4C4BA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v in the reduced form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
MELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 26
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4c4bA00
1DFXA 1VZGA 2AMUA 4C4BA 3QZBA 4BFJA 4D7PA 2HVBA 4BGLA 4BV1A 1DO6A 1VZIA 4BK8A 1DQIA 4BFFA 1DQKA 4BFKA 4C4UA 1VZHA 2JI1A 2JI2A 4BRVA 1Y07A 2JI3A 4BRJA
chains in the Genus database with same CATH superfamily
2JCCF 3WL9B 2HPOA 1GKEA 1RSFA 3AGWA 4OFYD 1NC2D 4I1RA 5EA0L 2H9GA 5HI3D 4E0RB 3J2PA 2J20A 4JANA 4PWHA 2XQBL 2BC4A 3KWWB 4HOMA 5EWIL 2L8AA 2OX5B 2UX6A 3ZE0B 3WTUA 2DBJA 1A7PL 2CA4A 4WFED 5D5MA 2GHZA 1TVBA 5HGAB 1LD9B 4F1SA 4KX8A 3RU8H 4EZMA 2J5LB 2O5NA 3IJEA 4PLOB 5CZVH 5E6IB 3MUGA 1LMKA 4JAMB 4YMPA 2CRIA 1EEQA 3VWKA 1AHMA 5DS1A 3NEXA 2X1QA 1FVEB 3MJ6A 1MJ7H 3RWFA 3SPIA 1UQSA 4YSTA 3MLXL 1QATA 4NDMB 1CFBA 9CGTA 4W6WB 2X3AA 4PJBB 2X6UA 4MXWL 2AK4D 3S4SB 3BZ4A 5ACZA 3QNXA 2QVMA 3X1GA 1P7QB 4EI0A 5E9AA 4L8CA 1IBGH 3U1PA 1ZIBA 3P4NB 4B9ZA 4HLZH 3RGVA 4M48L 3A6BH 2VLJD 3DTDA 3GGWB 4HT1L 3ECWA 1IUZA 4JE4B 5LAPA 4M5YH 4DUWA 5I23A 1I1CA 3U4KA 4PRHA 4WCYH 3LKPA 4MJ2A 2CBMA 3RP1A 3QC6X 5L7XH 2O6PA 3HG1E 2OW7A 5DJAA 3STZB 5FB8A 1R6VA 1T2JA 1WDAA 1MI5E 4K7PH 1UWEH 3IWVA 3AXLB 3ZRCC 2GAZB 1A4KA 4NZUH 4DP4X 1Y6MR 3WGUB 4AG4L 3M07A 2XWBA 3MBED 2W1NA 4CILA 4TUJA 4DN4H 2VXTH 1BQLL 1HCYA 2GPZA 3QDMB 3Q8AA 1CGTA 3VRIA 4AMKL 1U9KA 5KVDL 3PGCA 4NC0B 4LIQE 4QRRA 2A6DA 1VEPA 3PWJB 4M00A 1EBAA 1QR1B 4JHZA 3FRUA 2K78A 5DLLA 4WUKH 3IN0A 1HYSD 4FFZA 4JFVA 3NZHH 3T0ED 4MAZA 2I7OA 1ZWIA 3NJXA 3FRPG 5D4JA 3IFLL 1ACXA 4PTTA 1OSYA 5IB4A 1KYUA 3MRCA 4MX7A 1HK6A 2PYED 2WZ6A 3ARGB 4PGDA 4OLWL 3NCYS 5DD1L 3TA3D 5HHXL 5AW3B 1F8TL 1FWXA 2CGYA 2DQFB 2J73A 1RZ8B 2VDOH 3PU7A 5LNEA 1LILA 3JT0A 2X70A 2CR0A 4QHKJ 1WHOA 1XAUA 4OLEA 3TN0B 4FX5A 3SY0A 2FWUA 4Y2OA 4MNQA 5TTRA 1XL4A 2C1OB 4KMTH 1IGCH 4Q8BA 4PS8A 1BXVA 3OJDA 4BA0A 1K2DB 1J8HE 2MHAB 3Q3GA 1S7TB 5EA0H 1R24B 4N2LA 4XAWH 1KB5B 1XGTB 3U46A 4RMRA 2XQBH 4N9GA 4M9OA 5ITFA 5EWIH 5FV1L 3K4ZA 3V4VL 4QHNB 1EV2E 1A7PH 5HDBE 4ZPTA 3T9WA 3I9GL 5C6TL 3RZCD 4OSUH 4HVBA 4ATTA 1VADB 1ZT1A 1EJOL 5FW7A 4YDVB 3EH5B 1RMFL 5T3ZD 3TCTA 4Q97A 4H8WC 5K1VA 4JY4B 4A66A 5F7UA 4J3WA 1KTRL 3E6FB 3FFCE 1PZCA 4PM1A 1N8ZB 3CFDB 3QCUH 3RFZC 2BNRA 2WBKA 2OR7A 1I85A 4XBMA 4HA1A 4W9DC 3MRBA 3NVQA 2NY4B 1E4HA 4L4VE 2MEJB 1FYTB 1S4IA 3KPQB 4PQXA 1RUAH 4M48H 4HT1H 2CK0L 3H0TA 3BP4B 4YPJA 1DVYA 4DGVH 4OZFB 5FFLA 5EUOF 1NFKA 4G8GB 3QC5X 4HH8A 5HHMB 3WUWA 5CGMA 2VO5A 1DBKL 1OSZA 3QIWA 2WVVB 4IK6A 1G9MC 1KWKA 4B96A 1OWWA 3JT2A 2DQHH 4MS8C 3GIZH 4NPYA 2OJZL 1YJDL 2WWKO 5C0AB 3SBWA 4CL7A 1UZ8A 2DY2A 4ZK8A 1KTCA 5EUOB 5I15L 3BWZA 4KVCL 1E4XI 1R5WB 3ARDC 1KFGA 3ECUA 1ODUA 1JXGA 4AG4H 4PLKC 3IDIB 1E4KC 1U8LB 2CLRA 2JWYA 1Y18A 3H3BC 5BS0E 2V0AA 2ZXWB 1HWHB 2A5UA 3ARVA 1CE6B 4HHGA 2FIKB 3ZX1A 4F2FA 1KLUB 2HN7A 1WBZA 3T8XB 4Z1PA 1W2KT 3KYOB 5LUMA 4G5ZL 4LDEB 5SWSD 4Z7IA 4YHKL 4HGWA 4NT6B 1P7HL 3GSVA 2MCPH 5AAPA 3HAEB 1KT2B 4P46B 5F44A 3NIGF 4PMFA 1OEZW 4ZMAT 3MCKB 3FQUB 4L4TA 4OLWH 5DD1H 5IROC 5HHXH 2BCKA 1F8TH 4YFLF 1R3IL 3UTPD 2ROYA 3VG0H 3AADB 4H0IA 2R23B 4HJUA 3TCLB 2JI3A 5DMYA 2WY3B 2BNQB 5E51A 4HULB 4UT7L 1OCOB 4FFYL 3HCVA 2AAAA 3MRPB 2VERN 4MA3B 4OI8A 1CVRA 3MZGB 4UBDD 3PXLA 3ZPDA 1KCKA 3FOMA 2XN9B 4KKLD 1QI5A 3WG7B 5D1QE 3VJ6B 4AITA 3K72B 3HR5B 3D6GA 3OKEB 2IAAC 2F1BA 1NJ9B 1IO4C 4X9FA 2EYSA 2QLVB 3Q6FA 4FFZL 2YUZA 4KO7A 3EO0A 4KHTH 2QPEB 4TSBL 3NH7H 4J3BA 4I2XB 1WGOA 5CJQH 2ZYHA 3V4VH 2AJYL 2VAAA 1EAPA 2WXKA 4ODSL 3THML 3NJLA 4YSEA 5KW9L 4WJ5A 1ETZA 2CLVA 3LKNA 3L5XH 4YIQB 4FQ2H 3Q1SL 4JE0A 4K8RL 1XF2B 1G4RA 1JCVA 1KCRH 4NRYA 3BIAX 4K5MA 3ABZA 3MV9E 4P3WA 2I07A 4Q6IA 2X7LB 2XTJD 3N2JA 2AK1L 2ISDA 4D0DA 5AZ2L 1IEBA 1ZSDB 2FT6A 4I48B 2QDWA 5J1AA 5IW6B 2XBTA 1T7ZA 1ED3A 3NJVA 2YA2A 3ZTCC 5LXGL 1LO3L 1ZVHA 1IU1A 1JZJA 1XR8A 3DTXA 2NY0D 4YDKL 1CQYA 5I73C 3RRQA 3SE6A 3FQTB 3OR6B 4WI3A 4J6IA 2FX9L 4NO3B 1RHHB 2NRDA 5CBEA 3MV11 2JFCA 4HH9A 2CK0H 2NY3C 4N2HA 1Y1UA 5F7EH 4TUOB 4HKJB 5PCYA 3T0WA 3HPLA 2EIBA 3NYKA 1E9PA 3DGCR 3W9DA 3VFUA 4W9CC 4O2CB 3V0FA 5I8EB 1PJ9A 4U3SB 2E27L 3MFFA 2NTFB 1UVQA 4Y88A 2WWNA 1G7PB 2X6MA 3VRJA 1T03L 4Z8FL 4JKMA 2QPFA 1AGCA 1Q4NX 2BZ7A 3L3IA 4TL5A 5GS2D 5I74B 4AYGA 4HGKC 3X1FA 1A22B 4G43B 2K8QA 3O8XB 2XWRA 2PUQT 4BWWA 3HC2A 4Z18A 2AEPL 1R3HA 3S34L 4IIQB 2XN1A 3UC2A 2G5BB 3FRPB 4P2QE 2EYRB 4FMFA 3UROR 4OUOA 2VYRE 4XMZA 1UZ6F 5I75C 5KSBF 2V17H 5MEQB 1N2RA 3N1PC 2GY7B 1EFXB 2XWCA 4UNVA 2O5XL 2FDBP 3KLAB 3EJCA 1IX2A 5CCGE 1EERB 4ODBD 3RJOA 1OIOA 4LDCA 5C0EB 3CPUA 3HTLX 4D8PA 1H8SA 5GGSY 2PO6D 4WFHE 2FUQA 3C2AH 1KXQE 1FN4A 3IJHB 1B3JA 1SPDA 4P3DB 2BJMH 1LTXA 4FFYH 4KOBA 5LGHH 1IC0A 5DUBB 5GZND 5JPMC 1M7IB 2IFFL 4WV1B 3ZTJH 5TH2B 3L4WA 1YEDB 3NN8B 5EULV 5AVYB 2NQ3A 3V0HA 4Q9QH 2ZOUA 4HWZB 2VERA 3ILEA 2ZXCA 5EPMA 4FQQB 3BKYH 3ULSB 4CADA 4X8JB 4H40A 4OBRA 2R15A 3NPSC 2AQSA 1LEIB 1PD1A 2XRAH 3FCTB 1J5DA 5FYKD 4Z95H 4ODSH 5FF6A 5IOPA 2OMXA 1DFXA 2D9CA 3EOTH 