1AI1H

Hiv-1 v3 loop mimic
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
QVKLQESGPAVIKPSQSLSLTCIVSGFSITRTNYCWHWIRQAPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLISVTNEDTAMYYCSRENHMYETYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 59.1 FAB (LIGHT CHAIN)
publication title Structure-based design of a constrained peptide mimic of the HIV-1 V3 loop neutralization site.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1996-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ai1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ai1H01
4R0LA 4Z8FH 2C5DC 3G5XB 4M48H 1PSKH 3LD8C 3V0WH 1JWMA 2ZCKL 1J88A 4LSTH 1YUHB 4XB7A 4XC3L 1PYWA 4GRMA 3C2AL 5DVNA 4KROC 4F7CB 1ZEAH 4NHCH 3ARGB 5F9OH 4N9OB 3QP3A 2A73B 4EI5C 5IVZA 3HFML 4XXDA 4PB9H 5EZJB 1QRNE 4KTYA 3DIFB 2HH0H 3LHPH 1CFVH 3K2MC 1BVLB 1KIPB 4Z76B 1AD9A 1J8HA 5A40E 4JPIB 2A6KA 3ZYOA 3ZDYE 2NY6C 1A5FL 4YAQA 2XA3A 4FQLH 4IS6A 3WXWH 3SCMC 4NCDA 2F54B 4LF3B 3OR7B 4YDLC 5FO7B 1WV7T 3D25B 3O8XB 5AG9A 2YA0A 5GGTA 3SDDD 1XIWB 2B8OT 3KS0H 4OLZL 3OR6A 5E4EB 4QRTA 2V9TA 4LSUL 4AG4L 4PGCA 1MRDH 1NBVL 3RTQA 5T1MB 2F53A 3AC0A 5AWNH 2P5EE 5EH1A 4J3WA 3MRPB 3QQ9C 5EOQL 4W6YB 4JKPH 1S78D 3G9VA 1CQYA 4GMSL 3STZA 2C1OA 4PLOB 1F11B 2IADB 4PJEE 4LRIC 2FR4B 1AR1C 3MMEB 4Y19E 5I66A 5IROC 3ET9F 5LWYH 2IH1A 4KY1H 1MCOH 4LAQH 2DI7A 3NABH 2CR3A 3B3IB 3MPCA 3LS5H 1T7WA 4GO6B 3VJ6A 1F13A 4L29B 4Y16A 3S37H 3UEZA 4YHML 4ZS6C 3KDMA 4PRPB 1R24B 1FSKB 2GFBB 2R2BA 3J8F7 4GOSA 5F1IA 1LEIA 1XIWC 4KTDH 3OF6A 1JK8B 5E4EC 4X7SL 1RMFH 3VGHA 2J6EL 3IJSB 4P99A 5LGHH 1W72A 5FGCB 1JNJA 5CP3A 3ZDYF 5DK2A 1FL3A 3BT2H 3BHBA 3NGBB 3RNKA 1A7PL 1IAIH 5CEXB 1PVHA 3TNNB 5L88H 5TJWK 4JPWL 1F42A 1QBLH 5F9DC 2EO9A 1UWEL 2BNUB 3OGOE 5E5MB 4NO0A 3TBYA 4LARH 3BKJL 3B5HA 5HGHB 3GSOB 1TNNA 5DS8A 5D7KE 4HCRA 1DANT 3AU1A 3ES6B 4ZOCA 2HVKB 3KLDA 3UTTB 3K7UA 3QFJA 4NRZA 3FQUB 1ADQL 1FSKC 1NMAL 4YX2H 1G9NL 2JB6B 1BQHB 2CPCA 2R0WH 4LLYB 3DETD 5DJCB 2ATPB 2EDRA 3BPLC 5CJOL 3RWGA 1I7TB 1BFOB 4QRPA 1IE5A 4Y1AB 4PJEF 3SDAB 2UZIL 4P3CL 3BWAA 5D96B 2NTFA 3NGBC 1XGPA 2IFFH 1KCKA 3D39B 3N1MC 3KXFE 5KVDL 1JPST 1B4JH 5KJRL 5GQBA 4EDXB 1OW0A 4L4TE 1KG0A 2J8UE 1JHKL 1I9RH 3CCHA 3Q5YA 4JM4L 4I3RH 5ICYB 1WFUA 5B21A 1JF6A 1MWAB 4HWNA 2J7LA 1YNTB 5KVGL 5CAYB 1ZLSH 4GRWE 4NC0B 4FQXA 1O7VA 5GRJL 4H20H 5TDPA 4H1LH 4CMMB 2JLLA 4MCYB 4OSUL 5JHDD 2YD1A 2NLJB 1Q9KB 1KB5B 5C2BH 3GBNH 1HXMB 2FEDC 4O00A 5FGRA 2AK1H 1CU4H 3SDAC 4HFUL 5C0FA 4FQCL 2DQFB 2ICCA 5L8JB 5GS0H 2BOBA 1MUJA 2M1KA 5D96C 4YE4H 2XKNA 5JXAL 2HRPH 2PTTA 1INDL 5HPMA 2DQDL 3ARVA 2DL2A 2K9UA 4PJHA 4M1CC 2ERJB 2IC2A 2PYFB 2W65B 4ZPTA 5IVXB 2P8MA 4OD3H 2V7NA 3ULUL 4PIRF 1IEHA 1FV1A 3RWDB 4POYA 1WBYB 1FHGA 3VXSD 1VERA 3PQYE 1AR2A 5J0BA 2BSRB 3VH8A 1QFPA 5D9SA 4JFPB 3WFBL 4JDTH 3H8NA 3D1MC 2XFXB 3V5DA 3V6OC 2YOCA 1C08B 2YWYA 2NY1D 1OQXA 1CT8B 1HE7A 3GKWL 3MNWA 4DFIA 2AABL 4N0YH 4X6CF 4OLUH 1QRND 4I13B 4FOMA 1PLGH 1JVKA 1VFMA 1FDLH 5LXGH 3UTZB 1II4E 1OLZA 5ENWB 4P2CG 4LNRB 4GRWF 1ED3A 2YBRB 4G80A 3X3FL 3OGCB 1MH5B 3IU3A 2ERJC 1OB1B 3GK8L 5IFHH 5H94B 1Z3GL 4MGXA 4S1RL 3MRKA 3CFKB 3TJEH 3TPUA 4NQDB 4OUUA 4WEUD 2D7OA 5EIVA 3IF1B 4P48A 1IC7L 5LG1A 1WBZA 3REVB 1IGFH 3OKMA 3VDAA 2Y25A 3RKDC 5D7JA 3SDDA 5C6TL 1E27B 6FABH 4NQVB 3ARSA 1VESA 4NN5B 1A7QL 3BIKA 3RPIB 1E6OL 2J2ZA 2PO6A 2P46B 4Y19D 1F00I 1P1ZA 1J1XH 1RZ8A 5TDNB 2HVJA 3H9SB 2GEEA 2NYYD 3P4NA 2I5YL 2XG4A 5IWLC 2KQMA 2ZOKA 2VWEC 3IDNB 1AFVH 1U8QA 1IKNA 1UJTA 3HR5B 1YEHH 2OTUB 5D7SH 4KRPC 2OS7A 2UUDK 3GRWH 4H0IA 1UJ3A 4C56B 5GS1A 1RUMH 2VE6A 3DTXB 1SY6A 2RCSH 1U91A 1VENA 4HUKB 4MB4A 5C0NC 4L1HA 4ALAH 2B1HL 4CL7A 2R1YB 4XP6L 1FZMB 5E8EB 1JPFA 3MYJA 5D1ZC 3MX0A 1MVFA 3MJ9H 2OTWB 5GGQL 3F5WB 3HMWL 4HGMA 3RVWD 4HS3A 4HKXB 4QXWA 4PFEA 3LMJL 4DW2H 1IGYB 1K6QH 1C1EH 3FO2A 1OL0A 3PP4H 4I2XA 4GFTB 4KJYB 5IB2A 2C4FT 3O41A 4P4RB 3BKCL 1ZTXL 2W0PA 5C71A 1BQHG 3S35L 5MHSE 1M7DB 5D7KD 1AGFA 1ORSA 2X6MA 3U4BL 5F7HA 5HVFB 3KHOA 2DOCA 1Q0YL 1FNSL 2K7QA 4M6NH 3GI8L 1TQCB 4DUWA 5TH2A 4MA8L 3MRDA 4DN3H 1G7PB 4TUOA 4XPAL 3X12A 1X6NA 1RUAH 3QRFM 1C16A 5C0CA 1A9EA 4XPTH 3PGFH 4LLAA 5HI3D 1QSVA 5DZLA 4HUMB 3PXJA 1N5YH 4N8VB 4K55A 1QEWB 5F7EL 5C0BE 1MHPH 4MJ4A 3BPCA 4A2MA 1AQKL 5GISH 3WNPA 1T20B 3ECBA 2F8XC 1CFTA 4PJIB 2X7LA 2ZCLL 4ODVH 5I19L 5ITBH 4LASH 3KXFD 4JHAL 1S7SB 4XPHH 4ZFGL 3G6JF 4PRHA 4L4TD 5HGAB 3VG0L 1CFNB 1EDQA 2WUBH 2XN9E 1NLDH 5L2KE 3V6ZB 5EO1A 1C5BH 2O5ZL 3PL6D 5MEPA 12E8L 4FFVC 5C92A 2EECA 1X3DA 1F4AA 1JWMB 5IMLA 1A6WL 4KJPC 1PYWB 4GRMB 5CGYC 4O02H 1SJHB 5BRZA 3MLRL 2CDGA 3VGGA 5ISZB 2KUTA 1RZ7L 2XTJE 2AXHA 4XXDB 4OZIF 1TCRA 2IFGA 1CIUA 4M3KB 1QZ1A 3EJZC 2A6KB 1JPTH 2CQVA 3UYRL 4NO5A 4L4VA 4YAQB 3T2OA 3P40A 4IS6B 3JWOL 3DROA 1M7XA 4YIQA 4HD9A 1MFEL 5F7FA 2DL9A 3LCYA 5DC0A 4XMKL 5H37G 1X44A 1R5VA 4JQVA 4U7SA 1AQDA 3TLRA 4CW1A 3O3DA 2YPLE 3O4LA 4UQ2A 5CP7A 1Z5LA 5HHPB 1B0GB 3OR6B 3WSQH 2DTSA 4OFIA 3NIDE 3JVGC 3RTQB 2F53B 4QHUA 5HHVL 4Z78A 2V5YA 1N6QH 3EFDH 5KSVA 1H8SA 1U8HB 4OFKA 2IGFL 2VYRE 4G8EA 4WCYL 3STZB 1SYSA 4PGBB 1N8ZA 3P73A 1Z9SA 4KHXL 3LKQA 