2CO4A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
b'DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
molecule tags Fibril protein
source organism Salmonella typhimurium
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co4A00
2CO2A 4OR1A 2CO7A 2CO3A 2FVNA 4PHXA 3UIZA 2CO6A 3UIYA 2AXWA 2IXQA 2CNZA 2CO1A 5D55A 2CNYA 2CO4A
chains in the Genus database with same CATH superfamily
1IM3B 4HSCX 5C0DB 3KLLA 2ARJB 5GZNC 3W9DA 2VDQL 1J05B 3QUZB 2VC2L 5I73B 4ZUWA 1A65A 5E8EB 3FAXA 3HE6A 4JUSA 4EBQH 2ED8A 1KXQA 3GSNB 2MQ0A 4FFWD 1ROWA 4JZJA 4IK6A 4MVBD 1CJYA 1X5HA 4ZTPH 1F97A 3O41A 4OCMC 3STLA 1PZ5A 4NKDB 3QEQD 3PL6C 2DWSA 5DUPL 3FXIC 4E9XA 1Z1WA 2QVTA 3SPHA 3WDHA 2PWGA 4XP1H 3ES6A 4FNSA 2BNRB 4AEIH 3QUXB 2OR7A 5JIIA 5ESAA 4DAGH 2H5UA 4K7PY 3ARBB 3IJHA 1KLFB 2DEWX 4YEEA 3AQYA 4I0PB 3KJ6L 5TQ0H 1I1AC 1UWYA 4GW1A 3U4BL 5IK3B 1N7ML 1NCNA 2MPAH 1KYOJ 3EJTA 4KKBD 1SEBA 3RZCB 3FO9A 4JFHD 3WHE1 1TYEB 3ZL4L 2P46B 3RG1C 3NCMA 5LNDA 2FJGB 3LKPA 1OVZA 5FO8A 2I9TA 3LYRA 3H3PL 4R7NB 5IEHA 2LLNA 4F9LA 4Y9FA 1S5IH 4NSKB 2EO7A 1A6AA 1O7SA 2H47C 2ZF8A 4H1LA 1EQWA 3LNEA 4JJOA 3EDJA 2MH4A 3NCYP 4IJTA 5AVQB 5B4MC 2NY6C 3QO0B 4XCNB 1D6VH 2UWEB 3V6ZA 3O3EB 3R8BB 1L5GB 3RHWF 2MKWA 1OSYA 2OA9A 4Q6KA 5C0DA 1P5UC 3VSQA 1V7NL 2HFGL 4NQED 3IRZA 4I77H 5E8NB 4LKCA 1XFPA 5D7IF 1OSPL 1XCQB 2B4CL 3QDME 5KVDE 2BXYA 2IC2A 5IFHH 5JQ6L 3DIFB 1R3KA 1H3PL 1IARB 4BSJA 1MAJA 2ZOKB 4I87A 3WUWB 3OAWA 4PLJD 5A2IH 2OYLA 4FCAA 1HHJA 1MHEB 5HDWA 4YK4C 3ULUL 1WZAA 1DVXA 5C07E 1MEXH 1SXAA 4Z7NE 3KWWA 3VG0H 5A2KH 3B2MA 5C70A 3EGSA 5JHLL 3OAUH 3CPLB 4OGXH 2LFEA 4KZ0A 3TH3T 3GHBL 3UX9B 5K9OB 1HHKB 3ZE2E 1PJ9A 3VI3E 3LHPL 5DS8B 4XOCA 2D3JA 2PWDA 3MV8D 3BC9A 4ZTPL 1UJ3B 3UCRA 2W60A 4WJ5B 1RPKA 5FUCC 1NLDH 1IEAA 4G7VL 4NKMA 4KK5D 3IMUA 3ARED 3VWJA 3HBZA 4NRXB 4FI6A 2AV1A 4PJAB 3ZTNL 4WI6A 3MRMA 4MA8H 1MLCB 4P2RB 1SOQA 2YO3A 4IOSD 1YMHA 4N20A 1Z3GH 1BVZA 1TEYA 1BMZA 4DEWA 5GRJL 4AT6A 4KOCA 3IMVA 2OQJB 2ZUYA 3RA7H 1IT9L 2DMKA 3JUZA 3VI4A 1NMAH 5KVFE 3MXWH 4M5TA 4O58L 4EDXB 4HZ1A 1XF4A 3C5ZD 2ZKYA 3HKFA 4CN4A 5IJVB 1OP3K 3ZDZE 3FCSA 1UT2A 5DJ0A 1OY3B 5T1MB 2RB8A 4X5WA 4PHZA 2RFXB 3QJFA 1JRHH 4G6AD 2F9BT 3TWCH 4FTVD 1OM9A 2XN9E 3KPNA 2R23A 4LSPH 4X5LA 1CE6B 2WZAA 2YXFA 4FHKA 2RBLA 3L3GB 5KS9B 4AV5A 4J4PC 1JOIA 3G6DL 4FQXA 4U0QB 4B53A 3UJTL 1G4MA 2G5UA 1WEJH 3IMTA 3PJLA 4LF3A 4AXWB 4I89A 3WDIA 1I1AB 3IMBA 1MRDL 2DQEH 4EI5D 6FABL 2FX7H 1AGCA 5GRUL 2IJ0C 1NBZA 4PGBB 1UVQA 1PQZA 1YNLL 1YUHA 4YHPA 5C09A 2Q7YB 4BD4A 5I73C 3QUXC 1QVOA 4YR6A 5HHME 2OLDA 3L9EA 4UM9D 5CF3A 1AGFB 5ITFB 3MBEC 3CVIH 1Q1PA 4DN4L 5CBAA 4HBQA 3U9UB 3C09C 1MHPH 4APXB 3QT2A 3M17A 1F4AA 3OVUB 1JWUA 4HIEA 5I66A 5MENA 2WKGA 1AC6A 2D7PA 3GO1H 4TSBL 3V8CA 5EU6B 2VKXA 2CLZB 2CKBH 2Y7LA 2YD3A 5GGUA 3UTTA 4CMHC 2WCGA 4ELKB 2EXYC 3RWDB 3IFPA 1BREA 3L3DA 3FTWA 3W0WD 4MX7B 2XDHA 3EW3B 3O4LD 5FGBA 4LL4A 4XB3A 1F5WA 3O9WB 4C83A 1BGXL 2A74B 4U1IA 5K9JH 2R4RL 2Y1AA 1MF2H 3RZCA 3GKWH 5AVXB 5IIEA 5IUSA 3TPUA 5CN3A 4PV8B 3TJPA 1WCBB 3WN5A 4XMPH 1E8XA 1MCCA 5C6PB 1IQWH 1J86A 3EOTL 3FT2B 3MLVH 1ZT4A 1E5UI 5DRZA 4ZSOB 1PZ2A 2V8LA 4OV6F 3WY3A 4GQZA 5TDPB 2DI9A 4NJAL 4S0TD 2GUOB 1ZV2A 2AERT 4F15B 3P4OB 3VYNA 4QCIB 5JIMA 3X1NA 4QXUL 1FFQA 2XRAH 1BPLB 1KJMB 1E8WA 5CJXC 1K4DB 5AD0B 2DWYA 2PABA 1X7QB 4ZXBB 5I1GH 1AZUA 4Y5YA 3UJIL 3VWJC 3B8SA 4GBXB 1WA2X 4LASL 4D7PA 4JFDB 1YNTA 3L2MA 5AZUA 1XF4B 5EN3A 3T1FB 3PAUA 1BVKA 2EC9U 4PVNA 1DL7H 1BOGB 3BP5B 1G9EA 4LARL 1YO4A 5I1IL 3R18A 2MCG1 4G80A 2CLZA 3FF7A 4M6AA 5ADPL 3BPOC 3MJ9H 2D03H 2EIMB 4H0LC 4KNTA 3H53A 1IAOB 4PJIB 1JCKA 5CGMA 1JHKL 1I8IB 1CT8A 3ILPA 4JFYB 2X4OB 1FCGA 2YD6A 4FLHA 2Z35B 3KPRA 3UYOD 2G4GA 3P3YA 1CFVL 1KB5B 5EU6E 2YHGA 1WWCA 2WNKA 3T4AB 4AL8C 4EUPB 4YHOH 5IF0B 4FADA 4WJ5A 3UJTH 1AGCB 4E9LA 5JW4N 4KQ0A 1XHHA 4KJWC 1BYPA 1FBIH 1DDTA 1YLBB 2YUZA 2VLME 3ARWA 4PVLA 2YUVA 3TP4A 3OKLB 3ZHKA 2Z64C 3AU1A 4CSPA 3UCQA 4ZZFA 3HBQA 4ODBD 5I18H 3MO1B 4Z76B 4HS3B 5F96L 1PD0A 3PHOA 4PJ7F 1MCDA 2H0FA 4NJ9H 2ZX8A 5I71B 4Q9RL 4J39A 4PTUA 3WOVA 3ME0B 3MRRB 2RFXA 1OAYH 1J8HD 1X4ZA 3FU0A 3OC8A 3WO3B 4PY8J 2OP4L 3MRLB 3G6JF 4M29A 2WIMA 1HXYA 3FT4B 1U91B 5EF3A 1LEIB 1UUNA 3G6JE 4Z7UF 2KZWA 3FB6A 5HYJE 3D3VB 1Y07A 1Z7JA 4MJ6B 3H54A 1EZVY 1TLMA 4E36A 5KVGL 4HPYL 2FGWH 4U05A 4PLKD 5FO9B 3DDGA 1D5BB 1TCMA 4ATWA 2HT3D 2KLRA 2AJZB 2NNXA 3BQVA 1Z9OA 3U2SA 4CL7A 1QSFB 4P23A 2VDKB 3KL5A 4OFDA 4XZ4A 1BD2D 1YA5A 3AXHA 2XT1B 4J2XA 4QO1A 2YD5A 3LVEA 5SWQA 3LN4A 3FQRA 5I28A 2XV2A 1ZT1B 2UYLB 5L2KB 5KYYA 5I1AA 2NY1C 2NUPB 1BIIA 1DSFL 3I02A 2RQEA 3ZTJH 1P6AB 3DRTB 1DJYA 1HHGB 2COVD 4ONHA 3L7EA 3CXDH 1F2XK 4HEME 1F4XH 4F3FA 1YHPA 5DQDL 4AYBA 3L1EA 3GSOA 1S8DA 3BP4A 5IQ7L 2DL2A 4A67A 1F58H 1T89C 5AZ2H 4A2HA 4WKZB 2QGBA 1I75A 2IFFH 2Z7WA 3SBWA 4D8PA 1SUJA 2EEAA 3O6FB 4L05A 2WLJA 4BM7A 3DMMB 2HRPL 4MNQB 4G6AC 4AXWA 2P7TA 4PJEE 3DMMC 4B9IA 5LGKA 4ACTA 1JPSH 1MFBL 2Q8BL 4NO3B 3AS3A 2BO0A 1ZVSB 3C5ZC 2ZWLT 4TF4A 1QNZL 5CP3H 5FO7A 2F7RA 4K8RC 4GNKB 4ZMPA 1I3RA 2FEDC 1SLUA 2E7LA 3CAFA 4PJ5B 4APQD 