1TETL 4AQEB 5KW9H 1KYOJ 1L5GB 4RGMC 4K8RH 1M7DA 4F9LA 1DQJB 1JF1A 3LHAA 3VXUE 2Z3FA 3NMEA 2WKOA 1IQDA 1P4UA 3GXMA 3O6FB 2OCJA 1RERA 5AZ2H 4M9PA 2BSRA 2F53D 5SX5K 1MJ8L 2CBPA 2YAEA 3QIBA 4Z7VB 5GJSL 4GO6B 2GW5A 1JERA 4PSRA 1L4IA 1S9XA 1AGEB 4AL8H 5LXGH 1FFOB 1KGIA 2VRAA 3A4AA 1LO3H 3P3UA 4IMLA 5EMYA 3ME0A 3OAYK 4JFOB 1HH9A 2QPSA 5FKPB 5I30H 4P2OC 1NWPA 4Z76A 4FFVD 4H0HB 1FFNB 5CZKA 4ZFOB 1LNUB 3P0YL 4LT7A 5D2NB 1CDBA 3BCFA 4O2FB 1WS8A 1VACB 4ETQA 1Z5LA 3EH3B 4L8BA 2BP0B 2XZZA 4FKEA 2VZSA 4URTB 4MAUL 3AZUA 1A2YA 4WFGE 3GK8H 4X6BA 5D96C 4ELMF 2GHWB 4R4BB 1X7SA 3FQ4A 3O4LE 4LEEA 3V5HA 1W0YT 4YDZA 5DO2D 1NSNH 1P5UB 2G9KA 3LDBC 2XG5B 1E9OB 2Z6FA 5F89A 4ELMB 1X5YA 2WAHA 2C7FA 3W1ZA 1EHLH 1UYWH 2NW2B 4YZFF 3VXQB 4H8QA 2KPNA 1DJXA 4X8XA 3NABH 3SDAB 1K6QH 2AEPH 4GSUA 3S34H 4PJGE 1WFJA 4PLJD 3ZKXB 4FQXD 3QJUB 4MNGA 1RVFL 3IJYB 5CSBA 4C4KO 4AI7A 1NUGA 4L3EE 4AV0A 3NFPB 3CSYB 1HJBC 3QULA 5D2LB 2WLYA 5ESVB 2YXVA 2O5XH 4NQQA 1SEBB 2IG2L 4MA7H 3T0VA 4A6YB 4L9LC 1L9QA 4OM1H 4GJTB 1CD9B 3VFRA 3KJ4C 1V8HA 4Y7OC 5LWYH 4WJKB 3G6JF 1C5BH 3PDGA 3QORD 3EZ8A 4UNTA 4HS3A 2ED7A 4Q89A 1JD9A 3B9KC 2DQMA 3K6FA 5GGSA 3FB8A 3BGAA 3IM1A 2IFFH 3BAJA 5HYSG 5DHVH 3U7YL 1NGWA 3DX1A 3HZ3A 2BOCB 3BSGA 3G6JB 2LOEA 3LJ3A 4XCCL 4M6ML 1N26A 4U6TA 5F70A 3TZVB 2W94A 5LB1A 3AREB 2DKMA 1NMAL 2B2XH 1JPSL 3BWSA 1PNCA 2BY1A 5C0CD 4LVNC 4XX5A 5AW0B 1S7QB 2MCG1 1CTNA 3ZVVA 1OPGL 3U4AA 3F64A 3NJFA 1GOHA 3HE7A 4FHJA 3CDYA 4YHOL 2WTRA 3KWVA 3ASNB 2WVUA 4HU8A 5EIIB 5AW6B 5T1KD 1LXMA 5CD3A 5D71H 4GIOA 3QE5A 1WZ1H 3KM2A 2IXQA 4TYUA 4GKLA 1NOLA 3NRFA 1G7QA 1PKOA 2GYSA 2QGCA 3X12B 4MYPA 4NJ9L 1HL5A 2HJKA 5MP6H 1U93B 4P5RA 5F0JB 1MJ8H 3C6EA 3EUUA 2C3WA 4QTHA 3RWHA 3MCLL 3VVWA 2WTPA 2N7AA 1XIWC 2VB5A 4RWYL 2Y6SC 3UERA 3DOSB 1UTDA 2L7QA 1E65A 5FEBA 3ZDXB 3BUYA 4BXSV 2UY7A 4HKZB 4NB7A 4N6RB 4A7TA 3EYVA 4FABL 2ADFH 3MRDB 2D7QA 4S1SL 5JW4Q 1A7QL 4PGZA 1CL7I 4MMXB 5I66A 3Q2WA 4U1GC 2O93L 1JXFA 4W9EC 1QRND 4JKPH 1T04B 1EAOA 4QJ5B 1B88A 5HJBA 1LMIA 5DJZB 5GPRA 4MAUH 3ALXA 4JRYE 1HXMA 1SXCA 4S1DC 1SXNA 1MUJA 3VXRA 5HPOA 4F15B 3R0NA 1OGAB 2OI9C 4N2IA 5AKSA 1AS7A 2MIZA 4Q14A 3DARA 4XNMB 3KYNA 2F54A 1OTUD 3FHEA 3QEQA 4YDIL 2A9CA 3WFZA 2Q76A 1DSFL 1DCEA 4KJQC 1T2QH 3DV6B 3SYCA 2DM2A 2ZKHH 1W8EA 2WM0A 1VFAB 2Y5QA 1HH6A 3H7BA 3MUZ1 3U79A 3CXHK 4NNPL 1W80A 3HB3D 4LSVH 4NFCA 4UM8A 5AZEH 4OD1H 3RQ3A 1A5FL 2WJ5A 1KJ2B 1QHQA 5E2JA 4XBEL 1WRFA 1C08A 2NY2B 4F58L 4ANWA 3K7UA 4IKJA 4Z7OE 2JK5B 2YQBA 1I8MB 3ZE0E 5JO5A 2H3XC 3FPXA 3H55A 4GO8A 4KGJA 2IALA 3MRLB 4X4ME 5JQIB 2VUOA 1SLWA 3OKDB 3US9A 3TO4A 1ZHBB 4BJLA 5FDWA 5J89A 5IHLB 4OD3L 4B0MM 1A02N 5DEZA 4JGJA 2NY6D 2XXMB 1JNNH 5EBMA 5J56B 3B2PA 4ZNEA 4NKMA 4KKBC 3TBSB 4KRPC 1I1RA 1QFHA 4ZAKA 3BJLA 2JKWA 3NP4A 4F8TA 4JL1A 1YPZF 2BRRL 2G2RB 1I9JH 4K8RC 1JPSH 2FZ3B 1U8QB 4AGMA 1IM9A 3QDGE 1SXSA 3FT1A 3O9WB 1KFAL 3QEHB 1OPGH 4AW7A 4M8VA 4YHPB 4H5SA 1KMGA 3QUMB 4FXKA 4YHOH 4KMQA 3KPMA 3FHQA 1YPZB 3QUYA 1LEGB 1YY9D 1T3FA 4QRPB 3T1FA 3ZKNC 1NBVL 3HG1D 2Y7NA 1YYMH 4OZHA 4AL8C 4DHLA 5EO0B 1GR7A 4E41E 4MCZA 5C8JB 3S3PA 4NJ9H 5ESQA 4IGBD 3DHMA 1A65A 3F85A 3NEEA 5DGQA 3V0IA 5I16A 3MCLH 5JTWA 2PMZA 1ZS8A 2IEPA 3CN0A 3DRQB 3FUKA 2LQRA 3QHFL 2OMVA 2RCSL 3SSGA 3ZE1E 1NPJA 2WINB 4WKZB 3BPLC 2H2SC 4G9FA 4A7UA 5E24E 3DRTA 2R7EB 1D5IL 1NEZG 1VDGA 4X5XA 5L9DL 5IOKA 5FO9B 1QUPA 3HFFA 3M8OL 3QJHA 3ZL4H 4S1SH 5ICXB 1A7QH 2VLRE 2NUPA 3EJYD 8FABB 1GZQA 2XPGB 2V9TA 4NQVB 2G30A 4PY7A 5GS0H 2P5WA 4F91B 3JWNH 2W9EL 3T6ZA 4M8RA 5DRZB 3SCMD 1N0LB 2X2UA 1NH6A 2XYCA 4FQJL 2J88L 1MJUL 1HINL 2FGZA 2V5YA 5IT2L 2L04A 2A73B 2NR6C 4WVRA 3GKWH 2K9FB 1OAXL 1YUHA 5D1ZC 1BYNA 1FZKA 3BZDA 3K6OA 3PS6A 4YDIH 2X2YA 1J9TA 1BQHA 4UUJB 1U8PA 4OCLC 1DSFH 2DM3A 4G6AD 3VWJD 3ZE2B 3GUTA 2B16A 2VR7A 4LL1A 3ILPA 4LP8A 4XC1H 1JTTA 4PJCB 5J57B 5EZLA 1J5OH 2CM6A 4UQ2A 5CCKH 3KWUA 4KVNH 2CQVA 4NO0A 4NNPH 1XGPA 3TNMB 2VDQL 2Q87A 3U9WA 5IMOA 2XG4B 1Q9OB 1E5CA 3D3VB 4XBEH 2I24N 2ID5A 2NUTA 1TZIB 3V9EA 4KTGA 5D55A 2HKHL 4TLTA 3MRFB 3ZDZF 4CKQA 2TRHA 5BRZD 3NIDB 3CXDH 3Q5YA 4HWUA 4ZOAA 4M6AA 5G4OA 3VGBA 3DMMC 1XEUA 4GKNA 4NZRL 2WCGA 3ZDZB 4WF7A 3FFCD 3D85D 3JQOB 4KXAA 5ACLA 2SEBB 2Y5TB 3NGBB 5TQ0H 5JMRA 1MHEB 1VSCA 2AXFA 2XV2A 3BQUA 1PY4A 2BVTA 3NRQA 2F7RA 2JJWA 2EDHA 1SUHA 3CN3A 4HX1A 4LLVA 3DSFH 1R3LA 2ZXGA 4Z7WE 4JZOB 2C9VA 3CD4A 1R33A 4CNIB 1FYTE 1L9TA 4G1EA 3P9LB 3ES6A 1F42A 2B1HL 5DQJB 2I5YL 2CKBB 1CR9L 1WBYB 3ALWA 4M7KL 1XWVA 1KLGA 1MJJA 1QRKA 3AT0A 1TEFA 5HHME 5I0ZA 4OKVB 4FC3E 3U7WL 3F7LA 4OV5A 4NI6A 3GPSA 3RWJB 2G3NA 3L4YA 2BX5A 3IJSA 5C0AE 1H8OA 1FHNA 1UH4A 4G7SB 4QXGL 2WLIA 4PUBH 3DX0A 2Q86A 5ID0B 3QHFH 2JJUA 4NENA 3LD8C 5GIRB 1CE1H 1CS6A 1QVOB 3AWFA 4QMEA 1HAUA 1WFIA 2CBQA 2OMNA 3S98A 1QBBA 5EF0A 2XKNA 3TYFA 4FADA 4B7LA 3F05A 4IBYA 5J0BA 2P8LB 3L81A 4X98B 4I0PB 4FCAA 4MKMA 4Y5YC 4YHNA 5E00B 4PP1C 1JZ8A 2XC8A 2B14A 2EXTA 4XN7A 4CU7A 5AFAA 4GG6B 4X6EA 3QXVA 4TKWA 1ZANL 3QYMA 1CXFA 4HD9A 1LGVA 1BD2A 2W9EH 4JCLA 4N2CA 4HG4K 4PCYA 3TEZA 3N9GL 2J88H 3AU0A 4M62H 3IDYB 4HPHA 4CDHA 4DP0X 