3QUMA 4GW4A 4X0KA 2X70B 1E4KA 2DTML 2M8XA 1L9MA 2QSQA 3PDGA 3X13A 4DKDC 2IH1B 4L3AA 4HUXA 3H3PL 4YR6A 2I9TA 3U82B 4PP2A 3B6SA 5DK0B 4Y16B 4QLRA 1F4YL 1J8KA 3KDMB 2R2BB 4UAOC 1LEIB 1HKFA 2MCPL 4RWYL 4XPGH 1JIBA 2CO7B 4UB0H 3RTQC 2GJJA 3RRQA 3VFGL 3T0EE 4JY4A 1W72B 3EHBD 3E8UH 4LHUA 3U30B 4HUWA 1CD9B 1JGEA 3MGAA 2P8PA 5DK2B 1A1NA 3ZL4H 3BHBB 3EO0A 2VISA 2R56H 3WS3A 1MY7A 4HWEH 5CFHA 4LNVA 4BUHA 1CLZH 1F4WL 2DB8A 1KTRL 2VL4A 1CFBA 1JGVL 2P5EA 4NO0B 3OJMB 1QTYT 2DQEH 3AU1B 1CWVA 4CADB 2ICES 4M03A 5BCAA 4OFYD 4P2OD 4J6RL 1GOFA 2ZOLA 1ZANH 4JM2D 1C5CH 4PJEA 3V7AG 4Y19A 5I1GL 1DQDL 3ESUF 2ZJSL 4Y5YC 2NY4D 1FLRL 2PTVA 3CVHH 5DQ9B 2VDRH 2WBJD 32C2A 4UV7L 4OD1L 3HCVA 2Q6WA 3U30C 3WFEH 5E24E 4PJCE 2NTFB 1TVDA 2OK0H 1XGPB 3FN3A 2Y6SD 4NFCA 3LKRA 3OKEA 3AVEA 5DRZB 5I15H 1X5FA 4P5TD 4P59H 3S3JA 3UZEA 1OP9A 1KG0B 3SGJC 1MQKL 3CCHB 3SPVA 4K2UH 4AK1A 4UNTA 5EORH 3MFFA 1H3VA 1XR8A 5CJQH 4MXWH 4JLRA 3B9DA 4FQXB 5C3TA 5TDPB 5IB5A 1H8OA 3PV6A 3PG2A 5MEND 2AERT 3K81A 4ZUVA 2Y36L 2AP2A 5AD0A 3OB0K 4NKDA 2YMXH 3VFNA 2LVCA 1WFNA 4GXUM 1A6UL 4N8VG 2YR3A 3FTGA 4RZCA 5IHLB 2BOBB 2OM5A 1MUJB 3SE3C 4MQXD 3RQ3A 5JLZA 1JV5A 2Y07L 3E2HB 2YD7A 5HPMB 3O3AB 3MJ6A 5I71C 4PJHB 2C3WA 3FQTB 5HDBE 4ZD3H 1FE8H 4LVNB 4ZPTB 3D48R 4YFLI 3V4UH 4EUPH 3U6RA 4OZGE 5CD5C 2ADIA 2P8MB 4YGVB 4FTVE 1GHFL 4PLNC 4OQTA 2B5IC 2GK0B 5ECJE 3VH8B 3V9FA 2QQKL 3WFCH 3HMXA 3KXFA 4OV5A 4X6CA 2A74A 4WTZA 3O6KH 4LSRL 3L9RA 3V5DB 2YD8A 3SE8H 3KVQA 2YA1A 4L4TA 2J8UA 5I0DA 4M1DL 2XWBA 1OOAA 3ARYA 2XTJD 2FYYB 2IMMA 3MNWB 4PJBE 5MP6H 1A14H 5FO8A 1U3ZA 3E2HC 3U48A 4YC2B 1T4KA 1BECA 1VDGA 1OM3L 1BOGA 3TO4D 5GGVH 1ED3B 4G80B 4U1MA 3IU3B 3E3QE 4LVNC 1CXFA 1ITCA 1JFQL 2NY0D 4ZMAT 1U0QA 2YN3A 1BJ1H 4NYLA 4HPYL 2F15A 5CZKA 3GHBH 4JFED 1BEYL 4QY8A 3MRKB 1KGCE 5FHAH 2YPLD 2H45A 3X14B 2GT9A 4OUUB 1FCCA 2A0LC 2AXGA 2A77L 4ZQKB 4M7LL 1WBZB 2A6JB 5CLTA 4X80H 1MAMH 3OKMB 1UCBL 5D7JB 2UV3A 3PGDA 5HDBF 3CXHJ 3PQYA 2PO6B 4ORGA 1P1ZB 4U3HA 4YC2C 3P4NB 5FDWA 5FKPA 2CH8A 5FECA 4ZYKA 3BP7A 5BMFL 3RBSA 4L3CA 3V4VH 1UJ3B 5GS1B 3I6KA 4Y5VA 4ZS7H 3IXTA 3LZFH 1SQ2N 4Z7QE 2VE6B 1U91B 5E6ID 2R0ZL 4PJBF 2E8YA 5JA8B 1LO0H 2IQ9L 2VDOH 4OGXH 2VJXA 1XF5A 5T3ZD 1DDHA 1JF1A 1JPFB 3MYJB 3QPXL 4CUCA 4YHZL 5D7JC 2FO1A 2F5BH 2GUOA 1EO8L 4LDLB 4QHMB 4ZTOH 4HS3B 5DJ6A 2PO6C 1X9QA 3FO2B 3DGGA 4XVSH 4LEXH 3O41B 5KVFL 2VITA 2BZDA 2ARWA 1OTUD 4PV8A 2UWEE 1ORSB 2CKNA 4HXBH 5F88A 1EMTH 3D0VA 3BWUC 4OM1H 5FUCE 3ARDA 4PJGE 3TBWA 4PJXF 5TH2B 3NACH 3OXRA 3MRDB 3ZDZE 3CD4A 1HQ4A 4TUOB 3X12B 2FLBT 2X42A 5DFVC 5BVPH 3UROR 5C0CB 1A9EB 3BDYH 3U2SA 4JN2B 1D5XA 3BP4A 4WU5A 5DDHA 2OSLB 2VH5L 4C83A 1NPUA 3UTOA 3X11A 5LBSH 2OR8A 3BPCB 2IANE 4HXAL 1CFTB 2X7LB 4F8TA 1UQSA 4WI3A 3QA3A 4BJLA 2UY6A 1NBQA 3D3VD 3MODL 4HC1A 2YK1H 3OHXA 4KJWD 4XC1H 3KPQB 2VRAA 4D3CL 4WFHE 4DKEH 2WBJA 5T3XH 1TQBB 5E00A 2H1PH 1F90H 4GBXB 4LOUD 5HGDA 4YHKH 5EO1B 4KK9D 3FT4B 5MEPB 3S6CA 1NH6A 1S9KC 4OZIA 4IBLT 3FOMB 5IMLB 4P5TA 5L9DH 5D2LE 2EDDA 4B41A 4X4ME 5BRZB 4IDJH 1TIUA 3OPZH 4G42B 4KTEH 3QIWC 1UACL 4M5ZL 3H42L 3RIAK 1UM4L 1TCRB 5EBWA 2AEPL 2AJXL 1QOKA 4G9DB 1WVZA 4R4FH 3TZVA 1XGYH 4NO5B 4L4VB 3CFJB 3DROB 3U83A 3LKOB 2A6IA 5IM7A 2J3SA 3FL7A 4APQA 4P23D 3SKJL 3BRFA 4WENB 2IBBA 4XHJC 2EYTA 4PJGF 3VH8G 3PHOA 1AQDB 3VGBA 4GBXC 4TOYL 3ZDZF 4DGVL 3O4LB 4HKJA 4GUPA 1Z5LB 4UQ2B 5CP7B 1HH9A 1PY4A 3PWUA 3TWCL 3MLYL 5C0BA 1DBBH 5JNYA 2LU7A 3QNXA 4WV1A 4MCZA 4I3SH 3GSWA 4QHUB 1OPGL 3TA3D 4HK3N 1Y18A 4Z78B 5KSVB 3DVNB 4IHOB 3BKMH 1ZOXA 3DX7B 1A6VL 4G8EB 5AEAA 1VB9A 1SYSB 5GXBB 1N8ZB 3P73B 5BQ7A 3LKQB 1OCWH 2XN9A 3QUMB 1WK0A 4GW4B 4X0KB 3WIIH 1G7MB 3SE9H 4LMQE 5L2KA 1RFDL 1UADC 3X13B 2XQBL 4RSVA 1ZLUH 4HUXB 3QWQB 2H26A 4YR6B 3QCVL 2I9TB 4Z6AT 1IGCH 2HRLA 4PP2B 3LDBB 4KKNA 4K94L 1RULL 4GXVL 4WGWB 2IAMA 3HE7C 3MJ7B 4JQVC 1MLCB 4NZJA 2FHBA 4M3JA 2V2XB 3RWIA 3QIBA 1OP5H 4AM0B 2D4DA 1CDJA 3OKLB 1KELH 1OY3B 2I07A 1IAOA 1KGCD 3S4SA 1CK0H 1KENL 5I1KL 3SJVB 4HMCA 5SX4H 5D7IF 3WN5B 1T0NA 4LHUB 1TJIL 4HUWB 2B2XH 4YDJA 1JGEB 3I50L 2P8PB 4WI8A 1A1NB 3L1OH 4NQXA 4NOBA 2VISB 3W5MA 4H8WL 1YEEL 3WS3B 2WAHA 2YPLA 3CLEH 3MJ8A 3QFDB 2H8PB 3JUYA 2VZ3A 3GSVA 1OARH 2JCCE 1DSFL 2P5EB 3ARFC 2APFA 1UM6H 2Z8RA 2IG2H 4QWWC 5CEYA 2ZG3A 4RBPH 4FFYH 5GRWA 3HAEB 2CRYA 2ZP0T 4FXKA 5DVMA 3CFEA 1IAKA 4TN9A 3MRCB 4EOWL 2ZOLB 1M6OB 4PJEB 4W4OA 3D18A 2DQHL 5H8DA 4XRCB 2MTPA 5JPMA 1JN6A 3KYMA 1PKQE 4HC1L 5E8DH 4P4KD 3WN5C 1LNUB 1CFQB 1RJCA 4G5ZL 4BM7A 3WXVH 32C2B 3HCVB 2Q6WB 4ETYA 1FBIH 1TVBA 5EZLA 3QUYD 5IJVB 2L7UA 4OCWH 3GDBA 3OKEB 3MRFA 5B3NA 1GCFA 2X4NA 3D0LA 4PV9A 3D85D 2CDEA 4LAJH 5E6IA 1IBGL 3T65A 2CO6B 3QEQA 4D94A 4Q9CA 4G43A 4P5MA 3T0EA 3SPVB 4FQ1H 1J0HA 3MFFB 2CMRL 3PP3K 1XR8B 2B4CL 1U8PA 3ZHKA 3RVXD 4U6XA 5JUEL 5IB5B 2XICA 4ZUVB 3CXHK 2NXYD 3UBXB 3DRTA 4HKZA 4XNXH 1I8LC 3VFNB 3QZWB 4MA3A 3WMSA 4KH2A 4KMQA 5LVEA 3NBNA 3FTGB 3Q6FA 4RZCB 4Z7NE 3L3IB 5TE6L 3WEXA 1CZ8L 5JLZB 4J3UA 3INUH 4PJ8B 1JV5B 4BQ9A 4EBQL 2MPAL 4OIAA 4UT7L 4HSQA 4HJJL 2IAND 4I5BA 2R23B 4I18C 5KTEH 1MF2H 3U0WH 2DQGL 5B8CA 2LFGA 4M7ZB 4LPUA 4V1DD 4CKVX 