3S36H 2ADJA 3FFCA 4ZFZA 4F24A 4BQ8A 3IF1B 1KXTB 3KEDA 4UV4H 5HHPB 3DURB 2XXMB 1QO3B 4OVUA 3P11L 4AKOA 1UURA 3PNWB 1QMUA 5D72H 2YSSB 4KZCA 5CZVL 4KKBC 5ACZB 3D06A 3NZ8A 3HC3H 5AKVA 3F7RA 4RAUB 2QFPA 4NDMA 5A2LH 3VXSD 3WNOA 2FEEI 4A38A 1MI5E 3AGVA 5DHMC 3QG7L 4P4RA 1YEKH 4RGNE 1IJ9A 4JQXA 2X4SA 3HFML 4N1HB 1UA6H 5DD1L 3SGEI 4R4ND 2EDRA 2IBZY 4K2UH 3S35X 1I8UA 1A3RL 4ZOEA 1QTSA 1J10A 4I88A 5IQ9B 3A67L 3TVMD 1N3NB 1A02N 2UZYA 3N1MC 3PWPD 3ZE2F 4HUUA 1GY1A 2NY3D 1T89A 4N8VB 4Q74A 4B7IA 2YRBA 4O5LH 1U8MB 4UV7H 5BS0D 4JRYA 4NN6C 1F11B 3FCTB 5DVOA 3VCLA 3HE6B 1JZJA 3HNTH 1RIUL 4JFEB 4YHKL 1TETH 1S7QB 3L8QA 3B4NA 3VXTB 4R97B 5FKAA 2DI7A 2WWKO 3KZ8A 1UB5A 2WLNA 5CLZA 5DD0H 3HG4A 2V5MA 4YDJA 3RL2B 4MNGB 3QUMA 2WXGA 1MRDH 2DQEL 2FSEA 5TE6H 4YBLC 2WN3A 4JRXA 4V1DA 3IKCB 4RESB 1UXMA 3MLUL 2ZG3A 4GMSL 3DPBB 1A0QL 1X9QA 3CXHK 3KWTA 4XCFH 4TNWF 1O5PA 3BZDA 4AGOA 3HRZB 4NO2B 4J3OH 4I13B 1DVFD 2JB6A 4PTTB 2QL1A 2CO7A 1A7OL 4G7YL 1ET7A 5DC0A 2O72A 2AF2A 1H0DA 1QPKA 1CMOA 4YHYB 3QWOB 2YAQA 4P2YA 4U0RC 1MAML 1NUNB 2WM0A 4AQ1C 1HINL 3SPCA 5TPWL 2B0SL 3T71A 1A7QL 4OIBA 2C9VA 2WPGA 3O8XB 1QNIA 3F84A 4XBEL 5GGTA 2BSRB 1QSVA 1USQA 2PW2B 4GUCA 3PDOB 4M3JA 2JI1A 2EIJB 3SCMC 3P9MA 1X5LA 1AG0A 1A9EA 1CXIA 1SBBA 3RYMA 4OGYH 3KLHD 1GMEA 2HLFD 5CZRA 4DKFH 4QTIL 4JN1H 3M8OL 1Q94A 2BHZA 3DTXB 4BH7A 4I5BB 3NJIA 1NIEA 4M48H 1IEAB 2Z7ZA 6PAZA 1IFRA 3V0FA 5DHDA 2Q10A 2ZYRA 2ZUWA 4WHYG 2VNCA 1HHKA 3OWEA 4F8PA 3CSYB 1WCQA 3P4NB 3Q1EA 4WWID 4YDMA 3UJIH 3ZQ9A 1WZ1H 5EPMA 4FEIA 3QAZB 1XGRA 2LGNA 2A6IB 5E4IA 2DLFH 4OU3A 3UO8B 2PKDA 1TZIB 1MIMH 3IMRA 5DHVA 5IW6B 5D1XE 3GRBA 2NNAA 1ZLWK 5HVHB 4XVTL 2VMEA 1O9ZA 2XI9A 4PJ5D 1A2YA 4URTB 5DSCB 4ZX6A 3BZFA 1WJ3A 2KERA 4L2YA 1THCA 3RWEB 3QQDA 3O0RL 1FLRH 3MV8E 3KAAA 3IXAA 4NT6A 3ARRA 1W0WA 3WL9B 2EYTB 1WZKA 3WJJA 4MZRA 4KI5D 4QUOA 5ADOH 1Y6MR 5BW7C 5IM7A 4JFZL 1RFDH 3MJ9A 3RTQD 1WK0A 1RZJC 4ERSL 5DUML 4QJ3B 2GJ6D 1ZD6A 4XMLL 5C0FA 2ZKHL 4M6NH 1PLGH 3DIDA 1M1XA 3ZR5A 1KBGH 4GS7B 4U1GC 2BRRH 4KTEH 4OLUL 1CLCA 4JQIA 3PGCA 3T5WA 4LOUC 4P5SA 5I18L 1HILB 2Q8AH 4OJAA 4RWYL 5I8EB 3WHXB 4XAKD 4XPGL 1HESA 3OLGA 2HJLA 4JQXC 2NCMA 2P3YA 4RA0C 3QIUB 3S4SA 1QI3A 2LW3A 1G0XA 3IJ9A 4F8QA 1W0YT 2J2ZB 5HXMA 5SV3A 3DV6A 4KO6A 1TQBB 4MJIE 1MHHB 5GS1B 1B9ZA 1ZVYA 1MUJB 1BD2A 4NIYE 4O02A 5JHMA 4WW1B 2ZOWA 1TZOA 1XB3A 3U6RA 1OOWA 3V95A 4Z3EA 5BV7B 3QEUB 2G9HB 3QWOA 4Z0XA 3LOWA 3WU1A 1AZBA 2HJFB 4XRCA 4WU7A 3CVHH 1EX0A 4QRBA 4PREA 1RVFL 1S7VB 4WUUD 3RNKB 1DL7L 1F4YH 1C16B 2X4NA 2YA2A 5HHXL 4X9HA 1PNCA 3T77B 3H56A 1T6BX 4NO2A 4Z3IA 3K74B 3KCWA 4MS8C 4LCUB 1GS7A 3SODB 3BIBX 4OQ1A 4E41E 3SIKA 5J89A 3MCG1 3HMXL 3UZQA 3G3LA 5F9JA 5DVMA 2EZ0D 4GS7C 3UBFA 4X6CF 5D5MA 3MA9H 4X0KB 4XVJH 1WT5C 3PLYA 4LRNL 1CGSH 1V27A 4YN3A 1SJMA 3GBNH 4L4VB 3ULSB 2GTWA 2CJ3A 1G7LB 2DM4A 4U6XB 4X5RA 5T8IA 3NA4A 2KZ1B 4Y9GA 3LQZB 1E3XA 4NQQA 1R17A 2FZ3A 4PJ8B 4J28A 3GLDA 4MAYC 1N67A 4XAWL 3T0EA 3RVUD 3ZW3A 3WEBA 1ZHKB 2Q6WA 4KY2A 1G6RL 4NN5B 4QHUB 3CVBA 1XMWA 5EZIH 5HJGA 3X3GL 3UG5A 2W91A 2HB0A 1KC5L 2YSTA 4R0LB 1JVLA 2VLKB 2IPUG 4WUUA 3CK0L 2E9BA 3QG6A 3N5AA 4L3CB 1CB4A 3CUPA 2VDOB 4ES8A 4B0MB 4XMTA 3DO3A 2LFGA 3QR0A 4J3SA 5I6XB 3D8MA 1MJ7H 4N8UA 5C9JB 2WHVA 4UWQB 1VJSA 5L6YL 5J4MA 4ZW3A 2WYHA 3BH8B 3WDJA 2GY5A 3UO1L 3WIAA 2HTKD 2L3BA 2NCEA 2WZ6A 2VR6A 1VPOL 1QRNB 2BRRL 3FT2A 4OLZH 2HLAA 1TXKA 2A38A 2E7CA 3EZJB 1T21A 2BXZA 3EUDA 1W8NA 4GRWB 2IWEA 1YECL 4GAFB 3S96A 3IJ7A 4OZHB 3U0PB 4M4RB 5KZCB 1WD8A 4YL9A 1D2PA 4I8DA 3CX5J 4NM4L 1P7KB 2FEDD 4XP6L 3BYTA 5GIRA 3QQXA 4R2GB 3WNMA 3WBDA 5ICZA 1WE5A 3O9WA 1T5KA 2XTJB 3PP3H 2NX5B 1J9RA 4HIHA 4XRCB 1S5HB 4MMYA 3TV3L 5D7LA 5EORH 4AIXA 1ZLSH 2H3XC 3OG6B 2FO8A 3VFMA 2A9MH 4AOFA 2OX5A 2VXVL 5FUZL 3P2DA 3ZSSA 5D9SB 1EDYA 3MJGX 4P2OD 4M7JL 4WV1A 2XACC 4PGCB 1I7ZB 2HX8A 2F54E 4PJFB 5DI8A 1MG2C 1KPVB 4JFUA 5AOLA 4G71B 2MSPA 4XH2B 4J8QA 3CXFA 5DWPA 2D4DA 3P02A 5DRWB 1IU1A 4R8WH 2EXTA 5I6LA 4H8HA 5DD6A 1EA9C 4EIUA 4DAGL 1IVLA 3FB5B 3MRDA 3P54A 2X4QB 4OFYA 3R4RA 2F18A 3OPUA 3QHZH 5I0ZA 1SHWA 2DLTA 1IGCH 1NUFA 5EMYA 5KVGE 4YWGH 1OGAE 1VACA 5KAQF 4W81A 3SE9H 3C8HA 2FB4L 5KSVB 1OF2B 2BFVL 2F1AA 3NZHL 3OR7B 4PW9A 4R90H 3VH8B 4EI5A 5DFVD 3B3BA 3IDIB 1JGVH 3KWUA 5LJYH 3PHOB 4U1NA 5D4IA 4ZG1A 3OKEA 5AVUB 3AREB 4Z7NF 3QCTH 4FXKB 4Z7UA 2R4RH 3QXAA 3T3MF 1FFOA 3ESVF 4MBRA 3VDCA 1A7QH 2CCWA 2VDKL 3S0PA 1BX2A 3RY6C 5BRZE 5LNGA 3VB9A 1NDGA 5I8KL 3BUYB 1IFGA 2RR3A 1DEEA 2WXQA 2ZUXA 1H3VA 3M7OA 2WB1A 3EYFA 4XX1E 4PJ7A 2J8UA 3CFIC 1X5IA 1NICA 4YDLC 2J57A 2MNUA 3TVMC 2IMNA 1G0DA 4S1RH 3RUGF 3DVGB 3BFWA 4LZKA 4WFGE 2LLGA 5SWSE 3LQAH 5D96B 1EEZB 2APWA 5IWLA 2CXGA 2H6PA 3E9TA 3HI5H 2QR0A 2HT4D 1J8HB 1MVUB 3TBYA 1HZLA 4Y8DC 3H42H 5EIQA 3LDBB 4FFWC 3GJFH 4JRYB 4M1DL 5FECA 3FQXB 1ZLSL 1HHGA 2NY4C 2CBTA 3ARYA 4TQHA 3ARUA 5DJ8A 2PCPB 4L9DA 3TFKC 4Z77A 5IOKA 1OAUH 4LSRH 43C9B 5CLWA 4NERA 1MCPL 3X1BA 2R0ZH 3U4AA 3VU2A 1E27B 1IC0A 3VG9C 1AGDB 2YEQA 1PY0A 1H6UA 1CPUA 1TMCB 1KELH 4JKWA 4RFNC 2R2HA 4I4WA 2FUQA 4JAMB 4X5QA 5F9AC 4UTBL 2M83A 1MIEH 