5TJWK 1U8OB 3GIVB 2FL5B 3EO1A 3RVVD 1FBIL 4HXAH 8PAZA 5TE6L 4HLEA 3UP6A 2WXGA 4HV8A 5D1QD 5D7JC 4AQ8C 4UV4L 1IT9H 3HE6C 1I3RB 1F11B 1NCHA 1MCPL 4OF0A 1B4JH 3RWGA 2XN9E 4DW2L 4HUUB 3RNKB 3EJTA 4IHOA 3ZGHA 4FQIL 3CFEA 1WISA 2DRUA 3IU3A 4MCYB 4X7CC 2BSTB 2Q7YB 1FV1A 3MXWL 3IVKA 3MAWA 4D9QE 4ZUWB 3KL0A 1OY3B 2EE2A 2L7UA 3MV9D 3SKNA 2RQEA 3ULVL 3QGVA 5TE4L 1UG9A 4AGOA 1BVKB 3OAZH 1PLBA 2R1XB 4MD0B 4NNXA 2DM7A 3KXFE 1ZTMA 4WO4A 3HNVL 4NZRH 5DFVD 4Y4KC 1IBHA 4RAVB 3JYBA 2AI0L 1PZ5B 3DJZA 3LMJH 1ORSB 3TLRA 2A1WL 2LLLA 3UYOD 4X5WB 3OXRB 3QEGH 3DBSA 4BBWA 2O1AA 1QKZL 1I3GH 5HVHB 2F6AA 3VXMB 4BQ8A 4K73A 2YZ1A 4FXGB 3H9SD 3I02A 1JUFA 4LCCA 2KZBA 4F5CE 1KIPA 1ID2A 1FSKB 5I1DA 1NCBL 2I27N 4JKLA 4NQED 1S7UB 4M7KH 4ADGA 3ILQD 1SNRA 4LKCB 1CTOA 2AEIT 3F7YA 2FD6L 2H7WA 4MZIA 5HHOE 3SGDI 1FZOA 1CPUA 1GY1A 2E7DA 4RX4D 4I85A 1CFMA 4EPSA 1F4WH 3O3BB 2I69A 2HXAA 2YAFA 4YBQD 3MTRA 1UXWB 2CIIB 3O6KH 3VM7A 4DCQA 2WQVA 4IMKC 2C3GA 4RMSA 4QCIA 1MXDA 4BFJA 2RJMA 5HI5C 5T3ZH 2EUWA 1E8ZA 5GS0C 4ZQKA 2PPFA 3JWNC 5KUKA 4N1HB 3SDXE 4P2QD 1DQLL 4AQAB 3VRLE 1NIBA 1M6UA 2XV3A 2Z7ZA 4G8AC 4JFHD 4K55A 7PCYA 1I1AA 2APSA 4DEWA 1GKOA 4WHCA 2UYLB 1JJUA 3KPTA 3PABB 1LWHA 2ADGB 1INDL 3EAKA 2YSSA 4JQVC 3MOAL 1QTYT 2XNAB 3N9GH 3FO9B 4OJFL 2WYIA 5BO1L 1X5KA 4PGEB 1H15A 5T8IA 3V0DA 4HF5H 4UT6H 4WFHD 2NSMA 4RSYA 4PY8J 5FX3A 1OP5K 4C56B 2B59B 3CXFA 1FZMA 4GW5A 3QJFA 3LVTA 1UUSA 1OAYL 3N42B 5F0MB 2MCMA 2FK9A 4ODWB 5TE6H 3QG7L 5K9KA 1AO7A 4UV4H 4LMQI 1PZ3A 1IGML 1MCKA 4MMZC 4ODTL 5F96L 4U1JA 1MCPH 3L17A 5C0GB 3S2AA 4Y4FC 2BW4A 4R4NC 2Y4SA 4NIYE 1WT5C 3LH2L 4X6FB 1TLMA 3GNMH 2K45A 4EDXA 3D8MA 4RFEA 5IB1B 3G5XB 3EW3B 4OCRL 2HA1A 4KVPA 1NCJA 2QTEA 3BHBA 4NQSB 4M4RB 1CF8H 4HAFA 3VXUD 3SEPA 3EBGA 3ULVH 4OGAD 3QWOA 5IW3A 3WE6B 1QBLH 2FJHA 1KULA 2BPBA 4BUQA 2DWDB 4RLDA 3HNVH 1P1ZA 4NQTA 5C09B 4Q56A 5DJ8B 1JHKL 4K94H 5E1HB 4N2AA 4D0BB 5IJVB 5K9OA 5DJCB 4B3VA 4WI4A 1ANUA 2CE6A 3ZHNA 4Z7VE 4HG4J 3GMOB 4MZ2A 3WE1A 3O3DB 3LXAA 5L2KA 1G4MA 4EDWL 2EAEA 5B3NA 4HP5A 4AZ8A 1J1XL 1AQKL 1RPQA 1QBAA 2AQ2A 4PW3A 4NKIL 4JDTH 2WUBH 1JL8A 3IRPX 4K2UL 4KK8D 1HSAB 3NFNB 1B2WH 1WAAF 3LKOA 4P5TD 4BK5A 4WFGD 5D2NE 2DYPA 5KVGL 4NYLA 3X1BA 5IQ7L 2IWFA 4HZ1A 2FD6H 4ZTPH 6CGTA 3ALPA 5MHSD 3WKPA 4WUUD 4HJ0C 2YAMA 4LU5L 1A6UL 3HRPA 3PHQA 3E1F1 4JGNA 4PRAB 5AB0A 3WIAA 1XGZA 4FS0A 2ROXA 4EN3B 3MR9A 5ISZD 3G6AA 1XGQB 2DQTL 4OLYL 2VZOA 3ZL2A 3VVVA 5DD3L 4AE0A 1ESOA 2I32A 4Y4HD 5CLTA 4CA4A 4F20A 4Y5VB 2LTQC 2ESVA 1UGKA 2DWYA 3OG6B 5E1AB 1F1AA 2R2HA 3SE4A 2C3XA 2PCYA 3W11D 5CSZA 4YFEA 5A16A 1KEMH 1DQLH 1KIRB 4CRPA 3QFJD 2IDCA 4LEOB 4QJ3B 5AOZA 5FGCB 5FGBA 5FXCH 2Z8WC 5AYUH 4EI5D 5IQOA 1IIKA 2IVFC 1F2QA 4EIUA 4YHZL 4HHAA 4YDJA 3K91A 4PREB 1SJEA 1INDH 4KK9D 4C83A 2E46A 3BC9A 4O2EB 3VFOA 5BO1H 1ZT4B 4OJFH 1DL7L 4JDZB 2A74A 3QUXD 4HIJB 4MKTA 5GRXG 2X89A 1XH2A 5CJXA 3P4OA 1F1DA 3ATDA 3FPYA 1J12A 3U9PH 3MBEC 3L3HA 2D9QB 3QO0B 4QRUB 2P42B 4CJ1A 4GP5B 5BUAA 2ZF8A 5A1AA 4J3VA 4P5KA 3WN5C 1SMOA 3LY6A 1TFPA 1IGMH 3LYRA 4HQQH 4JFXA 4JFDD 1I1YB 1Z3GH 1BQKA 5GS2H 5AW7B 4ZMLA 4XMKL 4KV5E 3LH2H 3FCUB 2JQAA 1JDDA 4G1MA 5CP3H 5E9DB 3S0PA 3CDZA 4TNGA 4TUUA 2DWSA 2YD6A 3AITA 4ORZC 4QNPF 5DTFA 1J10A 2VR4A 1U21A 1HILB 4HHWA 2AJSL 3T71A 2W81C 4JFTA 2R8SH 2BSCA 3UTTB 2OTWB 1F56A 3ARFC 3QI9D 4MJ6A 3EDEA 5GSVA 1TJIH 2PR9A 4X83A 3FUMA 2YEZB 2C7UB 3UJIH 3QRLA 5KYYB 2R2BA 2G5UA 4H0GA 4N4YB 3F04A 1U8HB 2GI0A 1YC8A 1J0JA 3N41B 4TULH 5FUCC 5KBMA 1JHKH 3N0PB 3MRMA 4JZJC 1UJ3A 4M3HA 5JHBA 1DVXA 4IEFB 4O5LL 3RTQC 1MI5A 2Q2LA 1DQDL 3EKCA 2LAAA 5KANG 3C6LD 4EDWH 4PRIE 1RURL 1KJVA 4WTZA 1PIFA 2OMZA 4Y16A 3D2TA 3IDMA 4JRXA 4K2UH 1PKQB 1W8NA 4MJJA 1CXLA 3AWGA 3DIFB 3ASOB 3L1OL 5EZJB 1PLAA 2AABL 4JRYD 4LRIC 3UYPA 3RL1B 4F2EA 4UOZA 2H1XA 3JXAA 2GEQA 2UUDH 1DJHA 4DQOH 4IOFD 3MJ8B 4LU5H 1I8UA 4CMMB 3GMMB 2VR6A 4QRQA 1XO8A 2WJ7A 4XAKE 3PHSA 3V5DB 1A8JH 2IBGA 2Q1EA 2DQTH 1XSKA 4OLYH 1BAFL 3FU7B 1F58L 2VLKA 2VXSL 3MRRB 4GW1B 1MFAH 3WY2A 4JM2A 1KGUA 1VFUA 2NMSA 2Z93A 2D3VA 2WXPA 1URZA 4MD4A 2WO3B 15C8L 2F7QA 3L2LA 1AR1C 1OL0A 3ARSA 1X4YA 3ZR5A 4P4KB 3GJFA 4PJFF 2X41A 2XIBA 2R83A 5E8EA 3WJJA 4F2MB 2ZICA 3FO0L 4HC1A 4I18A 4M93C 2J1WA 1NL0L 1DN2A 1QW9A 3R1GH 1NTDA 2P52A 2VR3A 5C0JB 3OJVC 3KH3A 3OKYA 2CUIA 3G04B 5DEGB 3V6OA 4PJFB 3O2DL 2CDGB 1DL7H 3I50H 4PD4J 5CFAA 2FHCA 2UWEA 3CFUA 3D0VB 2PTVA 4ES8A 3IXAB 3HI1B 1A0QL 2ZYSA 5BZWB 2HLAB 3CZFA 4LLQB 2CCLA 4PJ9A 4AEFA 2OA9A 1H3GA 3CFCH 4NKOA 3S35L 4XNUL 4U1NA 4YO0A 3VQMA 1P84K 4NXKA 3X11B 3WJMA 1MRDL 5IEKB 1SJMA 3ULVC 1P7QD 3V8CA 3EXJA 4JKWA 2C4FU 4AV4A 3G5VA 4LNRA 3ZDYF 4TNFA 4QHLA 1Q9LB 1DHKA 2WBJC 5MENB 2FYYB 1NCGA 4K94C 5JNYA 2AAVA 3MXVH 4PJ7F 4XMUA 1IKOP 4QRPE 1OCWL 3N50A 3VCLA 5DURB 2KZ1B 4KNTA 1GGCL 1P6FA 1SJVA 2VLLA 4X7TB 4PJ7B 5C08E 3RFZB 1CFSB 1I8LC 5HD8D 4B9YA 4KKLC 1CYGA 5KN5B 3Q0HA 3UBXA 4RNRA 3MNWB 4M6OL 2JMRA 2PW1B 4NUJA 2ICWB 5DA0B 1DQDH 5B7EA 3QDMD 1HFUA 2IH3B 4TSAL 1MLBB 4PB9H 4KZCA 5G5DA 3SN6N 5BQ7A 3CWGA 2EUXA 2WC7A 4GYBA 3CU7A 4PJHB 4ZW8A 2CR6A 3DJRA 2PCPA 3VXSA 5F21B 1CGVA 