2CO4A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co4A00
3UIYA 2CO1A 2CO3A 5D55A 2CNYA 2AXWA 2IXQA 2CO4A 4PHXA 2CO6A 2FVNA 2CO2A 2CNZA 4OR1A 3UIZA 2CO7A
chains in the Genus database with same CATH superfamily
2CUAA 2CUIA 1EJOL 5F7UA 2ED7A 2BIMA 3EFDL 1DJYA 1NTDA 5SX5H 4Z5RB 2GBUA 5IFJA 3U0WL 2E75C 2WBWB 5E2WH 1HHGB 3PAZA 4OJCA 4Z7AA 1OD9A 2GTWA 2VYRE 4DZBB 3G04B 2Y7QB 2BOCA 3WFBH 2FIKB 4G11A 2AJUL 5FA4B 1IFHL 1GS6X 3CX5K 1ZGLA 2E9WA 4FFYA 4WUUD 5C0IB 1KEGL 3QEQE 2XZAH 1Q0XL 2JXMB 3GJFH 4QT5A 1UVQA 4XP4L 3RP1A 3UCQA 3R4DA 2CRIA 5AZUA 4BHUA 4JRXB 2J57A 1NLBH 2VDOB 1ZLUH 4CVUA 4AQEA 4X0NA 3VFSA 3AAZB 1IGML 4R7VA 4Y5YB 3TBVA 2OR7A 3DPBA 3VH8A 1EXUB 3CLFL 2QSVA 4NHCL 2NY0D 1EAQA 1T66C 4OZHA 1YYML 3RTQC 4U49A 2QEJA 5HI5C 2AJUH 4GRLD 2MHAB 3D0LB 3AQYA 3WTYA 1DJZA 3MODH 5KOMC 1SN0A 1F45A 1LK2A 1W6LA 3U1PA 5HSFA 4G6JL 4HSCX 5EA0L 4MNGA 5KSAC 1J05A 1UD5A 3K5SA 4QRRE 5C0BE 3HI5H 4ZZKA 4NQCD 3ZSSA 4ZFFA 2F5BL 5EZIH 1BLNA 5LJYH 5E4EC 3IBOA 3EJUA 3LDBC 4P48A 3OJDB 2QQQA 5C2BH 2PCYA 1K2DA 1IQWH 2OZ4H 4RGMC 1AR1B 1DQML 3W2DL 3MXWL 1CLZL 4Z7VA 1N70A 3ZMNA 3WHE1 4G6KL 1QFOA 2HN7B 3MCKB 5FUCC 1OW0A 4P9HC 1SEQH 4JQVC 5C6TL 5JMOC 2OA9A 3FMGL 1HAUA 2FNWA 4NIYE 4PJIF 2E0PA 2L7EA 5CP3A 3PJSB 4QEGA 4H13C 1U9KA 3APNA 1FORL 4GLRI 4R7XA 1I1FA 3K8LA 3BXNB 1QMUA 4PVLA 3TEWA 4PSRA 1FVDB 1G4RA 2EIJB 4H44C 2VQ1A 4N6RB 3T65A 2DH3A 5JPMC 4N8VG 1MIML 2R7EB 2UX6A 5C08E 4UQDA 5D7LE 1BSIA 3V6ZA 1ETB1 5JIPA 5BNXD 3D05A 4MB1A 4ORGB 5IMOB 1HWWA 3VJ6A 2FGWL 4LU5H 2AK4A 4ETYA 4AQAA 4WUUA 4G7QB 1XGPB 5TGBB 4DWHA 4TQEH 2F1BA 1PG7H 2XKNA 4G8EA 4AUUA 1GGBL 2WUCL 4N0FB 5FYJD 3R18A 3S0PA 3ZZSA 4M7ZC 1A4AA 2BHZA 4PP2A 4F2ME 1UOVA 4PJGB 2FCBA 5DHEA 2EKSB 4GS7B 1A1OA 3T3PF 2MNUA 3ARXA 5E6IB 3S96B 4ERSL 4IBUA 3BVUA 4KNUA 2ZG1A 2QJDA 2YWZA 3MFGB 4NZ8A 4IGBC 4JO3H 3G08A 2YD8A 3IDIB 4M7JL 3S36L 4Z7OF 5DWUH 3ETBF 2VXUH 4JZJC 4BQ8A 3JV6B 2J88H 5DK2B 1FNGA 4QHLB 3ZHFA 4WI8A 5LWYL 4JKPH 3AB0B 4JQIA 4KQ4H 2A74C 1CQKA 1PX3A 5CWSB 5FDYA 5T3ZL 2N56A 3QNZA 4MZRA 4ZI8A 4XNDA 4ODWB 3F84A 2X40A 4PG2A 1E4JA 3V52H 2YQ3A 3AQXA 3EOYG 3FB8A 1PYWA 2YXMA 3IGAB 4PGBB 4O02H 4Y19E 4OCSL 1IGTA 3QEGL 3CHPA 3CDCA 2B9BA 3KE0A 2J5WA 4AI7A 3V6OC 3WEXA 2FWOB 3CHQA 1AACA 1PU0A 1DO5A 1D6EA 3V0EA 2NY3B 4F58L 4WEBL 4P5KA 4ONOA 4PGCB 2LVEA 1PSKH 4Y1AE 4XPGL 2V6HA 4X6FA 2G5UA 3B9KD 3MQIA 4GMTL 5KS9E 4CU7A 2EVHA 4JCLA 3ZDZF 3QR2A 4MJ5A 1SQMA 4BK8A 3E80A 1FSKB 2ESVD 1PKQB 4X6DF 3QQDA 5TE6H 1AKPA 4WI0B 3V0FA 4OBSA 3PGFH 1NCCL 3RNKB 3VTAA 2C7UB 1GYWA 4WWOA 1EEZB 1LYQA 2AXFA 3P9MB 2IPKB 2BOBA 3D39E 4B3EA 5JIHA 2BIPA 1OCZB 1JV2B 3E9UA 3LSOB 1E2ZA 4AEHL 3VRJA 1J5HA 1WYJA 3IKKA 1GGTA 4LPTA 4FXGB 4LT7A 4X5XB 5IFJB 2X4TB 3OKOB 1KGUA 4PCTA 1SF3A 1OCCB 3UPRB 2VWEE 1YNLH 4IDJH 3RVWD 1FH5H 2Y7QA 4LSDA 4U1KB 1E28A 4FJZA 3D25B 2FVNA 4EI0A 3D85B 3O45A 5G55A 4L5FE 1ZJBA 5C6WH 1CZ8H 3FCUB 3V0GA 2R1YA 1IGCH 2PTTB 2XQYG 2K3HA 3KD4A 4JPWL 2WQXA 4Y4HC 2R39A 1KPRB 3DO4A 1PFCA 3V4PA 4GO9A 1W0WA 3VA6A 4OIBA 1TSRA 3T4AB 1O9ZA 2ZXAA 4LPXA 4R7LA 3TTYA 2XWRA 2F53D 5FK9B 3POHA 4PRDB 3TNNB 4YSAA 1Q1JH 4BZ2L 2H8PB 4LIQH 4OZHB 2BHYA 4ELMA 3C60A 3VD1A 3SJVB 2CPCA 1I8UA 4DK6A 5SV4A 1WICA 2E27H 2EYSB 2WOYA 4OUUB 3O6LH 5HGAB 1NBVL 4CU8A 3BD4A 2EXYC 1KIQB 4HCRA 1XF4A 4GIPD 2EDRA 5IG7B 1WGVA 1NC4D 4UIKH 4KFMA 1YYLH 4JO4L 1H3XA 2I07B 4G2AA 4UQ2A 1I8KA 4NNYB 1HZKA 1A22B 4JFQB 1JS4A 3SDYH 4ZYKB 2VLKE 3HNSL 3HUJB 3G6JF 1HQRA 2CJTA 2XLLA 4DP1X 1MWAH 1OANA 3C5XA 1KG0B 1UKTA 1X4ZA 1PGRB 2IALA 4HLJA 3S3DB 3KPRB 2Y5EA 1R5VB 4G5ZH 4ICWA 5CJ8A 2Q76B 1KLGB 3CWGA 3NFPB 4CJ0A 3X17A 2VISB 4GAGH 3D3VA 3U2SB 5KVGE 2X4OA 4RESB 5IVOA 2B0SH 2DWXA 1Q9LB 5D70H 3IPBA 1YYLL 1TTUA 2G2NA 4FX5A 4P5RA 1HK6A 1T4KA 3I85A 4NKDA 1WG3A 1WPCA 1CL7I 3X14B 3SDAA 3QFJD 4R26H 3DVFA 2YMTA 5T1DL 3IJYB 2RMNA 2XFXA 3S88L 1CBJA 1P9MA 3ESUF 1N64L 2P48B 3L1EA 1UD2A 5EN2B 3AG3B 1VA9A 5LQBL 2LU7A 2SEBA 1RLWA 3OZLA 1K6QH 2DW5A 5PCYA 2AXGB 4GG6A 3QHZL 3MV8D 5K39A 4LPVA 3QNYA 1BJ1H 4HCIA 3VJ6B 4DZ8A 1E5BA 3IFNH 1Z9SA 2EXSA 3MVSA 1QUPA 1F6FB 2DL9A 5IKCB 2WTRB 3EBIA 3VXUB 3DX4A 2VABB 1GGIH 1GVIA 3TJEH 1JF1A 5DLMH 4WO4B 2MIZA 3HRZA 2JKXA 3KVPA 4HWEL 5T3ZD 4AWJC 1CUOA 3Q13A 1NWOA 4HQQL 1L0XA 3ZT6A 2DKSA 2ZWYA 1USZA 1AO7E 1M1XA 4W68A 4L3AA 5F0MB 1KGCD 1D5IL 3HZ3A 2W59A 3QUKA 1EVUA 1KPUB 1JNJA 4WW1A 2XTJE 3AQZA 2YPLE 4U3SA 2IH9A 3ZTNL 1YAIA 3HE7C 1XSJA 3ARUA 5I28A 1Q90A 2V37A 1YUHB 3IGKA 3FHEA 3L2MA 1WZMA 4ODBD 1HOEA 2PUQT 5CFAA 2FJFB 2JCCE 1G6RL 3H3PH 4IS6A 4P04A 5KAQF 3NK4A 3O2DH 1BQRA 3E3QE 5F0JB 4G59C 4M1CC 3ABGA 1E5YA 2HWZH 4F1ZA 3JWOH 5EDXA 2VLRB 2FJGA 4LCWB 5ADOL 1HQ4B 1YHPA 2UY6A 1JGDB 1DVFB 2X4QA 1HYSC 2VDPB 4KJQC 4R8WH 1L9QA 3AZUA 4W9LC 5GIRB 3LTVA 3IMBA 3BO8A 3WEXB 3MV01 1D6EB 1QW9A 3K0YA 2A2QT 3EOTL 4DKEL 1T2QL 4XBPA 1RI8A 3ULSA 4LSRL 1TZGH 5F9JA 1LE5B 3FT0A 1MFBL 5KVFE 3K80A 4H5SB 3V4VA 5DD3L 5LCVH 3U48A 5JQ6H 5HHMB 2ADFH 5KBDA 4JKWA 1BF5A 3WYRA 2WQWA 1G6VK 4Y2NA 4TLUA 1MVUB 4MMYA 5E2VH 2OZ4A 3QAQA 4S1RH 1LO2H 1TIUA 1R3HB 3HEIB 1EEZA 1NC4A 