2CO4A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co4A00
2CO6A 4PHXA 2CO1A 5D55A 2AXWA 2CO7A 2CO4A 3UIZA 4OR1A 2CNYA 3UIYA 2IXQA 2CO2A 2CO3A 2CNZA 2FVNA
chains in the Genus database with same CATH superfamily
4RFOH 5JYMA 1G6RA 1SJHB 2CRMA 2HKHL 4HUXB 1JGVL 1TVBB 4M5YH 4TNVK 3S97C 3NJKA 4LOVA 1I9IL 3WCYA 3CZGA 3FHQA 4RDQF 5I26A 4N2LA 4IKJA 2JI2A 2VUKA 3QEHB 4MA1C 4O2FA 4FMKA 3WS6A 1IFHL 3CSYA 3F7VB 2XWBB 4PRAB 2B4CL 4X98A 4OQ1A 5JXAL 3MACH 2YHGA 2NTFA 3ZE2E 3LNFA 5C3IA 3T0AA 3IWUA 4NO3A 1PQZA 3EF4A 5K33A 3T0VA 2Z92B 4LLWA 3RWDA 1WD9A 2DKSA 3RPIA 4U1LB 3W2DL 4A37A 2ZX7A 1FZJA 3VG9B 4YSQA 4BSJA 1V8HA 4PG2A 1E27A 5D6DC 2VDKB 3FYEB 1EANA 5CP3H 1KG0A 2WTPA 4JRYE 3L3OC 1G1CA 1ZTXH 3Q6FA 1FG2A 3C87A 4P4KD 1WO2A 1ZPLA 4Y16A 4JFTA 3QEQD 2F74B 5KJ7E 5EEVA 4I3GA 3IGAB 1VACA 4AVKA 5E2UL 2KERA 3BAJA 1J0HA 4GIPD 5CGYD 1CL7I 4PHZA 3DROA 4U6YA 5D7SL 3IBOA 2XKSA 4UYPA 4Y19B 2XBZA 1I9JH 4QOKD 3H0TA 2OL3L 3T2NH 3IDGB 3B2VL 3JV0A 4CVUA 4M56A 2BXZA 3K2MC 1FFOB 1IUZA 5DHYA 1MCBA 5ALCH 1O6SA 2DMGA 1B6UA 3VFOA 1L6XA 4HWNA 4JQVA 3IE9A 1HI6B 1G7MA 3D4ZA 3ZTDC 4APQC 4GG8A 3FTZA 3F58H 4G2AA 5DUJA 5T33H 2APSA 3QRFM 3VGDA 1AXTH 4XHJD 4NXKA 1DJIA 2E47A 3V9FA 2ENQA 3F01A 2XYCA 3S3BB 2WINB 5HDQH 3RGBA 3RGVA 4IIQC 2XBTA 4HIEB 3CSTA 1JV2B 2X2UA 1BW8A 1DANU 2FYYA 1ZHKB 4AGLA 1LK3H 4HX1B 1J87A 1RZFH 1TJHH 3D50A 1J8RA 3FS9A 3QG7L 5F6HJ 2JJVA 3MOAH 4ZMLA 4DN4L 4L8CA 1SOSA 4G6KH 3T8VA 4YIQB 1EUTA 3QIWC 1NWOA 3UAEA 2QHRL 3UJIL 5D2LE 2XIBA 1RFDH 5EO1B 2C9VA 1AYOA 2V3DA 2F08A 3FFCB 3OSVA 4R90L 4XPGH 1WWWX 3WFCL 4U31A 4M7JH 4M8QB 1J0YA 1T0NA 3TPUA 3L4ZA 1AGFA 4RMWA 1M7DA 5J06A 1TITA 3LN4A 4LPXA 1PX4A 1D6VL 3S96B 2EDOA 4WO4B 4N24A 3T0ED 3LEVL 4XOBA 2NPLX 4OCNC 2QR0B 4IOIA 4EI5A 3WTVA 4HS8L 4LXFA 1IGJA 4MA3B 2NT1A 4LRIA 3QQXA 2Y07L 3GUTA 2BS8A 3WKNA 1IC0A 4GB9A 4XVOA 3UBFA 1T1WB 3AG2B 3VTAA 1HNGA 2BSDA 2GBAA 4QRSB 5G4MA 3WL9B 1QO3A 1UJ3C 3CZUB 4FTVA 3ARGD 3CMOL 4GSDH 3L3GB 4KRMB 2H1XA 4KJYB 3NJXA 5CMAA 3ZTJG 1OPGL 1I53A 3P30H 4BK5A 1FFTB 2JSFA 1TTUA 3CDGA 3HR5A 4OD2A 1S7QB 4KNTA 5MEPB 3S4SG 2ZT9C 4BV1A 3VXUB 5HJBA 3BP7A 3KCPA 5DO2C 1MI5B 1KBBA 3OKMB 3TZVC 1R46A 1KTDA 3WJMA 4Y4HB 5CBEB 1C08B 1YEDA 2ED6A 1EGJL 4HOXA 3NIDE 1E4XI 2DIEA 3K6SB 1UXMA 3JTSB 2VR5A 3S98A 2FATL 3QDMA 4GAJL 1T22B 3H3KA 2HG0A 4PVMA 1L9OA 2F68X 5H4ZA 1A7NH 3BVDB 3OJ2C 2V2TA 2VTFA 3HC0B 1DBJH 3RHWK 4AYMC 2Z7WA 1E2ZA 4HHAB 4DT2A 2F7OA 2HJKA 3P4NA 2R27A 1PAZA 4D0CB 4N1EA 3ULUE 4OZGA 2BPBA 2ZCLH 5BCAA 3EJZC 3MJGX 2WWNA 5JW4M 4RA3A 3TVMA 5FECA 5D7LE 2VSMB 3MNVA 4J3OC 2EZ0D 1MW3A 4JREC 5MERA 5MHSD 3G04B 2EDKA 1WBYB 2Z31D 4X8CA 1T83C 4HWBL 4LIQE 1D2PA 1CD9B 3T8XA 1N4XL 5EV7A 4ZOAA 1MHPH 5EO0A 1EX0A 4QAMB 3MX0A 4LLDB 4ZG1A 4E2OA 4WTZA 4MNHB 3O6ML 4OJAA 1RZJC 2R56H 5EOCH 3J7HA 4ZW5A 3DJSA 5F88B 1JZ5A 3C8KA 4MRCA 5FS5A 2EYTA 4MJ4A 1EHXA 3FUNA 4P2OD 1HIMH 5EB9A 1BFSA 3RRQA 4DGUA 1MREL 2EYSA 2X88A 4KXAA 4L0ZA 4O9HL 1QKZL 2C5DC 3RDTA 2DQJL 4PJ9D 3E8UL 4PJ8B 2J4WH 5DTFA 2VH5H 5J13C 4WSGA 2GJPA 1NH6A 2WQVA 3AY4C 4MDJB 5I82A 2DMHA 4J6RL 2L3BA 4J3OF 5D9SA 4JNXA 3UBXA 8FABA 4XNZB 1AI1L 1IFGA 4W4OA 3MV7D 3CFTA 3AWFA 1T1ZA 1MWAL 2FEDD 3SKOB 3WLWC 4PTTB 3BPCB 4FCAA 5LBSA 2WLNA 2CO4A 4GQ9L 3DUUA 1TNNA 1K8DA 3HNSL 1SUHA 3ZR5A 4HH9A 2UX6A 2QQNL 1AZVA 4NJ9H 4IK7A 4NO2B 4BSVB 4EN2A 5ICZB 4I3RH 5HYSB 1SDDB 3PJSB 2Y6SC 4ZS6C 2WNWA 4A39A 4PS4H 2AKRA 1L7IH 4N20A 4QYAA 2ITDB 5GGTA 3JV5A 3BKYL 4M7KH 5LXVA 2ZOUA 3WHE1 4AKOA 1J5DA 4KXZI 2V3EA 3MRRA 5T1MB 2W0KA 3CCHB 3GMLA 1RUML 5DZAA 4DK6A 2WKLA 3MRIA 3TH3T 2B0SH 4S1DC 2A6IA 4U1IA 1ZS2A 1AY1H 3AGWA 3BDBA 1KJ2A 3LEYL 4JRYA 1MQKH 3ATFA 4FN0A 4FULA 1J12A 1IGFL 2X6MA 5SWSD 2NY5C 1KN2H 1WEJL 5D2NE 3WFBL 4UNVA 3EYQD 1H3XA 3KGRA 3NCYS 3KH3A 4LEXL 1JZ3A 4ZFOA 3O3DB 3KPSD 2DYPD 4K15A 4TM9A 3S35H 3QJSB 2BSCA 3OXSB 4QRPE 1OE1A 3N55A 5IESH 4E68A 5FGCB 1JNLL 1ECYA 3ZHNA 2PKDA 4HIIB 4HJTA 2PPAA 3E1F1 5ADOL 4HGWA 5IVXF 5KSBB 4L3EB 4NN5C 1IBFA 4P3CL 5CLYA 1UC6A 5IFAH 5FDWB 5F7WC 4URTB 4DGYL 3NJLA 1T21B 2VDKH 2YPVA 1XSIA 2VR3A 5A3IC 4PV8A 3HPJA 3OKDA 1UOLA 1VRSA 2GITB 2A4EA 2X9ZA 4GQQA 3U4EB 4UT7L 4XI5D 1MVUA 4JR9H 3RVVD 5KTEL 4WI4A 3MLPA 4NRXB 4JO2H 2NX5E 2MOGA 3A67L 4RVBA 3IF1B 3BGMA 2WNXA 1QZNA 2UYLB 4PLJC 5IMMA 4OZ4B 5CIPA 3QULA 2CPCA 4KDWA 4R8WL 5JHDA 3ULAB 2UY7B 1O7SA 2P5EE 4PJAB 1FL3B 3PP4H 4NNYA 3IPFA 1E6JH 5I75C 2BWQA 3WMSA 1VGKB 2F5AH 1DFBH 1KIRA 1QYGL 3IDYC 1M53A 3LZLA 3ZTNL 5B22A 4X0KA 1TCMA 2CLVA 5BS0E 5D2LA 2Q76B 1FE8H 2AERT 2DYRB 2ISDA 2YO3A 3L7EA 1X6NA 1B9KA 3ETTA 4KZDL 2J8UE 3HS0A 2GIXA 4BFGA 2BNUB 1NTDA 1CXFA 4FXKB 4JAMB 4QHMA 5DZLA 3SPCA 1CI5A 5HYJE 3NG5A 4KRPC 5HJ3B 4CADB 5BQDA 1IBBA 1BEXA 4POZD 5FKPA 5ITFB 4CN6A 1K5WA 5EA0L 5C8JA 1N9PA 2WP3O 3FCSB 1G7HB 1XR9A 2BHFA 2PXYD 4R7NA 1BM3L 5ABAA 2TSBA 2ZWZA 4LOFA 2HRHA 3Q8BA 5ICXA 3U7YH 3BZFB 1MELA 5I18H 5CEXA 3HB3D 2X6VA 5HDBF 4J4PC 3S4SA 4YZFF 3ZKMD 3GEWB 2WXHA 4A2MA 4KUCD 4NO5B 4F7TB 4PY7B 4M3HA 5E2WH 5IGXL 5J89A 1IL1A 4JFEB 2E7HA 4LLYA 1BEYH 4HC1A 1NPUA 1I8IA 1V7MH 4PS3A 4ELDA 