4C4BA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v in the reduced form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
MELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
total genus 26
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4c4bA00
2AMUA 1VZIA 4BFFA 4BRVA 1DQIA 3QZBA 4BV1A 2JI2A 2HVBA 1DO6A 1DFXA 4BK8A 1Y07A 4C4BA 4BFKA 4BRJA 2JI1A 1DQKA 1VZGA 4C4UA 1VZHA 4D7PA 2JI3A 4BFJA 4BGLA
chains in the Genus database with same CATH superfamily
2ZICA 4HS6A 3BZDA 1BXUA 3ECUA 2DQDH 4NRXA 1P5UC 1G94A 2JCCB 1Q9WA 3FFOA 4PHZA 1BOGA 5D2LB 5BRZD 4W9ZA 2OW6A 1TT6A 3SGJA 2V7HB 2WD0A 2HG5B 1MWOA 1A4KA 1EXGA 1ZEAL 4RNRA 2BNQB 2GSIA 3PPEA 5EOTA 2WQRA 4Q97A 1IM3A 1IAOB 1XZWA 4IJTA 3RNQB 3VI4B 1FUNA 3BQUB 1QFWH 4LL4A 1MN4A 2AQPA 2J5WA 4AQ1A 4EDXA 5HPOA 4KVCL 3OLGA 2J1XA 5FB8A 1FN4A 2ENQA 2O6EA 4KKRA 3FCUB 4MX7A 5IBLD 3K2KA 1S5HB 3GXTA 1B4JL 1ZHKB 3RZCB 4Y4FA 1U6AL 4RZCB 3AG1B 1OK8A 2E27L 4BCZA 1QUPA 5LKNA 1KJVB 1ZT1B 2WZ0A 5LNDA 2LU4A 1Z9MA 3SO3C 5CAYB 1QTYT 2OS7A 3AT9A 1DQVA 4ONFL 3BAIA 4OSUL 2FWLB 5L0QC 5GGUB 3EBGA 1I8MB 5E4EC 1DBMH 2BVEA 2QQNL 4FX5A 3LYRA 3BWSA 3LIZL 3EW3B 4P9HC 3WHXA 1K5WA 1O0VA 2QQLL 5LGJA 3D85B 1A7BA 2AEIT 2FGWL 4UT6A 4F5CA 4I2XE 1JDDA 4MCYA 5FUCC 2J8UA 1PU0A 4CN4A 5FKPB 3UMNA 3CFBA 3WFBH 3RIAK 1BD2A 5MEOA 1NFAA 3JYBA 5T1DL 4P59H 2HVBA 2NXZB 4WTXA 3ZKMC 2FQDA 3GB7A 3BPNC 4KQ0A 5CEXA 5JZ7D 5A2CA 2R2EA 1RZKC 1AANA 3GHBL 3O45A 4JFDD 1MIEH 3BHBA 1S7UA 2H9GA 3ECBA 5BW7A 1M42A 2K6ZA 4QXUH 3CFKB 3LS4H 5L6YL 1NBVL 2MNJB 5J4MA 3S5LA 2WNXA 1CDHA 2CJUL 3F6JA 3IBOA 1NANH 1JXDA 2YQ3A 4UZSA 4ZO9A 3RJDA 3O3EB 4I9WD 3UTTB 2GJ6A 4XMZA 4OQ1A 2QGCA 5AVVB 5JHLA 1XGYH 3L95A 4LIQL 2OFQA 2QEJA 5F6IB 5ILTL 2BIQA 3LPGA 3PAVA 4LLAA 1D5ZB 1GGUA 2BIIA 1U58B 2WVSA 2XWDA 4NT6A 2FWOA 1RUAH 3EHBB 3BMWA 4ZPVA 3K71B 3TESA 1ACZA 2PNDA 4NQCB 2GIYA 1GPOL 4YEEA 3K6SA 3SPGA 2KL6A 4HAGA 4JKKA 3TBSB 4N8CH 3VFPB 3CDZB 2J1KA 2R1XA 2WLLB 2DM4A 2QFPA 3CFCH 1XVSA 2X1PA 3TVMB 2UZYA 4O2CA 3HRZB 1BFVH 4PJBA 4H40A 1Q0XH 1VADB 1HZLA 2CGRL 5C86A 4JFPB 4YIQB 5JORA 4AQ8A 3QPQC 3L54A 3M17B 3OPZL 4PUBL 3H9SE 4AMXA 5FFGA 1N0LB 4PS8A 4HXBH 1LP9F 4EJ1C 2G4EA 5HPMB 2X53A 3Q43A 2EXWC 5FYJD 5A2KH 4HIIB 4I0PA 2ZF8A 3UCQA 1INEH 1S9WA 1UG9A 4HA1A 4MDJB 1BGXH 1N9PA 4DP0X 3TJEL 2R29H 3QUZC 5TF1L 1OGPA 3EXLA 4JPWL 4S1QH 1UFUA 5E6IB 5FHBL 3P4NA 1ZT7B 1E2ZA 5DUBB 3KNBB 3RGVD 4ZMPA 2JXMB 1YJDH 3VVWA 1EO8L 1RZFL 5DEJA 4JDEB 3V4UH 5KSAB 4XO5A 2IANA 4J5VA 5D1QE 3MI6A 3SDXE 3QGVA 5HY9B 3ENEA 3T9WA 1HQRB 1OGAB 1AI1H 3FU5A 4X5XA 3M6DA 1ASQA 1WGVA 3ZW3A 2YAQA 3WEBA 2A9NH 4F2FA 2FATL 3MZTA 2DEWX 1ET8A 2R1YA 4Z3EA 4LVHC 5DJZA 2F58L 4YDJA 4F7EB 1UJ3A 4W9JC 4F7PB 3ULUE 3BP4A 2JB6A 3RHWF 1FGVL 1AH1A 4X6DA 5FUOH 2HFFA 1XR8B 1M05A 2EE0A 1KTCA 1WCQA 3CHSA 2YD6A 4OLEA 4AXWB 3STLA 4PRAA 5JW3H 1EHNA 1CICC 4WTZA 1QAWA 4ONHA 5KVDL 4JNXA 5LGHH 1KEGL 1BF5A 3UEZA 5C0AD 1SOXA 3HE7C 2WZ6A 2EEAA 4BHUI 4N9GB 4QF1B 5DFVC 1KGJA 2YMXL 2PCXA 2FUQA 1U8IB 4FYQA 1W72B 1WICA 4MD4B 4Q4EA 1HL9A 1NEPA 1ESOA 5C0FA 3S5ZA 1X9QA 5JHDB 5ANMB 5DRNA 4A37A 4GIAA 5HHXL 4JMXA 3OAYH 1COBA 2OMYB 3EOAB 4KKPA 5AG8A 5D1ZC 5CD5D 1FIEA 1SZNA 2EYRB 1Q1PA 2MFNA 4KX8A 1MJ8L 2DH2A 2JTYA 1R0AH 3TH3T 1GYCA 4NNPL 3VI4A 4F5CE 1F6LL 2BJMH 5TDPB 2P80D 1XF5B 5I5RA 4LSSL 5J6SA 1BD2E 3VXTB 3REVB 1C8PA 1U92B 4NPKA 3V52H 4KTGA 2E6QA 4L3AA 4LRNH 1FF5A 3LS5H 4A7QA 5IJDC 5EEXA 3RZCA 2XV0A 2WZPD 3NFPA 5AFAA 3GXPA 3V6OC 3SE4C 3PDOB 2FHBA 4RAUA 2DN7A 1KJ3L 1PZ2A 2A9DA 3DV4B 1EFXB 3MBWA 5H37H 3JYCA 1I3VA 3EADA 1A0QH 5DJ6A 1KCBA 4L8SC 2F8VA 2VJ8A 3DO7A 1S7TB 3P4OB 3MNWA 5JQ6H 2NYKA 4EQ2A 2FWUA 2ARJB 4AL8L 1JNJA 1QI4A 4M5SA 1HHHA 2YUVA 4S10A 3SCMB 3CVIL 2P24A 4IU3A 4X9FA 2FX9L 3L7FA 4K5LA 2FRGP 3PQYA 4PM1A 2PYED 5KJ4A 3TN0C 5FDWA 4WWKC 3SQBA 4S1RL 3VM7A 3PNWB 4PRBB 5AKRA 3GXUB 2A2QT 4AGNA 3TC9A 3AG4B 1R17A 3HZYA 1J87A 4MA1B 1N5AB 1FA4A 1AR1D 4DFIA 3L45A 3MBEC 5I8OH 5GS2H 1H5BA 1A2YB 3U79A 2X2UA 3DXAA 3QDJD 4OLZL 4ISVB 3RKPA 5L4IA 5I1IH 4UTCA 2YSTA 3BUTA 3CN0A 1KGCD 2Y1YA 3TNMA 5KSUB 2I5YL 4NKMA 4U1HB 3PL6B 4BUGA 1QNZL 5IBTL 2G3ZA 3I6SA 1CE1L 4WKXA 4PYHA 4NGHH 1QZ1A 1F00I 2OJEB 4PN6A 1B0RB 3RVTC 3E2HB 5CIPA 3WAKA 4JM4L 5HD8D 3C5ZA 43C9A 3IAQA 3N1FC 4BK8A 3PGDB 3T2NH 4Q9RH 3KXFB 4AVIA 4D7BA 1J11A 3I9PA 3UEQA 3NAAL 5C08E 1D2OA 1I9IH 3D50A 4KH9A 1J7VR 3VXNA 2R2HA 3EH4B 4A7SA 2EE9A 3FU0A 1VFMA 2D7TH 1KCRH 2R7EA 3JWDH 2EEBA 1OCWL 2BM3A 5D93C 1DJYA 3HNVL 4Z7OF 1LO0H 2V5MA 1A6AB 4KRPB 1JIBA 3SPVB 3P77A 2VLRB 4Z3TA 3OV6A 2OXGB 3AS2A 1V7ML 1CD8A 2F08A 1M9WA 3S35L 4X6DE 3V8CA 3GBML 1QTPA 3NTCL 5BS0A 1NAML 4ZMTA 5CBEB 4FTVE 2KC0A 3UPAA 2TSBA 3VA6A 4RWYH 1RK1B 1EDHA 2IDFA 5DQDL 4TQIA 4ZOEA 3P3TA 4XPAH 4GAFB 5FOJA 3NN8A 4KNUA 1MLCA 2BWIA 4ZMAT 1F8TH 4IRJC 5D72L 3PP3H 3WXVH 4LSVH 4ZNEA 3HPLB 1BEXA 3B1UA 4LSRL 4U6YB 5FGRA 1TQWA 2KERA 3W0WB 1LM8V 4N24A 5GRWA 5E9DD 4OZHF 2IDTA 4J3OD 1AD0A 3VFNA 2XN9B 4Q9BA 1FNLA 2NTFB 1YUHA 2NY4C 3EYFB 2RIKA 5HHOD 1Y6NR 4UT9L 5DURB 4F7TA 3OKNA 4XNMB 5HYQA 5T33L 3GMQB 4X9GA 2PYFA 4EUPG 1UD4A 3IRZA 