3MODL 4NPJA 5CZVH 5B3NA 4DSYA 2JKTM 2YR3A 2BM3A 5T3ZE 1A8JH 2WP3O 3Q3GA 4PJAA 4OQTH 5I5JA 1QFHA 5IT2H 5LGYA 2CJUL 4NN6C 1VESA 1FO0B 4LLQB 4Z0XA 4ZX4A 4G42A 4CL7A 1GZPA 1D6VL 4Q6IC 4HDIA 1JGUL 2ITDA 1XH0A 4PRPA 5E4IA 1HXYA 5IUCA 1WA0X 3ARTA 1U2HA 4XO8A 1IE5A 5E7BA 5FM8A 4FCAA 5G5DA 1A66A 4YHOH 4N85A 2NR6D 1I7ZA 4GW4A 5D7JD 3MRPB 4B9GA 3JVGC 4UV7L 1TQTA 3OAZK 2E5EA 4NNPH 3C6LB 1OGSA 1PW3A 3WCYA 4LKXB 3NJGA 3WN6A 2R0KH 4JM2A 1JZFA 1GL4B 1TQUA 2ZNWA 5DZLA 3THMH 3PPSA 3HA0A 4UTAA 5HHPA 2FQFA 4FXKB 1NCDL 3IF1A 4ELMB 1A3QA 3GIZL 4PU2A 1GOGA 3BFWA 2J4WL 4DUWA 5D6DC 1I9RL 3QIBB 4LVOC 3QAZC 1QKZH 4NX0A 3E6HB 3EG9B 5GRVK 3X13B 4UBDC 4A2DA 4LXFA 1U3JA 4DKFL 1XF5A 2Y2YA 5F7DB 5AVWB 3ZTDC 5E9DE 5I8CB 1NMCB 3FU7B 2BNUB 2H3NB 1BMWA 4XPFL 2A77L 1LJMA 3CMGA 4JFQA 5HGDA 9PCYA 1FNAA 3KBFA 2CDEB 1DQTA 4HD5A 4OZGA 2FD6H 2VOTA 4LLMB 1BBDH 1A4KA 2Y1VA 3O6LL 2ZYIA 4GKNB 3IDXH 5JLZB 5DJXA 5IOPB 1ZV5A 5EG6C 4ABQA 3CJJA 2PO6C 4Q97A 3DUHA 1H3GA 5L9DL 3GRWH 15C8L 1QSEA 4JFPB 4ICXA 3IFOA 4JKPL 4N0CD 3Q2WA 1KTJA 1HH6B 2QKIA 5HHOE 3GT6A 3U2SA 4HWZB 1XXFC 2FO1A 2XN9B 1A6TB 3QRGL 5IB4B 2GJZB 1QBLH 2NY5H 1WAAA 3MI6A 4NKDB 4PRAB 2ZAHA 2ZJSH 2GTWB 2QADD 1LO0H 2QQNL 4ZOCA 3B4NA 4DZBA 4F5CE 4DJMA 2P7TB 4F7TB 5GGSY 2ZD0A 5AAWC 2W0FB 3AT9A 2F7QA 4P2OA 4XNZC 3F5WA 3GMRB 4XAKE 1OALA 4NPYA 4NFBA 1ONQA 3WY2A 3LB6C 2JELH 3MGOA 3FQTB 4HZAA 3MOQA 2PR9A 2QR0B 1U36A 2FT7A 3RWFA 5BRPA 4XNAA 1GGBH 1FZJA 4PP1C 4RMTA 4I0CC 3SYOA 4PAZA 3OG6B 1F6AA 3MRNA 2NT0A 1P84J 5FYLE 1NBCA 5AVTB 2NSXA 4XXCA 3PXJA 4A37A 4OLXH 1NUNB 1OB1B 2WZ0A 1XIWB 1DBJL 3ZIYA 3KMDA 1OWWA 3ZTCC 5B38A 5KVGL 1ZPUA 5TPWH 1MCOL 4KKAD 4XPGH 3UBFA 1RY7B 3BP6A 3GXPA 3Q43A 3CFJB 1AGEA 2MPAL 4YLBA 3UTTA 2DWDB 4RZKA 2BS8A 3QIWC 4P59H 2NX5B 2DTML 4ZUSA 4JO4H 1THAA 1YUHA 4M8VA 2AXHA 3BZEB 4PLKC 2NDFA 5EF1A 2X2HA 1UOWA 3MNMA 1XCQA 1U8MA 2BVOA 4Y4FD 5J1AB 4ALAC 3SD2A 2X4PA 2V8MA 4XCNA 1BG9A 1RSFA 3GJFB 3HB3D 1AVAA 1WITA 3OKLB 1ZTXH 1URIA 1N0LA 2X70A 1XGZA 3CN1A 1U3HA 3KBEA 4FQ2L 2V2TA 5AYTA 1I8MA 1M6OA 4PJBE 3WNIA 1A6VL 2LT9A 2XVLA 3X3FL 3HPJB 4KY1H 2YQ2A 3G3LA 3I6LD 2WCGA 5DRWA 4YSDA 1TZIB 1INQA 1EEYB 3IGFA 3U25A 3J2PA 3VWKB 1A7QL 1ZLEA 3PV7A 1EK3A 4ZPTA 4ALAH 2E46A 1PNDA 4PS4L 3I2CH 1KXHA 1C16B 2CWRA 1ZGLM 4YDIH 3GRWA 3SE8L 4N0UE 2QADC 2VE6A 1AGFB 2B7DT 3RWDA 3K5RA 1A9BA 2EXWD 3K2UL 5IMOA 5D8JL 2ZONA 3EOAA 2YUWA 2AFNA 4PJBF 1K85A 2Z35B 4ZNEE 4NP4H 2BMKA 5AUMA 4DPCX 4JW3A 2G5RA 1JNHA 2PP7A 4OZFH 1GW6A 3NABH 1KY6A 2K0RA 4PJCF 4N2NA 3FU9A 4LARL 4ZTPH 5EEZA 3F64A 4PP2B 3B8YA 3IRCA 1I3GL 1N10A 2DQJH 4PW3A 2OTWB 2L7JA 2VQ4A 2YA2A 5D7LA 4BFEA 2CUMA 1NFDB 4OJFH 5F7YC 3R1GL 1SY6H 1G9ML 2V33A 2DTSA 1P4UA 4ZUUA 4AQ8A 2KYIA 5EU6A 3FNKA 4UNIA 5EOCH 1QFPA 4K7FA 5E2UL 1FO0A 4LLQA 5ECGA 1G7IA 1HXKA 3P4NA 1R3LB 2W65B 4PLNC 1FFPB 4M3HA 1U6AH 1KEML 4IKIA 4YEFA 2FO4A 5FEBA 5INDA 4F2MA 3QWNA 4N1HB 5DK2A 3SJVE 3BPOC 4O02B 1F4YH 5DD1L 4ADIA 5GS0D 2IWKA 4J28A 1I53A 2ICEA 3SY6A 3QUZC 1I7ZB 1MFDL 2P5WA 1OE3A 4ZD3H 2FT8A 2ZKWA 3QUXD 5CWSA 3TYFB 2K6YA 1E5ZA 2OMUA 1J1XH 4XOEA 3WSQH 3HHRB 5LAXB 4Y4KA 3AMKA 1HHIB 3FB8B 43C9A 4J3OD 4J3TA 5FDWB 2OMXA 4ZS6C 4FXKA 5KBLA 1OAYH 4BZ2H 1CD0A 5EHFA 5D6CA 5I1KL 2Y06L 4JO1L 3WY3A 2SODB 3NESA 1UH4A 3OR7B 4R8WL 4JFDA 1NEPA 2X4RB 3BHBB 4IMKC 4TLKA 2BNQA 2OBGA 1G7PB 2Z31D 3QQ3A 4NN7B 5I8CA 3QUXC 4I0PA 1JYWA 5D7HA 2YD4A 4KPHL 3DX8B 4RIRA 2XZZA 1QSFD 2GSIB 1E8WA 2HPOA 2PW2A 1MAML 4PJ5A 2CDEA 5B1BB 4ENED 3SGEH 3L3IB 5DD5H 1M05A 1OF0A 4RWYH 3B2UD 1AXIB 4GRMB 2R8SH 3UTQB 4L4TB 1SJVA 4MJHA 1OSPL 4WI0A 4KAQH 5B38G 1KCBA 3PL6C 2EVIA 3NJLA 2L0DA 5I1KH 4JFED 1JL8A 2ENPA 2IPKA 2R9HD 3P69A 3IVKB 3BKJH 2BK8A 3DX9A 4R96B 3VRJB 2JB6B 1KZQA 1Y1UA 5HHME 4AKQA 2VDLH 2Z64C 3AG1B 4PWFA 5BZWB 5IB4A 2IV8A 5D70L 4X5XA 3LZLA 1AMXA 3RNQA 2FGZA 3LPWA 2AJVH 3WFDH 3ULVL 1MQ8A 5C07B 1HNYA 1FZKA 1P7BA 1QSVA 2AITA 2RR3A 3NJFA 2YEZB 3ML8A 1P53A 1DJSA 1F4WH 3K3QA 2B3IA 5CKGA 4MTMA 3K8KA 2FT6A 3QUYA 1LO4H 5DQJA 3LRMA 4MS6A 3APCA 2F58L 4L9LC 3X3GL 3U0WH 4YJZL 4QYAA 2J6EH 1KTRL 3ARDD 4OVUA 2CKBH 4TVPD 4Z6AT 2W92A 3NBNA 4BQ6A 3QC6X 3FQUA 4NFDA 4B95C 2APFA 4JDVB 3FO2B 1JPTL 4P23D 1AR1D 3LZFL 2VNCA 1RPKA 3QUMA 3EYFB 5CN3A 5H4ZA 4HEMA 4NNPL 1I1AA 1X9RA 2J1WA 2P3YA 3HG0A 1TZHA 2HTKC 2QKSA 2R29H 3SDCB 4WF7A 1WTLA 5JZ7C 4N2GA 2CRZA 3BD3A 4JN1L 5IFHL 3GXIA 3T1WA 1AG0A 4C4KO 2PP8A 1F3DJ 1RMFL 4BFIB 3BEVA 5DZAA 4A7UA 3GSVB 4HFWB 2DWEA 1WWCA 4MCZA 4N8CL 2WBJA 2C3GA 1VEMA 3L4UA 2DWDA 4XH2B 3LPOA 1RJZA 3RA7L 4TULL 4KQ3L 2NXZC 2C3HA 3HZMA 4ZFZA 5T1LA 4Z7QE 1Q1PA 1NLDH 1QNZL 3P0YL 3K6OA 4NKOB 4GI6A 4AQZA 5C0EA 3Q44A 4N0YL 1C5BH 2Q76A 4FYTA 1G84A 5E5MB 1ET8A 1E9OA 2R29A 2VLRD 3FQ1A 2N1KA 1YYMH 3T5WA 1DBKH 4EO5A 2R4SL 1ZK9A 3H7LA 3JT2A 4QUOA 4Z23A 3E1F1 3MRHA 1U8PB 3GHBL 1T4KB 2ED6A 1H5BB 4N1EA 2WUCH 3FTSA 2YJQA 1CFBA 5EZLB 4CW1A 4HPOL 3MR9A 3MV8B 3G6AA 4IBZA 4J3OF 1KXTB 1F02I 4N2DA 4X6BB 5E6UB 1OTTD 2C4XA 2DY2A 2DQFA 2Y07L 3TWCL 1H3UA 4MA7H 3RIAK 1A6UH 3KW8A 1MHEA 3DRQA 1QYGH 2I85A 3GTTA 1KCVL 1PL3A 1UZ6E 4G7SB 1N8ZA 