4C4BA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v in the reduced form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
MELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
total genus 26
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4c4bA00
1Y07A 1DQIA 2AMUA 2JI1A 4BFKA 4C4UA 4BK8A 3QZBA 1VZHA 1VZGA 1DFXA 2JI3A 2JI2A 1DQKA 1VZIA 4BV1A 4D7PA 2HVBA 4BRJA 4BGLA 4C4BA 1DO6A 4BFFA 4BFJA 4BRVA
chains in the Genus database with same CATH superfamily
4Z3TA 1WD9A 1DQIA 1CVRA 4RAUA 2PR9A 3M1OA 2DMKA 2COQA 3BLPX 5FYKU 3UDWA 4P59L 4DK5A 1EGJH 4FLHA 5T1MB 1CB4A 5SWZD 1CN4A 5E2TL 5MEQB 1BD2D 2FT8A 4Z7UE 3GHPA 1OE3A 1YN7B 4Y19A 1SHXA 1BYOA 4QRQA 1MFBH 2BFVL 5HVWA 4K2UL 4LSVL 1A3RH 3ARZA 5IW1B 2JQAA 1A14H 1JMZA 2OI9C 2ADIA 3RWGB 1JF5A 1C16B 1R3KB 3FAXA 5IB5B 2LU4A 4IU3A 3WDJA 1X5KA 2E46A 4QJ3B 4HJJL 2GSGA 4LIQL 4L23A 4IBZA 5K39A 1NCUA 3FFDA 3CMOL 3FB8B 5C8JB 1OQXA 1ZV5A 2VDRH 1NCTA 3P73A 4M5ZH 4P06A 1DSWA 5SWZB 1ITBB 3RJOA 4HFWA 2VAJA 4ATTA 2VMFA 3RGVA 5DS8B 1QLEB 1WSST 4HXAH 4WFHD 1XXFC 3MBEA 5KYNA 5ALCL 1JWSB 3TBCA 4ZQTA 4GRMA 4KHXL 1MVFA 1E8YA 3MTXA 5IB1A 1FGNL 4Y8DC 2DMBA 5BOPA 5JW4M 4ZMXA 4WWOA 3V10A 1RZPA 1B0RA 1OB0A 3JTTB 1Z9SB 3LQZB 1FNEA 3O2VH 3S48A 3FO2A 5L0QC 3IPEA 4UOJA 1TQBB 3PQYA 2O5NA 1NBQA 2X0VA 3D51A 5DRXA 3FQRB 1UM5H 3KGTA 4YDJA 1D5ZB 3IT8D 4DGVH 3H4FA 1NL0H 4MNGB 4OGXH 2F15A 4XP5H 2PLTA 2ZCZA 5C97A 5I30H 4XC3L 3WKQA 3VX1A 4HF5L 1ZRUA 4DW2H 5DD1H 3CSYB 4BYHA 1XF5A 5C3IA 3HE6B 3MJ7B 3MRPA 4UQAA 3L5HA 2A5UA 2J8UB 4AW4A 1QA9B 4E9RA 5HJDA 2Z0BA 3T1FA 4M8VA 4YLQT 3CFKB 2A6IA 3RX9A 1QSZA 3EJYD 4JJ5B 4KVNH 4CU8A 3N2JA 1DDHA 4M8QB 3IDNB 5AB9A 1ZLDA 5F9JA 1CXIA 2B1AL 1HAWA 4FLQA 3L3GA 4P5KA 3MJWA 3LB6D 5C3TA 4WU5A 4EOWH 4P5RA 4YXKL 2OJEA 1QQDB 1OAYH 5D1XD 3WG7B 5BRZB 1THCA 2EP6A 2VKWA 2ZT9C 3NCJH 4Y2DD 2HTLD 4ENZA 3ZYJA 1E3FA 5KSUA 5FGBA 4JQIL 2Q2EB 3MRDB 2B20A 3PUUA 1VKXA 1BZQK 1DBKL 1H5BC 2NY2D 3G5ZB 1GY2A 2LU5A 1GOHA 3ENEA 4NBZB 1DVFC 5DUMH 1UM5L 3HG1E 3FQWB 1EEYA 4WW2C 1QATA 4NUGH 4U6YA 4ONOA 4EN3D 3FB6B 5FOBA 1DVSA 1ZPUA 2NSQA 3E3QE 4OF7A 2OV0A 3KWWA 3VI4E 2OSLB 1OOWA 4JCWA 4GW4A 1MZZA 1A7OL 2OCFD 1N19A 4JHVA 1KJ2H 3HW7A 5K1NA 2VSCA 3VYPA 1SJVA 3GXNA 5CUSH 3VDBA 4JGMA 3QI9C 2XFXA 2D3NA 2H3NA 3I6KB 3K3QA 1PCSA 3CDCA 3DYOA 1M05A 4EBQH 3I6LD 4XBEH 4KVNL 2AQRA 4U1LA 3FRUA 2XXGA 3QJSB 2EZ0C 1FNSL 3KPLA 3D3VE 4NZRH 2CA3A 4O9HH 4AY0A 2W65B 1KC5H 1ECYA 4U49A 2Z4TA 3E8UH 5T3ZE 1KLFB 4RLDA 4ZSOE 3GRWL 1KCVL 4FI8A 2WCSA 3PJLA 5EO9A 3ZTNH 2A6JA 1XGQA 4JPKH 3BAEH 1P7KB 4BE5A 3CZJA 1F0LA 3TH3T 1CL7L 3MJ7A 4EDWL 5T1LB 3JWNC 2EXSA 4WKZB 1TUPA 3TCXA 3LXUX 1N64H 1JZ8A 1UD8A 2VXQH 4X9BA 5HYIA 3BVTA 4X80H 1TVDA 3V4LA 3E8VA 4AH2B 4FZ8L 1DBKH 4JZNA 5L9DH 4ABVA 4F2MA 3HUJB 4M5YH 4M6NL 1FNHA 1DJZA 4W70A 3TBSB 2KBGA 1EMTH 4P2OB 2UWEA 3CVHH 1S5HA 1A7QL 5CILL 4CDGC 2GT9A 3IFLH 5EU6E 5L2JB 2J5LB 1BLNA 1LD9A 4XAWH 3QEHB 4F27A 4JRXD 2KPNA 4EIGB 1RJZA 2BSTA 3A6BH 4W9EC 2WBJD 3LSOA 5IV2B 2E7DA 1Q72H 2VDNH 4K9EL 4AM0A 4X5WA 2H2PC 4HJ0C 4J12A 1A2YB 4PWHA 3ZZQA 2YD3A 4WWKA 1NGPH 3QYNA 2DWDA 2B1AH 2R1YB 5IQ9A 4YR6A 2D2OA 4GAAA 5I75C 3U2SB 3R18A 1X4ZA 1SOXA 4BCYA 2PW2A 3T0WA 4OCRL 3EG9A 3FCSB 4Z3HA 1FPTH 3OKNA 2WINA 2AQNA 2NY5C 1P6AB 4ODTL 4Z0XB 2AEIT 5DJYA 3OB8A 1F4XH 1SLXA 3FXIC 2AZAA 2FCBA 4LRNL 4A55A 1WBXA 3GS4A 4FQXA 5FW8A 3U46B 2GSGB 4PVNA 1O6SB 2VUYA 3BEVA 2IPUK 5LBSL 3FUEA 4MASA 3TH4T 5EF0A 5KSBF 5CJXA 2GITB 5CO1A 2ENYA 2QZ5A 4QTIL 5E6IC 2C9QA 1UWGL 4YSPA 3STLB 4HEME 1AIFA 4M5SA 4HDIA 3MA9H 2GEQA 1MFAH 1TLKA 5EBWB 1CGXA 2FYYB 3KVPA 1ZLUK 3QIUA 5KW9H 3TO2B 2XTJD 2R1YA 1F97A 2A9AA 3PGFH 1MHEB 3OPZH 2H9GB 2UV3A 5IVXE 3C2SA 3D18B 5KSVA 5CZVL 2GBAA 1LO5B 2C3VB 1FO0A 3JQOB 2CHDA 3CWGA 1PKQA 2HFGH 3NSFA 3TV3H 5PCYA 5C0CA 4F5CE 4P2CG 3SBRA 1I75A 4PW3A 1CYWA 3WN6A 1TCRA 3N42B 3OPUA 3SBWC 3SDYL 5LBSH 1SQMA 2ZSVB 4NQDE 1H8OA 2QKIC 1H3UA 2F53B 5FAAA 5AVYB 4IRZL 1ADQA 2QKIA 1I1RA 5KYYA 2VT0A 3U1SL 2Z91B 1SEQL 1MWAL 1SGKA 1CK0L 4ALAH 2Q3XA 4YDLC 1TQBC 3OKOA 1MHPL 1AO7A 1UWYA 1WC7B 2APTA 5J1TC 4EZKA 2AJSL 4OZFH 5EEVA 1OKEA 1F6FB 2EDWA 5KSBB 5KVEL 3CZLA 3CC5A 3BJLA 1A3ZA 2WLLA 2DJUA 1B0RB 3FTYA 5LCVL 1P7KA 4A37A 4E42A 3G6JB 1LK2B 1UJ3B 2NTFA 2V9QA 4L29A 2FR4B 2Q20A 5KEZA 2OR9H 5DA0B 4L1TA 4OGZA 1DO6A 4YHOL 1RZGB 1NINA 2H6PA 2OP4L 5CMAA 5JQHC 3UBXG 3K6DA 3QJXA 4BFIA 4WFED 3VWJB 3KLHC 5E1QA 4WKXA 3OC8A 3MUHL 4FG4A 4Y5XB 3BAIA 3L4ZA 5SWSD 32C2A 3MLSH 3BXNB 3V0WH 1FNGB 3PWLA 3N40P 1P5VA 2K1MA 1JGLL 2C9UA 4OB5H 4XP1L 5FHBH 1FZJB 4I5BB 5TPWL 3LKOA 2WXJA 4QYOB 3ZE1F 3WJLC 4OZIB 3GRGA 1EERB 4X4MA 4O02L 5IQOA 2YRPA 1KF9B 1ADQH 2V9RA 2TSBA 3M45A 2HVKA 4HUWB 4OCYH 1XCQB 4FQ1H 5MHSD 1B6UA 1KJMA 4FQIH 3I9GL 3RKPA 4IKKA 2Y7QA 3SCMA 4L4TB 4L9LC 1ZGLM 4I2XB 3H9SD 3IS0X 4U6XA 4A7QA 2R0WH 1IBFA 4EI5A 2XV3A 4WWKD 3IXAB 1OPOA 3U0PA 4RWHA 1V10A 2PTVA 4FTVA 2CR3A 2DWTA 5K69A 4PY7B 4RNRA 3P4OA 1QW8A 2D7TH 2K3TA 4OVVA 3V4VB 1JRHH 1S7XB 5I24A 1WD8A 1VLXA 2H47C 2E27H 2H3XC 2J88L 3BFWA 4TM9A 2E47A 4TULL 2VDMH 3TBSA 1Q1JH 4MSWB 3RVTD 4FXTA 1BVLB 