3QDGE 1P84J 3C08L 5DRWA 3F7RA 4I0PB 1I1AA 3V2AR 3BYYA 5BOZG 3CFCH 3BXNA 1E4XI 2F5AL 1BIIA 1XCTA 5JQHC 4X6CB 2A74B 1K8IA 3L9RB 1QUNA 2F8VA 5IG7B 5A2LH 1RUPH 1QD0A 2XWBB 5ACZA 4KVNL 2W9LA 2DBLH 3D69A 3JUZA 3QUXB 4HJ0C 1KJ3L 4GRWB 5FO8B 1KSRA 3MRIB 4MQ7B 4PJ8C 5CHNA 4F3FA 5DJ2A 5E7BA 1BFVH 3GBMH 5ICZB 3ULVH 1OAUL 3Q48A 1M71A 4AIOA 4U1MB 3OZ9H 5EBGA 3P4OA 4R7NA 2WWMC 1V7MH 4NKIL 3W0WE 4JVWA 4K3JL 4NM8H 1T3FA 2X9WA 1YMMB 2HT4C 4I0PC 4QY8B 3EYFA 5C0RH 3P11H 2GT9B 1M05A 1A7BA 2R4SH 4K3DL 3QAZC 1YQVH 3WKMH 2XNAA 3WL9A 4MJ2A 1I8KB 1RIUH 1V3KA 2FRGP 4DEPB 4J3VA 2W9DL 3HE6D 3FN9A 1QNZL 4MAYD 1V3LA 3RAJH 4AIZA 4TUKH 3L3HA 3DBXA 3ULSB 3NA9L 4FTVA 1JRHL 3PGDB 1FYTD 3ZMRA 3QUXC 2F74A 3T2QA 3PQYB 4WI7A 1P7QD 3QUZA 3LQZA 2DYPD 4ORGB 4BSVA 1UXWB 1PG7H 1I9IL 4OBSA 5CBEA 4HH8A 3HG1D 2EDKA 1WWCA 5J3HD 4M7KH 5FKPB 1U8MA 1WT5C 2DD8L 5FECB 4WHYH 5T33H 4PJBA 4L3CB 4YLQT 5IHUH 5FYKE 1QHOA 3I6KB 5GPRA 2BMKA 1V7NL 4Y5VB 3IXTB 4LHUG 4JO4L 3VXMB 3O9WC 3FRPG 2E7CA 4L9LA 4H26B 5CKGA 3DUUB 3BH8B 2NXZC 3W11C 1J18A 5T3ZL 4DEPC 1JF1B 4RMQA 5A16B 5E2TH 3CX5J 5IB1A 1TJGL 2GUOB 1VGEL 3GMOB 2CXGA 1Z9MA 2NY5L 3SQBA 3I85A 3O3UN 5DJ6B 3HAEG 1LO3H 1U2HA 2NY3B 1QQDA 3A6CL 3DGGB 3KG5A 2BXZA 5EOTA 2VITB 3MXVL 2WUCL 4OCMC 3JTTA 4PV8B 4J4PC 4QOKD 4MDJA 3RJQB 3PE9A 1Y6MR 3KR3L 5C9JA 3ARDB 1Q9WA 3TBWB 3OXRB 2CXKA 2Y4SA 3OAUH 3BEWA 3U2SB 2A1WH 1I3GH 1D5XB 1NDGA 3SGKA 4ZNEE 1FL5B 4F57H 4WU5B 5DDHB 3X11B 2O5XL 3G6JB 1AXTL 4HBCH 2HKFL 3QA3B 5ITFA 1XZ0A 2VLKD 4OF3A 4P4KA 1HHIA 4GMTH 5FCUH 1CGUA 1C5DA 1A6AA 3JSSA 5DR5L 3L3DA 2CUIA 1JGUH 5HGDB 3SOBL 3UBXG 2AJYH 4FQJL 3QZWG 1DBML 4LPXA 3ULVC 4OZIB 4XAKE 5F89A 3ARDC 1DFBH 5JW3H 5E8NA 4LCCA 4UT9L 3G6AA 5D8JH 5EBWB 2E6JA 2PETA 4JQIH 4M6AA 1LK2A 3Q0HA 2OJEB 4CJ1A 2X1XR 3RVTD 3TZVB 4HK0A 5I1IH 4PJGA 4Q9QH 3E0GA 3U7WL 2A6IB 2YD3A 4UV4H 5IM7B 1T89A 4APQB 2NY2B 1S5HA 4F2MA 4MDIB 5E9DD 2EYTB 2YUZA 1G6RH 1WIUA 4QCIB 4K9EH 4GUPB 5E0QA 1HH9B 3PWUB 5SWZD 3FB7B 2N7AA 5C0BB 1CICB 2ZCKH 3MV9B 5JNYB 2IANA 4WV1B 4MCZB 4XC3H 5KOVC 3GSWB 2BXYA 3C2AH 1Y18B 3JV4A 3RGHA 2BVOA 3UTSE 3HFMH 2X89D 3QPQD 5DHVA 5E2UL 5D5ME 5C09B 1HHKA 3I02A 4NPYA 4FABL 2VXSL 1JYXA 2XN9B 5C2UB 4N90E 5L2KB 5J57B 1FO0B 2ORBL 1TENA 1IAII 1X5JA 3RP1A 3VWJA 4PG9A 1A5FH 3TZVC 1BBDL 4Q58C 4DTGL 1DVFC 4R4BA 5D2LA 4X4MA 2FECL 3Q1SL 1RHHA 3OBAA 3N0PB 4NKMA 4WDIA 2IAMB 4MNQD 2NY2C 2EYRA 4OGYL 2AVGA 1J05A 5HI5D 1AKJD 4Z18A 2EE3A 3W0WD 3QQNA 2Q3ZA 3DI3B 3QIBB 4OLZH 4KDWA 1WJ3A 3LN5A 5HHME 4LSUH 3MBED 3O6FD 4AG4H 2JJTA 1CICC 2I07B 1NBVH 3S4SB 2RB8A 3H7BA 1U93A 4JFXA 1R0AL 5EOQH 5I1JL 3DWTA 4YDJB 4ODWA 2Y7QA 4GMSH 4M1GL 1QLEL 1FFOA 4NQXB 1P84K 4G8IA 5IF0B 4KK8C 3G08B 2K1MA 3ZLQC 3TBTA 4JZOA 3MJ8B 2HLAA 1CVRA 1DQJB 2DKUA 2HTKD 3OAZK 1MFDL 2ZNWA 5KSAD 1J12A 1L7TL 5BZWA 5CEYB 1S7XA 3HE6A 2OL3A 3QXVA 2E7LC 2BVEA 4WHTB 3U9UA 2VDNL 1CXHA 2YXFA 4YHMH 2IAMC 3UX9B 4S1DD 1VPOL 3VFMA 1U8IA 3T09A 3QJHA 3CSYA 4X7SH 2VLRE 4G6FD 5D5MF 2J6EH 5GRVK 4WO4C 5E4IA 4KXZH 1IKFL 2VLME 4JJ5B 4OFPA 4XCCL 3C60A 5JR1L 3BQUD 5EZLB 1A7PH 2HT3C 3V5HA 3MRFB 1S8DA 4JPWH 2X4NB 3D0LB 4UDTA 1AGCA 4JDZA 2CDEB 1UWEH 1PDKA 3T65B 3QEQB 3QXAA 1DLHB 4G43B 3VFPA 3VWKD 1YEIL 2PF6A 3T0EB 1U92A 4KHTL 4PLKD 3MLWL 1UM5L 3T0BA 1U3HD 1U8PB 1U8NA 1ADQH 1NMAH 1G9NH 5I8KL 1OWRM 4D2NA 5FYLE 1BZ7A 2VLLA 3MGTA 2JCCA 1W0VA 1KTLB 5CJOH 1F4XL 3RL1A 5AUMB 2UZIH 5D93B 4P3CH 2HJLA 3BJ91 1F3RB 3TFKC 1GGUA 3Q6FB 4G7VL 5T1LD 1C7TA 3LRHA 4TUJB 5EA0L 3AUVA 2XQYG 1X5ZA 3ILPA 4UMGA 5CJXC 3IXAB 3L7FB 3TEUA 5KVDH 4I5BB 1B0RB 5KJRH 5B8CB 1PKQA 1JHKH 1T04B 3QXUA 3ZTJG 2VZOA 1EFQA 4JM4H 1VADA 2X4SA 5KVGH 5DRWB 1NMCB 1I1AB 1I9EA 5GRJH 4TSCL 2P24A 3CX5K 3ARRA 4ZAKD 4XZUA 3BXNB 4QRQA 4OSUH 1BQLH 1BIIB 4CBPA 1XCTB 2W91A 4XAKD 1K8IB 1BIHA 1DL7L 1NGXA 3WJJC 3EOAA 4HFUH 4QRRB 5ACZB 4FQCH 5DA4A 1FFQA 1TDQA 1NSNL 3D69B 1JWUA 4P2RB 2D7TL 8FABA 4F7TA 1EHXA 4IOFD 5CHNB 4F3FB 1UCTA 5DJ2B 5JXAH 1INDH 2DQDH 1LE5A 3HI6L 2CKBA 3BKYL 3QJFA 4G9FE 1HQRA 1YEKL 1MEXH 5B8CC 2GAZA 3P4OB 2E7HA 3BDXA 4Y0GA 1HYSC 3ULUH 2VR4A 1T3FB 4B5EA 5JW4M 3BVNA 1K2DA 1WF5A 3VFRB 1JTTA 3EYFB 3OG6B 2WANA 1M05B 4JO2H 5DWUL 4K3HA 3WFBH 2JKXA 3OJDA 2IQAA 1T2XA 5F7UA 5AZ2L 5CILL 3WL9B 1BOYA 2NY7L 2VDKL 5ETUB 2V17L 3QDGA 3UTSD 4AIZB 2DRUA 1NAKL 3GKWH 5GZOD 2AABH 2C4FU 3DBXB 1QBBA 3L3HB 1T22A 4FTVB 3MLUL 5C0JA 2W0KA 1AY1L 2F74B 4N90D 2BP3A 3QUZB 4BSVB 3TVMB 4BQ6A 1MREL 4XP5L 3NVQA 4KRLB 5CBEB 3X3FH 3BP5B 3GK8H 3DSNA 1U8MB 5J6HA 4F33A 3S4SG 1Z3GH 3BFOA 1KIQB 4PJBB 1KIUA 3MOAL 4S1RH 3PABA 2PYEB 2BMKB 4N1HB 5HHMD 4L9LB 3ZT6A 5JQ6L 3DVIA 3CX2A 4Z7VE 4X5XA 1YC8A 5C6TH 2RR3A 5IB1B 3W0WA 4M8QA 1A7QH 3MBEA 3O6FA 1E6OH 1P2CA 3B9KA 3QUZC 1T1XA 4UNVA 2I5YH 3TO2A 3TVMC 2AQ2A 5DZNA 1NCUA 3EYUL 3D9AL 3ZKMC 2X4QA 4PJXB 1TFHA 2BSSA 3QWRD 4ENEC 4GAYA 3JTTB 3UJTL 4FQHA 3S9DB 9CGTA 4MDJB 4YHOL 1SVZA 3GMNA 1WCQA 3GEWB 5C9JB 5I8CB 4LCUB 3T3ME 1EBAA 3TM6A 4L8BA 5B38A 4FQIL 4BQBA 2B1HH 2Q87A 4GJTB 4XP6H 4AL8L 3ELAT 5FK9B 5FAAA 3STBA 3V6FB 3NFSL 2QQQA 4YFLF 5GGQH 3VI3F 3C6SA 2VLJE 2OP4L 3HMWH 4NRYB 1EAPA 3LMJH 5ITFB 2DS4A 3HNTL 1OLLA 2CGRL 