3QDMA 4MWFA 4MGXA 4DZ8B 4KOCA 1AQ8A 5F3BA 1QI3A 5T33L 3EGDA 2GTZA 2R0WL 4LLYA 4G8GD 4BBWA 4E0RA 3P30L 1JF1B 3OX8A 1RFDH 4XPTH 2A7BA 1OAQH 2YAQA 1NWPA 1IFGA 3VFNB 4XRCA 1IC4H 5IROD 3KPOA 3DUUB 1OZTG 1AIFB 1MUJA 3LKSB 4PJHA 5CZKA 2XBTA 4XC1H 3BKML 2OJEB 4P9HL 4QRRD 2IQ9L 2Z93A 3FB6A 5F6IB 3LKOB 1UXWA 5E8DL 4BYHA 2E47A 1EUUA 1KC5H 2WNXA 3N41B 4KZEL 3LAFA 4X5WA 3GHPA 4HF5H 1K8DB 1J8SA 4WEEA 2QPDB 4PY8I 4WCYL 5F8RC 1QLFA 4ANVA 2PXYC 4DVBA 3GMLB 3K71A 4CSSA 5D7KD 5DC4B 5LAXA 5ADPL 2KLRA 4N86A 3BPNB 3GSOB 43C9B 5AKSA 4AVHA 2OP4H 1EO5A 4DKAA 5D6CB 1ZANL 3BN9D 3BO8B 1IKNC 2VUKA 1BM3H 3LRLA 1F3DH 2DRUA 2Y3AA 2Q8AL 1G9EA 3TN0C 1FFQA 1BGXH 4P99A 1E5UI 5KSAB 2X6BA 3ZDZE 2E9JA 3CHOA 1IT9L 2IAMA 2A4ZA 4WI2A 1E8ZA 4OIFA 4W93A 4C4UA 4GS7C 4BUHA 3GM8A 4PS4H 2H3XC 4Z18A 5DD6B 1MJ7L 2YUZA 3TBTA 5BV7H 3SPJA 1LGVA 3Q8BA 3QWOB 3BI9X 1DSWA 4OF5A 3LNEA 3ASNB 2EAEA 4LL9A 3RB5A 1N6QL 4MXWH 1Y6MR 1MLBB 4K8RH 2BY1A 2CM5A 2MQ3A 1P0SE 5F1IA 4N9GB 3SN6N 1TCRA 4AGQA 5CBAB 4D8PA 3VYPA 5DT1H 3TCTA 3QJUB 1KB5L 5DEGA 1TNNA 2JB6A 3VI4B 2GIYA 4I77L 5EPMB 3T1FB 1G0YR 4KOBA 4C4KT 2WKOA 3DX0A 4A6YA 1NAMB 3FUDA 3SJVD 5D2LB 3VXQB 1ZE3H 1EPFA 3QJTB 2OJZL 1FNHA 1YC7A 4QRPE 2WO3B 2UUDH 4ZUWA 1VPOL 3DX7A 4JQIL 4W9FC 3K2MC 2WIIA 3S8WA 4UILH 2HPTA 5J3HC 1HN1A 2VZ3A 3KYKH 4E36A 4XAWL 4WHTB 3A23A 4HUMB 4PJ9C 1J8HA 5IJKA 3QUZB 3K1KC 4LPYA 2IXQA 4DKDC 1PZSA 1ILSA 5AW3B 5C0RH 2WXGA 3QZNA 4LKXA 4FEMA 5A3IC 4QRRA 2HXAA 3BKYL 1G1OA 3EH4B 4ZFOB 3CH1B 3MO1A 4M7LL 5E5LA 4AEIL 4YFLF 2Y1YA 4N0CC 2VN6A 2VQTA 5AL8A 5MEPB 2GUYA 2JKSA 3E6HA 3EG9A 5K9JL 4FTVD 3LV3A 2CMRL 4NHCH 3ALPA 4G8GA 2WLYA 1YEIH 1Y7VA 3CFKB 3ULVE 3K2UH 4JO5A 2EDKA 3KVQA 2XZQH 4UU9B 2R1XB 4ACPA 2QDVA 1UJTA 3AXIA 3ROOB 4KKLD 4LLMA 5IROC 4ZNCD 3IGUA 4G9DA 3NCCB 4KXZH 2OAAA 1L6PA 3ECBA 3BH8A 3WFHB 2VZ1A 3FFCD 3DDFA 1M56B 1B3JA 3IJ8A 4QPEA 4D94A 1X6LA 1AFVH 3KGRA 5DF0A 4UQCA 3CDZA 3I6GB 1R3IH 2F9BT 2D3NA 3D2UD 3IPEA 4K23L 2OX5B 1EJ6A 4WTZA 5C08A 4FQCL 4F3FB 1KGWA 3QDJA 1SZNA 4JY4A 4PRIE 5EZJA 3O11B 2D7MA 4LLWB 3MR9B 1PD6A 2P8MB 1SDYA 3RGHA 2XZQL 1WUZA 2YA1A 3VXRE 4NPYB 4DVRH 4LQFL 1FNEB 1Z3RA 3G6DL 4CUCA 3BSZL 4WKZB 3IBEA 1SEBA 3BGMB 3T2NL 4YSQA 4KQ0A 1AS8A 1EMTH 4JRWA 3FKUS 1NGZB 5I30L 4TTDC 1MCOH 1R3KB 3OAUH 3OKDB 3GXMA 1PEWA 4KNTA 4A55A 1U8QB 3LZNA 4NYLA 1FA4A 2EIZB 2FX8H 2BY2A 1N9PA 3V4VL 1QWHA 4JGMA 1RU9L 3BKCL 4D0CA 4RNRB 3PIQB 5ID0B 4KUCD 1U92A 5HYSG 3QAZB 2XPZA 2DZEA 3IWVA 4ODHL 3ROLA 1RJLB 5K5YA 4LL1A 2AJ3B 4QXGL 4QGYA 2EVFA 1EEUA 5AW6B 3U1QA 1AGEB 2CJ3A 4Y4FB 4Z1PA 3OKEA 4XNYL 3FB6B 1OT4A 2XIIA 2CIIA 4NZUL 1FNSH 1P6FA 2WD0A 3OBAA 5E0QA 2CUHA 1SXCA 4JREC 1BZQK 3QEHA 5EU3B 3BFOA 1BZEA 5K93A 5EU4B 3AY4C 2DQIL 3NZSA 1I1CA 4LF3B 4O9HH 4X8JB 4EBQH 3L4WA 1MJJB 1Q0XH 1UD8A 1M6UA 3GJFA 3M8OL 4UTBH 1TJXA 4EUPG 3WOVA 1YY8B 4K5OA 2NY5C 2NZIA 3EDKA 3IDMA 3N91A 5LBGA 3ZZQA 2P5EA 5BVJB 1CFMA 1UZ8B 2FTAA 4M4PA 2OKMA 2EXYD 5FV1L 4Z7UB 2NLJB 3EXLA 3FO1A 4HF5L 5LNEA 1HSBA 2PR4H 3HHSA 1QA9B 4JHWH 2OMBA 3VWKA 4P2OD 4AX3A 2JTDA 5J9PA 3DO7A 5IM7B 5C0AA 4XBMA 3U46A 1SBBA 2JQMA 4HXBL 1COBA 5I16B 2XXCB 1NIAA 3H42H 3EJQA 4G1EB 1IGYA 5TDOB 2I9TB 4JKLA 4L29A 3CQQA 4Y16D 5DC9B 4KDWA 1FCGA 2H6PA 1YRKA 3H3KA 1KCUH 4WW2A 1OP3K 1LILA 3HJEA 4JB9L 5GS1A 1UA6L 1A7PH 3QIUA 5IESH 3C6EA 3P11H 4LSRH 5CGMA 4F7MB 4XN8A 3KS0J 1JRHI 1CXLA 2Z91A 4MSWB 4S0TD 1JF5A 2BNQD 2JK5A 1FVEA 4M02A 5ENWA 5F1IB 5T33H 1U8NB 1ZSDB 3RJDA 4E42B 5B1CA 5ESVA 1JZGA 2QZQA 4WY7L 1EGJL 2EE6A 4BHUI 2CNYA 4O2EA 2A9DA 2VLME 25C8L 3VUAA 4KVNH 3FUMA 3MNZA 1AKJB 5HYEA 5F1KC 1NCDH 3F05A 5EMYA 2VLJD 3N9GH 4X6CE 1MPAL 1XGYL 4LHUB 2IG2L 1T0NB 3MXVL 3MUGA 4LAJH 3ATDA 4MCMA 4MLSA 4U1LB 5J11C 1T1WA 1MDAA 2I32A 4OV6F 3D4ZA 4IYKA 3SDDC 3LS4H 1EERB 3O6FB 2WYZA 5G2NA 2WXRA 5IK3B 4QMEA 4E9YA 4ELDA 4JQXA 4YXKL 3S35L 2D7NA 2F8VA 2R4SH 1NEZA 1PZUB 1W8EA 4ILDA 1V8HA 2HZHA 3V0WH 5ELIA 5FM5M 3I9GL 1WFIA 1ORQB 3D8MA 4CGUB 3SKNA 3WO3B 4R7DA 4WV1A 3MLYL 1NUDA 3MNVA 1KFAH 5GGRA 2HJLB 2WXHA 1UKSA 1Q94A 3W39B 3C8DA 1C12B 1JRHH 1T04A 3HZVB 1B2WL 1S7UB 2ZYRA 3STBA 4FA8A 4Z78B 5IT2L 3WJJA 1CN4A 3DUSA 1Z5LB 1OSPH 3TN0B 4M56A 4LEBA 2ZCHL 1LP9B 3AM8A 2CD0A 1Q0YL 1JWUB 4RIRB 5FGCB 4N8CH 5JPNC 3LKNA 4R2GD 2D3VA 2DEYX 5F89B 4JCWA 2WQSA 4JFFD 5E51A 4WUKL 3C6LD 4WWKA 2V9TA 4RX4A 4DUVA 4JFDE 4NKMA 1P2CB 2R2BB 4HKBA 2VMJA 2F7IA 3DLQR 3WIHL 1CFNA 1WBZA 3NFSH 4NO0B 3PWUB 4LPWA 1ZD6A 4YDLC 5CU5A 3ZYIA 3FT3B 1M2VB 2VAJA 3UZQB 4PJ5E 4K5PA 4CMMB 3CX2A 3P73A 1XEUA 4NQSA 3P4OB 3QCUH 1CJYA 1WQVT 1BXVA 3ETBJ 3UTSD 2CQVA 4H8VA 1F8TH 4PJBB 5E8PA 4ZFQA 1BM7A 5H37H 4EUPH 4FG6C 2FQGA 5HYJB 4LLWA 3DIDA 1A9EB 2QVKA 3IETB 3WG7B 1K4CA 3MCLL 3DV4B 3OQRA 1E7VA 5D93B 3VXOB 4UQ3A 5HHXH 1WA1X 1CD9B 4LHJB 3ARSA 2BIHA 3U36B 3BUTA 4JY6B 3FQUB 4PV9A 2IQAA 2EIDA 4MXVE 4L0ZA 3WU1A 3SE9H 1T0MB 2TSAA 2UXGA 3PU7A 5D4JA 4KK8C 2RH0A 2JELL 5AWNH 4AGLA 3RHWK 1NDMA 2XVKA 4LNRA 3SE3A 1MCLA 1F90L 1WIOA 3EYUL 5D2NE 2E4TA 1UB5A 3TBBA 3L9BA 2BIIA 3D0VB 2ILLA 4KJQD 1IAOA 1TQWA 1D5XA 1E3ZA 4XMKH 1RXLA 1GGIL 5DRZA 4XH2A 