 1KT2B 3VXUD 1P7KB 4LASL 4N5ED 2D9CA 3V52L 2AK4D 3BP5B 3KJ6L 3C5JB 4YHYC 1FRGH 3GHBL 5I1DB 3CX5K 3MLSL 4YHPB 4M7JH 3T4AB 2FO4A 3QPXL 4Q9RH 5BV7C 4ALAL 5IBUB 1KACB 4NBYB 1JGVH 1QSFD 2BP3A 3LV3B 2P1YA 3IFOA 1F11B 4MNQB 3I75B 3CDCA 4NQEB 1HZHH 2AJXH 3TWCH 4Z78B 1AQDB 1PX3A 4HS8H 3AROA 2H26A 4BH7B 2F53A 1XGUA 5GHWH 3BEWB 1YN6A 3MRJB 1GGBL 2R9HD 1BFOA 5C07D 3UPRB 5F93C 3SKNA 4NKDA 5HYQB 1GL4B 1ZA6B 5C86A 1ZA3A 5B8CC 4NO5B 1PQZB 4DZBA 3D85A 2VISA 2VWEE 5E9DE 4LQ1A 1C16B 3VMNA 3HE7C 2QQKL 3MOAH 2GJ6A 5D1XB 1EO8H 4UU9A 3NIGE 1G7LB 1PBYA 4ZDHA 3TNMB 4Z7VF 1KTLA 5IIEA 3KLHD 1ZLVK 1R5IA 2Z91B 3TT1L 1SYSB 4R96A 4L4VE 4LAQH 2EDLA 3LEYL 4QRPA 5IMLA 4ONGL 2HKFL 1G7PA 3SDCB 1EZVY 1A6ZB 1CFNB 2BY3A 3W81A 3EAKA 3F6IA 5IEHA 3DV4B 4QRSA 1A4JB 3IF1A 2OS7A 4K2UL 5LG1A 1YPZE 4WWKB 1FVEB 3RFZC 4WU5B 4H0IA 5C0CA 4O00A 1X4ZA 2FGZA 4FQHB 2PKDA 3S4SG 4YC2C 1ADQL 1F5WA 1CDCA 2XN9E 1U8PB 3H6JA 5F1IA 3PHOB 5C0GB 4OLUL 3Q6FB 2IH3B 4G6AC 1IAIL 2VR5A 1E4XH 3A67H 1I1AA 2ZUUA 1FYTA 4C55A 4JDZA 5FA4A 4LNRA 4JFFD 3CK0L 3RDTD 2CLRB 3PF2A 3P4MB 1NBYA 1MCIA 2G9HB 2HRPH 4GRWE 3O6LL 3ZLQC 3UXFA 1HSAB 4PJ8D 1QFPA 4RAUA 3WFHB 3MRIA 5HJ3B 5LAXB 5IMKB 2NY6C 3DMMA 1KCUH 2G2RA 4RFOL 5D1ZC 2ICWJ 3RWEB 1JPSL 3RWCB 4GRLA 4QWWD 1CVSC 4HK3N 4LF3B 3VFWA 1MCJA 3GIVB 4DWHA 4HGMA 4DKFH 4M7ZC 1VA9A 5HVWA 4WO4B 1NGYB 4UQ3B 4KJPD 3V0AC 3QUYD 1ZSDA 1BVLA 2HFEB 5I0DA 2DAVA 3CFKB 1ZE3C 4PJDB 1GOFA 4XHQA 3WIFB 4NFDA 4NO2B 4JO3L 3CSYA 5L88H 4IOFD 3BP6B 3FB5A 4HDIA 2BNRD 3ZYJA 5DRNB 3X12A 2IAMD 4GAYA 4GG6A 1GIGL 4NQCD 2VXUL 4QF1B 3EOTH 2R4RH 4O2FA 4D9QE 1EMTL 4ZAKA 2IEPA 3ULSB 5GGRB 2IMMA 3BZEA 3DX7B 1Q9WA 4M48H 2OMBA 5E4EC 3U7YH 4LLUB 5AG9A 4MJID 6FABL 1KCSH 3BPNB 2EZ0C 1KIQB 2HRLA 3M45A 2XA8L 4YHKH 2R69L 2CSPA 3LS5L 5AUMA 1QVOB 1TPXB 3SJVB 4FNLL 4OV5A 4AMKH 3VG0H 4P4RB 3MNWA 1ZWIA 1TJIH 3IJHA 3I84A 5A43C 1FO0A 3MNZB 4MA1C 1X7QA 2YS4A 3JTTA 2APTA 5IM7A 4NN6B 2YPVL 4MXVE 4BFEA 4KQ4H 4M93C 3RQ3A 4JPKH 4U6HB 4OCWH 1TTUA 2CXGA 1DQJB 1ED3B 1XCQB 4P2YA 1JZ6A 1CK0H 2BVQB 1CF8L 2NY4C 3GDBA 1LDSA 5A2KH 1VFBA 3QQ4B 2Z8WC 2DQJL 2DTMH 3NFNB 4NO3A 1RULH 4XGZB 1K85A 1PSKH 2FBJH 1IAKA 2Z93A 1T1YB 3BD5A 3K1KC 2P45B 5C0AE 2CLVB 3VFSA 4ZNEA 1SEQH 1BECA 3C5SA 3QWOB 4NNXA 1F3DJ 5JR1H 4WEBH 5E5UB 5IB3A 3QB7C 3OXSA 2COQA 3ARFA 1CU4L 2AJ3A 3V0VA 4IRSA 5I8OL 3SE4C 3UTTB 4MZ2A 5IFAH 5C0DB 32C2A 4Y4KB 2BJMH 3IKKA 4Y19A 1G7JA 1MFAH 1NGWA 4HAGA 1UH4A 4FFYL 2EC8A 3D3VE 4NM4L 1OPGL 3O6ML 1F4XL 1R5VB 2W38A 4M7LL 4S11A 5C09A 4LDOB 1L7IL 1A7QH 2YUVA 4WI4A 1LWRA 1I8IA 1EEZA 5HI5D 3EDEA 2JJSC 2K7QA 1YJDL 2NZ9D 5L2KE 1NEUA 1MCPH 1OP3K 3TBVB 4YX2L 2XZCL 4HK0B 4L3EE 4LRNH 4O2EA 1MQKL 5T1LB 5T1MA 4X80L 4KK9C 2OJZH 4JY5H 4GFTB 1A9BB 4JFZL 4CN4A 3B9VA 4UDUB 4LARL 4DTGH 3ULVF 1Z5LA 1E27B 3HG1B 4LVNB 4WI9A 1KG0B 2GJZA 2W9DL 1LE5A 3HE6D 4JKLA 3BPLB 4JN1L 1FG9C 1IKNC 3AFLA 4JB9L 4UB0L 3T0VA 5KBNC 3O4LE 4LCIH 4OLEA 4ZUSB 5ISZD 3WSQH 4M4PA 1EEQA 1MI5A 2FO4B 3CFIC 4KDWA 4J23A 4YHIA 3RVXD 3D2UD 2PXYA 1IARB 1JCKA 4HLZH 5C08E 2XWJA 1J12A 3MV8D 3NAAL 2QV2A 3QAZB 4J7RA 3ULUC 3IFOB 5DEZA 1DCLA 4BQBA 1FFQA 2ED9A 1IAII 1U8HA 4IMKC 3DWTA 4KUCD 4ODXA 2F53B 5MENA 1X5GA 1HH6A 1YN6B 3U0TA 4LP5A 3MMEA 1AR1D 5DHXB 2BHYA 1IJ9A 4XNUL 3SKNB 2NY3C 1ZA3B 2CLZA 4RFNC 1UA6L 4DZBB 3D85B 2VISB 3RIFK 4X4YA 4PTTA 4P49A 2CRYA 3VRLF 5LQBH 4MAUH 1AY1H 2GJ6B 5CJ5A 1TJGH 4ZDHB 1T2XA 1KTLB 3O3AA 3WO4C 5IIEB 1QSEA 1R5IB 2J5LC 5FYJE 3BDXA 1RJLA 2W0LA 1MCHA 4R96B 1JIBA 4OBSA 2CO7B 4M6MH 3EO0A 1CFBA 1CDJA 4JREB 2WUCH 1G7PB 2KBGA 5HHPA 1JNJA 1H3GA 4ZS6D 3C08L 5I74C 2VERN 3NABL 4QRSB 5J06A 1EX0A 5IB2A 3IF1B 1CXFA 1IZKA 5C0CB 5I8CA 3C5ZC 2BCKA 3ZDXF 1RQ5A 3ZSTA 2CKBH 3BKYL 1IVLA 4GSDH 3FFCA 4N9OB 2E7CA 3S3SA 4KHTL 2A83A 5HHOA 1I1AB 4O5LH 1FYTB 2C9AA 4JVWA 2C7UB 2P43B 4JDZB 4RDQF 3LQZA 5FA4B 4OD3H 5BV7H 1F58H 2Y07L 4LNRB 2ICWA 1EHAA 4M5ZH 1NBYB 2DOCA 3S9DB 3CSBA 4PJFF 5FHBL 3QZWG 5F7LB 4K55A 4U31A 4S1SH 4V1DA 4YIQB 3ZKXC 5I71C 3HZYA 1OTUD 3QWQB 2G2RB 4R4FL 3LEVH 4U3CA 4P9HC 4LHUA 3L3GB 3L3KA 4GRLB 5C92A 4UNVA 1RK1A 2B2XH 3VFWB 4L8SA 4D9LH 4U6VH 2NX5A 5E2TL 2EDFA 4ZSOA 1FNEA 4XVTL 4X6FA 1BPVA 2IFFL 3B5HA 1WZ1H 1MPAH 1ZSDB 1BVLB 2WW8A 2JK5A 2ZUQC 4S1QH 4PJGE 5HYSA 3MFFA 2EDOA 4MQSB 4FQIL 3AREC 4OI8A 2Z92A 3CSYB 2P5WD 4M03A 4U0QB 1H5BA 3SKJL 3D18B 5JPMA 3FB5B 4MS8D 4HDIB 3X12B 4GAYB 2JIXB 4KXZH 4GG6B 3HPLA 4MMZC 2E3VA 2VLJA 3I50H 1G7MB 4O2FB 5BMFH 1EHLL 2MJWA 4ZQKA 5EB9A 1JFQH 4G9FA 3P9LA 5CZVL 4Q9QH 5GRYA 4Z0XB 4Y16A 2FX8L 4OCMC 3BZEB 1Q9WB 2BY0A 4CRPA 1EVTC 3RKPA 3FN9A 5A2IH 2VSCA 1JPGA 2D0HA 3QIUD 4JRXA 3ARGA 1XR8A 5INDA 2X4PA 1MEXH 4FQ1H 1U42A 4OV5B 3QCTH 3MNWB 1KN4H 1ZWIB 3IJHB 5FYKU 1AH1A 3C87A 4NCDA 2X4RA 5E2UH 4EBQL 1FO0B 1F4WL 5EZOL 3VI3E 1MWAA 1HI6A 4NQDE 5IM7B 2JCCA 5C7XL 3IFNH 5MI0B 1H3UA 5B3NA 4JFDD 2YMXL 3NPSB 1JZ4A 4JFOB 5GJTH 1CICD 2F5BL 2X4SA 5BS0A 4NQEE 4U1SA 1F6FB 1R3KA 5E2JA 2XXMB 3BJLA 