3CDFA 2EDHA 1IKNA 5D2LF 3F12A 3TM6A 2H1LM 4ENEC 2XKUA 4AQEB 2ITFA 4CMMB 4AIEA 2XJKA 1MCNA 1QFWM 2G5RA 4JRXE 3LQAC 2N59A 1YNTF 1B0WA 3FZUC 3NG5A 5HHOA 1Q90A 5AW1B 3US1A 4JRFA 1L9QA 4DW2H 1NLBH 4NKQB 4L1DA 4JY5H 1A6PA 3A3YB 4HH9B 3UJJH 3VXUB 2BW4A 4L2LA 2F61A 1EZSA 4HJGB 3UIZA 1NFIA 1JE6A 2CO7B 4N8CL 2GJ6E 4JHWL 3RPIA 4FQLL 3TOPA 3APMA 5E2UL 4K4KA 4PB9L 4Y16D 2B1OA 1VAHA 5J12B 2RCSH 4MD0B 4YPJA 1T83C 3AM8C 4A66A 1GGIL 1RZ7H 1IC5H 1QBLH 3W0WB 3GSXA 4CVUA 4LEXL 3EDEA 3DO4A 5F7DA 4KNSA 4G8IA 4ELKA 1K8IB 3ZZQA 4XX5A 3CHSA 1SMAA 5KBPA 1OE1A 1CF8L 1KJ2B 4DVRH 5FWRA 1I9JL 4MJ4A 4G9DB 3U9PH 2A74A 2WTRA 3HLAA 3TO2A 1CBVL 1L9PA 3V0JA 3VSUA 3WJMB 1JTTA 3ZUCA 4JDTL 4A2EA 5LVEA 4NUJB 5EIVA 1AJ7H 4D9QD 2FJFB 5INDB 2EDMA 2JXMB 4GIPD 1KEMH 3MRQB 2QSCH 2OL3B 4DO5A 5I0VA 1ULVA 5CCKH 1GGCL 3MRNB 4GG6B 1ZAGA 1G1CA 2PPDA 4JL2A 3HG5A 1ONQA 2QADC 4KDTA 2DEXX 4M62H 4J3BA 2R0KL 5GS0H 3PDGA 5F1IA 5HYJB 2GK0A 3IDJB 1IIIA 4UNIA 3TBSA 4H2CA 1N59B 2PCYA 4PJ7B 5DQDH 5IVOA 2J1KA 5C92A 4URKA 1AVAA 2DQGL 4AG4H 4I1RA 1FNEB 4XO5A 1ES0B 4RFNB 3VGDA 5C08B 3I6LD 2QV2A 3KVDD 4QGTA 5BZDA 3UTSA 4H44C 5I76B 3VMNA 3QXAB 3SDCA 3A4FA 3PCYA 2X53A 3QUZC 3LKSB 5EF2A 3V6OE 4UOW0 5LUMA 3GRWL 5E9DE 5JOPE 2FWLB 3N85H 4A2FA 4XPAH 3ME0A 1SY6L 3UTPE 5JHAA 4FS0A 3H3BC 4LLVB 1U21A 1R5VB 5HHVH 5CFAA 1CWVA 2KMWA 4XN8A 4JQVC 2FSDA 4UOQA 5C0IB 1NDTA 4P2RD 3WIIH 4JY4B 3TESA 4A2GA 3LMJH 2UX6A 3NZSA 4UOW1 2HVKA 3MGOB 4JPVH 5DTFB 4AJYV 2ZUVA 3PWLA 4HFUH 3QDAA 4RGOL 5AVWB 1YEGH 5CSZB 3UEZA 6FABH 3ZKND 2MRYA 3MV9D 4DP0X 1BW8A 2FUTA 1Q9KA 3UJJL 4F7KA 3RIFK 3NZHH 1MKFA 1CLZH 2BNRD 5IVZA 1UWFA 4MD5A 3B2DC 4GSUA 1BF8A 5ADPH 2I9LA 3ASWA 2HFTA 3AREC 3UBGA 1YUHB 5C09B 4PVMA 4LCYB 3E8UL 3VX1A 2JJTA 2BY2A 2DYRB 3DRTA 3NSFA 2F7PA 5IESL 3CHOA 1EO7A 4OUOA 4XC1H 2YJQA 2HA1A 2O5YH 3L3OA 2IH1B 5HVWA 1F02I 2GBAA 2HH0L 3CXHJ 1AGBB 2H0EA 1DUZA 4NPKA 2FQEA 1IKOP 3QDMA 4HCGA 1RP9A 3AY4A 4W4OC 1U8OA 5IMOB 5KAQG 3WKMH 4KI5F 4PIBA 4E41A 2CALA 5FHBL 3NCJH 4MJ5B 2XXCB 2VDMH 3HCVB 2ZUQB 5CMAA 3RWCA 5BUGA 4WFHE 1J1XH 3VRLE 2R83A 3BSHA 4XVOA 3GWJA 3IVKB 1S7XA 4LDCA 4HF5L 2R27A 4MASA 3VXSE 1VEMA 3NH7L 1LHZA 2A83A 3L4TA 2EXYD 1JGUL 4ABQA 4L1LA 4X7DC 4BRJA 4U1LB 5ICUA 3W3BA 1BVOA 1Z9SB 1NCTA 4ODXA 3WHXA 4F20A 1SEBB 4X5XB 3QZNA 2BSTB 4NRZA 1TT6A 1I1YB 1ZRUA 4S1QH 3MV01 3T0WA 1KLUA 5AW6B 4P5MA 4ZPVB 1QOKA 4QHPA 4V33A 4YFEA 1O6SB 5C0FB 1G7PB 4MMXC 3S3JA 2DRUA 4WI7A 3FFOA 1CDUA 4JHZA 3TIEA 1WBZB 4R96B 2BFVH 3N1GC 1EXGA 4PJ9C 2JJVA 1FNSL 4Q7DA 2JELH 4UDUA 2WQAA 5HI4D 4AENA 4YGVA 3FCUB 1ZV5A 4LBEA 3MFGB 4MZIA 4MDRA 1RPUA 1DUYA 5FV1L 3V4UL 3CZJA 5E9DD 4CILA 5JOPD 2X6BA 3WFBL 4PJDE 2E75C 2P80A 5D5MB 2F68X 3WUWA 2C26A 1RZKC 3Q8AA 4HC1L 3S35H 3F7VA 4L4TE 3HI6H 4K71B 4WWKA 1QRNE 4RMRA 5G2NA 4Q0XH 1W72H 4LKCB 1E9QA 4PP2A 1S9XA 4Y16C 4Z7QE 3F7LA 3FZUD 5E56A 1UB6A 5FDWA 1AIFB 2ARJA 3BH8A 3O3EA 4IIQC 5FFOA 3FYEB 2CIIB 4ZRGA 1IQDB 4BZ2H 3OZLA 4KH2A 2JK5B 4JE4B 3HLKA 1IBYA 1S7UA 3L45A 4IMKA 4Y89A 3ZYJA 3U1PA 2MMXA 2NDFA 2VC2B 2NSXA 5IEKB 4PJCE 3H9SA 1ZHLA 4N28A 4Y2OB 4EI6A 1P4LB 4LEOB 1DZBA 2ZPKH 4ODTL 4P57B 3VXOA 1TUPA 5F21B 4HMEA 3IEAA 1G7HB 2MPVA 3GBML 4GKSB 3WMSA 2JI3A 1WO2A 3BIKA 3UTTE 3WEAA 3BMWA 4GRWH 5K1VA 2VISB 3MRKA 5DQJB 1Q9WA 1K2DA 5F7LB 4BZ2A 2K4AA 1URLA 3T2PA 2X4TB 2ZQKA 5H4YA 3OHMB 1YMHB 3OLIA 4IEFB 5IHHA 3GBLA 4UT7L 2PYEE 4XMPL 3C6EA 2DQIH 4YE4H 2AQ2A 2YA1A 1JYVA 3IU4L 3M1BB 4H26B 4Z7WF 4NYLB 1FZJB 4I2XE 5E0FA 2D9CA 2J3SA 4IJ3B 3UZQB 3IF1A 4V11A 2BJMH 1KGIA 3ZSTA 4DH2A 2UX7A 2D7QA 5J6SA 3LNGA 1I53A 3VRIB 3JYCA 2VDRB 3TVMA 1MPAH 1NEUA 3AMLA 2NY6B 2B16A 7PAZA 4CC4C 2PLTA 4WFFE 5CEYB 3AS0A 1DUZB 4OJCA 4P2QE 1SN5A 4BFGA 3KM1A 4WCYL 3POHA 4L4TB 1JPGB 4FCHA 3U46A 3ATAA 2DQHH 2CUHA 3GLAA 3FRPB 5F1OB 3O3BA 1BX2B 2FEEL 3OB0H 1IO4C 4MSWB 1UEMA 2JKWA 4PB9H 2AEWA 4WI0A 2ZUSA 4FP8H 4DETA 4BK4A 3AREA 1EZLA 1W15A 3RX7A 3V2AR 2ZNXA 2XU9A 1NC4A 1CFQB 1HCVA 1XF3B 4PJAF 5FUOH 1EFXA 4K07A 1T22B 1YY8B 3NP3A 4R96A 3OC5A 2AXGB 4J6IA 4H0HB 4K9JA 5T1KD 5FOBB 3ZXAC 3TLRA 3JV4A 4FP8L 2YIHA 3HE7A 3CFMA 4NWTL 4DVRL 5JIKA 3WIHA 1GYWA 3EO9L 1O6SA 5KW9H 2HKHH 3H9ZA 4LGRB 5GGSB 1G9NH 1E67A 2HT3C 2H3KA 4BSWB 3B6SB 3QZLA 4IRSD 4J23A 4WEEA 2AJYH 4EIZC 1RVFH 4Y5VB 3FOMB 1F4WH 4XO3A 5DRWA 2IGLA 4HC1H 4Y4FB 4HXBH 1KT2B 1AG6A 3NJFA 2VWEC 4NNPH 3OKNA 3HI6L 1VADB 2DJ4A 5B1AB 3WFEL 2ZP0T 4W4NA 1G7HA 1IT9H 1H8LA 1J11A 4UZGA 2NY3C 1HHHA 1A4KB 4PWGA 4WNSA 1VLXA 2J6WA 3T65A 3ULVC 1RP8A 3EF4A 2W0KA 2RH0A 4W9CC 1HCFX 2P5EE 1KDIA 4OGYL 4ZD3L 3SQBA 4EZMA 4KXZH 3WTVA 5BNXD 5HI3C 3T8VA 2YK1H 5DRXA 1JPTH 4G42A 1GZQA 3E7JA 5DZVA 1KEGL 3EKCA 5C2BL 2CO3A 4BYHA 5IG7B 2BVOA 4UB0H 3K6SB 1NCGA 3BH9B 4QTFA 4AGPA 3D52A 1JK9A 2FO1A 1ADQL 4MQ7A 35C8H 4S1QL 3NDZE 1ACZA 3NAAH 5FR3A 1RUPH 5KYNA 3TJEH 2NOYA 4OW6A 3ZDWA 5KEZA 2CPCA 5KWYC 5HDBF 2V33A 4OKVB 3I3EA 2OSYA 4KX7A 4OCRH 1CL7L 2CXKA 3QORD 3KDPB 3V0VA 1WAEA 1AACA 2J5LB 5CN2A 3ILPB 2FJHA 2ZF9A 4QIRA 3QI9B 1FP5A 4YGVB 1CGUA 3KLSA 4Y2NA 3DHUA 5JUEL 4Q4EA 5JDSB 1U3HD 1XH3B 2Y69B 4HKXA 2OL3H 4FGMA 1KXVC 2YR3A 2X2IA 