2HH0H 2K4WA 3OB0H 5DVLA 3BMVA 1QNIA 2XWRA 4N0FA 2PN5A 1HNGA 4PUBL 4Y5VA 3QCVH 2FUQA 2WVVA 4IMKC 1GW0A 2BIHA 1UWEL 3GIZL 3MCYA 3A21A 3GWJA 3KPQB 2AW2A 5IGXL 5TQ2L 1AR1B 1RUPH 2J4WL 1RZ8B 3T2LA 1CFTB 3IBEA 3C5JA 3ECVA 4CNIA 1YYMH 3QORB 4PTUA 2VJXA 1NCHA 2DLFL 3UTOA 4RH4A 2YKLL 2B7DT 5IJCC 4QEGA 4CMHC 1U2HA 5CHNA 1UCBH 3AM8C 4XX1E 2EIKB 1JWUA 4UQEA 4Z23A 1FNGA 1FC1A 3CVIH 1HK6A 3BXNA 5AZ2H 2K9FB 3CN1A 3Q8AA 4GINA 4MNGE 4LASH 5IJDC 3VD1A 3MRIB 2MQ0A 3LZNA 4NPYB 4U6VH 2VDML 1KCKA 1W72A 1U8HB 5J12B 1R3LA 5D9SB 5JOFA 4D8PA 4PRIE 3GSQA 4XMKH 3LEYL 1QSFD 3BOVA 4AJVA 1PNDA 4QUOA 5IEHA 1DBBH 4M61B 1WK0A 3KCWA 3SYQA 1FP5A 1JWSA 4ZFOA 3BIBX 1JHTB 3U25A 4OZGF 4BCXA 1VCBC 3O8XB 1RAMA 5AAPA 1NOFA 3ABZA 3T77A 4LLMB 3IAQA 1TFPA 1NEZB 1ZV9A 4RA0C 4F20A 4PWFA 5KN5B 3ARBB 3QIWA 2O61B 2OW7A 2QV2A 3RTLA 3LEXB 4ADJA 1IKOP 1SPDA 2O4EA 4AJ0A 2ZX9A 2ALWA 3ZT5A 5FLUA 3EJCA 5CD5C 5C0AD 3WLBA 1FCCA 7CGTA 1XZ0A 3B8YA 2OR7A 4O00A 3C8KB 4NQSB 1B2WH 3QPXH 4NN5C 1CFQB 3LKPA 4N5EC 4U7MA 5ANHA 4OW6A 4W9CC 2JB5H 1A9EA 3MRJB 3TNNA 1RMFL 3UH8A 1D2PA 1RL1A 4OZHB 4KXCA 1GW6A 1AI1L 2G60H 3MNMA 4HU8A 3HPJB 4NRXB 1BQKA 1KXVA 4ZPVA 1BVOA 4ZMZA 1RZ8A 3CH8A 2FE0A 5GZNC 2A6IB 3HE7C 1BCIA 1DJGA 3VRIB 4RDQF 5GZNA 3HMXL 5I16B 4AQ1B 3MV7B 4KK8C 4G5ZH 5C0JB 1QACA 2HKFH 4I0PA 4W9JC 3IJHB 5DZ9A 5DUPL 1JXJA 4KROC 3UTZA 1B9KA 2LHAA 2AK1H 3VVVA 1IIIA 3BW9A 4EAEA 1CFSB 3K91A 3L3OB 3NCBB 5D8JL 1XT5A 4LLUA 3EGDB 3PLYA 4N2DA 4ABWA 4H20L 4E41D 1TKWA 2RMNA 3PL6A 4MZRA 1EO8L 3EYUH 4P9HH 3LNDA 4LCUB 4YSAA 3B6SB 4CVZB 4NJAH 5A6IA 3FW6A 3NCMA 4J5VA 5T5NF 3MLUL 1MCWM 3W56A 1S7WA 3WFHA 2ITEA 2D4DA 4S1SH 4QAMB 3BWAB 2OL3L 4WK4B 5A2JH 3R19A 2UZYA 4L4VA 3L5JA 5SV3A 3RGVC 5C9KA 3T6QC 3VQ2C 1J1OH 1CFNB 4DP0X 5ADPH 1JNNL 2DM3A 3DBXB 4EI5D 3FT2A 4LEBA 3TFBA 4HQQL 5FXCH 4JFDD 4KVPA 1J9SA 1T0PB 2BHUA 1RZJL 1VSCA 2AGJH 5ALBL 3WFBH 3IMWA 2TRHA 4NNYA 1NBVL 4AK1A 3O6MH 4B0MB 1C7TA 1FRGL 3W0WA 2YPLD 1QLFA 2R2BB 1ZGLB 3AAZA 3HE6D 4UT6A 4TXVB 3K2UL 5EIIA 2EYSB 2Q5BA 2VDQB 4YDKL 2QV4A 2CHXA 2ROYA 2Z4QA 1EAPB 2YXMA 3ZUNC 2VLJB 2WBJA 3IJSA 2BZ7A 2FJGA 2OTUA 1ZVNA 2R23B 1E3XA 3S36L 3THMH 4UM9B 2HFEA 2X1XR 3KDMB 3VXME 4QNPE 3CHOA 3C6LB 4UTAA 2O5ZL 5GGRB 1PLCA 4QTHB 4KUZH 4TLTA 5EBMB 3FUMA 1KOAA 2VDKL 4OCMC 2EIZB 1R6VA 5E8DH 2CDGA 4GKZA 2R1WB 4P9MH 4PY8J 2E56A 2WIIB 1H6EA 5FYJE 2V9UA 3US1A 3B3IA 4PJ9A 3GS0A 3OKEB 1D3CA 2GK2A 4RAVA 3S8FB 4F57H 5CGYD 3HC0B 3LIZH 1RCYA 1HL8A 4JKPH 4MAYC 1FFPA 3U1PA 3P77B 2NY1C 4Q0XL 1IU1A 2FJFB 3KVQA 4XXWA 3UJIL 3FU6A 2E59A 3U4AA 2YMXL 2JIXA 3QI9D 4LLYA 4YGVB 5I5JA 4JQXC 4UBDD 4F7EA 4XN5A 2AXFA 1G94A 4L5FH 4XN8A 2DKSA 2Z7YA 4XNBA 5GPRA 5DEFA 3I84A 4ORGB 3B2VH 1GYWA 4KNTA 5CLYA 3JZYA 4OZHF 3NN8A 1KY7A 2QR0A 1LP9E 1F56A 3QT2A 2YQGA 4X5PA 5F7NC 4BFRA 1OLLA 4CVXB 5DC4B 2YD8A 2OMVA 4NKOB 2CUHA 4NRYB 4MFHA 4BWWA 3D69B 2VXQL 3ZE0E 5JA8B 2CGYA 4X7TB 4PJIA 4YDIL 3NA4A 3RX5A 4N25A 3K6SB 2NXZD 3A4EA 2RCSH 2NUTB 4RFNB 1JGDA 1MAML 1VCAA 2B1HL 1JOIA 5DK3A 4HVBA 2CG9X 4FMFA 2Z35B 5C07A 2NUPA 1LP9A 2ED8A 3GSVB 1KN2L 1W8OA 4OQTL 1KWKA 4FG6D 3A24A 4TQPA 1BBJB 1JNHA 3DOHA 4PJBE 5F0MB 1AD0A 1I7UA 4NDMB 1TTBA 4CN1A 4N85A 2A6KB 3MNDA 4TMPA 3QXDA 4RGNE 3EIFA 4P3WA 4DP9X 3KPOB 3G6DL 5DFWH 4B0MM 4OLYL 4G6MH 5F97E 5DMKA 3H6JA 5D6DC 3APDA 1T4KB 2YK1L 5PAZA 2G0KA 1FZMB 5D55A 5GZND 1SYVA 1TZIA 1LMIA 5D6CB 4LAJH 3RWIB 1S7QB 3T1FB 3BRFA 3ZDYF 4YXLH 4OFPA 3CBJB 5C3LD 2ADFH 3IETB 3KPTA 1R19A 1XVSA 4YQXL 4JO3L 3RVXD 5FO8B 2IO5A 1F4YH 4DTGL 2VW7A 1D7CA 4UQDA 3ZL2A 4ODSH 3KWUA 2X2YA 1QBBA 2X7LA 9PCYA 2Q76B 2XA8L 2NUPB 3O3AA 1B3IA 1NGZB 2CBPA 4G8GE 4XH2B 1CF8H 1ES0B 4OF8A 4PP2B 2GTQA 1WP6A 3UP1A 3T2OA 4KKLC 3VFPA 5I1HL 4NQDD 5ITFB 4U4IA 3WL9B 5KS9B 3CVIL 2X9XA 3BE1L 2OM5A 1AACA 3MV9D 4DGIL 2GBUA 4JFFB 4PJAE 2EE2A 3D52A 1JNLH 1P84K 1IILE 3BCDA 1AOHA 4W9HC 3K71A 5DYOB 3PDDA 3IE9A 2HRPL 1H6TA 1OSZB 4KTDL 3K6NA 4QF1A 2IPTL 2VLMD 3PCYA 5J1SC 4QD2E 2NXZC 3LN4B 2F74B 3TJEL 3MLWH 5IWLC 3V4PA 4PJBF 2WOYA 3T09A 2KDGA 4Y9FA 5CEXB 4XCFL 2VZVA 2AXFB 3VWJD 3O6FD 4DAGL 4XPGL 2NW3A 2PPAA 4Y1AA 4ELKB 4PN6A 1N70A 3V7AE 2AMUA 4F9LC 1PDKA 5HJ3A 1OWRM 4PRPD 1A4KB 1G1CA 1MSPA 3S3JA 2YN3A 3BISA 5ERWB 4QWWC 2BIMA 1HHHA 2PR4H 2Z8SA 2ZYHA 4L8CB 1A47A 2BM3A 4LLWB 4AEEA 1WWAX 1UZGA 1PSKH 3RY5A 2H26B 2WNGA 4XE0A 5JQIB 4PJCE 2EDJA 5BQ7B 1T22B 2JKTM 1U3HA 3TVMB 5D7JA 4K3GA 3DIDA 1U8NB 4MTMA 3L1FA 3KG5A 4MQ7A 4PCYA 3SPIA 3ZE2E 4LPXA 4CNIB 2XA8H 3VXSB 3UC0L 2DQCL 4QHMB 3GMPA 4JFQA 4YHNA 2OL3B 5IJVB 3D85D 1OZUA 1Q1PA 4G5AA 5HD8D 3UO1L 3WLWC 4GW5B 43C9B 5E08L 4NUJA 5BV7B 2GQHA 1RSYA 4QXGH 2ZPKH 2QHRH 3EFDH 5E5MA 4Y4KC 3SE3A 1H0DA 5FGSA 2D3JA 3A6CH 1G7PA 1SN2A 3BPLB 1OARH 1BGXH 4Y2DC 1KGWA 4ZFGL 3F7YB 5IMLA 4L8BB 3VXTA 4OLYH 5EU6D 3CDYA 1DVFA 5FHBL 4FAAB 4U1JA 3IMVA 4ZDHA 4JY6A 1V5JA 3BVNA 3OJDB 2BIOA 3R4RA 2X3AA 3BAYA 4JFEE 4NQCE 2VISB 2DQDH 1BQSA 3K5SA 4JFOA 4QNPF 1SDYA 2VLJE 3V5DA 2NNAB 1ANUA 2BP3A 1A7BA 4LSVH 3GMPB 4OCXH 1NCIA 5I71B 3VSVA 3TYFA 3N55A 3WNIA 1USQA 2WQWA 2YPVH 5C09A 3SDCB 2VN6A 4JM2C 4X4ME 4J8RA 3GBLA 4PBWD 