2NXYB 3SDXA 3U4BL 3W5MA 4JY4B 4WW2F 1JPFA 4PRNA 5F6IB 5DEFA 5CJBA 4J6RL 1VFBB 2EYSA 2GEEA 2WP3T 3IDUA 4GMTL 4NO3B 3K80A 1IAKB 2Z93B 2AW2A 1DL7H 1X5AA 4L29A 2DMCA 1EXUA 3VFSB 2NLJA 5ITFA 4NNXB 4HKBA 4N8VG 5IB3B 5F1SA 4PP1C 2HFGH 1I3GL 3ARFB 4G80A 3RVTC 1NLBL 5EORH 4PLJD 2AJ3B 3V0VB 1N7MH 2E9JA 4NRYA 4F15C 2ARJQ 32C2B 2YWZA 4XP6L 3T0EE 4Y19B 1G7JB 2I27N 3P4OB 1NGWB 4D0DB 1XIWA 4JKMA 3D69A 1CXIA 3BPOB 1A6UL 3LB6C 1MY7A 3VFNB 1M7XA 4ELKA 3H7LA 3X3FH 4U2ZA 3NIGF 1CI5A 1I8IB 5JIPA 3JV4B 1NAKL 5DHVA 1KCKA 4P5MB 2WM0A 5IEKB 5JXEA 3RJDA 1P7QD 1HEZA 1F4HA 4O2EB 5T1MB 1M4KA 4UIKH 3PP3H 1UM6H 5EOCJ 4NZJA 2YN3A 4PREA 1Z5LB 4HCRH 1EBAA 1RI8A 2IQ9L 4XCEA 4HK3J 3LPGA 1VACB 2GJZB 1LE5B 4X4ME 4A6YA 2AEWA 4WTZG 1YPZF 3QIBD 4P3DA 1T2QH 3KXFD 3MCLH 4MQTB 3ULVD 3DX6A 5LKNA 2ZG1A 1U41A 1PY4A 1WLHA 1MI5B 2PTTA 4HIIA 1MH5A 4PJBE 1RUKH 1V5JA 4YHIB 5IVNA 1CGTA 2PXYB 1NAML 1BFVH 1OM3H 3UJTH 2O5ZL 4KTEH 4LU5H 4JM4H 3V6OA 2XWJB 2NY7H 2R29H 2XQYG 2EDKA 4ZO8A 3VG9B 1CTNA 1U8HB 5EU3A 3LCYA 3MXVL 2B8OT 5E2VH 4AIXA 3S37H 4ODXB 2P4AB 1EAPA 2Z0BA 3G6JA 1HH6B 3U0TB 3MMEB 3NCJL 2OR9L 3UYPA 4I5BB 1IGCL 4J2XA 2CLZB 3FONA 1ROWA 4X4YB 5F7MC 4PTTB 2D7NA 4P9MH 1WF5A 2OXHA 1VGKA 2HLAA 5HHMB 4X5XA 2RHEA 43CAA 5I1HL 1QSEB 2BY2A 1RJLB 4WHYG 5SWQA 3GSQA 4GH7B 3EO0B 3CDYA 3CVIH 1G6RH 5KVGL 3I02A 4XMLH 5HHPB 1H3VA 2OZ4A 3BIKA 3QWRA 3MGTB 5CGYD 3MCG1 2JJWA 4I13B 5C1MB 5D7LD 4HBQA 3F5WA 5IB2B 3MRQA 3B9EA 5ESQA 1DEEA 5I8EA 2MKWA 5FIEA 5F9WC 4OFDA 2BCKB 3IS1X 2ZOKA 4FQJL 3JUZA 1NCNA 1OARH 4JPWL 1PZUB 4YNYA 1CTOA 4Y4HA 4NZUL 3NH7H 4I3RH 1VEMA 5FKPA 1LK2A 1TVBA 3MLTA 2A83B 4M6NL 5HHOB 1DUYA 5FV1L 5DUBA 1JV5A 5DC4B 4ODBD 3LQZB 5DLML 1QYGH 1FLTX 3TVMC 5HVGB 2ICWB 4FQ2L 2BVEA 3OKLA 4APQD 5KANI 4X7CC 1ETZA 4OTXH 3ULUH 1YEKL 3MUJA 1QP1A 4V1DB 4GAGH 1EH9A 3JWDC 3ZTJH 2BXYA 3EYQC 3HZYB 1UXWA 4X7SL 4HWBL 4MXVF 4GKZA 5EU5B 1UZ8A 4LHUB 4P99A 4UZGA 1OW0A 3RAJL 3HN3A 1TZGL 4P2RE 2VDRL 4L8SB 2AJYH 2E9IA 2DMKA 3VFGL 2NX5B 1GAFL 4TSAL 1OAQH 1Q0XL 3UTTE 1QBML 2Y7QA 1OSPL 1FBIH 2JK5B 4M9PA 1CLZL 3KPTA 5HYSB 5M95B 1AGDA 3MFFB 4G5ZH 2J6EA 2Z92B 1WWAX 4JQIH 5ALBL 1H5BB 3FO9A 5JPMB 1KEGH 5ABDE 3R0NA 4CNIA 4ODTH 3HPLB 3QEQD 1K5NA 1Q1JH 3ULVL 1O7VA 2X4UA 3DXAA 2VLJB 4ZQKB 4WW1A 3GJFA 3HFMH 3P9LB 4G9FB 5D7IA 3MGOA 1GGCL 1HYRC 4NSKA 4Y16B 5GZND 1E4KA 4OZIA 4AEIL 1JPGB 3PL6D 3MREA 3AS0A 4JRXB 1CN4A 1NKOA 3ARGB 1XR8B 3MJ9A 4G6JL 5I15L 2BVTA 5INDB 1GJIA 2X4PB 3VXPA 1K3IA 4WTWA 3QUMA 1FL5A 1NGQL 4XTRC 3VU2A 5HHQA 4KKAC 3H9SA 4Z95L 4V2CB 2XZAH 3RVWD 3V6ZA 5BZDB 5E6ID 2X4RB 4LCWB 4N5EC 4DGIL 4EQ3A 1EJOL 1MWAB 2VXTL 4PD4J 4MA7L 1HI6B 3CFJB 2JCCB 5CS7A 4XC1H 4K94L 4ZO9A 4QHLA 3U9PL 3UEZA 5I1KH 3QCUL 4M61A 5BS0B 2A38A 2ZSWA 4P9HH 1HSBA 2V5RA 1R3KB 4U1SB 5HDQH 1REIA 1B88A 3HNTL 5LXGH 3SDXB 2VKXA 4YEEA 1JPFB 2VE6A 1OWRM 5DEFB 5D2NA 5HTSA 1HHHA 3TA3D 1EAJA 4EUPA 2EYSB 5T3XD 3OKMA 4L3AA 4P5TA 1A7OL 2J12B 5L6YH 4OZHB 2R9HC 2IBZY 1UKSA 1IAMA 2Q7YA 1BM3L 3VWKD 1ZLUK 1A1OB 4L29B 5F7DA 2WWKT 4PJAA 5ITFB 3B2VL 4HKBB 4GBXC 4JAMA 5LWYL 3PXJA 3IDJA 5H94B 1J1OL 1MVUB 4G80B 4XPFH 2WAHA 4JZJA 1IC5L 1PG7X 4Z76A 5E95B 4NRYB 3KLHC 4ORZC 4N90D 1MAKA 2VDOL 1G6RB 1Q72L 1U36A 1BFTA 1E4WH 1XIWB 4P2CG 3D69B 1HOCB 5FYKH 5LVEA 1G9EA 1IKFL 1W72L 5L7XL 1CQKA 4ELKB 5ICZA 2Y9RT 4R6UA 3L3JA 1LP9E 3KLSA 3IRZA 5EBMA 4Y89A 4RX4D 4PIRF 3SCMD 5C0CE 5LCVH 4P4KD 5E9DD 5DHVB 1AJ7H 3NACL 1WEJH 3WNNA 1HEZB 2EXWC 3HRPA 2RR3A 1J8HB 4NGHH 3T09A 4FTVA 1S7UA 1KJ3H 3EZJB 1FYTE 3GBML 3A6BL 4PREB 3GMPB 1IGJA 4N0UA 3I2CH 4UOJA 1ZS8A 4OQTL 4XH2B 1PZ5A 4HJJL 4A6YB 1I85A 1ZKAA 3KJ4B 2ZUTA 3P9MA 1GPOL 2O5XL 4P3DB 3RDTC 4FQXA 4GQ9L 4UTBH 1O0VA 1P4IH 3DX6B 1KC5H 1YJDC 4PJ8C 5CD5D 4H20L 1KPUA 1X5KA 4XHJD 1RHFA 2DICA 2PTTB 3DI3B 1MH5B 4HIIB 3UAJD 4RGNE 4TUKL 2GTZA 4KRLB 4JHZA 4M1CD 4YZFE 4NKIH 4FQLL 2ZSVA 4EDWH 1JF1A 2XN9D 1IILE 3BSZL 5TF1L 5D1QD 4QWWC 2ZG2A 5KVFL 3OJDA 2ITDA 3CXDH 3NVQA 1M7DA 5EU3B 4EDXA 3LKPA 3ZZ1A 5TDOA 1O7SA 4YDLC 1ZXQA 1EAPB 3G6JB 3PQYA 3OTTA 4KJPC 4EUPH 2ZCLH 3QUYC 5BW7A 3D0LB 3NZHL 2LQRA 2ZUVA 4MYWB 3HI6H 3FONB 5F7EL 2C3VA 3SGEI 2WMPA 4GG6E 1PY9A 1VGKB 2HLAB 4IOFC 4X5XB 5JXAL 4KMTL 4K23L 1D5BA 43CAB 1QFHA 3IFPA 3PGDB 3WEXA 2IAMC 3K4ZA 4LHJB 3MBXH 5ILTL 3RWFB 5JIHA 3VD7A 1T3FA 2LAAA 5SWQB 3CX5J 4PJGF 2VLLA 3GSQB 5HVHC 4QXTA 4KMLB 5C6TH 3FB8A 5E1AA 4NM8L 5CEZE 3I02B 1E4JA 2E7HA 3BIKB 3O2DH 3WIHH 5BXFA 4KJYA 2VXSL 1CL7L 3RX8A 4HUKB 3F5WB 3RJQB 3MX0A 4B53A 2DM7A 5ESQB 1DEEB 5HGAB 4Y5YA 5I8EB 2NY5H 5T3XL 3S37X 1T0NA 4EI6B 2ZKHL 2ZOKB 3DPBA 3H2WA 3ZL4H 4E5XB 3C6LD 4YNYB 4Y4HB 3HB3C 2BX5A 3CXHK 5DUMH 4AL8H 3Q6GL 5FKPB 4D9QD 1LK2B 1T7WA 1TVBB 3MLTB 1ITCA 1S5IL 3QDJE 4E9LA 1DUYB 5DUBB 1JV5B 2VLRE 3MRGA 3WJJA 2F8XC 4CU7A 1MUJB 3EJYD 5DD6A 3C8HA 1V3LA 1RZFH 5TQ2L 1ETZB 3SE3C 4IBLT 3LRHA 1FNGA 4NNYB 2XWTA 3WHE1 2CK0L 1N5AA 2GI7A 4ZUVA 4KZEH 4XP1L 3VI3F 1DBML 1CDGA 1BGXH 4JFEA 4GKZB 3ZMRA 