5CEZD 1BWMA 4KKAC 2I9TB 2CBMA 3II2A 4AJYV 4LGPB 4KAQL 2KQMA 2R59A 3ATEA 4AV0A 2JE8A 3MBWB 1N8OE 1KB5A 4ZPVB 3HC2A 1KF9B 2ED7A 3LDBB 1OSZB 1A4KA 1AKJB 4RGNC 1PZCA 4C4KT 2ERJB 2CUMA 2OAAA 5GGVY 1BSIA 4FF9A 1RZGA 3LKSA 3FKUS 4OUUB 4WWNA 3RKPA 3FFDB 3QG6A 4G8GD 5MEND 1J9CT 2E7LA 2GG1A 3NTCL 1IKNC 3HPLA 2HRGA 3LXAA 1IBGH 4JQXA 3R7QA 3SDCC 2PCFB 4QT5A 3ARVA 1N8ZB 4BQ6A 3CZFA 4ISVA 5I1IH 4LF3A 5T5NG 1M7UA 2GAZB 2VQ1B 2WJ5A 4UV7L 2QADB 5D7LA 4IRSB 4G1MA 5EO9B 2DM7A 1XGUB 3ULVL 4ZPTA 4JFVA 5FW8A 3LIZA 4HIJA 2A73B 2VMCA 5BNXD 5EBWA 3MVSA 3W37A 4PJHB 3CBKB 5CUSL 1KLFB 2BW4A 4PHXA 2XIDA 3NPZB 3BFWA 5GHWH 5C07E 2JMRA 1FZMB 1J10A 4TL5A 1XCQA 4P5TA 3C08H 2B16A 4X6CB 3V9CA 3HS8A 1M2OA 3IN2A 1GKEA 2MTPA 2XXFA 1G9NC 2VISB 3EZJB 3FUJA 2AQ1A 3UGUA 1SEBA 1Z3GH 2KZBA 5F9WB 1DQLL 2WB1A 4EZJA 4ZXBA 2GSIB 5I9QC 4NO0A 4OJDH 3QIUB 1HC1A 3QJVB 3UCQA 2OW6A 3MRQA 2BS71 3H9SB 2Y7OA 2G0KA 4WEUD 1IAMA 2VLLA 1X4ZA 4PFEA 3ZIMA 5B1CA 2EXSA 1AGBA 4YBQD 5KYWB 2CMRH 2HG5A 5FB8B 1S7XB 3LN5B 3OD3A 3QT2A 5FWQA 3ULSA 5CR8A 5C0JA 3VWKB 1MCIA 3V0EA 3EO0B 1R47A 1S7TB 3SDDC 1TF4A 4NM4H 4TQHA 2FX9H 2B1AH 5I1EH 1QPKA 4DQOH 3PWLB 2HKFH 4F27A 3CU1A 4MB1A 4X7FC 3UPRA 1E4WH 2YRLA 4XXWC 4TSCL 1IKFH 1V27A 3O2DL 2EDJA 4YDMA 5DFAA 3UYOD 1CMOA 1U58B 4CRPA 3OPZL 4ANVA 1JTTA 2FO4A 3WELA 4GRMB 4ELMA 1H5BC 3PG2A 4WFHD 1FUNA 1XGPB 4LBEB 2ZUQC 1YEKL 4LSTH 3FQXA 5E2VL 3CFBA 5AD0A 3EXLA 1SXNA 1W72L 2FNWA 3B8SA 3RVTC 4CW1B 4P9HC 1P7QD 1UWGL 5K1NA 1BF5A 2AV7A 1OAJA 2XA8L 5ACLA 4OF7A 1BQUA 5D2NA 1WWCA 4UB0H 1SEQL 5IHZA 2D2OA 1MOEA 5AVXB 5ISZD 4I0PD 1B4TA 3HE6A 1FYTD 4P4KC 2JKRM 1IEBA 4QRPA 2DBLL 2F53B 2YKLL 2UVEA 3KL3A 3QCVH 5CU9A 4F93B 1GS6X 5JHAA 1IMHC 3QDJD 1G9EA 2YWZA 2Y7MA 2MQGA 4NQVB 3H4HA 3THML 4U3CA 1MCCA 4QCIB 1ETZA 2F58H 2QKIB 4ELKA 1JNNH 3AU1A 5KS9B 1INDL 2WVVB 1KN4H 2HWZL 4BFOA 3MV9E 1UWEH 3LV3B 4C56D 5L2KE 5M94B 1ACYH 3ILPA 4I0CC 1KJ3H 1S7SA 4GXUM 2DJ4A 4I9WE 1F3DJ 1WE5A 2VC2H 2YJLA 3FULA 4MA8H 2OULB 2F19L 4IGBB 4QGYA 4B7LA 2CJTA 5CSGA 1FJ1B 2OYLA 4BE6A 2NX5A 3UTSB 4FHJA 3VXOB 2Q5BA 4OD1L 5AVUB 1JZ6A 1WBZB 3FT1A 2G5RA 3MJ9L 2OMNA 5DF0A 2P5EA 1SLWA 1DVUA 1OE3A 3KBFA 5DVNA 2QELA 5CHNB 5DJCA 1QFWI 1KCLA 3L1GA 1MJ8L 4F2FA 2K3HA 1GAFH 4W9FC 1LE5B 1QLEL 4GMSH 4NZRL 5TPWL 2DQHH 5BS0A 1SPDA 5FLVA 1WS8A 1QI4A 4LCIH 3E7JA 1JXGA 3P2BA 5BRPA 4H8QA 3NSYA 1I1FA 3FTUA 1JRHI 3QRLA 5HYJA 3LRKA 4M6NH 3M17A 1ORSA 1SVZA 4OD3H 5EU3B 1HXYB 1KFGA 3QORA 2O61B 4WI9A 3MLUL 4J2QA 1DSYA 1WLHA 3L95B 2BSED 2JTYA 2X89D 3VQ2C 5IMKB 5EEUA 3J2PA 5DUBA 4PJXE 1CVSC 1FRGL 3PQYD 5GS1C 1KJMA 5L8JB 2IH1A 2C3WA 3LQZB 2AXJA 1EDQA 5I76A 1P4LB 1XF3A 2IH8A 2O5XH 2WXGA 1B90A 1CR9L 1EDHA 1F2QA 1HQ4A 2OMVA 2P26A 2X4UB 3A4AA 4AGMA 4M6MH 4WO0A 3ABMB 3VGHA 2BNRD 3GIVB 4X9HA 4D9QE 1CS6A 4KUZH 4PRPA 2CM5A 2F1BA 4LPYA 4Y5XC 4JY5H 1XSJA 1PZDA 3EGDA 3KWVA 5CJQL 4D0DA 5I17B 3IAGC 5D1XD 4X4XB 3VI4F 5CINL 4OZHB 2M1KA 1BOGA 5DJZB 4O4YL 1JHLH 2GY7B 1U8OA 3L6FB 4FQCH 2A83A 2X6CA 4JM2C 2VERA 4G8FB 5F6HI 4OVVA 3KPQA 5DQ9A 3QJHB 4BFFA 5AW1B 2A9AA 2BINA 2VDQB 3DHPA 2UX7A 2E27H 2W38A 5JR1L 4Y4FB 4S1QH 5IFHH 2ZOLB 1IM3A 1KWGA 4F58H 3GC3A 4ZX3A 1CLZL 4AEFA 4MJ6B 5KVEE 3ROOB 4BGLA 2V3FA 4EMZA 4A7UA 3VAEA 5A2CA 3AY2A 4GW5A 4GKSA 2Y1ZA 1ZV9A 3VG9C 2NXZD 3NACL 4UT6L 3DVFA 5ILTH 4HZLA 3GSRB 3L45A 3MRLB 3OPUA 4ATWA 1CU4L 2VWEC 4WI3A 3V5HB 2X1QA 3BKCL 3L2NA 3FQTA 4OQTA 4HETA 2BDNL 2W92A 2R29L 2WYIA 4FG4A 3RTQD 5DMYA 1G9MH 1CFVL 4HG4J 4JM2F 5E1QA 2NY7H 4AC4A 3GXNA 4FABL 5ESQB 4FMFA 2G5UA 2QSVA 2VL4A 4NI3A 3FO9A 1KLUA 4PCTA 4PLKD 2G9HB 1Z9OA 5K1VA 1ASPA 4EIBA 2PWDA 3RFRA 3H7BB 3ZR6A 4M1GL 3FU3A 1N6UA 2IPKA 3O6KL 4YSCA 1T1YA 3S34H 4LSQL 1EUUA 1ZLVH 2VIRA 5ANME 1O6TA 4LCCC 5H35A 5C07A 3DMMD 4K5NA 3VFNA 4DH2A 4EDXA 1BZQK 4ZMTA 3WD5L 3MDJA 4DN3H 5FYKD 1UXSA 5HGAA 4I18A 4XN8A 1C7SA 1ZGLM 5JOFB 4LU5H 5ETUB 4L5FH 1FGVH 1ADQL 4ENZA 1ZCRA 1H3UA 2V9UA 1Q9LB 3WU1A 4XZUB 5C09E 4N8VA 3RKDD 4F9LA 1A7OH 3BP6B 4PRIB 4XC1L 1A6ZB 4Y8DC 1B2WL 3CFCL 4FL4C 2ZKXA 5F2FA 5GRZA 5KVFE 1T89C 4K7FA 3V6ZB 4A66A 3LPPA 5C0CB 3OMAB 4PJ9C 4A7TA 1UUNA 4HIPA 1G5GA 4GRWE 3OR7B 3DKHA 5FR3A 1YQVH 2DQTH 1NGXB 1A5FL 1YUHA 2HTKD 4ANWA 2G3NA 4FHBD 4TULL 3D48R 2WQRA 3W0WD 4FFZL 2YN3A 3VRJA 1QFHA 3ZKQD 5F7YC 3QWQB 1TO4A 4PB0H 2I7SA 4L4TB 2KYIA 3KYKH 1HOCA 2OXHB 5L7XL 5TDOA 1EH9A 1KCVH 4NQED 4RDQG 2WQAA 5I1HH 3DPDA 2HPOA 2W9EH 1U3HD 1IIIA 1UD6A 3OHXA 2C9QA 4G7VH 4ZQKA 4HCRA 1TXKA 4JKPL 5GS0C 3OXRA 1IGMH 3VFTB 1PAMA 3BIAX 3X1BA 3DIFB 2RMNA 3FB8B 2Y69B 2DS4A 3NIFB 1H15B 4AL8H 1YVLA 3OAWA 3WYRA 3TBYA 1CQYA 5GS2D 3ML8A 3SKJH 3P40A 5D1ZI 5GZNA 1XGZA 2J25A 2YD0A 4O58L 4KQ4L 1P9MA 5KSAB 2X40A 4NDMA 3FW6A 3EYQC 2ZXWB 3ZTEA 5DC2A 3KS0H 1R17A 2J43A 2R2BA 5GIRB 4CNIA 1HVXA 2NSQA 4IU3B 4PJCF 1A0QH 3I6SA 5T1LA 2QDWA 2IGLA 2A77H 2P9RA 3D5OF 2VSCA 4QWWD 1U6AH 4GG6A 2PW2B 3MCLH 4XP4L 5CSZB 3MV9A 5HPOA 1LEIB 2Z7YA 4Y4HC 3WBDA 3O2WL 1CL7H 1JZ7A 4I1PA 4B95C 5GRUH 1JPGA 4FYSA 4LSUH 3UROR 2XG5B 2B14A 4RSVA 1NCUA 2DWEB 3N42B 2IBGA 2KMWA 3PL6A 3QCTH 4GKNB 3K1KC 2IQAA 4QRTB 