5KWYC 4F37F 2YD0A 1A1OB 1RHFA 1KTKE 1DVXA 5E00A 1LO2H 5D70H 1I8KA 5F7FA 3JWOL 1G7QA 2WK2A 2D31A 2XY2A 5EMYA 3OAYH 2FNBA 1BGXL 3NA9H 4FTDA 2BVQA 4XAKD 1DSYA 5ERWA 3BZ4B 1P5VB 2BSED 3QSKB 4Q4IA 3NPSB 1NGQH 2C3WA 3ILPB 4S1DD 3ZHNA 4KY2A 3O9WD 3NFPA 1ZS8B 2O6CA 2W91A 1N2RA 2G2PA 2XVGA 1J5HA 1GGYA 2YKKA 1FAKT 3HC4L 1SYSA 2VC2H 3QXWA 4OJAA 3HAEB 3TN0A 3SO3C 3EDEA 3A6CL 1PD6A 5BRQA 5GS2H 43CAA 3FU7A 3VRIA 5A2LH 5ACLA 5KVFE 5B21A 3JUZA 4CKQA 2CK0L 2UVFA 4KTGA 1PL3A 5T33L 2I5YH 4HETA 4L2YA 5HY9B 2RFXA 3AXLB 4XBMA 3WIFB 4DGWC 1YNLL 1ADWA 4YSSA 3L3KB 5EEZA 2ZXDA 2Z35A 1SJEB 3BVUA 2AKRA 4XPAL 3DSFH 3U0WL 2D31B 2G4GA 5CLXA 3T0EC 3DO4A 2I07A 3CDZA 2HJKB 4LF3B 1WCBA 2HLFC 3PL6B 5DZJA 2ZCLH 1G9NC 2YC1B 5E23A 1CXFA 2DLGA 1TIUA 3U82B 1JUFB 2Y23A 4LOVA 4ZJ9A 3CN3A 4GB9A 3SDXB 3DVIA 4TQ8A 4OM0H 3H8NA 2P43B 1ONQB 3TU6A 2WQSA 2WQ8A 3BKYH 4FP8L 2QGBA 4HG4J 3MLRH 4M7LH 4PJCB 3VFOB 2FDBP 15C8H 2P26A 3CLEL 5DC2A 1IC0A 5E1AB 1OAXH 3MXWH 4PGBA 4AQ1A 5LJYH 1V54B 1F3DJ 4L0ZA 2EDNA 1MFEL 5HI5C 4H7VA 4XWGH 1RZFL 2AGJL 4GFXA 4PRIA 3IGLA 1QSVA 4DVRH 2XQ0A 1IMHC 2VC2L 4HGWB 3SB3A 3RHWK 5IF0B 4BSWB 1L6XA 4R4BB 2I27N 2CPUA 4ZS7L 1BAFL 3CZUB 4D9LH 3S9DB 1DR9A 3ZIMA 1X4XA 3HHSB 3H0TB 1WG3A 5TQ0L 1CLCA 3C5SA 4HSAC 4F9PA 5D5ME 4RGOH 2ZKHH 2CSPA 1XSIA 1GPOH 4HUXB 1C5DA 2AV1B 2YUVA 1A4KA 5AYUL 2LVCA 3C12A 1F6AA 1CIDA 3ZQXA 1N5YH 1RIHH 2HFEB 1S5IL 5IQLA 3QJTB 3S34L 5D7LE 1VPOL 1E4WL 2ZUQC 2VMEA 5GS1A 4WEMB 2HFTA 1NC2D 1KGJA 3ZTNL 4OQ1A 4RWYH 5F88A 1PG7L 5INDB 3GXFA 5C0AB 4MXQC 1KG0B 3ARVA 5FFLA 3K5RA 2IH1B 4N2IA 5BZDA 2VJ8A 3GZOA 5JHBA 3MCKB 3OB0K 4N0FB 3GSXB 2DIAA 3B1UA 2A3TA 3HBPA 1TITA 5IB4A 5BS0A 3CZGA 1WHPA 2QSCL 1O7VA 2X6UA 5IW3A 5L4JA 3LSOB 5JW4Q 1OWWA 3GRWH 4LSUL 3DTDA 5C09D 4JFFA 1DBMH 2WGXA 5AW7B 3MBXH 4M7JL 5E56A 3ULAB 1A8ZA 3CQPA 1MLCA 5AVSB 5AYUH 2XWCA 1ORQA 1AS6A 3BZFA 1F90H 1E40A 2BXZA 1WFTA 2YZ1A 5AW5B 4WAFA 2BSEA 4DP1X 5FUCC 3RLSA 2XQBL 5LG6A 1IE4A 2R8SH 2V2WB 2VLRB 4ZG1A 3L4WA 1W16A 4MX7A 2W0FA 2ZCKL 3L4UA 1CFVH 2FX9H 3RBSA 1PIGA 4V2CB 4WJ5B 1EX0A 4NC0B 2HKHH 4TNWK 2BW5A 2XZAL 3ZT7A 1B0WA 5JHLA 1J8SA 1G9MC 3ZPDA 3FSZA 3J07A 3BH8A 1ACCA 1AZZC 2O30A 3P2TA 1LILA 4N2CA 3T0EE 1LEGB 3O45B 4FRWA 4G80B 5I66B 1ZGLA 3EFFB 4F3FB 3WCYA 4NM8L 2XV2A 1AD0B 3CZNA 3US0A 4NWUL 2NY3D 2IMNA 4ZYKA 1OCZB 4YDMA 5KVGL 2YD5A 3GUFA 3S37H 3V6BR 4QRFA 2R9HD 3ZKXC 1XD0A 5FUCE 2DJSA 5I73C 1OAUL 4TTDC 2P5ED 2XX1A 4PJ9C 2QL1A 1VIWA 3I2CH 2GJ6D 3RWEB 3RWHA 5GS1B 5DD6B 2COVD 4XVUD 1EVUA 1Z3GL 4Y0GA 5I1HH 5L4FA 1G0DA 1A7PH 1TG8A 1S7TA 1CFVL 5SV4A 1JZJA 5LAPA 2IADA 3N0PB 1FFTB 3L5WA 3B2MA 4D9LL 1XAKA 5ACMA 2CLVB 3BO8A 4WCYL 4PSPA 3C8KA 2Z9TA 2X4QA 4L3CB 4P3DA 4KXZH 4P2OC 1QBML 2X9WA 1I7ZB 2FNWA 4LSSL 5LGKA 5TK4A 4FTVE 1ZLVK 3WXWL 4U1GB 3LPGA 1EHXA 4ODHH 1TQSA 4GBXB 4P46C 3ARFB 1RPQA 3HFML 1U8CB 3ZKSD 3LX9A 2AK4D 2HFGL 5ID0B 2JIXB 4L48A 1UM6H 2WKGA 2AJ3B 2RBLA 5DWPA 2YBRB 3DV4A 3S35L 2CCVA 4ZXBB 5T5FH 2AXHA 4NJ9H 4BQCA 1TNNA 2A9CA 4YFDB 4YGAB 1KJVB 1A8JH 2QZQA 5IJBC 3GI8H 3TM6A 2ZXQA 2WBJC 3ULSB 5F7HA 4YXLL 1KYOJ 4NBYB 5DO2C 4JNXA 3GXMA 5KSVB 3UZVB 2D7QA 1QHPA 4XNMB 4LSTL 3GT6A 5DFVC 1DQTA 4S1SL 3RY6A 5KUKA 4L3EB 4MJHA 3ML8A 2FWOB 2CRZA 4ZUVA 3N43B 5AVZB 3I3BA 5LNEA 4G7RB 5CEZH 3EF7A 2VSKB 2DMGA 2AK4B 3CSYA 2IDCA 3QI9B 1JUFA 2W9EH 1N5YL 2YA0A 5K5YA 3X12B 3OMAB 4HDIB 2CLRB 4Z7VE 3VFUA 4HWEH 3BAJA 2H26A 1JYNA 1ZIBA 1NPUA 2OMUA 4KXZI 4LLWA 3QRFM 3P9MA 1SOSA 3PDOA 1D5ZA 4UDUB 3HAEG 4RZKA 4HJJH 4AQ8C 4WW2B 2GK0B 2VMDA 3WU1A 4K94C 4DUWA 4TF4A 2F58H 4JFUA 2BX5A 4U3SA 2WUCH 5ISZD 1Y6KR 1Z5HA 2CBOA 3ZRSA 2WAQA 5DMKB 4LT7A 3V4PB 1UZ6E 2X4RB 4L37A 4I7ZC 4WFGE 2VABA 3HG1B 4GSQA 1KB5L 5HXMA 2XN9B 4MB4A 3AAZB 1JF1B 2C5DC 1Z32X 1IKFH 3GI9H 5LWYH 2NX5B 3SE8H 3MN8A 3FQ1A 1TSHA 3P73B 4UV7H 4PWIA 3VXUD 1X5ZA 1V3MA 2BINA 3I75A 4PJXE 3X1NA 1I4FA 3DECA 3DGGB 3G5YB 2WXHA 3VWKC 3NIGF 2I7OA 4BFOA 3SGKC 5AUMA 3GPSA 5LQBH 3L6FA 4PP2A 1A6PA 1XGUA 3VFPB 1B4JL 4Q2ZA 4MNHA 3V9CA 3MI6A 1DZ0A 3UBXA 2BH0A 1TQCB 5A2IH 3PAZA 4IDJH 3GMRA 5C2UB 1U58A 1A6WH 2IADB 2XVLA 3CX5K 1ZTXL 3A0OA 2JCCA 4U0RB 3MRKA 1FSKC 3G5WA 4IKJA 3UIZA 4Z78A 1KBGH 3VXUB 1F3DH 5F1IB 3WTUA 2QVMA 3FDWA 4ODUA 5EFIA 4X7SL 3A4AA 4F7TB 2OBGA 2Y5QA 3X2QB 3JV6B 3TZVA 2R7EA 4N8VA 2F8XC 1AFVL 4ICWA 2DEXX 4K7FA 1S9XB 5IMLB 1KLFA 2A77L 3LOWA 4HAGA 4R3SA 4YFEA 2J55A 1RUKL 4K0OA 3V0EA 1OCWH 4LSSH 4Y19E 5ID1A 4LKXA 4XN4A 1JGVL 4KBPA 4Q9BA 2OXGA 4XZUA 3QC6X 5D7HA 4PBXA 3F83A 3T65B 3UTTB 4BZYA 1E8ZA 5D4IA 2N4IA 3MKKA 2NDGA 5D2LB 1BQLL 1OVZA 2XYBA 3CE1A 3MYZA 5CKGA 4E9SA 2OSLA 4Y4FB 1YMHA 2D4FA 4KRNA 4UYPA 1O9ZA 1KYAA 3QHZH 1MCHA 3OZ9H 4UM9A 1FJ1B 3LNEA 3OG6B 1J0HA 3LPFA 2V6HA 4D9RD 5CU5A 2VDQL 3Q2NA 3SKJL 5K59E 4OAWA 1IEAA 4LPTA 3O3EA 7FABH 2V9TA 2QELA 3IDMA 3FH7A 4U1MB 1IV8A 4FQCL 2MNWA 5J6HA 4AEIH 4X9YA 2JJWA 1B3JA 3DV6B 4I9WD 4UOZA 5BRZD 3EYQD 3QQ9C 1T1YB 4EN3C 2WXPA 1PDKB 5HJ3B 3MGTA 1QLRA 2BIQA 2LV4A 4Z6AT 2VO5A 5IJKC 4NNXA 1NGXB 1TTAA 1WJ3A 3RDTA 4Y9GA 2FJSA 1M7DA 1LE5A 1FZKA 1JPGA 2Z8WC 3KBEA 4MCYB 2F7QA 1KB3A 2IBZX 4IDLA 2CQVA 