4UANA 4DN3L 1CLYH 3NPSC 3O8XA 4YNYB 5TE4H 5B39B 1U3ZA 1URIA 4HIXH 5KYYB 1YEEL 3OXRA 5HYQA 4G6KL 1YN7B 3EHBB 4Y7MA 4UTBA 3OKKB 2HH0H 2F58L 1HQ4A 2AS5M 1EJ6A 4HUVA 3V55A 5AOKA 1TVHA 4OQTL 4PJEA 1CZ8H 2VW6A 4XMVA 5IK3A 1YC8A 3FUMA 2A9CA 5K9KA 2XZQL 1YYCA 3REVA 2B59A 3TO4A 3L3HB 4N0UE 1PZUB 5FYKH 2BOBB 1K8DB 4NQXA 1PJWA 3GFUA 4RFEB 4KQ3L 2XIIA 3QBTB 3DX7A 3BYYA 5D1XB 2JKJA 1D5XB 4GAGH 4W9DC 3JWNG 4JQIL 1T0MB 4R4BA 4WFED 2NZ9D 2Z4TA 3D4GA 1KPUB 3MRCB 1JWMB 4PRPA 4HW6A 1BLIA 3CLWA 5E00B 5AW0B 3SDXF 5E9DA 2GW5A 4JO5A 2VZ1A 4FTVA 1YEGL 4PRIB 3RWIB 4PQXA 5F72S 3MOQA 5G55A 5AB9A 2OKMA 4NWUH 4IRZL 1E27A 1E2ZA 1PX4A 2R2BB 4UB0L 2VRKA 2DQCH 4ZUTA 3BFQG 4LK4A 1JGUH 4JO8A 1DQVA 1XMEB 4J3OF 1SFDA 2J4WL 5LB1A 2O5XL 4RZKA 1BZ7A 5C07D 3B7RL 3OF6A 1QLEH 1TJHL 4OZGB 4KJPC 3R06B 2XQYA 2X4PA 1LILA 4CN1A 1EGJH 1KIUA 2P8PA 3Q3GA 2BMKB 3D0LA 3VH8G 1SNRA 4WKZA 1OAZH 3HLAB 3WTUA 1M1SA 3BP4B 3PWPE 5D2NC 4UQAA 3KPSB 5C0AB 3WFZA 3QIUA 5AOJA 5HJ3A 1S7RB 3ILQC 4X6BA 4XZUA 4JRYE 2ZX7A 3DX6B 4FZ8H 1J9TA 4LSQH 3U36A 1JTPA 1DO5A 2NSQA 1DVUA 2BP5M 5IV2A 5EIIB 1ZK5A 3H42L 3LN4B 5JHDA 2ALAA 1RIVH 2GITA 5C0BB 3VGAC 2ZXAA 3ARSA 2OSXA 5FYKE 1FIGH 4PGJA 1Q8MA 2P42B 2EKSA 1YDPA 4Y1AD 4HUXB 1L7TH 3D09A 5DFWH 4I9XA 1RLBA 4FL4B 4EDWH 3KMDA 4OCNC 2CUAA 1CFTA 2HSIA 3FCSB 3G5VB 4IU2A 1YEDB 4HS8H 3LEYL 1A7RH 5EIIG 3STBA 2VABB 5I76A 2NY6D 5TE4L 3PL6D 5E6ZA 2F74A 1XEUA 3UMTA 1FYTD 5IB1A 1NBYB 3IAQA 1M05B 2E9JA 1R3HB 3GXTA 3T2LA 1UJTA 4XNQB 2WN2A 3D3VD 2NSMA 3QC5X 5F1SA 2FTAA 1MJ8L 1RIUH 1W8OA 2O6CA 2FD6H 3QRGL 5HY9A 5T3ZE 1P5UB 1U58A 2G2RB 4LOUD 5D72L 2PMZA 4ETQB 4IYKA 5LGHH 4LHQB 4LRIA 5IT2H 3SDYL 4AKPA 4JGJA 1ONQB 5LWYH 3LV3A 3VD5A 2J5WA 4MXWL 5ILTH 1F3JB 1MWAB 5E6IB 1CK0L 4HAKA 1MJ8H 2X1QA 5JOFB 3ARFD 3CFBA 2GJZA 4DTGL 2D3VA 3WFBH 4F80A 3SY0A 2P45B 5DD1H 2G5BB 4G6FD 2YD4A 1KDJA 3GS7A 4NO5B 4LQFH 1KTBA 3V9FA 3CFDB 2LAAA 2YZ1A 4JREB 3CCHA 5ITFA 5ICZB 2P49B 2QVFB 1KGWA 3D9AL 3GK8L 4FFYH 1NCCH 2P8PB 3Q3GB 4PRID 1O75A 2PO6A 4PJDA 4B5ZA 1AO7B 1CFSA 4S1DC 5E9DB 4WGWB 4BFOA 2DMHA 2H8PA 4V2BA 2FATL 1RZ8A 4KY1H 2MNWA 5IVXA 2ATPA 4KO5A 5HI3D 2YPLD 3QXTA 1QRNA 3VXRD 3VQ1C 4NQUA 2DYPB 2LOEA 2FX7L 2GK2A 5D7SL 4HG4K 1FSKB 4OLYH 5D1XA 5HDLA 5D1XD 1BM3H 1D9KD 4TMPA 1VB9A 3FH5A 4G7SB 4XOBA 1IC7H 5EUOB 4HCIA 1N64L 1U33A 2Z91A 5CJ8A 3V6FB 1SJVA 2IH9A 1JWMA 4PRPB 4MLSA 3MV8A 2CLRB 4NQSB 2XFGB 3NJJA 3LRKA 4U7MA 4PEEA 1JPEA 5AKRA 3OV6A 5IJVA 4JPIB 2P1YA 1EGJL 1MN4A 4L3CA 4MNQE 3VE0B 1SDAB 5IJBC 2WWKT 4FLRA 2R29H 3H9HB 5IFJA 4GAAA 4G6ML 3RQ3A 4ZSOA 2H41A 4G1EB 2J7LA 2RMNA 3KPSD 5T3ZL 3NACL 4P5TD 5CCKL 1AO7E 2DQDH 2N7AA 4OLUH 1H15A 3MXVH 4FERA 5I16A 1RZKH 2CR3A 2XETA 1XAKA 5M7QA 4H1LG 2EC9T 5DRNB 4XXDB 4OJYA 4HUVB 2P47B 4R3SA 3KPSA 3BIKB 4FNQA 4KUZL 3BUPA 2WTOA 1FV1A 1XEDA 1YEHL 1HK6A 2IGFL 3O6LL 3CZUB 5ICYA 1CFBA 2N3JA 1MCOH 4QYOB 5DJYA 4IOIB 1FGNL 2AJVH 2Q3AA 2TAAA 4U31A 4J6RL 4JK0D 3NIFE 3S5LG 4I2XA 4Q9QL 1BJ1H 4GAGL 1X9LA 1AXTL 1DBKH 4FHBD 2E6PA 1KN4H 2WK2A 2B3RA 2CO1A 3M17B 3E6FA 3KXFB 3QRGH 3VRJB 3EYUH 5T33L 1ZK9A 3FFDA 5I24A 1QRND 3B9KD 2NY2B 3SE3C 2J72A 1MW0A 1MHCA 2ZE0A 4S0HA 3W5NA 3CU7A 1QVOB 1EK3A 4YR6B 1KY7A 2QDWA 1YMMB 2OJEA 3OJDA 3WIHH 4AZUA 1LO3H 2Z0BA 1TQCB 2D7MA 2PO6D 3EYFB 4QWWD 4BIKA 4ZDHB 2VN4A 2IBGA 3O0LA 2W0FB 3HHRB 3R7RA 3RTLA 5BV7C 4P48A 3CFEA 3ZHFA 3SQOL 3RNQB 4R2GD 1FZKB 1REIA 1MLBB 3EO0B 4GJTB 1OTSC 3NBNA 2YOCA 1KIPA 5EN2B 1HOCA 1NMBH 4Y4KC 2AGJH 2ZP8A 3NOIA 2HUHA 1IM9A 1SVCP 1QABA 5IMLA 3GMRB 4KOBA 1UCTA 1LO0L 1T66D 4W6WB 4WNQA 5IIEB 3G7TA 2EO9A 4YDVB 5TF0A 3L1OH 5DO2C 4L3AA 1MAKA 4W9ZA 3E38A 1FNGB 5AYTA 1UOLA 3MR9A 2I9TB 1WC7B 1FYHB 1HILA 4GAJH 4ABUA 1H6EA 2B1AH 4Z0BL 5AL0A 3GMPA 4QRPB 4N24A 4AE0A 1HQRA 2B15A 3LXBA 1BM3L 4LU5L 2AK4A 1NDMA 2ADIA 1AQKH 1ZLEA 2R4SH 3WXVH 4PJIE 5HYIA 3SJVA 4IOFC 4NNYA 3GSRA 2XZAH 4TNVK 1WZMA 1RJCA 5BW7A 3VI3B 1QI5A 5DEFB 4KWUA 3BHBA 4RWYH 1Z5LA 3FSWA 3CLFL 1RMFL 5F9JB 2BSED 4KK6D 4CVXB 2Q7NA 3L17A 3QQDB 3RURA 3K46A 3ELQA 3MRIB 2CUMA 4PJ8D 5EWIL 2LTQC 1QSFE 3K5RA 1UWEH 2GAZA 2P24B 2P5EA 3E3QE 4I18A 4JHVA 3VFVA 1QZNA 1FFTB 2O6PA 1NPJA 2HG5B 2F1BA 4M43H 2QVMA 3AAZA 3BWUC 3GI8H 2Y7QB 3ZZSA 3ISYA 4AM0A 4ETQA 4YC2C 4JQIH 5AW2B 5LO7A 1DANU 2BS71 3RJQB 4DCQA 5IT2L 3HPLA 4AY0A 3U2SB 2J5LC 3S5LA 1NSNH 3QPQD 1UCBH 3Q6GH 4HWZB 1AMYA 3FSVA 1FAIL 4X4ZA 1QKZH 1WIOA 3DK0A 5LXVA 3LKNB 2KDYA 2X89D 3UABA 3VAEA 4PSRA 1KPRB 4IRJD 1PZCA 1T80A 1MJJA 4D9QE 5D7LE 3DV6B 4ONGH 3MCLL 2IQAA 4FZEL 4J4PD 4KQ4L 4K3DL 4X6EA 3NSCA 1VADA 2BH0A 5DMJB 1EPFA 4HJJH 1XR8B 3ZKQD 3QQ9D 4XCEB 4GSDH 3DKHA 4XCNA 2J6EH 5F7YC 2FJUB 4OKDA 3WELA 4YE0A 3K71B 4NNXA 1E43A 1LP9A 5CILH 4IHOA 4YSSA 4P2RE 4Z76A 1U8QA 5C09D 3MCLH 4KQ4H 3U4EA 3KBPA 4H88L 2GIMA 2AJXH 5E1QA 3SKOA 1FRGL 3MLWL 5AVRB 3L5XH 3S34L 4HT1H 2DBJA 3B2UD 1MREH 4KXZI 4U1KA 1T3FB 1R24A 4JPKL 4BV1A 4QHUA 4F9LC 1M7UA 4FKKA 5B39A 1CF1A 2VN7A 3SDDB 2P52A 1OZUA 2AGJL 4WNQB 4XMWA 3UAFA 3KLQA 5LCVH 4FULA 3RKDC 2R29A 5CXPA 4CU6A 1QZ1A 3PAZA 3LKOB 3OHXC 1TJIL 3EYOB 1OTUD 4ZAKD 5C86A 5DK0B 1CYGA 2R59A 5EN2A 1A6UH 