1IT9L 3S6CA 5IHBA 2CGRH 4HIHB 4XAKD 4DZ8A 3MLRL 3ORJA 2ICWJ 2BSTB 2RFXB 1VEPA 4KROC 4XI5C 2JI3A 3GJFB 5D7IB 1G1KA 3L1EA 5AKTA 3U2SA 4ZI8A 3V52H 1LTXA 1ANUA 3F5WB 1A9EB 3F7KA 5I71B 1YMMB 3OG4B 1C5DA 4DKFL 5DS8B 3TURA 4GAGL 1LILA 4UTCA 4WUUB 5CN1A 4N2DA 5HHNA 2WUBL 2V5YA 1M57B 1TDQA 1N5AB 2PNDA 4XWOD 3EGXB 4QHUA 3JWOC 4PJ7B 3CZJA 3PHOA 2NNFA 4OZFA 2ORBL 2F54E 3CZKA 5BZWB 5J6SA 3F6LA 4A2DA 3KPLB 4LGSB 3KL0A 4MAUL 1R24A 1KIUB 1Q9KA 5HJGA 3F7PC 3IMTA 4K71C 4W9LC 4AEHL 2DH3A 2XC8A 1Z1WA 5BO1L 4A6YB 3R0MA 1YC8A 3ZGHA 3X11A 2IG2H 4IBTA 3JSSA 1ZT4B 2VUOA 3L3JB 5BVPH 2R2EA 1T4WA 3DOIA 1Z9LA 4Y4KD 3DHJA 4HLZH 5EPMB 3BUIA 4KO6A 1XQ4A 3CVHB 4XNYL 3L9RA 4PJXA 3C9NB 3RVXC 4OFDA 4S1RH 5AKVA 1CGSL 4HULB 4L1BA 3RAJH 2FD6H 3MQIA 4PJ8C 5E95B 2XQBL 3SD5A 1NPNA 2M26A 2W81C 3ARUA 2GJ6B 1Q4NX 2AJSL 2GBTA 2YQ2A 4HW6A 4L9DA 4XNZC 4RISL 3VXNA 1UASA 4YC2C 3KMDA 1NKOA 3GNMH 1A4JA 3P73B 5ESVB 4AQEB 1DVSA 3TEXA 1TTGA 5D8JL 5DD6B 1XMEB 5LGHL 3C60A 1N2RA 2EKSB 4GI8A 5F70A 1ES0A 4NQDD 4AKPA 2R4SH 3U36B 3QK0A 3D8MA 1FORL 1NMBL 2AJYH 1J8HE 4Z7WB 1DJGA 2VM4A 1E4JA 3VYNA 3JYBA 4LHUD 5HHVH 3B6SB 3DX6B 4HH8A 4ODUA 3BAIA 1J5HA 1XH1A 2AGJH 2LLGA 4BJLA 1J18A 3P9WB 1A14H 4HBQA 2WWKO 4YHOH 1JWSA 1AS6A 4NZDA 2HPTA 4DW2H 3RWHA 5TE7H 1JJUA 2H45A 1DL7L 2IAMA 4ADJA 1PF3A 1LJMA 1K2DB 3FJTA 3NZ8A 1ZLSH 2WANA 2BP5M 1QPXA 4HSQA 2WSDA 5I1CL 5JPMB 3I75A 4JFFD 1NCHA 1BYNA 4K94L 4YHZL 1HZLA 1E4XH 1PZ5B 3LZPA 4KUCF 3P9MA 2ALAA 2CAKA 3EDFA 4HJJL 5IJVB 3SIKA 4OJFL 1XWVA 2ZSVA 3EOYG 5E2TL 1GGIL 4ONGH 1OGSA 1KCBA 5JW5A 4JQIH 2CR0A 4FXGB 5LG1A 3NFNB 4WFEE 5AZUA 1R1CA 1FNHA 2EEAA 1F90H 3OX8A 1AJ7L 2DWDA 3KWTA 5KAQF 3B56A 5ANMA 1E9QA 1G0YR 1S9VA 4ZX5A 2FJFB 2XXCB 4PJ5B 1NCCH 3KJ4C 3GBDA 1COBA 3GZKA 2ADJA 4N1HB 4ZBJA 3L4CA 3WNJA 1YEJL 3DXAE 2PWFA 2XZQL 4Z3JA 3KYNB 5I1JL 3OKNB 1MW0A 4FCHA 3C8HA 5C09A 5L4IA 2KZWA 4PB9L 3LSOA 5CN2A 2OX5A 4LGRB 2OPCA 5EEXA 5CEZL 4E41D 2BVPB 3S3SA 1G87A 3UTZA 4ZW7A 4DKEL 4TUJB 3WEOA 1QW8A 4OCLC 4YAQB 3P9LB 3RWFA 1ZA6B 5BW7C 4IM8A 5EF3A 1MCFA 4MHHG 4F7PB 1QA9A 5I1KH 1KEGH 2ZOKA 3VH8B 1NFDB 3IGUA 1WV7T 5IKCB 5T1KA 3EOAA 2VQTA 3LS5H 4N28A 4F33B 4X7TA 3GSUB 1QI5A 4WNJA 5EF0A 4LCWD 1UACH 3ASNB 1XEDA 2H3XC 4ZFFB 5J6GB 5K9KA 3QVAA 1NDMA 5DZNA 1MCEA 5C71A 1P5UC 2FGWL 3FQ1A 3VXRD 2W60A 3UZEC 1S7RB 4HJGB 5DR5H 4FFTA 1VGEL 4X7SL 4AUJA 2AVGA 4TUKL 4L18A 4XO5A 1CF8L 1NM9A 4MCYB 4NQCB 1HCYA 3HG5A 1R3JB 1WD8A 1K4CA 3BHBA 4G8IA 4FYTA 5B39G 1NGYB 3APDA 1O7DC 1QRNB 4GLRH 1BQRA 3TESA 4Y2DA 3TO2B 4J3VA 2ZXQA 5IG7A 1BQLL 1I7TB 1R3LB 4UILH 5IQ9B 4H0IA 1ICTA 3G5VB 5GJSH 3UJTH 5DMIL 1W0WA 2AITA 1YY8A 2ODHA 5C6WH 2L7JA 4NNXB 2CGZA 2DICA 3CN0A 2WXIA 4W93A 1L7TL 4GXVH 3GHEH 5IVXE 4ZFZB 4LVHB 5E08H 1E9OB 2W9DH 4MNQE 4UTAA 1CF1A 3MLZH 2FEEL 5FOBA 1ZLVK 4YEFA 1PZSA 3IETA 4Q89A 2KT6A 1NCBL 1JVLA 3GF8A 3T4AC 4HPYH 1P4IH 3HI5H 2APBA 2J21A 3EO1B 3U9PH 3WXVL 1CO1A 1GOHA 2P5WB 4KI5D 4G6MH 2A6DA 2NUTB 1I1AD 1O0VA 2JB5L 1N10A 2YOCA 4RRPM 5D6DA 5C08D 2VZSA 3O45B 3L3OA 4YE4H 4K3HA 3R19A 3BDYL 4F20A 2ERJC 3U4BL 3DX4A 5JQIB 1S8DA 4XCNA 1S46A 4I85A 2DL2A 5TK2A 3QI9D 4NNPL 4FQXD 3B8YA 3AUWB 3VGFA 1G84A 3MYJB 4Y89A 4ODHL 2BHUA 5GGSA 3BFQG 2YRPA 3HC3L 3KEHA 2Z9TA 4QLWA 2VXTH 4JM4H 1ID5I 2F1EA 3LCYA 2MKLC 3WLBB 2QADC 3BT2H 5F8RC 3DIVA 3IDNB 4XBEL 5LQBL 1NJ9A 2BC4B 4APQA 3FBKA 1IC7L 1WJ3A 4MNGB 2LAAA 4YHKH 2XWJA 4BK4A 3PE9A 3DV6A 2QLYA 3SJVD 3IJSB 4KRLB 4BZ2L 2WBJB 4Y1AD 3VSUA 3GSVB 3TN0B 1AMXA 4RMBA 1M56B 3DPBB 5I5JA 1AZBA 1NBCA 4U6VL 4IIQA 4AEIH 2QVKA 3OZKA 5I74C 1MHCB 3DRQB 3MV8D 5ADPH 3UBXI 3KW7A 4W9ZA 3SDAB 3HAEB 3GZQA 1TETH 4JDTH 2EVIA 4L3CB 5HHME 5HDBE 5JHLL 4YZFE 2G2RA 5J1SC 5F7EH 1F4WH 4IMKC 4NENB 3OKKB 2NW2A 2Z8SA 1BDYA 5F9WC 3KPNA 3FMGL 4UCFA 2AXFA 1K8IA 3QIWA 2YGVA 4DP9X 1LO4L 3K8LA 1SOXA 2I85A 4P2RA 3QIUC 3TYGH 4Z7NE 2E4TA 2NCMA 3F12A 1F13A 3CVBA 4JJOA 3B2XA 3GKWL 5C0AE 5ICUA 2O72A 3SOBH 5B3JF 4I1NB 3CFNA 5EUKB 4A6YH 2EE2A 3MJ7A 2I5YH 4PRHD 1UYWL 3MTRA 2GI0A 3WIHA 3DSNA 3V55A 3KPMB 4JZOA 4RETB 4JLRA 4HOMA 1NCOA 1CVRA 2YN5A 4DVRH 4PJHF 4F37K 5F3HA 1NSNH 4PEEA 4Y5VB 4YL9A 4ETYA 4WU7B 5F8QC 3HS9A 4JFYB 3VXSB 2DQCL 5K9QG 1MSPA 3MLTB 1J8HA 3ZE0E 3QXDB 2FLMA 4GO8A 4XCEA 3V9EA 2FH6A 3SPGA 5EIQA 3SBPA 2JQAA 3LKQA 2YPKB 1GGCL 1C5CH 2CDFA 3B1TA 4JBSA 4CC1A 3TA3C 1UJ3A 2MNJB 1L0PA 1PKOA 3ME0B 1PKQE 5AEAA 3F7LA 1UH3A 4E5XG 1AQ8A 1L9TA 3X3FL 5DT1H 3NCXA 1MEXL 5IQ7H 3P3UA 1PX3A 5F1SA 5KJRL 1DUZA 4Y9EA 3I2CH 2GTQA 2Z6FA 5JNYB 2DQGH 4BFIB 3EYSH 3MRHB 4ZUTB 2NXZC 1OANA 4PRNA 5EC1B 2J20A 5DFVC 1S7UB 1UT2A 1I1YB 5CP7A 3TZVA 5EOTA 1K6QH 3V8CA 2EDTA 2OMTA 4QHNB 2MCPH 3FL7A 4JFOB 1CE6B 4G1EB 4RGNE 1GGBH 2B1OA 2HLAB 5AZEL 5HYIA 1ZDSA 3RTQC 1XR8A 3BE1L 3WNIA 5ACZA 4AUYA 2NW3B 3NABH 2OTUB 4JDVB 4EPSA 3UJJL 2DQUL 4NKDB 3T08A 3UYRL 5F7DB 4P9ML 1SFHA 3CWGA 1IAOA 3K0YA 4JGUA 5I5MA 3DMMC 4JHUA 43CAA 3L3DB 1JHTB 1BLNB 2OR9L 4MJID 5FLUA 2ESVE 1GJIA 2CUIA 1Y1UA 1XCTB 4K3JH 5DJ2B 2ZWNA 4XCYB 3R4DA 4NUGL 4RRPG 1T83A 3QQ9D 5FWRA 1CGVA 2ZWSA 5LGJB 3ZQWA 2VZTA 3X1FA 2BZCA 3V4VB 3MOBL 