3O9WB 2JNZA 2OZNA 1W72L 4QXTA 4X4YA 5GIRB 1QFWM 3INOA 3IDNA 4XMPH 1Y0LB 4QXUH 5ICXA 4W4NA 4HPOL 2UY7B 1HOEA 3LH2L 1SEBB 5DT1L 2B3RA 2P5WA 2F7IA 2HX9A 4GFTB 3RTQB 1CF8L 1R3LB 5D9SA 1KB5B 3PIQA 4ZFZB 4N0YL 5EBWA 3VVWA 2YPLE 1NANH 5KS9A 1SNRA 4N2BA 3E2HC 3QNYB 5J1AA 2VOTA 4TLUA 4NXSA 1XDTT 5BXFA 1YN6A 2VR6A 4Z5RB 4NAMA 4OF5A 3L08A 4AENA 1N64L 1FO0H 3RPKA 3WUZA 3ZDZE 5AD0A 1XH2A 3HJ0A 4LOUC 2BCKA 5F8RC 3ORJA 1CL7H 2JTYA 4L4TE 4W68A 1OO2A 3GQFA 3GB7A 3QK0A 3SGEH 5ID1B 4LEXL 2KDYA 1NMAL 4NO0D 1CE6B 3RWJA 4PJGF 5KYWA 4QRRA 1WICA 2IV9A 4X4XB 3EBIA 3E6HB 4K7PH 5IHLB 3RWCB 5AAMC 3FQ2A 2VXSH 5JMOC 2A9NH 4Q14A 1YEFH 5DHEA 1T7XA 5HHOA 3TX4A 5CCKH 2ICEA 3FHEA 3GHEH 4G43A 4R7NB 1GSMA 2MCMA 4WUUD 1GPOL 5DI8B 1MHEA 2KT6A 3AWGA 4N6RB 3UMNA 2AZUA 3CMOH 3EJQA 3GSWA 2I32A 2WN3A 3TT1L 2AQ2A 3D6GA 1A7NH 4MXQD 4PREB 5IFAH 5I8KL 1BOYA 4OR1A 3GMNB 1FE8L 4BSVB 2QADD 2K45A 2OA9A 3GSVA 3GJEA 3GBNL 4HJEA 4W1TA 2R0KH 3AQDA 1JD9A 1I7RB 3MA7A 4JZOB 5DTFB 3U7AA 4H0IA 5K39B 2VMJA 2EH8H 3VFVB 1A1NA 1I8IA 2R2HB 5TF1L 3QAQA 2LLGA 1T4WA 4XCEA 3LV3B 4V33A 2GW5A 1P4BL 4M43H 4WKZA 5FA4A 3WFCL 4PW4A 1MFCL 5LNDA 1M7XA 3QS3A 15C8L 2EDHA 3CLEH 2DTSA 1BQLH 4KROD 43CAB 4F33A 5DD3H 2G2RB 3L3HB 1PS3A 4UOW1 2WQUA 3VW3L 5CEZE 3LKOB 4QYOA 1NBVH 1ZT1B 4DKAA 4NAQA 4XOCA 4XMTA 1HIMH 5IHZB 5ALBH 1YG9A 4OM1H 5DJ0B 5E2UH 2V0AA 1IBYA 5GGUB 2W92A 1E9QB 3ZHFA 4TVPH 3I6LE 3ATBA 1QTYT 2QMJA 2AXJA 4PJ5E 3SZKC 2BP8B 5GRXG 1BOGA 4D7PA 1CMOA 4WWKC 3PXLA 4M5ZL 4MMYB 3UGEA 1DN0A 2H1PL 4NNPH 5I73B 4GSUA 2ZJSL 5DHXB 4ZW8A 3PP4H 2DH2A 4IBLT 4WHCA 4Z7UF 3ZKXB 1B2YA 5KSAD 3MJ9L 4G70B 2FLMA 4OI8A 1QABA 1FYTA 2X10A 2X2HA 3IGFA 3KHOA 4U6YB 1DQVA 3DDGA 1JFQL 4WUKH 5B8CC 3ULVD 1UD2A 4ES9A 1LLAA 1CGTA 3CIAA 2LLLA 2VXVL 2H0FA 1HINL 4B5EA 3APCA 5JHLL 2XNAB 2ATAA 2JI3A 4HEPA 3Q01A 3ISYA 3WN5B 2C9XA 1JYVA 4PJ5A 1YMHB 3WIHA 1HN1A 2X4OA 4XNQB 4I3SL 5CP7B 3FB5B 3SQRA 3JWNG 5BRZA 5AYQA 1DVZA 1KJ2B 3IGUA 3D34A 1C5BL 5KANG 2AQQA 1IKFL 2BP8A 3GI9L 1H0DB 3N1QC 5LWYL 3OLDA 5C0ND 5J06A 4ISVA 5I6MA 4JFPA 4LVNB 1U8OB 2X88A 1DBJH 4IQHA 3MV7E 1BW8A 1DVTA 5KJ4A 4NERA 3DX6A 5I74B 4DVBA 5DK0B 4K71C 4RCAA 3DIVA 4JVPA 2N1KA 4CMHB 1YY8A 3LN5B 5EFIB 4DEPB 3UXFA 4YHOH 5I17A 5JNYB 3JUYA 1WBXB 2JELL 2G5BA 2B59A 2VDKH 3VFMA 1MCBA 1Z9NA 4GIAA 4BJLA 1T3FB 4Q97A 5IOKA 3OXSB 4EN2A 3L9RB 3QEUA 1IAKB 2CKBH 1S9KC 4P3CL 1I9IH 1R4XA 4NZUH 4UNVA 1YZZA 2FECL 4QJ4B 2AJZA 2YIHA 3KYKL 4XBEL 2VDPB 4KO9A 2BNRA 3D09A 4XR8C 3F12A 3HVDA 4X6BA 1H8SA 2XN9E 3GTVA 4NO0A 1CF1A 3DC0A 4M6OL 3GJEB 4OH2A 3QUXD 3VGDA 5IT2L 5DLML 3IN2A 4KRLB 3BWUC 1BLNB 2PMZA 4NLAA 3VXRB 2G60L 2ATKB 4P2OA 1EEQA 2GYSA 4N1HB 4PRAA 2IXQA 1Z9OA 1W0VA 5AZEL 4DJMA 2W07B 1R3IH 3DJZA 3VTTA 1U8PA 2XZQH 2GABA 2DI9A 2X6CA 1JVLA 2H3KA 1A9EB 3MRJA 3MGTB 1NAKL 1X4YA 3LS5L 3UBFA 3CK0H 1OTTC 3D0VB 3KYOA 4NIYE 1ES0A 2YGVA 1EFXD 5EZOH 1NGZA 2OJ1A 3RAJL 4APXB 1R3HB 5EN2A 3PDOB 4L1LA 4MQTB 1R1CA 4JRXE 5FO2A 3RZCB 4AUUA 5DDHB 5JOPE 4DT2A 3SJVB 2HMIC 4WDIA 2EYTB 4MJ6A 3FU8A 2ZWKA 3GLDA 1I85C 4H2CA 4PJFF 5J57B 4JFHE 5E6YA 3C2AL 4CN6A 5JLZB 4M62L 5T1MA 4P3CH 2Q9OA 4W93A 5BO1L 2IPTH 4PD4J 3F6JA 3FO2B 2AQ1A 2C3VA 2LTQC 1MLBB 3INUL 2UZXA 3LEYH 1L9OA 3SBQA 3HBZA 2XTLA 3CXDL 3EH1A 2VZOA 3NZHL 3GDCA 3BE1H 5ISZB 4ZX4A 4O2FB 3LQMA 1J5OH 1YEDA 4G8EB 2ISDA 2PYEE 4Z77B 4HGMA 1T20A 4KI1A 1RIVL 3BGFC 4WI7A 5ABZA 5JYMA 4R90L 5EDSA 1C08B 5EC1A 3MOAL 4EI6A 3DRQB 1ZLVH 2ERJB 4H25B 1BAWA 1M7DB 1RIUH 3TJHC 3FB8A 1JJUA 4RESB 4JJHA 1FQ9C 3HRZC 3H2WA 5C0GB 4JQIA 3GMOB 4XVTH 1AO7B 1NCCL 5CLWA 2AJZB 4YDLB 1R5WA 3S96B 3TA3D 3GIVA 4I0PD 1QUPA 4XTRC 2VZ3A 4IMLA 1SLUA 4ZQKB 1W6WA 3SDXE 3K46A 2P24A 2K4AA 3DUUB 1QFWI 4LCYB 1U3JA 4M93B 4MLSA 2CJUL 4UTBH 3VXNB 4DIXA 5HYQA 1YEWA 1YN7A 1XH3A 1E6OH 5DXWA 3F7QA 4RFEA 4U0RC 3LJ3A 4U1KB 4KQ3L 4DO5A 5FF6B 1FIEA 5HDQL 4YSTA 3D9AL 1VEPA 1MQ8A 1J10A 1U8PB 4HALA 4QHLB 3AM8A 2OMTB 2W9LA 5C0IB 2PWDA 5JIPA 3RX7A 4TV3A 3MOBL 5L4IA 2BHZA 4WV1B 1AG0A 5DRWB 2IIJA 1JRHL 3GGWA 4J6RH 1S4IA 1JPFB 2P80D 5IOPA 3FTGB 3P2BA 3BRDA 4YBLB 3RVWD 1PU0A 3KPRB 3C5ZC 4Y2OB 5AVQB 1E5UI 4CMMA 2I9LA 2XA3A 4MDIB 4TN9A 2HUEA 3SKOA 3VGBA 1BVNT 1QR1B 5B4MD 4HIIA 4J1UB 3OGCA 4G80A 3FB5A 4F37K 4NZUL 5LLIC 3BSHA 4PRHA 4H5SA 1TVBA 3EBAA 4HS8H 4RQQA 2VLRE 3KH4A 1E8WA 2QSQA 3W0WD 1MIEH 2NLJB 1JZ2A 2EJ1A 2J44A 3W5NA 1FVDA 3SDDA 4P59H 2BSSA 3VE0B 3QDGA 2ATPB 3W9DB 2BSRB 2DLFH 2AAAA 4Y2DB 4Z3IA 5JORB 5BV7L 2CHWA 2VITA 3MQIA 4EF3A 1A3RL 3TBVA 1K6QL 4FZEH 3ARGB 1G7HA 4PHZA 3VCLB 1VFOA 2QQKH 3O3UN 2X4SA 1HSBA 1ACZA 3RWFB 3TL5A 3BP7B 4Z7QE 1L9RA 5T1DH 5I17B 1RUPL 2J4WH 3AREA 3QUYC 5B1CA 3H9SA 4R90H 1NCAL 3RWDB 4X6DB 2CMRL 3OGOE 4MJIE 2J6WA 1MJ7L 3BPNC 4EZJA 1YLBB 4CADA 3EADA 2KS0A 2UX7A 3WEMA 2CUMA 5M94B 3OG4B 3DGGA 3G5YA 4DZ8B 1F11A 3ESPA 1WWBX 4GS7B 1T66C 3MLXH 3ATEA 1MFDL 3GMMB 2FWOA 3RDTB 1LO3L 3ME0A 4JRLA 4XPFL 1RI8A 1IEBA 2CDEB 3GD1C 1DCLA 4IIQB 2N1TE 5D7LD 3MBEB 1NBCA 2PXYD 2GHWB 3KEHA 1CYGA 3MKGA 4ZMOA 4L29B 5HYFA 1MJUL 3NZ8A 2UY6B 4G3YL 2JKXA 5KVEE 2WLLB 2V7NB 2XIBA 4FG6C 1HHJB 1I1FA 1QI5A 1XGTB 3OKMA 