2P4AB 2XX1A 4DGYL 1V55B 3QZPA 1S2EA 1T7YA 5BV7L 1QYGL 4BCXA 3UROR 5I1JH 3K2IA 1Q72L 4X42A 3RFRA 1TTFA 3KS0H 5F6IC 2FDBP 1TNMA 4XMKL 5F3HA 4NLHA 4CRPA 4ZFOA 2JIXB 3GO1L 2UY7B 4X50A 4L3FA 5MERB 3B43A 1JFHA 3MAWA 1NIFA 4IRJA 3VGHA 4PB0H 5I19H 1XTLA 2X89A 3WY2A 4NO0D 5GSVA 3BWSA 3O8XD 4CAGA 4D0DA 2ZXGA 5EBGA 4MDJA 2J8UE 4JB9L 3IS0X 4HJSA 2ZWNA 4H5SA 4YXLL 5GZNA 5CEZD 5J1SC 1RV6X 3IPBA 3Q2WA 4JM4H 3HZYA 3LZOA 4KAQL 3MZGB 1GHFH 4NQVB 4P46D 3EJQA 5F7NC 2XQBH 4Z7OB 4WEMB 3SDCC 3VFTB 1JIBA 1U8KA 4BKTC 4DP8X 2KZBA 4WLCA 3IDXH 1AMXA 3FH7A 1C5CL 3BAEH 3KDMA 4PRDA 1O6VA 1G7IB 4JANB 1J18A 4U6VL 3HZKA 4WY7L 3LX9A 4BQ9A 1V7NH 2HFGH 1LP9F 5DR5L 5BZWA 5BVPH 1DEDA 1OSPH 5CCHE 1L6PA 1UGNA 3CFNA 5F0MB 4ZS6D 1IAIL 5HYQB 1I7RA 1X5FA 3S5YA 1CURA 1KLGA 1XIWA 4MRCA 3V7MA 3GJEA 1S7TA 2NDGA 5JHDE 1U8QB 2J43A 2BSTA 2EJ1A 5F97E 2G9KA 5GGUB 3UTTB 4ZTEA 5H8DA 3MBWA 4EZJA 1MEXL 3PUCA 5DJDA 5TQ2H 3SKMA 1WRFA 4M1CD 3D05A 4NHCH 1U6AH 1VEOA 4EN3B 1EH9A 3SBRA 3TWYA 1VERA 1XGZA 1U9KA 3VFSB 3F7YB 3D6GA 3MNDA 2WZPD 2AI0H 4M1GL 1QP1A 3HJEA 3VSVA 4AQEA 1COBA 4H5SB 4UNUA 3Q2CA 1CR9L 4HWZA 5SX4H 1G1YA 3MODL 3PV6B 1AD0A 1AP2B 4Z7AA 2WIIB 3WENA 3HB3C 1PG7W 3KH3A 5FKAB 2DN7A 1RJYA 4DTGH 3OG4B 4OBRA 2CWRA 4E9VA 1TTUA 3U9PL 1OK0A 4WK0B 2Y4SA 4ZFOB 1AYOA 2Q86A 1RZKL 4MTMA 3IK2A 3V5DA 3AS2A 1S9YA 4CU7A 4POYA 5EH1A 4YSAA 3PWJB 1PU0A 4X6CB 3ASOB 5DQ9B 4PHXA 1KGXA 4L1BA 1U3JA 5JW5B 1SXZA 1H8NA 3VD1A 1UH4A 4BH7B 4N5EC 1CGTA 2AXFA 3T6VA 5I17B 3ULVL 1YRKA 3VYOA 4PRBA 5AVZB 2J2ZA 5DUBA 3ZGIA 3US9A 4B9KC 3LPPA 5JNYA 3NJVA 3NCJL 3IJYB 3NEEA 3BP7B 3B7YA 2YPLA 3ESMA 3HG1B 3TL5A 1NCIA 4DP1X 5BV7H 2AQ3A 1BG1A 3OZKA 3ZX1A 5I5RA 3LRSA 5F44A 5JHLH 5L2KE 4M8QB 5BXFB 1SOXA 4GUOA 2O26U 4K5MA 2BERA 5E9NA 2HP4A 4YHKH 1E5ZA 4OCSH 1JF5A 3LEXB 1TZ8A 4NQSA 4GP5B 4KK6C 4ZMVA 2WINB 3CIQA 1T2JA 3HN5A 4G6JH 1HJBC 3MUY1 4PM1A 1WHOA 3OR7A 3UG3A 4AC2A 2QKSA 2VRQA 5HI5C 1TCRB 12E8L 1A5FH 1V10A 1IQDA 4UTAL 1YJDL 4PTTA 1SJEB 3VVVA 1OL0A 1QATA 4HWBA 1AJ7L 2PO6C 4WWPA 3QCUL 5CILL 1D5MA 4WDIA 4IBUA 4MD4A 1DQQB 3MA7A 3JUYA 3L9RB 4K3EL 1RZ8B 4O4YL 2VN3A 1AO7A 2VH5L 3L6FA 3ZTDC 3II1A 4M7LT 4Z7WE 3LS4H 5FWQA 1CF8H 4UNTA 1YZZA 4Y16A 2WQSA 1NCWL 3EHBC 2R0KH 3UYRH 3LIZH 5GS0L 4UDTA 4WCYH 1CQKA 2N7BA 4DP5X 2D7OA 1JRHL 2K9UA 3U7YH 3X2QB 2DJMA 2EH8L 1FG9C 4G9DA 1RUMH 3VW3L 5IBLC 1FVDA 2CAKA 5E95B 3PIQB 4DP9X 3I02B 2ED6A 2J1XA 1EFQA 1QYGH 4IOIA 2YD0A 1Q94B 4WI5A 3S36L 3HZMB 3G04B 1XF2A 4TVPL 5T5FH 1PW3A 4MB1A 3B2UC 1AD9A 3NFSL 4NQEB 4G8GD 5D6CB 4RGNC 2A6KB 1DQDL 3KPLB 5D2LE 4ZXBC 5KYWA 3VJ6B 2HTLC 4K94L 4BDVB 1SLXA 3GNML 5B21A 2R51A 2GABA 3BJLA 3MCKB 3C5JB 3LZPA 4XODA 5ANMB 4JE0A 5GS2H 4UT7H 5I1CL 5IHBA 5I16B 2R2CA 1Z9MA 2FD6L 1FVEA 4FMKA 2GQHA 1D2OA 4LARH 3EJUA 3ES6B 4F33A 5KUKA 1P84K 3LH2H 2HMIC 2E7DA 2YEZB 2PTTA 2R1WB 3RNQA 2DTML 1ZCRA 4W9EC 3O6KH 2IFGA 2M2DA 1H6TA 1SXBA 3EH4B 2YLKA 1KENL 4KI5C 2GJPA 1DHKA 1MHCB 4MHHG 4CC4A 2WBJB 1RERA 3BKYH 3IDYB 3K4DA 4IS6A 3O9WC 4NQDB 2HFFA 3QPQC 1R3LB 1JXDA 4FZEH 1MLBA 3NK3A 4NUGH 5DR5H 3FTVA 5FHAH 2OMWB 3ILDA 2F1EA 4NX0A 2V5YA 3GGWA 4A6YB 2RD0A 2AJSH 5DMIH 2A9ML 4EZKA 1C8PA 5ANME 5A2BA 3BKYL 3PIQA 1F6FB 3T6XA 1NAML 3HI1A 5DZNA 2ZOLB 3AT0A 5AYUL 4D8PB 4XP4L 1X5KA 3GXMA 3VXTA 4D3CH 3NAAL 4PJ8C 3UBXB 4BCZA 5JORB 3QFJB 4P2AA 4OGZA 5LBSA 1GR7A 3HMWH 4F58L 2WUBL 2WBJC 3GI9H 3HC4L 4HH8A 1B2WH 3EIFA 3LJ3A 3QRBA 3W0WE 2Y2YA 1KTJA 2ATAA 2ZAIA 1IAIM 1FPTH 1MCIA 3MLXH 3O3DB 4P5MB 3HKZA 4ZPVA 3N06B 1R3IL 3B9DA 2ZWYA 3H9HA 5IG7A 2HLFC 5E24E 1UXSB 3D25B 4I3RL 2NX5E 5JW4M 1TQVA 5DURD 1UWGH 3LIZL 5ES4B 4GSRA 2PWEA 1KTDB 2DIAA 5KVFH 4HQQL 4QRUA 3W37A 3QJFB 5E6ID 4YGAB 4MA7L 3BQUD 3MYJB 4O4YH 3S6CA 5CCJA 1T7ZA 5GGQH 3VFRA 3NIGE 2VMFA 4JNXA 3ZDYF 4Z3JA 1N9PA 1VENA 1DZ0A 1VACB 1DQKA 5F2FA 5E08L 4CW1A 5DVLA 3UTZA 1AR1C 3CHPA 2VXTL 3MUZ1 1IV8A 1ERNA 2PPFA 1F56A 3V0HA 3U7YL 4PRPD 2FATH 4DGWC 4NOBA 5H2BA 3FB5A 3QIWC 5DA0B 2A9AA 4XPAL 1LP9E 3A22A 4NZRH 2IFFL 2BIQA 3DHMA 4NCC2 4WGKA 5KVDH 3LQAL 1KTCA 4P3CH 4P2RA 1YN7A 4XPTL 2YXVA 2EE0A 4YLBA 3BDYH 5L88H 1MCBA 5EEXA 3B34A 1KNOA 3ETBJ 1UH2A 4M9OA 4C58B 4NRXA 4QAMB 5INCB 3GSUB 4LCIH 4N68A 1KULA 1QSEE 1UJ3C 3GINA 4FNPA 2XCMC 1NL0L 2ZX6A 4JDZA 5ENWA 4Z6AT 1AKPA 2OX5B 1LMIA 2I07A 3MRIA 1MDAA 1V3KA 2Z4QA 3WIHL 2XWRA 4JO3H 3EJJX 4KMLB 2V2TA 3FRUB 4KVCH 4LAQH 5MEQB 4FQIL 1QFWL 2H6PB 4ODSH 4UQDA 3INUL 3MOAL 3WEMA 4NBYB 3CPLA 1J12A 1XL6A 2OFQA 5ELIA 3F58L 2E47A 3HAEG 3WO4C 2P5WE 1OD9A 2I7OA 2B14A 3F3HA 3KJ4B 3QXDA 4G8GB 4F7MA 5FCUL 4YWGL 5DSCA 4MYPA 1G94A 1D5IH 1RZPA 2GJZB 2Z34A 3TJHD 4MCZB 3VQ2C 1S9VB 2VN6A 1UZ8B 4I1NB 4OM0L 1DJXA 1S5HA 4MMYB 1BJ1J 1J8RA 3ZPDA 4XPBH 5TH2B 5HJDA 4TL5A 1YEDA 1KWGA 2YD7A 3COOA 1S46A 4NZUL 2IAMD 4OZHA 3U0PA 5ETUA 2IMMA 4J3UA 1CR9H 5LBGA 2ZAGA 1LM8V 5B38G 3KVPA 4MWFB 4YDLB 3QEHB 4JG9A 4LNRA 4PJEF 3IU4H 1RUML 2GITB 1M4KA 2IPUK 1L4IA 3DYPA 4XN9A 3N42F 3CMOH 5EEYA 1GGIH 1U91A 3EO9H 3QH3A 5E1HB 4QR7A 1CE1H 1T2QL 3NK4A 2AC0A 3GBEA 2F19L 5JA9A 1OARH 3LIUA 2WUBH 1NBVH 2BP0B 4OI7A 4ODUA 5LNEA 4NP4H 3D0AA 4GUPB 4PV8A 4PJ9A 