1IGTB 4AM0B 4O5LL 1L5GA 1MFDL 1BJ1H 2V9QA 3HZKB 1TCMA 3SYPA 3OJDA 2ZXEB 4KRNA 1J1XL 1KYOJ 2NCEA 4PPTA 5DUPH 1BIHA 4WHDA 4F1ZA 5INCB 4LOUC 1IM9D 4H0IA 5IQ7H 3DX8B 4K8RD 3WIHH 1Z5YD 4HJEA 5CN1A 1I9RH 2YLHA 2B1AH 3A0OA 3QNFA 4OF6A 1FO0H 4X5WB 1IVLA 1B2WL 3B9KC 4OZHB 1F58H 1UXWB 2YJLA 1TSHA 4MCMA 1P1ZA 3O11B 4JO3L 4P46C 1MFBL 1YYML 1M71B 3UGEA 1XGRA 4BCXA 3L4UA 4IYKA 5F3HB 3PGCB 3JVGC 4TQHA 4BSJA 4FAAB 2QKSA 2WQWA 4HKZA 2HKHH 2QGEA 4ZFOB 3S5YA 4YEFA 1SLWA 3CG8A 5D7KD 3GSVA 1UHVA 5TDPA 4PGEA 3L9YA 4BH8A 2FR4A 3RI5K 1UFGA 3UTOA 4EMZA 2PCYA 1OW0C 4EN3C 3ZZLA 1DQLH 3C60A 1T1YB 5E6YA 5L8KB 3CVCA 2NY0B 3PJNA 3T3MF 1DVTA 3WEAA 5I76A 1GS7A 1WEJL 1J88A 3ALWA 5D8JH 3T2OA 4FQJL 1HZHH 1U42A 3ZQXA 1C8QA 4HPYH 5EU3B 1H6TA 3GSRA 3SKNA 3WEXA 2NQDA 3B3IB 2WMPA 3D48R 4JAMA 4XCFH 3DV4A 3OAYK 1THCA 4N26A 4MMXA 3IRCA 2EDRA 4YMPA 1MCWW 1MH5B 2ICWJ 4I18A 1ZTXL 4N2LA 3T0BA 1SXZA 4CNIB 4UBDD 3LNGA 3EFFA 4MJIA 3MXWL 4GXFA 2BW5A 1WFNA 4X7SL 2VLKD 4Q14A 2ZCHH 4ODVL 3H54A 2WCPA 4QY8B 1I1RA 3JV6B 1Q38A 3KWTA 1IEBB 3DUHA 5JDSA 3ULVF 2J5LC 1BLIA 2A73A 4RVBA 4F9PC 3T3MB 1WZAA 4QDGA 4NJAH 3BKCH 2A6KB 3Q0HA 4KI5C 2RQ8A 1U8PA 2HX7A 2HJLB 3DX3A 4H88L 5IW6A 3QEHB 4G1MA 4XVUC 4I3SH 4JDZA 3L1OL 2XY1A 4ZXBB 2BY1A 2BOCA 2VE6A 3L4ZA 1BQRA 3TO2A 5AW5B 5DS8B 4PJCE 1NBCA 2YKKA 3MUUA 3VSUA 4DAGL 1BMWA 1OSPL 3GM0A 1KBGL 3CVHL 4LLDA 4PJ5D 4UNTA 1NLDH 3K1KC 4APXB 3GSNH 2IJ0C 4XP1H 3UOAB 5E95B 5BS0E 1EBPA 4FULA 3IMUA 4Y2NA 4A2LA 3D0VA 3DJTA 3KGSA 1YEEH 3GJFA 1BW8A 5CD3A 2YQGA 2CO2A 1KB5H 3U7AA 3ETBF 3CZJA 4HP5A 3GLZA 1RJYB 1AQDA 5LBSL 3WS6A 1AHWA 1HWHB 3LN4B 4C56A 4DP9X 5CEYB 3VRLE 4F1SA 1WT5C 2H0JA 3V9FA 3WNPA 5JMOC 3KZ8A 4M1DL 5ID0B 2CBTA 2FYVA 1NL0H 4XB7A 2KQMA 4JFTA 4OKVB 4RRPM 1RPQA 4Y5YB 3T6WA 3RUGE 5BMFL 3B43A 4AC2A 4KFMA 4J8RB 4N3TA 4O02L 4U1JA 1Q94A 4BUQA 1LWHA 1UGKA 2BHZA 1P84J 2GYSA 3MVSA 4EBQL 5IFAL 1JWSB 3F62A 4JCWA 3CFJA 1T0OA 2CO7B 1PZBA 1YO4A 1DLHB 4Y4HD 3QDMB 2V7NA 3MJ8B 3QJHB 4MBRA 2HP4A 3BAEH 5FR3A 1LJMA 1J0YA 2Z8RA 4AV4A 3OD3A 2WVVA 1G7HA 1T0NA 3P30L 1O6TA 5GS0L 1RCYA 2AJVL 4UU9A 2OZ4L 3CHOA 2EIKB 5IF0B 3G04B 1MG3C 3ULUH 3D34A 1FIGH 5E8EA 3NEEA 3UBXB 4H8UA 3RA7H 4X8XA 2ESVD 4QXGL 2QMJA 2R2BB 4M93C 3NJFA 4P2RB 3HG5A 3V4VB 4Z3IA 4CW1A 1MNUH 4ODUA 1CG9B 4OLUL 1TG8A 2VDRH 2L7QA 3N40P 1Q9OA 4FFTA 1S78D 2I25N 3ZHLA 1T21B 2B20A 4TVUA 1KXQA 2D7MA 1LK2B 4FFVC 2ZNWA 1E9OA 3IGUA 3NK3A 1LMKA 3VVVA 3PP3K 5I18L 3D52A 5CZXD 4M8QA 3QJUB 2NYZA 1SOKA 4M7KH 1MF2H 2F74A 1WITA 3E6HB 4BQ6A 4N8VG 2H3NA 4OW6A 3T0DA 4DUXA 3F65A 3P3SA 1YNKH 4NBZB 5D7SL 2EXYC 2WB7A 1OGSA 3TBVB 1DJWA 1A6VL 4N0CC 4A2HA 3DV6B 4PR5A 5C3IA 5IFJA 5EHFA 2Q7AA 4B9YA 4LZKA 2C7UB 1CMOA 2OCFD 4NI6A 2DBJA 1U8OB 3LVEA 4E42A 2EDKA 3GYRA 3DGGA 3LRKA 4M61A 1I8KB 1I85C 1ZSHA 2VXVL 3BDYL 4HWEL 4YN3A 3V6BR 3KLHC 4FQXB 3FO0L 1QLFA 4IBQA 1MHCB 5HJGA 3U9UB 5DRXB 4RSYA 1NCDL 2YEZB 2W94A 3QORD 1ZWIA 4JEGB 4TUKH 4G43B 1KGUA 4W9HC 4K73A 1VFBB 1J48A 4K3EL 4C4UA 2D7PA 1AD9B 1KLGA 1LD9B 3UGUA 3KBHE 4AVKA 1IBZA 5ISZB 2J1ZA 2QVTA 1C9SA 1FG2B 4FQQA 2XWXA 3WO3B 1P4IL 4QRRA 5MEPA 2BERA 2VL5A 4PJGF 5BPPA 2W07B 1T2JA 4AKQA 4DSYA 2H4EA 2AJXL 1AO7B 1U8JB 2ZX7A 4GNKB 4KGLA 3QYCA 4N2KA 1HHJA 3T6ZA 4S1SL 3WTUA 5H8DA 2ROXA 1XF3B 3TBWA 3FUKA 1MW1A 2AITA 1PD0A 5AL0A 1E9PB 4Z76B 2XRAL 1K8IB 2MTAA 1MELA 1ANUA 2YPKB 2H6PA 1WBZA 1XGTB 1W0YT 2JCWA 2XDHA 4IGBC 2VLME 5LCVL 4AUUA 1B90A 4C56E 2R4RH 4OZ4B 5SWZD 1FL5A 4F80A 4CC4A 2JB5L 3MLRH 4OD2B 4HSCX 2WPGA 2DQJL 4AYGA 1FFQA 3RIFF 3QHZH 3EYOB 1JV2B 3LXBA 4UANA 4P4KC 5EMYA 2BMKA 4PJ6A 3PWVB 4MNHA 4PJGB 4HQQH 4LHUD 1KF9B 2XKUA 5IMKB 1FHNA 4Z95L 5HYSA 5GGSB 3BWUF 2EDNA 4EI5C 3GMMB 4S2SA 2NNAA 5EU6D 5DZVA 2ZCZA 3NZSA 4LE8A 5IIEB 2Z0UA 3QK0A 3ARDC 2AGJL 3DX6A 1RL1A 1X5HA 2I85A 3VXPB 1AKJB 4I0KA 2ZXDA 2C4XA 3LB6C 4BRVA 4EKXA 2XV2A 1MI5E 3L3OC 4RGNC 4KUCD 5C09B 1WPCA 3SD5A 2BXZA 2E3VA 3Q3GB 4GO9A 4YL4A 4HPOL 1HWGB 1TQUA 4DGWC 3EH3B 3ZKMD 5CUSH 4DP2X 5JQIB 2XZCL 4HS3A 3VXUD 2IEPA 4NQEE 3Q5TA 1CLZL 5L4JA 3ZT6A 3VFUB 2K3HA 4CA4A 2E9GA 3O6FB 1KV7A 2O5NA 4C55A 1CI5A 3QH3B 4HUXA 3TO4A 5D1XB 4KVCH 2F6AA 3RWDA 3C8KB 3SHSA 5L9DL 1JK9A 1OK0A 3MV7B 4UDUB 4EXKA 3LQZA 3WE6A 2RD0A 1B4JH 1QSEA 1YJDC 3K6FA 1EIBA 4H8WL 4J8RA 4LCCC 2YBGA 1U6AH 3DX9A 2HJFB 1QEWB 4NIYE 3WJMA 5C0JA 2H7WA 1D5BA 4UIMA 2C9PA 2E27H 3WYRA 1ZD6A 1M7IA 1KXQE 1S6NA 3KL5A 1HOCA 5D2NE 3L16A 1L3NA 4LCWB 4ONFH 3LV3B 1N67A 4OSUH 4NCDA 2EEXA 1MFNA 1OE2A 2W1NA 4V1DA 1TR7A 4P2OC 3VDAA 4OCMC 2QQNH 5FWQA 3D25A 1EO5A 4LP5A 4AX3A 3LIZH 2QQLH 1JPFA 1UWYA 1KWGA 1VEOA 4Q6IB 2FGWH 3H42L 1MCFA 2WOBA 3KLLA 3V4PB 1RPUA 4G8IB 1EVTC 5ENWB 3L4TA 3CSBA 3N41F 5T1DH 2J1WA 1F90L 5AW0B 5I6XB 3ATBA 3QPQD 2NX5B 4GSUA 4DVRL 5L2KA 4E68A 2K4AA 4P2QE 3LQAL 1ZT4B 4TUJA 1U41A 4Q9QL 3GHBH 3LVTA 2BNRA 2EXWD 4JY6B 4ZMYA 4B9IA 4A7TA 3KVDD 4X7TA 2F15A 5L6YH 1NBVH 1CGUA 3QUZD 1D3CA 2CJUH 5IMLB 2XZQL 2WYTA 3IWVA 4ANKA 1YAZA 4JZNB 3ZE2F 1CK0L 3T65B 1QRND 5GGTA 2G9KA 2Y1AA 4LIQH 3R06B 5IMOA 2IPKA 4WGKA 4ZQTA 3VXSA 5ILTH 4QO1B 1HK6A 3ARPA 2C3VA 4NERA 4X8JA 5A3IC 4BKLA 