1X5AA 3SEPA 3RKDC 4HD9A 2R0LH 3P4MB 5GGVL 1NICA 1YRKA 1X4YA 4HCFA 5F7UA 3CVIL 5F93C 4QUOA 1DLFH 3CDYA 4S0SD 35C8H 3H9YA 3Q06A 1FZOA 32C2A 4WEBL 1SBSH 1N12A 2ITFA 1QPPA 4K07A 3VXMB 3UYPB 4MSWA 3ATAA 3I6LD 2L7EA 1F6FB 2OCCB 1QQDA 3MCYA 2CRIA 3KGSA 5E7BA 5IB4A 7CGTA 3A0OA 3RZCC 5K59F 1AZNA 3PIQB 2WLYA 3TIEB 3T6ZA 3SY0B 1HZKA 1E42A 4FQ2L 3C5JB 4XCFH 4DSYA 2I07A 2C34A 3GSOB 1LK2B 2PYFB 3AY4A 4Q6YA 2Z1PA 5AVVB 3BQVA 5I15H 3F2LA 4S1SL 1J1XL 5D1QB 2EDNA 5IROD 1S5IH 2A7BA 1YNLH 4OH2A 1M2VA 3VXTB 5EF2A 2W5PA 4M7LL 4UI2A 5D1ZB 4QTIL 4HIXH 3UABA 2OTWB 4L3FA 4IDLA 3VA6A 3UO1H 2L04A 3QO0A 4HEPA 3SDXF 5JUEL 1WUNT 2VAAA 1Y1DA 1FC1A 4HALA 1F86A 2H0EA 2ZSWB 4EIUA 5IVXA 4R4ND 1KLGA 2BSBA 4MNQA 1A6TA 3O6LH 4JFZH 2XTJB 5LAXA 1OSPH 2WXQA 2VN3A 4WTQA 2PP7A 2BVUA 1E9PB 1OB0A 3GS7A 4IU2B 3TWCH 3HW7A 4KO7A 1S9YB 4S2SA 3OB8A 1CE1H 2MPAH 5ECJE 4X6BB 3NJMA 5C0EA 5JIQA 3B5HA 1HHGA 2GSMB 2HT4D 5AKSA 1DQDL 4LEBA 4P2QB 3IKCB 4W6WB 2QT6A 1PNDA 1RV6X 2VDNB 2F18A 4NUJB 4U1JB 5FO9A 3HHSA 3SQOL 2NY1B 4K9EL 3M1CA 2HX9A 2RALA 1TJGH 2Y5TB 3SYAA 2Y7QA 4DGWC 2VR6A 4NERA 5L8LB 3DBSA 4OJYA 1P0SE 1XB6A 2GHZA 3BUDA 3VD4A 3PS6A 2X9XA 3WFHB 2E0PA 3MI6A 5AL0A 3KLAA 3MLYH 4TNEA 5CJ8A 1B0RA 3B2UD 3EUDA 4TQPA 1ZE3H 3AG4B 3IFLL 3NSJA 3QH3B 1WC7B 3C09B 4PBWD 3FH8A 2PYEA 1FLTX 2E86A 4MD4B 1DJYA 4PW9A 5JTWA 2CZNA 4N9GA 3K71A 3NCJH 3WIFA 3V5KB 3DX1A 4XN4A 2NZ1A 5T3XD 2W95A 3ZKSD 4JHAH 1N67A 3WKYA 5T8IA 2P8MB 4CDHA 3C2SA 3QDHA 2Y5QA 1ZT1A 2BRRL 5CCKH 1A64A 2XKNA 4IRJB 3I50L 1KPUA 2ZICA 3E8VA 1VFBA 4XMLL 2NQ3A 1ZVYA 3R1GH 3A6BL 3Q8CA 5JO5A 2AF2A 3P3YA 4FKHA 3T77A 1PSKH 1UD2A 4HWZA 2ZPKH 4D8OA 3EDEA 3MRJB 4Y2OA 2OMYB 4X98B 4XTRD 4NN6C 3SKNA 7PAZA 4P04A 3VU2A 2PMZA 3LS4L 3N50A 4PVBA 2QQKH 4X80L 4JCWA 5B1BB 1PQZB 1T5XA 2ICWI 3NMEA 4LLWB 3RWDB 5IEHA 3AUVA 4M4RB 1FZJB 1P7KB 3BPLC 1N0XH 2FX7H 1ZANH 2NOYA 2NUPA 3HAEH 4KMTL 2OMUA 1UZ8B 4LRNL 4J3XA 4BA8A 1NFAA 3Q6FB 4IBZA 1TZHA 2ZCZA 5AVSB 3Q8FA 4E5XA 4XB8A 2FWSA 4NP4H 2YMXH 1PU0A 4R7VA 3QJUB 4PD4K 5DC4B 4L8BA 3CDCA 3JTBA 4UINL 3TBSA 1G5AA 2RTTA 4J4PA 5I66A 1INQB 1QBML 3D9AL 4A68A 2B2XL 3ARTA 3M1OA 4HHWA 2EIKB 1A3QA 2DM3A 3NZSA 1TPXB 2ZWYA 2Q2EB 1T4KA 2E6PA 1PKQA 1O6SB 2YZ8A 2P7TA 1G7MB 2VE6B 1XSOA 1A4AA 4DZBA 3VD7A 1FSKB 1JGUL 2A6JA 4KHXL 2OI9B 2BVOA 2O6PA 5J3HD 3CFUA 4DVBA 3BYYA 3AFLA 3GMQA 3GSXA 5DMKB 3RGVB 4P49A 3S5LG 4LSSH 1RUPL 2YBGA 1DJWA 4EBQL 1FCGA 2NRDA 4JFUA 3F00A 1CLYL 5CM1A 1OAQH 1OTTC 3FFCD 2PO6B 1G7IA 2WLHA 3N1FC 2J6EH 4URKA 1EJFA 1WS7A 4A67A 2G3MA 4Q0XL 3U4AA 4WO4D 3UIZA 4I5BA 3SDCA 1EV2E 1OTUD 1EFXB 4GY4A 5IB1A 4H1LG 3RUGF 1JK8A 3QIBB 1EEQA 2BZDA 3IGLA 5C9KA 2X4RB 4HS6A 1CLVA 2ESVA 3PYCA 4C4UA 1OHQA 4EXPX 2Z7ZA 5BZDA 2ZD0A 5AOZA 1IAIL 1CDBA 1N19A 1WA0X 3MV11 1T0NB 4OLYL 1K85A 2YGOA 5HHQA 4AX3A 1M7DB 3D85D 2H9GA 3C6LD 3OB0H 3NEOA 5T1DH 2IC2A 3VWJB 3OLDA 3KLHD 1H3PL 2R69L 2APWA 1Y07A 3R06A 1D5RA 2A1WH 2A9MH 4PJBF 1UCBH 2EH7H 2HSIA 1J5OH 4L0YA 1UZGA 3QHZL 3GLEA 4I0KA 3KW8A 1GL4B 5CSBA 1NBZB 3NRPA 4JVUA 4XO4A 1U8QA 3T3MB 3BAWA 5JDJA 1R4XA 4Q58C 1MI5D 3VYPA 1SY6H 1CD8A 4M62H 5IWLC 1UB6A 3N0PB 1QO3B 3WNMA 4FTVB 3FN0H 4OVUA 2C9UA 4DAGL 1AS8A 3NK4A 3MSPA 2VDLL 4MD0B 5DZJA 5HI4C 1AG6A 4C54A 4OU3A 3CDGB 1DANT 3HR5B 4OD2B 4PI2A 2BP8A 3TCXA 3N42F 2ROXA 3O3UN 4V33A 3CFDA 5F7HA 4JJ5B 3AS3A 3CH1A 3HUJE 4Q74A 1H3WM 1AHWC 2AV1A 1RZKH 2XWXA 4LLQB 3WJMB 1EXUA 2BCMA 5D7IF 3X2QB 2ENYA 3GBEA 3HZVB 1DVFC 2QEJA 4NKIH 1OAXL 2HTLD 2C7FA 4WDIA 3SDDA 5KN5A 4GQZA 2J71A 1XGYL 2VLRE 3QDMB 4CGUB 1JF1A 1U8JB 2V2TB 2IDCA 4XXWA 3M88A 2V0AA 4M43H 4ZO7A 3EFFB 4PJCE 5F97E 4YXLL 1L0YA 4PJ7F 1T0PB 4N90E 5IHHA 1B88A 2EECA 1H5BA 4EO5A 1AGDA 2BIPA 4UWQB 2VDPB 4J1UA 4LO9A 5FECB 3TVMB 2IV8A 5I19H 4WCYH 1BFOA 3MNVB 1TT6A 1MCWW 1T66C 3N9GL 1EO8H 4KO9A 1WCBA 3TIDA 4MLIA 4JDEA 2BHYA 5FAAA 4XBPA 5IB5A 4DP0X 4LMQE 4OLUH 4QHLA 3ZKXB 3MX0B 1F2XK 2EUZA 2H6OA 4LDOB 1BZ9B 4P4KA 3ZKND 1F4YH 3C8KB 1WIPA 5C0ND 3VNZA 5AUMA 3PHSA 5F1NA 2VDMB 1CLOH 5J7CC 3QCUL 2CJUL 2DQIH 3KPSE 3QI9C 1RCYA 5L4JA 1U4FA 2IADA 2EYSB 2N59A 5D7KD 3OKYA 2IWGA 1FAKT 3U1SH 1DVYA 2APFA 3JXAA 5HHOA 3FSAA 2C7UB 5HVWA 3PJNA 1BAWA 5DTFB 3B83A 3QNZA 1IKOP 4L2LA 4LESA 5FCUL 4PJIF 4L4JA 5FM5O 5FYJH 4HJIA 1EHLL 5L6YL 5C0DA 3TP4A 3UBXB 3VRLF 1FI8C 3BAKA 4N5EC 2DAVA 3LKRB 1I85C 3V6FA 3VYOA 5I6XB 1KPVA 1AYRA 4JGMA 2QVIA 4UOJA 1IGIH 4HF5L 2FSEA 3FQRA 4EJ1C 1VSCA 4HAGA 2HN7A 4Q52A 1AVAA 2IFGA 3DUUB 1K8DB 4P5SA 4HH9B 2Z4QA 3ABGA 2Y36H 2AANA 5INCA 3VDBA 4PJ6A 4DGIH 2KL6A 3BEVA 3FTWA 3V0WL 4GT0A 2AKRB 1XEUA 2IPTL 4U1MB 4IHOA 4G5AA 3B37A 3VI4A 1GOFA 3P3TA 3R0NA 3ZE2B 3MRRB 2Z0UA 3FQNB 3ABZA 4LL4A 4UTBH 4GS7C 4BFNA 3BQUC 2WUCH 3BESR 3MRIB 1JPSL 2HFGL 2DMKA 3PDDA 4M3JA 1PLAA 4RFOL 4U1IB 1TO5A 1KJ2B 1G6RH 5DZOA 4L3ED 2HT3D 4JRYB 3HBQA 5EU4A 4M5YL 4EKJA 4L37A 2PUQT 4A7QA 4WVRA 3TC9A 1J1OH 1R5VB 4ZAKD 1SXBA 2H32A 5I73B 5JXED 5GS1A 3Q8AA 4O2EA 3WFDH 4AJWA 4I2XE 3TL5A 4ODXA 4ZFOB 2OTPA 3MACL 2YAMA 1D9KD 1X5FA 5E56A 4Z3FA 4JKKA 1BF8A 2AEOA 5HGDA 2MCMA 1CLCA 1BLIA 4KJPC 1I3UA 5E70A 4O5LH 