3F12A 2VMDA 1BAWA 2XU9A 2VC2L 3CVCA 4Y5XB 3LS5H 3MYZA 4G72B 4NWTL 3SJVB 3V6FA 4AYID 1VGKA 2Z7WA 3VXNB 3ARGD 1AGDB 3ARDB 2XTJC 3KLHD 1BZ8A 4MJHA 1ICTA 1Q9WB 5B8CC 3CTTA 1CLOH 5IW1B 5I5IA 2CO6A 1AQMA 3TN0D 4APQA 4NP9A 5TQ2H 1KIQA 1NGPL 5ALCL 4IDJL 2X4RB 5EU6E 3TVMC 15C8H 3K74B 3ZE2E 3QB7C 1IC4H 4TNVF 5FWQA 2PTTA 2WK2A 4RZKA 3FO0H 4PJCE 2ICWI 3LIZA 4J7RA 4UQIM 1S3RA 4JLRA 3SQOH 1JTOA 1QZ1A 3QDAA 3KNBB 4K0OA 4ZFZB 4ZODA 5B39G 1NMCB 2PTUA 2NXZC 1IGTA 3O2DH 5IJBC 3OGCA 4OR1A 4TLUA 3JSSA 3GJFK 2VZUA 5KVFH 2ZXEB 3PUCA 3V4PL 2W07B 4WDIA 3S5YA 2X4PB 1A0QH 4GXUM 4ZI8A 5A7BA 1PD0A 2XACC 1IB5A 1EJ8A 4IJ3C 3BZEA 3AM8C 1BP3B 2CDFB 3LQMA 4A7VA 3BKCH 1YEWA 3V0GA 5GZOA 4MQTB 3S35H 2BERA 4BQ9A 4X4KA 1P4LA 4JHVA 4HC1L 2J8UB 5C7XL 1IAIM 3ABKB 2NY4D 1M2VA 1FYTD 3RY6A 4FULA 3QEUB 3D9AH 1RZPA 5JORB 1SHXA 4H26A 2VMFA 4TRPH 1Q72L 2JB5H 4NWUH 5D9SB 1QQDA 1SFDA 4G8GD 2ZQKA 5HHMD 4Z7NE 1H8LA 4ORGB 4BCXA 1U8KA 4JO3H 4ZMWA 4I5BB 5HI4D 5IEHA 1KSRA 2CO3A 5HGBA 3O6LH 1NCDL 2DIEA 1EGJA 2PO6C 5C0AD 2VJ8A 4ETYA 3LZRA 3MRJA 1PG7H 2XZQL 2Y3AA 4KUCD 5SV3A 1GGCH 4DGUA 1ILSA 2A9DA 5GZNC 5IR1A 5AUMA 3CMOL 3KPLB 1AD9B 5IUSA 5D8JL 4XWOD 5I73B 1D5XA 1EWHA 2IAMA 3GTTA 5F7NC 1HCFX 4TSAH 3BVNA 1U8MA 2YAOA 2DB8A 2VJ0A 3G08A 3L9EA 4JDEB 1O6SB 1ZHNB 4MDJA 3SKJL 4AQOA 1AZRA 2C4FT 3DXAA 1BOYA 4BH7B 3LV3B 3ORJA 1SBBA 4Z9KB 3M17A 1MW2A 1OAZH 2VC2H 3I3BA 5JHAA 3GSUB 4NWTH 4LK4A 3SD5A 4ALAH 1EANA 4H25B 4PPTA 2CG9X 2KC0A 4P46D 4UAOC 5I9QC 1YO4A 5SWZB 5I0XA 1L0XA 1QLRB 2Z91A 4P59H 1NLDL 5EUKA 3RWCA 3BLKA 1OHQA 3UACA 3VTMA 3WFEL 3BD3A 3QNYA 3SBQA 1TTUA 5JW5A 4TN9A 5IJKA 2HG0A 2BNQD 2KZKA 2L7JA 5D1XE 1W72A 4UZSA 1XF4B 2Y23A 4QO1B 1CTMA 5ALCH 3AAZB 1JMXA 4IDJH 3B3IB 2WIIA 1IAII 2R0KL 4FFVC 2XN9D 5KANI 2OZ4A 1CICC 1I8KB 1UFUA 4JW3A 4JGMA 3MJ7B 5I75B 5INDB 5IY5B 3WKYA 5E6YA 1KPUA 1WGVA 3DX3A 4HALA 4RMWA 1CT8B 4LIQH 1U8CA 4QHKI 4A38A 5I5MA 1N64L 4WIQA 4HISA 5DK0B 4OB5H 5DO2C 4OT1L 1NM9A 3DO4A 3OZ9L 2P8PB 4ABQA 3CDGB 2VLME 4APXA 1C5DA 3V4PH 5HTSA 3QUKA 2CRMA 1HQRA 1MOEA 2VH5L 5HJ3B 1L0QA 3CFQA 3KPRE 5JPMB 1MVUA 3WMPA 2X05A 5D7LA 3POCA 1U6AL 2MFNA 2VRKA 1VCAA 2XIDA 4Y9EA 1VLXA 4BE5A 3W2DL 3ARBC 4FQCH 1BMGA 4HCIA 2A9MH 3MJ9A 2QQNL 3NPSB 5HYJB 1C1EL 3WNMA 4OI7A 3LIZL 1KACB 1O6TA 4QJ4B 5C7XH 3HUJB 1AHWC 1AKJA 1HYRC 3CC1A 2XQYA 5LCVH 1ZPUA 4EI6B 4XMTA 2Q8AL 2CNZA 3BXNA 4RGMB 5J3HD 3GUFA 1FFQA 2QSTA 3TV3L 5CFHA 3LQZA 2ZP0T 5CIPA 4D9LL 5KJRH 1IEHA 3UZEA 1GIGH 1UACL 25C8L 2Q10A 1NCDH 2WXHA 3CZUB 4ZPVA 4XPFH 3VFMB 1T6BX 3KL5A 3AS0A 2XZQH 1S7WB 3AU1A 3WNOA 5E4EC 2XWJA 1AS8A 1BFTA 2DTML 1G5GA 5IF0B 5FIEA 4P2OB 1FVDA 2V2XB 1DQQA 4LMQE 3O8XD 1JK9B 1QZNA 4IBVA 4WY7L 2GT9A 1Y6KR 2UWEF 4N26A 1GXEA 5FYJD 3LSOB 2YOAA 1KLFA 4Y9GA 2IWGA 3EHBD 3DYPA 5IG7A 1JFQL 2Z0UA 2JKIS 3SKJH 4A37A 1HSBA 5BMFL 3MOQA 2HT2D 4KZEL 3PRZA 1UM5H 2OCCB 4HSQA 5CGBA 4OIIL 5DJYB 5BV7H 4JHWH 4U7MA 3ROOA 1EFXD 4XVJH 2EE9A 2EVHA 3LDBB 1KJMB 4R3SB 5DJ0B 2CO7A 5T5FA 5J6GB 1FO0A 3WS6A 5CN3A 1E5YA 3CLFL 3GMRA 3B6SA 5D7IB 1OAQH 4DKDC 2BIPA 4GRWF 2BY0A 3WFEH 3RWDB 1NFIB 2V8LA 2I60L 5LGKA 3JUZA 4GRLA 1A7OL 3EG9B 2QBWA 3GS0A 2LAGB 5DVNA 3BIBX 5E1QA 5CBAA 3G5ZA 4J5VA 2QJDA 3WUWG 4XHJD 1M53A 4O9HL 2CK2A 3ULUE 2FGWL 5E6SB 3U2SB 3CLWA 4K3JL 1J0KA 1ACCA 2NLJB 4P2YA 2R0KH 3MGOA 1MQKH 5EBWA 3VFWA 4J3XA 1TMCB 4ZMVA 2Q6WA 2OP4L 3OF6A 3M86A 1S9VB 4U33A 4F7TB 5IK3A 3LRHA 3NP3A 4XO4A 4L9LB 3V4UH 2JKNA 1KXTB 4V1DB 3TFKD 1N64H 3KJ4B 2ATAA 4J1UB 5E5LA 4DEUA 4Q9BA 5IBTL 4GBXC 4OT1H 1ONQA 2WB1A 3B2XA 3OZ9H 1QFPA 4HKXB 4K9EH 1BFSA 4P2RA 3Q13A 5LVEA 2IPKA 1TQTA 4NQDA 5F9DC 5ALBL 2WP3O 3V4VB 1YDPA 1W72L 2R29A 4LCIH 5GRUL 1GJUA 3OKMB 2JELH 5GRVL 1MG2C 4X4ZA 5T3XE 3LKQA 5E08H 4KKPA 2ZUQC 4JB9L 5A2BA 3PAVA 4KFMA 1U95B 1XGRA 3FUIA 2OZ4L 4LVNB 1CXIA 4Z7UB 3IJ9A 1BVOA 1GYAA 4QRTA 2IH9A 4OIBA 2DQUL 2VJXA 1XR9A 3GXPA 3V0AC 2KMWA 3RUGF 1F2XK 4XXDB 4JPIA 4KX7A 2Q8AH 2PR4H 4OLXL 5F3FA 3TV3H 3U0PB 2X4NA 1RIVL 2XWTA 1MY5A 4HIIA 1WQVT 3K71A 4R26L 5I1AB 1ZV9A 3CX5K 4JANB 3RUGB 25C8H 3B8YA 2BC4B 2CPUA 4OH2A 1VAHA 3HMXA 4YC2C 4TTDD 2VXQA 5ANMB 4I1NB 2XQYK 5KSAA 1FLTX 4OZIE 5E8OA 3WKQA 1I8IB 5D5MB 3MV7B 1TVBB 1AC0A 3KPOB 5TF1H 3Q1EA 1CD1A 2OJEB 4JZNA 4ZUVB 3MUGB 4GUPB 4N2EA 4YL9A 3MJ9L 3G7TA 3SDAD 3TPUB 4BFBD 4U1GB 5AAMA 4ALAC 2XV0A 1JFQH 1DBML 1UQSB 1FNEB 5J5EA 2OPCA 3Q5TA 4PRDB 4GKZA 4IKIA 5K1NA 3L45A 5C07E 5D72L 4C54A 2F9BT 3FZUD 1GYVA 5FGCE 3ZYIA 5JHLL 2P49B 3Q43A 2P7TB 4HJJL 1HC1A 5DDHB 5GJTL 1FPTL 1NINA 1W0VA 3LPPA 4U6XA 4Z3HA 5JIKA 3NCJH 4NM4L 4QRAA 3LNIA 3C5ZA 3CLFH 4IGBC 5JR1L 4IRZA 1TENA 3QCTH 1JWSB 5ANHA 1OSEA 1U3YA 3FSAA 2QSVA 5FA4A 3FTXA 4NZFA 3KBPA 3RIKA 4PRHB 2HKAA 1PSKL 4XB7A 4E9RA 1NDGB 1H3TA 5EEXA 4JHAL 2XX0A 2G75B 1A6AB 1DVFC 4K3JH 4NO5A 5DR5L 1BQ5A 4YPGA 5FB8B 1FRGH 4H20L 3EJYC 3JZ7A 3QZBA 3SKMA 4LO9A 1B4LA 3ARED 3TF7C 4PWIA 2VKXA 2HRGA 2GJZA 1DDTA 1FNLA 4MCMA 4TUJB 1XF3B 1RUPH 1CFNA 2PCFA 3PV6A 1KGCD 3AXHA 3SCMC 4FNPA 5D4QA 3PGCB 3SGJC 4QRRB 3QDGA 1RULL 5T5FL 2NQDA 3JYCA 4HLJA 2IFGA 4JQVA 5FM5M 2BK8A 2YAQA 1K8IA 2GSIB 1EXHA 3U6XA 