1SYSA 5TE4L 3SDYL 5HGDB 4OUUB 2VQ1B 4TTGA 2XNAB 3BJ91 5HGAB 4A2FA 1QR1B 1S9XB 2PXYC 2XY2A 1BLNA 1GPOH 2ITDA 1KUMA 4AGOA 1G7LB 2XTJC 3FO9A 1E4WL 5I0XA 1IO4C 2HVJA 3A4EA 3GTNA 4K3GA 2CUAA 1WD9A 5D6DA 4KJPC 3SYOA 2CGRH 1OIOA 1NFIA 4X8CA 3OPZH 4PUBH 3ZE2B 1CICD 2WYZA 1A3QA 1Y07A 5DGQA 4BZ1A 1Z66A 1NC4B 1F18A 1CDGA 1TEGA 3G08B 3HE7D 4TUUA 3TJEH 4CJ0A 1BZ7B 5DFVD 2OSLA 5TF1H 4AGPA 4CAGA 4FXKA 4CGTA 3B7SA 3GFUA 4JPWH 5DHEA 5FHBH 4P5TC 4XVSL 3TPKA 2QVKA 2Y5TB 3BGFB 3CSPA 4GMSL 1B4LA 1SPDA 1L9RA 4U6TA 1BMGA 3JV5A 3OZLA 3QEQB 1FZOA 1T80A 1EO8H 1KG0B 1RZFH 2GI7A 2OL3A 2X44D 4PJ7A 4UQAA 4WUUA 3S4SA 1OT2A 3PABB 5AB9A 1BZDA 5D1ZD 2YAOA 5BUAA 2GITA 4NZUL 1OXYA 4Z78A 1I4FB 1YNTA 2F53D 4O9HL 2FATH 5GSVB 4NQSA 1JPSL 2F58H 5HVWA 1GY1A 4POUB 4AEIL 2VN3A 4JZJA 4Z7QB 2V8LA 4TSAL 2R0WL 4NO0A 3VG0L 1OZTG 3GDBA 1K3ZA 2ZXCA 1HX0A 1AE6L 4AQEA 1BQSA 2CLZB 4OTXH 4QTIL 2D0FA 4HV8A 5GJSH 2YAHA 3BPLC 1ML0A 5F0JB 3Q6FA 3U6RA 2AEPL 5KVDH 1KEGH 4HCRL 3KPMB 4XNQB 1KNOA 2F7QA 3PS6A 4HGWA 4RCAA 4EXPX 4KO6A 2JQMA 4LMQI 4TNVK 3UTSA 4RGMC 1YZZA 2YMXH 4E36A 1XB6A 4MDIA 4XBGB 1AS6A 2EDHA 2IH1A 5EBGA 3HMXA 4KQ3L 3E80A 1C12A 4Y89A 4PJDA 3BCFA 4XNZC 1LNUA 4GRWH 4LDLB 4FJZA 3TN0D 1GS8A 4WWKD 4WZ9A 5HHXH 4NKQB 3KCWA 3P02A 2V9TA 3VNZA 3D69B 3QUKA 4DKAA 4L9LA 1ACCA 1R47A 2RCSL 3EKCA 1MJ8H 2XXCB 4R26L 4JFVA 5MENB 3SKOA 1NMAL 4PTTA 1KT2B 4NNPH 4XZ4A 1ZSDB 3MBED 4HWBA 2FEJA 3X13A 1DZBA 3PHOB 1EAPB 4LSSH 2BVYA 3HI1B 3II1A 1K9TA 5D7HA 2CA3A 2KDGA 1EH9A 2DYSB 2X4UB 4PY7A 5TTRA 1HH6A 3UZEA 4AIEA 4KNQA 1IAII 4ETQA 2DYRB 2BZ7A 4KMLB 3EXJA 4LCYB 4U49A 3PFUA 3AWGA 3T0EB 3VX1A 2QR0B 4JVPA 4E9TA 1KJ3H 1MNNA 4P3WA 4KNTA 5FGCB 1G7PB 4DESA 2I9TB 2A6DA 3QNXB 2ADJB 3RIAF 4CMHB 4B97A 3RVTD 2NR6C 3OSKA 4AL8H 1DUZA 1JPTL 2GJZB 2NCMA 3RYMA 3CVIH 3IDNA 1LL1A 4FQ2L 2FX9H 2GTZA 4WI8A 2OMVA 4HJ1A 5EZJA 4WWOA 1FYHB 4S1RH 5I28A 3D2UB 1XZ0B 5HDOA 3V4PA 4OLWL 1QBMH 2NXYC 2NNFA 5DK2B 2Z4QB 4XI5C 4HLEA 3II3A 3N6YA 2IDSA 3HEIB 2CE6A 3D4ZA 3DX0A 3LKNA 5T1KA 2EVHA 4L4VB 1H0DA 4YC2C 4L8CA 5E51A 1QOKA 3HAEB 4OLZH 3FB6B 1A02N 5A43C 2CLVB 3CHXA 2C3GA 2PR9A 1FVEA 4G42A 4JX0A 1HJBC 1EXHA 5IVXF 2I5YH 1QNZH 5IBTH 4DGVL 1CE1H 5I0DA 3MREB 4WI3A 4Z7WF 1EHXA 4OFVA 2B39A 3F7KA 4EO5A 4R7NA 3CLFL 3IFPA 3QQ4A 2VO5A 2P5EE 3ARQA 4W70A 1XD1A 3D18B 2A74A 1U91B 4IRJD 5T3ZD 3LY6A 4JQXA 4JM4H 4XCNB 3OM3B 5DYOB 4LK4A 2HRHA 1WBYA 3KPQB 5CWSB 1WRFA 4AV5A 1NCTA 1MWAB 2DWSA 3NT0A 2NY4D 2BDNL 3GI9L 4HFWB 3NAAH 1I1FB 3NK4A 4HZAA 4WU7A 5C92A 4K94C 2X6UA 4FQ1L 5E6UB 5B1AB 4GRMB 3G6AB 4Q4IA 1VERA 4NNYA 3T8VA 3IKCB 1OCWH 5DZLA 2JJSC 3BZ5A 3MLTA 5F1NB 3SDDA 3VWJA 5IVXB 1Z9SB 1I53A 3HNVH 4JCMA 3BMVA 3D87B 3SO5A 4NUGL 2WP3O 1NKRA 4P5KA 4G7YL 4Z7WB 4LBEB 2ZAGA 3U2SA 3NFSL 2C4FT 4N25A 1V7MH 5T1LA 4E2OA 4LOUD 3U36B 3GBMH 1OV8A 3EJJX 3CCHB 4PJEF 3OHXB 3NTCH 1NAMH 4HBCH 4WEBL 3NABL 3P9WB 3TT1L 2WUBL 2GAZA 3FB8A 3ALXA 3C6LB 3B9KD 3QULA 5B38G 2Y5TA 3FQWB 2OMWB 5DQDH 3WNIA 1A25A 1W9XA 2LT9A 5IB1A 4MZIA 1IC7L 3IJHA 4P46D 2ZSVA 1MZZA 3MBXL 5D72H 4M3KB 4IRSA 3WN6A 2WANA 4LSRH 2QTEA 5ANHA 4DP8X 3CPLA 1E0OB 1UWEH 3MNVB 2VISA 2WLHA 1U3YA 4PJDE 4Q52A 3PWJB 1LO5A 3H7BB 2EDDA 3KDMA 3R0MA 1CT8A 1OAXL 5T33H 4UT9H 2GSGA 4EOWL 4ORZC 3C5XA 1OGTA 2V2WB 5EOCJ 4EN3D 5K5YA 2F54E 4O5LH 4PY8J 3VWKC 1MFDH 3JZ7A 3PWLB 4L05A 1XMWA 1J1XH 2PTUA 5IMMA 5KZCB 4M5YL 4NQDD 2BY3A 1NDMB 4WW2A 5E56A 5T1MA 4HIEB 5KVEL 2HN7A 3TA3A 4MD0B 3L3HA 5FYKL 3EO0A 3UAJC 4IIQB 3J7HA 3KPNB 3W39A 1T0PB 3SDAB 3UTPD 5HHPB 2FSEB 5JLZA 1OO2A 1B2WH 2VB5A 4R7DA 4MVBC 2BC4B 2N0MA 4MQ7B 4WEEA 2D9CA 4MMYA 4XMPL 4PJ8B 5CJQL 4M7ZB 3LSOB 2CUIA 2OR9H 1MFBH 1YYMH 4Y9EA 1V3JA 3FT9A 3FB7B 3ABZA 4GKSA 4G83A 4FMKA 2UZPA 4NLHA 2RTTA 4J39A 1P5VA 3LHAA 1F6FB 4KI5D 5FA4B 2WQUA 1AXTH 3DRQA 1T1WA 4JFED 3MV8E 3T77B 1QSVA 4XVUD 5BZXA 4JM2C 1ODUA 3EFOB 5F6HJ 4QHNA 4JVUA 2P4AB 1KLUB 4PG9A 4FQJH 1OB1B 1G6RB 5J1TC 2AEOA 2F5BL 4AYFB 4B7LA 3S5LG 4XT1C 5ABAA 4NRZB 4DZBB 4GYBA 4I13B 1JG9A 3HBZA 5TDOA 3SGJC 5EU7E 2JIXB 4ZUSA 4D9LL 2C9UA 3VYOA 1T5KA 1PLCA 2WO4A 4UZGA 1ZTXH 2HMIC 5IW1B 1TCRA 3MXWH 3ZGIA 3TBYA 4X7SH 4AQ1C 5ACZB 4ODVH 5J7CC 5BRZB 2DWDB 2X4SA 3BSHA 4FXGA 4OJFL 4XCEB 5D5MA 5ETUB 5LGKA 1TUPA 3F2LA 5B1KA 4PS7A 2FYYB 4Y4FC 3TNNB 1ZE3C 2WTRB 2Z4QA 2VOTA 3W82A 3W9DA 4LCIL 1CXLA 3P2BA 2HH0L 5HGBB 2D31A 5I75C 1FZJB 3FSAA 4YBLB 4LF3A 1TTCA 1X4YA 3MLPA 4DQOL 1PD1A 4KDWA 4ES9A 4BSVB 4GUQA 2VLJD 1SHXA 2CBOA 2WKOF 3L1OH 4UIKL 5CZRA 2GY7B 3L4CA 2G0KA 1ZCRA 3LDBC 4XWGL 3TH4T 2EVGA 4JKWA 3FT1A 1DN0B 5D7IA 5DC9B 1U4EA 5AW8B 1JWUA 1OSPH 2V2XA 1BYOA 1JF1A 1KBGH 2YQBA 3AQZA 3CVHH 3OKMA 3PV6B 4L1DA 5ESVB 1RV6X 3OKKA 3ZRCC 3M88A 3EUUA 3QIBA 5T1JA 3L4WA 1Z3GH 5F1IA 3AQDA 4IBZA 3CIAA 2YA0A 3RWEB 3S37X 43CAB 2CNYA 1C7SA 4R0LB 4KJYA 1C5BL 5BW7C 3VMPA 2HT3C 5LBSH 3OR7A 1FL3A 5LHDA 4LP8A 3BGMA 1XGQA 5DWUL 2ED7A 5H35B 4PD4J 3F85A 2BSRA 2R27A 4M8VA 1ZOXA 3W1ZA 3VG9B 4WI0A 5F7DB 3SGEI 4M1DH 3RG1C 4IOFC 1CD1B 1TPXB 1YQ2A 3E7JA 2DYPD 1TJMA 3CFMA 4JFDB 5DRWA 4FFVD 2KS0A 2CR3A 4GP5B 4YZWA 5BMFH 3LNIA 3IDGB 4NM4L 1ETJA 2W80C 