4Y4HD 3TBVB 4GAJH 5BCAA 4F2FA 3IPBA 1R17A 1YNTA 2X41A 3H9YA 1N7MH 4BA0A 1OAZL 3ARFA 5FB8B 3VXMD 1UKTA 4EQ2A 2ARJA 2D7OA 3B9DA 1PKOA 3U9WA 3HN5A 5BZXA 4PGJA 3BN3B 3KM1A 2XU9A 2RIKA 3C5SB 4ZAKB 2HFFA 4XC3H 4CC4A 3HB3C 3ZE2B 1GGBL 3UYPA 1ZXKA 3AW5A 3CN2A 5ECJE 4Z0BH 4MMYA 4ANUA 3DRQA 1GYVA 1PNCA 1AHKA 1P7QA 6FABH 3B34A 3QNFA 4D0DA 1H15B 2G4EA 1T2QH 2NY2B 2X9YA 4WY7H 4QY8A 3KBFA 4KFZC 4JPSA 3TFKC 1O7DC 3TJPA 4ZX6A 4HPOH 2PWEA 3H3BC 3LEVL 5DFTA 3QG6A 4FXGA 1P4LA 1UT2A 4NRZA 3ELAT 3QPQC 4PR5B 1MVUB 4OIIH 5J11B 1NGQL 3UPAA 4BH7B 1G43A 3E38A 2I25N 3P30H 3WNKA 2Q7YB 4ANXA 3EH4B 4WUUB 4U1KA 2CXKA 3UYOD 1MNUL 1EO7A 1WA1X 5KVDE 1AZRA 4W6WB 3KPPA 1AGDB 4LRNH 4HS3A 1U58B 4KX7A 1A5FH 4YEFA 4ZMNA 5M95B 5DUPH 1JV5B 4V1DB 4EDWH 3NVQA 3REVB 4PJIF 1DQJA 1MWAH 1KPRB 3D7PA 1SOQA 3MLYH 1EZUA 4GKOA 5FKPB 4NGHL 4KDTA 5E9DD 1CLVA 3BAKA 1RJLB 1LVEA 2VLRA 4JO2H 5H2BA 2WINB 1OCRB 4X6CA 4LFHD 3OKNB 4XMLL 1BM3H 1N18A 1N8ZB 1UC6A 2WLIB 1MJJB 1NEZA 3WV0A 5DFAA 2R0LH 5KVFH 3OLIA 2DIBA 1X44A 3F64A 5DD5H 1T20B 5DFVD 1EGJL 5ICXB 3X3FL 4N9GA 4UU9A 2ZXBA 1CLOL 4NJ9L 5MI0C 3S88H 3K4ZA 2MTPA 2E9WA 1VFMA 4PV8A 2O5YL 3UJTH 2C3HA 4N90D 3ZQ9A 1AE6H 2J1XA 2CE6A 4JDEA 5I5MA 4NO0B 2P7TB 5DS1A 5TK2A 2B0SL 4HKXB 1LD9B 1YUKB 2PUQT 4P2AA 4AQ8A 2DM7A 1OY3B 4LL1A 3P4LA 1N0LA 1YEEH 1FO0L 2Y5EA 1XF2B 3MRRB 1JWUB 1VA9A 5CSGA 1YCSA 3U6XA 3QUHA 4IW4C 1OGPA 3FTZA 2NQDA 2DQUH 4P5TC 4PRHD 1DUYB 5AWNH 3MRBA 2WD0A 3QIBB 5FYJU 3H53A 3HI1A 4YDJB 4HJUA 1UXLA 3IETA 3MLZL 3MPCA 3VSTA 1TQTA 1YMMB 2MSPA 3RBGA 4DN3H 4FNRA 4JHUA 1QYGL 4MXWL 5K9QG 3QG6B 4YDVB 1VJSA 2BW4A 1IBGH 2HN7B 1HQ4B 5KTEH 2A99A 4N8UA 2ZNXA 4PRAB 2A83B 1IC4H 3WKML 4HIIB 4NM8H 1QVOA 3QIBD 4M4PA 4D0DB 1N59B 2LE9A 2A73A 4R4BA 1P7HL 3TBBA 1M56B 2IGFH 3X13B 2R9HC 2XCMC 4UCFA 1ZA6B 1ZLUH 2F08A 4R3SB 3O6KH 1Q72L 2IBZY 4H88L 3QJZA 3VXMA 3KPSD 5LXVA 3UABA 3VAEA 1G7PB 3HS0C 4LDOB 5FW6A 2QFRA 4UV7L 3LQAH 4KY1L 3ZTJG 2WZAA 3U0PB 1XSOA 2XTJB 5CILH 5INCB 4RIRA 1P4BH 4M43L 2MOVA 3VXUA 4PJAF 5C9JB 3ZOAA 5GZOA 2R8SL 1UWEH 1GZHA 3GIZH 4XB8A 1B0GA 1WDAA 4HS6A 4U7KA 4OCNC 2L0DA 2QQLL 4TKWA 4YFLF 3AJ7A 3SKNA 3CQFA 4KRPB 2C1OA 3G5ZA 2SEBB 2ORBH 2ZX8A 3GS7A 3RJDA 2CHZA 4GJTB 4NQXB 2EYRA 3VXOB 3NZ8B 4PS8A 4OFQA 3K72A 5EOTA 2XTJE 3GIVB 2OLDA 3ZR5A 3FT9A 4Q9RH 1KIQB 1ZIAA 3M88A 5EWIL 1A7NL 3GMOA 4U1HB 4HS8L 4FQHB 3ZKND 4O4YL 4HU2A 5EF2A 2NY2C 2N56A 3QWNA 4Y4KA 5ALCH 3SE3C 1LO0L 1LL1A 2DYPD 1VENA 2W9EL 5HY9A 1TU2A 2DBLH 3ECWA 1MUJB 1KBVA 4OLUL 1KLUA 4M7JH 4CW1A 5IHHA 3TZVD 4L8DA 3CZSA 4RGND 3H6AA 3SE9H 3OX8B 1PZBA 2WO2B 4BKLA 3HB3B 4D0CB 1J8KA 5HDBF 4WI9A 5I0ZA 2DWYA 5DD0H 4AYGA 3HAEA 1BDYA 3VG0L 5EBMA 1A7OH 1BWWA 4MD0B 1I7TA 3HNTL 3OKKA 3UGUA 2JELH 1MWAB 3OAZH 5FYLE 4OGXL 4K8RC 4K7PX 2EDYA 5D72L 1J87A 2P4AB 3Q9QA 3IJSB 3ULUC 3BP4A 3B83A 2XICA 5FGCE 5G4OA 3SJVA 5D6DA 4C59B 2R69H 1P6FA 4NKIH 5MENE 1NWOA 3BDBA 4PP1D 5J9PA 1UG9A 3TJHD 4ZSOA 1L0YA 4YHKL 5GRYA 1QLFB 1G7LA 3C09C 2B39A 4BFEA 2OXHA 4I0CC 5I1AB 4HKXA 1J5OL 3WTXA 1AANA 1ZK5A 1RZFH 4PH8A 3KPRA 4GXUN 4WEEA 3X17A 3S37X 2RFXB 3AXLA 4HJTA 5BS0B 1RV6X 3OXRA 4XNMA 3U4EB 4ZT1A 1CDUA 4MD0A 3T4YA 3H9SB 1DN2A 1F18A 4JDTL 1OALA 4G7VL 1HILA 1S78D 1U6AL 2V3EA 5F7EL 4FQLL 3RU8L 1A6VH 5BRZE 1BJ1J 5C8JA 3TVMD 1E4JA 3ZO0A 1C8PA 3NFPB 4JKPL 4MNQE 3B8SA 1A14L 4L0PB 2Q87A 2NT0A 3Q8CA 4F1ZA 4RFOH 1N6QL 1BREA 1XTLA 1C5DB 2AV1A 5JPMA 5D1ZC 5IW6A 4KAQH 1C8QA 1H3WM 3IJ7A 3MRCA 1YEKL 3KWTA 1KYDA 2XOTA 1MHCA 2GUYA 3CZFB 3LNGA 3MACL 2J72A 5GGSA 5I9QB 5KSAC 1G0XA 2JJVA 3H0TA 4P4KB 4Q56A 2IVFC 1J1PH 5BVPH 2P3YA 5F44A 1CLYH 3VXSA 3V9EA 2DLTA 1C9SA 4F9LA 3TWYA 4NQDA 4POYA 1YQVL 3TYFB 4ZMAT 2Q6WB 1BFOA 4EVNB 4IU2A 1UXSB 3K80A 1A25A 3L1EA 3TO4D 1BECA 3NEEA 3N42F 4OUUA 4AG4L 2GJJA 4ALAC 2HAZA 2UWEE 2ZF9A 4LLVA 1XF4A 1OP9A 3HKZA 4JUSA 2IG2L 1PYWB 1L0XA 3HC2A 3VG9C 3QQNA 3BQUD 3CSGA 3F85A 2Y36L 4Y9EA 5E5UB 3V2AR 2DKUA 2BWDA 2MPAL 3O6FA 1AQHA 2UXVA 3L5XL 2EH7L 4APQB 2CPCA 3KDPB 2VJ0A 5EUKB 1MXGA 2GFBA 5KZCD 2LW3A 2ED9A 3WN5A 3T0ED 4BDVB 5DURD 3SYPA 1OXYA 5E4EB 3ZZLA 2HVJA 5GQBA 4UTCA 2ERJC 2YXWA 1I1FB 3OKMB 2BVEA 4RSYA 2H6UA 3ARBD 4QLRA 4LCCC 5F3HB 2Z34A 4TNVK 1SBSH 4K55A 4LP5A 3HZVA 4IOFD 1KYOK 1E8XA 1GAFL 1GKEA 1RIHL 3WUWA 3VMPA 3T2QA 3QXAA 1T22A 5ANMB 5ICZB 3PU7A 3MBWA 2Y7NA 3QHFL 5AKTA 1FL6B 4CC1A 5F1SA 4H8QA 4YHPA 3VSQA 2MOQA 4M6NH 4MCYA 1XWVA 4Z7UB 3BEWA 5EA0H 2F68X 1KCUL 2BWIA 2BNRB 2VM3A 1E28B 2EH7H 5ENWA 1FNFA 2QPSA 2WB1A 3L7EA 5DUBB 1U4EA 3D0LA 1J0JA 3AXIA 1NFIB 3S98A 5TDNA 4F1SA 3GXPA 4H8WC 1AXTL 2GY7B 5CEZD 2YO3A 3MTRA 1E4XI 1UM4L 5HGDA 3ILDA 1MCPL 5IP4A 3GLEA 1VGEL 3HZVB 4HIXL 4N24A 4YN3A 5F0LB 3WXVL 5HGHA 4YH6A 1FJ1A 1XH0A 2F6AA 2YBGA 4PRHE 3EJZC 4YHZL 2VXVH 3PGCB 4OZ4A 1PZ5B 2A6DA 3CSPA 3L5IA 4JFOB 4HPYL 4LCUA 4PJGA 2IWGA 5EUOB 2HMID 5CM1A 2CR6A 3T3PF 2V17H 3N50A 4AGOA 1QR1A 2J2ZB 4M1DH 1RK1A 2WUBL 4BUGA 3GHBL 3ZU8A 4BRVA 2J6EL 1D9KD 1XBDA 4P8QA 3ROOA 2BNUB 2PW1B 2XN9A 3PJSB 4A6YL 2YMTA 5FYJD 1YNTF 4AMKL 3I6GB 1CT8A 4FQCH 1J8RA 3PFUA 4MJ5B 2HT2C 1P4LB 1VFBA 2VLRD 1KCSL 4G1EA 1J18A 3W82A 