1HHIB 4PRAA 3T4YA 4WI6A 4KPHL 1C5DB 1QP1A 1FNEB 1A6AB 1ZTXH 3BKCH 3BQUA 5F97E 3S35H 3L3DB 4UZGA 5BV7L 5KAQF 4NQEB 3U4BH 4MNGE 1Q0YH 3S3PA 1FNSH 1E6JL 1F6AB 3GI8H 4D0DB 4MA8H 4XPAH 5E8NB 3EYQC 4LCCB 1BFTA 1IGTB 1WISA 2FDBP 1KCLA 4KKLC 1EJ6A 4CVXA 3MREA 3ISWA 5F7EH 2BRRL 1AQKH 3K8KA 4BFIB 2C3XA 2EIBA 3QYCA 4PJGB 2ZCLH 1G1CA 3K4ZA 1T1WA 5I19H 1IAIM 4JFZL 5JW5A 5IUSA 4JHAH 1S5HB 4F2MB 2Y72A 1T5XB 3VG0H 5EU5A 1XCQA 4ZNEA 3AREA 2O5ZH 12E8H 3ROOA 3VD9A 4LLMB 1A6WH 4PLJC 4NFDA 3JV4B 3MLRH 3SDCC 3VRLF 1RZ7H 3G04A 3VGDA 4LCCC 4JQXA 5DHVB 3I02B 1J11A 4KZDL 4NPYB 1LVEA 3MNZA 3ME0A 3QHFH 3UYRH 3VWJB 1G9ML 4JHBA 2DAVA 1ZVHA 1UB5A 4R4BB 1EGJA 4LLDA 2I27N 1YEFL 1RHHB 2KBGA 4NKMB 4XMKH 2EYRB 1ZMYA 1I3RA 3ILQD 3T77A 1J05B 2N1KA 1MAKA 2NW3A 3RZWA 1B2WL 1B9ZA 2Y5TA 1JMXA 2R2HA 5I8EB 5D7IB 2WQ8A 3LN5B 4KI5C 2YSSA 3VXUE 3H7BB 1U93B 1RIVL 4KKCD 5HHVH 4MA7L 1YYLL 1TTUA 1LMKA 1KJ2B 3LSOB 2IGFH 4ODWB 2Y7QB 4WCYH 2AK4B 1FFOB 1I1FA 4G8IB 4JY5L 4W68A 3TBTB 2DTMH 5ERWB 2HLAB 5FF6B 5D1XC 3TT3L 4LL9A 1HOCA 3H3PH 5A2KH 1ULVA 2BFVL 5FIEA 5BZWB 3UTQA 3OXSA 1SJXA 2Z31D 5IVNA 2OL3B 3PGCA 2YPVL 4NZRL 3UTSA 1F4YH 3U9UB 1RK1A 2IPTH 5D5MA 3EAKA 2FGWL 1IC4L 1U8IB 1KYOJ 1XF2A 4PJ7E 1EVTC 2MCPH 3QJHB 4RWYH 4Q74A 4XCYA 3C6LA 4P46A 3S97C 3WLBA 5HYQA 3VFGH 1LEGA 5L7XL 4G8GD 4ZFZA 1A3LH 1P5VA 1NMBH 3IJYB 3C60B 1PZUB 4FS0A 3WYRA 5HHQA 3RWEA 1U95A 3S5LB 3V5HB 4N0UE 4M4RA 1F4WH 1SM3L 4UDTB 2EZ0D 4JDZB 4KVCL 3QXAB 1CXKA 1JGVH 3U36A 3VFPB 4LEOA 5FO9B 3IFNL 4YXKH 1U92B 3RVUC 5FGSA 1ACZA 3R8BB 2B1AL 4QHKJ 1SEBA 1C12B 4J6RH 4U0RC 1ZHNB 2AV7A 25C8L 3HTLX 5I1GH 1A0QL 1DQDH 1BZ7B 4JFHD 2VLLB 2ZJSH 1XF4B 1UA6L 4EN3A 1W0VB 1FLRH 2VXUL 4OIIL 1F2XK 4N5EC 3LRSA 1AGBB 1NCWL 1CDHA 3RL1B 3SO3B 1UEYA 2HJLB 2CLZA 3QWRA 4UV7H 4OD1H 4FQQA 4DWHA 1ZT4B 5MEOA 4RGMB 1HEZA 3QDHA 4NJ9L 1M7IA 2F19L 3L5IA 1J1PL 3DI2B 4MYWB 1HHHA 3R06A 4RAUB 1JNHB 3PHSA 3JBG7 2VLRA 5F6HJ 4GG8A 1Q1JL 1IJ9A 3VD7A 4PD4J 1PKQB 2K3TA 4S11A 1MQKH 4PJ7F 4Z95L 3H2WA 1VADB 2X4SB 2YS4A 3QG6A 3VI4F 4QT5B 2P24B 1MJ7L 4PRIE 5T1DL 1P6FA 1LK3L 3LPFA 1EGJL 4HIHA 1J10A 2BNQE 1A6UH 1NGXB 1DN2A 3SO3C 3AY4C 4Q6IB 3RIAF 4BK5A 1K5NA 3NIFE 5DJXB 1QSFB 4XH2A 2F8OA 2DM2A 4RGMC 1JWUB 8FABB 2Q7NA 3LQAC 5FYJE 4F7TB 2Y07H 1RK0B 4HLZH 5C86A 1R3IL 2CKBB 3QJFB 1HQRB 3QDJB 2GAZB 4KZEL 5JOEA 1OT1A 1FN4A 4H0GA 5INDA 2DQTL 4PJ9A 1GHFH 5I1HL 5KN5A 5FKAA 5IP4A 1ZKAA 1K2DB 1T5WA 2FX9L 5JPNA 2QQKH 2W0LA 3PWJA 4XP9L 4YDIL 3WO4B 5E5UB 5HTSA 5DT1L 3OJDB 2IQAB 4LSRH 4M1DH 3DARA 1KPUB 3QDGB 1MCCA 4Q6IC 4NN6B 4KJQC 4K8RD 5DURB 4ACPA 4YHNA 1MCWM 1KLUB 4L3EB 3FCTB 2QR0A 1GL4B 3MXWL 1X4ZA 2L7JA 4BZ1L 1OM3H 5GRUL 4CN1A 1TNMA 3U4EA 4URTB 4IDLA 4F58L 5JZ7D 1JFQH 5JDSB 4MXVF 4F33B 3D6GA 4HPYH 4IEFB 5J6HB 1BEYH 4Y4KD 1XAUA 1ERNA 5FXCH 2YC1A 5E6YA 4TRPL 3IFOA 3NIFF 5EU3A 1YMHA 3WO4C 4KUZL 3VXUD 3L5WB 4M7LH 4LU5L 4G9FA 4RGND 1UCBH 4WUUE 5FM5O 4ELME 4X5XB 1OAXL 1MJ8L 4M8QB 2HLFC 1CXEA 1OGTA 4AIXA 2CK2A 3B9KB 1GGIL 3QWOA 4IRSD 5IHZB 1FZKB 4YHIA 1MJJA 3RHWK 1ZT1B 1NBZA 1U36A 4BQCA 4Q97A 2FATL 2X4QB 5CIPH 3IYLW 1IL1A 4FQHB 2OR7A 3QXWA 4HMEA 3GJFB 5HHOD 5BMFH 4QGTA 2UYLA 4N0FB 2IPKA 3TN0A 4Y4FB 1ZSDA 3T0VA 3QBTB 3HPLA 3VRIB 5D4QA 4L8BB 2R0ZH 4DVBA 2Z31A 5B38B 4XB8A 4HDIA 4BQ8A 2IQ9H 3L3JA 2X05A 3S5LG 3A0OA 3VXSB 3ROLA 2R9HD 2F54E 4LRNL 1GGBL 1JZ7A 4YHZH 3QPXH 2GHWB 2X1OA 5EIIA 1RZJL 3ORJA 4P9HC 5L8KB 3P77A 4POZC 1EO8H 1CL7L 1EAPB 3I6GA 1HI6B 3QI9D 4PRAB 1OP5K 3BESR 4LSVL 4HIJA 5KVFH 1Q9OB 5ADPL 3T1FA 4Z7VA 4EVNA 2R39A 5I74B 3VD4A 5HI4C 4Y4FC 4OI9A 1GYAA 5BVJA 3W81A 3MZGB 2O5YL 4HKBA 3WIHA 1HKLH 1NCNA 3X17A 3KPSE 3ZKQD 1A6PA 4L5FL 2VH5H 2HAZA 1O7SA 1MFBL 1PY9A 3DMMD 5HHNA 4HXAH 3EIFA 1KYOK 3HB3D 4UIMA 2YKLL 1T1WB 4OF0A 4NZTL 4X6FB 3JV6B 3MODH 3CC5A 4D3CH 4BA8A 3NCBB 4JG0L 3DXAD 3GSRA 5E8PA 4PYHA 5FGCE 1KC5L 2YPKA 1UVQA 1KPRA 1I7RA 1XCQB 3AREB 2JJWA 4U1SA 1ONQB 5IK3A 3ROOB 4OCRH 1PZ5A 2VLJA 4PJDF 4X4XA 2HA1A 5SX4I 3G04B 3P0YL 5HSFA 3HRPA 4JDVA 1A7NL 1UACH 2BNQD 3QH3A 3H42H 4M5ZH 3KPTA 4HG4K 4QXGL 1UM4H 2GJ6A 4OLWL 5T1KD 1MY5A 2BVPA 4YQXL 2AJXH 4M62L 2P7TA 5JO5A 4MNGA 4M6ML 5FGBA 4LLDB 4JB9L 2ZG2A 4OTXL 4GLRH 3U9PL 4NNPL 3SKJH 2DQUL 4F15B 1MFCL 4XPBL 4Y1AE 3KPMB 1I3RB 4FFWD 3T77B 2NW3B 3VD3A 2Y5TB 1ZA3B 3TWCH 2R2HB 4DGVH 3P4MB 3MLXL 3AREC 3MLYH 2HWZL 1NGYA 4E41E 2GITA 4JN1L 2YSSB 3D39E 3CVIL 2XZQL 1OPGH 3H9HB 4GS7B 4R96A 3EDKA 2VTFA 2PCPB 4JEGB 1R3JA 4WUKL 1A6VH 4DKAA 3WNNA 4PD4K 4S1QL 2MQ0A 4PS4L 2VKXA 3K2UL 2FZ3A 1D5IL 1OP3H 2I60L 4RGOL 1RFDH 2Y06L 2EH8L 2EIDA 4R2GB 4AEIL 5CEZD 3B9VA 4R6UA 1HOCB 4Y8AA 3QCVH 4KC3B 3WFDL 4NN7B 5I1CL 4G6ML 4K94H 3V6OE 1RULH 3PGCB 4GXVH 4X7DC 4KROD 5K9OA 4O9HL 4EI5D 1RK1B 4F15C 5D5MB 3RVWC 5B3JF 1XGRA 4HV8B 4LDEB 1WWWX 2APBA 1XF2B 1TTFA 4PY8I 4XCYB 1Q9LA 3C6LB 3KNBA 4P46B 4U49A 1KENH 3WLBB 5HYQB 5I1KH 1UZ8B 4JKKA 5HD8C 2GYSA 4GS7C 3PWPD 3FQRA 3BI9X 3G5VA 3OKDA 4JAMA 4GRLA 1TJIH 1D6VL 4FNLL 1IQDA 2FBJL 3I50H 5IOPA 4A6YA 3RWEB 3MJGX 4Y4KA 5IVXE 5TDOA 1U95B 4G6AC 4KK6C 1JWSA 4H8WH 1YEEH 4M5YL 3LY6A 4JRXA 2ADJB 3GSNA 1T0MA 4R2GC 3VXUA 1CS6A 1KNOA 4KDTA 2JJSA 