4O02H 4WTZG 5GGVL 3WDHA 4PV9B 1MLBA 3CCHA 4TULL 4MA8L 3ETSA 3OHXA 3S7GA 4EBQH 2J55A 4LLVA 2Y1VA 1MAML 4CKVX 4N68A 2Y06L 1U21A 2EXYD 4AQZA 2EH7L 3TCXA 5AYQA 4NP4L 1L9MA 3PHSA 4TL4A 3BP5A 1FGNL 3SIKA 4AQ8C 4GUPA 1Z9NA 2NLJA 2BVUA 5GS0H 3AMLA 2AJVH 4OR1A 2OZ4H 4J6RL 3MFFA 1DCEA 5SV4A 2RBLA 2B9BA 3KLAB 1UKQA 4PVBA 1BZEA 3S48A 1RXLA 4I0PC 3AT8A 4HUWA 4TQ8A 1ZHBA 3QIUA 3QNZB 4URKA 3KLHD 1GJIA 1IBDA 1A6ZA 3VD4A 1RFDL 2VAAB 4ES8A 1KJMA 4OLUH 5EU4A 4TM9A 2ZWKA 3N1GC 4QCIB 1L9NA 5IP4A 2DBLL 1P53A 4XP9L 3I6GB 3S3CB 1UVQB 2EYSB 4Y1TA 3L5WB 5I18H 2WINB 3IFOB 1UQSB 2DQIL 5DWPA 4GG6F 1XBRA 3DARA 4OGAC 1AFVL 3LZQA 4TQEL 3LKOB 3D39D 1SQMA 4QKXB 1UJ3C 3MA7B 2PW1B 1RZIB 1GGTA 4W9IC 1PKQE 3RGVB 3TXAA 5D7SH 3QZWA 2YGOA 1TFPA 4NN6B 3GM8A 1A6VH 1KCLA 1OP4A 1UUSA 2BRQA 2DKMA 3B37A 4JHVA 3RI5F 3JZYA 3UP1A 2VGLM 1BYNA 1LO3L 3BI9X 5IQOA 3MRBB 3ERXA 5FOBB 5DQJB 1B9ZA 3WY4A 4XMKL 4J3TA 3PWUB 1J10A 3MDJA 5G4MA 1W2KT 2LVCA 2XIIA 3DIFB 4HIXL 1CDUA 2UY6A 4XBEL 4IGBD 1S7RB 2YXFA 2VXVH 5D5ME 5EFIB 1MCHA 3BDYH 3BSZL 4GSDL 1L9QA 4HWEH 1JVLA 3QW9A 4LOFA 1BEYL 5SX5H 4F91B 3FO0H 4HMEA 1L0XA 4GG6B 4PCKA 3CIQA 4HH9B 3B8SA 4HJIA 1JTTA 1NCDH 1Q8MA 1J05A 2ATPA 3UZQA 4JG1L 2WUCL 5KANI 1OCZB 4K3EH 4WGWB 1A6UL 1AAJA 1RURL 3CZSA 5C0AB 5L4FA 4NRZA 4EI5D 1M6OB 1TVDA 3SZ6A 1I9JL 3IVKB 4R7VA 2QZQA 3ARDD 5JPMB 1P4IH 4WK2B 3HNTL 4L4TD 5I1GL 2DV6A 2Z64C 3I9AA 3IGFA 5D7IE 3UIYA 3LB6D 2AJXH 1GZHA 1O6VA 1TO5A 3JTSA 4FP8L 1BVOA 4RGND 1DVFC 1K6QL 1WA2X 3JWOL 5HHME 2DWDA 4S1SH 3UJIL 2X09A 1NMCC 1NCBL 3IK2A 3OBAA 4PI0A 3LZNA 1QSFE 1J1PL 2PP7A 2XRAH 1AYOA 4ZUUA 3O6KL 2XWTB 25C8L 3MC0A 3PREA 1H19A 5C0BD 3MCKA 5D55A 1EJOL 5LCVH 1JZGA 1UD5A 3L3DB 2JB5H 4BHUA 4HUKB 3SDCA 4B9ZA 1DQQA 2DQJH 3MYJA 3BP7B 5DHYB 1JERA 3MRNB 2DQ6A 2IALA 1E9QA 2VQ4A 3KPTA 3L5XL 3DJRA 4FFYL 3CFTA 3TEWA 1P9MA 2I07A 1GSMA 1O7DE 1O9ZA 4M03A 4Z95H 5K9OB 4LSTL 3DUUA 1BREA 3JSSA 4R90H 1KV3A 4YDLC 1E42A 4Y8DC 3VE0B 1QBLL 1MCIA 3KH3A 1PIFA 2ZP0T 3IMRA 4OFYD 5IM7B 5ICYA 2ZNXA 3FO1B 5KVEE 4P2OD 2AGJH 2CSPA 5FYKE 3T09A 2AQ1A 4EI6A 5IB4A 3T1FA 1H5BC 2WXPA 4NRYB 3VGHA 2BVOA 1WZMA 1N0XL 2PYEB 4G8GD 1PZ5B 4U1MB 3AU1A 4Q2ZB 3KVPA 4HPOH 2AV7A 3FRPG 4OCXL 5TDNA 1N10A 3O3AA 2XZCH 1QFWI 1VFAA 2EKJA 2H8PB 1AR1B 1CLZH 3BKYL 4PGCA 4FMVA 4FNSA 2EIZB 5CBAA 3VGBA 3ABKB 1TYRA 3AXHA 2BOBA 3GIZL 4HETA 2BFGA 3QDJB 2HLFC 3QQNA 4R84A 5L9DH 2YPLA 4NQTA 3SSGA 4LLUB 3C5ZC 4H8WH 2OK0L 2J8OA 3ZTNL 3WLWC 4CADA 5F9JA 2DPKA 2CIIB 3L81A 2LLLA 5F1SA 1DO6A 3QNYB 2NY6B 3H2WA 4M3HA 5A3ID 2BVPA 4CRPA 2PUQT 3HZMA 2PPDA 4PJFA 4RX4D 1O5PA 5F93C 5J56B 2PXYD 4DO4A 3U0WL 4H1LA 1H15A 2R69A 5EBLB 5DI8B 1FBIL 4WWNA 2XTJD 2NZIA 2ZYRA 3FTGA 4KROB 3KJ4B 3H42H 3V0IA 4D9QE 2XYBA 2Y7NA 4FNRA 5T5NG 3JTTB 1PDKB 1EK3A 3EIFA 3Q9PA 1F90H 2PCFA 4DETA 2HWZL 4DVRH 5CLXA 1LEGA 4MNGE 5FX3A 5CP3H 3LQAH 4NLAA 5JIHA 1W72L 4J3OF 5T3XE 4Q9QH 1S5IL 1NANI 4BFOA 3TFKC 2Y7SA 5LGYA 3VFOB 3Q2LA 2XZQH 4XR8C 4JFYA 3EF4A 1I3UA 4P5TD 2ZYSA 1CK0H 3QAQA 4LLMB 1TNNA 3LKOA 1AHMA 2EKSB 3BIAX 2AZAA 1FFNB 3LN9A 2VZ3A 5TE4H 5ICZA 1EZVY 5L4MA 3IDJA 4Z7NE 5I71B 3SDYH 2X4TB 3SQOL 2VRAA 2CR6A 5DRZB 2W5PA 4MASA 4E9RA 4EZMA 1YYLL 1F3JB 1T7WA 3O6ML 1GKOA 1MUJA 1EEZB 2L7EA 4NUQA 4PGBA 4TNWK 5E9DB 1URLA 5HJ3B 5CS7A 1E4WH 1AC6A 4A6YB 1HIMH 4XNYL 4DP7X 5HHOB 4G1EB 2AXHA 5B3NA 4UMGA 4ZDHA 5EFIA 4HUVA 2H41A 2JE8A 3CFEA 3QEUB 1IZKA 1KJ2A 4DIXA 1PZSA 4U6HA 1CFBA 1HDMA 2EH8L 2QKIA 3ZU8A 4MMZA 2IAMA 3B56A 1NSNL 2B0SL 2HG0A 2W0KA 3PHQA 4HAKA 4KH2A 1VEMA 2B59B 2Y2WA 3PUUA 2AXGA 2OYLA 2K7PA 3HCVB 1OL0A 2ED6A 2YWZA 1IM9B 1GSKA 4RIRA 4NCC2 4A7GF 1IGIL 1SOQA 1N6QL 2XFXA 2WY3B 4AYEC 4XVSH 4GMSH 3BEWB 1U8QB 5IFHH 3HPJA 2ENJA 4ZT1A 5J11B 3QA3B 3T5WA 3KR3L 2Y7QB 5SX5K 5GRXG 3C60C 5C6WH 5DZ9A 4NZUH 3CGTA 1S7SB 2VLLB 4ABWA 4QLRA 2NW3B 3T4AA 4N6QA 2YD5A 1JPSH 4AEIH 4H0LC 3QQDB 2DLIA 4TSAH 4YSDA 2R0WH 3VG0H 2P1YA 1S7VB 4MMXC 1LMIA 2VR3A 3MCG1 2WWNA 2WWKT 4QOKD 1AE6H 4I18C 3HS0B 4QTIH 1TTGA 2FB4L 1EEQA 1S7WB 5B39B 3BZ4B 5I6NA 1HHKA 3IDIB 1MFCL 1WHOA 2AEPH 4BFFA 5ICXB 4X8GA 1P4LB 5L7XL 4HCRH 5LAPA 2ZX5A 1OHZA 3EUDA 4Z0XA 5HDBE 4JG5A 4XOCA 2DRUA 4JRLA 2ERJC 3VNYA 3FOMB 4FCHA 4FQIL 3OKEA 3WJJA 5I9QC 2NR6D 3VXRA 2Q7YB 1GC1L 2A83B 4IHOB 1MCQA 2JCCE 4KQ3H 4X7CC 5A7EA 1AZZC 5FK9B 3I9GL 3ZDXE 3CAFA 1I31A 3LKRA 4HU8A 1J9CT 1I75A 2BNQE 2VLKB 1R24B 4I88A 5EA0L 4XHJC 2VM4A 1CS6A 1EGJL 3TYGL 2NXYD 2OYMA 2RCSH 2VZVA 4X99B 4XI5D 4R26H 4JQIL 1XB8A 2WTPA 1NMAH 1E40A 3MZGB 3O6LL 1B6UA 2PP8A 4PW4A 2VERA 3BP6A 5C07A 4QRTA 4HDIB 1X7QB 4ZW7A 4F7CA 1QLRA 2H5UA 4JG9A 4JRYD 5JPNB 4AZUA 4PFEA 3GS7A 5FV1L 3HLAA 4AIZA 2P7TB 2B5IB 1UACL 3QUGA 3OGCA 1JI1A 2QPUA 3RX9A 3WS6C 1AHWC 1IGYB 2D3LA 5FV2A 2BSDA 4U0RC 4PJ5B 4JY5L 4PCYA 4OZGA 3FAWA 2D03L 2A9CA 1Y18A 3LPPA 1E6JL 1P0SE 1NEZB 4M4PA 4U1GC 4KDVA 4A1RA 3ROLA 4D8PA 5FECB 1FI8C 1JPTH 1JK8B 3GSWB 3LKQA 3I3BA 4FQ2H 1JZHA 3U7YH 4GW1A 4W9DC 3T8XA 1S4IA 3L3GB 1FLTX 5I0WA 1FZKB 4L3CB 1INQB 3VGGA 2E6JA 5IV2B 4LSPL 4TF4A 3VTTA 3NH7L 4OLWH 3FT3B 2CIKA 4MLIA 4M02A 4Y1AD 4L5FL 1JYWA 3SJVA 2KLTA 3SKJL 3CC5A 