1MY7A 3CXFA 3QZLA 4HGWB 5IBLD 3RWGB 3QHTC 1MDAA 4Y5XA 3UPAA 2QPDB 2AK4D 3QJFB 4MXQC 2XWTB 5A16A 1LEGA 1ZTXL 5A6IA 3ZTCC 4DP6X 3HPJB 1D5XB 4PJEF 4JM2A 3GBMH 2ADYA 1IZJA 4UQIM 3VXQA 1MVUB 1TEFA 3SODB 1DBBH 1ODAA 3W3BA 4HUXA 1TVBA 1I9JL 4MD5B 2GEEA 3CUPA 3O9WD 3T2NL 5DWPA 1C12B 2XUWA 5GGQH 5BRZD 2XDHA 1RJYB 4ZDHA 4D7BA 4PRAA 5CIPB 2H0JA 2ZAGA 5ALCL 2XN0A 1OM9A 3SB3A 1OAUH 3NYKA 2H0PA 3LQAH 1M71B 4RMTA 2VO5A 3F58L 4U1LA 3QRBA 5T33L 3ARFD 2XU9A 3MV01 1AXTL 3HKFA 5KVGE 4X0KB 1QVOB 4G8GE 2IBZX 5AENA 1W9XA 1WZKA 2ARWA 3SO3C 5KAQG 5AKRA 5MENE 2Q86B 1MCKA 5D2LB 4JK0D 4JRLA 5HDQL 1H6FA 3L7EB 3C5XA 1WP6A 3DVNB 4HCGA 3WEAA 2BIOA 1FA4A 4KV5F 1T2QH 3HS0B 1A3RH 1U3JA 3IGAA 5B1JC 4FQHB 2IMNA 3Q48A 4J28A 4M61A 1LK3L 4Y19A 1RZFL 2IGTA 3CZLA 1TJHL 2XOTA 2DJMA 5FKPB 3AADB 2D9CA 2YXVA 3BWZA 3CLEH 4WI0A 5C8JB 2JKLA 3MOAL 15C8H 3Q1SH 2K78A 1FFOA 2YQBA 1FO0A 2CIIB 1INEH 4G6KL 4LCCA 2YPLE 4MS6A 3AQDA 4KRNA 4JO4H 1NPJA 4XX5A 1RFDL 1HI6A 2OR7A 1SXCA 5CEXB 5LGYA 4XC3H 3S4SB 1NUNB 5BMFH 1KCSL 5D7JD 5F9AC 3ROLA 4XPGL 1SLVA 3S5ZA 3V0AC 4M7JL 1KT2B 1RUAH 2EO1A 2ZYSA 3AS2A 3DJ9A 1AKJD 2YC1A 3TN0C 1H6TA 5EBMB 4JFXA 1IC1A 1I8IB 2IO5A 1JV2A 2ENJA 3MZTA 3OV6A 5CCGE 1T89A 3SDAC 3N1GC 2YSTA 1HYSC 3S2AA 4PJ9A 4LPUA 2NSXA 4PW3A 3KNBA 2I60H 4YDNA 3MUGB 2CO1A 1KB5B 5HI3D 4WNQA 5B7MA 1U2HA 4PGBB 1A4KB 3REVB 2COQA 3EYUH 4YIQA 3QQ4B 5IROC 3T3PF 3TF4A 3NIDB 4IRSD 1RZGB 3LKSB 4S0TD 2CHZA 5AW7B 2VLRA 4GSDL 1RXLA 1JI2A 2YS4A 4G42B 2X2JA 3M6DA 3WO3B 4N2EA 4A2FA 5BV7H 3D18A 1Z3RA 3P30L 3AXIA 5IOKA 2UZXA 4CKVX 4J3WA 4PJCA 5AW2B 1AIFB 3QHFH 1W8EA 4MMYA 1G94A 4Z7QF 4DETA 1AZRA 1E5BA 3F04A 3KZ8A 1TTBA 3B4NA 3QR1A 1KB9K 1KV3A 2C3XA 2QJDA 3CZFB 1KIPB 1L9SA 3N41B 4MAZA 4MZ3A 5GGRB 1YN7B 4XNDA 2ZAHA 1O7DE 5D7LB 4JCMA 4WFHE 3VVWA 1VFAA 1QR4A 2PCYA 3LXUX 4ZPTB 4YLQT 3JWDH 2ITCA 3QFJD 3HE7D 3OB0K 3QBTB 1T1WA 1KXVC 1A7NL 1Q72H 2FO8A 1DBJL 1NC2D 3HCVB 3WL9A 2HT4C 3QWOA 4HMCA 1A7QH 4FNRA 3L3GA 4M4PA 4P5TB 5AOKA 5FXCH 1TVDA 3S36X 3ASOB 2ZCLL 4H8WC 4JN1L 3OLIA 2VDPH 3O8XD 2J55A 1DN2A 4KO5A 3JUYA 4E9XA 4XODA 1EEZA 3HEIB 2COVD 3VWKD 3ALPA 1FC2D 2AW2A 1ETJA 4BKTC 3BOVA 1RZ8A 1MHPL 4Y4HA 1WWAX 2PCXA 5F7FA 3WFEL 3MRQB 1AXSB 2ZX6A 1ZRUA 2VLLB 1F3RB 1DFXA 5BQ7B 1S6NA 3B2UC 3IFNH 3C5ZB 2R56L 5EOCL 4ANKA 3IT8D 3JTSA 1G4MA 1JWUA 3PDGA 3K6SA 4C56E 1YJDH 3WJLC 1CGYA 3BI9X 2X4NA 3N91A 2XX0A 3ULSB 4E42A 2VDMH 4HHAA 1HIML 4X4YB 3EBHA 5KUKA 1Q0YH 2EINB 3E0GA 5FYLE 3NSCA 4JO1H 1U8HA 2YGNA 3UPRB 2J4WL 1OP5H 2VH5L 5B3JE 4GBXD 4JPSA 3G04A 4GUPB 1WBYA 3FT3B 5IMLA 2FO4B 3HI6H 3BJ91 4GKOA 1KTCA 3TT1H 4PWHA 2J5LB 1CFSB 3G6DH 2D7OA 2F7IA 3CFBB 3K7UA 3QZWG 5IOPB 5LBSH 1ILSA 3ZDXB 3GRWA 1URLA 5AYTA 2AV7B 3BLBA 4AJVA 4CUCA 4AZUA 4IKLA 4I3RL 2XY1A 5E1HB 2BK8A 4PS4L 3IPBA 4I2XA 1L7IL 4ESKA 3LRGA 4IS6A 5HVHB 5GGTH 1XXDC 3HE6B 1FCCA 4OKDA 4M7KL 5IF0A 4KQ3H 4PJ8A 1IEBB 2RCSL 2DLIA 2YLKA 4IGBD 4QRPB 3PQYE 3TBTA 5I8CA 5IEHB 3V6BR 1X7QA 2WVUA 2ZUUA 5GGUA 3MNMA 4LOUD 5SWZD 3OKLA 4MDJA 3X1EA 1G7PB 4RAHA 1NZRA 1E65A 2AEIT 2DPKA 2B0SL 3UTSD 4W81A 1ETZB 1HYRC 3AU1B 1AY1L 3CLWA 3OWRA 2VZUA 4OFYA 1KJ2H 5FYKU 5KJ4A 1MQKL 5EOCJ 2BNRE 2YLHA 2ZIDA 4APXA 3SKOA 2BY3A 1GW0A 2W65A 4PTTA 1KN2L 3BPCA 1S7SB 2PETA 4L8SC 5E1IA 5F3BB 5CXPA 3X1NA 2WXFA 3KHQA 2VMEA 2GCYA 4KI1A 2GSGA 2H1LM 5D55A 5EU7C 3S35L 3PGDA 4NO2A 1CJYA 1G0DA 1EFQA 2D3LA 2NX5B 3CE1A 3PJSA 3RNQA 5HYSA 5IESL 2QVFB 1T03H 1W0VB 4IHBA 1AOHA 2ITDA 5F71A 5IFAL 3ZZLA 2ICCA 4F8LA 3LRHA 4LQ1A 4R4FH 4WHYG 5DJYA 2P5EB 3GMMB 2VDKL 3EFDL 5TGBA 4MVBD 2HFFA 2YPVH 2Z3FA 3UMNA 3TO4D 1PLBA 4NOBA 1GY1A 2VXUL 3AQZA 5DRWB 3UAJD 3QXAA 4JR9L 3QYNA 1NM4A 4TTDD 5DQJB 3IBEA 5BS0B 3ZUNC 2CRYA 3I84A 3NA4A 4JO2L 5ES4B 3L2MA 1DHKA 1EJOH 1Z9MA 1UADC 1ZY9A 2CSPA 2YAPA 3MROB 2J8UB 4N8CH 1WBXB 1IILE 1QSED 2XWEA 1UFGA 3M86A 3KYAA 4G9FE 2I25N 5E8NB 5CIPH 5HYQA 3FCGA 3UH8A 1ORSB 2H7WA 5I6KA 3QORB 3PP4L 4L8DB 1E6JL 4LCYA 4R84A 4HIIA 1TQWA 2F5AL 1DFBL 4GRLD 2EYRA 4ZQTA 3RIFK 2F7PA 3B9KD 3KH4A 5DUBB 1YEGH 4YUEH 1H8LA 5FDWA 1W91A 2YPLA 2IH1B 5KG9B 1CG9B 3TEYA 3HMWH 5TTRA 2Y0SA 2F8XC 2LW3A 3P02A 5I76B 1FE8L 1XF3B 3QS3A 5K59E 3BRDA 1JZFA 2OMVB 4FYQA 2GITA 4DWHA 3STLA 1E40A 4B9JA 4K8RH 4Y4FD 5FYKE 4XNUH 4D0DB 4NRXA 1OQOA 4BHUI 1NLBH 3IF1A 5I6NA 4UANA 4JPQA 3DOHA 2CBOA 4W9CC 3ARYA 5D4QA 5GISH 4IRJC 2CO7B 3KPQB 3VGAC 4F92B 1EZVX 3MCG1 5DQ9B 4P46B 3ZTJH 3M46A 3FSWA 4FA6A 5BW7A 1HL5A 3U7YL 1FL3A 2CLZA 3SDXE 3P4LA 3BJLA 1V5JA 3FU0A 1IM3B 1SM3H 2BNQE 2Q76A 3GBLA 5E24E 1TQUA 1BBJA 2Y06H 3SE4C 1HWGB 4J5VA 3DIDA 1L3WA 1BEYL 2GQHA 3MA7A 2JTDA 1IAIM 4HC1H 1V7ML 1JXKA 4GW5B 1T6VN 4GKSB 1P5UA 4JAMA 5JQ6H 3FZUC 3UZEA 3KDMB 4DPBX 1FV1B 5HJ3A 1GRWA 5ITFA 1DQJA 4LARH 1C16B 2YA1A 3MXWH 1UM5H 1DQTA 4Y9CA 3FCSA 4H7VA 2MHAA 3HR6A 4YHYB 1TTCA 3GSWA 1VKXB 4NQEE 5ANHA 5FO7A 4I48B 1HAWA 3VQLA 3BZFA 2AQSA 2WNGA 2XJKA 4P3DA 1FIEA 5LAPA 1IVLA 3FO9B 3N5AA 4HFWB 1FHNA 3A6CL 4HISA 4LPCA 5HDWA 2IPKB 4KX8A 1T1YB 4NO5A 4XPBH 4YHIA 4PRID 4PY7A 1R3HA 4ZO6A 1P7QA 2VXSH 1IBGL 5H35B 5C07B 1CFMA 3Q0HA 5AW5B 2HJLB 