4C4BA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v in the reduced form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
b'MELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 26
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4c4bA00
4BK8A 4C4BA 4C4UA 3QZBA 4BRVA 4BV1A 4BFJA 2JI1A 4BFFA 1VZIA 1DO6A 1DQKA 2JI2A 4BRJA 4D7PA 1VZHA 2AMUA 4BGLA 1Y07A 2JI3A 2HVBA 1DQIA 4BFKA 1DFXA 1VZGA
chains in the Genus database with same CATH superfamily
3QARA 2WXKA 1T4KB 3O11B 2J4WH 2PTVA 1JV5B 4FHJA 4AGLA 5DVOA 2XWEA 4GP8B 4I4WB 1IVLA 5BOPA 3C60A 5KBMA 2ICWB 1KIUA 2Q7AA 1MXDA 5KS9B 2NX5B 2XI9A 4PUBL 4DZBA 5BQ7A 3Q6FA 1QYGL 1SUHA 1WBXA 1WJ3A 3QB7C 4A7GF 1KIRB 4PRPA 3OGCB 1IM3D 3V7AE 1C7SA 1J8HA 4RFNB 4RA0C 4F7MB 5ITBL 1MRDL 5I0DA 5E8OA 4I0PD 3C5ZB 1L0YA 1FUNA 2PPCA 3QPKA 1M9SA 4OM0H 4QY8A 4PGDB 4BUHA 1ZLUH 4PLNC 4J3OG 4LCYA 5B1KA 2X4TA 2Y06L 1QFWH 1FFPB 1U6AH 3L9EA 3HJ0A 4HUNB 4LLUA 4G43B 5DD6A 5SWQB 3WUWA 3V4PB 3BX7C 4MJ5B 3K71B 3DIDA 3C60D 5C9JA 2EDBA 3HRPA 4KFZC 1CFTA 4R7NB 3MCKB 5DD0L 3RIFF 2Y25A 1NKOA 3CMOH 4JO8A 4CMHB 4Z7QB 5DURB 1FL3A 3NZHH 3P9LA 4GAFB 1A6UH 3QZMA 5I1DB 1MJJB 1WK0A 2VISB 1FFNB 4QYOB 4GBXA 4X9HA 5TE4H 2X9WA 3QUXA 3REWA 5HHMB 4TVPE 4BZ2A 1A7RH 4TUKH 5GZOD 1J8HD 1HYSC 4JKNA 1E8ZA 4NPYB 3LV3B 2NY2D 4XNDA 1QACA 3K74B 5IJKA 2ADGB 1J8SA 1BSIA 2C3VB 3TIEB 1MCJA 1KPVB 2BSTB 1OTUD 1TEFA 2I9LA 1EZSA 2CR0A 3HG1A 1XXDC 3WBDA 2IOMA 3EJRA 1JZ4A 3VI4E 2ENSA 4H25B 2FX7H 1DBBL 1GKEA 3O2DH 4LESA 3RL1A 5KVDE 4M5YL 3HAEA 1QSFB 3MROB 4E36A 4F8NA 3ZU8A 5HYSA 5JPNB 1T66C 3BFOA 1IE4A 2NY7L 2OJZL 2FQEA 3HS0C 5JW4N 1URLA 1D6EB 1PG7W 1QSZA 3K72A 4YGAB 1HIMH 4U0RB 1DTUA 3RURA 1UD5A 5GJSH 3FQWA 4XTRD 1QBLL 3THMH 4J3WA 1LO4H 2IPUG 3QUXD 4OCRL 4AQ8A 1BIIB 1DO5A 2V3DA 4Y4HD 1BF8A 1NCTA 3WNMA 1PY4A 1E3ZA 4RVBA 1IM9D 1DYZA 4YSPA 1E4XH 2YN5A 1P2CB 1M56B 4YBLB 4GLRH 4Q4EA 4ZTOH 3TT1H 3ARGB 1NUGA 4P57B 5B4MC 1H5BA 4F80A 1PLBA 1HTYA 2XPYA 3DHJA 1XIWC 3GJEA 5CJQL 3ALPA 4DESA 2B15A 1G9ML 1S7SB 4UM9A 3QJSB 1ZMYA 1L9TA 2WXGA 1INEH 2UX6A 2VLRA 4IRZH 4UQ3B 2Y7LA 3P3TA 5K59E 2BJML 1CB4A 2DD8H 4B9FA 5MEPA 2DKSA 2CWRA 4EDWH 1UXWA 1NINA 4Y1AA 5DJXB 2OTWA 2Q7NA 2WBJC 4JRYA 5ACMA 4ZOAA 4Z1PA 4KVNH 1ZOXA 3I9IA 3FT2B 3K4ZA 3VFNA 4ZO6A 3F83A 4WJ5A 5B7FA 1S7VA 1R5VB 4Q2ZA 3VO0A 1WV7T 1HT6A 5EA0L 1WHPA 2VDML 4H26A 2VXSL 3T4AB 3NA9L 2R9HC 2G75B 2E8ZA 2GJ6D 3RA7L 3U0WL 4DVBA 1IMHC 