5BZDB 1EIBA 4U6XB 1NPJA 2MCPH 4WI3A 1U8QA 5K1JA 3MRPB 3FPYA 4MS8D 4P48A 3SGDI 4JE0A 5DJXA 3IRZA 3HKFA 4QRRB 3CFBA 4LCWE 3FOLA 1A0QH 3ZMRA 4X9FA 4Z7QF 1LJMA 4AXWB 4EVNA 5L7XH 1LE9A 3BSZA 2A6KA 3P0YH 1QRNA 1MFCH 3MV9E 2FEJA 5HDBE 4AIEA 4GUPB 1DHKA 1XR9B 3D1MC 4WCYH 4Z95L 3UAJC 3NPZB 5TF1H 1FZJA 5I74C 2P8LB 5DGQA 3SE6A 3Q3GA 3T2NL 2CJTA 1IGJB 2XG5B 3FH8A 1YYML 4RRPG 1MJ8L 1OP3H 1TZHB 4QHNB 3L17A 4IJ3B 3L3KA 4X7DC 2AJUH 3P3RA 4JY5L 4Y5XA 4WI0B 4X7TA 3CDGB 4Y1SA 2Y9RT 4TVPD 2M26A 3CFTA 5FYKE 7TAAA 1KT2B 3D69A 5IHUH 2X5PA 2CIIB 3V4PL 1L9TA 4PY8I 4BH8A 3GZQA 2N7BA 1IGCH 4ONHB 2V7NA 4UYQA 1HCFX 5AB1A 3CXHK 5J6GB 4XN2A 5JHAA 4QO1B 4LEXH 2O93L 3LTVA 2NY0C 3QQ3A 2BSBA 4PGEB 5IEHB 4FFYH 3RY6C 1EVTC 1A6WL 2BDNL 4NWTH 4X8CA 3ZIYA 2WQXA 3ZL4L 1U8LA 5GISL 3VGGA 2D7TL 3MZGB 4DO6A 2QLYA 3BZ4A 5T5FL 3G3LA 1JXKA 3S97C 3V4UH 2IDFA 2W60B 3KWXA 3QEQE 2ODIA 5B8CB 4UT7H 2OR8A 1X9RA 1TOXA 2FQEA 2XG5A 1UFUA 2O6EA 2IFFH 1JN6B 5H4YA 4OV5B 1IEAB 1UD4A 4KVCL 2XHNA 1KN2H 4F92B 5FM5O 1YJDC 4PVLA 2X4SB 1AGBA 2Q8AL 5TE4L 2D7MA 5EU7C 1V7NH 2VZ1A 3KPMB 5KJRL 2ATPA 1Q9LA 3RRQA 3BUBA 3HE7D 3HRZA 3ZVVA 2WUCL 1CGSL 1MRFH 3DHUA 1ZT1A 4WWID 5ANME 5E8OA 5EZIH 3BZDA 3CHPA 3MRNB 3MGOA 3BZEB 2BDNH 4NWTL 4PJHB 3EOTL 5HDLA 2UUDH 4H5SB 4X8JB 5MEPA 4U31A 2BNQB 2DWEB 4H1LA 1EZSA 2BPBA 2FYYA 1JHLL 2MNUA 2BOCB 1JE6A 1TTRA 3S37L 2AJ3A 1O9WA 6PAZA 4MDIA 3ECQA 4P2QE 3KL3A 1DQKA 5FK9B 1RK1B 4QXVA 4GQZA 3KLSA 4X8GA 4J3UA 4DPRA 3S4SB 3PGDA 3HE7B 4U6HA 1IQWH 3LMJH 5JXEC 3VQMA 3MBEC 4Q0XH 1HWHB 2FQDA 4NO2B 4KQ0A 5BUAA 3B9KC 2K7PA 4JL1A 4KKCC 1MRCL 1A3LH 1CO1A 1I3RA 2NMSA 4GBXD 2NZ9D 4B7LA 1LK3L 2G5BB 3M6DA 4FYRA 4KKPA 4XPBL 3GSNA 3MNZB 4MMZC 4PRNA 5B1JC 4KZDL 3EO0A 3U79A 3UPRB 3OZ9L 1M3JA 1YNKH 4KO5A 4C57C 1XGUB 3SOTA 2BWQA 2YA1A 4I1PA 3HZMA 2FL5A 2H2SD 1BJ8A 3HCVA 1F6LL 1A0QL 4LRIC 2PKDA 3N3EA 4PV9B 5LBGA 4GO6B 5HVGB 1JPGB 4AM0B 1HH6B 1U8OA 3EGDA 3L45A 1BWMA 4AZ8B 3LB6C 4H0LC 3SDDC 2W0KA 1SDDA 2DQJL 4LDCA 4XO9A 3K0WA 3LZFL 4BFKA 5IVXF 3C6SB 3L3JA 3I02A 3MCKA 2HT3D 2QEJA 2JF1A 4GG6F 2KI6A 2W0LA 4PJAB 5H37A 2F74A 2HX8A 3IFPB 3L16A 2WC7A 4X50A 2PCPB 4HOZA 4EIZC 1TXKA 1S9VB 2B5IB 4DK3A 4DETA 3O6ML 3ZTEA 3QVAA 4PS4L 5IBLC 3ETTA 3TIEB 5KVDH 4XPBH 3U4BH 2Y3NA 5BXFB 3ZSSA 4XP9L 2H41A 3WTSA 1CZ8L 2K8MA 1NFDA 2WTOA 1J8HA 4NJAL 4R4FL 3SPVB 3UBHA 4LGSB 4LQFH 3C5ZB 5B3JF 3H9HB 3ARGD 3RTQC 4YBLC 1IQWL 4ZUWA 2D0HA 4FFZH 5HP5A 4GG6B 2ZSWB 1E4KA 3VI3E 2HT2D 5BQ7A 3GDBA 1IT9H 1XB6A 1JZ5A 1J0KA 1PTZA 5JTWA 3QUMH 3RJQB 5D2NC 3NJXA 5IWLA 1Y1UA 3BHBB 1IUZA 1SHMA 5I1LB 5B38G 5D1XB 3ESNA 3EYUL 1BZ9A 3QORC 1BG1A 1UA6L 1JL8A 2NX5D 3T9WA 5DJ0A 1RZ7L 4FFVD 1XFPA 2OTWB 4G42A 4K3JH 4QRTB 2H1XA 4R5VA 3VXSD 1FO0B 1HTYA 1KLGA 2ZCKH 1RUQL 3FT4A 5GZOC 5G5DB 3BVXA 4OZGB 3HR5B 2X4PB 5C6WH 3KNBA 4N9GB 2V8LA 5HPMB 2ETWA 4B6ZA 5CNHA 3GSQB 4OV6F 1QTPA 5HYEA 3MMEA 3ZL1A 1WWWX 4YSRA 3T6VA 1F45A 4JFYA 1MCOH 4MNHB 1KCWA 5IR1B 4NO2A 1H3PH 1T2QL 5DEGB 1E4KC 2R69A 4FCHA 3T1WA 4JHBA 4MCZA 3ZMNA 1UXMA 1UQSA 1ZD6A 2I85A 4YDZA 2WZPA 4WU5B 5LBVA 5C6TH 2VDLB 3R8BB 4JPQA 1T89C 1IM3B 5GRJH 4AIZB 3QORA 4PTUB 2EVJA 2P8PA 2VE6A 2PR4L 5HHOE 12E8H 2GAZB 2VABB 1BQRA 3HG1A 4JPVH 4PJFB 3K1DA 2VCOA 3RTQD 3UIYA 3FT4B 2DW5A 5DJZA 3IVKA 3QQ4B 4ERSH 1MELA 3HE7A 4U6HB 4D9QE 1XB3A 2G2NA 2R29L 5EU6A 3VD7A 3TGXA 1NFIA 1KC5L 1SMAA 2RH0A 3RPIB 3QB7C 2DWDB 4J3OF 1IAMA 1H5BA 4FQLH 1J11A 2R4SL 5AW0B 1A3QA 3ILPA 4UANA 4P46D 1KXTA 2ZOLA 1AZUA 5M7QA 4RSVA 5I1EH 2PW1A 3GJFB 4XOAA 2F8IA 4R9HA 3WFCH 1DSFH 2IAMD 1V3LA 4B5ZA 4XX1G 2J25A 2OMXB 4JO4H 3QJHA 2YRBA 2OMYA 1CG9A 2EXWD 3L2NA 4LASL 4UAOC 1JDAA 2EIZA 2X4OB 4ZBJA 1AGCA 1KBKA 4JZNB 2HXAA 1CLYL 4GO9A 5LHDA 3KW7A 4NKDB 5DUML 1X5JA 5C0CD 4OGQC 3EOAA 2YN5A 3KBPA 2WIMA 3ZE1B 3FTSA 3L3IA 1CUOA 3KLLA 5AW2B 3BKJH 5BQDA 3WIFA 3LKRB 3AB0C 2A4CA 3UZVA 1JF1A 1OAXL 3MXWL 3ALWA 1K4DB 2JJTC 1RY7B 1S9VA 2DH3A 4AUJA 3HFFA 4LLMA 1TJGH 4UB0H 1DFBH 4MAYA 3VMNA 1NFDF 4TTGA 4HA1A 1KTBA 1FDLH 1HWGB 4J3WA 2NRDA 3TJEH 5KS9E 3QRLA 3QCVL 5D7KE 5C0CB 3IGKA 3B2UC 3GMMA 2CUIA 4HEPG 3RL2A 2GK0A 4N2EA 4Y5YA 1CQKA 5L2KA 2J1KA 1FBIL 5AAMA 2IH1A 3ZO9A 2EE0A 1FAIH 4E68A 4IKLA 2H0JA 3LRGA 1LQBC 4BH8B 4OSUH 2CDFB 1EQWA 3ABLB 3EO0B 4P57A 3FC8A 3ZMEA 3K72B 5I6NA 1BFOB 5KYUB 4FHBD 3ZYOA 2NYZA 1RERA 3FBQA 4YHKH 1T03H 3ECBA 4XNYH 5CP3H 5F3HA 3IGAB 4Q6IC 1J8HD 3QFJE 3SKNB 1D5BA 4A2EA 1S3RA 4ZUUB 4Z7NB 2WXNA 4HOMA 5A2FA 3U48A 1XXDC 5MERB 4YOKA 4JO3H 4HCIA 4G6FB 2WBJB 1ZHLB 4LHUA 2MHAA 3FCGA 5DR5L 4A6YA 3EFOA 4A2FA 1A6AB 4AT6B 2D2CC 4KJYB 4FI7A 5I76A 3ETSA 4PJAA 3T3PB 5DJYB 4W4OA 5B39A 3ARDB 2OCJA 4HIEB 3E0GA 1IKNC 4EE2A 1JZ7A 4KPHH 4P4RB 2OAAA 3EG9B 3FCSA 1PG7H 2D0FA 3K6FA 4N8VB 4D2NA 4DZBA 1ZHKB 2VN7A 5I16A 1E9PB 4XO4A 3TA3C 1CDCA 5F6IB 3O3DA 4JFED 1FDLL 4WTQA 2J8UE 2NR6C 5HHPB 4N86A 1AZNA 1BZ7B 2M1KA 2PPEA 1NUDA 1LDPL 3U4EA 3ZRFC 4B27A 4AJWA 3HZMB 4KDVA 3JTSB 2NY3B 4Z78B 2VW6A 2GIYA 5HHNA 4G7YL 4WENB 5ILTL 1AKJA 1WIPA 4OCSH 2Y7SA 3L13A 2C7FA 2B1OA 4LVEA 4UZGA 2BCMA 4TSCL 4AITA 4PU2A 4IBUA 2BHYA 1ASOA 3PDGA 5ACZB 3W57A 4LEOB 