3BGFB 2D7PA 5DJ6A 1UXSB 3T4AA 5HGAB 5CLZA 5KSVB 5JHBA 1FSKC 3APNA 4R2GD 2QZQA 4XMXA 2VM3A 2LT9A 4QGTA 2I9TA 3ZKNC 5DZ9A 4ECNA 1LDPH 3MBWA 4LIQH 5C0BD 1S78D 1OCZB 2CQVA 3LIZH 5EF1A 2WAQA 1XFPA 3NCEB 4BWUA 4KPHH 4X5RA 2WXNA 4RZCB 3RIAK 5GHWL 2JFCA 4C47A 4ORZC 3EO9H 2PO6C 3C08L 2BIIA 4NFBA 4K55A 3ZZSA 2C3VB 5DRXB 1H19A 2JK5A 1ML0A 4LSPH 4OJEH 4X5QA 4NKMA 3MUY1 1LO3H 4NWTH 3HZ3A 2PCFA 3DLQR 1LP9F 4XAKE 1Z3GL 2VZ1A 1AQDA 1OW0C 3QIBC 1YNTF 1DZBA 2HZHA 2VDOH 4RX4D 5DU7A 2MJWA 3B3BA 5GRYA 3E2HC 3PREA 4P57B 3IM1A 1XGUA 3BT0A 1HOCB 2JB6A 1TG8A 3D2UB 1F42A 1MFAH 5TDOB 3VWJC 2CMRL 2GI7A 4AYID 1SJMA 2A73A 3PHQA 3UXFA 5D72H 4F8PA 4J3SA 3GZPA 3ZQ9A 4AWJC 4PJHA 3OHXB 4PRDB 4ZQKB 3JVFC 3RDJA 3OXRB 4BD4A 1IV8A 1FZMA 2ZKHH 4NM4L 2BJMH 5CILH 5DFWH 2B1AL 2FX9L 5I1EL 4DQOL 3RX9A 2Q7AA 5E4EC 1O7VA 3TV3H 4A55A 2HKFL 3D06A 2PTTA 4L3AA 3TBYB 4OM0H 5DJDA 1E4WL 1J86A 3VDAA 4GKLA 1IKFL 4OCSH 4U1GB 1U2CA 2HT3C 3NP3A 5AG8A 4NQUA 3QEGL 4NPKA 5D71H 1TIUA 3GGWA 2QTVA 1KFAH 1G9HA 3GZOA 4NDMB 3FRUA 3QIUA 4BYHA 4DEPC 1RHHB 4UQ3B 3PQYA 4LSTL 1KBGH 5FGRA 2FEJA 4KKLC 1OP4A 3BMVA 1WAPA 3V0HA 2GY5A 1D9KC 4JE0A 5KYWA 2ZAIA 5J57B 1I3GH 3FB5A 1OAKH 3LN5A 1TQSA 2BNRA 3QQ3A 3MV9B 4JB9H 4LK4A 4LFHD 5KEZA 1SMOA 2F8IA 2FL5A 4D3CH 5L2KB 4XPHH 1TUPA 1S7TA 3VM5A 5MEOB 1JPGB 1P4BH 1X3DA 2P3YA 4UB0L 5G5DA 1BAFH 1WCQA 3QUGA 4QRQA 1JPEA 4WUUD 3WDJA 1XSKA 3PL6B 3QE5A 2IQAB 2FSDA 4ALAC 1X5XA 1GC1H 1WZ1H 3HJ0A 2CDEA 5CJBA 3QCVL 3T3MF 4DZ8B 4DKAA 4MJ5A 2OSLA 2CKNA 3NFPA 4ENED 4WWKC 3U2SB 1FN4A 3AMLA 4V1DB 3TXAA 1MIMH 2F58L 3TA3A 3MJ8A 1JNNL 1XGPA 4LBEA 1MIEH 4XOEA 1KN4L 3RUGE 2A38A 1C5DB 3QXUA 1A8JH 1UWEL 2AABH 5HHNB 1ACYL 1JBJA 5H37A 1KJ3L 2V4LA 1OP5K 1V7NH 1KXHA 4QHUB 2NQCA 2NXYD 2VC2L 1OGAE 4X4KA 5DMGD 4MA8L 4YGVA 2MCG1 3TJEH 2C9XA 4FJZA 4CW1A 2ZWKA 2EDXA 4KGJA 3ARFC 4N0UE 3V6OC 1YECH 4BCYA 3S8FB 2G75B 2BY1A 2NR6D 3QZNA 4NCDA 3U0PA 1GW6A 4MXVF 4PJBE 3WFZA 1F1AA 2QMJA 2ZXDA 2ZG3A 2ZCHH 3ARRA 4G9FA 4KNSA 3X11B 2Y7SA 4MDIA 1ZMYA 2PWEA 4MXWH 2GJ6D 2F53A 4N0CD 3RTQA 5CZXD 1BZDA 1HESA 3FU6A 3L7FB 3MRPB 3FQUA 3L9RB 2EIZA 4X8GA 4QCIA 1GAFL 1R6VA 5ABZA 3UADA 4GMSL 3F83A 2DQHL 3CGTA 3BPOC 4BDVA 3KPRE 3TEZA 3WTTA 1QUPA 4LCIL 4NLHA 1U21A 5DD5H 2JKIS 3DMMA 4X2UA 3UFIA 5C7ZA 3LZFH 2V7HA 2XN9D 3PXJA 4ATTA 3BH4A 3VXNB 2BIQA 4M6NL 4X99B 4OD3L 5I6XC 3RVUC 3I74A 4E9QA 3E1ZA 2JELH 3VXOA 3BD5A 3C60B 1N2RB 1U93B 2GT9B 1ES0B 4NHCH 1WBZA 3BH8A 1JZIA 4MMXB 3FUKA 4Q2ZA 4UMGA 5L88H 3BMWA 1R5IA 3VD0A 3SDXA 4NWUH 2O5XL 5JZ7D 3HC4H 3MLVH 4M6ML 3QUZB 2R1XA 1MPAH 5DHXB 3A22A 3EDJA 4ODUB 4PJ7E 4KUZL 2BNQA 5IUCA 4JY5L 1CD0A 1JWSB 3MXVH 1NCDH 4LKXA 4E9TA 1IRAY 3AACA 3RWHB 4PUBH 3RZCA 3BAXA 1CIDA 2IAMB 1JHLL 1R3KA 1N3NA 4FQCL 1AIZA 1NIAA 1HX0A 3RWIA 1D2OA 2CHNA 4GW4B 3MLSH 1AGEB 3KYMB 5K9JH 1HZHH 1VERA 2R1WA 3BZ5A 5I16A 5EU6D 2FVNA 2E27L 3H55A 5AB0A 2BSSA 4S1QL 1SJVA 3P9MB 4NQEA 4OIAA 5IFHL 3BUYA 1E0OB 2ZSVB 4F58L 3MRGB 1P4LA 4D9LH 5IUSA 3L5WA 1WFNA 1F18A 2X4UA 3AREC 2EEBA 1XH2A 5AWNH 4JVWA 1ASOA 5ANMB 2UUDH 1E9QB 3HE7C 5ILTL 5I0XA 1S9VB 4B9PA 4X6EA 4PGDB 4NQXB 5DJZA 2DQ6A 4NIKB 3L6FA 1BZOA 5DQDL 1JNHA 4OQTH 4G8FA 4JEGB 3INUH 4PJIE 1Q1PA 3E80A 1G9ML 4NJAH 3EHBC 3CHPA 4TLKA 2NY7L 3BVNB 3Q5OA 3VRLE 4UBDC 5C09B 4UOW1 2CKBA 4HFUH 2A0LD 4PJDF 2X4TA 3INOA 1F02I 3KLKA 3ZLQC 3S34L 4LHJB 4LE8A 3QXVA 1EPFA 1TYEB 5C08E 2FJUB 4GRWB 4RH4A 4MJ6A 1QA9B 2Z8VC 2ZOKB 3MRCA 4DN3L 3KVPA 3FONA 5T1KB 3EOAB 3U7AA 4LU5L 4NQCD 3L5JA 4X7TB 1FFRA 2X38A 1GY2A 2YBRB 4L5FL 5LCVA 3GSRA 1EHAA 3L3KB 4L1DA 3FN9A 1D7FA 4AOFA 2WQ8A 3CAFA 1A7OL 5K9KB 1NDMB 3BLPX 3EYFA 3L8QA 3O4OB 1JPTH 4IRZA 3TJHD 2JCCE 5DUPH 2W60B 2DV6A 5ESQA 5TF1H 3RTLA 2O26U 2LV4A 4XN2A 2G9HA 2N7AA 4GBXC 3H7BA 1YQVL 3BZDA 4N8PA 2DQTL 4G8IB 5IZ7A 3BHBB 5AOJA 4NQTA 3SGEI 2F2HA 3SJVE 4CU8A 3WEXA 2Y3AA 1RU9H 2E6QA 4ODTH 4RA0C 4Y2DB 4PTUB 3I02B 2QLVB 3GDBA 3QB7C 2WVTA 1HQRA 5HBBA 2C26A 4L1LA 1MCDA 3S7GA 3UOAB 4MMZC 2LU3A 3MV8E 4PB0L 4XO9A 4G7YL 1YY8B 5ETUA 3GPEA 2PLTA 2X5PA 2ROYA 3KYKL 4HUVA 1LM8V 1KCVL 2Z34A 1NUFA 5I1HL 4TSAH 1LMIA 3IETB 3VW3H 3BP6A 1W16A 2W9EL 1A6ZA 4G7VL 5J9PB 1KSRA 1QEXA 3V6ZA 4PJEE 2B39A 4HCRH 1IGML 1NIBA 7FABH 3H42H 2X2HA 4QHPA 4QTHA 1HT6A 4MA7H 4AL8L 2A6DB 1P7BA 3W5MA 3TV8A 3ZT6A 1NCWH 4GT7A 4FP8H 2WBWB 2WQWA 4TS6A 5FGSA 3SKJL 1MG2C 2AQQA 1EVTC 4MS8C 3FK3A 4NM8H 1SVCP 5LBVA 2IXQB 4RFNC 4YSDA 4CILA 3SPJA 1KZYA 1XT5A 4XCNB 3V7MA 4KJWC 4N6RB 4GJTB 1PS3A 1GGUA 4L4TA 3OQRA 4OCWH 5GJTH 4O02A 2WBJD 5GGSB 3OAUH 3N44F 4X9GA 1QG3A 3ZOAA 1A0QL 2O5NA 4QYOA 3ULUC 2A77L 5EFIA 5E5UB 1U6AL 3RUGA 3MCLL 3ZN6A 3N04A 4AZ8A 3W11D 1N0LB 1CL7L 4XCCH 1E2VA 4UQEA 5GRUL 3B9DA 3VFTA 4APQB 4KV5E 3WOVA 4LSUL 2V5RA 3DIFA 2XWJB 1OGAA 3DV6B 4MVBC 3BH9A 1P4UA 3MNDA 1EAPB 1TTAA 4N0YH 3QCTL 2IFFH 1U8PB 1RI8A 1YEHH 2F54B 4GW1B 4JX0A 4N0UA 2X44D 1QACA 2Z8WC 2BWDA 1MZZA 4PJBA 2QSQA 1RLWA 4TTDC 1MFEH 1ZHLA 1OLLA 4JE4B 3NRFA 3QUYB 3V52L 1ZGLB 4KZ0A 3NIDF 5KANI 5BOPA 4NI6A 1KBWA 2LAGB 5I0DA 3TBWB 2G2RB 5GIRA 5E6ID 3QUKA 4KK5D 4IU3A 3MBXH 2NSMA 2RB8A 3LPOA 