4LASH 4P3CL 3STZB 3KJ6H 3V52H 1VSCA 3DVNA 1NMBL 3GHBH 1EUUA 2BNUA 3DHMA 3MLSH 2XACC 3F58L 3QPXH 5C0EA 4U05A 4FA8A 2Y7QB 4L9LA 4ALAH 3RGVD 4IRJA 2GQHA 5DMKA 4JLRA 2QSTA 1AGDB 4L4TA 3IJYA 5J1TC 1EFXA 4JR9H 2XRAH 1T04B 3P40A 3REVA 1TFHA 3FO9B 3DLQR 3S6CA 1WFTA 1GGBH 1FFNB 3K2UL 4ZUWA 4CNIB 5JLZB 4LLVA 1K5NB 3ZDZE 2B4CC 1DN0A 2HT2D 2X4UB 3DXAB 4LPVA 2XOTA 5GGSA 5HI5C 5C0AD 3MOQA 1CIUA 2R2EB 4WW1B 2IG2L 3GJFB 3MJ8A 3MGOB 1OP5K 2QQKH 3KPSA 4NSKB 4OF3A 3SOBL 1MAJA 4X7EC 4CVXA 4I18A 5F9AC 4EIGB 3MREB 1UYWL 4PRPB 4JPIB 3VXPB 2Y72A 3H3PL 1FL5B 1PLGH 3LEYH 3QUMB 5HHQB 3H9SB 4NHCH 4ONGH 2HKFH 4EXKA 3DUUA 3V6ZB 2R56L 2QTEA 2MOVA 2LVEA 1MI5E 3OR7A 4Y4FB 1C7SA 1TLKA 3JXAA 3WMSA 4PG2A 5F3HA 2LTQB 1BZ9A 2FJFA 4HMCA 4QHLB 2LV4A 1PFCA 4K2UH 2OJEA 3PWPA 4M61B 2EC9U 4HGKC 4L3ED 1EJ6A 3RUGE 2QEJA 3RVXC 3OAZK 1HSBB 5KSVA 1MFCL 4NQSA 5HGDA 2Y25A 1EGJL 2VE6B 5D2NB 1HHHB 1R3JB 4EUPB 2P8LA 4KMQA 1WISA 1G84A 2YUXA 4P5TB 3MOBL 3KVQA 3EJJX 1I8KA 1AR1C 2Q7YB 5FDWA 3O6LH 5AWNL 3AM8A 5F7DB 5H8DA 4PJAB 3UCRA 5I73C 3D9AL 2GFBA 5CINL 5MEPA 2DQCL 4JAMB 3IDJB 4KTYA 4N5UA 4LPCA 4RFOH 3HC3L 4JZJB 5C08D 4DN3L 4D0BA 1JPSH 4XNMA 1BD2B 1GRWA 3C2AL 4OLXL 1UCBL 1R0AL 1Z9SA 5BO1L 4PJ9A 4TVSa 1T21A 4PUBL 4KZDL 4HBCH 2VR9A 4P46A 2FHFA 2QHRL 3TM6A 4HUUA 5ICZB 4U2YA 1CFQA 3L3JB 2AK1L 3ECBA 3BZ4A 5EBMB 4ZS6C 3TESA 4JO3H 1I9IH 5GQBA 3BUYA 4XP4L 2X1PA 3FQRA 5I1AA 1FN4A 2OL3L 1HCFX 1GIGH 4FTVB 1S7UB 5HHOE 2VXUH 3PGCA 4TTGA 4N0UB 1KYOK 1IGJB 1UM5L 1EMTH 2HAZA 1WC7A 1ZS8B 5JPNA 4JJ5A 1INQA 1PZ5B 3CSPA 4MVBD 5IKCA 1CCZA 1RIUL 4OLZL 3K74B 3VFMB 3P9MB 3U9UA 5KSBA 6FABH 2YD5A 4FQXB 2W9EL 5D6DA 2WP3O 3EHBD 4R2GB 1YEIH 5SV4A 2XA8H 1KPUB 3R8BB 5CUSH 4KAQL 4RGOH 2GTZB 5CJXC 1OTUC 1EEYA 4R97C 3SHSA 2ZSVB 1JF1B 5HI3D 4YLQT 4NN5B 3RL1A 2HA1A 3OJDB 1M7DB 4HC1A 4EDXB 3LKPB 2YPVH 5TDOB 3DVIA 1FH5L 4GKNA 4OCSH 3E6FA 3QHFL 2R1XA 3PQYB 1EIBA 4PJHA 1Q94A 2ZUYA 4I9WE 3MV7A 4ONOA 4XVSL 3TF7C 3AS1A 4MZ3A 5D93B 2W91A 4MCZA 1CF8H 4H1LA 3V79C 1I1FB 1SJHA 2C3VB 5I1IL 2FEEL 3MNVA 4O51A 2DWDB 2DQJH 2EDYA 3QUZA 1QRNA 4MS8C 1D5BB 5CJQL 2CK2A 3IFPB 1YEFL 3WEXB 4NP4L 3WYRA 2GTWA 4G9FE 4Y2DA 3L5JA 1T3FB 3V5HA 1ZV5A 1IZJA 3OKKA 4DKEH 1I7TA 4D94A 1YA5A 3FB8B 5E1AB 4EI5D 5GS1A 3LPWA 3RX5A 1CU4H 2DM3A 4NPYA 5I8OH 1IQWL 4OF5A 1B2WL 3S34L 3P11L 4KJYB 4Z7QE 5M94B 3QIUC 3U82B 1BZQK 1Y6NR 3V6BR 2XZQL 3WDJA 5IW6A 4Y5YB 4LCWE 1D6VL 3DURA 4NM4H 3VMPA 1OPGH 3O6MH 1F4XH 4M7LH 2JCCE 4WWID 5JQHC 1CFTA 2PN5A 3DUSA 1M71A 1L7IH 4GKOA 4NCC1 2RB8A 5EBLA 4LEOA 1YJDH 2IBGA 4WHCA 1FSKC 2XZCH 3MRGB 1ZMYA 2NY0B 3D6GA 1YN7A 1CICC 5DD6B 4NYLA 1MQKH 5B4MD 5E24E 4X80H 1N8ZA 1W0VA 4JFZH 3SGDH 3MV9B 1FNGB 1AE6L 4LARH 2DJSA 1N5AB 4ZUVB 3H8NA 1NCDL 4P2QA 4NN7C 4OZHE 3SQBA 3W9DA 1VHPA 3GMQA 2W9DH 4JFEB 4JN1H 4OFYD 3AGVA 4UB0H 2D4DA 4HFUL 2A6IA 2VLME 3UJIL 4G8GA 2JJTC 2P5EA 1IFHL 2BNUB 4GLRI 3BRGC 4CMHC 3CCHA 1FC1A 5C0EB 2F74A 2A6JA 1I3UA 2JJVA 3U1SL 2J8UE 1NGPL 4MNQD 4IRJB 4NQED 4PLJC 3NAAH 4JLRB 4L4TB 3IJYB 4N8CL 1EFXB 4YGAB 3OSKA 3GO1L 3EUUA 3REVB 4LHUG 3T1FA 1FP5A 4H1LH 2X10A 4KK8D 3RY5A 1DN0B 2HVJA 5GGSB 1UA6H 3QXTA 5D1XD 1Y18A 2ATKA 3L5XL 5DUPL 2V7HA 1KPRA 3MV11 3MJ8B 1J8HE 5FUCC 4L9DA 5HYSG 5B8CA 4CVXB 4I18B 4JM2B 4IDLA 1AC6A 4HUMB 3QJFA 3CU7A 4QXUH 4Q58C 4X6CB 1LP9F 2KZ1B 2ZZUT 1V05A 4F9LC 3ULUE 5F8RC 2AV7A 4YK4B 3ZKND 3QO0B 3E0GA 4JFQA 1HILA 5DVNA 2AEQL 5B38A 4Y7MA 3DUUB 4XT1C 2FIRT 3CSGA 3OR7B 3C08H 2R0KL 3ULVC 4XPAL 4WWKD 5F3HB 1MVFA 1BZ9B 1DDHA 2FJFB 3V6OE 2OJEB 1KJ2L 3PWPB 3V4VL 4RZCA 4QCIA 4MJ2A 1GOGA 1DTUA 2WBKA 4W4OA 1ZLVH 4QHKJ 4YGVA 1M1SA 3MODL 2XWBA 5KSVB 1MIML 3ARUA 1J5OH 4NQSB 4PRIE 5HGDB 1I1CA 4KHTH 5DWUL 2P8LB 3FZUD 2DYPA 5DJ0A 1WFOA 3VXRE 2Y07H 4HKXA 4WCYL 3TJHD 3SKMA 5FDWB 1MCFA 1NLDL 5FHBH 1CIDA 1N59A 1CVRA 4B7IA 2VIRA 3NBNA 4K94C 5FCUL 2GFBB 5I6XC 4MWFA 5F7NC 1ZGLA 1C12A 1WVZA 5HD8D 3BFOA 3UO1L 3HAEH 4D0BB 2K3TA 2A77L 3KWWA 1J0ZA 4XNMB 3ZKSD 3CUPA 4WO4D 4JFYA 1N5YL 4X7TA 3VGDA 4PLKD 1SJXA 4OM0L 5E2TH 1FNHA 4XVTH 3GSWA 4P46B 2IFFH 1J1PL 3FTGA 4X7FC 1RY7B 4X6EA 4GG6F 5KVEL 1CFQB 2NR6D 5AEAA 5FEBA 3ECBB 1U91A 3BZ4B 4QNPE 5CGYC 4M5YL 3QDMA 4FQIH 3BUYB 1FE8L 2NYYC 1B0GA 2Q7NA 5GRUL 3TFKD 4MXQD 3SKJH 3FQNA 3FQRB 8FABA 3JBG7 5IW3A 3TEUA 4HUWA 5I1AB 1MCLA 3MRFA 2VLKA 1F02I 1I9EA 3E3QE 4KKBD 43C9A 1KB5H 3PGCB 4M7KL 4MNHB 1WC7B 3L6FA 5JPNB 1EHLH 2HMIC 4JJ5B 1INQB 4JVUA 4YDJB 3SE8L 1JPTH 5CZVH 4FXKA 5IKCB 1BWWA 5ENWA 2FX8H 5AZ2L 3U9UB 5KSBB 3ZHLA 3ARYA 3SQOL 3DTXA 4APQC 2XTLA 1OF2A 3SJVD 3IDXL 1OD7A 5JUEL 4ENED 5C0RL 3ARSA 2GY7B 3VW3L 2XNAA 5FO7A 1EEYB 3ZTNL 2IPUG 5EZOH 3RL1B 5EU6A 1F3JA 4ZPTA 1RVFL 2YPKA 5C7XH 4OBRA 1OAYL 1BQUA 3QRFM 1NGXA 2YMXH 4GKNB 3E6FB 5FYKE 1JZ7A 1UT9A 2F5BH 4JFXA 2R1XB 1NMAL 4PJHB 1Q94B 3MV7B 1CXKA 1P84K 2BOCA 3U4BH 4CJ1A 5FAAA 1WBZA 4MCZB 5JW4M 3VGAB 4H1LB 2X1XR 1SJHB 4O51B 3BN3B 3QUZB 1QRNB 5J57B 3UMTA 4GMTH 3DXAE 3NCBB 3OMZA 