3NCFB 5AUMB 1E4HA 3L48A 1A7PL 1N2RA 1NIBA 3CMGA 4G8EA 4F15B 5I0VA 1VGEL 4HUMB 4R3SB 4UQ9A 5J6GA 5J9PB 2Z92B 3APCA 3UTTE 2IADB 1YEDB 3BUYA 5DR5H 2IXQB 2XQYK 3G5XB 3MRKA 4MA7L 1CLCA 5AAMA 1FC2D 1JXKA 4CILA 4DGVH 2VJ0A 2WLJA 3UTQA 1OP9A 2OTWB 4PV8A 4Y4HB 4AEFA 1PG7W 2LTQC 2ATKA 4ZFZA 2ZUTA 1DN2A 1XSIA 4ZFOL 1ORSA 3WTVA 4HZLA 2FJFA 4WSJA 4FQPA 3KMDA 3S88L 2G30A 3N2JA 3G5VB 4LLQB 1F3JA 4ZAKA 4ZX3A 3MJ7A 4MS6A 4NQXA 1I7TA 2BDNH 3GI9H 1OAUL 4FQ1H 3E0GA 4OLYL 2ESVB 4JVWA 2CM6A 1ZV5A 3VGEA 1Z5LA 2B4CL 3AU0A 4NZFA 4OGYH 3QEUA 4DKTA 3VWKD 3VX0A 2YGNA 3WUWA 2AV1B 4NUGH 1JXJA 4G7YH 2YPVA 1J0ZA 3NFSH 1UTDA 4P4RA 1I1YA 4BELD 1KWKA 3UAJD 3V0AC 3N1QC 4M48L 3VRJB 2CHZA 3S3SA 3X2QB 1TZAA 4WEBH 3NABH 1WFOA 1DJXA 2WUBH 1DBAL 4PJIA 3TT1H 5HYSG 1CBJA 5E1AB 3H9SD 2CO6A 4MVBD 3CV5A 2Q76B 4LEEA 4JFZL 3T2LA 3FH8A 1JDCA 3QA3A 1NC2A 1ZA6A 2RALA 3UFIA 1IC7H 3HHSB 4K7PY 3MBXH 3RL2A 1KMGA 1EDYA 2D73A 3VXRE 4O58L 1LP9E 4H5SA 2RQEA 2DMCA 3TM6A 4HKJA 2QFRA 3Q8BA 1YECL 1FDLL 1YN6A 2NW3A 4TSBL 2XWJB 1OAXH 3QISA 4LEBA 3WIAA 1T5XB 3FAXA 4EOWH 1ND0B 1NZRA 4P3DA 2VDNL 1RZ8A 4B95C 4U1NA 1U8LB 4JM2D 3FU9A 1SGKA 2PWFA 2JVUA 2YGQA 1G7IA 1SLXA 3SPJA 3GHPA 4WCYL 3RNKA 3ULVL 3QORB 2OX5A 5KAQG 1D5MA 4M5YH 3CZFA 4WSKA 2VN7A 5ICXA 3T6VA 1ECYA 3SB3A 1DANT 2OMBA 5KVEH 4NO3B 3QUYB 1A7NL 5FYKH 3B9VA 4GQPH 4MZRA 4NC2B 4DUWA 3QYMA 5JHDE 1IM3D 4X9IA 3ARGA 4GIPD 1KYAA 2ENPA 3O2DL 2HMID 2RFXB 5F88B 1R3JB 4UYPA 1P5UB 4C54A 2MTPA 4XMPH 5CJQH 2G2NA 4U6XB 5KUMA 2KZBA 5H4YA 4CC4C 3K6NA 3GXDA 3O41A 4OZGE 3NIDF 1T1XB 5EH1A 5EIIB 4Y4FD 2OSXA 1WHPA 3AREA 1HAUA 3IETB 1N3NA 2NUPB 2D4DA 3SE3A 4YLCA 4BSWB 2Y2YA 3HJ0A 5SWZB 1SF3A 1X7QA 3STZB 4KUCF 2EIBA 3GMRA 5I1CL 1JZJA 1TTFA 4JB9L 1O6SB 5DDHA 4K7FB 4FL4C 3WEMA 1R1CA 5FYLL 2XG5A 2F5BH 2GKIA 4LHUB 4NKOA 3LD8C 4IK7A 3C2AL 4RESB 3SKMB 2CHNA 2OM5A 2MQ3A 3SO3B 3IJ8A 4AYSA 2NY7L 1BD2D 1JWMB 3NIDB 5EU6B 5GSRB 3LNFA 4D9LH 5L0QB 3CZGA 1TYJA 5D6CB 5E4EB 3FCGA 2WW8A 4NNXB 4DZ8A 4F37K 3V4VL 2CR0A 5LXGL 3WLBA 3ZGHA 2QLVB 1NBYA 2HT3D 3LKSA 2FO4A 4XNUL 3F00A 3TO4C 1J5IA 4OJFH 4U1LA 4WKZB 4KJWC 4F2MB 4TLUA 1FVCB 2HUHA 4AGLA 2GJ6D 1E8WA 1RUPL 3OX8A 4IOFD 3BPNB 1BAFL 2AP2A 2Y07L 4LCIH 2HH0H 2DW5A 3DJZA 5DJCA 1PG7X 5DJ2A 3DOIA 1U8NB 2G5RA 1PS3A 2V5YA 4JREC 4MSWB 5INDA 5EF0A 3DHUA 4DQOH 3DGCR 2FZ3A 3MRQA 5K9QG 3H3PL 3J27A 2ZX8A 3QIWA 1KDIA 2H32B 1QR4A 2PLTA 1FNFA 1OSZA 4X4XA 1T03L 1G9EA 4KDTA 4UIKH 4Z7VF 1KTLA 4MXWL 3KYNA 4R4FL 4JO4L 4XWGH 2F7RA 5IEKA 2OTWA 4Z3HA 1VZGA 3I75B 3QUXA 3FN3A 2O6DA 4X0KA 3PUCA 2HLEB 2XTSA 5DJXA 3KXFE 4PJIE 2MCPL 4ZW5A 1NBZB 1RZGB 5E70A 3V10A 2O72A 4OZIF 1HXMA 2EQDA 2Y3AA 1C5BH 4I0PD 4DO5A 5DUJA 5JUEL 5DWUH 5BXFB 5HI5C 3DVFA 3MGOB 3OF6A 4DTGL 1KCWA 3COOA 1URIA 2VLRE 3CNKA 3IMTA 1G9NC 4KKQA 4D0DB 2KBGA 2B77A 4XNDA 1YDPA 1ZLUH 1NGXA 4HOWA 4JPIA 2IAND 3N1PC 4NM4H 1CXIA 5EZLA 2YHGA 3M7FB 5GGVH 3QUZB 4OGAD 4TULH 4MA8H 3Q05A 2OQJA 4IU2B 1KN2L 3NSYA 4OZIB 2E8YA 2BS8A 1QRNB 2X7LA 4JN1L 1MAMH 4YHIA 2Y06H 4JFXB 2CDEA 2EH7H 5D6DC 5K39B 4NP4H 2UXGA 4JFUA 5BRQA 4Z7OE 5DHXB 5DJYA 1FGNH 4HK0B 4PRHA 2YEQA 3QZMA 1QW9A 2X1WL 2Z93B 4U3SA 2HT2C 2XN9E 3L3KA 4XC1L 4ZW8A 4HKBA 3EBIA 2Q86A 4J6RH 4J27A 3CVDA 3H4FA 1KULA 4CC0A 4LVHB 2W65B 5LO7A 5BUPA 4JO1L 2XVLA 4FXKC 5I8EA 2CKBA 1W8OA 3T4YB 4BEIA 2WN2A 1RFDH 2LE9A 1B6DA 5ADPL 5AVXB 4GP4B 3OWRA 3Q1SL 3V5DA 1CICB 2YD8A 4IEFB 3S37L 4NAQA 5HDWA 5GS1A 3DROA 4MRBA 2DBLH 2FL5A 4LLWB 4XP9H 5T5FL 2QQQA 4L29A 2G0LA 4OQTL 3MCLL 4ZMVA 3MPCA 3HE7B 3MGTB 2YEVB 2DQIH 1ETZB 4GG8B 4OZHE 4Z7UF 4BFEA 2FGZA 1AFVH 4QNPF 1BECA 2MEJB 4TQEH 5D96C 5JO5A 3QJOA 4V2BA 4GLRH 1IQDB 5F7EL 4JK0D 4JZJC 3ULSA 3BAWA 3GMLB 4G71B 3VQMA 3OG4B 2R69H 1LO3H 4P2AA 1EO7A 4J23A 4DP1X 5CINL 5D1ZB 4WTQA 3D09A 4XMKH 3C9NB 2IWFA 3RZCD 3FBQA 1SDDA 2G5BA 4WRLA 2F53B 2G9HB 4BA0A 5I24A 5K9KA 2GK0B 1NGWA 4HIXH 3ILDA 4XBEH 4GRWF 1SF5A 3GSQA 1ETB1 1CXFA 2K0RA 4KRMB 3B9DA 5DC2A 2J4WL 3RAJL 3WNNA 4BSWA 2NW2A 2BRRL 3BSZH 4NZRL 4GSDH 4H4NA 1BEYH 3NEOA 5IG7B 3ARFA 4QLWA 1HC1A 2XX0A 4Z7UB 4P57A 2TRYA 1QUNB 3OKLA 5AVUB 3NZUA 1G5AA 4JG1H 3BFWA 1FYTA 2WUCH 3PQYD 1A6UH 4KGJA 1RURH 3WU1A 5KYXB 1FNSL 4NYLB 4L8SB 1I9JH 4G7VL 4L9LC 4J1UA 4KVPA 2XBDA 4GSQA 3HNTH 5I1GH 5F7MC 4ADJA 2HJKA 2XLLA 1M7UA 3RP1A 2P45B 3TFBA 2LAAA 4ZJ9A 4E9WA 3DXAD 2FBJL 4BFIA 4FP8H 3LQAC 4KXBA 2X9YA 1K6QH 3TN0B 3JWOH 3IPFA 4WWKB 3RPIA 2MOVA 3FFDB 3BVWA 3T3ME 4PLKC 4AK1A 1FJ1B 1NCBH 2MCMA 5IBUB 3IJ9A 1LDSA 2PW2A 2YAPA 4G2AA 4NKDA 4YDMA 1J1PH 2C8NA 4I1PA 3O6KH 2BP8A 25C8H 5EU5A 2DLHA 2Y4SA 1ZLSL 4NWUL 1EJOH 3MBEB 4PRIA 4NZ8A 4AENB 3EJRA 3QZNA 2HLFD 3BSGA 3OXSB 1KZQA 1J1OL 4F33B 1Y7VA 2VXUL 1JOIA 3ZDYF 3C5ZD 4NUJB 1XH0A 1T7YA 3NJKA 3KPPA 1IJNA 3WLWD 1FE8L 5DEZA 4L1HA 3L5XH 4FFYH 3FQTB 4ZUVA 1DQJA 3V0VB 2FH8A 3U30C 3K4ZA 4XXWA 1JTOA 3DTXB 4LSTH 3BZFB 3ULVE 1QBLH 5HHNB 1V7NL 4P04A 4F27A 1WWWX 5ITBL 1AXIB 2W60A 3LRHA 3U4BL 1YN7B 2UWEF 4YX2L 2UY7A 2BCKA 2MOQA 4XOEA 3RTQA 5KSVB 2VDOB 4LEOA 2DJ4A 2WBXA 1AG6A 1VKXA 3B2XA 3IN0A 3TH2T 1N0XH 2GCYB 4K5NA 5I66B 3BT0A 4GKZA 4R4BB 2ATAA 1JGVL 