3NSYA 1ZT1B 3L1GA 3MGAA 4JPQA 2G0LA 1O7DC 1L9SA 3UP1A 3V7AE 1UA3A 3MMEA 3QIUD 4ALAL 1W0VA 5EU4A 1FORH 3JTTB 1MJJA 5HVHC 4OTXL 4BK5C 3H9HB 1DLHB 1HXMB 2FWUA 5E8EB 5A6MA 3VFOB 4MQ7B 3DOIA 3CVHL 1HL8A 3AC0A 3TBYB 4HS6A 1IBFA 4LSPH 1SQ2N 4HJTA 1OAUL 1PJWA 4PVBA 2MCPH 5EUOB 3BQUB 1JV5B 1XL6A 3R19A 5GZOC 2K1MA 3FBKA 5LXGH 4KK5D 5A2KH 3FTGB 4M62H 4ZT1A 5HYIA 1V5JA 5IP4A 2W94A 3N1GC 1U2YA 1BD2A 1KJ2L 4E9LA 5JYLA 3WNOA 2GAZA 2AV7B 2Z1KA 2B9AA 2QSCH 1NGPL 3HNTL 4EI5C 4OH2A 4MD5A 4OGXH 1XMEB 4GKSB 5EOCL 5EBWA 3THML 3HB3B 1A8ZA 1KGYE 1Z9PA 5IVNA 4OLEA 5GS1B 4PJAE 2CXKA 1PKOA 5F3BB 1XMWA 2Y5TA 3WLBA 5AZEL 2X0WA 4YAQB 2E76C 3SDXE 4P9HH 4HUKB 1P5VA 3EGSB 5B21A 4M8QB 1JHTB 3G5ZB 4OVVA 2GTQA 4L37B 2GG1A 2XWCA 4MNGE 2MCPL 3B5TA 4EE2A 3S4SG 4PJ5D 2X4SA 3EKCA 4JB9H 4ZG1A 1FCCA 2EDFA 5IB1B 1U33A 3BH9A 1X4XA 1XGQB 3O3BB 4FQXA 5D9SA 3UAFA 2ODHA 3GWJA 2WYTA 3QI9C 7PAZA 3RWGB 1UXWB 4JFDD 5FM5O 5C97A 1UCBH 3PL6D 5KVEE 4Y2DB 3WAJA 1KTKE 4U1SB 5D5MB 1F5WA 3QARA 1I1RA 4GSDL 3O6FA 4RGND 5DHVB 3GSNL 1J88A 4CJ1A 4GBXA 2UUDK 4OCWL 2RIKA 4DVBB 4K3EL 3S5YA 3T3MF 3R1GH 4AXWB 1OSYA 5JW4M 2ZNXA 2AQNA 4NQXB 2DQJL 1SRDA 3AU1A 1GS8A 2FE0A 2DIBA 1R47A 5E8OA 4OZGE 2BP8A 2Q6WA 3SYPA 5IHUL 5I66B 1XTMA 1C12A 1T04B 3C87A 2ARJA 4PJGE 1XIWC 4CC1A 5BV7B 1NGQH 3S35H 1JXKA 2I7OA 3D87B 2ZOLB 3IM1A 3Q5OA 4X0KB 3INUH 3QCTL 3W56A 1U8OA 2H7WA 1QKZL 4PS3A 1DQDH 1W9XA 3X1NA 2VM9A 1KB5H 2F58H 4I85A 4JHVA 2MKLC 4WTZG 5F89A 3QRBA 3ASWA 1R0AL 3EUUA 4KMTH 4WVRA 3O8XB 4TSCH 2JVUA 4P2QB 1A4JB 4Z7NB 4HUVB 5F7HA 3HAEH 2R2BA 4HKBB 4EN3C 2IDSA 1DYZA 3Q9PA 5CN1A 4PJGF 1FGVL 1J0KA 4FEIA 5MERA 3NPSC 3T6QC 3D34A 4P23B 3UZQA 3DX1A 2RBLA 1OAYL 2Q2EB 4X7SL 1RUPL 4XWGL 1BEYL 4GXFA 3DHUA 3MCG1 2F08A 1VFBB 4PJ8C 3KWWA 3ZTJH 1QZ1A 2AV1B 4ZAKC 2R29L 3DETC 3VH8B 1H8NA 1RUQH 2BWQA 3L5XH 4MJ6A 1RULH 4Q7DA 4Y5VC 3RL1A 2LQRA 4OGQC 4FD0A 4JRLA 1OARL 7FABH 1CF1A 1T21B 2G5BA 4JK0D 8FABA 5BUGA 1ORSA 5JDJA 4MDIA 4PTTB 1NCUA 2WZ5A 1AI1H 1XD1A 4J6RL 4OGZA 1WHPA 2KERA 2C34A 3MJGX 2P8PA 5D1ZD 5I1EL 5E94A 4GQQA 5B1AB 2BY3A 3WAKA 5ACZB 5K1NA 1UJ3B 2DAVA 3D09A 4MXQC 3T08A 3L5WA 3HFML 2MFNA 5CLXA 3MLRL 5DUML 1UB6A 4PR5B 5EN3A 3M86A 4OD3H 1KTLA 4I3SH 4PBXA 4AIZA 4M00A 1GIGL 4KNQA 3FUFA 4WU7A 4UUJA 1BLIA 3VRLE 2QBWA 5CEZL 2NXZD 2OR8A 2UWEB 3VI3A 3FDWA 4ODUA 1T6BX 1ACCA 4MNQD 1FF5A 2WLZA 3WNLA 3IK2A 1F11B 3TZVD 1L9TA 4QY8B 4PJAF 4NKIH 4JRYD 4OLWL 1Q72H 2CBOA 1KWKA 1RV6X 2AJZA 2EKJA 4UIMA 5A16B 4JCMA 4ES8A 5JIMA 4QJ4B 1TJIL 3PQYB 2ZPKL 2WB1A 3BAEL 2NXYC 4GSXA 3MXVH 3ZDYE 3BH8B 3ASOB 4YZFF 3CC5B 1W72L 1YEEL 2VQ1B 1QPKA 4TULH 3H9HA 3U0PB 3ATAA 3ZYJA 3NCJL 1M7IA 1NLDL 4PM1A 3OHXB 4ORGA 1D9KC 5IWLC 4I5BA 4M48H 5F70A 1GCYA 1HT6A 3KJ4C 4F3FA 1JV5A 1JN6B 4R0LA 3U9PL 4G6KH 5DHYA 2BVUA 4C83A 3ELQA 5I30H 3OSKA 4X9IA 1RZKC 4TNEA 4Y1SA 4WHDA 3QJVB 4A68A 4ZD3L 3CVHH 5B8CC 3T2LA 2XNAA 3LD8B 5AG8A 2DQMA 2IDQA 4KHXH 4PWEA 4WKZA 2AABL 2ZYSA 4NCC2 5ANME 4DGYH 2CR6A 3GS4A 3MXWH 1ZIBA 4M6ML 1KCSL 5DYFA 3ARZA 4JFTA 2NY6D 1U8QA 4JR9H 5ALBH 5L7XH 3TF7C 3V9CA 1KFGA 1MIEL 1O7VA 1KLFB 1EVTC 1FNGB 2ZF8A 1MJUL 4FQPA 1JZ5A 4DCQA 2DB8A 1UD3A 3FQRB 1U92B 2K3TA 3APMA 1YC8A 4PB0H 3FTXA 4DF9A 1TXKA 2HRPL 3X1FA 5AAPA 1U8KB 4HZLB 4JG1L 4KKLC 1WWAX 5D7IE 3AXLA 3CVIL 4ZXBD 1MHPH 3BEWB 1HH9B 1VHPA 2F53A 1ROCA 1CYGA 4HOZA 2BSTA 2OXGB 3TWYA 4Y2DA 5IJVB 2GPZA 1XX9C 1IGTB 2AABH 3UTSA 2XVGA 3OG4B 5D5MA 4X50A 3RX7A 4LLVA 3B6SB 2H2PC 5AFAA 4LF3A 3PAVA 2X1WL 3O0LA 1T22B 1CVRA 1YPZA 2VDMH 3P30H 4S10A 4BK4A 1A1MB 4PH8A 3TONA 3J07A 1X3DA 2IBZY 4MJJA 3TVMA 4FFTA 4B9IA 1UZ8A 1TENA 3D9AH 1RZGB 4YSRA 3SSGA 1ZT7B 5CILH 5BUPA 3NEXA 3WFBL 4AMKL 4GG8B 4FNRA 1SYSA 3LS5L 3IE9A 5IUSA 1KIRA 1J7VR 2UZIL 3FO0H 1IM9B 5D4HA 3W5MA 3PJLA 1P84K 2VN5A 3MCLH 4Y16B 1A14L 1KXQE 2P44B 1ACYL 4GPVA 4X4XB 1P7QB 1TZ8A 4TUOB 3GM0A 5KOVC 4UT6A 4E9SA 3IU3A 3RY5A 2F8IA 4ATTA 3IFLL 5TDOA 4U6XB 1DFBH 4JANA 1QEWB 3OAWA 4M93C 4PUBL 2A9CA 2CLVB 2DTMH 3B9KA 3FTZA 4NC1C 3X12B 4APQB 4FLQA 2IPUK 4LHQB 1SOSA 4PJFA 2Y36H 3ARFB 3T2QA 1S7RA 4IRSC 1ACXA 1FFOA 2O72A 2EYRB 1ML0A 1U8CB 4NQVA 1HI6B 3ZL1A 2Z0UA 2VZUA 1NM4A 3MV9B 4I18B 3WELA 3UDWA 4ONGL 1EAOA 1UM5H 43CAB 4WNQA 1XF3A 2AGJH 5HBBA 4HIHA 4B9KC 4DHLA 3QJQB 3K6SA 4ODXB 3L3KA 3W11C 3SPGA 5C86A 2EQDA 2Z1PA 4P2CG 2W9EL 4K7PL 3MKGA 1E8YA 1KBGL 1VCBC 1D7CA 1NJ9A 4HALA 4R96A 4WO4C 3Q6FA 5TDPB 2ICWB 3LKQA 4NRZB 3WNJA 8FABB 2DI8A 2DBLH 3IEAA 1L7TL 3B83A 1I1YB 5BQDA 3VGBA 2X9XA 5I75C 5K9QI 1C1EH 2P8PB 1KENL 2YBRB 2AJYH 3HBQA 4KXDA 1CGUA 1E5AA 5ACZA 2CJUH 2Y2TA 1F13A 3ZDXB 2RTTA 3T0EC 2CRYA 3GXDA 1ORQA 2PWHA 3WE6B 4MJIE 4FQQA 4OZFA 3WTSA 1DDHA 2E7LC 1Q94B 2BSRB 5FO7A 4NOBA 1NL0L 4QRQA 4YDNA 2EUWA 1MFVA 3QDGB 4OAWA 2I26N 1KLGA 4HIIB 5F88A 4XHJC 3BKYH 2V5TA 3CIAA 3MZTA 4N3TA 3UJJL 4PCYA 1J5OH 3PHOB 1X4YA 1SBSL 4LDEB 4OFIA 4F58H 1SNRA 1EIBA 1JNNH 1JWUA 2CAKA 2DEWX 4Z5RA 4NNXB 3BD5A 1L6XA 1CTMA 3Q5YA 1F00I 4JDEB 5HI3C 2Q3XA 5J1TC 3UIYA 2V17L 4UIMB 4KY2A 5FYKD 4F57L 4XVTH 3LCYA 3U4KA 5LGHL 2CO4A 4NKQB 4XMWA 5B39G 1HL9A 3I9PA 3SDAB 