1DSFH 3U36B 5HI3C 3DPBA 1TZIA 2R1WA 4NN7C 3H3KA 2VC2L 5F3HB 1QKZH 3ARGD 1SEBB 3CDGA 1TVHA 5BXFB 4X4ZA 3W9DA 3BH9A 4UOW1 4EOWH 4MD4B 1NUGA 2AV7B 4TNVK 5B38G 5ESQB 2DQHH 4ERSL 1AR1D 4EN3B 3LRSB 3RY4A 5J6GA 4G5ZH 2CLZB 4U4BA 2VWEE 5E6ZA 3PL6C 4K3GA 4IRJB 3W5NA 4I3GA 4NKOB 3UXFA 3O0RL 2F54D 1H8NA 1HEZB 1M7IB 3O8XD 3DURA 5EFIA 4PJ7A 3ZTNL 3UZQA 3R06B 1XIWD 2Z9TA 1IBGH 2VLRB 1GC1L 4GG8B 5IQ7L 2RAMA 5KS9E 5HYEA 4GSDL 3BP6A 3BZDA 3QG6B 2CMRH 4AEEA 3RL2A 1CGTA 1YC7A 5JUEH 4QGYA 1ZLVK 3RDTB 2BY2A 2EDLA 4OZFH 2E3VA 5KVMC 1NUFA 2PXYA 4NFBA 4EN3C 3H9SE 2AJSL 5EBLA 2HKHL 4IRJC 5TE6H 1CZ8H 5F96L 4EBQH 3MRLB 2UZYB 3TPKA 2KZ1B 4PRPD 2MPAH 4N0RA 4UT7H 4C56E 3QXDA 2I9LA 4TVSa 5F9WC 3W2DL 2DQGH 1R5WA 2Z93A 4RDQF 3V7AE 1FN4B 3P9MB 4OCLC 5INDB 3C08H 5I6XB 4PJ9B 2VQ1A 4JRWA 5FKAB 3DMMA 4RISH 3TESA 5CD3A 1T5WB 5GGVY 5JPNB 1CTNA 3PWJB 4YZFF 1INQA 3WUWB 4ZFOA 2F5AH 3CMOL 3RDTC 4U1LB 1BD2E 1U3JA 4LQFL 2AEQH 2I26N 3MFGB 4Y88A 1BHGA 3QEGL 4KVNH 5J11B 4YHNB 1ZV5A 4NQSB 3OKNB 5KS9F 4WWKB 2HT2C 3AM8C 1BPVA 3UTTD 3P30L 4JFOA 4LSQL 3IT8D 3MCG1 4PRIA 1RZKL 1NAMA 5SWSE 1OAUH 2QTEA 2KL6A 3U4EB 2BNQA 5EN2B 5IBLC 4NNYA 4NKIH 2FEDD 4K3JH 4Y1AD 5F93C 3SDAD 1B3JA 3MLSL 1ORQA 2YC1B 1S9YA 1AH1A 3IFOB 1NC2A 4K3DH 4B7IA 5D7LE 4NUJA 3D39D 4HIXL 4G9FB 1U58A 1OTSC 2Y5EA 2W9DH 4Z7OE 4KGJA 4WW1A 1QNZH 2XWJA 4JGJA 4M1CD 2G60L 4JM2C 1QR1B 3WS6A 1H3WM 1ZHKB 1OAYL 3NA9H 1JRHH 1S7RA 5BO1L 3CSBA 1DP0A 1IVLA 4WWKC 1OGTB 3IGAA 3EYOB 1CF8L 1WWBX 3QWOB 1GXEA 3GJEB 1I9IH 4YHIB 1MJJB 5MI0B 4XNMA 5ISZE 5DD0L 4YNYB 4GQ9L 2VAAB 1IL1B 2DD8H 2R4RL 3QCUL 3MLTA 1T2QL 1G1YA 3DO3A 3MROA 5CKAA 1IGML 2IPKB 3TN0B 1V7NH 4JO4H 5ESAB 4U1IB 1A2YA 1IEAA 4DVBB 4HDIB 1PQZA 3L3JB 1QLFA 3ROLB 5T3ZH 2Q1EA 3RX5A 2VSCA 3WNOA 2EYSA 5EIIB 4LLVA 1CDCA 1TJGH 3AS0A 4JR9H 3P77B 4FFZL 1VGEH 1NC4B 2NY5H 5EOCJ 4PGZA 3TBVB 3A6CH 5DYOA 3SCMA 4HIJB 5MI0C 5I1EL 4HPOL 3MXVH 1R3LA 1LILA 2WUCH 5JXEC 1Q94A 4WUUA 5C6WH 4J3SA 1IRAY 4ELMA 4Z7VB 5IW1A 1U8JB 2RBLA 3RKDD 5GSRB 2AJ3A 3NN8B 4Z7OF 3TN0C 2QHRL 5L8LB 1OGAE 5JIHA 1VEPA 5BVJB 1CR9L 1YUHA 3O11A 1NCDL 3DX8B 2ZPKL 5GGRB 4F7CA 5I2IA 3MCKA 5FFLA 4XBPB 3W39A 1CDBA 2PNDA 5EZJA 2O5XH 1OF2A 2HJKA 5HHNB 1AXTH 5FOJA 3PNWA 2P48B 1WZLA 4LRIA 3I3BA 4UIMB 4ZFOL 5IROA 1G7HA 1TZGL 4JPIA 1H3XA 2HKFH 4PRNB 5H35A 1IEBB 2ICEB 4NQDD 1HWGB 4KUCF 5C0ND 3IAPA 3OAYH 5DR5H 2F54A 1VGKA 1UVQB 5A1AA 3D25A 4MQTB 3SOBH 4U1SB 5DGRA 4FQJH 4WEMB 5IK3B 4CDGC 1DBMH 5CSZA 1BLNB 1PZ5B 3F8UB 2VLJB 3BPOB 3ETBF 3TO4C 3LVEA 3JV5A 3VD5A 3NPZB 5K59F 2BHYA 2WNGA 4NSKA 3QH3B 2WP3T 2Z92A 4UT9H 4OKVA 1T7VA 1MFAL 2GJ6B 3H9SD 3B2VL 4AH2A 2BVPB 2R15A 3RI5K 2P7TB 4MNGB 1X5IA 5HVHB 5HYIA 4E0RA 4ZOBA 4CDHA 3MMEA 2DIBA 5GGSY 4C56D 1SEQL 3U7WH 1RZIA 2DIJA 2GY5A 1GJIA 1JTOA 1HSAA 4X98B 1AHWA 3B3IA 4U1KA 3WUWG 3FONA 3KPSA 2Y23A 1PAMA 1R24A 2DM7A 2GFBA 2W38A 2LABA 3LEYL 5EDXA 5F7DB 1E28B 5CSGA 4R96B 4WEBL 4YFDB 2DLFL 5ANME 4JZNB 1R3JB 2WM0A 1J0JA 5E2UH 2Y9RT 4FABH 1MSPA 2VXSH 2FZ3B 3B8YA 2ORBH 2ZNXA 5CEZL 2XA8L 1BBDH 5E2WL 4DTGH 1WGOA 1QBAA 4ONFL 5C0AE 4TPRL 2BY0A 5CGYD 2R0KL 4LCWE 5K9OB 3WFZA 3WJLA 4OGYH 4Z0XA 1XGRB 2NY5C 5D1QA 2HVKA 3VFSB 3KNBB 2APTA 3EJZD 1DUZA 1I7UA 4U6HB 5GJTL 4KRNA 4M02A 1R0AH 1BQHA 3FQRB 5I1JH 5DJCA 4FZEL 3OKDB 1X4XA 4JAMB 4GRLB 3CU7A 5F6IB 5IOPB 4M1GH 1QLEH 3BD3A 4A6YB 2J8HA 5TDOB 4L4JA 1JWSB 4JRXB 2P49B 3GSNB 4E41A 4BFBD 3GMMA 1MFDH 1T0MB 1KNOB 3D39A 4LLWA 1L7TH 2W9EL 3I9GL 2JIXB 4WTWA 4EIGB 1TZIB 2R1WB 4OM0L 2D3VA 3WKNA 2VDNH 3BN9D 5ISZD 1TVHB 3W9DB 3BH9B 3QULB 3LH2L 2WSKA 3RX7A 5ICYA 3VGEA 1MWAA 4UUJA 4EXPX 2IMNA 3UPRA 1GZQB 1KIRB 3DX9A 1Z9LA 4XTRC 1VHPA 1KLFA 1IKFH 5E1AA 1P5UA 2VAJA 2NLJA 4RMTA 4OLXL 5J6GB 1ZGLA 1AIFB 3MV11 4XCCH 3V6OA 1FAIL 2G2RA 5JR1H 4CNIA 5JDJA 2DQFA 3H7LA 5KAQG 2VSDA 5EFIB 4PJ7B 1FPTL 2CLVB 1QHPA 4UBDD 3Q5OA 4I4WB 4KDTC 1YEIH 3QQ4B 3EYVA 3RTQD 2F53D 2FX8H 2JF1A 4MJIA 4KHTH 3T2NL 3MLWH 1UM5H 3BP6B 4ZUUB 4JKLA 2DF3A 1UWXH 3BE1L 5IVXA 3QDME 1H15B 4JKWA 5DUML 3P9LA 5HHXL 5IB4B 5I8KH 3O3BB 1D9KB 1FC1A 1UXSA 4P23C 1U8LB 4PJAF 2BSRA 2WBKA 4M93B 2PXYB 1MAJA 1F4XH 1A64A 2MKLC 3LKSB 4H25A 2ITDB 4OF5A 4CGTA 5EBLB 1QLRA 3QEUA 3QT2A 4G7VH 1AD0B 5EA0H 1ZT7B 4Y16D 2V6HA 1CT8A 4FP8L 4W6WB 3S3SA 3TA3C 2XZCL 1PFCA 2DQJL 2VQTA 5CMAA 2I9LB 1I8MA 1EZVY 4HQQL 3FT3A 5IT2H 1R5WB 2Z93B 1EHAA 3QNZB 5EBMB 1QSEE 1YY8B 1NUDA 5IWLA 1KCRL 5E8OB 1WWAX 5GHWL 3OGCA 3H9ZA 3G6DL 4YBQC 5H94A 1NFDE 1ZLWK 4TSCH 1INQB 3BUYB 1D9KC 3KPNA 4M93C 4G6KL 3C8HA 1DL7H 5KS9A 5EG6C 3R1GL 3V79C 1FZJA 1KCVL 4NO0D 3REVA 4XXCC 3BGAA 1NSNH 5D1ZA 2CRIA 3TCXA 2D7TH 3JWDL 4NQVA 4JFOB 3CFDB 2APXA 4MJ6A 2HFFA 3HI6H 4PRIB 1NAMB 1B90A 3BKYH 3RPIA 1XGUA 2EDJA 1D6EA 1YEKH 4HULB 1YEDA 1V05A 5TDNA 4PY7A 4LQ1A 3H9SA 1A21A 2FX7L 4NNYB 3VFVB 1PX4A 3IDNA 2M26A 4DKFL 3BDBA 1OHQA 5EZOL 1DBJL 3HPJA 3VRJB 3I75B 3P0VL 3VGAB 3RNQA 1ORQB 2FJGB 1S9YB 5DWUH 4PJ5E 5AYQA 1NC2B 4JCLA 4QNPE 5AZ2H 2IJ0C 5CILH 1U58B 4JKPL 3RU8L 2NY7H 2VDKH 2V17H 4MLSA 2XWJB 1U3YA 1NAKH 3AS1A 3EO1A 5CD5D 3MLUH 1XGQA 2FL5B 1S7RB 3VCLB 1FZMA 5E8EA 1MWAL 1AY1H 3FB8B 3OV6A 4O5LH 2EDNA 3MZTA 