1F97A 1IAMA 4PRHE 1CFQA 5BS0D 2VDPB 4GIOA 3ZDYB 4E0RB 4OCXH 3WXWL 5EC1B 4QRUA 5D93B 1E2VA 3BKYH 1CGTA 3VU1A 5AKVA 5A2IH 2H3XC 3NIGF 3GIZH 3VH8A 2G2RB 5AYUL 2A74C 3K7UA 4W1TA 3RBGA 3TFKD 1G7QA 4JQXC 4ABUA 2OK0H 1LE9A 3FPYA 2UWEB 3K8MA 3ZTNH 1ZHNB 3TPUB 1RP9A 2YSSA 4B3EA 2IO5A 4WI6A 4A38A 1QPKA 2F0CA 5FYLE 3TEYA 3ZYJA 1L6ZA 7FABL 3QG6A 3FC8A 1R3LA 5J6HB 1BZOA 4IRJB 1XF2B 1BBJA 2C1OB 3SDDC 3VWJC 4GUOA 4GFTB 1CDCA 4MD5A 3D9AL 3U0WH 4FTDA 1I1CA 1CB4A 1FBIH 2SEBA 4UZUA 2ZF9A 4N2AA 2I7SA 3U83A 1ZLUK 4PCSA 3FU3A 4P2RE 1ZHLA 4JPSA 1UA6H 1NPUA 1TF4A 2NY4B 5EG6C 2YARA 5MERB 3JWNE 5ID1B 1BFTA 1ID2A 2HWZH 2ICWB 4I1RA 3BYTA 1BQHG 1H8LA 4D0BB 3ZMNA 5C6PB 1W72H 2KH2B 3TBTB 5I1JL 1S5IH 2E5EA 3D0LA 4EE2A 3CHQA 5TE7L 4WHCA 1A1MA 2XV3A 4WO4A 4RISL 4X0NA 4TTDC 4IRSC 1WAAA 3LEYL 3BWZA 3OR6A 4PYGA 5CLWA 4RFEB 2Q2EB 1AGEA 2LABA 1FNGA 3VXOB 3B9AA 3AXLB 1MCNA 2ZPKL 1MVYA 3NA4A 5HJDA 4Y19A 3B9KB 1J5DA 1NOFA 1T2QL 2VSCA 4ATWA 1MCJA 2DQFB 4OZFA 2V37A 5CZVL 2XXGA 3B4NA 4HISA 3DK2A 4HOZA 3L9RB 4HCIA 2V9UA 1BVZA 4P46B 3SBRA 3SQOH 1BIIA 4M9OA 2VR8A 3C60D 3AB0C 2W88A 1YYLH 2HX8A 3G9VA 1JSYA 1DR9A 3O6MH 5CJOL 2QGBA 2BOLA 2YA1A 1F11A 4WW2C 4ZFFB 1MAKA 2RB8A 4XNYH 3AGWA 5EZOL 4YHPA 3TA3C 1GCFA 1KIUA 1G1CA 4U1KB 5E5MB 2VL4A 4EN3B 3FQ4A 4ZZFA 3Q8AA 5FA3B 3QWRA 4FDWA 4XGZB 2EH8H 4MJID 4KO5A 1R34A 4KI5F 1NSNH 2B0SH 1KIRB 1G9ML 3MNDA 4NQDB 1IQWL 3CN1A 4HWZA 4APQA 4QHLA 4FRWA 3AWEA 3HC0A 3ALPA 1PQZB 1WFTA 3V2AR 1H3VA 3RRQA 1IGIH 1OT1A 1F42A 4XMXA 3AITA 1MVUA 1N6QH 2YFOA 5TPWL 2PWEA 1AO7E 4EUPB 4B5ZA 4FOMA 1TOXA 1VACA 3ZRSA 1MCWM 5SWQA 4X6BA 5HGHB 1EWHA 1TQCC 3KR3H 5E2TH 1R5WA 4XHJD 1KIQA 1BZ8A 1FL6B 3EGDB 2XZAL 3GRWL 1HKFA 4PRPA 2ZZUT 2ZOLA 2J5LB 3QT2A 3ZDZF 1BXVA 3QR1A 2Z6FA 1FNEB 1CFSB 2GJRA 3HBPA 1ZGLB 4JFEB 1X5JA 2H1XA 3O2VL 1GY2A 1C08B 2ZWZA 4XZUB 4JANB 3G6DL 4RAHA 1FNAA 3EYVB 1KXTA 4PJGE 3MLSL 1NFDF 1NIAA 2I69A 4FCAA 4HIHB 2ISDA 2FB4H 1Z0MA 2FT7A 1D7DA 1N5YL 3DTUB 1MFCH 2AQNA 2NY5L 1NUNB 1I3RB 3K5SA 5D4IA 2FQGA 5L7XH 4L23A 3X14B 5I1LB 4NO5A 4MKMA 1ZRUA 2VLMD 3EZ8A 1DQDL 1MWAL 2XIDA 4FXGC 4MA3A 4WTWA 4C56D 4C57C 2WQAA 5DYFA 1NCHA 1AHKA 2D2OA 4FQIH 3FPXA 3PWPA 4OV6F 4E41A 4GXVL 4POZC 2Z35A 4XXDA 3CE1A 4ZNCD 1GC1H 3P73A 3ZDZB 4Z9KB 1RZJL 4CBZA 3H2QA 3I9GH 1WTLA 3B6SA 3PJSB 4BXSV 2OP4L 5BV7C 3TURA 2NMSA 3B2VL 1A6TA 4FQHB 5EA0H 3VTMA 3U0PB 2LQRA 2I9LA 2YXWA 3TYGH 3LN5B 1U8CA 1NFDB 3LH9A 5DHVA 4JQIH 5HTSA 2C9QA 3UG4A 5HHQA 3O6LH 5D1XE 4HGMA 5KYYB 4PJHA 1PZ3A 4XBPB 1J9RA 1BPLB 4ELMA 1AJ7L 3RWIB 1YMHB 1XDTT 2WIIA 1WS8A 3VI3F 3QIBC 1N4XL 1MFUA 1AGBA 3T6QC 3GXIA 5EO1B 5C8JA 3HVDA 3OZ9L 1DUYA 2VLJB 4EN2A 3W5MA 4WW1A 5LAXA 3CSTA 1UACH 4KPHL 4LCWE 1JYVA 4ZBJA 4J12A 2WAHA 1CIDA 5ELIA 1BHGA 3CZNA 5B1BB 1RHHB 4G5AA 3IDMA 1HSBB 1QFOA 1TEYA 3GIVA 1J8SA 4JY5H 1WAAE 2D03H 1JXFA 1MCEA 1E6JH 3V5HB 2DQHH 4YK4C 3OB8A 5BVJB 1GZPB 3MRRB 1ZLEA 1IEHA 3MRGB 2DF3A 4QYOA 2DMKA 3RWFA 3BVNA 2BS9A 4W81A 1O7DC 1TVHB 4WIQA 2GT9A 1L6XA 5KS9F 3FCSB 2CKNA 1IV8A 4EVNB 4LSPH 5EEUA 3NH7H 3PRZA 4M93B 2GBUA 3AT0A 1YNLL 4L5FH 5I6MA 4IBWA 4N2EA 3SKJH 2HZHA 4DQAA 2HLAB 2Z91A 1IJ9A 2DYPB 3ZUCA 1A7PH 4M5ZL 4D0BA 1YEJL 4Z8FL 1VGEH 1HVXA 4YS4A 1K5NA 2XXMB 1CBVL 4WI9A 3US0A 3HUJA 1HH9B 3JUZA 3D4YA 3MTRA 2ZUUA 4ZUWB 4MA7H 1HHIB 4N0YL 4KK9C 2Y36L 1CLOL 4GP8B 1KFGA 4JR9L 2VW6A 1GL4B 2M83A 2X89A 3ILQC 4AGMA 5KS9B 3QIUC 5DD5L 2LR4A 2F7OA 3K0YA 4WHTB 5JXAL 2A6JA 1V3LA 4YE0A 1JZ3A 1DDTA 1E28B 3LMJL 4JUSA 4HZ1A 3S88H 1F56A 1UWXH 4FKHA 1XAKA 2AQRA 4RMUA 1P6WA 2IQAA 1WTGT 1R3KB 4LPVA 3ZZ1A 2BHUA 3DX2A 3QDGB 1G6RL 1OAUH 2PO6A 4OGQC 1JL8A 1ONQB 9PCYA 4FEMA 4OLYH 4F20A 1S8DB 4LGRB 3ZE2E 3FZUC 2QV4A 2B4CH 3RHWK 3IN2A 2BSCA 1HILB 4U1KA 3RWGA 4QRRD 4ZUTA 2WBJA 3GNML 3NZ8B 5EBMB 1HE7A 3RWCB 3VFSA 5EIVA 2H45A 4B60A 5C2BL 1E5AA 3UX9B 7CGTA 5MI0C 4XN5A 1CR9L 3K8KA 1QNIA 2EUVA 2GC4C 2WYHA 4ZTPL 3S3DB 1OSEA 5JOFB 5M95B 4E9LA 5FXCH 1K72A 4WU5B 2IDUA 4QHPA 2YR3A 4M48H 3MRIA 3W5NA 3JBG7 1XCTA 4MNQA 5JIKA 1KPUB 1UJTA 2FEDC 3GGWA 1DBAH 4N90E 8CGTA 2ITCB 2OTUA 4E5XA 3QEQE 1G7JA 3D39B 3GPEA 5FIEA 2IOMA 4JFZH 1E27B 3N1MC 4N5UA 1EAQA 1AXSA 1L0QA 5LWYL 3ILPA 4FG4A 1UZGA 3ZL2A 5DGRA 3GZPA 4O58H 3SPCA 1F2QA 3BDXA 5AENA 1QVOB 4GAGH 5IR1B 2CPCA 4HS8L 1YECH 1FDLH 1O75A 1N59A 1FAIL 2E7BA 3FHEA 3K3QA 4GBXA 4WHYH 3VM5A 4IGBB 1A9EB 2HB0A 4RH4A 1M1XA 4G9DA 5FGSA 4N87A 3MRHB 1PX3A 2VDNH 1ZGLP 3HE6A 5DMJB 4KUZL 4JANA 3BZEA 3TIDA 4BXVA 2BS71 4WCYH 4P4KB 3ULVH 4PJHE 4DVBA 2OCCB 4DW2L 1HS6A 3TIEA 1CFMA 1JNNL 4MCNA 4XWOC 1GZHC 4MHHG 5LQBL 5K93A 1A7NH 1T0MB 2JKSA 2JK5A 4DN4L 4EI5B 4N0UA 5EC2A 2FBRA 4PJXF 1U33A 1ZPUA 1A22B 1DJZA 1BXXA 3ARDB 4HALA 2ARJQ 4H44C 3MLYL 4L4TB 4BD4A 5IY5B 2AVGA 1DVYA 3T71A 3R0NA 3DC0A 2ILLA 4G6KL 4UUJB 1CF8L 3TO4D 2NSQA 3SDCC 3L3OB 32C2B 3CFIC 4HKXA 2ZKWA 4RGNB 5DQ9A 1ZLVK 3E8UL 3BJLA 1QSED 1P2CA 1LLAA 4KJWD 5JW5A 4NO2B 3BVTA 4KMQA 3W9EB 4OVUA 2E9BA 1SHSA 3F7YA 4QGYA 5CCHE 3VFRB 1A64A 3GMPA 4LKXA 2A6IB 5GRVL 4AVJA 1P9MC 1HE8A 3DMMA 2KDYA 5C0BB 1XH3A 5F3BB 2VR4A 3J2PA 5ERWA 3A24A 3EBHA 4LPTA 4BUHA 2K78A 