1VB9A 3BUYB 5LGKA 1SMDA 3W1ZA 3GXUB 4XN1A 5I23A 3VXSB 3IDGB 5D4IA 5J5EA 4DVRL 2LTQC 5I1GH 4HAKA 1HHHB 1OAQL 3D18B 4F20A 5A2BA 3UAEA 4LSPL 2SEBB 5C2BL 2BVQA 3R8BB 1W8OA 2X4UB 4XCYB 2UZPA 5GS2D 4CMMA 1YEJL 3OHXA 2BZCA 3SHSA 1FYTE 3H9SE 2F2HA 1XHHA 3JV4A 4NN5C 4WI9A 4RMRA 3V7AG 3WHE0 2CIKA 3L3JB 4PRPE 3QZPA 5EC2A 5JXEC 2ATKB 1YMMB 2ZSWB 3TJHC 2R2EB 1K4CB 3WV0A 5IW6A 5JIIA 1JZ4A 1DUZB 1F3JB 4MAYD 5CD5C 5FECB 2NY7L 5H94B 1RZIB 1FE8L 4E68A 4UQEA 3I50L 3MRMB 1GJUA 4EIBA 1M1XB 4XNUL 2FUTA 4JHBA 3OLEA 3MSPA 3PWLA 5ICYA 1M9WA 3QA3A 3OKYA 3RIFF 3CV5A 4K9EH 1JG9A 4HWBL 5F7WC 2J21A 5MENE 5EZOL 3KPQB 4AL8H 1HCZA 4WNJA 5JXED 3NABL 2Q8AH 5IEKB 2B0SL 2J3SA 3OKMB 2AJSH 1FL6B 1JMXA 2FBJL 2Q7YB 2NY3D 1EH9A 4RGOL 4CC4A 1HEJC 3K81A 4PJIE 3JWOL 2FYYA 2JQAA 4I9XA 3WBDA 2IH3B 3TO4B 3GSWB 3L5HA 2VDNL 4EAEA 4DEWA 5I8KH 4EIZC 1KJ3H 4Z0BL 2M26A 3VWJC 2EDTA 1RHFA 2DWSA 3L4YA 5BRZD 2NY2B 2HFGL 4ZXBA 2WMPB 4B6ZA 4LLVB 3S4SA 1MRDL 1QPPA 2CBQA 1BZ7A 4EI6A 3E1ZA 4LKCB 4PJ9B 1KDJA 5M7QA 5FV2A 3RPIA 1VCAA 2V2XB 1AG6A 2BFVL 4M62L 2BERA 2Y7NA 5CD3B 3WE1A 2VL5A 3TVMB 4WO0A 3HJ0A 2ZCLL 4K73A 4OFPA 3P2TA 1ZT7A 1FL5B 3S2AA 4HWEH 5L2JB 1A7PL 4F5CA 4UOJA 3C5JB 2GY5A 3HNVH 1KIRB 1VDGA 4LCYA 4UDUA 1BQLL 4WJ5A 4FMVA 5CN2A 2WP3T 4WGVB 3O6KH 5DMGD 3QXDB 5EWIL 2AXJA 1UOKA 4MAYC 1QLEL 5DLLA 1IC1A 5B7EA 2D9CA 3PUUA 3M45A 4UINL 2N0MA 4LE8A 4UCFA 4JFOA 3CLEH 1M7DB 4NQCE 3RPBA 3NJMA 5FYJU 1RKRA 3PV6B 4KNSA 4LGSB 4U6XA 1EFXD 5FGCE 3T0AA 4XB8A 4QHPA 4HKJB 2XA8H 4YHLH 4PJDF 3IDIA 1NMBH 3FU5A 3SGJA 3N42B 1JD7A 3EYSL 4M8QA 4W4OC 3RFRA 1ZGLP 1WBXB 2Q0ZX 2YD7A 4XR8C 4YHOL 1HINL 3WEAA 5G5DB 5FHAL 4ZMZA 1I3RB 3UTTD 4UDTA 4UQIM 3W0WB 1OP3H 4WI7A 4LDCA 1W15A 1F86A 2X4SB 2W5PA 2WV3A 5TQ0H 3PGFL 3BRFA 2BINA 3OC5A 3N43F 4F2FA 3RDTA 4A7VA 1PLGH 2M83A 4Q0XL 4PGBA 5EEVA 5EEXA 3DK2A 4YL9A 1DHKA 5C0FB 1YVLA 1TYRA 2EDEA 2ZUSA 3H0TA 4L9LB 4W9HC 1OGAE 3KYMA 3N1PC 4GY4A 1HZLA 4JVWA 3GMMB 5D1ZB 3DURA 1C08B 3LRSB 4EKXA 4KRPB 4YSEA 4DGYL 3S5LA 4AH2B 2NQCA 3NEOA 4JFFB 1FBIH 1QD0A 5JW4N 1GKOA 4HSAC 3ZR6A 4AXWA 5TE4L 2TRHA 3F6LA 3QZMA 3M1CA 1IV8A 4MMZB 2EUXA 1ADQH 1LWJA 2IWEA 3ISRA 3PDGA 3T0ED 3UYRH 2Q7AA 2X89A 2Z0BA 1WC7A 1N3NB 2W9DL 5GSRB 3TFKC 1ES0A 1L0PA 1BFOA 2WY3B 1HKLL 4J3UA 4AIOA 4PRBA 1UT9A 4N90D 3IFOB 1L5GB 1Y18B 1MFDH 1AY1L 1T1XA 4NHUA 1JV2A 3LSOA 4NQCB 4P2QD 2XXGA 3WKYA 1A14H 1NC2B 1W91A 4Y4FC 4IBLT 4YO0B 4FRWA 4B9FA 4HGWB 2I60H 3BAJA 2LLNA 3DJRA 4NP9A 3L48A 3QHFH 4QTIH 1DN0B 4ENZA 4HC1L 3UADA 1TMCB 1XAUA 3O8XA 2ZPKH 4N3UA 3DHMA 5CMAB 1S7WA 2Z3FA 1VACA 2BWDA 2C3VA 4BWTA 5KBMA 1C8QA 3GBLA 3B7TA 4X6DB 1E4WL 1ZDQA 3U2IA 5I73C 1UCTA 1ADQA 3KPLB 3VGDA 5DDHB 4DK3A 1S8DB 1LLAA 3NACL 1B0IA 4JKKA 5AAMC 4AIXA 2FSDA 3Q05A 1BXXA 2H0EA 3II2A 4PJIB 4AZ8B 2OMYB 3QHTC 5AVVB 3II3A 2VH5L 4A7TA 4X6CB 3FONA 1H5BC 4L0YA 2O1AA 1F58H 4D2NA 5FCUH 1D7FA 1NBQA 4EN2A 5HYFA 2ATKA 2J6EA 2DLGA 5SWSE 1SOXA 2BIQA 2J1KA 5EO9B 5DUPL 4J6IA 1ORSB 5DVNA 4MDIB 1X44A 4NO5A 5H94A 1RZIA 4PFEA 1B6UA 4HC1H 3ZRCC 4YHNB 4LO9A 4OI9A 5EO1A 3MV7B 1PSKL 4HFUL 3CFJA 4FNPA 4AQ1C 1I8KB 3O9WD 1PLBA 4NNYA 1OAZL 4X6EA 5FYJE 5LGJA 4Z7WB 1J5IA 1Z9LA 3DRTB 3LEYL 5FLUA 4O58L 1RURL 1MLCB 4MD4B 5FUOH 2C4FU 1F1AA 1INDH 2YKLL 1KG0A 2ITCA 4S1DD 2XWEA 1KTLB 3EGXA 2G4GA 4AIZB 4J3OH 2DN7A 1WBYB 4H8WH 4F9LA 4LVNB 2KPWA 4ODUB 4YDLB 1EZLA 4ZUTB 3RE0A 1XEDA 1Y0LA 5BMFL 3TO4A 3QZBA 1I8MB 4FQIL 3SDDD 2YQGA 2HG5A 3DXAA 2PPAA 3QWQB 3LZFH 3HPJA 1PZ5A 4PN6A 1UURA 3OZ9H 5J6SA 2VWEC 1TZIA 2WMPA 3MLWH 3VQMA 3RGVD 3R8QA 1SPDA 5DQDH 2V2XA 1O9VA 2AANA 3SO3C 3TZVC 4QWWC 1AGFA 3PP4L 3FFCE 4I1NB 1ESOA 1SXSA 1JD9A 4XP1L 5I6KA 3LH2H 2YAHA 5TFSL 2Q5BA 4P46A 4JZOB 5LNGA 3MYJB 1DBMH 1Z9SB 2W0PA 2A9MH 2WNWA 1WHOA 4FXTA 3U1SL 5TDNA 3C09B 1XSKA 3VSTA 5IKCA 3TBSB 4Q4EA 2QFRA 4WU5A 4RA0C 1BOGA 5D1XA 1A2YB 1OTUC 3FS9A 2XQYA 4FLOA 4F7CB 2OTWA 4AYEC 5FGRA 4XCFL 1H6TA 1MH5A 5FKAA 4MRBA 2LFEA 4Z8FL 3BZDA 5EU6B 3ZT5A 3A4DA 1CDUA 3F65A 5DQDL 3LMJH 4RFNB 4CVZB 4Z3FA 1H19A 3I2CL 4WW1B 1JZJA 4NC2B 4QTHB 5FF6A 1P1ZB 1I1AD 5DHDA 1P7KA 2EH7L 4R4FL 4NT6A 4NQDA 3WN5C 1BVKB 3CDYA 1T3FB 3SE4A 2VJ0A 4O02A 1G9MC 4GXVL 4KY1L 1F90H 1NGYA 4NDMB 1GMIA 2Y7LA 2IGTA 1SYVB 4HZLA 5GISL 3ZZLA 4JG0L 4LVHC 3VFTA 2NQ3A 5BVPH 1ZHKB 3NFNA 4DO4A 1JGDA 3EBHA 2GT9A 5B1JA 4P5SA 5F9WB 2XQBL 2Z7WA 2X7LB 5LGHH 5IB2B 3GJEA 4KI1A 5JORB 4BZ1H 3BRGC 3ECWA 4JQIH 3WGUB 2H3KA 4JUSA 2CBTA 3NOIA 3QG7H 5HYSA 1P7HL 3HMWH 3GMMA 5D1ZA 2CO2A 2HFGH 4IBSA 4U1IA 4L8BA 1T22A 1YPZB 5CCGE 3LQZA 4KK6C 2QELA 1MCPL 2CDGB 5KZCB 3V9EA 5A2CA 4B41A 1T66D 2WWNA 4KJWC 1BFSA 3ILPB 3IFNL 1MELA 4AYGA 4UAOC 5I9QC 3BAYA 1UTDA 3BDXA 4ZO6A 3F7VA 2CHZA 3UMNA 4B5ZA 4TVPL 4K3DH 4P3CH 3FQ4A 2VITA 1BVNP 2AEIT 3D69B 1QLEB 3DX9B 2ESVB 3AS2A 3CG8A 4P2RB 2ENJA 2WBKA 1ZV9A 3MROB 1KXVC 5T3ZH 1FFRA 4GRWB 1BECA 1D5IH 4KWUA 1X9LA 1C5DA 3WLWC 2P8LA 3EFFA 1NCWL 5F97E 1IARB 2ZWZA 3H7BB 2P28B 5D8JH 3TEZA 3P3SA 1MCCA 3GSNH 5IMKA 3VCLA 4YHMH 5CMAA 3UZEC 3VM7A 4PRPB 4ZDHB 4XVJH 4NC1E 3QFDA 1YMME 1Z9NA 4P05A 1UVQB 4XMKL 5GJTL 4I18A 3BH4A 