3IGAB 4CVZB 1PEZA 1BWWA 4FQXD 4NQCA 2BNRE 4UINL 4ZOAA 1BD2A 1MREH 4XP5H 3QUYC 1QO3B 1NFDF 1KB5L 4W4NA 1ZK9A 2EKSB 2W07A 5I76B 3MLTB 3MV01 3L3OB 4WI2A 4U6TA 3MOAH 3MROB 4HWUA 3VGAC 2FH6A 3L3GA 2MQCA 4XPFL 3UDWA 1A2YB 5I8OL 1IEAB 4CVUA 4OBRA 5BOPA 1PQZB 1ROWA 5SWSA 5JQ6H 5F21B 1QLFB 2J5LC 1G7PA 2BX5A 2CIKB 1RZFL 2EYSB 4S0TD 4HFWA 4LLVB 3WS6C 2A38A 3O4LE 4LGRB 4NDMB 1LDSA 4F80A 4RQQA 1T83C 1V3MA 2NY6B 4X99B 3MOQA 4NRXB 1RJYA 3MCLL 1T20A 2Q8BL 5D7LA 1ZE3C 3BMWA 2XZAL 1AI1L 3SCMB 5K33A 5E08L 3EYUH 3D9AH 1JI1A 3NIGE 3UJIH 1Q94B 4WUUB 1DE4A 2XY2A 5IW1B 4QNPF 4YHOH 4YX2L 1N5AA 5EC2B 2EEBA 5DD5L 3K0WA 3O2DA 5IEHB 4AMKL 3JVGA 2HN7B 3O11B 4FQIH 1NDMA 2YD5A 1SJHA 2YHGA 4AL8H 5I2IB 3QIUA 1T6WA 1Y0LB 5ISZA 3MCKB 5M95B 3NFSH 1U42A 2IFFL 3W39B 3MRHB 2AW2A 5F1KC 3LPWA 1OF2B 2HJKB 2EDEA 2OP4H 3PF2A 3PNWB 4Y2OA 4LDOB 1W8NA 1G7HB 4S1SL 1MI5E 3HNTH 5H35B 2CGRH 3SJVE 1FYTB 3NH7L 4KPHH 4PJDB 2X9XA 1VGKB 5BV7H 1GGYA 2X4OB 5CSZB 1FNFA 3M07A 1IC5L 1E6JH 5D7JD 3VXPA 5HHPA 1FFRA 1WBXA 1B0GA 1T03L 2PO6D 2H2SC 4NSKB 5DUBB 1AP2A 2DKSA 1BF8A 2Z92B 4OKVB 2ILLA 1U8HA 1T66D 3VMNA 4AH2B 5K9JL 5M7QA 3MBXL 2BRRH 4MB3A 4PGBA 5DMYA 5JW4Q 1LEKB 1G6VK 2EIZA 5C07E 3BO8A 2X70A 4E0RB 2EDYA 3NIGF 1OGAA 4JFZH 1RZIB 4MAYC 5LCVL 1FFNB 4ONGL 1HSAB 5ICXA 4OD3L 2B39A 2ED7A 5DFVD 5EU6B 1AHWB 4OZHF 4U1KB 5DK0A 5CWSB 3FONB 4YEEA 3THML 4V2CB 3KPSB 4PP1D 4FMFA 4BSWA 2Z91A 1MPAL 3CZJA 1I1YB 2OR9L 3P4LA 4Y5YA 1HK6A 3BPLB 5DC9B 4Z77B 5TPWH 4M7JL 5GRVL 5CLWA 4KZDH 4HK3J 4WFGD 1RUKL 4QRUA 1G9MH 1JF5A 1Q8MA 2V2TA 1YEFH 2V9RA 5F3BB 3SGJA 4IM8A 5JIPA 4TVPD 4Z0XB 5IFHL 3L6FA 1AHWC 3CAFA 3SY0B 1K85A 3C09B 5C0CD 4CADA 5D1QB 3GM8A 3V95A 1INEL 1IGJA 4LPYA 3IU4H 1NGZA 1RIVH 1DUZB 1I7UB 2IBZY 4YK4C 1YYLH 4OD2A 2V2WB 4S10A 3GJFK 5FDYA 5DQ9A 2EXWD 2R29L 5M94B 2VNCA 2X4UB 4JY5H 3MV8B 3FQWA 4PRHD 2D0HA 3PWNA 3SE3A 4RA3A 4GBXD 4XBGA 3V0VB 4JRYE 3FT2A 4E41B 3O2DL 3GMMB 4HS6A 2BFVH 4LLWB 3RHWF 1XH3A 5DRZA 2C3GA 3UPAA 4X6CE 2YPVH 3L3KB 2C1PA 4K7PX 4MD0A 4NZRH 3NA4A 5ANMA 2ENSA 5BRZD 5ALBL 3T8XA 1FVDB 3WJLC 1OSZA 2FGWH 1IC4H 3C09C 5D1QC 1HN1A 4UUJB 1RI8A 2EE9A 4PGDB 4NWTL 3G5ZA 4CVWA 3DX9B 4LPTA 3UPRB 4NM4L 2HMID 4AQOA 3GI9L 5C0AA 5L7XH 1FORH 3ARBB 5E1AB 4L4VD 1ZGLB 1UH4A 5BV7C 4LCWA 2G2RB 4CNIB 2VQUA 3K4AA 5GGTL 5J4MA 3RZCA 1YMME 4KV5F 1SM3H 2BHUA 1HHJA 1JPGA 1TTGA 1X5XA 3O4LD 4KVCH 3K8LA 5DEZA 3IFNH 3O3AA 3EYVB 4MJIB 1FAKT 1WC7B 2HFTA 2W0FB 3FQTA 2B1AH 1WZMA 4B0MM 2V5MA 5EZIL 3UJJL 2H9GB 1D5BA 4O2EB 3NCMA 3P9LB 4YGVA 3HC3L 1A0QH 1UXSB 2GK0A 3CFBA 1UA6H 4QYOA 5I1DA 3QR2A 2VXUH 4OIIH 4G7YH 5C1MB 1NCWH 4F9LC 3ARBC 4H25B 2FGZA 1BGXH 1QLRB 3QEUB 3E1F1 2A9ML 1MIML 4NJ9H 1MHPL 1X5KA 2FYYA 2F19H 2XKSA 1J1PH 2YN5A 3T04D 2DJ4A 3IETA 1T2JA 2XRAL 4JG1L 5C08E 5CMAB 1I8MB 2MHAA 3ARWA 1Q1JH 3FT3B 4MB5A 3VXME 2AGJL 2ICWA 4E42A 3S7GA 3SJVD 1W72L 5GSVA 5J13B 3U0PB 4LHUD 1HXYA 1Y6KR 4M6OH 5D72L 1G9MC 3GMQA 4KRPB 1AO7E 1MJ7H 4AEHL 2WW8A 5T1DH 1KTDA 2Q3AA 4ZSOA 5SX5K 1LK3H 3X14A 3KPNB 4F7PA 5KS9B 1RPQA 3BISA 4ZQKA 1FZJB 2ESVA 2P5ED 2A6JA 4LVEA 3LKNA 5SWQB 4PTTA 4HCRL 3FO9A 3MGOA 5D1ZB 4H1LB 3QDMA 3ULVE 3L95B 4DK6A 4MJ6B 1R3IH 2HFFB 5J1SC 1XGUB 1D6EB 2QSCL 1YEDB 4R7DB 4ZUTA 1A6ZA 4PY7B 3V52L 1S7TB 1CE1L 2DQTH 1RVFL 5J13C 5I1HH 4HHAA 1ZVSB 3HNSL 3HPJB 3L7EB 4ZXBA 4O2FA 3UPCA 3RNQB 3SHSA 4GW5A 2Q76B 2FX9H 4JREC 4XP9H 4RIRA 4YDIH 1OT2A 4AENA 3G6JE 4MXQD 5DT1H 2VN4A 1XR9B 3I3DA 1JZ2A 1EEZA 1DQLL 4EUPA 2Q86A 1CVSC 1QSEA 2GTWA 3ARTA 3EO1B 1C7SA 4YUEL 1XGQB 1QPPA 1JZ5A 2CRMA 3BZEA 1RURH 1XF3B 2F9BT 2P5WB 1NFDA 2VXQL 1KN4L 1SJEB 1DUYA 2JK5A 2C26A 1PG7W 3ALWA 3MXWH 4NQCB 4QHMA 4BZ1H 4OZIE 5GRUH 1BD2B 1VACA 1OD9A 2FHCA 3GSXA 2DLTA 4XI5C 4F58H 2H32H 1BBJA 4GQPH 1WLHA 3FO0L 3HZKB 3MRMB 3RPKA 5GS0C 2AJUL 4IMKC 3KPLB 4XVTL 2XACC 3VWKC 3M8OL 3O4OC 4JPKL 3L3GB 1DBKL 5DFWH 4TRPH 5AZEH 4HJ0D 3AS3A 1YJDL 4PJ8D 4KUZH 1IT9L 3QHTC 4PLKC 4LU5H 5SWSB 2NZIA 1LGVA 1U3HC 3QIWA 1JMZA 5A3IC 3ULVF 1OAXH 4HFWB 1OWWA 1MJ8H 3RWFB 4BH8A 1VFUA 2WWMD 4JN2A 2BK8A 4L1DA 2OSLA 4XNYL 2HT4D 4RQQB 5I1LB 4I0PD 5DJZA 1GGIH 3MV9E 4PJ5A 1RJYB 1WFOA 4KAQL 1QFHA 5D7LB 3A6BL 2GSIA 3ARZA 2FATH 3Q5TA 5D71L 2LTQC 2KKQA 3KPQA 5EO9A 5IR1B 1DE4B 5C09E 4TNVF 3D2UA 4GBXA 4WVRA 1N5AB 2E9IA 1KUMA 3U1SL 2ZUQB 5C3LD 3FT4A 3EBAA 3QUXD 3CU1A 3UDWC 4X8JA 1MCKA 3FOMA 3H9YA 1L4IA 2BNRA 1NDMB 5MERA 4R9HA 1ZS8A 3OWEA 3QIUB 4G42A 4LRNH 1GGBH 4ELKA 4RMVA 3KAAA 2OK0L 4OI8A 1M1SA 1RZJH 4XCFH 5B4MD 3SDXE 1CL7H 2YA2A 1H5BC 2RQ8A 1YMMD 3LOWA 4G9DA 1MQ8A 2L0DA 5F1OB 3CFJA 4LSVH 4GLRI 3LKOA 1MCLA 4C4KO 1YDPA 3FRUA 5ADPH 1EFXA 3HE7A 4UAOB 1MCNA 1OD7A 4HT1L 3VXPB 1WBXB 4Z9KB 2ZUQC 4YXHL 3EDFA 2LAGB 1TLKA 2O5YH 3PQYD 4DOHE 3WIFA 1AP2B 1YECL 3VXRB 3DVNA 3SKMA 3QIUC 4RDQG 2VDLL 4IHOA 3AMLA 2JJUA 4HGWB 3DX7A 1VA9A 4L5FH 4U3XA 4DK3A 3C9NA 5KSUA 4HH9A 1MFBH 2MCG1 3TP4A 2EIZB 4J4PD 4R90L 3BO8B 1G7MA 2YKLH 4OGZA 1OGAB 4NZTH 5ILTL 3QUKB 1SY6L 3ARFA 3SKOA 5ICXB 1HH6B 4JG0H 3VXMD 3NAAL 2QQNH 1KC5H 1U8OA 3NCEB 5TF1L 2PW1A 4IIQB 4BSWB 3MJ7A 1MLCA 2Z91B 5I17A 4XX1E 2V2XA 4OCYL 2FO4A 4AM0A 3OKLA 4Y5YB 3QEQE 1MI5A 