2NW2B 1RIUH 4WV1B 5GZOD 2DIBA 1KYFA 1M1SA 2AXFB 1K8IB 4HKZA 3B9EA 3KPRA 1PDKA 4PAZA 5CSZA 3ULUF 1AQHA 3AS0A 2W80C 3B9KC 4OZFH 5E4IA 3VFGH 2HLFD 4IBQA 4PN6A 1RURH 5JOPD 5TDPA 5B8CC 2XG5A 3C5ZC 4YDKH 4GKNA 4R7LA 2IG2L 2WC7A 3MJ7B 1GJUA 2G4GA 3BSZA 3F62A 3VXPA 5BVPL 3DSNB 2BSTA 4JZOB 1K4DA 4FG6D 4JLRB 2ZP9A 2I69A 3GJFA 5D7IA 1OKEA 1U9KA 5F3HB 2HMIC 3T3PE 2XV6B 4S1RL 4QXGH 3KS0J 4XVUD 3RAJL 5CF3A 1YMMA 2FD6L 3IAQA 1QBLH 4POUB 4C57C 3C6SB 3CMGA 2BWIA 5DK2B 2WB7A 1J8HB 1NC4D 1MVFA 2ENPA 3OSKA 4TVSa 3VX1A 4XCEB 1T3FB 3HBPA 1A6UH 4MNGE 4Z3TA 4PJ7A 3ILEA 4Z7QE 1LNUA 2CDFB 5IWLA 3HLKA 5BZWA 3GNML 4Z7VE 2ZKYA 1KY7A 3KPLA 3BUQA 3GXUB 2J5LC 1UA3A 1CGXA 2K45A 5HVGB 3OJMB 4PIBA 3KAAA 2R4SL 1U8CA 4JN2A 4JCLA 3HZKB 1TMQA 2YIHA 3IXTA 5EPMA 3OAYH 3CVHA 1A3LH 1AHWA 2JLPA 2XWDA 5CP7B 5HHVL 4Z8FH 3F8UB 5EOTB 5HHPB 3B2PA 2OMTB 2I24N 1DVFA 2AGJL 3IAPA 3UTPD 2ZP8A 1DBMH 1A14L 4MB3A 1W8OA 4YHOL 1XIWB 4FLSA 4DW2L 5SWQA 2G2NA 5TE7L 4OFVA 5ACZB 3F6JA 3GMNB 5KVEH 1QAWA 1GIGH 1MWAB 4RAVA 2W91A 1VCBC 1ZLSL 3NZHH 3UO8B 5C86A 2M2DA 3CBRA 3GLAA 1IAOB 4GKZA 4U6XB 4XO8A 4AQEA 1R0AH 2GVYA 1J7VR 1E4XL 2R1YB 4K2UH 1X9RA 4LLMA 2EKSA 4PVNA 43CAB 3DXAB 5ACMA 4TPRH 4PJIA 3FOMA 3NQIA 2NY4D 2ITEA 2VXQA 3GLZA 1AGCA 1RJLA 4RZKA 3VXSE 5A6MA 2XQYG 3NRQA 1A8ZA 1KCRH 3ZDXF 3VXMD 4ONGL 3US1A 1YYLH 3CTTA 4JQIL 5B3NA 3B6SA 5DHVA 2DTML 1F90L 1AQMA 3O3BB 3GD1C 1ZSHA 3MFFA 3DBXA 3R18A 5C08A 5TE6H 4H0HB 3LH8A 1NCCL 3OM3B 2OSWA 3SCMB 32C2B 1A65A 4TQ8A 3AROA 4YFLF 4UT9L 4B0MM 4V11A 5D1QD 1TQCC 2BOBA 4Q9CA 4MSWB 3B7YA 3QI9A 4YFEA 5FCSH 2VQ4A 3W9DA 5B39B 3ILQD 1QQDB 2DY2A 5IB4B 5D1ZD 4ZODA 2BP3A 3L17A 4PCKA 1IGYB 4QKTA 2DMCA 5KVFH 3NJGA 1IM9D 5CD5C 3ISWA 1KEGL 5I1KL 2Y72A 3NFNA 2H2PD 4PP1D 5DS2A 5A2LH 2XTJD 3MRFB 1I85A 1X7SA 3LS5L 3KL5A 1Y18A 1JVKA 3AT0A 4J6IA 6PCYA 1FBIH 1MG3C 2ADFH 2FJFA 4JZNA 1UACL 4PJ5A 1FDLH 2RQ8A 5T3XE 4NX0A 3QO0B 1BECA 4Z3HA 2VAAB 5GPRA 4TLSA 2ZOWA 2DLGA 5IVXB 4P2QD 5IVNA 5DR5L 1KLGB 3F7QA 4MNQB 2FWLB 1A6TB 2VRKA 2EUXA 2UUDK 1Y0LA 3IEAA 5FYJD 2UY6B 3C75A 3DDFA 5L4MA 1GMEA 1SQ2N 3S48A 5AAMC 1ROWA 1KMGA 2J8UF 4PJEA 1F0LA 4K5LA 4Q4IA 4P46C 3BAEH 3WO4B 3P9LA 5C0EB 1ZA6A 3BQUA 4UILL 3DX8A 3PNWB 2DQMA 3BP5A 4P59H 4J12A 1F6LL 1HHGB 2EC8A 5GJSL 3UJTL 1BIHA 2VW7A 5IKCA 4ETQB 1HNFA 4BBWA 1R34A 2D31B 5EORL 4F33A 3IDIB 2NNXA 5E08L 4GXVL 2WXKA 2W9DL 3DX2A 5JHMA 3MLZL 3OGCB 4ZFFA 4UTAH 5FO9B 5JOEA 3HHSB 1D7DA 2AQ3A 4L1HA 2EO7A 4UQ9A 4NFDA 3TNNA 1DUYA 3MMEA 1AS7A 4H26A 4JRXD 3RI5F 3ZE1E 4HPYL 1P4IL 3HI5L 3U9PL 4XH2A 4DN4H 1JYWA 1OXYA 1SYVA 1WF5A 4G6ML 4NN5B 3LZRA 4MCYA 4UAOC 4ZNEA 2ZP0T 4TQEH 1V55B 1NGYA 1QRNA 3RDTD 1A6WH 5LUMA 1WISA 4YE4L 1WYJA 3TO2A 5F21B 1I7TA 2XACC 1LO0H 4LPVA 2EXWD 3G5VA 1LVEA 1CN4A 5EU7E 5INDB 3K71B 4AYFA 4K3DH 2NXYC 5EMYA 5DHEA 2NYZA 2G60H 1E9OA 4EN3B 1NCTA 2WPGA 5T5NF 3MA9H 3BGFC 3PWVB 2XKNB 2NR6C 2VXTL 4JM4L 4HUMB 1MF2H 5DDHB 5HHMB 3QR2A 1KPUB 1YQ2A 2XPYA 4H2AA 5HDBB 1VFBB 5EBLA 3WGUB 1BXVA 3G6JB 4KTGA 1JFQH 2MNUA 4K9JA 4R26L 5JO5B 2VLMD 3GRGA 3T77B 2DL9A 2LGNA 2CJSA 3CNKA 3IDYB 3QPQD 4N0CC 4YHKL 2NUTA 1HHHA 4WWID 2X41A 4Y2OB 2CE6A 4Y16D 5BPPA 1ONQA 3CK0H 4Z7NB 2DH2A 5DJXA 2F1AA 1MJ7H 1DE4B 4LLUA 4OFKA 5C0AB 2GTWA 1T5XB 4AEIL 4RLDA 2NYKA 2XFGB 5ADPL 5I1DB 5B1JA 2CNZA 5B1KA 4DFIA 1KC5H 5HHXH 5IHWA 2NUPB 1TETL 3PHAA 4H5SA 4JDTL 2ZWLT 5GRXG 2PPFA 3DUHA 3MN8A 3MYJA 1HTYA 5PAZA 3BXNB 3RGHA 1JG9A 4OBRA 3BAYA 5F7EL 1F4WL 1WAAF 1A2YB 2E7CA 5GQBA 1N59B 4GQRA 4YOKA 4E5XB 4MZ2A 3OLGA 4A2EA 1R3IH 2XG4B 4HA1A 2ILLA 3TYGL 1ZVSA 3ZE0B 3AT9A 3D08A 3IDNA 1S3KH 3TBSB 3UTTE 2XN1A 2BCKA 5I66B 4UOQA 4MNGA 3RLSA 2Q7YA 2X6BA 5I24A 1LMKA 1UD3A 3CFJB 3SOBL 5CBAA 4A6YL 5JZ7C 4FFWC 1HHIA 3IJSA 3RGVD 2I5YL 4V2BA 3S37X 1CDGA 3V2AR 3GSVA 3D4CA 1E8WA 4R9HA 4WFGD 1PKQB 3TN0A 4PD4J 4Z5RB 3WIHH 4G9DA 2P7TB 4P23B 2BVEA 3ETBJ 4HKJB 4MQXD 5M95B 4DVRL 2NNCA 1MHCA 1NSNL 1KACB 4N9OB 4TUUA 3U6RA 2BOCA 1CXIA 3WNKA 3SDAA 2UZPA 3DJZA 3CSGA 1CBVH 2BVOB 2EDHA 1WQVT 2HJFB 4DVBB 2HRLA 1U3YA 3GMQB 5KSUB 2IGFH 3GSXB 1N4XH 4NENA 3K2KA 1CQKA 1CFBA 3BVTA 3OKKA 3Q44A 3JWNC 4ZX6A 1OSEA 1C5CL 1TOXA 4RGNB 2XICA 5IROA 2GC4C 1UB5A 2KHAA 1MKFA 4B97A 2AFNA 5JA9A 4NP9A 5B38G 1G7IB 5DT1L 5K93A 3Q05A 5IQ7L 2XQYA 3L4WA 3U1PA 1TFPA 5F3FA 2OZ4A 3HNTH 2JKNA 3I2CL 3WKMH 3SDCB 1WGVA 2DQGL 4U33A 4TF4A 3EYSL 1QSVA 4PJFF 5IHLB 3NPSC 2IMMA 3MBEC 2NY2D 5IB1B 4EI5D 4N1CA 4J8RA 5EU5A 4HS6B 1K6QL 2ESVB 3VJ6A 2MCPL 2LABA 3VXSA 2QPEB 2MKWA 3ZMNA 1GGBL 1KYUA 1YC7A 4K0OA 5DEJA 5HHQB 2H9GB 2NY3C 3QXDA 3D7PA 2V5TA 4CU7A 3C8DA 2OQJB 3EH2A 3LEXA 3NABL 3CSFA 1KXVA 3R06B 1LWJA 4MCNA 3B2DC 1PG7X 1LP9E 2K6WA 2H6UA 1JOIA 1W72B 3ME0A 5CU5A 4ZTPH 4K5MA 3LRMA 4FG2A 3ATBA 5D7HA 2YEZA 1DQKA 1D5IH 3O4LE 2EDLA 3P4OB 1YDPB 2C1OB 2R9HD 1Y7VA 2WNKA 3BO8A 3HVNA 3PLYA 4K3JL 4J3OH 5HDOA 1CD1A 3MRHA 4U4IA 3IFPA 3Q2VA 1MLBA 3FSZA 1WITA 1HHKB 1JZ2A 1AO7E 3NCYP 4QHNA 3SHSA 4JFOA 1CE6A 3D30A 3QDMD 2NZ9C 3KGTA 4G1EA 4MKTA 1GZQA 3J27A 2HLAA 2R0LL 2IIJA 1HHJB 3CFDB 1RZJH 5IM7B 4BZ1A 3LZOA 2NW3A 1DLFL 2OTUA 3CH1B 