4WHYH 3ABZA 1GTFA 4KK9C 1BVLA 3BKJL 3KDMB 2ZPKL 4PRDB 3EHBD 3P30H 1OEZW 1MW2A 4QRPD 5EU7E 1RULL 2F19H 5ESVB 1MXGA 4FXGB 5DK2B 4B97A 3BRGC 1J8HE 1ZHLB 4Y2OA 1M6UA 3TGXA 2DQHL 4BSVB 5FYJE 1R34A 3JV4B 3HZYB 4NQVA 1S6NA 1TJHH 4X4MA 4UUJB 2VUOA 4BK5C 4YO0A 4DGVL 2CDEA 1A1NA 2I60L 3CC1A 4MDJB 4ZUTB 4HOZA 1L9TA 1NGQH 5JORA 2EUWA 3GMOB 2CA4A 5F7KC 3WNJA 5CZXD 4LOVA 3MXWL 4O58H 4WI0B 3MA9L 4GSQA 2TRHA 4GI6A 3R06A 2BJML 4OZFG 3ZO0A 4PREB 3I3DA 1VGKA 1AS8A 2OR8A 4TPRL 2J73A 4X8GA 5I15H 3V4LA 1A9BA 5HHQB 2C9UA 3DIVA 1XGTA 5MHSE 2CRZA 4H20L 2X87A 4JY6A 1EVUA 1HNFA 4GBXA 1MCEA 4H8WL 1R5IB 4OFVA 2FT8A 1CL7H 4NO0A 1UASA 3EFDL 3CBJB 1IC5L 1MHPL 4HJGA 1OIOA 2XYCA 1WHPA 1LO4L 5IBUG 4F37K 4UV4L 1DLHA 2E27H 3L7FA 4NSKA 5EC2B 2FO4A 3VD7A 1S7TB 5FYLH 3B83A 1E4XL 2Y72A 4B60A 1ZMYA 3N44F 4HIIA 3OAUL 3ZDZB 3I74A 2P5WB 1ORSA 2YMXH 2D2CC 5GRVL 1JF1A 3SKNB 3KPTA 3QUXD 2E27L 2WW8A 4N2FA 3PABB 1E8YA 3FOLB 3MRKB 5DQJA 2DDQH 5BPPA 3V5HA 2VDPB 2YRLA 2J88H 4AGLA 2VE6B 4MNHB 3Q1SH 1QASA 2FJHB 1G7LA 4TTDD 3EYSH 1DJZA 1GIGH 4WEBL 4XPFH 4B9GA 4G9FD 3WYRA 2A5UA 2AV7A 5I17A 3NYKA 2EDEA 2CK0L 1ZGLB 2WYIA 3N9GL 2ZZUT 2RHEA 3FB8A 4DPRA 5KBMA 2WXRA 2IDQA 3CHRA 1U3HB 1LO5A 1WBXA 4KROB 4NNPL 5AUMA 1ZTXE 1UADC 4KO7A 4NGHL 5GGVH 4PJXA 1F3JA 1MWAA 1XF5B 2AEQH 4S11A 2B4CC 2UUDH 4DUXA 3EGSB 5KVMC 2EUZA 2AVGA 2Y3NA 1RJYB 4ZXBD 3QFDB 3OHXB 4PRPE 1PKQB 2FR4A 2OM5A 3ATEA 4BHUI 3ULUC 3B2XA 1S9VA 1ASOA 4RVBA 2ZTBA 2Q7AA 4M7KL 4C4UA 2VR5A 3A6OA 1CDCA 4Z7WA 4NCC1 3NN8B 2QFRA 3K80A 5F6HI 1P1ZA 3LNIA 2NLJA 5ISZA 5EDXA 4LB8A 4FN0A 3L9YA 1EO5A 4NNYB 4AM0Q 4MB4A 3AW5A 3B5GA 4S1SH 4ALAL 5IHLB 2JKNA 4JHUA 1F4WL 3H7LA 4PCSA 4PB0L 2MCPH 1R5WA 4NZJA 3RVUC 3HPJA 4JFXB 1BIIB 3JTTA 1BJ8A 1RD6A 1T04A 1J87A 3FU5A 4FG4A 3CLEH 4R90L 5LN4A 3SGDH 1AQMA 5FA4B 2WJ7A 3WEOA 4DP7X 1UT9A 3FS9A 1FC2D 1RUQL 1V3LA 2BWDA 3DRQA 3IM1A 4OLWH 4OFPA 5C0GA 5EO1A 1W9XA 5KS9F 1XXFC 3MFFB 3GB7B 2NY4D 1UZ6E 4NZTL 1HSAA 4DKDC 3Q8BA 1DQTA 4MJ2A 4ONOA 4P49A 1CICC 2GBVA 4C56B 4IDLA 3L4ZA 4O51A 2D73A 5J57B 1VZGA 3B8YA 3Q13A 2F5BL 3HUJF 5E5UB 3VXPB 3WFHB 4UM9B 1JDDA 4W93A 1T83A 5AOZA 1JS4A 3AY4C 4W4OA 5D9SA 2PR4H 2W60B 2Z3FA 4M48L 3POCA 1VF5C 3MKKA 5DEZA 2AK1H 3CNKA 2YGVA 3PNRB 1YEFL 1I1FA 4KC3B 1H0DB 3ARBD 3GDBA 5GGTH 2DQFA 3MV9A 3UBXI 3Q44A 3RWHA 3ZE0F 4Z5RB 2JNZA 1KYOK 5CHNB 3AVEA 4FA7B 2XV0A 3EO1A 5HJBA 5MHSD 1LYQA 4LPXA 1P7KA 3P4NA 3ARGC 4P9HH 2UWEE 4OCRL 3FTZA 1G84A 1VRSA 1F3RB 4XTRD 4QWWC 3NSJA 1U92B 3PWNB 4X9IA 1LO5B 4Q8BA 4BFIB 4X98A 5I1GL 4JL1A 1EAJA 3GHPA 5AAMA 4PV9B 4Z1PA 4N9GB 1FN4B 4QRTB 3IMWA 1GYCA 1EXUB 2AQ1A 2G75A 3HR5B 1OAZL 2H9GB 3BDYL 5L88L 1GJUA 4HCRA 5KJ4A 2BOBA 4HXAH 3VYPA 3EOYG 1A9EB 3SEPA 1JGEA 5DO2D 3RDTC 2H32A 4JFWA 5K9KB 1ZPLA 1EUUA 2KYIA 1QFHA 2VE6A 2EVFA 4G1MA 3ABLB 2V8MA 4PY7A 4M6ML 1GGTA 4M8VA 3FUKA 5JO5A 2UXFA 1WBZA 1TYRA 3FSAA 4KPHH 5I8OH 2WB7A 1E4KA 7FABL 3V0DA 1PLGL 1T20B 4ZS7L 2QKIA 3SE6A 5KJRH 1A3RH 4AJ0A 2VAAA 2ZUQC 1FWXA 5DD5L 5IWLC 1I9EA 1JZIA 3C2AL 4A63A 5B8CA 3OB0K 2FO4B 1DLFL 3SD5A 2JV6A 3H8NA 3EDDA 2PTUA 1BEYL 4LVEA 4X7CC 4DZ8A 4TSCL 5HVFB 2A83B 1TETL 2MTPA 4BWWA 3F2LA 3SO5A 4QY8B 1E4WL 2IQAB 2VXQH 1WTGT 4CKVX 3QB7C 4YL4A 2ICEB 3AG2B 3SHSA 1J1OH 2XWCA 4V1DB 4X80H 4PJGB 3LXAA 4XOAA 3U7WL 2DTSA 4X7EC 3T04D 1IAII 2BZ7A 4TLKA 4D9RD 5HHNA 1A6UL 1E9OB 4MNQD 1UEYA 3P3TA 5E6UB 4FG6C 5E8EA 5G4MA 4YLCA 3VD0A 5EZJB 3S7GA 3O4LE 3Q9PA 4FQCH 3WJLA 4U1IB 1ZKAA 4X5PA 2A6IA 4FA6A 3WTSA 1GCFA 4JR9H 1FG2B 4L4JA 2X4UA 1C16A 3FUNA 2A2QT 3WEXB 2V7NB 1X5XA 4MX7A 3QHFL 3MRQA 1JMXA 3HE7C 4N2KA 4O02L 1GAFL 3SYPA 2AMGA 4F9PA 2VSDA 4PGZA 5L9DL 1DSWA 5HGHB 4EKJA 4KKAD 4P5KB 1F4HA 5C09E 5J1AB 1X4YA 3D0VB 3VXPA 3WFHA 4DQAA 1TOXA 3IGLA 1TDQA 3BQUA 2CDGA 4IKJA 2FBRA 1YY9D 3S37X 2Z1PA 3C09B 5FF6B 5C9KA 5AZEL 1NC2D 2VCOA 4OZFA 4EEEA 4MAYA 1NAKL 2HVJA 2QT6A 2J21A 2BSDA 5IB1B 1BQHG 3PGCB 4OSUL 4R2GC 1KCWA 3EFOA 3FHQA 3FB6B 2IOOA 4G83A 3CQQA 3VE0A 1AQDB 3PQYD 2HRPH 5FDYA 4CADB 3X11A 5AOMA 1ASQA 1RLWA 1AI1H 1W72B 4JRXD 4OSUH 1BWWA 1FBIL 4KTEL 5I1EL 5DJCB 4P04A 1KBBA 2OZNA 3EJYC 3MLUH 3D3VA 4RIRB 3CVHA 4OZGF 3LEYH 1AOHA 1QBAA 2UZXB 3MRBA 1FYTE 1W6LA 4ZS7H 3FT4A 5JW4R 4IKNA 4KTDL 5E8OA 1E28A 4YHZL 5MEOB 1N19A 1ZEAL 1GW6A 2JQZA 3ETTA 4PTUB 2B1HH 1V54B 4A7SA 2C7UA 1NEZA 3C08H 2LE9A 4HS3A 5CU5A 1F6AB 1PFOA 1AXSB 4HJ1A 1MIEL 4I18C 4TSCH 5I75C 4PRBB 2XWJA 4L5FH 3E6FB 2BINA 3AU1B 2FGWL 2XFXA 2J1YA 1CDBA 3DSNA 2CDEB 3EBHA 5CP7A 1DLFH 4JFFB 1HH6A 4JDZB 1JZFA 4PJFF 2ZKXA 2VDKH 5CSZA 1OT2A 1DBJH 2QDVA 1SMOA 2CBPA 1AZNA 1DVFA 1ZTMA 4RWHA 5INCA 4B0MM 1G9ML 4H26A 4HBCL 4NUJA 1KN2H 2BHYA 5FPIA 1MJUL 4JB9H 4GT0A 1JI2A 1BCIA 2X4UB 5LAXB 4L48A 4QTIH 5JIQA 1D7DA 1WDAA 4HU2A 4I48B 4K5OA 1QSFA 4P23B 2W92A 1N8ZA 1WVZA 2DW5A 2LT9A 5KN5B 5IHUH 3IJEA 3MRCA 3BT0A 4OF0A 5ICXB 3KM2A 4APQA 5DTFA 3RB7A 5EOCH 3RB5A 1ACYH 5CD5C 3NZ8B 5DT1H 5BZDB 3OL2A 1HXKA 2FLRT 5I5MA 2ITDB 4NRYB 2WSKA 3HNVH 1QHQA 3RHWK 1MW3A 3QJVB 3CZKA 2BSSA 5D7KE 3CDYA 1OF2A 1UXWA 4AJWA 4H1LB 1JPSL 1N5AA 3LKSA 1Z5HA 4M6MH 2BNUB 2L7QA 5FLVA 1E65A 4N0YH 