3COOA 4GW4B 5IREA 43CAA 1KGIA 4HIHB 4N8PA 5JIKA 3U4EB 3X1GA 3C6LA 2EDNA 3FO2A 4WWKD 4BELD 3ARVA 2HKHH 3EYFA 5TQ0L 3FSWA 4HUCA 1DVZA 1MRFL 5LQBH 1DJIA 2AXWA 3GBNL 2VXQH 2OSWA 4N8VA 3MRJA 3MRFA 4ONFH 1IBGL 2Q3AA 3OLDA 3W0WE 3WUWB 4L8DB 2X3CA 2VXTL 2ADGA 4L3CA 4U1GC 2H1PL 3BEVB 4N2OA 4NJ9L 2DQEL 2E27L 3IJSB 1G1YA 3UJTH 1JWSB 32C2B 4M4RA 2DWEB 4MCZB 1NBYA 2FH8A 3PJNA 4X7SH 4BDVB 3EXJA 1BLNB 4LASH 3IGLA 1OM3L 4Z7WA 1LMIA 1SBSH 4OZGB 5T1MA 3OJDA 3VRLF 2C26A 4KXCA 2WGNB 1K2DB 4Y5XB 1CBVH 3DGDA 5L6YH 5C0EB 3W57A 1GMEA 4HG4J 2Q7NA 4UM8B 5F88B 5CUSH 5H35B 4XXDB 2D7TH 1FO0L 5DRXA 2GFBA 4F27A 1BG1A 3LYRA 2A9NL 2VXQA 3ARQA 1XGTA 3DYMA 4GRWF 3RRQA 1V3MA 1ZVSA 3NCXA 4PJ7B 5ECJE 5BRZB 5CLWA 4KGJA 4X7TB 3GBML 4JFHD 1QFWI 4MA8H 3ZY7A 1OZUA 5GRUH 3QEGH 2Y7OA 2UXFA 2OK0H 1I3GH 2W60A 4LOUD 1F1GA 3RI5F 5T1LD 4F15B 4XO9A 4JFXB 1ANUA 1A3LL 4O2CB 3DTDA 4DP4X 5I82A 1I9JH 2EJ1A 4NEHB 2VJ8A 1ECYA 3TGXA 4YDVA 1OB0A 4JE4B 3CBKB 1ZA6A 3VXTA 4KJPC 4EEEA 1MREH 3JV4B 4AQAB 4LOFA 4YFEA 5ALBL 3MRNB 5D2NC 5E6YA 1V7ML 3MLYH 4G8EB 4JRYB 1V27A 2GTZB 1JPGA 4GUQA 3ZTJG 5L4FA 1NIFA 2HLFD 3HS0B 3KPSD 4PRHE 5I74B 4E0RB 3RWIB 2OK0L 5A43C 2HJKB 1J8HE 4KKPA 2BSSA 4QR7A 3QPXL 3NN8A 1JGEA 4MA8L 3TEUA 4NQDD 1S7VB 4FQ1H 4JPSA 5G4OA 1R33A 5GZOD 4H0GA 2L04A 4LBEA 3LKOA 1MF2L 3P4LA 4J1UB 3W9DA 5IEHB 4IEFA 1P1ZA 5AVYB 4FA6A 1LM8V 2OMWA 3U9PH 3E2HC 1BVKA 1T3FA 1T89A 3OKMA 2AMGA 3HN8A 4V2CB 1U8MB 5J1AA 1K4DB 4S0SD 5FUOL 4I1RA 5I2IB 2Q7YA 4FI8A 3OKLA 4ZUVB 1ZHBB 4Z7VF 3DVIA 5IR1B 1QFUH 3D9AL 2ADYA 5D1QD 3VXRD 2E59A 4QOKE 1KY7A 3Q01A 1NFIB 4TL4A 4HS3A 1PYWB 4JUTA 5GGTA 2X7LA 4ZK8A 1AXSA 3FU0A 1JI1A 1F42A 1QTYT 4LDLB 2VDKH 2G2PA 5J6HA 2R1WB 4E5XA 2GITA 1OAXL 1DFBL 3DIFA 3OV6A 4DQOL 3MJ8B 5AW9B 1V3KA 3IFLH 5CD3A 3FT9A 3TYGH 3ULVF 1AJ7H 5DD6A 1JGVL 3FTWA 2K7PA 4PRIA 2Z4QB 1Z0NA 1WEJL 4GAAA 4W6YB 2V2WB 3B3IB 4M48L 3QQDB 3TOPA 3WY1A 4NO2B 3LH2L 3ZPDA 2CGRH 5K9OA 4I89A 1GSKA 1JPFB 2JCCA 4FYSA 4ZX5A 3VGFA 4YHYC 1XH3B 3UEZA 1B2WH 3UGUA 1MLBA 5HHMD 3QO0A 4PYGA 1PLCA 3MRGA 4BFBD 1EFXB 1WZAA 5JZ7D 1OSEA 3QXDA 1NCOA 2BOBB 2J8UA 1EO7A 4U1HB 4EDXA 2XXMB 4FNUA 5CIPH 3GUTA 1DQJA 1ZXKA 5HDBB 5DEGB 3WEBA 5B4MC 4M8UA 5EOQL 2OR9H 4K9EC 5D7JC 4YGVB 1M7DA 2BHFA 1J5DA 2XTJB 3G5VB 4Z7NF 5C2UB 2NQDA 5BZDB 3HC3H 3QDJD 5CP7A 3L95A 1B4LA 1BGXL 2MCAA 4Z8FH 3WL9A 4U1KA 5EBLB 1E28B 1C1EL 4E41D 3P1VA 3MN8A 4DGIL 4F2MB 2XQ0A 5INDB 1BAGA 1TVBB 1YNTF 2NCMA 1XGYH 1XB8A 1O6SA 3CZFA 3FF8A 3OXSB 4QYOB 3Q1EA 1CCZA 4GQ9L 2DQUL 2XN9D 3IXTA 2DICA 3IDJB 3V4PB 2FB4L 2NZ9D 3VQ2C 4NZTH 2X2JA 4Y9EA 1IZKA 4GG6E 1HJBC 4GP5B 4IM8A 1HDMB 3C2SA 3L3DB 2L7QA 4Q9CA 4J8RB 4TVPE 3LNGA 2APWA 2YN3A 3EUDA 4XGZB 2PLTA 4F24A 1W72H 5C0FA 2G75B 2OL3L 1YQVH 3TJPA 1KJ2H 1I4FA 1M57B 3GIZH 3BHBA 3MV7D 5F0LB 3VG0H 4XBGB 4QHKI 1XF4B 4I9WE 5DR5H 3EF7A 5IG7A 1N59B 2HG0A 1JWSA 2WPGA 4HEPG 3DNKA 4AEFA 1WLHA 2I07A 4UQ2B 5DGQA 3F12B 1Z5HA 3CNKA 3A4FA 5I1HL 3CSYB 2GSIA 1AO7A 3MLZH 4ZW8A 1NCGA 4ZYKA 3HUJA 3SPVA 1EO8H 2F7OA 2B4CC 3UH8A 3QORC 5IQ9A 1YJDC 2PXYD 4GAYA 1OGAA 1S5IH 1WC7B 2YPLA 1IBHA 1XIWD 4NXKA 4LHUG 5DEJA 2C9PA 1IAIL 2Y6SD 4LEOB 1X5GA 1BQSA 2BHUA 1E4XI 1NPNA 1T1XB 4NHUB 1M2OA 2DQTH 1KBGH 3R7RA 3EDFA 3X1BA 1TQVA 3TH3T 2APBA 1FHGA 1T4WA 1VENA 4YO0A 1A21A 1I7UA 4QF1B 4GEJA 3B2VL 2ROXA 2VDQH 4X7TA 3VI4F 3SKMB 4YXHH 2O6FA 4W9EC 5JO5A 2ICWJ 3KYAA 2JCWA 3KHOA 5GS0C 1CDGA 3ARBB 2NYKA 1P1VA 1HHKB 1OXYA 3FCTB 3VWJD 3QFGA 2BW4A 3C08L 3QUYB 4C55A 4POUB 5HVHB 5E1QA 1EDQA 1GA2A 1A6VH 2C9XA 4B97A 1UUSA 2OMVB 1SDAB 4UQAA 1Z9MA 4JRXA 2HFEA 1XCXA 2WWMD 4CVXA 1XSIA 5JQ6L 1ZA6B 2YEVB 3ZKSD 1SXBA 1TFPA 4X6CA 4CSZA 2LVCA 3QUMB 1BBDL 4KZDH 5LAPA 2O4EA 4XP6H 4NYLB 4JRYA 5IHBA 1TZHB 3SDCA 4G8AC 2O6CA 4XXWC 1U3ZA 4TLTA 1J18A 4RNRA 3BUQA 2VKXA 4IMLA 4MNQA 5EO9A 1OGAD 1AAJA 2YD5A 4CMHC 3EIFA 4MHHG 1QBAA 2QSCL 4U1GB 2O5ZL 2GKIA 3GSVA 4ODSL 2D4DA 2QSQA 1SMOA 3DV6A 4AMKH 2Y24A 4F7EA 1RZJH 5LGJB 2WNGA 1NM9A 4J7RA 5BMFH 4IEFB 3MBEA 1RK1B 4IRZL 5AVRB 3UGEA 2ICCA 1MCEA 3MTXA 1U8LB 1XV8A 4HIQA 2H0JA 1ZS2A 3UTSE 1JPSL 3IMVA 3ZU8A 4F7KA 1WBYA 1W80A 1NKRA 3RIFK 5I24A 4YSCA 3RUGA 2R0WH 2VC2B 1BEYH 1J11A 3NJHA 4C56D 1BMZA 5CHNB 1RD6A 3ABLB 2ATPB 1BIIB 3MJ9H 4RQQB 1LL1A 4TM9A 1E8XA 2VRKA 4PI2A 1DQIA 4UMGA 1NINA 3RVVC 5KS9B 3BUIA 4H7VA 5FOJA 1P4LB 3G9VA 4HJ0D 2YD3A 3LXUX 3HZYB 2OW7A 5I1JL 1F4WL 4DN3L 1QAWA 1ROWA 1WTGT 3DX2A 2WN2A 2BPBA 2KT6A 1O7DE 2AGJL 1RZJC 2Z31C 4J6RH 5E00B 3RWCA 4PJEF 4XTRC 1FFNA 3HMXH 4JKNA 3EJYD 3MRBB 3PREA 2Z4QA 4NJAL 1ITBB 2WLJA 1CICA 1TJGL 2C9UA 3HOGA 5KG9B 4U6HA 1OAXH 2D31A 3IMRA 5C08D 4YPGB 1J0IA 2C7FA 1JWMA 1XH3A 5DJ6A 3S36X 4KI5D 3AMLA 1BOGB 4P4KC 5D1XB 3KCPB 1B4TA 1NC4B 2N0KA 4HEPA 5T1DH 2OYPA 5FW7A 2E8ZA 4EIUA 2H0PA 3V4PL 2WM0A 4O2EB 1ETZA 1OAJA 3QXVA 1JHKH 2VIRB 3KBHE 1CDHA 2VXVL 4K9JA 4M7LH 2EP6A 3O3EB 4IW4C 5ITBL 5EBLA 2EINB 1ASQA 4PRPD 4KH2A 4Z77A 3BWAA 1BOYA 2XHNA 4G80A 1T0NA 4U1LA 1TVBA 1UWXK 2B08A 4GQRA 4KH9A 4M1GL 1JGLH 2GQHA 3P9LB 2X12A 3T0BA 2WLIB 3IXTB 3IDJA 1ID5I 4RVBA 2WIMA 3SDYL 5KANG 1X5LA 3QNZB 