1BVKA 3LZFL 3VDAA 5FECA 2GTWB 2V5MA 4Y2DB 3V5HB 2FEDC 1QO3A 3O9WC 3MLWL 3OKKB 2DLTA 2XFXA 5FCSH 1TENA 2APVA 2B39A 2GSGA 3UTTD 5E08L 3UP1A 1I3GH 1VB9A 5CP3A 4F7CA 1NLBH 4Y4KD 3L3DA 4LCCC 4PRPE 4NPYB 3X3GL 1KB9K 2ADJA 4UAOB 3D39A 4CMMA 4I2XA 1BQHB 3MJGX 4N1EA 3ZDZF 3N1FC 1KLUA 1LVEA 2FLRT 5IW6B 2JB5H 4RFEA 3G9VA 2V2TA 1YEGL 3DURB 4OB5L 2XTJB 4N1CA 3RVWC 4NJ9L 1DE4A 1M71B 5E6IC 2AAVA 1R3HA 2DIBA 5EBLB 3CLFL 5T1LD 2EO9A 2CDGB 2YRZA 3O6FA 1YN7B 4M62L 3T0AA 4NYLB 2JJSA 4KPHL 1FYHB 3NIDF 4JHAL 5M7QA 1N8ZB 3HG1D 1U8MA 1W0VB 5I76A 2DN7A 4RGMC 4DUVA 5E8OA 2X89A 3RI5K 4JZOA 1WITA 1IL1B 4P2QB 3KYAA 3UYRH 2IQ9H 4LL9A 5FM4A 5GRZA 3TA3C 2R15A 3W9DB 4XWOD 1Q9KB 2B1HL 5IFJA 4NZDA 2OTWA 3GKWL 4WW2C 3RUGF 3CX2A 2A6IB 4G8GB 2DL2A 2P5EB 3KG5A 3VWKC 4AEHL 4OIAA 1DEDA 2QSVA 3I6KA 2Z8SA 3CCHB 1IKNA 4ZD3L 2F74B 2UUDK 2A6JB 3QXAA 4DW2L 3KYOA 1BD2E 2O5ZH 4U0RB 2VABA 4PG9A 2F53D 4K71C 1JZ2A 1TXKA 5FUZH 4LRIA 3MXVH 3QEGL 5JOEA 2ATPA 3T1FB 1XAUA 4ODHL 4PV9A 3FO2A 3NCJH 1WAAA 3D85D 1LK3L 5FB8A 5CAYB 3BPCA 5J56B 1IGCH 5ID1B 3CZFB 4JQVA 3U0PB 2HVJB 1TCRA 2GJ6D 1FGNL 5BZWA 2DBLH 4M4RA 1Y18B 2ATKB 4P4KC 2V7HB 1KPRB 1BJMA 3GNML 4LDEB 3P4LA 1KB5B 5CSGA 5B3JE 5I1HH 1X6LA 1CT8A 6CGTA 2EO1A 1UADC 3MA9L 3WXVL 2FSEA 4YHLL 4YXLL 3PDDA 3EDFA 2NZIA 2AV7B 2YBRA 1P9MC 4LNVA 1HILB 2NY1B 5CKAA 3TWCL 5B38B 3SKOB 5KVGH 3QJHA 5J3HD 4UBDD 1UKTA 2Z31A 1JI2A 3EBAA 2EE9A 2VZ3A 3QDGA 4S0TD 5C0CD 1FAKT 1DDHB 5CD5C 4HWEL 4XHJC 3UAJC 4YHOL 4RZCB 4QCIB 1WZKA 4YGVB 4M1CC 2XWBB 4FQJH 3I6GA 3MOAL 1OGTA 1I1AD 1FYTD 4NZUH 5D1QC 1MCOL 2NY2B 3PQYE 3C5ZA 4M6NH 4K9EL 1IEHA 2BOBA 3HMXA 5DJ0B 4D0CA 5DLMH 4OLYL 4HKXB 4JQXC 4FQ2H 3JTSB 3SKMB 3B5TA 2YK1L 2GK2A 4DUXA 1N59B 2VIRB 4YFLF 3MLRH 2CRZA 4MWFB 1ZGLB 1C12B 1BWMA 3B8YA 4GRLD 2J8OA 2LU3A 3FN0L 3CPLA 1ODAA 3KWWB 3RAJH 4YWGH 1TZGH 3NFPA 4CADB 4EUPG 2VDRH 2Y1VA 3BKML 3CUPB 2HT4D 4X7TB 5DMGD 4PRHA 2NY6B 2JF1A 1QLEH 4L8CA 1RUML 5HXMA 1GAFH 3OF6A 1JWMA 3VA6A 1QBMH 5IUSA 3GSWB 4BH8A 3FTGB 1J0JA 1QFWM 4GG8A 4X6EB 2HN7A 4TSBL 1CGVA 4Q0XL 1CLZH 3O3BA 1YC8A 1U91B 3MYJA 1H3TA 3WO3B 4GS7C 4XCFH 1CDBA 2JIXD 3NGBC 4LPTA 3FQNB 5IMOA 2ZWLT 8FABB 4HUWB 2DIJA 2ID5A 3MRFB 1QNZH 4QO1A 4R7NA 3AREA 1KCUL 2D7OA 5DJDB 3C6LC 43C9B 5DJ8A 2G75A 1MCBA 2PYEA 4Z7QF 4ZFOA 3L6FB 3IETA 5IHBA 1GGCH 5ENWB 4NO0A 5CEZD 3MV9E 4R26L 3EJYC 4J4PA 2J88L 4AEIH 2GCYB 3DTXB 5KG9A 1JHLL 1OF2B 2JCCF 3W39A 4G6JH 2KUTA 5I15H 1NBQA 5CGTA 1Z9MA 1NGQH 2BXZA 5D4QA 3BH9B 2XNAB 3AY4C 1DJSA 2CR6A 3FJTA 3SDXF 4TUJA 4X0KA 4DGIH 1I8LC 4Z7OF 3IDGB 5EU6B 1F3JB 4FG6D 1EJOH 2VXTH 4ZPTB 4PJ5A 4MA7H 1RZGB 2YPKB 3MBEA 3V7AG 4H26A 4K94H 4DFHA 3WHXB 1NGXB 2R4RL 1WIPA 3CD4A 3QCUH 2NXYD 1I1YA 4JFXB 4L4TE 4MA1B 4OZHF 3RGVC 4OQ1A 3T77A 4DKAA 5J1AA 2BOCB 3HNTH 4M48L 4WUKH 1MCDA 1KCSL 3OAYH 3RNKA 1T2JA 3RVUD 4QT5B 4YPJA 1A7OH 4CGTA 1BVKB 5EU4A 5T3ZD 1ZHKB 4XX1G 5BVPL 5FECB 2J8UF 3S96A 1MRCL 1U95A 1BM3H 1QO3B 2ERJC 2HT2C 4PGBA 2XFXB 3ARFD 1ZLWK 3B2VH 2MQCA 2GSGB 4FHBD 4Y5XC 2WANA 1J1OH 3BE1L 1S7WA 4F7CB 4K8RD 4X6CE 1IC5H 3L3DB 1X5JA 4Y19D 3OAUL 4IS6A 2ADJB 3B5GA 5FKAA 3EDKA 3NCYP 1HDMA 3D39B 4I2XB 2XY1A 4K3JL 2VDOH 1Q72H 3TO4A 1KLUB 4RA3A 2VDNL 2V2TB 5MERA 2VZSA 1W72H 4PRAB 5L7XH 1JYVA 4LLYA 3IDIA 2BHUA 1DE4B 1R3HB 2DTML 5D5MB 3PWPE 5EN2B 4U1GC 1OSZA 3SDAA 4FABH 3NACH 1JYXA 1A7BA 3ULUF 3O6FB 1SEQL 2EEAA 5TE6L 15C8L 2CIIA 5FGCE 3V9FA 5JR1L 3GRWA 3EFFA 1KIRA 1ONQA 4EN3C 5GISL 1HXYA 1U8MB 4UI2A 5I76B 3GBMH 2APXA 5E8OB 3V7MA 1ZANL 2RQ8A 3T3PE 3IT8D 4JZOB 1CGYA 3RWDA 2VQ1A 3LRSA 4OQTH 2V9TA 4HJJH 4U6TA 9CGTA 3MA7B 5IFJB 1JHTB 1E28A 1GPOH 5I9QB 4WI2A 1MI5D 3WNOA 1MFDL 2UYLA 4H25A 5FGRA 1A7QL 2PXYD 4H20H 4P2OA 3E2HB 5GRXG 3I6KB 3DOSA 2PW2A 3LKOA 2LABA 4TUKH 1IC4L 3KHOA 3EOBA 3KYOB 3QXAB 5DJXA 1MCPL 2E9WA 1KCRH 1LO2H 3FQXA 4JCLA 3RGHA 4NWUL 4PG9B 3BSZH 3IKCA 4HEPG 4HH9B 4MX7A 5TF1H 5KVFH 1QUNA 1NFDA 4M1DH 5CBAA 3CXHJ 1F4YL 3HR5B 4KC3B 1MHPH 2EKJA 4PV9B 1ES0A 3FO2B 5GIRA 4TNVK 5CEZL 5FB8B 4XPGL 4W70A 3M1BB 3NZHH 3BPCB 3QG6A 1IM3A 1TCRB 3B83A 5HHMD 3FHQA 5BZWB 4LSRL 2WK2A 3IU3A 5SV3A 5JMRA 5J11C 2PTUA 5JXAH 1FO0L 4KMTH 4NRXA 3AB0B 4K23H 1U8KA 2XV6B 1N0LA 4QTIH 1CT8B 5JORA 2FIKB 4ESKA 5KZCB 1A7RL 1Z3GH 3WV0A 2EH7L 5E8NA 4QNPF 1LEKA 2L0DA 5KSBE 2YBRB 3M17A 4MVBC 1E4XI 4NM8H 3GSVA 1VGEL 3QJHB 2O93L 2Z31B 3FQUA 5CCKH 5FGBC 3FMGL 2VXSH 1CL7H 3EHBC 4GQPH 4HAFA 4FQPA 3KR3L 1S7RA 2F19H 1S3KL 4BKLA 5T3XH 1CD1A 5IQ9B 4N68A 1NL0L 1KTDA 4GMSH 4JKPL 4LPUA 1X4YA 5D96C 4HKZA 3I6GB 5LBSL 4MAUL 3TIEA 3IXTA 5T3ZL 1F00I 4XCNA 4FXLA 5HI3C 5HHOD 2BNRE 3AC0A 1KPVA 2P42B 3Q6GH 5TQ0L 4PJHE 3R1GL 1S5IH 3MV7E 3OGCA 1R3LA 2PCPA 2BOBB 4D0CB 2LU7A 2XQBL 4L8BA 3U30B 4M6ML 3Q5TA 4K8RL 4V1DD 3TZVA 4AQOA 3AS2A 5ITBH 5TQ2H 3LKSA 1C5BH 4MJIE 1TTFA 3PE9A 4KTDH 2CK0H 2WIMA 1G1YA 5ICYA 1PJ9A 4PGEA 1DBMH 2GK0A 4MB5A 5IVZA 3UDWC 4KUZH 1G0DA 1MFBL 3CPLB 1A7NH 1A1NA 2RBLA 3LAFA 1OQOA 2NX5D 4OCRH 