1ZWIB 2F19H 3BQVA 5C9JB 5CJBA 5BVJB 2A38A 3HPJA 3MRCB 2XFXB 4FNUA 2HFFA 3TO2A 3W0WE 1QWHA 5B38A 4PJEE 4Y2DC 4PGDB 3FONA 3US1A 1AI1H 1IAOB 2F7OA 1IARB 1FHGA 1TQCB 3LX9A 4DO4A 4LCVA 4I3RH 4NPJA 3LCYA 1L9MA 5DI8A 5GISH 2WANA 3RI5K 3SY0B 2IH1B 4MNQB 5EV7A 1JNLH 1WA2X 3BEWA 3KMDA 3OJDB 1UB6A 4OLXH 5EO1A 2IDSA 2WXMA 5IVXE 4PWKA 3NTCH 4NBXB 4ZSOB 1RIVH 1CLVA 3I6KA 3P02A 1D6VL 4PV9A 4GKSB 5K59F 2EH8H 4DJMA 3AMKA 3U0TA 4R26H 4Y19A 4MZRA 3BVTA 3ZSSA 3W5NA 1HEZB 4GP4B 5ITFB 4KJWD 1OGAD 3NIFF 4FI6A 2CR3A 1CQKA 3BPLB 2PXYA 2R29L 1XB8A 3FO2B 1JNHA 2EICA 5DGRA 3A6CH 3K6SA 2VOTA 3ECBA 1ZT1B 3K3QA 3LEXA 4FNLL 1MWAH 3DX8A 5BV7C 1E9QA 3GC3A 4G6ML 2DLEA 4LLMA 3AW5A 3IDJA 3MODL 3Q8EA 1JDAA 5H35B 1W6WA 4KROC 5J6HA 4AIOA 4NHUA 4F2ME 4MLSA 4XN5A 5D72H 4RDBA 5D7EA 5FUZL 5JHLH 3HBZA 5CJ8A 1DP0A 1QPKA 1MVYA 3CVDA 4LVOB 2NY2D 4PAZA 1WWAX 5D1ZB 3VI4A 1NCNA 2EUZA 4HOXA 4G42B 2X42A 2VXQL 4MDIA 4NM4H 3FUFA 1YNTA 3KPSB 3QRGH 5CLXA 3WENA 3OKOA 2UXFA 3PDDA 4NI3A 3P40A 3ESVF 1GGYA 1BZ7B 1T83C 1EBPA 2QDVA 1OSZB 4A2EA 4GAYB 2B0SL 3H2PA 4M7LL 4XH2B 1S5HA 2XA8H 1ZLSL 2OXGB 5B7FA 2X2IA 5BRQA 4JHAH 1TTGA 1VZGA 5E5MA 4LOVA 1CN4A 1SDYA 5DR5H 1CLZL 3CX5J 4OZGA 4XNDA 2HT4D 1OB1A 2HKFL 1IV8A 2IBBA 4FN0A 4H20H 5F1OB 3BN9C 1PQZB 1M71B 4K9EC 2CJSA 4BSWA 4DVRL 2DEYX 4JFEB 4YSAA 1NCCL 3O9WD 4J28A 2CLRB 1EO8L 4KK6D 4LCYB 3PYCA 5DHVB 4M7JL 2BMKB 1YECL 3D48R 4QRPD 4F7KA 4M8UA 3B56A 4XPGH 4Z3GA 2HN7B 1WBZB 3HJ0A 1UH2A 3SDYL 5C08D 1QTSA 2ODHA 1KTDA 3ZRSA 5D1QC 1CBJA 2GG1A 3QZLA 2O6FA 3I6GA 3HLAB 1I7RA 3DUUA 1OALA 3Q9QA 3UO1H 3G6DL 3VGAC 3FYEB 3NSJA 5F1IA 3L8QA 3PUUA 3STBA 1FNHA 3K1DA 4BA8A 3HCVB 2G60H 3T0EA 1YC7A 2Q2EB 2FBOJ 3K1KC 2VDNL 3H9HB 1RIHL 1BPLB 3NJIA 4OAWB 3L7EA 2ZUSA 2GTWA 2ZKXA 1TUPA 3NFSL 1EEZA 3L3DA 3TA3A 5I76A 5KOVC 4YE0A 5DRWA 3SJVE 4EZLA 1F0LA 2DN7A 5K39B 3JV4B 3WO4C 3L3GA 2YPLE 3FT3A 4U1HA 2VAAB 4HEPA 3TH2T 5GGVY 3FH7A 1EZVY 2ADJB 5KEZA 5FA3A 1U2CA 5IBLC 1MG3C 1ROCA 2CLVB 2ITDB 2HPTA 3ESOA 5E4OA 5JXAL 2QMKA 3SGKC 5L6YL 4Y5YB 3EYUH 5EF2A 5IBUG 2JCCE 1UD5A 4B9FA 3VFGH 1WBXA 3GLDA 4HIHA 3RI5F 3FUJA 3WS3B 4ZUSB 5D6DA 4LLWB 2K7PA 4M29A 5T5NG 1DBJH 4LLYA 1RUQL 3E3QE 2X3CA 4HIEA 4DF9A 2ARJQ 1JZEA 3D3VD 3ILQC 5JMOC 3RZCA 1CO1A 5E6UB 5H4YA 4G11A 2VR8A 3IETA 2MOGA 4FQ1H 4W6YB 2E4FA 4ZFGH 1XAKA 3BYTA 5JPNC 3NCYP 4MJIE 5GGRY 1NBYB 5D7JB 3HKZA 1O75A 4WU5A 3W9DB 1P2CA 2B0SH 5F3HA 4M7LH 3VFUB 1ZLSH 3S36X 3MPCA 1S7SA 3SDDA 3VDCA 5ERWA 5F0LB 3NBNA 1I8AA 4TVSa 3MV8E 3U4EA 3VRJB 2V9RA 1X5AA 3NCFB 1PEWA 4F37F 1AD0A 4JM0A 3TFBA 4POZD 3CDCA 4E42A 1H9DA 5CR1A 5JIHA 1VZHA 5CEZE 3ECQA 1T7WA 1FNGA 5FYLD 2F08A 1R3HB 5TDOA 3S3CB 4E68A 4UQCA 1RJZA 4LF3B 3QH3B 4M7JH 2F7PA 3O4OB 1BF2A 5SX4H 1XTMA 1S7RA 4Z7QB 1GAFL 4M8QB 3NT0A 4Y4KB 4JX0A 3T0XA 3FT2A 3ENEA 4UTCA 4C4BA 4EQ2A 5IHZA 1B0GA 1NFDF 2DH2A 5EOCH 4N1CA 1T7VA 1I9RL 5E8NB 5IFAH 7FABH 3D4YA 1KCSH 1ILUA 3INOA 5C0RL 4LSTL 2IPUK 1LWRA 1QPXA 4D8PB 1Z3RA 4YXLH 1JGLH 4EUPH 3QXWA 1FZJA 2H6PB 2N7BA 2W0FA 4NP4L 2FT8A 3VGGA 1FN4B 5ID1A 3EFOB 4I0PD 3M46A 3IMSA 3RKDC 3P30L 2R1YB 3AY4A 5SWSA 1AMXA 3WLBA 4XC3L 4KTEL 1F6LL 3U9UB 1WUZA 4TQHA 3UAEA 4OGAC 4BKTC 2KI6A 4DKEL 3NFSH 5H2BA 3SPGA 4F7MB 4TSCH 1E4WH 1KENL 1T6VN 4CADB 2EVJA 1KGWA 3L5JA 1OANA 1TJXA 4HW6A 5SWZE 4DO6A 5IHBA 3PWUB 3APFA 3GSNA 4X6DB 5I8CA 4M1DL 2DMGA 4TVPD 5CP7A 2E3VA 2E6JA 2IF7A 4NIKB 1OF2A 4D3CL 1TQUA 3NZ8B 5EC2B 1MCCA 2X6AA 5I0DA 1I8LA 1MCWW 4IS6A 1YCSA 4UQ9A 5TPWL 4ZJ9A 4NCC2 1D9KC 3BPCA 4XCEB 1PCSA 4AEIH 1XB3A 4UNIA 4WFFD 4KK8C 3QIBB 3HFML 4P5TC 5IHUH 5TE7L 5F6HJ 1NLBL 2DYSB 1RUQH 3SQBA 3ME0B 1A4BA 1PF3A 1R75A 4J3UA 5FO7A 4ZW5A 4AQ1A 1ZLVK 4MMYA 2K3TA 4O02A 2AJVH 1Q0XH 1QABA 4P57B 5IFHH 3VW3L 4GI8A 3GS4A 3H2WA 2B39A 4LCWE 1D7BA 1CI3M 5E2TL 4L8BB 2ZX7A 2R2EA 4NFBA 5DWUH 3QFDB 4HOWA 1YMME 4Y4HC 1A2YB 2BSED 3HC4L 3CFNA 4MMZB 2DF3A 5DZJA 3LOWA 5GGRA 4Y4FB 5L88L 4IW4C 5I6PA 1D5ZA 3ATEA 1O0VA 5DWPA 3VXMD 1A6ZA 1X5XA 5I1KL 1BPVA 2A6KB 1E3ZA 3BSZA 5FOBA 3V4LA 4GFTB 5L4JA 4CVZA 4HCRH 1JXKA 1TZHA 1QHOA 2CHWA 2XY1A 4PJIA 1R0AH 3INUL 3B5HA 4I4WB 2DQCL 3HUJE 1BQHG 4ZZFA 5KSUA 4KKCD 4XXCA 1X5IA 4GIPD 3BT0A 2X40A 3QUXC 4YWGH 3F2LA 4AIZA 4R2GB 4AX3A 1CD8A 1L7IH 4YX2H 4PS4H 5HHVL 4NM8L 4PRPB 3UADA 4HIQA 1N3NA 2Q3AA 2YFOA 3D25B 4Q6KA 1LO5A 1WP6A 3KS0H 4BZYA 1E4XH 4NN7C 3W57A 5C0RH 3TBYA 2Y69B 3NDZE 5J9PB 1IBBA 4QOKE 2WMPA 3T65A 1T66C 3MUJA 2F74B 1RKRA 4LRNH 4G3YL 2FX7H 4JFFE 4GSXA 1QO3A 2RMNA 2QADC 3CDFA 5ICYB 4NP4H 4XVSL 1J18A 5GSRA 3MUUA 3UTZB 2ZCHL 3OKNA 3MREB 5A7EA 4U6VL 4ES9A 4W9FC 1EO5A 1A3LL 5DHXB 5EO9A 5DHMC 3GMPB 2P5EB 2WCSA 4XO3A 4DKEH 5DEFA 3NIGE 2K70A 5GGTA 1GSKA 3FQRA 4OLZH 2E9IA 3WLWD 4P3CH 3D69A 3PGFL 5KVDE 3P11L 4HKBA 2W65A 2B7DT 5A2IH 2LTQB 2ENJA 2WTRB 4C56D 4KTDL 1EUTA 1DZBA 3MUY1 5DHEA 4JGUA 3ZUNC 2ZWYA 4K7FA 1MVFA 4D3CH 4PG2C 1EJ6A 4DUVA 5B7MA 5BVPH 1KIUB 2ZAHA 3AMLA 2EO1A 3C6LC 3IF1A 3ROLA 2YD9A 1MPAH 5AVXB 3X14B 2HJKB 1GZHC 4N8VA 4UQEA 2FRGP 1JFHA 1PAMA 1RK1A 2W9DL 2D7TL 2NY5H 5HYFA 2ZKYA 2YLKA 5IQ9B 1QSFA 5TE7H 5C3LD 3K81A 1LWJA 3BUYB 1A7NL 1ZHKA 