1XZWA 3QW9A 4YC2C 1GY2A 1KWGA 4M6OL 5KUKA 2ZXDA 3O2WH 4JL1A 3T3ME 4Y5VB 4BSWB 2GT9B 3LRGA 1SF5A 1SLWA 2FATH 4FFZA 2CG9X 4ANXA 3NSCA 2E86A 5E1IA 4GAFB 1O6TA 2N1TE 3GLZA 5AL0A 4HUXB 2V3EA 2PF6A 3C8KB 2OQJB 4UWQB 2X28A 5JW4R 5E6SB 3SQRA 4PWHA 4C56A 3SODB 1XF5B 2ZAIA 4K7PH 2ZCHH 1D7DA 4L8BB 1Q0YH 1TOXA 1UGNA 1XQ4A 2VUYA 2IAMB 2ZWNA 4AM0Q 4BUQA 1LP9A 4GT0A 2W07A 4PJDA 4AENA 3AWEA 2LE9A 3BDBA 2VM3A 5BJTB 2IO5A 1MCWW 4MLIA 5HGDB 3W0WD 3A21A 3SPVB 4H20L 3ILPA 3TH4T 1RP9A 4XI5C 1IQDB 2XICA 3QWOA 2ZX8A 2YMOA 2AVGA 3VGGA 5KVDE 5EOTB 1UATA 2MOGA 1ASPA 2VDQB 1INEH 4H88L 3WTWA 5CJXA 1NFDE 5ID1A 2DOCA 1SHWA 2VDRB 3MRIB 3ZVVA 3FT3A 2H9GA 5J57B 1KB5A 1XGUA 3IYLW 3REWA 1TKWB 4ZW6A 1FI8C 3T1FA 2DQCH 2C9AA 5FFOA 1MHHB 4PLKD 2X4TA 4Q9BA 5E6IC 3HZKB 5EFIB 5D2LA 4PRAA 2LHAA 3SDXA 3GBMH 2OR9L 2WANA 2WBXA 1YCSA 2F54E 4PREB 4WZ9A 1JNNL 1U42A 3ARBA 4JJOA 4WDIA 3ZXAC 2QTEA 2IANB 2K6ZA 2VL4A 3CPLA 4Q6IB 4YBQD 5IV2A 1I9IL 1D5MA 2NUPA 4YZWA 3NIGE 1BPVA 3FUNA 4EI5B 3TA3C 3M7FB 3RILA 3BPLB 3KPPB 3A6BL 3FB5A 3WKML 1A0QH 4P57B 3T4AA 3T3MB 4J27A 3GO1H 4JZNA 1KIUA 3UJTL 3S7GA 2XV3A 1R9FA 4MBRA 3WMQA 4J4PC 4O2FA 4NI3A 4RAVA 5F9WC 1OO2A 1OM3H 3V95A 5IVXB 4FOMA 2Z92A 3P40A 2IGFL 3UIZA 3D2UB 2WJ5A 3WUWA 1O9WA 1PAMA 5B38B 1E2WA 2GI0A 1YNKH 3RFZA 4YOKA 3LHPL 5CEZH 1NBYB 4BDVA 4BM7A 5C0DB 4NERA 3ULUL 5CINH 1SOQA 1KBVA 2YLHA 2WVVA 4V2BA 4WSJA 2Q87A 3UO1L 4EPSA 2Z65C 1T20B 1PD1A 3WJLC 1HQRB 3PNWB 3I75A 4X9FA 1V3LA 3ZHNA 5I76A 1B3IA 4OCYL 5I9QB 4OBRA 2ZOOA 2CALA 3B9VA 1IIKA 1T5XB 3VM5A 3GMQB 3J27A 3QCUL 4RGNE 2X4NB 5T5FA 2X41A 5L4MA 3JTBA 4JFYA 4XXDA 5EORH 4ZMVA 3CFEA 1WAAF 3NJNA 5HJDA 3GHBH 4EDWH 4HJ1A 3KLAB 35C8L 3WUWG 3NZHL 3GTVA 5CR1A 1T6VN 2KHAA 2YC1B 1BIIA 4RQQA 3NQIA 1M1SA 5E56A 4XN7A 2X5PA 1WGOA 3IXAB 3C2AL 4DNLA 3HIZA 3TESA 5BV7C 3WIFA 3O11A 2W60B 2P8MA 4HIXL 3WTVA 4R5XA 3J8F7 3DMMD 3H8NA 1JERA 3EJSA 4TXVB 3MRQB 3KGUA 1U93A 5CJOL 2Z35A 4XC3L 5C3LD 4W70A 2Z8WC 3NCBB 2VAAB 3OLGA 4P3DA 4O5LL 4YUEH 2VN3A 1CPUA 1NMAL 2L7UA 4EN3B 5I1LB 2HTKD 1IM3B 2XRAH 3ARGC 4IKLA 4YPGA 3U2JA 3M1BB 3NIGF 3W9EB 4RZCA 5E9NA 3O2VH 4RLDA 1VLXA 3VFPA 3T9WA 4P23C 1UXMA 2HJKA 5C09A 1MN4A 3O41B 1JK9A 1AZBA 3GSRB 2YAOA 4WEBH 3TBCA 3UAJA 3WXVL 5LXGL 3R06B 5BVPL 4OCRL 4JM2F 4QGTA 2F74A 3BH9B 4QXWA 2XG5A 4QXTA 1G7IB 5EU7C 4MNHB 3RWGA 1ZOXA 4Z3JA 5TH2B 2O5XL 4W9ZA 2DF3A 3CVIH 2CLZA 4G80B 5FPIA 1ZHLB 2P42B 4U3CA 5HTSA 3QCVH 4PRID 3A67L 5IMLB 1T1ZB 3NYKA 4XO3A 5DJYA 4AV5A 4IHBA 2ID5A 3N40P 4D0BA 3OJMB 4KKQA 4OCWH 1AHMA 3VGAB 3ALWA 3FCBA 4CRPA 2CDFA 1C7SA 1A64A 1KT2A 1RZ8A 1UJ3C 1T2JA 1V10A 2FJGB 2WHVA 1A6UL 5E03A 4GO6B 1PZDA 2LV4A 2D8KA 1A7NH 2OMXB 3GMPA 3FQ2A 2WLNA 5F0PB 4Z7VE 2L3BA 3GXFA 4QWWD 1TSHA 3ZKQD 1WE5A 2I27N 3IN2A 4ZQTA 2O26U 2YK1H 5HVGB 2CU9A 5ANMB 4GRLB 1PDKA 2NY1C 4I4WB 4B5EA 4I0PB 3ULVD 4OF7A 4RRPM 4QOKA 2B5IC 4X98A 3SO5A 3V55A 3B2XA 3K1DA 4TNFA 1QP1A 4NI6A 2VO5A 2CBMA 1AH1A 3VD0A 5ABAA 4OLVH 2BH0A 5BW7C 3OPUA 2Q10A 4GRMA 4N6QA 1AR1C 2V7HB 3CE1A 1HCYA 1QNZH 3UFIA 5EULV 2JCCB 1MW2A 3OM3B 4LVNC 2Z91B 5E2VL 2YPVH 1AC6A 1NDGB 4JL2A 2J20A 4Q2ZB 5DJ8B 3ZRSA 4HHWA 2OMZB 2J5LC 3MRIA 1U8NA 3I9IA 2VDNB 3G5WA 2EICA 4WI5A 5ABDE 4K71B 5E4AA 1E50A 2B39A 5DMYA 2DQTL 4MS8C 5GRYA 3RU8L 1HAWA 4N2EA 3V0VB 2OCJA 1HKLH 2XWZA 2HVKA 3G5VA 3FUEA 3L95B 4MJ6B 2I5YH 2VXQL 2WQUA 4QD2E 3VWJB 1GZPB 4LHUA 2R51A 5SX5K 1RZKL 1AZZC 2YPKA 3KH4A 2YD1A 3ESPA 3CZEA 2VR7A 4J12A 3LD8C 4X6CF 5ETUA 5DS1A 3ULUD 1R3JA 4HOMA 4YDMA 3BPOB 5D5MF 4MB4A 3FB5B 3BMVA 4MA3B 4ZMPA 4MMXA 5C7XL 2NMSA 4YSSA 5DVKA 3VB8A 5FO8A 4KX9A 3NCFB 5DD0H 4NN5B 5DUMH 2K4AA 3DMMC 3L5WB 2FX7L 4PJHF 5I15L 2ETWA 2NTSP 1BVLB 3L3GA 3QDME 4H2AA 3NSDA 3JXAA 4J8RA 1F0LA 4O2FB 4RAVB 1G4MA 3B9DA 3MNVB 5GGRB 3MUJA 4M5SA 5BV7L 2YBGA 5C0GA 1FPTL 4F1SA 1AZUA 1KBWA 1YPZE 3HKZA 3KW7A 4KK9C 4WU7B 1IEAA 4NUGH 1F6LL 1NCWH 3B7YA 1GKEA 2H26B 1A02N 4B53A 4ELMF 1LO3H 5T5NF 3NP3A 1Z5YD 4JFZL 3WIIL 3P3UA 4EZKA 5IHLB 4EUPB 4PLJD 4WQOA 1YECL 1GGUA 4A7GF 1F11A 1J0HA 1UQSB 1C8PA 5AZ2L 1UHVA 2VRQA 2ZKXA 2ZUUA 1AO7B 3E7JA 4OFYD 1I8IB 1RJYB 5F71A 2JJSA 3HZMB 4ZFZB 5T1LB 3QJFA 4DKTA 3PQYA 1TETL 5IQ9B 4LEXL 2KZ1B 3JWDH 4WWKB 4RDBA 5EUOE 3QJSB 3POCA 2YPLB 1DANT 2NR6A 4XVSL 1PTZA 4QRTB 1N4XH 2MH4A 1BV8A 2XN9A 2YC1A 3BVWA 2DEXX 3QB7C 2WKOF 4QF1A 1HU8A 3BUPA 2JV6A 3GUFA 1CI5A 4Z7NE 4U7MA 1ZTXL 1PLAA 4GUCA 3CH8A 3PDOA 3P0VH 4E41A 1QLRB 4X4ME 2P7TA 3UP6A 4F7TA 2J55A 2H32A 2W0FA 5JQHC 4BFRA 4PLJC 3F5WB 3GMRA 5DSCA 2FJUB 3LPPA 3V10A 1QVOA 2H45A 3PXLA 1XZ0B 3OGCB 5I1CH 3FT4A 3UCRA 3ULUE 1TQBB 3RVTC 3T4YB 4KI5F 1OHZA 5GS3A 1HEZB 4HJJL 1N5YL 1ZWIB 2RFXB 1SFDA 4K7PY 4OTXH 2R56H 3Q1SL 2DDQH 2FX9H 5C9KA 4KK8D 4Y9CA 2LAGB 4XNXH 4X5QA 2WLLB 1MCJA 5EIIG 3TCLB 3JYBA 4M5TA 4MXWL 1ZLWK 1LK3L 5MEOA 2FBRA 2JF1A 1ZVNA 5KBNC 4G9FA 3QIBC 4LSSH 1MCPH 2PYFA 1RU9H 2VXVH 5D7SH 1DBJH 1QQDB 5FUZL 4FI6A 4X80L 4EZMA 3KPOB 4AMWA 1AIZA 2QKIC 4HK3J 1NMCC 2AI0H 3ZTNH 4K94H 3LZRA 4TL5A 3SKJH 5IOKA 3BEWA 4ACTA 3QC5X 4KUZL 5LN4A 4HX1A 4MCNA 1EQWA 4FKEA 4QRUB 5TF1L 3SCMA 1E4XH 