3NFPB 3DX8B 1NMBH 2A0LD 3MRPA 1JNNH 4PFEA 3B3IA 3F58H 2OX5A 3TYGH 4NCC2 4L8CB 2ZG3A 1FNAA 5F6HI 1ADQA 1JWMB 4K07A 1WGOA 4RMRA 3CVHA 4ZXBB 4GG8B 4EI5C 3OB0K 2CR3A 4I9WD 4JKKA 3O3BB 4I77L 4OD3L 1F58L 4LLMB 1W2KT 3MYJB 1QLRA 3IDNA 3V4PH 2XTJE 5I75B 3WKML 1KXTB 3OR6A 3BGAA 4RMUA 3GI9L 3FAWA 4TTDD 3DRTA 5IMOB 4BQ6A 4C56A 2VLJD 3K2UH 5DVMA 4YHNA 4DK6A 1AP2A 1AXIB 3P0VL 3BISA 3QPQD 4R7NB 3AREB 3U6RA 1BF8A 3F12A 4G9FD 1YMHA 5DJ8B 4Y16D 4U1IA 2G75B 5HDOA 2PYEB 4ZFOB 1K6QH 2B2XL 3IETB 2IG2H 4P57B 1UEYA 3F7RA 2IH1A 5DXWA 3ARGD 3SOBH 2EDJA 1JF5A 5B4MC 4P2QE 5KG9B 1UYWH 3H9YA 3EJZC 3W39B 3M8OL 3D25B 5HY9A 3DROA 3H3PH 1CE1H 2JELL 4LCWD 4U6YA 5F88A 4HIXL 3E8UH 3P77A 4G8GE 1Q0YH 2R56H 3CFEB 3BDBA 4TUJB 4X0KB 5EUOE 4E41A 4YDKL 4PJ5B 3TH2T 1ORQA 4DGVL 3MBEB 5HI4D 4H26B 5BS0D 4HEME 3IJSA 4FN0A 2GITA 2AJVL 1PYWB 1I1YB 3VJ6A 2A6DA 3T77B 4Q9QL 5J1AB 2A74A 1MFCH 4YE4L 5C2UB 5HDBE 2DJ4A 3LN4A 4H5SA 1EGJH 4PGDA 1B3JA 1KIPA 2EEBA 1KYOJ 3RNKB 3P2TA 1UJ3A 3FO1B 3DGGA 3MOBH 4FQ1L 4KK6D 4PY8I 5EU4B 5GRVK 2UY6A 4WI3A 2E7LA 4LLAA 4HPYL 3QCTL 2MQ0A 3S96B 4NUGL 5AWNH 1U95B 2YRLA 5D8JH 4LGRB 4PYGA 5D1XC 1PKQB 2EKSA 5CINH 5ISZE 5J9PA 2L7UA 2QQLL 4WGWB 1S7WB 2VKWA 5IVOA 3HC3H 4DN3H 1XIWD 5FKAB 3S36L 1HDMB 4XNZB 3CVHH 4KJWD 5DRZA 4GBXA 4OT1L 1TQBC 2WIIA 4OLXH 2X4NA 1UCBH 3OXRA 1INDL 3ILPA 3MV8E 3TO4B 2OCFD 3T0WA 2E8YA 5BO1H 1YC7A 4PUBH 5J6GA 4KZDH 5MERB 1I7UA 3F7YA 3MRBA 1ZLUH 2QHRH 4LLYB 3H3BC 2AK1H 1MJ8L 4QHUA 5B3JF 1KXVC 2Z9TA 5JXED 1Q8MA 1OSZB 3SDAB 1J8HD 2YOCA 4XP4H 1B90A 2CIIB 3QISA 2R2HA 4KI5E 3EFFB 4AM0A 1KIRB 1ONQB 5DVOA 1JK8A 1OLZA 3KPRA 3TBTA 4OZFA 5K9KA 1OAUL 1UM5H 3RWDB 2VQ1B 3LRSB 1UFUA 2OR7A 1BEYH 4EEEA 5JW3L 3WUWA 3GJFK 1RIUH 1OAZL 1QA9B 2I26N 1E28B 2W9EH 4P23A 3K1DA 3TJHC 5F70A 1IGIL 4RAHA 2UYLB 4H25B 4P2OB 3FHAA 3X3FL 5DEGA 2PW2B 1BIHA 1M05A 1CR9H 2DLGA 2UWEA 3G04A 3LKOB 5D72H 3DX9A 4KAQH 3KLDA 4F9PC 3EOBB 1F8TL 5DJXB 4JGMA 5HD8C 1N3NB 2FH6A 1A3RH 3CU1A 5J6HA 3IKCB 4MX7B 2X9XA 4WO4C 1NFDB 4O2CA 1I7RA 4PLKC 2FH8A 1RUAL 1FH5H 3FT3A 3WNKA 1UB5A 3QHFH 1IC7L 3DUHA 1ES0B 1NCCL 5GIRB 3VCLA 1IEBA 1GZQA 1MHCA 1FNLA 4K3EL 2NR6C 2KPNA 3QG6B 4XVSH 1IM3B 2EDEA 2FECL 4HPOL 5EBGA 1YQ2A 3IU3B 5I1IH 4U1JA 3QDAA 7CGTA 3TFKC 4MXQC 2EIZA 4NRXB 1U8KB 1N6VA 1MWAL 2K9UA 1RUKL 1YEFH 5JORB 4NP4H 1OM3L 4KTEL 4KKBC 3W0WB 5E70A 2R29L 5E8NB 4NT6B 4X5WA 1LEKB 4RQQA 1MJUL 2X05A 2OLDA 3M17B 3QWRD 2IAMA 3BPNC 2VXVL 2X40A 3GSVB 5I66A 5E2VL 4DQOL 1VERA 4NQCA 2HFTA 4KI1A 5TDNA 2YSSA 3FQUB 1IQWH 1B2WH 3P11H 3RY6A 4XNQA 2AXJA 1TPXC 4RIRA 5DMIL 4ENEC 3K7UA 5D71L 2DM2A 2XZQH 4XP5L 1S7RB 2BERA 5AZEL 1D6VH 4BKLB 1RIHL 2CUHA 1CD1B 1K8DA 4HGWA 1KTDB 4Y4HD 4QHNA 2H2PD 4HKZB 2P5WE 3ISWA 4OI9A 3IXTB 5HYJA 2ARJA 4NN6C 2ITCA 3BZFA 4XCNB 5IMMA 1GCFA 3BUTA 1KPVB 4K7FA 4PJXE 1TCMA 2GIYA 5B38G 4X7DC 2RIKA 3VXTA 3OGCB 1CLYL 4S10A 3RTQA 2YHGA 1XZ0B 4L8BB 1G0XA 3TZVB 1G6RL 3BHBA 3LKSB 1AE6H 2YA0A 4IHOA 1LGVA 1OT2A 3U2SB 5ICYB 1NCDH 4GRMA 3ES6B 5IVZB 4OZGE 1JMXA 5C0BB 1P6AB 4P48A 2EIBA 3QUKA 1A1NB 1F3RB 3FQTA 4HFUH 1AC0A 2YA2A 4KXZI 3MRPB 1GZPA 1IFHH 2ZP0T 3B3IB 2YA1A 5TF0A 3S35L 2DWEB 1JTTA 2YD2A 3GGWB 3NH7L 3T2NL 5FYKD 3U1SH 3V6FA 3CVHB 5DGRA 4I2XE 4JFDE 5L2JA 4Y4KC 1FNSL 4POZD 5FO8A 1QYGL 1QLRB 3IDNB 2D03L 2FRGP 3GSNA 4A6YL 3GO1H 4R0LA 3JZ7A 3OR6B 1YNKH 5D5ME 4OV6F 2FX9L 3DRTB 2W60A 4JM2F 3DXAD 4C56B 3KYMB 1GGIL 3DGCR 4YHNB 4AENA 1ZGLM 1AP2B 4LVOB 3U6RB 3F12B 3B2UD 1SBSL 1U3HA 4X6CF 4QRRA 1RURL 4U1IB 1U93B 1FZOA 4MCYA 5LGHL 2HVKA 3L5XH 5DUPH 2BC4A 3TP4A 3CMOL 4L5FL 1A64A 1LNUB 2AJYL 2DQFA 3X17A 2IH1B 5IJVA 2HJKA 4PRPD 2YEZA 3EDJA 4LVNC 3H9SD 5EH1A 2JLLA 1DANU 3PP4L 4X4XA 5HY9B 3BPLC 2ICWI 3DROB 5H37G 3MROA 4KKLD 2DRUA 3MJ7A 4Y4FD 1RUPL 4M8QA 5F88B 3P77B 4XWOC 4LPWA 1RHHB 2OI9B 4G42A 4E41B 2F8OA 2R0KH 1T0PB 2DQUH 1ORQB 1OP5H 1FL3A 1JPST 4Z7UA 4F7EA 3WJLA 3IJSB 4OGZA 1KJ2H 2GITB 2Z35A 3GIZL 3FT4A 5KSAA 4ELMA 4HWNA 3VJ6B 2Q8AL 1QR1A 5JW5A 2BNQB 3BGFC 3IDYC 2A6DB 3MODH 1NANH 1MIMH 1YMMB 2A74B 4PRBA 5DWUH 1F6AB 1C7TA 4P5TD 1CLOH 4PGDB 2UVEA 1WAAE 1S9XA 1UJ3B 3D2UA 5DFWH 4DVRL 2ZJSH 3NCFB 2CGRL 3DGGB 1Y0LA 3QI9D 4NJAH 4GAFB 4UOW1 2G60L 4WCYH 2HT3D 4FQCL 1FJ1A 1NLDH 4MD0B 3OAZH 4W68A 2EKSB 1H3PL 3MRRA 5J9PB 3IDMA 4XC1L 1OAKH 4XRCA 1BD2D 1NCWL 1JYWA 3C09C 2A77H 1S7QA 1U8OB 5FYLE 5DRZB 2H6PB 4GBXB 2WIIB 2IANA 2X4NB 3OXRB 3ILPB 4KKCD 5BJTA 5LXGL 4JREC 4OM0H 5J6GB 4ZPVA 1I7UB 3F7YB 1J1PH 3MRBB 5KVEH 5J3HC 4UBDC 4LSVH 4DCQA 1P84J 2X4QA 4QHUB 2FDBP 4ZYKB 1JTPA 1QFUL 2J2ZA 4M5YH 4QGTA 2D2OA 1JYNA 5GRUH 3DO3A 2O26U 4FTVD 2PF6A 5KSBF 2X9YA 1R5WA 2R2HB 3GM8A 4AM0B 1X44A 4JVPA 5ERWA 1JK8B 2HG5A 3KPRB 5ECJE 3TBTB 1I1AC 4OZFB 1IMHC 5K9KB 1GHFH 4M7KH 2LVCA 1U92A 3VXNA 4M1GL 2F5AL 4FQXD 3SE8H 4X8JA 3WUWB 4A2LA 5AZ2H 1BMGA 4R2GD 5FYKL 2AJUL 4XMKH 2LAGB 3SQOH 3B6SA 4WI5A 4P23B 3JVGC 2B0SH 1KB9J 2J6EL 5GSRA 3IDXH 3BQUA 5SWZE 4AK1A 4WHYH 5C0RH 5DEGB 