2X4PA 35C8L 4MKMA 3WJLA 3NIGF 5D4HA 7PCYA 1YY9D 4S11A 1SBSL 4TNWF 2AV1B 3OAYK 5F7DA 1EXUB 5FDYA 2V2WA 3H7LA 1XO8A 4WDIB 4QRUA 3FTGA 5EUOF 3AWGA 3TVMD 5EDSA 1AE6H 3H85A 1CICD 1FVDB 1KGCE 4U1KA 3EJTA 1A3ZA 3L3DA 2NDGA 1JHTA 1WHOA 3WEMA 4XCFL 4YSRA 3N6YA 3SSGA 1DZ0A 5ADOH 4TVPE 5C7XH 5CR1A 3ULVD 3L3HA 5I15L 1H5BB 1AGDB 4BZYA 1FZKB 3V4VA 1S5IL 2ZUQB 4LAQH 1QWHA 1YNLL 4KFZC 4NZTH 4MMXC 5CKGA 3ZHFA 2NZIA 4HIXL 1QLEB 4LVOB 4Z7UF 4OIFA 3UO1L 5KTEH 4AE0A 1EEYB 3TIDB 1WCBB 3EJYC 4IBVA 3QUZC 3VQ1C 2HX8A 3A67H 4XBPB 2IDFA 1MH5A 1X44A 3O6LL 4HQQH 4JFZL 1XBDA 1J9SA 2J88H 1OSPL 3AQYA 1IEAA 4ABUA 3AG3B 4P4KB 3TIEA 3T5WA 3K6NA 3O3EB 4MZIA 4NBZB 4F24A 2X6UA 5AUMB 1REIA 3GSOA 1LK2A 3TWCL 4EIGB 5F1NB 2KKQA 5JPNC 1CE1L 2MPAL 4FADA 2WXJA 4ICXA 2IADB 3POHA 4POYA 2XZZA 2YD7A 3SYOA 5IIEA 2NT0A 3IMUA 4MXVE 3VXTA 4HK0A 2OKMA 3IS1X 4B9YA 2OTWA 2NY5H 3PGCA 4L8SA 1OD7A 5CZKA 3W11C 2MEJB 2AK4E 2IVFC 3OMIB 1WFTA 1A1NA 1TJGL 4DO4A 5CCJA 3V6FB 3KWWA 2ZSWA 1IBHA 2WWKT 2N1KA 4WGWB 3SGJC 5IFJB 2WCSA 4K4KA 4QRAA 1BQHG 2ZKMX 2FSEB 4WTXA 4E0RA 2HN7B 4QXTA 1CC3A 3MLYL 5BUPA 2Z93B 1EO7A 3ZYIA 1OTSD 1OOAA 4ZFQA 5IR1A 4IU2A 1H8OA 2I27N 5BRZE 3VO0A 2HLEB 4AM0A 2Z4QB 4AEEA 4K73A 5DJ8A 1HKFA 5INCB 1DO5A 2EDYA 4R96A 4GQPH 2MRYA 4JRYD 3HN5A 4X6BA 4ZTEA 3BEVB 3D69A 2B4CC 3DA0A 1OAZH 1CTOA 3QQNA 2E56A 5C1MB 3NH7H 4IHOB 5CEYB 5T3ZE 1TZIB 5E6IC 4KK5C 5AW8B 4Y9BA 3NCJL 1PY4A 2JIXA 2CK2A 1ITCA 4XPTH 3V6OE 3LN9A 5KZCD 3ZL4H 4JHAL 3FB6A 4FKKA 2B1HH 4WWOA 4M00A 1NINA 5FKAA 4NUJA 2X53A 5CCKL 4U7SA 4Q6KA 4ZW8A 1T6WA 2G3XA 4KHTH 1FFQA 2OLDA 1VZIA 1WHPA 5AL8A 4A2GA 4L37B 4ZUSB 3R1GL 1HL8A 2WBKA 2E9BA 3CHSA 1PSKL 4JMNA 2VERN 3AAZA 2ZPKL 4CMMA 4Z3GA 3L9BA 3EOBB 4KKBD 3EFOB 1P6FA 1MXDA 4ODXB 3T0EB 1JRHL 3O4OC 1UUSA 3RY5A 3O3AB 3UTTA 2CA3A 5IBUG 2QQKL 2H2SC 3QH3A 4NRYA 4XVUC 2X7LA 5DRZA 1WC7A 2FRGP 5EWIH 5HGDB 3NBNA 3KG5A 4XMKH 5FO2A 4X4ME 2WK2A 3NUKA 1N0XL 2FX7L 1ZANL 3S5LB 3V5KA 4AQ1C 3QUMH 3ZUCA 2WZPA 1JXJA 2ICES 5A16B 5JHDD 1LEGB 4U7KA 3HG3A 3ARGB 4IRJA 2EVJA 4NP4L 2YMXL 3VXQB 3GLDA 4GRWF 1J9RA 2FB4H 5BXFA 2HH0H 3U46A 2UXFA 1KCWA 3CUPB 4PJGF 4HVBA 4OT1H 5B7EA 3ARXA 4NS0A 2O5YH 1EMTH 5L2JB 1TVHA 3MRJA 4H1LB 3M7FB 4YSOA 4ZDHB 2OMYA 1SHSA 3CV5A 2X05A 3SZKC 5CFHA 5F72S 1EHKB 1DBKH 4K8RD 1SHMA 2JQMA 4LSRH 3SE4A 1BWWA 3CN4A 5E4AA 4GFXA 4RAUB 5CGTA 1QI3A 1MCHA 3K5RA 4OCYH 4JANA 4M4RA 1JPFA 1P7KA 2FLBT 1NFIA 3S0PA 3ECBB 5D70H 3DI3B 1QHQA 2E8YA 1IBYA 1UZ8A 1GR7A 5EH1A 3K74B 4R4BB 1MN4A 4PJDE 5DUMH 2FLRT 2HFTA 1KYOK 1URIA 3TH4T 3EH3B 2VT0A 4M61B 4OLVH 1OAQL 1WFIA 4AXWA 1M7IA 3QWRA 3MGTA 3DO7A 5G4OA 4CGTA 2QVMA 1INQA 4BGDA 5HP5A 5I30H 4HZ1A 1BREA 2YQGA 4WI0B 1FP5A 2K4AA 4XNQA 2Z31B 1PJWA 1LP9A 1FO0B 2C4XA 3R8BB 3O6FC 2Y4SA 4LCCB 1ITBB 3QFJE 3FO2A 3GINA 4EEEA 1YNTA 3BWAA 2AC0A 3V4UH 1BVOA 2VE6A 4G6AC 3O4LA 1VADB 5DWUH 4UZUA 4TSCH 3EXJA 1A9VA 4J3TA 1G43A 2WOBA 3ROLB 1CFTA 4Q6IA 2CO2A 2PR4H 1U36A 5JIHA 3VD2A 2VITA 1OE2A 2YC1B 5DMKA 5T1DL 2IEPA 4JFXB 4IDJH 2BVQA 2BHZA 1IU1A 1W6LA 2A1WL 2A9ML 1AO7A 4GH7B 4FL4B 3TONA 1TJIH 1UCBL 3QUYC 2EH7L 3NCWA 5I5RA 1J5OL 1DEDA 4PJ9B 4HS3A 5HI5C 1TSRA 3DGGA 2PO6A 3KNBB 3ZYJA 1DEEA 3HUJB 1CTNA 2EXYD 3PNRB 4OTXH 4WNQB 1V10A 4WV1C 4OF5A 1G9NH 1XDTT 4ZSOE 3IDJB 4OKVA 4XMWA 1SY6L 3TT3H 4M62L 4JW3A 5D5MF 4AQOA 3ARWA 1EFXA 3U30C 1QHPA 3HA0A 1L3NA 5D7LD 3FN0L 3MV7B 3NFSH 2VLRB 1OW0A 3QIBA 4YLCA 2X4RA 1L6PA 3D18B 1J0JA 4XP1H 2UZXB 4PJCB 4P2CG 4Y7OC 1RAMA 2QSCH 4ADIA 1VPOL 2WWMD 3SGEH 4MMYB 4QXVA 5I1AA 4WQOA 3WTWA 3GI8H 3VWJA 4AH2A 2HCZX 5D4IA 3FSOA 2Q10A 1KXTA 2XV2A 1RZKL 5JQHC 2Q2LA 3FFOA 4GYBA 3PP3H 3RILA 4FFYA 1WPCA 4ODVH 1TEYA 4NKIL 1VFAB 2APXA 3G9VA 1NBZA 5IQNA 4YXKH 1BFVH 4M03A 2ITCB 3FUIA 3VGBA 1KB9J 2YUZA 3L54A 2HVKB 4OF0A 2FIKA 4ZXBD 4M43L 2CHXA 1RMFH 4NO0D 3AGVA 5F7BA 3QWOB 2AK1H 2NNAB 3VSVA 3DX3A 3PAUA 4MD0A 5SWSB 5DZPA 4QLRA 3NVQA 5E6SB 5IHUH 1KJVB 5I19L 1QTPA 4WCYL 3S3PA 1UJTA 4AK1A 3V95A 2D7MA 4EDWH 3KPSB 1D9KA 1H3GA 1QLEH 1EEZB 4JJ5A 2FIRT 5HDRA 1PFOA 1EO8L 1C5BH 1BQHA 2DB8A 5SWZE 4P9HH 1T20A 5J1AB 4HUWB 1RZ8B 2EKJA 4LLQA 4NSKB 3HZVA 4OLUL 3SDYH 3JTTA 1TEGA 3WY2A 1XIWC 2AK4A 2ZXGA 3CQFA 1JWUB 3BCFA 1U8JA 1F4YL 1LQBC 2X4NB 1CLOL 3EFFA 4KROB 5FA4A 4E42B 4LNRA 3GBNH 2NQDA 4WWKA 3K81A 2ZX9A 3P0GB 2A99A 2EVHA 3U1SL 3VTTA 5FA3A 5IJKC 4RMSA 4BFEA 2R0ZH 2VMFA 3PDOA 1U8HB 3J8F7 1JXFA 2FQGA 5FYJL 1ZHNA 4HLZG 5IMLB 5F44A 3VACA 1B4JL 1VB9A 3HBGA 5ID0A 4S0HA 2EEXA 3ARFA 3V6OA 4Z76A 3QPQC 4B9GA 4HXBH 2HP4A 4K71B 1IGIL 1A7BA 3D0VB 1ZJBA 3U2IA 1BZ9A 2HVJB 4PIRF 3SCMC 1IZKA 2J3SA 5F9JB 2ZQKA 5CJXC 1QSEE 4M1DH 2VGLM 4KU1A 4AC2A 3FOLA 4ERSH 2Y36L 3RL2A 4DGIL 4DP8X 3ZDZF 3T0DA 2DRUA 4I2XB 1ZLDA 4B9KC 4IS6B 2C7UA 3IDUA 3QS2A 5IF0B 2VKXA 3EF7A 2PXYB 3CX2A 3TBTB 5I8CB 4YEEA 4UTBL 1X7QB 3HG1D 5GGUB 3GSQA 3OKLB 3WXWH 2WUCL 4X4MA 4UUJA 1TQBC 3C2AH 1T5WA 4YC2B 3LKRA 1G6RL 2R2HA 5DK3A 2Y7NA 4EUPG 4OFPA 2JJTC 4APXB 2P5ED 2W65B 1J1OL 3BN9C 3OF6A 2H32H 1HNYA 2DLFH 5TQ2H 1Z5LB 3WFDL 4NQSA 4LASH 1RULH 2GCYB 3GHBH 2GSGB 4KXCA 4HKBA 4GLRI 2D9QB