4LHQB 4Y2DB 3P0YH 4BK4A 3SDXF 4XVJL 2NX5E 1A7NH 3SJVA 5HXMA 4H1LG 2NY3D 3WN5A 4QXGH 4OLWH 2H41A 2XPGB 2E9BA 1MRFL 4YQXH 3FRPA 4J1UB 4M62H 4LFHG 3FMGL 4QRUB 5K9KB 2E8ZA 1EAJA 4M6MH 3QFDA 1S3KL 2H8PA 1JPSL 5C0IA 4JB9H 2V2TB 4OTXH 1LO2L 3ARDD 3OKKB 1MVUA 1LP9E 3U9PH 4NNPH 2DQUH 4LCYB 1MFCH 4TVPL 4XPBH 1EK3A 1YN6A 3L6FB 3GHBL 5DTFA 3HAEA 1A7RL 5IFAL 3MLXH 3BD5A 2HWZH 5D2NB 2ZUSA 4JN1H 4FZ8L 1JZ3A 3MRCA 3MLVL 4IIQC 1IGJB 1M6OA 3FOLB 5C07A 1NGZB 3CVIH 2XZQH 1XT5A 1FP5A 1Z6JT 4P57A 5DO2C 4XRCA 3MR9A 1I8LA 4OD2B 3DVFA 3F62A 4Y2DC 4WUKH 3B2UD 4S1QH 4XNUL 1AJ7L 4PS4H 1LNUA 1CFQA 3T3PF 3K2UH 1D5IH 3FQWB 5E1HB 1ZAGA 3PWNB 2I60H 4RGOH 2AI0L 4XBGB 3C2SA 2Y06H 3FT2B 3RWJB 2EH8H 5BJTA 5IJVA 4AEIH 2WINA 4NZUL 2DDQL 4HS6B 2E9WA 1DLFL 1XH3B 5A43C 3WFDH 5ACMA 5I71B 4I18A 3MV7E 1X5AA 3NCJL 4G6MH 4U1JA 5I1CH 4MD0B 2C1PB 5I0ZA 4QRSA 5ANMB 4IOSD 4O9HH 3GO1L 5GGSA 1YPZE 3EDDA 3T8XB 4QRRE 1OSZB 3BX7C 1JHLH 1EEYA 4JFFE 2B5IB 5D2NC 4JY6B 4X5WA 4J8RA 4P2RE 4ZG1A 5MHSD 3G5ZB 3HI1A 2AJZA 5C0AB 3TZVD 4EQ3A 4X6DF 3FQXB 3UBXA 1D6VH 3QZWA 4FNLH 1TXKA 1GSMA 4F9PC 2FBJH 4LCWB 3STLA 2F5BL 3AXLA 5CJ5A 4APQD 4F7EA 1MELA 2NY2D 4M5YH 3WDIA 3RZCB 1LP9F 5DMKA 3L3IA 1HHJB 1JPGB 5DSCA 4PJ8A 3S36X 3FB5A 1NKOA 3EOYG 5C0BD 1CICD 1G7IB 1JCKA 3MV9D 3PUCA 1EPFA 2R23A 2VC2H 2FLRT 4JZJA 3SGEI 5AAWA 5DRNB 4PJAB 1D5BB 1RV6X 2VIRA 2OZ4A 3DYOA 3GGWA 5C09D 3EW3B 5IMKB 4I0PA 3QUML 4JRYA 2XN9D 3PV7A 2XV6B 4ERSH 3CFBB 4QYOB 5KW9L 5L2KD 5I1DB 1I1CA 2BY1A 4GXUN 2Z8VC 1PW3A 4NP4L 4AZ8A 3CXDL 2KQNA 1T6VN 5IG7A 3DNKA 3U0TA 3O0RH 1N6VA 1S9XA 1UZ6E 5I73C 4S0SD 1KEML 3MO1A 2IAMD 3F12A 4M9PA 4MLIA 3ZTNH 2FWOA 3IETB 3RZCC 2PYEE 3QUXA 1FCGA 1YPZF 3MRIA 4MQ7A 2MHAB 3QIBD 3B83A 4JVPA 5E70A 3IFLL 1W0WB 3CVHB 4X6EB 3IDIB 1A47A 1HILA 4LHJB 1F3DJ 4KKBC 5ICZA 5LQBL 4GSDH 2ICWB 1KPVA 4DVRL 4E42B 4NHUA 1WCBA 5GSVB 4DN4L 1MCPL 2ITCA 5DVOA 1HXYB 1R5IB 1WT5A 4DZBB 3GMQB 4U2ZA 3MNVA 3N1PC 1YMMA 1KTDB 4ZSOB 5TQ0L 3ILQC 3O9WA 3QRGL 1MNUL 4F7PB 5IQ9A 2AJSH 5HDQH 2ESVB 1I8KA 2D7MA 2HKHH 4FN0A 4JE4B 3LKNB 4PTTB 2FBOJ 4PJXE 3FO9B 3MGOB 5F96H 3RI5F 1J9CT 4WY7L 1JRHI 3QDMB 3ULSA 3KPRB 5EU7C 4OZ4A 3W2DH 1VCAA 2J1KA 1KT2B 1UXWA 1DTUA 4ZUTB 1A6ZB 5F70A 5HGGS 1FIEA 4HHAB 5C8JA 1EEUA 3TFKD 1T1YA 4ZXBB 4J4PA 2D7NA 3MRNB 1UKSA 4O2FB 5DQDL 4GW5B 4ODBD 4RIRB 3WD5L 3OQ3B 2BERA 4AENB 4I3SL 1EUTA 3CMOH 3SKNA 1YEJL 5C08A 1EEZB 2D4FA 1I7ZB 1UZ6F 3VXMA 4EUPB 2Q86B 2VZ1A 5EUKA 3BSZL 3RX8A 1ES0B 4H26A 3QEQD 4J12A 5IBTL 2XTLA 1QSEB 3DUUA 4K8RH 3QEGH 2GTWB 3BH8A 4J3XA 3PWVB 4NBYB 3T0ED 3OB8A 2BCKA 1J5OL 3SE9L 1FNAA 4UI2A 3BZEB 5A16A 4NQEE 1NFDB 1AO7A 3P30H 1DUYB 5IMMB 2JK5B 4LSQH 3OAYK 2E6QA 3GMOA 1T0PB 1RZKH 1MCEA 5DXWA 5C6PB 1VACB 3GSXB 1RU9H 4Q2ZA 2OJZL 1CLCA 1BBJB 2LVEA 1U8KA 4BZ2L 2EXYC 2CIIA 3KJ6H 3MLSH 3GM0A 5DD3L 4ZXBC 1P7HL 5HVGB 1N7ML 1A6TA 2CUHA 3MSPA 4HIXH 1T7XA 3LEVL 4KQ3H 4DGIL 5GZNC 3QIWB 2G60H 1FG9C 1TCMA 4OF7A 1OAYH 4BH8B 1AC6A 4PBVC 3G5YB 5BO1H 2NTSP 4WI5A 1FL5A 2DWEA 2OZ4L 1HYSD 4AY0A 4OQTL 4KI5E 1OARL 1IM3A 5DJZB 3ULUF 1I1AD 1CF8H 4PJ5B 3G6JA 2V5SA 2NMSA 3HMXL 1A3RL 2GSIB 5JOFB 1QFUL 4HX1B 4JFDB 2NZ9C 2G75A 2AS5M 4GQ9H 5EO9B 4EI6A 2R4RH 3QCUH 1JNLH 4GKOA 1T2QH 3D2UB 4QRRD 1S7VA 5DRXA 1IGMH 5IEKA 4GKNA 3TJHC 2PUQT 4P2RD 5I18L 3CFIC 4X8JB 2M2DA 1I1RA 2EC9U 2BNRB 2PTUA 3DHJA 5MERB 1ZS8B 4YBHA 1EHLL 2PW2A 4ELKB 5DD6A 1FJ1A 4FFZH 2E7MA 3REWA 5D7IE 2P43B 2OJEA 5BS0E 1QFOA 5LAXA 1KTKE 1DVFA 3FFCE 4LP5A 5I1EH 1YDPB 3FRUB 4HPOH 1EFXB 3QNYA 3SBWC 3HE7B 2AK4E 2W1NA 4MDIA 1SBSL 4ODHL 3C5ZB 4QCIA 2QHRH 4FTVD 3FB7A 4XNXL 5DC4B 3ZSTA 1CICA 5HDLA 1CR9H 3MV9A 2VXTL 1NCDH 4YH6A 3KS0J 2ZPKH 4ONHA 3QUZD 3WIFB 4XWGL 3EYSL 4P2QB 4KI5F 1KOAA 3SKMB 5HYFA 1XFPA 3TVMD 4XT1C 2QADB 1N6UA 2VL5B 3C9NB 5KSUB 2W92A 5C09A 4HH9B 1L9NA 2MFNA 4XCNA 1SVCP 1UENA 1NFKA 4KK5C 4R4NC 2CDFB 1FO0A 4OZHB 3B8SA 2PYED 4HF5L 1HNFA 3ARFB 2FECI 4K8RC 2C9AA 5DK3A 3SKOB 3K4DA 1YNLH 1U8OB 2E7LA 1RD6A 5A2IH 3S37X 5FM5M 2PW1B 3GFUA 1NCCL 3SDXA 1EA9C 3C5ZC 5I17B 2FO4B 5CGTA 2QSVA 5EUOE 5JZ7C 1MI5B 5LGJB 4WO4A 1NCBL 3U7AA 1FNHA 1MFAH 4YDKL 3SGDH 4QO1A 2FNBA 4HIEA 3B2VH 2QADC 5IJKC 1EV2E 1UG9A 3KLAB 4P2YA 4K71C 5IF0A 1P9MC 3G08A 1BVKA 3TIEA 4RGNC 3ULVL 5C0IB 1MHEA 3ZKXC 1DQJA 1SEQH 3A67L 1MVUB 4OJFL 1ZHBB 3EYQD 4Y4HA 1YN6B 3PJSB 5DTFB 2OCFD 4WHTA 4KKLD 5TE7L 4IRSC 1F5WA 2I24N 3LEYH 4EUPG 3GMLA 5C07B 3HC0B 4GKZA 4P57B 1PGRB 4WEBH 2DLFH 3MR9B 2FB4L 4Z7WE 3WLWC 4KDVA 3QO1B 1G6RA 4JJ5A 1FC2D 1EJOL 1U9KA 4ZTPL 4U1NA 3RVVD 4H0HB 2WWKO 4PGEB 2FJHA 5CEZH 4PTUB 5BJTB 2WINB 2XA8H 2FJFA 4NQED 5E2WH 1CDGA 5CJXA 3GMPA 2R9HC 4ONFH 1HINL 4TPRH 4I18B 4PLJD 2R0KH 4U1JB 4QRSB 1EVUA 1DLHA 4RMUA 2NX5A 5GGSB 4YXLL 5IV2A 2AXJA 4UTBL 1QSFE 4EJ1C 5EUOF 5F8QC 3EFFA 1EEYB 3O2VH 3QI9C 3EKCA 4X5WB 4J8RB 4K7PY 3HI1B 1J0YA 2X40A 3N1FC 5GJTH 2AJZB 4P3WA 1IQWL 2FIKA 2JELL 4FZEH 3KYKL 4DQOL 3HR6A 3QDJE 1LP9A 1KTLA 2X44D 5BZDA 4NCC2 5AUMA 3STLB 4HUUA 3WJJA 3AXLB 4GKSB 5L6YL 4IRZL 4KI1A 4F7EB 2OXGA 5L2JA 3V8OA 4TUJA 1ZWIA 4UIKL 5DMKB 4JO1L 4YDVA 4DZ8A 5DSCB 1JUFA 3HZYA 3FB5B 1OTTD 1X7QB 3BOVA 2W9EH 3I9GH 3IXAA 