1KENL 1M05B 2UWEB 3G04B 3VW3H 2QADB 3DX9B 5D7LE 5JW4N 4GRLC 4PJHF 1WEJL 5J6HB 4BZ2L 4X99A 1RVFH 1VADA 5EO1A 2HT4C 4NGHL 4MQXD 1OAYH 3PQYD 4O2CB 3HMWL 1KJ3L 4JANB 3FRUA 3FT3B 1P69B 3T2OA 5KW9L 1UB5B 4KWUA 1P2CA 5HPMA 1NMAH 2XT1B 4QTHA 1IEBB 3VCLB 3MJ9L 1GZQB 1MHCB 1H15A 3QUML 4M7LT 5SWSE 3A0OA 4UTBL 1KC5L 1ZLSL 2EYRA 4U1JB 3WNLA 3HTLX 2EIZB 2AP2A 2F58L 1MJJA 2PYEE 1HK6A 3QQ3A 5F1OB 2Q76A 4KQ3L 4EDWL 5C9JB 4NQUA 3MLWH 1HIML 1F97A 1NAMA 4X5WB 1MJ7H 4RQQB 5HGGS 4XPBH 5B21A 3CXDL 5E08H 2ICEA 4HT1L 5I66B 1NPUA 1YY9D 1MELA 2P24A 3X3GH 5IHUH 2YZ8A 1EO7A 3MACL 4RIRB 4Q2ZA 2I60L 1AQKH 1YEGH 4OB5H 5CEYA 4RWHA 1PAMA 4HGWB 1RV6X 3QIUA 4QHNB 1CZ8L 4WFGE 4NJ9H 1R3IH 3RZWA 5HYJB 4YHZL 2ARJB 2ITCB 3BZFB 5IMMB 3MYZA 5MI0C 4FG6C 5CMAB 2NY0D 4K7FB 5GGTA 2DQTL 2HP4A 3QEQE 3OG4B 3VXTB 5CGMA 2DQEH 3RTQB 2NXYC 1KEML 3MV9D 2XKNA 4KPHH 5C6TL 5F6IC 3C8DA 3BHBB 5F89A 4IHOB 4U1NA 4JFED 3GBLA 2RCSL 3BWUC 1X5IA 4GRMB 4GXUN 3RPKA 4LVHB 3RVUC 4LLWA 5DD0L 4F80A 2B1HH 3QUKB 5EOCL 3GKWH 2NY5L 5DVLA 3FQTB 4JDVB 1PKQE 4M02A 1NFIB 1U8IA 2GSIB 1NDMA 2X1QA 1U6AL 1GZPB 4AEHH 5HDBF 3GSOA 3ARFC 4IRJD 1A0QL 3EOAA 2AEPH 3CLEH 2WLYA 4AL8L 4ZD3H 1A3QA 3V6FB 4L4TD 4DW2H 3MRDA 1EFXD 2BMKA 3CFCL 5L2JB 1EZVX 4OIIL 2HYMA 5FO8B 4H0GA 3GSNB 5E94A 1RZFL 2R4SH 1QBAA 1TVHA 4R0LB 1N64L 3IVKB 1IT9H 1IC1A 1CDIA 1MCNA 3GBNL 4R4BA 5IJKA 3C8KA 1LK3H 4AENB 1X5FA 2W92A 3TYFB 5IFHL 1U3HB 4QRRB 3F7VA 3K46A 1FZOB 4HWBA 4MCYB 1FGNH 2HVKB 1FZKA 3MPCA 5J0BA 4JM2D 5I1EL 3GNMH 2DQFB 1VKXB 5IJVB 2HJKB 2VDML 1E6JL 2YEZB 1Z2KA 1AD0A 4KUCF 4GW5A 4ODWA 8CGTA 3MA9H 3WXVH 5CFHA 4YHLH 4YXLH 4N90E 3MROB 4JR9L 2XRAL 3MJ7B 4YBLB 4M8QB 4JRYA 3QH3A 3F62A 3L5HA 4G42B 5HYIA 3HR6A 1KELL 2FCBA 1A6PA 3PWPD 4KI5F 3S3PA 2QKIB 1FL3B 4Z7UB 3ZDYE 4F7EB 2PXYC 3QA3A 2N1KA 3H9ZA 4HWEH 2Z35B 5FK9A 5KSAB 3FT4B 4ELMB 4YHOH 1QR1B 1XGPA 2D4FA 5JW5B 1A02N 1WICA 1VFAA 1KN2L 1MCEA 4PRBB 2FLBT 1AD9A 1O5DT 3S5LA 2GKIA 2DI9A 1AIFA 1MCOH 4LCUA 4F57L 3BYTA 3RVVD 4X83A 1S9XB 4K9EH 5IVXB 3GMMA 1F2XK 2EC9T 1Y0LB 2VDKL 3QFJA 4AY0A 1KGCD 1LO0L 1PLGL 2PW1B 4OLYH 4M6OL 4MXWL 4NHCL 4NC1E 3D0VA 4BUHA 3O45A 1AGFA 3T2QA 2YK1H 3U0WL 3GZKA 2IALA 3MRRB 2C3HA 3N1QC 3O2VH 3IDMB 3FN0H 4XRCB 1CDYA 3W0WE 3AVEA 1DQDL 4UV7L 4Y88A 1S7QB 5KS9A 3BKMH 1S7VA 2X1WL 1CWVA 1OGAA 2IANB 4P46D 5BJTB 1FG2A 1RUMH 2DQGL 5EU7E 3AUVA 4ZPVB 1J10A 3LN5A 4F7PA 2AXFA 4TSBH 4Q0XH 1IEAA 3EFDL 4DCQB 3NCYS 2X4QB 3B4NA 5KJRL 3WN5A 3QNZA 4J1UA 3G6DH 3EYVA 3OBAA 3G5ZA 1OWWA 1WSST 3Q3GA 1BJ1J 3MRLA 5ERWB 2HG5B 2ZPKL 2FD6H 2R39A 3RWGA 4W6YB 1AFVL 1JWSA 3VXNB 4U7KA 4X8JB 5F97E 3B8SA 1ITBB 4R26H 3QQNA 1T7VA 2J88H 3DO7A 3B6SB 4HBCL 1KUMA 1JHLH 2ARWA 3BKCL 5GSRB 3BQUB 5IF0A 5C0BE 1P4LA 3TCLA 1QSZA 3QG7L 5TE7L 3SO5A 4O02H 5HGBA 2PTVA 5JNYA 4PJXF 4TUOB 1I9IL 3BVNA 1QBLH 1MNUL 2V6HA 2BVYA 4L8SC 1MQ8A 1WIOA 5J89A 4H88L 1DLFL 3PIQA 4X99B 4ZTOL 5C8JA 4HF5L 1VADB 5EO1B 3RIAK 1JVKA 5T5NG 4HIJA 1FFOA 4ODUA 3MV7D 3G5XA 3FRUB 3LD8B 1GYAA 5ID0A 1P2CB 5HPMB 4QTHB 2CXKA 1MLBA 4MNGA 4OZGF 5EC2A 1H15B 3QUZD 1QRND 5DJZB 4C56E 2CPCA 3AAZA 3ARPA 3GUTA 3QP3A 1YEIL 2EYRB 3P30H 4LPYA 1WIUA 3DSFL 5IBTL 5DS8A 4Y2DD 4RMTA 3CGTA 1MHEA 1MJJB 5CUSL 4RGOL 4TOYL 5BVPH 3QPQC 3QQ3B 1MRCH 3QEHA 2Q76B 5DSCA 1W0WA 2E9BA 4Y16C 4HZLA 3RIFF 3T65A 5D7JB 1AKJD 1X5HA 4H8WL 4XCCL 2ICEB 3BE1H 3O9WA 5D5MF 3OAUH 2P24B 4OCSL 5F9OH 3N9GL 2XTJD 4K3JH 1S7SA 4Q2ZB 2VDNH 4E41E 4PB0H 5CEYB 5ANME 5FM8A 2VZUA 3UPCA 4W6XB 2YPLB 5H2BA 1HKLL 4I8DA 2BNQE 3V4UH 3M07A 5HI4C 4UQ2B 4WEUD 3HS0A 5F1NB 1IGTA 5TDPB 1YMME 2F54A 4F3FA 4LPXA 5TE6H 15C8H 4DKEL 2XKNB 5FM5M 5GS3A 4QKXB 2R0LL 5GISH 1TQCC 4P2QD 1QPPA 3MO1B 2B5IB 3P73A 5F89B 4U1NB 1ZANH 4Y8DC 1FIEA 1X5XA 4LLWB 2WNGA 4G8GD 2P5ED 4KK6C 1MFDH 1NDMB 1AGBA 1J11A 1A3LL 1X5ZA 2P46B 2ICCA 3GSOB 3D87B 1YEJL 1IC4H 3WS6A 1WAAF 3PGFH 4NWUH 1XIWC 3VI4E 5DJCB 1U8NA 4KJWC 2X5PA 2YN5A 3T04D 5E94B 4OFIA 1TVHB 1F4YH 2R0WL 4MJ6A 5B22A 3PP3K 3C8KB 1T5WA 5CEZH 1DSFL 4XPGH 1U2CA 1JGUL 4Z5RA 1RIVL 3ME0A 2AABL 4W4NA 2UUDH 5JXEC 4LSRH 2DLIA 1FZKB 1Z9LA 3VE0A 5I1JH 5C0IA 2HWZL 5MEQA 3GMOA 4B41A 2JB6A 5FM5O 1FO0H 3RPIA 4S1DD 1QLFA 2ORBL 4OUUA 4HC1L 4MA8L 4GW5B 4ODWB 1HINL 3ARBA 1A7RH 2NY1D 4WIQA 2EH7H 3KJ4C 4BZ1L 1DBBL 3UROR 1FLRH 1UJTA 4JRYB 3QH3B 1FFPA 5J8OA 1VGEH 2H26B 5IV2A 1TVDA 1XGUB 1JI1A 3FMGH 4L4VA 2LE9A 2UWEE 3LH2H 4KRPC 5F71A 3SDDA 5CD3A 1SM3H 1BFOB 2AJSL 3BD4A 4NKDB 3KR3H 1HYSD 3AU1A 5FK9B 3V6OC 4DK3A 1S3KH 4I3SL 5BOZG 1XGPB 4PJEE 1NL0H 3B9KA 4JKPH 1VFAB 3MGAA 5GXBB 4KI5D 5LBSH 2NY2D 5BVJA 1ZHLA 1T0MA 5T3ZH 1AD9B 4UU9B 3S5LB 1Z6JT 2WINA 4KVCL 1YPZA 4LCUB 1FAIH 4HXBH 5TQ0H 3R1GH 4ZOBA 4QXUL 3GMMB 3QFJB 2XQBH 4QRPB 3U46A 1YNLL 5IMLB 5D1QA 1YY8A 4K8RH 3D0VB 1JBJA 3O45B 2ADFH 1AGFB 4IEFB 1BOGA 5CWSA 2IALB 5IT2L 4JQXA 3H9HA 5IEHB 5FYJU 4JEGB 5I19L 1A8JH 1MFBH 2C1PA 2NY6D 3ZYIA 5KS9B 1J18A 2P47B 1M7IA 2ZOLA 5D7KD 1S7VB 4JJHA 5JOPE 1OGAB 5IB5A 