4QRRD 4FEIA 2MJWA 4QRRE 5F8QC 2Y5TB 4UT9A 3CH1B 4MNQD 3QFDA 2OFQA 5FR3A 3DK0A 4P2RD 2Y6SD 4RGOL 5FUOH 2XDHA 4K23L 5T3XL 5IIEB 3VXSE 2J1WA 3BVVA 2Y36H 3LZQA 2YS4A 2IPKB 1GGTA 3G5VA 1KN4L 1RJYB 4ELKA 2BK8A 2NY5H 2XWTA 3B2VL 2O72A 4AQEB 1JP5A 2Y69B 3KXFE 4IRZH 4OJCA 4OLZL 2IAMA 4F8QA 3A23A 3CK0L 2N7AA 4PJXF 4Y4KD 2RA1A 2MEJB 2O26U 5KUMA 4NKQB 5E8OB 4P05A 3J2PA 1O75A 4BKSC 2NZ9C 3N06B 1YYLH 1P2CB 4N2MA 3QH3B 5LAXB 5ITBH 3DETC 2PTUA 1I7UB 4MXVE 4NDMA 3I74A 3PV7A 1SM3L 1SZNA 1MIMH 2ED7A 3MRQB 4PJ8D 1JNNH 3OKDA 4B96A 4A2LA 1X7QB 2H5UA 4BINA 2HWZH 3CBRA 3QJRB 2WUBH 2WXQA 4NXKA 1T0MA 3F2LA 1S7RB 1MY5A 1M4KA 1ZHNA 3GLAA 4YC2B 3I3DA 1CDYA 2X6AA 3QEQD 5F96L 5SX4H 3T6XA 3V0FA 2DY2A 5I5RA 4U1MA 5I1DB 2ZOKB 3JVGA 5EO1A 5F7UA 3DSFL 3U0WH 1ETZB 3U9UA 3L7FA 4A2HA 4BDVA 4IHOB 3TPUA 4LGPB 3IMUA 1EDHA 2DRUA 2ITCA 2DQEL 1DQDL 1PBYA 1J1XH 2IAMC 3MX0B 2VN5A 1DANT 3LCYA 1KWGA 3IFPA 4AIXA 3C8HA 4E41E 1UT1A 4U1JB 4X4KA 1XGYH 3C9NA 4NT6B 3FFCD 4O02H 1F1DA 1RH8A 1NAMA 1BZ9B 3TNMA 1K5NB 2XETA 1KLUB 1MJ7H 3SJVD 5C0CE 5F3BA 3KLQA 4HT1H 3NMEA 1U2YA 2F58L 1A6AA 4LE8A 3WS6C 2I24N 3OKEA 4DOHB 2J8HA 2X6MA 1TZHA 4QHNA 2IH9A 5EUOF 4J4PD 3MU3A 3V4VL 1KUMA 2C7UB 5EBLB 2GBVA 5ILTH 2IANE 5CHNB 5E99L 5I19L 3SYAA 1DLFL 1IT9L 2WZ5A 4IMKA 4JDVA 4MD4B 1B2WL 3QPXL 5GGRA 2DQDL 4GSRA 1IVTA 5TQ2H 3HE6C 5CKAA 2C1OB 4FZ8H 3HZYB 3T3ME 5L9DL 4HJGA 3IF1A 2F54B 3WD5L 2WJ5A 1BHGA 2A9ML 1OAZH 4QAWA 4KPHL 3GMRB 1ZLSL 1F4WH 5F7MC 1QEWB 2ICCA 5JXEA 1MFNA 1GTFA 4AYFA 1OP3K 4ORGA 3OZKA 1LO0H 1KBWA 4HZLA 2F1AA 4PS7A 1MH5B 1EJFA 1USZA 2VL4A 2H1PH 2A4EA 4NNPL 4L4VD 1MAMH 1F11B 1PFOA 1JPST 3FSOA 1YQ2A 3FB7A 2DV6A 4MZIA 2ZTBA 1MFMA 1LO3H 2DJ4A 4G6AC 3UYRH 4LL9A 4I9XA 1E6JL 1OB1A 3AS2A 3D9AH 3AUVA 2R2EB 4ZW3A 2BO0A 2AJUL 1KDJA 3Q6FA 5F70A 3T0EB 3TV8A 4YMPA 1A65A 1V8HA 1AVAA 2G3XA 3E9UA 4U1NA 4PJEA 1PZ5A 2A6DB 5AZ2L 4IOSA 4YS4A 2BVPB 3KXFB 2R83A 3SBPA 4AM0Q 3TTYA 1NCAH 2BIIA 1AKJD 3T0XA 4FNPA 2DMHA 5C92A 3HE6A 2DTMH 4WNQA 3TEUA 3SY0A 1T5XA 3ZBMA 1WYJA 4CSPA 4ZOCA 4FZEL 1J12A 4OLXH 3TFKD 2WLHA 3BFOA 5A6LA 3RVWC 3U2IA 4KRMB 3P9MB 3U9PL 4X5LA 3JV4B 4XCFH 3DIFB 5A40E 4AGPA 2J12B 1G1OA 1MH5A 1TFHA 2IF7A 2OJZH 5JYLA 1TEGA 1T83A 4JKNA 3T0VA 1TU2B 2BNRD 3NPSC 3NTCL 1NC2A 3NZUA 3SQBA 3W0WB 3ZDZF 4JGNA 3P1VA 3UZQB 3SE4A 4FXGB 4NRZB 4IOIA 4A67A 4QO1A 5J11C 3L95A 3WJMA 1I9EA 3HTLX 1U93A 4J3XA 5F7EH 3RU8H 1KXQE 5INDA 3N41F 2FBJL 2FJHA 2G75A 5E9DE 2XYCA 3LRSA 5JDSB 5HYJE 3S5LA 1Q9WA 2F1EA 2JQMA 3SDCC 5HHME 3T2NH 2YXFA 4LL4A 3P4NB 4XHQA 2EYRB 3BWAA 1Q9OA 4PCSA 3GSRB 4C83B 1G84A 4W9KC 1JPEA 1WCQA 4GQPH 2IBGA 3II3A 4HV8A 2R69L 1SEQH 1FYHB 1QFWL 5TE4H 3MO1B 3U9PH 2C7UA 5EBLA 2AANA 2JKNA 3L4VA 2APVA 4KNUA 5EIIG 3O4OC 1V05A 3VXQB 2EXYD 2GJZB 4N2LA 5L4MA 3U7WL 1DE4A 2PO6C 2W60A 4L3EE 4R97B 2ARWA 1OF2B 3FKUS 2VRKA 2PO6A 4HF5H 4JRYA 3U46A 5HHQA 5IFHL 3O2VL 4TUUA 5BRPA 1CPUA 3N9GL 4TUKL 1D6EB 3O6LH 2ENSA 5CGTA 1NM4A 1PZ2A 3NJKA 1SVBA 1GMEA 2LGNA 4I88A 3ULUF 4GP4B 1HXYA 2Q7YA 4OCWH 2QVKA 3SYCA 1Z1WA 4RISL 5GISH 5CIPH 3V5KA 5ADPL 3O41B 4JO8A 3WO3B 3M86A 5JDSA 4CSZA 2OK0H 5DD5L 3HNTH 2EDXA 1UCTA 4OVUA 5I15L 2WQAA 3NBNA 3C6LD 3HUJE 1KCRH 2G0LA 4KX9A 2E6PA 1HQRB 4K73A 2CHNA 1EHLL 2XIDA 3RWCA 1AY1L 4GS7C 4OZHA 2YAPA 1YMMA 3BUDA 5DVKA 1QWUA 3EFFA 3MJ9A 4F3FA 3RUGA 2MIZA 4H20H 4ONFH 5L8KB 1IM9D 1ZLSH 2K78A 4MKTA 3V6FB 4HOWA 4XB7A 1P1VA 2VIRB 5EU4A 1HQ4A 3QUYB 1MHCB 3EOBA 4NOBA 3WD5H 4WEUD 5JXED 2OQJA 2B1HH 1QRND 1OCOB 1WISA 4KJQC 5HGHB 4JM4L 4GLRI 5J1AB 3BQVA 1XIWA 3LZPA 4JFDB 3SCMD 3KPQA 4FG2A 2XBTA 1UJTA 3Q43A 4RZCB 4K3DH 2PNDA 1D5RA 4Y5VB 2QHLA 3GXTA 4MA8H 4UIMA 3RDTD 3V0HA 4BK8A 4GG8A 3RY4A 3V9FA 2UVEA 5B7FA 3AS1A 5DCCA 5IGXH 3PREA 5IQ9B 2FSDA 4GYBA 3H2QA 4MZ3A 3SQOL 4L8DB 1MLCB 4KKNA 3GBML 3VJ6A 5GRVK 3C6SA 3L3JB 5IQ7H 4CILA 3LIZL 5IB3B 3UCRA 2Y25A 3RHWF 1DQMH 1NBZB 3BEWB 1HZLA 3SDDD 1N8ZA 3PQYE 1KB9K 1FZKB 4MAUH 1BX2A 1QO3B 2L8AA 5H94A 5E8DL 2WB7A 4JPIB 1SJHB 4JM2F 4XX5A 3CFMA 4LQFL 3E6FB 1ILUA 3FU0A 3IMBA 3QQDA 5HGBA 5IT2H 1A4JB 3T8XA 1T21B 1IGYB 4K9EC 2BLFA 3O3AB 3QR1A 5AVUB 1BEYH 3QDMB 1FI8C 1FIGL 4ZD3L 1XO8A 2CH8A 2BRRH 2WXIA 4BQ9A 3IEAA 1H3XA 5EEWA 1AS8A 3OMIB 3DVNB 3WDHA 1B0GB 4HS6B 4ANVA 3NIGB 3R0NA 5E94B 4GLRH 2ZJSH 3VE0A 3QARA 5DZLA 2XZCL 3RIFF 2QADB 5DQ9A 1FZMA 3VFNB 1PZSA 1JYXA 4GAJL 4HUUB 4HK3J 4Y2NA 4QKTA 5B7MA 1EBAA 2IQ9L 3WFBL 3UZEC 1L9NA 5AWNL 4P4RA 4GQ9L 5ABAA 1I31A 4BFBD 1G6VK 3G04B 4OIFA 3IJ8A 4Z7UA 1JZIA 3DPDA 4G1MB 3Q1EA 5DVPA 1A1MA 2BP0B 2ENJA 3MV8E 4N0RA 4BFNA 3QCUH 4HZAA 1Z3RA 1SXNA 2APWA 3MLSL 1BYPA 2VSMB 2WMPB 4MRCA 3TT3H 5E8EA 3WTYA 4I8DA 1MFVA 1Z5YD 3JVFC 3BWZA 4NKMA 1C5BH 3PV6B 5FCSH 4IBVA 3HI5H 2JH2A 1UWGH 3CDFA 2ZX6A 3ECBB 4R8WH 1CLZL 1U42A 3U36B 5E94A 3DOSB 1M9WA 1DP0A 1MIEL 1IKNA 3GINA 2Z1PA 2L7EA 3IFOA 1WA2X 1GSKA 2A74B 4P23D 2EH8L 4LCYA 4Z7WE 5HYQB 3KZ8A 1IAIH 4P2QD 4K4KA 5BV7H 4Y9BA 3G5XA 2OMWA 3MLYL 2PTTB 5I28A 1TTCA 1WAAF 3EKCA 3VTMA 1FPTL 4TVSa 2FIKB 3N91A 3RL2B 4UILH 3ATDA 3CXHJ 2IEPA 1S46A 2CO6B 3OVUB 4G7VH 2FJUB 4IIQA 4KC3B 4M00A 4G8FA 3VG0H 3VM7A 3VDAA 