5I1CH 4V1DD 2EXTA 2G60L 3T0EE 3D33A 4JB9H 1W0WA 5I2IB 4LCCB 5IB3B 1JV5B 1U0QA 5FYLH 2DWEA 5FGCE 4F7KA 3X1GA 1LEKA 4EZKA 4N2MA 3C2AH 3PXJA 5F72S 5JIIA 4WNQB 2ZUSA 4R97C 2NY7H 4QHUB 4QHMB 3ZIMA 3HUJE 5TGBA 1UB5B 1QX1A 1RUKL 3S3PA 3GS4A 3NPSC 4P0DA 4P2OB 5L2KD 3WGVB 4YGVB 3I50L 5DSCB 3V4VH 4PLOB 2E7CA 3MJ9L 5LXGH 1A4JB 3V0HA 1WH0A 3RVWC 2BNRD 3JWNH 4DCQB 1FVDB 1W0VA 4XNUH 5LG6A 3D6GA 5DD6B 4G8GB 5E9AA 3L7EB 5HI5D 5F7HA 1F3DJ 3FTUA 3P69A 5FYJL 3QZOA 4PTUA 4U1IB 4LSQL 1KXVA 1S7XB 4JJOA 3RTLA 3GK8L 1RUPH 4QRPA 1BAFH 1YSOA 2MSPA 4P2CG 2Y07H 1VENA 4FLOA 4LNRA 3Q01A 4L37B 3VXSD 4G8FB 4I48B 3FRUB 2OMXA 5KVGL 3MLZL 2KLRA 1PY4A 3VB9A 3QUMB 3H3PH 1CQYA 3VDCA 1B88A 1NGYA 5C7ZA 1MCDA 2O5XL 3ELQA 1SRDA 3IF1B 1T03H 3L6FA 2NTSP 2YRPA 1T6BX 5JHBA 3DSFL 2Y7LA 3H0TB 4MXWH 5EUOF 4R4FH 4JO4H 4MWFB 3P2TA 1HHGB 1OPOA 2LVEA 4JDTL 4O2EA 2A9AA 3L5JA 3QQ3B 2PCPB 1J18A 3S3BB 3ROOB 3VRIB 3ZT7A 3ESVF 2ADIB 3PIQB 3HHMA 5FKAA 5L88L 3QFGA 2YC1B 4PB0L 2ZOOA 1KGYE 2MCPH 1UADC 3IFNL 6FABL 2HT2D 3LXAA 2JJTA 3B2PA 3SBPA 2PXYB 2E9JA 2QTVA 4JFOA 4R5TA 1I8AA 1S9KC 4Y9BA 2XTJB 4LKCA 5JUEH 4NIKB 1ET7A 1HZKA 4PWKA 4PS3A 4W93A 3ATFA 3G9AB 3QDGA 5ITFA 4DTGH 5HJBA 3RQ3A 3OLIA 4Z7WE 3GF8A 3VGFA 1PNCA 4AM0Q 2CGYA 4NHUB 4Z5RA 1JGUL 3V8OA 5AD0B 2D3VA 1BVKA 2N1KA 3RWCA 3RVUC 3KEHA 1D6EA 3UJIH 4TUOA 4XN1A 1RVFL 5IJVA 2AXFA 4WUUD 1XR9A 1JGEB 3UPRA 1E8YA 2E47A 3IGAA 2HUEA 1YEHL 1GZQA 1AZCA 1NIFA 1RIHL 4WJ5B 1UWXK 3JWOC 1KN2H 5EN2A 2LU3A 3ARBA 4P5TB 3JTBA 4DGYL 4ZMOA 1CGSL 4JN1H 5IUCA 1KIPA 3KWXA 3AFLA 1B0GB 5DZPA 1PG7L 1CF1A 4PJAA 2GEQA 4NO0D 1G1OA 5E8DL 4ZS6C 3DVGB 4N0UE 4YVNA 2ENSA 3RJOA 5CU5A 3PJLA 5G5DA 3BWAB 1J8RA 3WKQA 5I1AB 1CVSC 4JO8A 2X2YA 4XC1H 4ZMQA 2VABA 2QKIC 2XUWA 4MMZC 1VB9A 2IAMC 2VDKB 4OLXL 5AKSA 5F9DC 3MUGB 2A7BA 4NBXB 3LKPA 3CX2A 2WLIA 2Y6SC 4PJEE 3G5YA 3UTSD 3FFCA 3D12B 4N8VA 1TZIB 3LEVL 4JO1H 5CJ8A 5DJDB 1F1GA 4BJLA 1A9BA 4N1CA 1QLEB 3HG1A 3TEXA 3FQUA 3H3KA 1U2YA 1WQVT 3SOBH 5ADPH 3O3BA 1DL7L 1RZPA 1XIWA 3WS3B 3Q1SH 4IOIB 3BPLB 4P4KA 1WWAX 1MJ7L 3S37H 4K9EC 1YC8A 1D5IL 3DK0A 4OQTH 1FZMA 1MCOL 5K59F 3DURB 3MCLH 2DMHA 5C0IA 2A0LC 3HBQA 4RGMB 4KRLB 5F89B 3AMKA 4LVOC 3VUAA 1ZVSA 5DEGA 3TCLB 2CLRB 5EO0A 1CO1A 4HHGA 3T4AC 2BHFA 3D1MC 4ZO6A 2BSTA 4JPKL 2Q2LA 5F7EH 1HNFA 2MNWA 4F8QA 2EDFA 3CXHJ 4XNZB 1OD9A 2Y5QA 2X4RA 5AOZA 4G80B 2YXMA 4PLKD 5CINH 2EVIA 2HT4C 5ABDE 4QRSB 5B22A 3MA9H 3VXQA 1ZA3B 5GIRB 7PAZA 1RJZA 2R29A 1LWJA 3MNZB 4K23L 5CP7A 3TA4D 3K0WA 4DPCX 2AW2A 2KZ1B 3RAJH 2FJUB 2J4WH 4YLBA 2BRRH 4NZRH 4LAQL 1RIVL 3WJJC 1NFKA 3VSTA 4QOKB 2VZOA 1YUKB 4QRPE 4MB1A 4OV5B 3Q48A 2ICEA 1KB9J 4X4KA 3MRJA 1J8HA 4GKOA 1T20A 3NCXA 5F1OB 3DTDA 3FBKA 1FNSH 1QP1A 3C5SA 4G7VH 2UZXB 5KYWA 1TTAA 2XVKA 4OZFH 4L0PB 5T1KD 1J5CA 3JV4A 5TE6L 4U2YA 1A4JA 3FU6A 4KTYA 1ZJBA 1DO5A 2FBJH 3FUHA 1FC1A 4M29A 4D0CA 3UAEA 4F3FB 5CMAA 1NPJA 3V0GA 1MCBA 3J8F7 1ED3A 1TQBC 2NXYB 1QMUA 2BVQA 2QMKA 3C8HA 4Y2OB 4AEHL 3VFWA 4KZEL 8FABA 1VJSA 3SN6N 4M3JA 2XVBA 3CFDB 5K9QI 4HUNB 2XOTA 1ZLSH 4NWUH 4OLVL 4YC2B 4N2OA 2XKNB 5I1HL 2NY6C 2VMCA 3ARWA 4P5MB 5B8CA 1O7SA 3BIKA 1YC7A 1J1OH 4JRYB 4PI2A 2HRGA 2VXUH 2WWOA 4L18A 1OTUC 1YVLA 5BJTA 3WFEL 4HVBA 2E75C 1FE8H 1XCQB 4C4KT 1YLBB 3V0FA 3CZEA 4RBPH 5DF0A 1U8MA 2AJ3A 1V7NH 4NUMA 4A6YL 5ITBH 5H2BB 1G0YR 1T04B 1UD6A 1BX2B 3U4BH 1XH1A 5H94B 4YX2H 3SDDD 3VWJD 5C0CA 5JQHC 1CFNA 3WIFB 3CLWA 1P7QB 4CSTA 3NJJA 4NQVB 5LLIC 2H6UA 1NCCL 4GMTL 3REWA 5T1LD 3KBFA 1GW0A 1NMBL 4RFOL 2GTWB 2BSSB 3SD2A 4A2MA 4HWUA 3LNEA 3P4MB 1JGVH 1QSZA 4AE0A 4BV1A 2JI2A 3OLEA 4Y1AB 5AAMC 3WXWH 3MX0A 1EHAA 3KL0A 4JFDE 3OAZH 4K8RL 4LSUL 5H37A 1Z9OA 5G4OA 1T4KB 2YD7A 1CDYA 3L3IA 1BQ5A 5JNYA 1D5XA 3FFCE 2O61B 4XCYA 4YAQA 3Q44A 3Q6GL 1H3PL 4U1SA 5AYUH 4I9WE 4TTDD 4IRSD 1RMFL 3SYAA 3VFGH 3VFVA 4XNXL 1JUFB 3CDGA 4OJYA 3DI3B 5AVZB 2N56A 1IL1A 4ZAKC 5F71A 3FHAA 5ECJE 5I1DB 1MHHA 2YBRA 3C09C 4HIJA 1GGBL 4YFLI 3HOGA 3QE5A 3B7YA 7FABH 1NEUA 3DBXB 5BQ7B 3BEVB 2YGVA 5C1MB 2AFNA 2X6CA 4FKEA 3D9AH 2KQNA 3MOBL 3D7PA 5I74C 2AQTA 1U3HA 2OBGA 3MV9A 4I9XA 1F6AB 2X2JA 3TA3D 4YHYC 3QRGL 4UV4H 3P9MB 3R1GL 2R9HC 3AZUA 5CHNA 4OCLC 3RIKA 5FCUL 3RX5A 2P47B 2W92A 1A1OA 4LU5L 3VWKB 1AGDB 1YMMA 3DO3A 4AI7A 4JFQA 5I1JH 4A66A 5DJ8A 5TE7H 4Z77B 4RMQA 5J89A 3DUSA 4RISH 1N64L 4L8DA 4NZTL 3HFML 3LEYH 1QKZL 3IJYB 2HVKA 4JM2F 3SE9L 2FHFA 2ZPKH 3POHA 2Q5BA 4HSQA 2NPLX 3HIZA 2ORBL 3H9SB 4RAVA 1T2QH 1J8HE 3QWOB 3FMGL 2O6FA 1T22B 2CCLA 3QEGL 4ODWA 1CGXA 4QTHB 5CZVH 3BUDA 1HCVA 2V5RA 1YPZA 3A6OA 2F19L 1DHKA 3TYFB 1SMAA 2N59A 1PLAA 4TVPD 5LVEA 4I8DA 2EYTA 2YRLA 2W0FB 5ECGA 3BH9A 3CDFA 3CUPA 5EZOH 1EAJA 4CSPA 5KVMC 3BUQA 1Q0YH 4YLQT 1T1ZB 2JI3A 2X4NA 4XPGH 2KHAA 4OIAA 2B3RA 2FJHA 3SY6A 3ARGC 4JM2B 2CHXA 3RIFK 4HS6B 5C0AE 4NRXB 1SUJA 5K1NA 3QO1A 3NIFF 5C97A 1IQWH 2P49B 1Q9WB 1BOGB 4EKJA 4NX0A 2PWDA 1UZ8A 4JG0L 4JFFA 4FJ6A 5EOTB 1A4KB 4RNRB 4UILL 1KYUA 4X98A 2GSIB 4POZD 1IM3B 4A2EA 5TPWH 3AREC 1E4KA 1IAKA 3PAUA 3SE3C 1EJFA 4QUOA 1R6VA 4FZ8L 1UH2A 2J8UF 4AQ1B 4EDXB 4QJ5B 5KN5A 4UTBL 5FB8B 1FN4B 4MX7B 3HAEH 2CK2A 5C0CE 