3WFCL 1J5OL 1T22A 4IIQA 5F1IB 3WHE0 3ZO0A 4J3VA 4C4KT 4WGVB 3ZYZA 3LN5B 4F7PB 2AXFB 2WWMD 1UB6A 3DYOA 3QNXA 1XR9A 1IEAB 4PLNC 1L9NA 4BSWA 4I77H 1MY5A 1F45A 1NJ9A 4JN2A 5FUOL 3WKMH 3WN5B 3QNZB 1ORSA 2G5BA 4XBEL 3EYVB 3HI5L 5HYJE 3GI9H 3G5ZB 4Y4HC 4RAUB 3Q3GB 2H2PC 3MRIB 3MRLB 3P0VH 3DMMB 3E3QC 2C3XA 3T0BA 3RWGB 2YZ1A 4RISL 4RA0C 4C83A 1JWSB 4KROB 4TULL 2C4FU 2WBJA 1G6VK 5TFSL 4J3SA 5JA8B 3L5IA 3SBWC 3DO7B 2BRQA 5GGRY 1UH3A 3P0YL 2EZ0D 3M8OH 3KPQA 5IF0B 1A7PH 1P4LB 3TCLB 2JELH 2IPTL 5HGBB 3UTQA 3O3DA 5J1SC 4AQ1B 3BVNB 4HIXH 2XG5A 1SY6A 2KQMA 4OZFG 1VPOL 4M6AA 4QRQA 3TT3L 3DETD 4YDKH 5C8JB 3PIQB 3BEVA 4DGVH 3WUWG 2BSSA 4HIJB 1FFOB 4OD1H 4ODUB 4WUUA 1KB5L 2OL3A 3PDOA 3G5XB 2AJVH 5ID0B 4JHWL 5I1CL 4ZAKB 4N0FA 4QRUA 1JPTL 1MLBB 4MNGB 3N06B 5EC2B 1ZTXL 4YE4H 1A6WL 4POZC 4FZEH 4HWZA 5DDHA 1GC1L 1D5XA 3MUGA 2YD7A 3AAZB 2CH8A 3GUTB 5DS8B 2K1MA 4EOWL 4ERSH 4QRRE 1MHEB 5SX5K 1PGRB 2CIKA 5AUMB 4HPYH 3TLRA 4NUGH 1RUQL 2EE3A 3B2UC 5DSCB 4FXGA 1W0WB 1WV7T 1CQYA 1K8IA 4FFVD 4HZLB 3T65B 3VH8A 1X7QB 3JTTB 1F42A 1OOAA 4HSQA 4NIKB 2QQLH 3D39D 3O9WB 4HHAA 1J88A 2EE6A 4OGXL 3S36H 4MNQE 2ADIA 4OT1H 2VL4A 5DQ9A 1S7SB 1INDH 1X3DA 3SGDI 4E42A 2BZDA 2C3GA 3G08A 3O81A 3QIWD 3GB7A 4KKLC 4Y4FC 5T1KD 4ZOAA 4MQ7A 4R90L 4PRDA 1JGLL 2LTQC 1ZLWH 1XF4A 1PG7L 2APBA 1MJ8H 5K9QI 4ELME 3O6FD 3TBSA 3D3VA 5E00A 3UBXI 4IOSD 3HS0B 4KDTC 1IGTB 2F54B 4F3FB 1G7IA 3C5SB 2D7QA 2WQ8A 1P53A 2X89D 2FR4A 5D2NC 3OXSB 1LEGA 5L2KA 3NCMA 5IVXE 3P73B 1ND0A 4IRSB 1OAUH 4P5TC 4L3EA 1B4JL 3ZKMD 3SGJC 4EN3A 5JW3H 3ZDYF 4OD2A 1S9YA 1OAZH 2IWGA 3QI9C 2JB5L 1LO4L 4S0SD 2Q3ZA 2HJLA 4NNPL 1PKOA 3MC0A 3BOVA 1IGIH 1AGBB 1H8SA 1SY6H 2DLEA 3EZ8A 4LVEA 5C09B 2QSCL 2D9QB 3OG6B 1EEZB 3BGMA 5F72S 1CGWA 4MB3A 1F8TH 4NKMA 3EO9H 3O4LA 2FO1A 2IANE 1QTYT 2AKRA 3NPZB 5DURB 1G9NH 2V17L 3STLA 1V3MA 4KKCC 1RUAH 5C08A 1KOAA 3BYYA 4MJ6B 1CLCA 1IC7H 3UYRL 1NCCH 3BMVA 1BLNA 4K71B 2NY5C 2H8PA 4K3EH 4Z5RB 3BDYL 3VXSA 4GW4A 1S9KC 4UNUA 1CXHA 4HPOH 3LPFA 1FC2D 3VE0B 5C0IB 3GMOB 4A2MA 2JB6B 5KZCD 3RPIB 5ESVA 2PNDA 5JHLL 1QLFB 1MWAH 4R7DA 3TO2A 4Z77A 1K3ZA 4OUUB 4XB7A 1HXMA 5FYLD 3ARBB 2BRRL 1XH3A 1I85C 1XCTA 1WTGT 1MJUH 2Z31D 1T7XA 1SVCP 1RU9H 4FQXC 2H2SD 4DFIA 2VXVH 5FUZL 1FFPB 3FOMA 1MCSA 4DQOH 4R2GC 4EZMA 5IV2B 5DVKA 2AI0L 5CP7A 4MJ5A 5MENB 4HUVA 4FMKA 4L4VB 4PJDE 3SDDB 4WV1A 1F3DH 1QFOA 4F33A 4XBPA 5DMIH 5D71H 4XP5H 3RHWF 3AU1B 5AZEH 2VAAA 5C70A 5F8QC 1RIHH 3QHTC 2DBLL 5IG7A 4NN5C 4P3WA 3B9KB 3RNQA 1RMFL 4R9HA 5BVJB 1J0YA 1ZHLB 1T0MB 5GPRA 4X9HA 2WINB 1YPZB 1VFUA 3O3AB 4PP2A 5JHDA 4WJ5A 5JO5A 1TDQA 4MQXC 1CLYH 4NQVA 1Z9OA 3U46B 3RWHA 5D93C 2J3SA 3MXWL 3GMRA 1BOGB 1T7YA 5SWZD 1HCVA 5DFTA 5CWSB 3ZHKA 2CDFA 4QOKA 1EV2E 5AYUL 3SJVE 4Z8FH 3H9HB 2OTPA 4GRWB 2ED8A 2EICA 4G7YL 5I8CB 1SVZA 1M7IB 3OF6D 2ZOLB 4D2NA 5DHVH 1SJVA 4O58L 5IB5B 4IIQB 5KANG 4ZXBD 1Q9OA 3BKJL 1YEEL 1GGYA 3S35H 3FFCB 4MSWA 3T4YA 3T2NH 2XKSA 1N2RA 4QEGA 1UB6B 1YY9C 1FNSH 3P3YA 4BSWB 3EYUL 3TN0C 4Y5YC 1WT5C 1NJ9B 2D03H 4JN2B 5SWSD 4A6YH 1ORSB 3CZJA 2G5BB 3ARED 2FX9H 2YPLE 3MLRL 5FDYA 4PJGA 3TV3L 4YBQD 2VC2L 1GGIH 2PYED 1C1EL 5HHXL 1SBSH 1RURH 3X14A 5LGHH 1JHKH 2NY0C 3L3KB 3WJJC 4ORGA 2WBJB 1RK1B 4J4PD 3OB0H 4TRPH 4YWGL 3BRFA 3CMOH 4L5FH 3QSKB 1QLEL 1D7FA 1NEZA 2IBZX 1A1MA 4ZSOB 1FNEB 1A47A 5J12B 4X6FB 1T03H 1P5UA 5IROA 4DGYL 5TH2A 4BK4A 2E6JA 1RK0A 3UZEA 3KPQB 3PP4H 1ZEAL 3DIFA 4YAQA 4G7VL 5DD1H 5EZIL 1MLCA 4LIQH 3UTQB 3O3DB 1RUPH 1NDGA 4PJ5D 4XCFL 5DT1L 3MBED 4WFGD 4QRQB 4OF6A 3I9GH 3NZ8A 3BEVB 5CIPA 4L1HA 1QNZL 3OJ2C 2Z8VC 4AT6A 3L3IA 4WUUB 3WL9A 4BFBD 4D8PA 3PDOB 3GIZH 4OFYA 3IFLH 4GKSA 2Q8AH 5CILL 4N0FB 4QRUB 4NQDA 4O4YL 4KV5E 5D70L 1SQ2N 5FYLL 4HWZB 5DDHB 3LV3A 1D5XB 4HZAA 5ADOL 3HG1E 1MREH 1F11A 1UACL 4DVRH 3TH4T 4NQEA 2CGRH 2LU4A 2OZ4H 2V5TA 4MAYA 2AERT 2YD9A 3RHWK 2D3VA 3UTOA 2CIKB 2G60H 1YYML 3ARQA 4FQCH 4HW6A 4FXGB 3SO3B 3UPRA 2C26A 1K8IB 1CDHA 3VH8B 4Q6IA 1H3PH 3VI4F 1WTLA 4I18C 4JM2C 2H41A 4AIOA 1NCWH 3TO4D 4OFVA 2DIAA 4M3KB 2X4SB 3RVTD 4ODSL 1C08A 1G7LA 4JRYE 5DQ9B 4YK4C 1P6FA 3HMXL 4E42B 2EDBA 4LEXL 3G08B 1BF2A 2Z91A 2F53E 4WUKL 1JZ8A 4I0PD 1FVDA 3GB7B 4PRNB 3V8CA 5J4MA 1U3YA 4MQ7B 1J05A 1JRHH 2H32A 4PRDB 4PG2C 4NZTH 4Z7NE 3RZCA 2AXGA 3SDAD 3T0EA 4G6FB 5F6HJ 3GHEH 1HHKA 1QFUH 3AMKA 3TBSB 4G8FA 3D3VB 5E03A 5EIVA 2RGSA 4ZS7L 3HLAA 3RX7A 4H8WC 2GJ6E 3DV4A 1EXUB 2NLJB 4WRLA 4J12A 3U7WH 1WFNA 1FVEA 2FR4B 2VTFA 1LEGB 5L2KB 1M6OA 3C60A 4X5LA 1ND0B 5I18L 3QFJE 4P59H 3MR9A 4KH2A 4K3DL 4QRPE 5KAQG 2UWEF 1I9RL 1PX4A 3RVVC 4M1GH 2F5AH 3QR2A 4EN3B 2R1WA 3Q6FA 3N50A 3R06A 1S9YB 4OD2B 4WU7A 2C4XA 3R8QA 2AJUH 3LKRA 3AM8C 2HJLB 3MLVL 4P2OD 1UZ6E 4PJEF 2VZOA 4JO2H 2J6EH 3BN9D 4XCYA 2YWYA 5EOQH 2G9HA 4X4MA 1UM4H 1WZMA 1KENH 3BGMB 2E7BA 2PO6A 1HHGA 4NKMB 3O4LB 3F65A 1OGAE 2MKLC 1RJYA 4FABL 2BK8A 5F7KC 5IMKA 4ZFOL 3P4NA 2AKRB 4BZ2H 3GJFH 3QUXA 3HC4L 2AJZA 4PJBA 4P46C 4B0MM 3HMWH 3O8XA 