3QCTH 5CUSL 3L7FA 2K7PA 5E95B 4OM0H 4LVHC 1B0RA 2WP3O 3QEHA 4JZJB 5KOMC 1T04A 2WZPD 3TNMB 5JMOC 3LH2H 4KMTL 1U6AL 2ZCHL 4WFHD 1FFPA 2VIRB 4HWBA 3GGWB 4Z7WF 5FA4A 4JRYB 4L3EE 3RJDA 1FO0L 2R1XA 2DMBA 3N85L 3S88L 3QAZB 3VWJD 2IWGA 4OLXH 3MV7A 1FAIH 3ARQA 4OCXL 3B5TA 3U0TB 3V0AC 1YPZA 1S9XB 4U05A 1DCLA 4QRRA 3MO1B 3F12B 4WTXA 1Z0NA 1FPTH 1OAKL 2FWOB 4JFFA 2DICA 3P9WB 4CN6A 5F1NA 4P2RA 1EUUA 3IVKA 5AAMA 1HILB 3I84A 4KMLB 3T2NH 1KPVB 4NHUB 1WCBB 2ITCB 3IRZA 4JZJC 7FABL 3BE1H 5J89A 4RA0C 5JHDE 5DUMH 3ZT7A 2AK4D 5HHXH 1XF1A 3MNVB 5HYSB 2ZZUT 1JGLH 3VFRA 1DFBL 4JHZA 2P44B 3O9WB 4FFWC 3ZSSA 2DIAA 5IQ9B 2NXZB 5D8JL 3RVUD 4TNWF 5FA3A 5ETUA 5CGMA 4EEEA 3WDJA 1W0YT 4FP8H 2XZCH 2DQJH 4LMQI 1E4WL 4LKCA 2C3VA 4OZ4B 2QKIA 4HQQH 4ZO8A 2YRPA 3AGVA 1CXIA 2H2PD 1CG9A 5GS2D 3TVMA 1KCRH 1R3KA 3BD4A 3VXSE 2EDOA 5GHWH 1NGQL 3BP5A 3G6DH 4YHPB 5C8JB 1T1YB 2C7UA 4QF1A 3C60D 4RMSA 2BJML 1CE6B 4X9FA 4WFFE 4IMLA 1KIQA 2YUVA 1CGVA 2EH7L 2PYEA 3SKNB 5C08B 3IKCA 5GGRY 4G6KH 1CGWA 4NWUL 1I8IA 5EUKB 1IC1A 1WIOA 4D9QE 3R1GH 1KCVH 3MA9L 4PBWD 2BCKB 2Z8WC 1H0DA 3JWDH 3U79A 2VDML 1AO7B 1HHGB 1S9WA 4MQSB 3EOBB 3L5JA 3ZT5A 3LN4A 4QHNB 4Q2ZB 3NZ8B 4Q0XL 1A1MB 2FX7H 4JO3L 1U8KB 1LD9A 4DKFH 2QV2A 3S98A 5EZOH 1DBJH 4PJXA 3TH4T 2CIIB 1WEJL 1PEWA 3P0VH 1D5MB 4MVBD 3NZHL 3EUUA 1A6TB 3LV3B 5I9QB 1NANH 5I8CA 5JIKA 3ARGC 4PJFE 1L6ZA 4LCUA 3RU8H 3CLFH 5HPOA 3LS4L 5F7YC 3P2TA 3ZYIA 2XI9A 5FK9A 4HWBL 3V6FA 1G84A 1MWAH 1QR4A 2DWEB 4NBXB 2EEDA 4UDUA 5IMOA 1UKTA 5CZVL 5IKCB 1IM3B 2EEAA 4NRYA 5TGBA 4YJZL 4UINH 4Y5XB 4M8VA 2VZTA 3ZDXF 4DCQA 1KB5H 2P1YA 1CD0A 2G75B 3BEVB 3O8XC 4EI6B 2IF7A 1XMWA 1FNEA 4HUNB 3EZ8A 4K23L 4KRMB 1S7VB 5DRXB 4KJQD 1QSFD 1F2QA 4WNQB 5AG8A 4GKNB 4NQEA 5IEKB 5CJBA 4XPFH 5I8OH 2R0LL 3PWLB 1F6AA 4UQ3B 5I9QC 3SDCA 4D0DA 4OT1L 2PW2B 5DGQA 4PRDA 1RZFH 1BP3B 3QDJD 1IGTA 5DD6B 1AE6L 1FJ1B 3REWB 1MCHA 1PX3A 4X7TA 4L8SA 5HYJA 2EICA 5H37H 3SO5A 4BFIA 5LAXB 3MCLH 2Q8BH 3VXNA 1DVFB 1L0XA 4Y5XC 2XZAH 1AI1H 5E08H 3KPPA 4H88L 3QNYB 4N68A 1T5XA 3OJVC 3QDGD 3MLZH 4PJFF 1JYVA 5DJDA 5DD5H 5DURD 43C9A 2HLFD 4AMKH 4DJMA 4FXGA 4CAGA 2HFEB 4L3ED 4LLMA 4ONHB 2WIMA 3RGVA 4WHDA 4OIBA 4HIIA 1WIPA 2OBGA 4XCNB 4C57C 1DANU 3EDEA 5IW6B 1NKRA 4S1SH 4U3CA 4I77L 5D1XA 3LQMA 3NH7H 3S34L 5HYSG 4ODXA 2DN7A 4BH7A 3JWDC 1BJ8A 5IGXL 2D7PA 3DVGB 3SDXB 1IC5H 4HEPG 1BQLL 5D7IA 5I8EA 1UGNA 2BC4B 4POZD 1T03H 2WK2A 3B43A 1IM9B 2LE9A 3T1WA 1G7LA 5BS0A 4WO4B 2YZ8A 1A4JA 4TTDD 1ETZB 3B9KD 3FFCA 3KLHD 3W9EB 5SV4A 3ZKND 1F45A 4ODTL 4HIEB 1KJ2A 3FO1B 3LSOA 4N0CD 3RA7L 1GH7A 2BDNL 5F9AC 5K9JH 2AK4A 3MBXH 2BY3A 4XWOC 4POUB 1BVKB 3TIEB 4NO3A 1FIGL 5K93A 5ERWA 3HZMA 5FF6A 1MHEB 5HI4D 4Y4FD 1MEXL 5LCVH 2IH3A 4ONGH 4M4PA 3OAZH 1H3PL 4DOHB 4Y4HB 3BN3B 3HHRB 2EO1A 1J87A 5I75B 3THMH 4JANB 1A7OL 1A02N 1H3UA 4JO2L 4G3YL 2A9NL 1MPAH 3GMLB 4GKZB 5CS7A 2OR9H 4WFFD 1KEGL 4X9GA 5FYKD 1R6VA 1IMHC 1JE6A 4NKQB 1F8TL 4WRLA 5CINL 3M45A 4U6VL 4BSJA 1G6RB 4M7JH 5MEQB 4I0CC 5F9JA 4D9QD 3IJYA 4U1NB 2BRQA 4F7MA 3BAEL 2J8UF 1RUKH 2FJHB 3S5LA 3ALXA 2FJFB 1O0VA 2ICWJ 4LBEA 3GMPB 4RFEA 3BRGC 2IPUK 5EUOA 3PIQB 3QB7C 2GCYA 2NX5B 3VE0B 5FO9A 5SV3A 4OGAD 3BKJH 4Y4HC 5FHBL 5IV2B 5I75C 2NCMA 3HRZA 1EO5A 3EFFB 3N1QC 4X6DB 1ZHLB 1C12A 3T4AA 1INEH 3K80A 3ZHLA 2NR6D 1LWRA 1ZHNA 3FAWA 2FIKB 4ESKA 4FRWA 4YO0B 1XF4A 1LP9B 3VGFA 5BZDB 1AGBA 4HUUB 4NZDA 1GVIA 2R29H 3AY4A 2YXMA 4G8FA 3CSPA 4K9EC 2GSGA 1ZT4A 5L2JB 2X10A 1ZWIB 3TIDA 4YDVB 4XVUC 4DZ8B 1JUFB 3O2DH 3HZYB 3IDUA 3ARED 1FRGL 1QG3A 4RAUA 1JNHA 2BOCA 3FKUS 2PKDA 2PR4L 3QEHB 4Z7WA 5ALBH 1NGWB 2F58L 3ZE0E 1FFPB 1OSPL 5FA4B 4NWTH 4QT5A 2R1XB 4NM4H 3GI9H 4WHYG 4R26L 4QKXB 4M7LT 1JZ8A 5EB9A 1A1OA 3MV7B 3FJTA 4HWZB 1NLBL 1KJVB 5EOCL 2CUMA 1YPZB 4Q6IA 1IGIL 5DJXA 1QSFA 4F37F 5B39B 5IHBA 4NN5C 5GGTH 1K4CA 2NW2A 1BM3L 4JFFB 2QL1A 3O6LL 5F1NB 5K9QI 4QXUL 3IVKB 1RK0A 3RBGA 5HD8D 3DHMA 3QDJA 2Z35B 3MRBA 4TULL 4FQPA 1KJ2L 5EZIH 3UJJH 1YY9D 5MENE 3SEPA 2XWTA 4G6AD 4KK6D 3HC3H 4LCIL 5DEGA 1BJ1J 1BZ9B 4XMPL 5DJAA 4R2GD 3MRGB 4X83A 2A9MH 3OKOB 2OL3L 4OB5L 4K3EL 5FA3B 1MIMH 2NQCA 3A6OA 1KPUA 5JW4R 1ND0B 5F71A 1GGCL 3T0XA 4MMZC 5TE4L 4FG6C 3GSUA 1P4BL 2OX5A 2XRAH 4JG1H 4LKCB 1KLUA 2C3VB 4L3EA 3FCTA 4JM2F 3UZVB 2QKIB 4AJ0A 3ZE0F 2AGJH 1E0OB 4MS8C 3C6LD 1KFAL 4P46D 1AXSB 3V5KA 1CG9B 1HDMB 1R3KB 3VI3E 1W72H 4PG2A 1MCDA 3RY5A 5JW4N 4YHYB 1O5DT 5CP3H 4OFVA 5D72H 4R0LB 1SBBA 2C7UB 4QF1B 4ZPVA 5JDSA 5FEBA 4AEHH 1H3GA 4IMLB 3BZ4A 1TQCC 3DV6A 1FVCA 3IKCB 2APVA 5IVZB 1MCRA 1I8IB 1BQUA 3L5WA 1N26A 1IC7H 1MLBA 4D0CA 2DM3A 4HCRH 1AD9B 1J8HB 1X5LA 3DLQR 4ORZC 3QHFL 1H0DB 5F44A 5JHDA 1G9NC 3VFWA 1S9WB 1FQ9C 5FCSH 3V6BR 2QSCH 3LN4B 4U2YA 2XZZA 5IHZA 1FZKA 1G7QA 2X1WL 4JFEE 4EN3D 3V52H 1ZT1A 4O2CA 5CZXC 1CE1H 1RVFH 1LD9B 3I2CL 1JL8A 3HNSH 4YHYC 5TF0A 4QRTB 3SN6N 4IRJD 4R0LC 4PGCB 3GJFA 3LQAL 2Q8AL 4N0FA 1NEZA 4Y4FA 2D9QB 3BN9C 4C55A 1DQLH 3MRRA 3Q2CA 1DR9A 3VRIA 3B9AA 2VLRD 2C1OB 3UCRA 3VXSA 4YUEH 4XX1G 2VLMD 3S96A 3SQOL 1M4KA 3AAZA 5I66B 3VRLE 4UDUB 5IMOB 2VXQH 1KN4H 1CL7I 4XNZB 1WAAE 1KN2L 5TGBB 4JJHA 4J3TA 5GJSL 3RDTD 3VJ6B 1HI6A 2VMFA