2UY7B 5CINL 2DWEA 1VFOA 3MV01 4ZDHB 4HIXH 3VW3H 1L9PA 1KXHA 1UXLA 3TF4A 4Q9RL 1KBPA 1NIFA 2VDQB 1MNUL 3GSNL 4X7FC 1AANA 2WQXA 4WHDA 3RAJH 2QT6A 1B2YA 5T3XD 1A1NB 3HAEH 3R06A 4PCSA 4RGNE 5C09D 5GGVL 4UIMA 3IRZA 1DJSA 3WTSA 1MFBH 3IDGA 2VDRL 1MDTA 5MEPA 2X3BA 3IDNB 3VI3E 4NRZA 4G71B 3KYNB 1TNMA 2VGLM 2VXVH 2F54B 5I26A 3ZW3A 5KS9F 5L8JB 4CC4C 4Z7UE 1J5CA 2Q76B 3KGSA 4RA0C 2XBDA 2AERT 2VO8A 3B7RL 2DQEH 2JV6A 2ZOLB 2DV6A 3VA2C 3B2DC 1JPFA 3H7BB 2DD8H 3A67H 3ARFB 1HI6A 4K9JA 2E75C 4O02L 4P5MA 4JPWL 3L1EA 2WXFA 4R90H 5J06A 3BZFA 1G7JA 4KQ0A 1SF5A 2J5LC 4KKAC 4KHXH 4YUEL 1DO6A 1XSIA 4NM8H 1KPRA 1ZRUA 1OT2A 1CGWA 4OZ4B 2H5UA 3RURA 1LO4L 4R7DB 4EN3D 1JYXA 3RTQB 4XBPA 2GC7C 1USZA 4S0HA 1SHMA 3WNIA 2AITA 4R7NB 1PYWA 4WWPA 1L6XA 5CCJA 3BSZL 5FDWB 2D03L 3X2QB 4FQXA 3PHOB 1TYRA 1WG3A 2KPWA 5EH1A 2WWMD 4JQXC 1BLNA 2WLLA 2IMMA 3GMQB 1HVXA 1TTRA 3O0RL 3RDTC 1A3LH 3ESPA 1UZ6E 2O61A 2LVCA 3CSPA 3FB5A 5ESAA 5DMGD 3BP6A 4XVTH 2ZXDA 1GY2A 4HPYH 3JV6B 5C0FB 3PGFH 4KDTC 1FAKT 4OCWL 1HZKA 4FXKB 1QLEH 3KPMB 1JZ4A 1LK3L 1UM4H 3QORA 4N5UA 5D70L 5JW4N 5JUEH 4XXWC 3RJQB 2KH2B 1AR1B 4PRHE 3OR7A 3O11B 5ICUA 2GSGA 3JTTA 1WC7A 5CUSL 3BAYA 4OLVL 4PJAF 5BNXD 2DMBA 3FXIC 5I16B 4GAJL 4JPKL 2GIYA 4N2KA 2KS0A 2W9DH 1EZSA 3C8DA 4PY8I 5C0CA 3CC5A 4YSSA 5ABDE 2D31A 1CDJA 1SEQL 5E9DD 1I75A 1GC1L 4YGVA 3ZR6A 3PGDA 3CFBB 3EO9L 4BWTA 3CZJA 1Q1JH 3WAJA 4PJDF 3KLHC 2EE6A 3FS9A 3QDJA 2NUPB 4F8QA 1NAML 3UTTD 3CE1A 2CGZA 1YAIA 1OGTA 4MCNA 2BZDA 4QRRE 4XT1C 4JFPB 5IB5B 3T8MA 1DFBL 4GUQA 1GZQB 3ULVF 1P7KB 2G3XA 4YQXL 5C92A 2P5WB 2UXTA 5C2BL 2XOTA 1P5VB 4GOSA 4HZLB 3O41A 1FVCB 2FX8H 1WSST 3U82B 3EFDH 3BDXA 1DQIA 3P73B 5FLUA 2VDRH 1FG9C 5EOTA 1P4BL 2CLZA 4KNUA 3EOYG 3DYOA 3LRGA 4FG2A 1OCCB 3QJXA 3VGHA 4Z0BH 4JFQA 1E6JL 1AIFA 4OGYL 3S96B 1S9WA 1U8PB 4TQ8A 4ZXBC 2WBJB 3OKKA 2XSKA 1DDHA 1TKWA 3GUTB 3RX9A 2H2PC 4G8IA 5EEUA 3STLA 3ILPB 4R96B 3GRWA 2WSDA 3QWRD 4MNQE 3SE8L 3S2CA 4EXKA 4XBGA 2N56A 5FCSH 1EHXA 4L18A 5GGUA 2ZP9A 1ZVYA 2MCAA 5JW4R 3O2WH 1QFUL 3QW9A 4N3UA 5ICZB 1T4WA 3ZHLA 4TNWF 2R9HD 4NBYB 2WXLA 1OP3H 3DVGB 3RYMA 2M1KA 3FQYA 7PAZA 1MCBA 3EGSB 4GKNB 4JN1H 4JO4L 2NY4C 1XF1A 2WO2B 3B2VL 4P4KD 5I0YA 2YR3A 1UA3A 3BUDA 3O0RH 4X7EC 3KDPB 4LPTA 2AXFB 5FECB 3BQUB 4GT7A 1I7UA 2JNZA 3UAJA 1VKXA 1PCXA 1YEHH 1DEEB 5HI4C 2BNRE 1Z0MA 3WMSA 3K6NA 4JNXA 2W91A 1R3LB 2QQKL 4L2YA 2GTZB 4WW1A 3WMQA 4F57H 5I17A 2OMYB 1A1MB 2YN5A 4PJIF 5FW8A 2A6JA 1LK3H 1UA7A 1MIEH 4BH8A 5I8KL 3BISA 3TVMB 2CHDA 2NY5C 5D70H 1KLGB 4YLQT 5DJDA 2J25A 5LQBL 4PWEA 3LVEA 3SE9L 1BQUA 3CU1A 1JN6A 5IB2A 1MRFL 2EDBA 4OLVH 2EDOA 2O5YH 3IJSB 1SOKA 5DFTA 3WTWA 3QP3A 4BFIB 5T33H 2NXZB 3WFCL 4IRJC 3P2TA 1SEQH 4XRCA 3DX7B 4DZ8B 3FUDA 2ZYRA 3JBG7 2XKNB 1TT6A 1TFHA 2UXGA 4ZOCA 1LK2B 5MEND 1XB6A 1SVBA 1NAMH 4R7XA 3OB0H 1RK0A 3OHMB 4AH2B 3VFPA 1LE9A 4X6EB 3EGXB 3BJ91 2LLGA 3QJZA 1I9IL 5DURD 5I0WA 4XNZC 1H6UA 2ICEC 1BD2B 5BZXA 2E9JA 4A6YH 4RMTA 4LHJB 3IU4L 1QW8A 3RA7H 1HXYB 2VE6A 3VD3A 4JRLA 4L4TE 2O30A 1P4BH 4N0FB 1ODAA 5IMKB 4Q0XL 4PGBA 4HUVB 1SM3H 2A6IB 4G8FA 5ECJE 3RX8A 3OJMB 4GQRA 1OLZA 4LKXA 3VA6A 4HV8B 3S5LA 5CO1A 3R0MA 1CL7H 2P9RA 2R69L 4UQ3A 4MS8D 3VSQA 3RWGB 2JE8A 4FL4C 4WNSA 3SJVD 4A39A 3CVHL 3SY6A 3EGDB 4WNQB 5CAYB 3CFEB 5JXED 3IU3B 3ARDD 3LPFA 1RIUL 4L23A 3QZNA 4UTAA 2WB7A 2QGEA 4DFIA 1FV1B 3IVKB 3QUGA 4PLKD 1ASQA 1NUNB 3NAAL 4IKLA 5ITBL 4FP8L 3TYGL 4BUHA 1BVZA 3HC3L 3HN5A 4Y9BA 3O3AA 2N1TE 1Q8MA 3BAIA 3VWJA 4AOFA 2ZP8A 1QSZA 3GD1C 4ILDA 4UI2A 3MGTB 1K4DA 4LL4A 2ADYA 3SOBH 4WO4B 5LBSH 1ZGLA 4I13B 3IGAA 4LPWA 3P3SA 1BLIA 4U6YA 2KHAA 3B2VH 2WWKT 3QXAA 3AT8A 3TJPA 1XH3B 3MFGB 3QQDB 4GG8A 2A83B 2B08A 5I9QB 2N0KA 4N68A 3WELA 1HIML 2CCWA 1UWYA 1V3MA 5DJ6A 3UDWA 4ZMQA 5IROD 1SN2A 4YHMH 1C7TA 2VZ3A 2CO1A 5BRZA 1JUFB 3UYRL 4LCCB 2QQKH 1KIPB 3MO1A 3WIHH 4WTZG 5DUJA 2JB6B 3GXDA 4MSWB 1QBMH 5KUMA 1J1PL 4M1GL 1U8JA 1W0WB 5I8KH 1DLFH 3RVTC 4L29A 3O8XC 5E23A 1CICB 1E28A 5E4AA 4HJGB 5DQDL 1FZOB 3G5YB 3IFOB 4IIQC 1DYZA 5AAWA 3EHBC 3P9MB 1SVZA 5I19L 3CGTA 3DNKA 1SQMA 5CEYA 1BZOA 1PS3A 2HT2C 5TFSL 4CSSA 4HU2A 4EVNB 4GXFA 1RSYA 4DCQB 1V3KA 2V7HB 4TS6A 5DU7A 4JPVH 5LHDA 3RL2A 4QCIB 2AS5M 4ZQKB 1YEFL 3UCRA 4JG0H 2GUYA 2EACA 1YZZA 1T1WB 4O51A 3ZMRA 4O58L 2OYKA 3FH5A 3H42L 1HU8A 3PL6A 1O7DE 1AXTL 4U0RB 1KJ2H 5F9WC 3FC8A 2YWZA 1I9IH 4HWNA 4F8PA 1BHGA 4N0UA 4FOMA 2E86A 3IU4H 3ARBB 3FQ2A 4QXTA 4KQ4L 1H15B 1X6LA 1XZ0A 2N7SA 4L2LA 2KZWA 5DD0L 3K8LA 4ENEC 4OD2B 2AVGA 3OC5A 2NQCA 3QJFB 3PWPA 4XP6L 5DZPA 3SE3A 1FE8L 2NNRA 2W80C 1V10A 3RWEB 4M61A 5CNHA 1DUZA 2Q8BL 1INEL 2YMXL 3ZHDA 5CM1A 2DM4A 2R69H 4U1JB 1DBAL 1BEYL 3QCVL 3DSNB 1CG9A 1ZTXE 5F1NA 3CVHH 5E4EB 2NW3B 2R4RL 4XTRC 5SWZD 4Z7AA 3L3KA 1BM3H 3QUMH 1PIGA 3ULAB 3QBTB 3ZL1A 1M57B 4NC1E 3NAAH 2LT9A 4CMHC 4FP8H 3MMEA 1I7TA 3HC3H 2FO8A 3EBIA 1UH3A 3SKOB 2N0MA 4YSOA 4QEGA 1TEGA 1RFDL 5C0IA 4BKSC 4ZYKB 4CU8A 3TONA 1KJ3L 4LVEA 5JIMA 3L3OC 3C8HA 2YPKB 1H3UA 1QI4A 4OI9A 5D2NC 3RLSA 5T1KB 4FTVB 3V0VA 4X4YB 5K9OB 3WEAA 3PWVB 2KLSA 3I75A 5CMAB 1JV5A 4W9GC 4G7YL 2XCMC 4X8GA 5L2KB 