3OSVA 4ZX3A 5ITFA 1LE9B 3B6SA 2K78A 2ZQKA 1W72B 4KO7A 4NP4L 2X4PB 3LPGA 4P2OC 4XPBL 3ZMRA 5HP5A 1MG2C 2Q8BL 4KI5C 4H1LH 4OJEH 4XP5H 1FE8H 5D1QA 5E5RB 4AT6A 3JT0A 5JIDA 1PD0A 3NZUA 3F85A 3RUGB 4E9TA 3PWPD 4MQ7A 3V5KB 3WKQA 4AJVA 3OAZH 3TBYA 5KVFL 2QGCA 1S3KH 4D9LH 2CCVA 3MV11 2XA3A 3S48A 2GIXA 1RPUA 2D0HA 1SJMA 2Q20A 1UH3A 3HPLA 4U6TA 3S37X 5D2NB 1DP0A 3WXWL 1SJEA 4QRPB 3FTGA 4AW7A 4L4TE 1D2OA 1OPOA 4Q9RL 3BDYH 5FFLA 1XT5A 5DZNA 1A3ZA 1WT5C 1UASA 2QMJA 3BKCH 3ZKXC 1XAKA 4OLYL 1CDYA 1FYTA 1P4BL 4HWNA 1I9JL 4G8GE 3SGKC 4G70B 1FFNB 1N0XH 2WXFA 1CU4H 2BRRL 2DQDL 1CE1H 4M8RA 1A6PA 2C1PA 1QEWA 2OSYA 3F2LA 1PCSA 5DHVH 3QIWA 3VFGH 4XP9L 2VC2H 2YKLH 1KLUA 3AREA 1AP2A 2AKRA 2D0FA 2EYRA 1U8CA 5HI5D 3QJZA 1T0PB 3KWXA 5CBAA 2CA4A 1NMAH 1ZPLA 4N22A 1KUMA 3GSXA 1R3IL 3O2VL 4L4VE 3V0VA 2A3TA 4Q9RH 5HYQA 1XGQA 3O3BA 2I60L 1QYGL 2CR3A 5HI4D 3ARDC 4MAZA 3UO1H 1PS3A 3BESR 4BEIA 4DP2X 2W65A 3NSXA 3OZ9L 3GSUB 4ODVL 1DANU 2IAND 2KZBA 2ADJB 2WQ8A 3EO9H 2G9KA 4TKWA 3LKQB 4NRZA 3L8QA 2ZX5A 2DLTA 3RWEA 3EBGA 1UT2A 3NJIA 4FJYA 4UTAH 1I1YA 1KENH 1RVFH 5CXPA 5E9DB 3ISWA 3SO3B 2PXYB 4A39A 1EZUA 1U58A 5C8JB 4K7PX 4IIQC 4DPAX 1CLYH 3CZLA 1ND0B 1EHLH 3C2AH 1FBIL 4R2GC 3H53A 3HC3L 1U8HA 3BZFA 5DT1L 3DJTA 5GGVL 5AB1A 3X11A 1HC1A 3AJ7A 4B0MM 2X6VA 1C5CH 3IDYC 5DWUL 4JFVA 3OR7A 3BLPX 1JPST 4P5TC 1MWOA 1DBBH 3FSVA 3QXAA 4ISVB 3REVB 4AQ1B 25C8H 2EACA 4ELKA 3NQKA 4OJYA 4QHNA 3RX8A 4F91B 1S9XA 2HX8A 1IJ9A 1W2KT 2R1XA 4LCIL 4WY7H 1T2XA 2PP9A 4FJ6A 2P43B 3WJMB 1SHMA 1OOWA 2NYZA 4XX1E 4D0DA 1A5FL 4UOW0 1R5WA 2J56A 4F7PB 2MOVA 2X1QA 3GBDA 4LP8A 1L9PA 1OPGL 3ZDXF 5ID1B 5JPMA 3B1UA 4Q58C 1OT1A 5DZPA 3IVKA 1J10A 4FQ1L 3LH9A 2H9GB 3AG4B 1KB5B 4JPKH 3KYNB 3NTCL 3GI8L 4YXKH 4XODA 5GJTH 1MCHA 4OCRH 1CGSL 3A6CH 4ZMLA 2WTOA 2A74B 3NP4A 4Y1AD 5AOLA 5EFIA 4LOVA 3HZKA 4GW5B 2P80D 5TF0A 4X9YA 4L2YA 1JCVA 4KHTH 2D03H 4HS8H 1KB9J 4ODSH 1TMQA 4OFYA 4FXKC 4CDGC 4MKTA 5DA4A 1HWGB 2XU9A 4NIKB 2G5BB 5DEZA 2FJHA 3SYAA 1D5MB 5IW6B 3RA7H 2LOEA 1GJIA 2MCMA 3QYNA 1AY1H 1OTSD 1OAUH 3S3CB 4JPKL 3AGWA 4TUKH 5E94B 3FH8A 4HPOH 4PV1C 1H6FA 5JNYA 3BQUD 1Q38A 5GQBA 1KIUB 2OL3A 3VMPA 3KPMA 3KLSA 3H54A 4HLZG 5GZNC 2KZWA 3GI8H 5INCB 3IFPA 3MRLB 4EKJA 4M7ZB 2HJFA 2AEOA 3N41F 2XT1B 3L7EB 3BZ4A 1UXSA 3L4CA 3PL6A 3WIHH 3QVAA 3MRDA 2HRHA 2K7QA 5DVOA 3CTTA 3IMTA 1KOAA 3MFFB 4U6YB 3DJZA 2XPGB 1FAKT 4YDIL 2FYYB 3QPKA 4LQ1A 3SE8H 3SGEI 5C0JA 1E6JH 3RKDC 1YO4A 3TA4D 4JBSA 1FV1B 2PYED 4Q74A 2GSGA 4R9HA 1DSFL 2DYPD 3WEOA 5CD5D 3WTUA 1QBLL 3L1OL 1UACL 5FC9A 1HYSD 2FSEA 5A16A 5LG6A 4ODTL 1W6WA 1GC1L 3DGCR 4QRUA 3AABA 5SWZD 1TTFA 1W72A 3FULA 4U3HA 5I0XA 1TTRA 3GMQA 2IQ9H 3I3EA 1X5YA 4JFYB 4K3JH 3L9EA 1P4IH 3VXNA 4FNLH 2CM6A 1CB4A 3I9GH 4Z7UA 4PWKA 2NLJA 2XSKA 2E8YA 4L4VB 5K59F 3RVVD 2GCYB 2BCKB 2VR5A 5HHXL 4XCEA 5IIEA 3V5DA 2P5ED 2A6KB 4C83B 3PWPA 1AZNA 4IRZH 2ZOUA 2A1WL 1DBML 3MV8A 1SM3H 1VFMA 1X5ZA 3G6AB 3IWUA 3K4AA 2BJMH 2MQ0A 1RZJL 3UPCA 4C47A 5CCJA 3DO7B 5C0AB 5IM7A 1IMHC 4F33B 1NIDA 1AZVA 1ZS8A 4B0MB 5TPWL 2WQAA 3CVDA 2MQCA 1MNUL 3S37H 3RZCD 4OZ4A 5I1JH 1GRWA 2YA0A 3F3HA 3HNTH 2F1AA 2FBJH 3QFJA 1G6RH 1NDTA 1WH0A 1CDJA 4BIKA 5JHDB 2BC4A 2AQPA 5BOPA 5HY9A 3ARFC 1KLFA 4H0HB 3ZHLA 2UVFA 2H2SD 5ENWB 4R3SA 2L8AA 5C09B 5I6NA 5I6LA 5ESVB 12E8L 3H9YA 4DP7X 2Y1AA 3DROA 4XOCA 3TJHD 1S9YA 3VFVB 3G6DH 1RIVH 2PCPB 1AIFA 1MRDH 1MUJB 3LKSA 4RETB 3BVXA 4YHZH 4UT9H 2JKLA 2B1AL 4GOSA 3MNZB 1HH9A 2F53B 4HAFA 1NCIA 4NJAH 3RGVA 2OYMA 2F68X 1AGCB 2PTVA 4I77H 1ZHLA 1H15A 4XNQA 5EU7E 3SOBH 4F8QA 1A7QH 2F54B 3Q5TA 5DJYB 5HHOD 3B2DC 4H20H 3BE1H 3C5ZC 3K91A 4IBYA 4Y2DD 1REIA 1YNLL 4IDJL 4N2BA 4IOSD 1B9KA 2CDFB 2IPUG 4JFFA 4Z76B 4MJID 4V33A 5LN8A 2WKLA 3WTTA 4OW6A 3ARFD 1ZE3C 4K5NA 3N1FC 1T83C 1RULL 1SYSB 1SN2A 2A6IB 3BZFB 4AVJA 2VLKB 3HUJE 3TURA 1N3NA 5BZXA 3WMPA 5IQ7L 3ZE2E 2G3MA 4QLRA 4F8PA 4MCYA 4NOFA 4NUGL 3O2WL 2XA8L 2OJZH 3PS6A 3V0IA 1PDKB 4I4WA 3HAEA 1RUMH 1MCDA 4HWBA 5FUZH 4G3YH 1J0ZA 1DQQB 4QOKB 2ZZUT 4V1DE 5I6PA 3F7QA 4YL4A 5KSUA 2HFTA 3FQWA 3QEQD 5K9JH 1JOIA 4QRFA 5ICUA 1I7TA 3BGFC 3GJFK 4IDLA 1AHWA 3JWNG 4PLOB 4WK2B 1KDIA 3WJMA 4APQA 5D1XE 3DJSA 1UENA 1S7WB 2R0LL 4KX7A 1CBVL 1ZGLB 2Y0SA 2R23A 4GAJH 5C0ND 1S7RB 4PP1D 3UX9B 2CBPA 2GUOB 4XOAA 3VFGL 1XR8B 4HUWB 4AM0B 5DDHA 4HCFA 4CNIB 1JPEA 1FAIL 4JM0A 1OVZA 2AQ1A 1F2QA 1TVDA 2AEQL 1NBZB 5JR1H 4C54A 3OAUL 2A74A 2YAEA 3ZKMC 4A7QA 2YUXA 2UY7B 5CBEB 4IK6A 4PEEA 2VERN 2ADIA 4ZMTA 1VZGA 1IAKA 3CFBA 4KTDH 1CFVL 5HYJA 4KC3B 1GC1C 2COVD 4HIPA 2YPKB 3DV4A 4YBLC 5CFHA 2XI9A 2NZ1A 4H88H 5DJAB 4NO5B 3QPQC 3VXOA 2PABA 3E8UL 1UGKA 3U36A 2IAMC 4OZIA 2DJ4A 1V7MH 3WY4A 4RFNC 5FO8B 3L4VA 4TQ8A 1P5UC 4S2SA 4UT9A 5FO9B 2ZXEB 4OCYH 4LSVL 4KPHH 2VW6A 4AVKA 3LZOA 1PZ2A 1DDHB 1UWXH 2BSRA 5FO7B 5T3XL 3SKOB 4XN4A 4AW4A 2Y07H 2YGOA 2HN7A 3MCKA 1B2YA 1FV1A 2ZCKH 4GO8A 2COQA 2R2HB 4EMZA 1ZT4B 5E2JA 1A3RH 4RCAA 5C9JB 3LRKA 4YX2H 4I9WD 5DJ0A 5H37G 1ZMYA 4PVNA 2WTPA 1RUQL 4G43A 1I1FB 1HILA 4DUXA 2BNQE 1QLEH 2JCCF 3T6VA 5HGHA 5CLZA 2J4WH 2X3BA 1ODUA 1QO3B 1CD1B 1G5AA