4D2NA 1MY7A 3KYMA 3TIDA 5J3HD 1NEZG 3G6JA 3QUYD 2FECI 3REWA 1NWPA 5I1DA 4G8GE 4ZNCD 3LVTA 2ZXWB 5F6HJ 3TBSB 4XZUB 1IEBA 4L5FE 3GBNL 4GW4A 4LPCA 3LQZA 4KUZH 1OP3H 3CN2A 3OGCB 4TNWK 4APXA 3O4OC 3ABMB 1UD4A 3KHQA 2FWOA 3W9EB 3VWKA 3L3DB 3RUGA 3DGGB 2JFCA 3SDCD 1QACA 3SDDD 1DVSA 3D7PA 4M5ZL 3RTQC 3K2KA 2FX8L 1D7FA 4WWNA 1J1OL 2UZYB 1CCZA 2IEPA 2Z9TA 4N2LA 4P3CL 5HBBA 4YPGB 1VEPA 3F64A 1KY6A 4HEMA 3GEWB 4CJ0A 3EOTH 4WAFA 3FQ2A 5E6RB 3JZ7A 1J1PH 1JGLL 2L7UA 5I0DA 1KELL 4U33A 3VFGL 2YS4A 1CDIA 4U4IA 4Z8FL 2VSMB 5TF1L 4IDJL 2EADA 4PGBA 1T0OA 3S2CA 1VGEL 1UM5L 2BSSB 3O2DA 3W2DH 5AW9B 2BK8A 4XNQA 1I1AA 3BVVA 3GJFA 4G7RB 3G5YA 5C0EB 4RGOH 4Q52A 1EMTH 3R7QA 1F8TH 1RKRA 5C2BH 3QORC 2FGZA 3L3GA 3ZL4H 2VW4A 2RIKA 3QVAA 4J3WA 4D9LL 4XWGH 3DXAD 4ETYA 4KTGA 3A4DA 2XWTA 3H4HA 1Z0NA 1LXMA 5L0QB 1HQ4B 1MNUH 3S37L 4MJIB 4BFKA 2OK0L 4TS6A 4Z3HA 5E2UH 1JYNA 2ICWA 1AGDA 1NCJA 4XVJL 5JHDB 4H25A 1QBBA 2JI2A 4PLJC 4MA1C 3V7AG 3ZT6A 1LD9A 3TT3H 2XKNA 3QUYA 5KJ7E 3HPJB 2H1XA 2X4QA 4Y1SA 3PF2A 1HH6B 3VGEA 1WUZA 1TITA 4KPHL 5I8OL 4GMTL 3S4SG 3VWKC 4HKJB 1QR4A 3NABL 3J2PA 4Y7OC 4L0ZA 4XH2A 3W11D 1FVCA 1T03H 3AWFA 1NOLA 2IGTA 3UADA 2FQFA 3DVGA 1B3JA 1AOZA 3OQ3B 1F00I 1TSRA 2VDML 1EDQA 3O2DL 4RMVA 1NUDA 4Z7WB 3LKNA 2W1NA 2FX9H 4XBGA 4Q14A 1OGPA 2X4PB 3TURA 5CBEB 1T5WB 1WFTA 5KANI 3RFZA 3KEHA 3QWRA 5FECB 3SDAA 3S48A 3EDFA 3GLEA 2X12A 3DXAA 2B39A 5E8OB 4BFNA 3CDZA 4FQXB 2C3VB 2CO6B 1F42A 3P0YH 4C47A 3PGDB 1JXJA 5I6XC 5KZCD 3EF7A 3RWHB 3ZDXB 4ZMWA 3IDIA 1VFOA 1XF5A 3AG1B 4M9PA 3PG2A 4ZOCA 3WKQA 5KYXA 2DQDL 3ZIYA 5CGYC 1L9SA 3II2A 3EJPA 3BUYA 4QD2E 5I1LA 2YAOA 3OQRA 1F4YL 5HHXH 4CSZA 1FAIH 3FQWB 5GS3A 1ZY9A 1PYWA 2VB5A 4WO4C 4I5BA 3WTTA 5FUCE 1TLKA 2E86A 4RAVB 2AZAA 4AGQA 1TTAA 4WHTA 4ICWA 2BP3A 3S88L 5F7EH 2E7BA 2ROYA 4MQXC 4TPRH 3ARGB 4DOHE 5I15L 1T0PB 1WPCA 2QMKA 2Q2LA 1Z0MA 3MNWA 4HD9A 4HWUA 1CD1B 3CFQA 1GHFL 2WZ5A 5C0GB 1K2DB 4I3GA 5AAWC 32C2A 4H8QA 1QEWB 1XSIA 4TQPA 5EBMA 1MFEH 1NGPL 4Q58C 4GKSA 4M00A 3MO1A 4ODWA 4C83B 2ZXBA 25C8H 3AM8A 3IJHB 1T04B 3O45A 4RSYA 3ARDD 3UIYA 5L4FA 4XB8A 1EZVX 1RZFL 5CGBA 2QPUA 3KVQA 3U36B 4X6CA 5D5MF 3QJSB 5INDA 2NY5H 3U1SH 4PYGA 4EUPA 2JKIS 1O7DC 1OT1A 1S7UB 2BS9A 2XC8A 5A7EA 1E6OH 2R56H 2V5RA 3KGUA 1KBVA 4OGQC 4LT7A 1AIZA 1S3KL 1P9MA 4XPHL 5LXGL 1XGPB 3E6HB 3KPQA 3QEQE 4W9HC 5DGQA 1LWHA 4HWEH 3V4VL 4B9ZA 1IM3A 2PPEA 3UYPB 3NVQA 4OLYL 2ZOLA 2QHRH 1JXGA 3AC0A 2F8IA 4HGWA 5EZIL 1YEWA 5TFSL 1PZ5B 3BDXA 2YD2A 1FYTB 3D34A 2Z8RA 1YCSA 3K0YA 1N18A 3L48A 4N26A 4ANWA 3OR6A 5JLZA 2A9DA 2YQGA 4KJQC 1RAMA 3CFCH 2FK9A 3DV4A 1N6QL 4A04A 5BMFL 4DN4H 3U30B 2X4NB 3SE3A 4Z5RA 5LG6A 1D6EB 2L0DA 3TC9A 1OCWH 4TUJA 4ABWA 2R1XB 1I8MA 3THMH 1ODUA 3FB7A 2WCSA 2XNAA 2K4WA 3CFTA 1J5OH 3QG7H 5TPWH 1WF5A 5FO8B 2ZONA 4UM9A 3LRGA 1JMZA 3QS2A 2F8VA 1B6DA 4FNRA 4BFBD 1OAJA 3TA3D 4NN7B 5F6IB 3CLFH 1OAKL 4RH4A 3FTXA 1RUKL 2JMRA 4PY7B 2VDQH 1CD0A 2W8CA 3ELAT 4B3VA 1ADWA 4U1LA 3DETD 2VERA 1XAUA 3MV11 2GBUA 4J6RH 5KSBF 4HSAC 2VXTH 3D4ZA 2PN5A 4QXWA 4GXVL 2VAAB 4BQBA 4IIQB 5I1HH 1TMQA 4BE5A 3HHMA 5ACZA 3F7PC 2ZOTA 2AXFB 4OZGE 2MOGA 5I6MA 5HVHC 2WQXA 3GI8L 4DO4A 4M93B 4XBPB 4YMPA 5CMAB 1IAKB 2RA1A 4R7DB 4DW2L 1DQIA 1SM3H 2AXGA 1ZOXA 4E41B 2YAEA 2NW2B 3LXUX 5D96C 5I1HL 5FYLE 3QI9A 3I6GB 5CGTA 5C0CB 4ZTOH 2GC7C 3EGXA 1IL1A 2EH8H 3MODH 3PXLA 4NKIL 3RRQA 3QDMB 5JZ7D 1FZMA 1KZQA 4JDVB 4L23A 4J1UA 5B7MA 1BM7A 1RU9L 2WXLA 3A67H 1OHZA 3GIVA 3QZWB 3H3KA 3L9RA 4FXKC 5IJDC 4ONFH 2XA8L 2ORBL 1U8PB 1NCBH 1V8HA 2DQUL 1TO4A 1OSEA 3UP6A 4K3HA 3QXWA 4RIRA 4HXBL 3HUJA 1DBJL 4LLDB 1CBVH 2A4EA 2CHNA 5CR8A 4HJIA 4XX1G 3ASNB 3CHQA 4NQEE 4BWTA 1FLRL 2NY5L 3FRPG 5D93B 3M07A 3I9AA 3NFPA 1AE6H 2PYFA 3UMNA 2B4CH 3G6AB 1IGFL 5L4JA 2ALWA 3AS1A 3O45B 1KB5H 3TA4D 3VI3A 2DLHA 1HNGA 4OZIE 1KENH 2H4EA 4IM8A 2EDBA 1UZ6F 4R9HA 5E4OA 5ESQB 4G82A 2QHRL 1B90A 4LLVA 1OM3H 1OCCB 1MCLA 4LLYB 2ZSVA 4MB5A 3U6XS 1BYNA 2VISA 5AQ0A 2CHZA 1L9RA 1Z9PA 3P3UA 1EEQA 3BWAA 1NCDH 4IW4C 5FF6A 4Y5VC 4R4NC 4MA7H 4OTXH 4QRPA 1T2QH 2F74B 1NFDA 1M6OA 2VSCA 3UH8A 1S7XB 5FGSA 4LSDA 2C3HA 3BKML 4QRQB 4QHNB 1PYWB 2UY6A 2OSWA 4K9EH 1FNGA 3E2HB 3M6DA 2AVFA 1UOWA 5J13C 3QAQA 3VI4E 4P05A 3AROA 4NBZB 3V79C 4JVPA 1CS6A 3BGAA 2TSAA 4WW2F 4OY9A 4PJ6A 4YAQA 3ARZA 4YQXH 1QSZA 3QZBA 4I9WE 3Q06A 1RL1A 4FG0A 2YGNA 1MCSA 2UZIH 3WXWH 3DV4B 5LHDA 1JNHA 1MH5A 1T1ZA 3RTQB 2OCJA 4XWOC 1WITA 3MBXH 1ORQA 1E5BA 5GGVL 5CN1A 3EJZC 3IMSA 3LMJL 3W38A 1SF5A 3VXNB 2FT7A 2JJSA 1CG9B 4LCVA 4BFEA 4WJKB 3T0EC 2IAMC 4IKIA 4X6BB 4ZYKA 3RIFF 4YHNB 4RX4A 2WKOF 2XY1A 2CNZA 5LN8A 1M9SA 2X10A 4PJHF 4NZ8A 4ZD3H 5TDNA 4JUTA 5F3BB 3MLWH 1K9TA 3R8QA 4C56D 5D6DA 3ESOA 4GI9A 4H20H 1DBBH 2JVUA 2BSRA 2DLFL 3BO8A 2NXZB 2QJDA 2R9HC 2V7HA 2GCYA 1PF3A 3U48A 3ILQD 1T0NA 5ACLA 2V9RA 1G7PA 5MP6L 1DJIA 3MBEB 1UM5H 2PWHA 3I50L 3K5SA 3H4FA 5BS0B 3VWKD 1MSPA 1TYJA 2WQRA 3W56A 5F9WC 5HYSB 4X2UA 4XXCC 1G1KA 1C7SA 1U8HA 1AQHA 2F7OA 4XGZB 1PZBA 1K4DA 3O2WH 4N2CA 5PCYA 5AD0A 5BVJA 4MCYA 3T09A 5I23A 4D9LH 5I1CH 1WFOA 4Y9EA 2ENJA 2J4WH 1HDMB 1BQSA 4MLIA 4J3OC 2APFA 