3UBXG 1JZIA 1C8PA 4RETB 4HBCH 2MQ0A 2ZOKA 2HWZL 4OCNC 4FA8A 4YAQA 4TTDC 1OD7A 4UTAL 4J3OG 1VF5C 1P5UC 4PJXB 5D6CA 1J1PH 4M1GH 2DYPB 4R7VA 5D7KE 1ETJA 4ZFFA 1RU9H 3UTOA 1JI1A 1GC1C 1XBRA 2PP9A 4S1RH 3MLYL 4CBZA 5EZIH 2ATKB 1DUYB 2YRLA 3PHQB 3ESUF 3L9YA 3Q6GH 5I19H 3QPXL 2VITB 3MR9B 3TTSA 3CHOA 2H3KA 1KBGL 1QSVA 3GHBH 5CHNB 3ATFA 5B3JE 3H9SA 1B4TA 4XMWA 5TFSH 4W70A 1XMWA 3MLSH 4ANXA 2ESVB 3O3EA 4WU7B 3TBVA 1MCSA 3Q8BA 4GBXB 3KZ8A 2R59A 1BIIA 1B9KA 4OCXH 1KELL 3IFPA 5A16B 5I15H 3F00A 3NCXA 4CSTA 3QQ3B 5DQ9B 5I5RA 2BVQA 1AHKA 2HVKA 4QXUH 4XP5L 4MNGE 4Y1TA 4HHAB 4RX4A 2QKIA 2VISA 2ZUQB 1JCKA 1SJEB 1YEJH 1JHLL 1NMBL 2IH8A 3U2IA 3ZO9A 4LB8A 3C75A 1IGIL 5C6WH 4MBRA 3HZVB 1L6PA 4QAMB 3QQ9D 2E9GA 3DV4A 4E5XA 3WTYA 2A74B 4P2OD 5EU5B 5DD0H 3BH8B 2CZNA 2PKDA 4EOWL 4S2SA 1ZVSA 1E2VA 4UMSA 5DLML 5HGDB 1RZGB 3L3HB 4J4PC 1O7SA 4OF5A 3JWDH 4FNQA 2NNAB 2ALAA 3BMWA 1HOCB 4DERA 2Q8BH 4B50A 2YMXH 4JFXB 1PEZA 2HFGH 2FJSA 2RACA 1DBAH 4NSKA 2K6WA 1H3PH 1TZGH 1ZE3H 3I9PA 1E0OB 1S9YB 5JDJA 3MHZA 5CWSA 2EXYD 3RPBA 1L3NA 3AG4B 3GBNH 4KJPC 3CDZB 5TK2A 1LHZA 1BVLA 1E50A 4YE4H 2O26U 2XX1A 3ECVA 1KBBA 2VC2B 1OARL 4K23L 2F5BL 4ZS7L 5K69A 2WKGA 3GBEA 3BYYA 3FQXB 1G43A 5F9JA 2P8MB 3L16A 4HWEH 4HD5A 4N2FA 3EDFA 4R7LA 2CD0A 2AXHA 5CCHE 4Q52A 3GTNA 3LTVA 2PW2A 1TQSA 2OSYA 1D3CA 2BFVL 4FA6A 1T1ZA 2DEWX 1QSEA 1UJ3B 2HRHA 4JRWA 1CGSL 5EC1A 4V2CB 4L1DA 3VXTA 1A6PA 1G6RA 1MI5B 4I3SL 4V1DD 3U36B 4QAWA 1S8DA 4PJ8D 3K2IA 3IGKA 4RBPH 1DZ0A 2OMZB 1SLUA 1YG9A 3BH9A 5I1LB 1VFBA 1ET5A 2QZ5A 4WW2A 3UYPB 4TTGA 1N5YL 3S37L 4C4KT 1DVFB 4LGRB 2LLNA 3PF2A 4OQTA 3L5WB 2C9AA 2P48B 2AKRA 3HZMB 4FKHA 2DW5A 3MLYH 4UT9L 1F4YH 5IIEA 3VXRE 4NO2B 3ARTA 3H4HA 5KVEL 4HBQA 5KJ4A 3W9EA 5GS1A 3V4PB 3OJ2C 3WHXA 3W0WA 4AW4A 2VN6A 1IQWL 5HDWA 3ULUL 1T5WB 3QWQB 3WD5H 1A4CA 2VLKB 4XCFL 2ITCB 3MLWH 4JM2B 3WXWH 3QEQE 3RJDA 2M26A 3QQNA 3J7HA 2AEQH 2KYIA 3OSKA 4MD4B 3SZ6A 3HMWH 1CI5A 4DWHA 3T4AC 1T20A 5CLZA 4XNQB 1EHNA 3PE9A 4XN1A 4KY1H 2PWEA 3GJFB 1IAKB 2J72A 4G59C 5E8EB 4W9IC 2FO1A 4XNXH 4I18B 4WUUA 5JDSA 4ESKA 3M88A 1PFCA 4Y2DB 1T22B 1J8HB 4ONGH 4R0LC 2Y6SD 5AVWB 5ISZA 4P04A 4AYFB 1JHLH 1W6LA 4AUYA 1IGIH 1GGBH 4ZUTA 1OPOA 5HDRA 2GSMB 2FYVA 3MV7D 4OVVA 1XCTA 4UDUB 3QXDA 2W0PA 5H37A 1QASA 1S7VA 2XIIA 4G2AA 2KUTA 5HDBB 2DKSA 3CUPB 4ANUA 4W9ZA 5KOMC 1PZDA 3SOTA 1ND0A 4PVMA 5AKVA 1CIUA 3QFJA 1ACYH 3F7VA 3O9WC 3NA9L 3ZDWA 4EI5A 1BREA 3MROB 2LR4A 3MKKA 2VDPH 3O3UN 1FL6B 1QWUA 2H26A 5IZ7A 1H6FA 1CJYA 3J8F7 4JUTA 4ZNEE 4S1DD 1NGQL 4YO0B 1MCWM 3BFQG 5C3IA 3WNLA 1LP9A 3NACL 4IBWA 1FC1A 3FCGA 3WJMB 3VFVB 3RWIA 1G7MB 3TJEL 4LAQH 5HHNB 43CAA 4NKDA 4PJ6A 4X6CA 2JTDA 2MJWA 4LNRB 5CKGA 3M6DA 4KJQD 4L4VB 5CGYD 3GBML 4GUOA 5BV7B 3MNVA 1OARH 3DHUA 4PRHD 4ZS7H 2EDEA 5E5UB 1IC7L 1JWUB 4KROB 4QHUA 1FDLL 3CFJA 4JFDA 4OZHE 2X4UA 4XZ4A 5DJ2A 3VCLB 4R8WH 1Q90A 2Y06H 2PLTA 2VLLB 2AJXL 3UP1A 1DJGA 4BELD 3MZTA 4ZMOA 1P7BA 2YBRB 2MTAA 1EZVX 1HDMB 3UBXB 3ZGIA 4RNRB 5DZNA 1M3IA 3PJSB 4G70B 2YJLA 1MCRA 2UY6A 1NICA 2X0WA 3K5SA 1G87A 3LNEA 3Q2CA 4N90E 5EU4B 4G9FE 1IC5L 3BCDA 3EOBA 3OX8B 2Q20A 1WWCA 4QRRD 4EE2A 4ISVA 3U6RB 3PWLA 3QI9A 5E99H 2E8YA 4J27A 2H1PL 2AP2A 2PCPB 3VXSB 3KJ6H 3F12B 3HG0A 5BS0B 1MH5B 5INCA 1RAMA 2C9PA 3F5WA 3U30B 3DDFA 3V6FB 2P5WE 4R5VA 4MXQC 4UT9H 3EYFB 4K8RD 2QR0B 3MLPA 5DRNA 3OHXC 1XF5A 4XPHL 1I53A 2FT7A 4MJ5A 3TH4T 5KYWB 1N7MH 2XXCB 5AG9A 4XCYA 2OXHB 4MNQD 1MREL 3ZQ9A 4Z6AT 1GS8A 2WXJA 3UBXI 3TIEA 3TT1L 3P2DA 3QPKA 2BFGA 1IJ9A 2BVOA 2FO4A 3RIAK 2UX7A 4F3FA 1UT2A 2MNJB 1JBJA 1NOAA 5DD6B 3EFFA 5G55A 3S8GB 5SWQA 4OJEH 4YLBA 3BUBA 2V7NA 2AMUA 3HKFA 3JWDC 1ES0A 2BDNL 3IXTA 3NGBC 3VGAB 3EYOA 3ML9A 4NGHL 5I6MA 3N44B 3QHZL 3QYNA 3RGBA 4DAGL 1ZE3C 3WL9A 5T3XH 4POZC 3MU3A 4HJEA 2D0GA 4TXVB 1NC4B 2ZSVB 5T1MA 4K5LA 4BWUA 1ET7A 1OHZA 4TMPA 3FT4A 2W92A 4GXVH 3IMUA 4POYA 3UZVB 1P4LB 1KCVL 1ADQH 2MKWA 2NR6D 3S6CA 5D1ZD 1XVSA 1M2VB 1H9VA 1ZKAA 1QI3A 2J6EA 4LQFH 3UTSA 1MHPL 5E6IA 3KPSD 5I1EL 2EEAA 3BPOC 4UCFA 1QQDB 4AM0B 4CC1A 1FVEA 1U8KB 1JVOA 4LSPL 1M7UA 1JK8B 4BZ1H 5HGHA 1YEEL 4NDMA 1TMQA 4HSAC 1SOXA 4OM0H 4MJIA 4PJBA 2G4GA 4KDVA 2XJLA 3VFTA 1EZUA 3S4SA 2W60B 2AJXH 3I2CL 2WTOA 1J48A 2WZPA 3N1MC 1H3WM 5AUMB 1SVCP 4MWFB 3QK0A 3P4NA 4Q2ZA 2P80D 5FUOH 3GI8L 1D5XB 3KYMB 4JFED 3GGWA 2IAMB 5ADPH 3V52H 4LVHC 4ZMPA 2F5AL 1IC5H 4XB3A 1IGYB 3PPSA 5JPNB 1T4KB 2XZCL 4M56A 2ZWKA 2M83A 2CRZA 3MKGA 5D1XC 3OB8A 1CDCA 3STZA 3M17B 3TPKA 4GKOA 5A43C 4Q58C 4Z77A 1II4E 1WICA 5D93C 2GAZA 3VB9A 2Z91B 4WGVB 4AJ0A 2QHRH 3GMNB 1NA8A 4QT5B 4DPRA 2N59A 4NLHA 1DSWA 2KQNA 2WAQA 3QDMA 2VDKL 1R47A 2QFRA 3N85L 4CBPA 1D5MA 5EU7E 4N6QA 3VQ2C 4Z78B 2D0FA 5JW3L 3O81A 4ZMXA 3C09C 1QR1A 5F8RC 3SZKC 1MREH 1UXSB 3Q44A 1V7ML 1M7XA 4IBUA 3TT1H 3FH8A 4WNJA 3GB7A 2X6BA 3B9VA 5DRXB 1TJGL 2XHNA 3OPZL 3ARGA 4H8HA 1RLBA 4U4IA 1KPUB 2C9UA 1IFHL 4P23C 4L8SC 5I0VA 5AL8A 4N2DA 4RGOH 1KWGA 3QZWA 1YEIL 7CGTA 2X4OB 3TN0A 5D7SH 2VDLL 3QHZH 2W8CA 4APXB 5KYUB 4XMPL 3IGLA 2ZG2A 4FLQA 5E8DL 5CJOL 1MFCH 5CU5A 2DDQL 3MLUL 1X44A 3AJ7A 5FGRA 3OV6A 4PP1D 2MHAA 