5EULV 4LSQL 2WLZA 5KW9H 1AGEA 4XCEB 1EK3A 4RRPA 1BLNB 4OFKA 3MJ9H 2H8PB 4DEPB 5CEXA 4R3SA 3NOIA 3VXSB 4GW4B 3JUYA 4KY1H 3GI8L 3QUMH 1I3VA 2HFEA 5JDSA 4XI5D 3BT2L 5IBLD 1ZLSH 4NO2A 1NBVL 4PGZA 5F9JA 1D6EA 4KDVA 2F58H 5EOTA 3W0WD 5F3BA 3TO2B 4R7DB 4Z77B 4XPHL 3PHQA 3EKCA 3S97C 1HXMB 1V7ML 4KQ3H 5DRNA 5EIIA 1KCRL 2DKSA 1LO2L 4WFFE 1HIMH 1ZT1A 2UZIL 1UWXK 2VMFA 3K0WA 3FQWA 2NQCA 4M1DL 4PJ7A 1ZHBA 3FCTA 3MJ6A 1A6VH 3FOMB 4HT1H 5D6DC 3VXMA 3WXWL 5CP7B 1MHPL 4MJ5B 2P8MA 4HUVB 2FJGA 1QFWH 5L0QC 3TC9A 3RU8L 3MACH 4WV1B 3TCXA 1FIGH 2H9GA 5CKGA 2I60H 2VAAB 1T83A 2H45A 5IG7B 4HG4K 1T66D 3O4OB 1CZ8H 3RNQB 3SGKC 1CYGA 4YHZH 2Q8BH 4HULB 4H0HB 2EDTA 4QTIL 4PP2B 2DQTH 3KAAA 2N56A 5JHDB 3QCVL 4WJ5B 4Z7WA 5JO5B 1QQDA 5K59E 2G5RA 5BRZA 3TZVD 1Z3GL 4NQVB 1KEMH 5E8EA 4HXAH 2DM4A 3OB8A 4E0RA 1DVFA 3RWHB 2HH0L 1G7HA 3KS0J 2B7DT 4DN4H 3GMRB 3PNWA 3LMJL 1WWWX 4IMLA 3T1WA 3VDCA 5CCKL 2RCSH 5C0BD 2CDFB 4QOKB 4WNQA 1NC4A 1YECL 4JY6A 2YD4A 5DD0H 3MRQB 4Y2DC 3S5LG 2F19L 5EOCH 3F8UB 1IE5A 4GMSL 4BA8A 3SE9H 5LGJA 1U6AH 1CFVH 3FN3A 1QZ1A 4XVJL 1S7XA 1Q9OB 1DQML 4MSWB 4PTUA 4HQQL 3GRWL 1A0QH 4YO0A 4LOUD 5C0JA 4POYA 4UAOC 3CFCH 4P2RA 4OIIH 4L3CA 2Y23A 2APWA 4N8PA 5GGQL 1VFMA 3OKLB 1P5VA 2XTJC 5AD0A 3UTTA 1V8HA 1QBBA 3HHRB 2RFXA 4C56D 5ITBL 1C5BL 3PJSA 3E6HA 5IB4A 1N64H 4KTDL 2R8SH 4IRZL 1JGDA 5ADPL 3GBNH 4PJGB 2DKUA 1UXWB 4I1NB 1JJUA 4KUZL 5IFHH 3SEPA 1C5CL 1FZMA 2F54E 2ILLA 2VQUA 1A7NL 4D3CL 5T3ZE 1UZ8B 3X14B 4ZNEE 1CE6A 2OSLA 4OCRL 4ORGB 1R6VA 1B6DA 4S2SA 5I1EH 1JNNL 3TYGL 5K93A 5F1KC 4DUWA 3WIIL 5JA9A 1A1MB 4QLRA 3I3EA 2VDMH 2R0ZL 3WD5L 1E6JH 4Y5VC 4U1KA 5TH2B 4Y19E 4Z7UF 1RK0B 4X98A 1ZHNA 4LFHG 3DIFB 4YAQB 4ELMF 4LBEA 3V4PL 3LRGA 3S35X 4E41D 3OHXA 1NDGB 5HHNA 4FFWD 4POUB 5C09E 3EYSL 3CAFA 1KG0A 3PG2A 1KELH 3NZ8B 5CIPB 3KHQA 2BNQD 2VDQL 4AT6B 3L3IB 5IVXF 4ZUSA 3WL9B 4D8PB 1YMMD 4OCXL 4GKSB 2NZ9C 2NXZB 4U0RC 1K6QL 5D7IB 1ZVSA 1KN2H 5I17A 4NQDB 4U3HA 2IBBA 4LSUL 2BVPA 4OZIB 4C4KO 4F57H 3MRKA 3PWVA 4AJ0A 4MAYB 2VDKH 4RDQG 1LO0H 2ZCKH 3D5OF 1XMWA 5TJWK 1CE1L 4WHTA 4D9RE 4M6OH 4MXWH 4P5KA 3NIDE 3HE6C 1AHWA 3E8UL 5DD5L 1Q0YL 4HFWA 3DRQA 4N0CD 3U0WH 2HLFD 1N0XL 3ZE2E 5T33L 4Q6IB 3GMLA 2W0KA 3QT2A 3VWJD 2DF3A 4GBXD 3NN8A 4S1DC 1DQDH 1UXSA 3DYPA 4UV7H 4K3HA 1C08B 2ZSWB 3T08A 3TGXA 3ZHDA 1GC1C 1T89A 4LSTH 2NY1C 4C57C 2YC1A 2DQGH 5MENE 1FVDB 1RZJH 3MLUL 3OGOE 1J05B 2H32B 5SX4H 1TQBB 3V8OA 3OKMB 1A9EA 3O11A 1W8NA 2V9RA 3EFDH 1KLFA 2AXGB 3RZCB 3T0EB 5KJRH 1HHKB 2DBJA 4G8FB 4W4OC 3HLAB 1HYSC 2D0FA 5HHME 5D8JL 2VN4A 3KPRD 1LP9A 3JWDL 3EIFA 1QSEE 4KI5C 2GUOA 5IK3A 2NY2C 2ZPKH 3GSUA 1M6OB 5DZNA 3C60B 5F9DC 2EXWD 3NTCL 4BFIA 1AFVH 1LD9A 2VAJA 3MR9B 4RCAA 5TGBA 2Y5TA 4ETYA 4Z76B 4PJDF 3CVHL 3QNYA 4JE4B 2R1WB 4M9OA 4P23D 1B9ZA 3R06B 4WU7B 5D9SA 5GS0D 3LKRB 1J1XL 4NQXA 2C7UA 1L0XA 1WCQA 2FB4L 4XCYB 2QADD 3NA9L 2JTDA 3BKCH 1IBGL 1EHNA 3ELAT 2VJXA 4F8TA 3TBYA 3SDYL 3QG7H 5TE7H 2BDNL 2PO6B 1HHGB 4YIQA 3JVGA 1MNUH 4LSSH 1RJYB 2NW2A 3CH1A 3BD3A 1BBDL 3FFCE 3P4NB 4PBVC 3WUZA 4H88H 1DLFH 3BAEL 4ZTOH 2EXYD 4HF5H 3L3GA 3QUXB 4HX1A 2AJZB 4PJBB 4Q6YA 2JE8A 3O8XB 2Z4QA 3CNKA 3W2DH 12E8L 1AGEB 5B39A 1BEYL 2WWMC 4ZODA 5CEXB 4R3SB 2OTUA 1H9VA 2GW5A 2FWOA 5IW1A 4V1DE 4OLWH 5JDSB 1CL7I 1WWBX 5A3ID 1F13A 2Q1EA 3DSFH 5IBTH 5F9JB 1D6EB 4U4BA 3HZKA 2VL5A 4WDIA 3BZDA 5EOTB 1CR9L 5F3BB 5D72L 3D18A 4TOYH 3RWIA 3PHQB 3ZT6A 1MRDL 5I30H 5JOPD 3PWJA 1URLA 5EIIB 3VFVA 2JIXA 1A3RL 1ZT1B 2NX5E 3L3OA 3FQWB 3VD3A 1MF2L 4ZSOE 4G9DA 2ITDB 4H8WH 1G7MA 4PJ7B 1ZHBB 5KAQF 3FCTB 4XCCH 4HJGA 3VXMB 4HS6A 4Q9CA 1JF6A 4Z0XA 2P8MB 2FJGB 5ALCL 3N9GH 2I07A 2H9GB 5HYJD 7FABL 5C71A 4XVUD 4WUUE 3K4AA 2VLJE 3DETC 3RTQD 1HKLH 2CMRL 4QRTA 4Z7WB 3BRDA 1QQDB 3HB3D 5IWLA 1A21A 5BRZB 2UZYB 1AXTH 1SMOA 3W82A 2VLLB 2D7MA 1NUFA 5E8EB 4E0RB 1DVFB 1D9KA 4QXTB 1G7HB 2R0LH 2DDQL 4JFOA 4OZ4A 3JV0A 3ARDA 4JRXE 3PNWB 3UC0H 4IMLB 3QDJA 1LDPL 2NNAA 5BXFB 3IAGC 2VLRA 4JY4A 2DQDH 5T5FH 4WNQB 1NC4B 4JY6B 4UILH 4CU8A 2MCG1 2YKLL 4TPRL 4LSPL 1T0NB 4OCYL 5LGJB 1A3LH 3Q0HA 1S7XB 2D0GA 3TPKA 4KV5F 4NZRH 4FFVC 3T2PA 3WFEH 1YEJH 4PTUB 4YQXL 1D5IL 4YO0B 5C0JB 5BS0E 1Q9LA 1AI1L 4P2RB 4UV4H 4M00A 1U0QA 5DJAA 3IB4A 4L3CB 3SDXE 5DA0B 4ZTPL 4Z7OE 5C3LD 4EIZC 5AD0B 3MFGB 1OTSD 2RFXB 1FGVL 4CDHA 3PJSB 2R0WH 2XWTB 3E6HB 5IB4B 1JGDB 3QIWC 3P4OA 1U3HD 4D0DA 4I3GA 4QRRD 1NH6A 1DSFH 3QBTB 1JGUH 5GS0L 3VFNA 1EERB 1RIVH 1FZMB 2AABH 3BMWA 5ESAA 1L0QA 1CE6B 2OSLB 3O6FC 5E8DL 1B0RA 3DVNB 4N0YL 4S2SB 1CFSA 3BXNA 2HWZH 3JV4A 5GGUA 2OM5A 5C9KA 2CKBA 4P5MA 3O0RL 2EE2A 5DMJB 3T0DA 1QPXA 1OTTD 2ORBH 3HZMA 3QEUA 5IEKA 4MLIA 4L9LB 4HC1H 4MA8H 2OQJA 4U1KB 1HINH 1YNTA 1PG7W 1HNGA 4Z7NF 4X98B 5JIIA 5DMKB 1ZHNB 1II4E 4BZ1H 4JGJA 1DBBH 1HHJA 4LBEB 3ZKMC 5I9QC 4PJIA 3OHXB 5HHNB 4KJQD 4HS3A 5CZXD 1VACA 3TH3T 1YNKL 2FGWL 3E2HC 4PJCA 3JWOL 3NA4A 2A6KA 2FHCA 5KSAD 4ZUWB 2AJSH 1DANT 1KBGL 3KS0H 4LLVB 1MCWM 1DQTA 4XMPH