3MO1A 3EF4A 4LLQB 3PAVA 1GZQB 4S0TD 3SYOA 3LNFA 4JCMA 2W59A 5DO2D 4XVSH 4D0BA 4WW1B 1HILB 2MKWA 4H4NA 1G1KA 1TTGA 2Z31D 3V6OA 2X2UA 1P7QD 1YJDH 4FQJH 1B4LA 4L4JA 1PZUB 1X3DA 5IHZA 3VD4A 3SGKA 2L7JA 1ZEAH 3KBHE 2CNZA 5DHVH 1U3NA 2C9SA 3B7SA 1U8KA 4HUVA 5ICYA 3RVXC 3QZWG 4UIMB 3BGAA 3CFCH 1B6DA 1J8HE 5GRUH 5GJTL 3GBDA 1YMMD 5I1IL 2IH8A 3Q3GB 1NIFA 3RWDA 4GRLD 1IO4C 2VM9A 2N3JA 1M6OA 1QPKA 1J0IA 1NCCH 4B9YA 1BJMA 2RTTA 5IIEA 3OR7A 1RHHB 5JPMB 1XMWA 3G08A 2FT7A 3SKMB 4CSSA 3ARGA 3VCLA 4RGMC 1D5MA 1YEKH 2XJKA 3SDAB 3MRHB 1EA9C 4P0DA 3ZRCC 3NFNA 3VB9A 4XVUC 3KYOB 4N20A 5B7EA 2R56H 1VEMA 2I7SA 2VAAB 3NQKA 4B9JA 2VQ4A 5IUCA 1MWAA 4GT0A 4GI9A 3CMGA 3VYOA 1OAYL 5DQJA 3R1GH 5DHYB 4YSEA 2NW2B 1BZEA 4HHWA 3REWA 4P49A 1T5WB 3C8DA 5A2BA 5G55A 4GSXA 5DJAA 3AXHA 3JWNE 3RGVB 2P8MB 1QBLH 4ZMLA 5D4JA 2RACA 1UEYA 4LPUA 4LNVA 4AL8H 4RFEB 1X7SA 2B16A 5KTEL 1L6PA 2QDVA 4XMWA 1T89A 1S7WB 5IVOA 1RU9H 5F9DC 2Y7OA 1TYEB 5FKPA 4AEFA 4CVZA 5J0BA 1OAQH 2FIKA 5D2LE 1ZLEA 3Q1SH 3DMMC 3IXAA 3AS0A 4ZTOL 5AW3B 5T1KD 4NUJB 2QQLH 5I1GL 1OT2A 4QJ5B 2VDPL 4F2ME 4G6JH 4Q89A 4YIQA 5CCHE 1Z0MA 3IXTB 5LGHL 1AGDA 1GYUA 4PJBA 4X9GA 2Q10A 1G5GA 2X4QB 4L3CA 3AZUA 4P3DB 3RFZC 3RGVD 3FT3B 3S2CA 4KK6D 1Y18A 1GHFH 2LT9A 2QQQA 3C60A 5JXAL 3A3YB 3WELA 3LVTA 4PJ8B 1E27B 3OPZL 3KM2A 1CD1B 2EVHA 4BKTC 2R0KL 1AR1D 4LOUD 4ZOBA 4WJG3 2B14A 4LVHC 3S3PA 2CO7B 3PV6A 1JPTH 1HDMA 1VACA 2WBKA 4UIKL 3GSNL 3RVUD 1P1ZB 3V0VA 3QORD 4QRPE 3ASNB 1C5CL 1NUFA 3B4NA 3EYOA 3FSWA 4NFCA 4J6RL 2Q86B 5E7BA 4ZYKB 5I71C 2CNYA 4NN6C 3PAUA 4MVBD 4TULH 3SQBB 1IBGL 4FQJL 3HC0A 2PPDA 3EO9L 4NPKA 1JTTA 4OUOA 3DI2B 2CO6A 4YHZH 4QRSB 5HDQH 2E8YA 5JIIA 4M1GH 4IRJC 4K7PL 3WO4C 2F0CA 4TQEL 3LXAA 1LEKB 3VFGH 4S1DC 3S5LG 5J6HB 5ETUB 4NQXA 4YAQB 3ULVE 3WE1A 1URZA 3DA0A 4OLWL 5GJSL 3K6IA 1NKGA 4LHJB 3NH7L 3NUKA 2I69A 1P4UA 1KENL 3BJ91 4YLBA 2P28B 3NFSH 2GUOA 4JFHD 4YEEA 3P02A 3ZUCA 4B97A 4F7CB 5C9JA 2FJGB 4XP1H 1W8NA 4LCCA 3DXAE 1P5UC 2FK9A 5H37G 1WT5A 2QPUA 2XLLA 1TVBB 3ZDZB 3LRLA 3O8XA 4F58H 1BF5A 1SY6L 1M1XB 3FTVA 1PLAA 3QQDB 5DRNB 5DF0A 5HGBB 1E2WA 5E9AA 3QHFH 3T71A 5TDPA 3WFEH 4HBCL 5GHWH 1Z5LA 4L1SA 4PREA 5E95B 4JN2B 2WJ7A 2VO8A 4RNRB 5AKSA 5C6PB 2P48B 2XFXB 1G9NH 3C09B 4DUXA 4CC0A 1M1SA 2VQTA 4O5LH 1BEXA 3JWDH 3QH3A 2E7BA 4NQCB 4XMLH 1AQKH 2EDMA 3V5KB 3JV6A 2VSDA 3UG3A 4PP1C 3C2AH 3JXAA 1SXSA 1XCTB 3AROA 3S8WA 4GG8B 1E5CA 4YWGL 4XWGL 2VAAA 4I3SH 3IDYB 1OGTB 2DI8A 3EDDA 5FYKD 5F96H 3PNWA 4KUCD 2VN3A 3HMWH 4MVBC 3HI1B 3KPRD 2JXMB 3OHXB 5E8NA 4XCEB 2UUDK 3I6SA 3HLAA 1DE4B 1N7ML 2EABA 3CIQA 4LDEB 3SPGA 2A7BA 2NLJA 4AC4A 2OZ4L 4M7KH 4NZJA 3TO4B 3W5MA 1T21A 4G7QB 2VUOA 2BS8A 4BXVA 4NCDA 2N59A 3RI5F 3ZTJH 5EU4B 1WHOA 4I77H 4U1IA 3ZDWA 1IGMH 2JLLA 5TD4A 4ZO8A 4FQ2H 2APBA 3MJ9H 4JFTA 5GGVL 1A6ZB 5HYSG 1GZPA 1VAHA 4GAFB 1KACB 4BK5C 2YOAA 2EIBA 3PYCA 4P5MB 2P80A 1LEIA 3D2UA 5LQBL 3TEYA 5EIQA 2AJVL 2ZG2A 1EDQA 1WS7A 1F86A 2OK0L 2VXTL 3P4OB 1KGXA 3WNNA 4BXSV 3QJFA 1N9PA 4UQ9A 1CXEA 2D3LA 4FFVC 2F1BA 3LHPH 4M6OH 3WIIL 3UTSD 4PW9A 5GGSY 2ENPA 1BQHB 4HKBA 3NN8B 5AL8A 1JERA 3UOAB 3V6ZB 5CGBA 4ZFQA 4QTIH 3P0GB 1NGXA 5DURB 2ED6A 2Y6TE 4ABUA 4HLZH 3DBSA 4MA3B 3HMXA 4PRPA 4JY4A 4MA8L 1M1XA 2KUTA 3Q1SL 4IU3B 4GXUM 5EO1B 3W2DH 2YOCA 3ZDYB 3MRHA 4Z7OB 2EIMB 2ZG1A 5CN1A 5H4ZA 1F4XL 1UOLA 3NJIA 1IGML 5CZXD 5C0RL 2CXGA 1NKRA 1YECH 1ZTXH 1FLTX 5CJXC 5IVXA 1N6VA 3ARED 1QASA 2LU3A 3MRLA 2Q7AA 1FIGH 4F7CA 4ZD3H 2JKJA 5B39G 4NYLB 5T3XH 4GEIA 5GSVA 4FQXC 4Y5XC 2W07A 2EO9A 1SFDA 4XODA 5EB9A 2J20A 3IKCB 4Y4FC 5E2TH 3AADB 1NFKA 2I26N 2BY1A 4IKNA 1E4XH 1IZKA 2QJDA 1Y0LA 2H6PB 4LARH 5CJBA 5I8CA 2F7PA 4URTB 3ULSA 5I2IA 4Q52A 3EO1B 2FR4A 3QBTB 2HUHA 2YJQA 3SOBH 5MP6L 3HVNA 4ZOEA 3HZKA 4BZ1A 3H42L 4H44C 4XT1C 3K4AA 3I9PA 5JHDE 2FX7H 3F58H 5DHDA 4ZUTA 5KAQG 1QUNA 5FA3A 1T1XB 2FQFA 1MCEA 3HOGA 1UH3A 4LU5L 3V0VB 5AW8B 4ELMA 1IEHA 1RZKC 4OBRA 3EOYG 4AZUA 2WY3B 2RQEA 2QLVB 2FX9L 1FV1B 2H2SC 3O6LL 4XPHH 1F8TH 3QIUD 1F5WA 4PJ8A 2QKIB 3VD5A 4PS3A 1S7VB 1WFNA 2DWXA 2FH8A 3KR3L 4MJIA 1I7RA 1D6VL 1E2ZA 2G3ZA 4FA7B 1H8LA 3ARTA 2NXYB 4KMTL 1H3GA 1S9WA 4XN7A 4X5XB 4HCRA 2XG4B 2WVTA 3PP3K 1I8MA 4Y4HC 3HLKA 1L5GB 3WEXA 4HKJB 1E4HA 5K9JH 5LN4A 4GSDL 4K5LA 3V6ZA 2K70A 3U0TB 1JZ3A 2VDNB 1BQHA 3C08H 3PY9A 2A4ZA 2IXQB 1IGIH 5BZWB 1QFUH 4BA8A 4GI6A 5T3ZD 3FF7A 4IK7A 5HHXH 2Y2YA 2ZOTA 3GMNA 1NWPA 3B5GA 3T6ZA 1JD7A 2P5EB 5TGBA 4G1MA 3GKWL 4PB0L 3OKLA 2CIKB 4XXDA 4LCIH 4EUPH 5DI8A 4WUUE 5KBDA 3UTSE 3S6CA 1NMBH 3BZ5A 4CN4A 1KTDB 2HN7A 4AT6A 3MGOB 3WJLA 1HNYA 4JG1H 4N1EA 4GXVL 3QYCA 2AQ3A 2HA1A 1E9OB 3VD2A 3O3BA 1UHVA 3DX8A 4A04A 3TXAA 1OM9A 3SDDB 3IGAA 1TQWA 1WWCA 5EF3A 4H1LH 3MUGA 3GB7B 1ECZA 1T80A 1UADC 4HFUH 1NAKH 4JZJC 1K8IA 1DN0B 1YY8B 1M6OB 3S96A 2JV6A 1NCWH 1FH5L 5CJQL 3OGCB 5IFAL 4P23B 3HS9A 4L05A 1J86A 3PS6A 1JHKL 4Z7WB 1X5HA 2W94A 1MFUA 1SXZA 1EAQA 3H9ZA 1P7BA 3J8F7 2XWBB 4G6AD 4Y5YB 4YE0A 4ONFL 4RMSA 2A9DA 1D5IH 4K3HA 5CCKL 5J4MA 1KULA 2N01B 3IS1X 2O6FA 2P45B 1R3JB 3D50A 2EDEA 1KJ2A 2DYPB 5LNGA 4NN7C 4PFEA 2YSSA 3BWUF 4G72B 3TEWA 1CVSC