3U2JA 3IAGC 1S7TA 3CVIL 4WW2F 4MXVF 5IESL 2ZSWB 5JA8B 5D7LB 4HYTB 1KB5A 1XGTA 1YA5A 2ORBH 4KKCC 2XETA 4ZX3A 1K3IA 5B38G 1GMIA 4OGXH 3MX0B 3NPZB 1MWAB 2F58H 2X38A 1OGSA 4QHNA 1HNYA 1S3KL 2Y1ZA 3CFIC 5F2FA 1F6AA 1SN0A 3BPNB 2CWRA 2DWTA 5CGTA 4H13C 3WY1A 1UD6A 5I1EH 3F62A 1WA1X 3L6FA 3NDYE 1CDYA 3CHQA 3QRBA 3VQLA 4DKTA 1D9KB 1FAIL 4LPYA 1YEGH 5E2UL 2YWYA 3E6FA 3RILA 2QKSA 4ZPVB 3TEYA 1SFHA 1N8ZA 3CFDA 6FABH 4W93A 2YBGA 1V54B 2EABA 3IGUA 3GTVA 4YVNA 1FYHB 1Z9SB 3O4LB 2DQJL 1AG6A 3KPQA 1FVDB 3V10A 4CU6A 1MCIA 3L95B 4DUXA 3VD2A 1SY6H 3BP4A 1BSIA 2GT9B 4OZFA 4PJGF 4ZW6A 2F5AH 4G8GA 2YGPA 5IG7B 1A6WH 1TJHH 4N1EA 4DP2X 5EG6C 4TLSA 4LBAA 1OM9A 3LS4L 2J6EL 3T6WA 4GMSL 1ZLWK 3HS0C 1ZLUH 1CXKA 3S88L 4Y4KD 4PJGB 5EUOA 3HRZC 1KDJA 4YXKL 1AE6L 2XTSA 3ROOB 3D0LB 3UAAA 1U3NA 2EVGA 3FOLB 4UTBH 4XPBL 4JY6B 2CO7B 4A2DA 2AJ3A 3BGFC 4L3EB 3EBAA 2FJFB 2EJ1A 3IDIA 3B6SB 4MNHA 3IMVA 1U8LA 3COOA 4XN4A 1EK3A 1GYUA 2VDKH 3L4UA 4X6CF 5DK2B 1QFWL 1FL3A 1CE6A 1K8DB 4PMEA 4R84A 3G5ZB 2NSXA 1ZJBA 5JW3H 2FIKA 2ENYA 2HFEB 4LSRL 4XB8A 3NSYA 1KLUA 1V7MH 3KPPB 3KYOA 1CLYL 4NT6A 1AO7E 1TXKA 1GHFL 2WQRA 3KEHA 3MN8A 6TAAA 3X1EA 1KT2A 3QUZC 1TJGH 3OPZH 2XWEA 4P46A 5CEZL 1PMYA 4PRBA 1B9ZA 3DDGA 4F7EA 1XD1A 5TK4A 4NN7B 2Y36L 5I18L 5BJTB 4QYAA 2BNQA 5HJDA 3RPIB 5HI5D 2KLRA 3E38A 3EOAB 2H0EA 2CJUL 2IPUG 2QADB 3FF8A 3MRPA 4A7SA 3UOAB 5D4IA 4XMPH 3WJLC 2IPKB 2X53A 4DK3A 2DDQH 3MLUH 1OM3L 3VJ6A 3DO3A 3K72A 3NESA 1NJ9A 1KUMA 1IKNC 3QIBD 2BHYA 4LSQL 3GHEH 2HUEA 1XGRB 1G7LB 4ZMYA 4I2XA 4GQPH 3FBQA 4LHUB 2GBTA 2YLHA 1UWGL 1HWWA 1OWRM 3LHPL 1WH0A 3ETTA 1CBVL 1UADC 4HEME 3H3KA 5L2KE 4YIQA 1XR9B 4P9MH 1LQBC 3ET9F 4LLUB 4XNYH 1FFPB 1WCBB 3TBWB 2ZAIA 1UCTA 5D7KD 2P5PA 1KCUL 1Q9KB 3BT2L 1LDPH 2Y22A 4WSJA 4Y2NA 2X4NB 4FI8A 1ZSDA 3CK0H 4HIIB 4R6UA 2K4AA 2YFNA 4Y5VC 5FW6A 4I48A 4H1LG 3V5KB 3DBXB 3LXCA 2BHFA 4FQLL 4Y4FD 4R4ND 5A2KH 1RCYA 3UEZA 4EBQL 4J12A 1MKFA 5HYQB 3KE0A 1KB5L 2BIQA 5F7LB 3TEWA 3FQTA 3MCG1 3OR6A 1JGUH 4HEPG 4D9RD 4NO3A 1NIDA 2O6EA 4TPRL 3FQWB 4TUOA 5DMGC 4HKJA 4JFUA 1F45A 1GCYA 2ESVE 3F6IA 3BWAB 2QVKA 4XP1L 3SDCC 4QYOB 3Q2VA 1V7NL 3LS4H 4GMSH 3UJJL 1UM6L 2M2DA 4O2CA 4E36A 4GKZB 1N0XH 2YQGA 4R2GD 4U3SA 3D08A 5AVZB 3BUPA 4JQIL 2NTFA 1ZLDA 4YXKH 1AE6H 4PRPD 1G7PA 1U91A 3RG1C 1UJTA 4U6XB 3ZE0F 1K5NA 1GVIA 5T1LA 4AYSA 4K3DL 4G43A 4BZ2H 1WTLA 3C5ZB 4LSSL 2DTSA 2Y2YA 4IIQA 5FA4B 4Z7OB 2IBZY 1WIOA 2APWA 3LZPA 3R19A 2EYRA 1Z6JT 4DGWC 2C1PB 3AQXA 5MEQA 1OAKH 3EADA 4YPGB 2ADIA 1GHFH 4PJBF 4NQUA 4R97C 4HJ0D 5HYEA 1IBFA 3KLAA 5CEZH 2DQGL 2P5ED 2EE0A 3CN4A 3REVB 3RVXC 4EUPB 4FFWD 4UQBA 1OW0C 2GJZB 4OJAA 1BZ9B 5C0EA 5C0BA 5KSBA 1CFNB 1F90L 2PCFB 3D05A 4ODHH 3M7FB 3MDJA 5B1JA 5I18H 1CGUA 1C5CH 3ZKQD 4KWUA 4ODUA 1UASA 3QDGB 3BW9A 2YD0A 1TCMA 4A2FA 3IJHA 4G82A 3LB6C 3ETBF 5DUBA 3LRLA 4V2BA 3WKML 4EAEA 2CU9A 4MAYA 5EFIB 4WV1A 1F00I 1Q1PA 3G3LA 3IMWA 5SX4I 5TH2A 2BIOA 3RDTB 1BWWA 1VFMA 3K6DA 1TO5A 1Z7JA 3TO2B 5B38B 4E41B 1T89A 1IAIH 4HWZA 3ULSA 4FQQA 2VMCA 4XMLL 1AJ7L 3C9NB 3KH4A 2VSMB 4X8JA 3I74A 4AGNA 5FC9A 1LEIA 2YN3A 3PNWB 2WLKA 3FCTA 4DOHE 4P8QA 2OKMA 4WWNA 1IFRA 2QV4A 4PV8B 3BAKA 4S0TD 4X0KB 4AQEA 3ZE1B 1CBVH 2FWSA 1RZ7L 1D5BB 1OTSC 1J87A 1DQJA 1UENA 3TNNB 1KCUH 5BOZG 2WLMA 1N4XH 3FULA 4JRXE 3BT2H 3O6FA 3ISRA 3LKRA 5F6HI 2VLRB 5EF1A 1JGVL 2R9HC 3CX2A 4Y19B 2DLIA 5F7WC 5GRJH 4B9GA 4HPOL 1RI8A 1FFOA 1VHPA 4Q4EA 1T0OA 1DJZA 4RFNC 4P4KC 2PXYB 1Q0YH 1U8NA 5FKPA 2F54D 1JNHB 4ZFOA 3EYSL 1FFNA 5EOQH 3GSQB 1LNUA 3ECBB 2RIKA 1VACA 2AXWA 3DX8B 4TPRH 2YRPA 2VLKE 1E9QB 4WWKA 5I1GH 2XQ0A 4NOFA 3ARFD 4XP4L 3Q48A 4LLMB 2EXSA 2DOCA 2GUOB 4LP5A 3BDYH 2W9LA 5E2WL 3UJJH 2DAVA 4R4BA 2EO9A 2OMWB 4DTGL 2DEXX 4PU2A 5EZOH 1IGJB 5KAQG 2XG5A 2W38A 1E9OA 3VYPA 2O6CA 2AJZA 3RNQA 3B37A 4K71B 4ELMA 5DT1L 3K6IA 3RTQD 4MQXC 3V6OE 4FI7A 4K3DH 4QY8A 5DZVA 1LEKB 4MDIB 2WQUA 3OKOB 1QNIA 3SDAA 4WTXA 4ZXBB 3HC0A 2ED9A 4CN1A 4J3SA 2UWEE 2WZ0A 4QF1B 3VQ1C 4QHPA 1T7YA 4J8RB 2J55A 1VCBC 5E5MB 1MCLA 3CSYA 3NFPA 5D2LA 4OZGB 1CB4A 2HCZX 1X6NA 1SEBA 1XH0A 3D30A 3LQAL 4RMBA 4I9WD 3AGVA 2YO3A 4JVWA 4MA8L 3MLXH 3MOBL 4XWGL 1F90H 3C5JB 2F18A 3HI6L 3X13B 3KYAA 3GDCA 4GRWE 1VIWA 3DC0A 4MXWH 3SD2A 5FV2A 1VB9A 4Z7WB 1L0YA 4OFIA 4F27A 5I1HL 5ADOL 1AR1D 4ICWA 4HFWB 7TAAA 3WKMH 5E95B 2XICA 5E03A 4X5PA 2BOCA 3G6JA 2CNYA 4HK3J 3TZVA 2JJSA 1KTDB 3AREA 4KUCF 3S37X 1D7FA 3S3BB 4WAFA 5HDLA 3C6SB 2OBGA 3HW7A 1S7QA 3UO8B 2R0ZL 4Y5XC 5BRPA 1FFTB 1ML0A 5F1IB 1Z66A 5EIIA 5JXEC 5FDYA 4A7GF 1X5MA 4W4NA 4B95C 1EVTC 1ECYA 4W9LC 5F88B 3VGDA 4QLRA 3K80A 3V8OA 3X12A 4BQCA 3Q06A 1BQLH 1MFVA 4H1LB 3L7EB 3U48A 4AMKH 2GTWB 2P5WD 3VXSE 5KVDH 4LOFA 2WPGA 4D8OA 5DRWB 2VT0A 4YSUA 3ULVD 2ITFA 3VFSA 4IRJB 3IT8D 2OFQA 3RE0A 4N6RA 3E3QC 3TWCL 3IFLH 4JG1L 2NXYB 3MRDA 1QUNB 2GK2A 3GSRA 2FEEL 2WUCL 4MMXA 1E8XA 2WBJD 3CHRA 3FDWA 4NAJA 3CHXA 4RMUA 1NMCC 2IV9A 4IRSA 3C8KB 1T04A 2Y7LA 4KO6A 1FG2B 5DJZA 2OSWA 5IMMB 4NZJA 2WO4A 2AQ3A 1HHGB 2VIRB 1AXIB 1J9CT 4N8VG 5A2AA 1R5IB 4XNZB 2ICEB 1PLGL 1U30A 4U2ZA 5EU3B 3LZQA 4QTIL 4RISL 5IM7A 1MCFA 4FYTA