4QOKA 1KGCD 4OZHE 4X0KA 2WCPA 3J07A 5B1JC 1UA6L 1FE8H 2GSGB 1JZ5A 4HIJA 2H2PC 3E3QC 5GGQL 2AKRB 3PWNA 5EA0H 1I4FB 1XSOA 3O3AA 1BG9A 1KTDA 4ABVA 1PCXA 1BGXH 4TRPH 3GQFA 3Q7JA 3OKYA 1EBAA 2CIIA 4QPEA 3VXRE 4BGLA 5KBNC 1JI1A 2WLLB 3TBVB 15C8H 2B9BA 1A6TB 1BIHA 1FCCA 1I3GH 1PKOA 4Z7UE 4N25A 1PPIA 4BUQA 3DUUA 1I9IL 4HEPG 5CINH 1VFMA 3BEVA 4YLQT 4YPGA 4ANUA 3ULUE 4J5VA 3TNMA 4HWNA 4DKAA 1QTPA 2HWZH 2HX9A 3ZDYB 5KSAB 4YBHA 3T3MB 5EDSA 2X40A 3BO8B 4ORZC 4EE2A 2IDSA 3OMNB 3FH8A 3VFUA 1AS7A 3P3RA 1CTMA 1MHHA 2CU9A 3CVIL 3QJTB 3RWGB 1KTLA 3UZVA 3CZSA 5FYJD 3NIFB 3WS3A 5SWSA 4XMXA 5JW3H 1LWJA 2O61A 3FRUA 1BQUA 3KHOA 4UIKL 5DRNA 2A3TA 2BSBA 4MMXA 4BKLB 4G72B 4CBPA 4QMEA 1E3ZA 5E2VH 3VFWB 5LCVL 3P0GB 1E6OL 1MFUA 3BLPX 4N1EA 5F7DB 2N4IA 4PRHA 2YRPA 4X7FC 2V3EA 4MQ7B 4B5EA 1M3IA 2XKNB 5I1AB 2UXGA 2BWQA 1H3TA 1MH5B 1T1ZB 5AKTA 1LO0H 4XN1A 2AEPH 4JPIA 1AHKA 3C60D 1Z5YD 4PWHA 4QGYA 1HAWA 4Z7NB 3U0WL 4KKLC 1UWXH 3TH2T 3CJJA 2VZVA 1AZVA 3K72B 3QS3A 3UTQB 2HT2C 2HRHA 2BLFA 1KN2L 3GYRA 1CDJA 3TU6A 3EOBB 1MCKA 2HKAA 2GY7B 1I9RH 1BWMA 1I9JH 5E0QA 5CEXA 4ESKA 2MKLC 2XN9B 4XNUH 4CW1B 3VD2A 3C87A 3GDCA 3PP4H 5CWSA 1KYDA 1HHHB 3FO0H 4JO1H 3RPKA 4LNRB 1ACCA 4GQ9H 5C0EA 3SCMA 3WAJA 3LKRB 5D1ZI 1N6UA 1FA4A 4Y4FA 1VFBB 1N59A 1GC1C 3BPNC 2VXUL 5JMOC 1ZVSA 1UH3A 5HYJA 1ND0A 2KPNA 3UDWA 4LIQE 4ANVA 3VXMB 4RMWA 1JZ4A 1YEIL 2H3NB 3G04A 4M4PA 4P2CG 3GSOB 2DQCL 1NCDL 4IRZA 3INUH 5DCCA 3DUHA 3SSGA 1WIUA 1OGAD 3P40A 1F86A 2CHXA 2EZ0C 2JTDA 3FO1A 5D8JH 3ROLA 4PG2A 4FAAB 1HN1A 1KTRL 2IAMB 5BRQA 1XDTT 1NL0H 4UQBA 1TPXC 2FJFA 3T2QA 3UPRB 1A8ZA 1YEIH 3RILA 4LRIC 5CNHA 2RACA 2B77A 4MD5B 5ERWA 1G5AA 4QYOA 4NQCE 3PJSB 4FABL 3ZKMD 2WQVA 5ECGA 3PREA 3PL6B 4LCWD 2BDNH 2WC7A 3KGTA 4UTBH 4F15C 4A2MA 4JG1H 3C5SB 1ZANL 1NQBA 4IMKC 1JPST 4LEBA 1WFNA 3S96B 2HG0A 2ZG1A 2KZKA 3FU8A 3VTMA 5KSAA 3CDGB 1LL1A 1NWOA 1T21B 2QQNL 2R0ZL 1D7BA 4U2YA 3NPZB 4WDIB 3PWVB 2NT1A 1X5JA 5DZLA 1CFVH 1NAKH 1NCBL 2C4XA 4GBXD 1JJUA 2Z65C 4F1SA 1CDHA 3CSFA 5E8DH 2Z8VC 2G3ZA 3BVNA 1XZ0B 4FEMA 1T6WA 1LE5B 1DLHB 3BUIA 4X7TB 5C8JA 3DI2B 2NQDA 2R15A 3KLDA 5E00A 1CE1L 4KGJA 4OD1H 3RL1A 2I5YH 3RDTB 5CS7A 2DWTA 3EYQD 1MREL 2XTSA 5I2IB 2VO5A 2QVKA 4UOJA 2HJKB 4JM2D 2HRLA 3EH5B 5C7ZA 4G8EA 4S1RL 3MCYA 1K8DA 1JD9A 4OCWH 2E0PA 4Z7VB 1VCAA 3HC0A 4LHJB 5BXFA 2XX0A 2G60H 1BZQK 3TJEL 3QXUA 1V7MH 3VFWA 3V6OA 3HG3A 3T8XB 3CBRA 3EH3B 2DIJA 2Y24A 3B56A 1NGZA 3OPZL 3LN5A 4KDTC 4FQCL 1UB5B 1ECYA 2ICES 5ID0A 4LFHD 1JZHA 3GZOA 1S7QA 3CX5K 5DGRA 5TF1H 3VU1A 1GOFA 2FH6A 3UZVB 5BJTB 5L8LB 3O81A 1UM6L 3HN8A 3IBEA 3OXRB 2BS8A 4ORGA 5DMKB 2K8QA 1NUGA 5B3JF 4KKAC 4O2FB 3NCCB 4HHAB 1U8MA 3TBCA 3BUTA 4OZGA 2XNAB 2ATKA 1UJ3A 2W0LA 5I19L 4PJ9D 2R1XA 2QLYA 5I74C 3LPWA 3RY4A 4AVJA 1N3NA 4BK8A 5JPNB 3T2OA 2JK5A 2XBDA 3KGRA 5FHBH 1U4EA 1UM6H 1QBML 3BEVB 4PR5A 5EUKB 5CJQH 2CNYA 4N6RB 1HYRC 3E9UA 2F53E 1I3UA 1ZHNB 2SODB 4XC3L 1B6UA 2JQAA 3HZVB 1MFAH 3L4WA 3NZUA 2YGQA 1PMYA 1DR9A 4TSAL 3JWNC 1P5UA 1U58B 3TEWA 2DQMA 1N0LA 3HS9A 1DEEB 3ULVD 2HKFL 4YH6A 4AMKL 1IC4L 2W65B 3CFKB 1BZOA 2Z92A 1LO2H 2OTUA 3EH1A 3DX3A 5KVDL 4Z7OF 4JFDA 1KB9K 4JZNA 1ZT4B 1DUYB 2ZCZA 3CMGA 5TDOA 1Y0LB 4MAZA 4KGLA 5I5IA 1IC4H 3B9KA 1GGYA 4OT1H 3VTTA 3TF4A 3BH4A 4GLRH 3HB3B 4YSRA 4IHBA 4KROD 1NFAA 4P2OB 1AD9B 1MCQA 4NQEA 4N86A 4UIKH 4X9YA 3JZYA 2EYSA 5AKSA 1PG7X 1TU2B 4JM0A 1OPOA 4JMXA 2CM5A 1UWEL 4XPHH 5KJRL 4PGDA 4ODHL 1X5GA 5BZWB 2ADGA 2V4LA 4XPFL 3BWAB 3U4EB 3MRDB 3I75A 4OZIA 2N1TE 1ZANH 4HG4J 3ALPA 1OO2A 4B50A 5A6IA 4TVPE 4OLZL 4IGBB 4UQ3B 3D69B 5F1NB 1QX1A 3PL6A 4GO6B 5CZVH 3ABGA 2DKUA 4NC1C 4XB7A 5C6WH 3CCHB 3FQUB 3LNFA 1UCBL 3NFNB 5DYFA 2F8OA 3B9EA 1TZHB 3EBAA 1NAMB 3KJ6H 3OX8A 5TQ0L 3KYOB 1WD9A 3N1PC 1ZIBA 3ZE1B 4Y4FC 5C0JA 2CQVA 5I1DB 2IOIA 5TK2A 3D2UD 4WTZA 3Q9QA 1EAPA 3S88H 2HVBA 2WOYA 1G4RA 3DPDA 3RTQA 3QIBD 3RVXD 3DYOA 4YE4L 5T33H 1U8NA 4HA1A 4UILH 5HDOA 3KW8A 3S98A 1Q4NX 4JG5A 2Z31B 2C3GA 2A9NL 1II4E 2WIIA 4XN4A 5IJCC 4NPJA 1X9UA 3LRMA 3SE4C 3VXUE 5IGXH 1Q1JH 3O4LA 5FO9A 5FC9A 5A40E 2ZICA 3MRGA 5C2UB 4F5CE 3QUMH 5CAYB 5AENA 4L4TA 3KCPA 4K8RH 1VCBC 2HKFH 4DVBA 2ZNWA 1LO2L 3ROOA 4L8DB 2NZ9C 3L5WB 3QJZA 2XG4B 3EYOA 2JCCA 4FRWA 4MMZC 5A6MA 2WWNA 1SN2A 2ZYIA 4IBLT 4HUXA 5FUOL 3VMOA 3GXIA 1SBSL 4JREC 2AANA 2HJLB 4XC3H 4CGUB 4EOWH 4LCIL 2DV6A 3P3SA 5E6YA 3G6DH 1Z9NA 3WG7B 2DZEA 1HZHL 1FZJA 4U1MB 5FW6A 3KLAB 1A3ZA 1U41A 3OAYK 4HFWB 1RURL 2VLRA 5D7IE 2HVKB 3MGOA 3QULA 4U7KA 5DJAB 1DDHB 4M6OL 3G9AB 4OFIA 4PJCA 2CMRL 3OKLA 3UTPD 4EI0A 4ZX4A 5C0IA 5AW3B 5CSGA 3M1CA 4HPHA 5IB5B 4LVOC 2NQ3A 1JHLL 4I77L 4HX1A 2VDLL 4QXGH 1MFDH 4D0CB 3AABA 3UAJC 5EOQL 1P7BA 3CPUA 5H35A 2HYMA 2YWYA 4ZODA 4HEPA 5IM7B 2YPLB 3HG1A 4ANKA 2VIRA 3S3PA 5K9OA 1KFAH 2WBXA 5LGYA 1FZOA 1N4XL 3H9YA 3SDDC 1H19A 5F7FA 4UZUA 4M03A 4I7ZC 4UT9H 1AR1D 3ZTCC 4OKVA 5HGHA 3P9WB 3V4PL 5FA3A 4KNUA 2ZOKA 1J7VR 4W9GC 4NJ9L 4L37A 4N2NA 4QTHA 2W0FA 4POUB 3HI5L 4UQ9A 5DFAA 3EYQC 3GSNA 1OP5K 2Q8AL 1E4WH 2G2PA 1I7UB 4YHMH 4CVZA 1BD2E 3DUUB 4OJFL 3WEXA 4Q4IA 3C9NA 4WKXA 3NJNA 3V6ZB 3H55A 4KUCD 2MTAA