2XZAH 3GRWH 4Y4FB 3MROA 2W9LA 1ZANL 5HVHC 3BRDA 1QASA 5D9SA 5KANG 5I75B 3NIFB 3WIHA 3NJXA 4WHYG 3BUIA 3O2VH 5E5RB 4QAMB 1EDQA 1FO0A 1RSYA 1XT5A 4OFKA 3QIBD 3G6DH 3QS3A 3MLSH 4MQXC 3BIBX 5LDUA 1CFVL 2W8CA 4N22A 4TLKA 3V79C 1N5YH 2ENYA 2IGFL 3WHXB 3FCTA 2NY5H 5HGGS 5LGJB 3KM1A 3LDBB 5F8QC 1P7BA 3KGUA 4MCYB 1DQDH 1MWAH 2J3SA 2J8UB 3TP4A 4KZDL 1BD2B 5MEOB 1SXSA 2OMNA 4GXVH 3AQXA 3ARSA 3GEFA 3GB7B 1PFOA 1RZJH 4AG4H 5CEXB 2YOAA 5E2VL 2R2EB 4JKMA 1TVBA 1P7QA 2OP4H 3O45B 2J6EL 3BHBB 1S7UB 2H9GB 3B2VH 3ECBB 2LFGA 3UP6A 3S5LB 1TKWA 3QIWC 4PJBF 2X6VA 4CMMA 4KDTC 4Z23A 2Z3FA 2GJ6B 4PRNA 4ZO8A 4RBPK 4NS0A 3WOVA 3H2PA 3L95B 3VXMA 1L0PA 4ZO7A 3QUXC 1AJ7H 1KGCE 2QHRL 3EJTA 2VN5A 4I2XA 4NT6B 1BCIA 2FWOB 1N4XH 4N6RA 5FO2A 5L2JA 4ZPVB 1HKLL 3OZ9H 4WQOA 2H3KA 1ZV9A 4Q56A 2CO3A 1TTRA 1E5BA 4UWQB 5IB2A 3LPWA 5FLUA 4KK9D 4KPHH 3K6SB 5HDLA 3BH8A 4CDGC 2R1XB 3ILQD 2Z31A 1RK0A 1S3KL 1EZSA 3QIUD 4GKNA 4ERSL 2OLDA 2UZYB 3WD5L 5FCSH 4O2CB 4PJBB 3ME0B 1PEWA 3S96A 3ISWA 1G5GA 5JORB 4YHML 3OAZK 3B9EA 4JJ5A 3ASNB 1A47A 5A40E 4M43H 4YHLH 4C8XA 5CLZA 2BP0A 3KLSA 1H6EA 4YNYA 1FLRH 4JO2L 4I0PB 3JWNG 1S9WB 4X9HA 1YPZE 1A3LL 2QPFA 3PFQA 4X6DF 3O4LA 3FZUD 4R5VA 1YNLH 3GBNL 3FTXA 3T2QA 2HPTA 2DL9A 3CX5J 3GSOA 5EF3A 1WCBA 3P4NB 1IGFH 4M5ZH 3GSNA 3R7RA 1YEJH 5I6LA 1NKOA 4Z8FH 4CU6A 1YQVH 3KPSA 1QD0A 1IEAA 4D9QD 5AOIA 1CBVH 4ZD3L 2IANB 3D07A 1KB5A 1BOYA 3ASOB 3ZIYA 5SWSA 4X5XB 3SYCA 4N0YH 2FEDD 4P07A 2Y36H 2YLKA 4ZYKA 1CLOH 2R1YB 3Q5YA 4JHAL 5DJZB 5T3XD 4M6ML 4JR9H 4YDJB 1UJ3B 1SN2A 3NMEA 2FDBP 3FU7A 3NFNA 5DD5H 5D2LF 5F7YC 3DVNA 3BP4B 2JB6B 4X6DB 2QLYA 2HFFB 5JXAH 1V8HA 1M05B 2O6CA 5BZWA 3STLB 4PRAB 3P9LA 5HHOE 4ONHB 1CE6A 5GS1C 3VI4F 4WV1A 3CSYA 1BZ9A 4JDVA 1PLBA 1G6RH 1QYGL 1I7RA 1LK3L 4N8UA 4R4NC 3O3DA 3E8VA 3FH7A 3UBGA 5B38A 1V5JA 1NDGA 5DLML 1HCZA 2ZSWA 3IBEA 5D1QA 2BIOA 3SDXA 3GNMH 3V9EA 2KYIA 4AW4A 5C2BH 3QZLA 1Z32X 5C0FB 2COVD 1CR9H 3GXMA 1ZVHA 2VXQL 4XWOD 4ZTPH 4B9CA 4P9HL 4O51A 2ZOTA 3E6FA 3FO2A 4PJ9A 3CH8A 5DRNB 3U6XS 4HT1L 4R7LA 2P42B 3CMOH 5EBWA 2QSQA 2TRHA 3JVFC 2NOYA 2WVTA 4UM8A 4EPSA 4YL9A 1QACA 4CVXA 3D30A 4AQAA 1MJUL 3WTYA 1CLVA 5LWYH 3SDCD 1RZKL 2CJTA 5KJ7E 3ARFC 1DVFB 3ZKQD 4M9PA 1NMCB 4M56A 4FHJA 4HS8H 2RHEA 5I0ZA 3AWFA 1RY7B 3NFPB 5D7KE 5FDYA 1FAIH 2W59A 2CDFA 4WAFA 5JOPD 4G82A 1WUNT 3MBWB 4PS4L 2KPWA 4RAUB 2W38A 1DTUA 1W91A 5EDXA 5DJ6B 3QXUA 3DO7B 2EP6A 1PTZA 3BD5A 2BIPA 3MNWB 4KUZH 1DJGA 1EMTL 2DQUL 3NGBC 2QSTA 1SYVB 2D7QA 1AIFA 1HHHB 2GHZA 3C6SA 4W9FC 3VCLA 2P24B 3B2MA 4IU3B 5E0FA 3QCTL 3VH8G 1JN6B 3VXME 3L7FB 1JNNH 2JELL 3PQYB 5LQBH 5FDWB 4YDLB 4Z7AA 4DN4H 3SQBB 4EIUA 3WMPA 3ZLQC 1Z7JA 2AKRA 1FFPA 3CU7A 3QPXH 3HZYB 2P9RA 2AK1L 4ESKA 4DJMA 5B7MA 2OI9C 5IKCA 3MLYH 3QHFL 3RVWD 4PGZA 2CJSA 3CH1A 1H5BB 1CF8H 4G6KH 3DXAB 5AB1A 5IJCC 6PCYA 5KBPA 5GRJH 2YPLD 3E8UH 1TU2A 4C47A 2VRQA 3TNMB 2VXTL 2YUZA 4NKMB 4DGIL 2YD0A 5IVZA 2V3FA 3D3VA 2KT6A 5DJAA 1RLWA 2BY2A 1L7TL 4LFHD 4XXWC 5GRZA 1QI5A 3MAWA 3O4LE 2Z7UA 4N5EC 2YO3A 4GKLA 3EYQC 4XE0A 2G60H 5CIPB 1IBHA 1GYVA 2WC7A 2Z7WA 3C5ZB 3KGRA 43C9B 3RTQC 2R39A 4KX9A 1HCFX 4N2GA 2YD9A 2K8QA 2CCWA 2HPOA 3VJ6A 1HXYA 4ZMNA 3KPSE 3NJGA 1BPVA 1E8ZA 2CMRL 3GKWL 1R3HA 4YO0A 3VXNB 3L3JA 4HIQA 2R2HB 5JIMA 5EULV 5KG9A 5DVNA 1RUKH 1T83A 1JE6A 5SWSE 2R7EB 3ME0A 2Z34A 1JI2A 5DVMA 4OZFG 3I50H 1QO3A 4BDVB 4UQ2A 3MJ9H 1EZLA 4L1SA 3P77B 3IGLA 1RKRA 2ZG3A 2B9AA 3N44F 1A7RL 2ED8A 5FYJH 3BPOC 4X2UA 2QQKL 4B9KC 4LSQH 1DVXA 1JZ8A 4BFGA 5BS0B 3GK8H 4UQ3A 2F8IA 3Q13A 2YZ8A 3N55A 3A6BL 4MQTB 4XRCA 5IESH 3RVUD 5KVGH 3IS0X 4NKIL 4IRZA 3MLZH 3EO1A 5AW1B 1SY6L 3NN8B 1MLCB 5C08A 3QCVL 2FECL 2O5XH 4WI7A 3RDTA 3NACL 3DSFH 5FEBA 3HG4A 3THML 3BWUC 3DYPA 3VFNB 1AD0B 1L7IL 3I3DA 1YUHB 4JDTH 4F7TB 3OKNB 5HYQB 3N44B 4PH8A 4ZS6D 4B9FA 2UXVA 1SQ2N 2X4QA 2PYFB 4I89A 5L88H 4NJ9L 1UT2A 3H6AA 4PB0H 1L5GB 3IFNH 3PY9A 1DBBL 2XACC 4ZOBA 4NQQA 3U4EA 4D2NA 4JGJA 3OJDB 2IAMD 4FTVA 4BM7A 5AVYB 1KCKA 5G4NA 3GMOA 1TZHA 1UGNA 3F58L 2Y6SD 3JT2A 4WO4C 4NENA 4PRDA 2EC9U 2JKXA 4GAYA 3B7TA 3RWJA 3SGKA 1B4RA 5JXEA 1JGUH 4L2YA 2E86A 5T8IA 4QKTA 2NSXA 5TQ2L 1P1ZB 1RVFH 2PMZA 5HXMA 2R8SL 1EXUA 1VCAA 4NC1C 2Q10A 1AZRA 3LIZA 2A0LD 1MHEA 2Y0SA 2QSVA 1XGRB 1YEHH 2HSIA 3GBDA 4W68A 4B27A 1RIHH 5E4IA 4Y2DA 5B3SB 1EEUA 4HHWA 3UH8A 4HKZB 4DGYH 1CGSH 4JGMA 1U30A 1Q9KA 1PG7H 35C8L 1IILE 4PGEB 3GSVB 5E8DH 2ADGA 4BH8B 2FR4B 5D7JB 2MKLC 3GUTA 5CFHA 5G2NA 4Z7VA 1YHPA 1DVFA 2LGNA 2MRYA 3C60B 2HT4D 4FE9A 5I76B 3RZWA 4D7PA 1AP2A 4NAMA 2DWXA 1MG2C 3P3RA 4XH2A 4OLXH 2VITA 3GSRB 4NN7C 3O4OC 3SKNB 5DXWA 3WEXB 4APQC 3KS0H 1NUFA 4X5RA 3ZOAA 2WMPB 3QI9A 3NSXA 4JAMB 2ZP8A 3LEVH 4MMXB 3CXDL 4DH2A 2B16A 3VXRD 5IB5A 1AGCA 4QWWC 4I18B 3UJTL 3LAFA 4MHHI 1SYVA 1DL7H 3D3VE 3EFFB 4MJIB 5D7LA 1MJ7H 3I84A 1G9HA 5AEAA 4K5MA 1JN6A 2VDOL 3D5OF 4LLYA 5CEZD 1D5IH 1MCOH 3U46A 1XAUA 2ZOUA 4OF3A 2ERJB 1I1AA 2MMXA 5AVSB 5JDSB 3U0TA 5I9QB 2A73B 2Y69B 3K91A 4GLRI 4W9LC 3W11C 2QSCL 2VDPL 2G3NA 4TLTA 3KPOA 2OSYA 4H25A 4JPKH 5C07D 4NN5C 1U8PB 1J0KA 3EDKA 5IW6B 2DM7A 3RE0A 3O9WA 3GSUA 4ADIA