4XI5C 3MXWH 4ALAH 2NYZA 4MJ6A 4MNGB 5F89A 1S9WB 3ZBMA 1RJZA 3GS7A 3VB9A 1YUHA 3SPHA 1G6RL 1AS6A 5EC1A 1PCXA 2VLRD 3UPCA 3ZHFA 1KCRL 4LLWA 4MA1B 1G9EA 4IBWA 5CMAB 3U6XS 3T6VA 4E42B 2GBVA 3RX8A 3GI9H 3KBHE 4N1HB 3IDNB 2V17L 4LU5L 1E8XA 2X4OA 3QO0B 2X7LA 2OTUA 1OZTG 1CC3A 4ODSH 3WJLC 4BV1A 3CU1A 5E5LA 3VH8B 5TF1H 2G9HB 2NSXA 1DQJA 1NEZA 1IC5H 3S37L 4FQ1H 5F9JB 2MFNA 5KYYB 4OF8A 5C0BB 5T1DL 3QDJB 3CHQA 4JDTH 2Y23A 2VLKA 4AVJA 3X13A 4FFWD 4NKOA 4AYEC 1KN4H 2GSIB 3MRKA 4L2LA 4QRAA 5JIDA 1D2PA 4U1SB 2DPKA 2WLLA 5I5IA 1WP6A 1U3HC 1JNLH 1MZYA 4ELKB 2DM4A 4XN7A 1IILE 1UM6L 3VRJB 1NWOA 2WGNB 4UDTA 3F85A 5EB9A 3DX1A 5L7XH 1CD1B 4FG0A 4NZRL 1WAPA 2F58H 2MTAA 1WTGT 4UQIM 1H3XA 1MQ8A 1I4FB 4GUPA 5F7LB 3K4DA 3RWFB 4F92B 3GKWH 1PD0A 3Q1SL 1JUFA 1T7ZA 2I5YH 3N91A 1DCLA 2Y0SA 1CR9L 1X5YA 3D4ZA 3NJIA 4PBWD 5IQ9A 2I7OA 4N20A 4WO4C 4OZHF 3X1FA 4KROD 5FYJL 4K07A 1YEFH 4UUJB 4I9WE 5BRZE 3LXAA 4G8EB 5FKPB 2AAAA 3OJVC 3TBVA 3I2CL 4I1PA 4Y9BA 4OLYH 1KTBA 4RSVA 3FQRA 5IW1A 4I2XB 3SDYH 2YUWA 4HXBH 2UYLB 5T8IA 5C0JA 1A9VA 3EGSB 3SDXF 5JORB 1NCDH 5AZUA 2CDFB 3ULVL 1ZS2A 1A0QH 5CGYC 4WWOA 4ETYA 4YS4A 3LQAL 4RH4A 3FB7A 5HDRA 4FRWA 1PDKA 1HZLA 1TNNA 3GMRB 2BLFA 5JMRA 1KJ3H 1RK0B 2WNWA 4HC1H 3JV0A 1UFGA 4ONHB 3HLAB 4N25A 4G6AC 1R1CA 3UTTE 3GFUA 2BNRE 4K7FA 2L7UA 3IMSA 1BVOA 5TQ2H 5FO9B 3A24A 3E6FB 4Y2LA 4AQ1A 4OJFH 5JNYB 2C7FA 4KC3B 5EEXA 4O2EA 3B1TA 3NZSA 3LRKA 4I0PB 2PP9A 5EHFA 4KJYB 2OMYA 4WJG3 4ZS7H 2DIJA 4KV5F 1H0DA 1NC4D 4RGOL 1EMTH 3X1NA 1XWVA 4O00A 3II1A 3OZLA 4DKEL 3CXDH 4V1DE 4KK9C 3V0EA 4F15B 3ZE1E 5EBGA 4P48A 1BF2A 3GXNA 4DOHE 4F8OA 1FYTD 5AG8A 2VE6A 1HC1A 4FAAB 4JQVC 3C60B 3ZHNA 1KIUB 4FL4C 5K1JA 1AJ7L 1HKFA 5HD8C 4OLXH 1KJ2A 4Y9FA 3AITA 3G6JF 5BQ7B 1YVLA 4DZBB 2IH1A 3Q6FB 4GNKB 1WBXB 2J8UF 5CBEA 3NBNA 3IEAA 3WFEH 1KYUA 4AIXA 1MW0A 4LGRB 4PRPB 2BW5A 1CN4A 1J8HB 4X7CC 4D0BA 2C9PA 5E8OB 1CURA 25C8H 2ICEC 4LSVL 4FQ2L 1VF5C 4OW6A 2DQ6A 4PV1C 5E2JA 1MFDL 5J89A 4QY8B 2EADA 3IBEA 1QHQA 3QNXA 4K3JL 1TFPA 1R3JA 5D2NA 2HJKA 4LCYB 3BCFA 2X4TB 3HE6D 1ZTMA 1EUUA 4JO4L 1HNGA 2YD0A 4LLUB 5DD6B 2P47B 3PHSA 1HL8A 5DXWA 3WUWB 4AE0A 4AL8L 3UPAA 5C9JB 1PX3A 4YEEA 4ES8A 1CFTB 4PJ5D 4XBMA 2VDLH 2KLSA 3LSOA 5I15H 1G43A 3TCTA 1FL3B 3P9LB 2WO2B 2Z7WA 3RB7A 2KH2B 1OSZA 4GBXB 5J1TC 1XGYH 1R24A 2I26N 1XZWA 5D1ZD 3QUXB 3REWB 4X80H 4AQEA 2Y3NA 1IO4C 4QDGA 5DEJA 4YMPA 2NQ3A 3M8OH 1FH2A 1BP3B 1HWWA 2EIBA 2ZXGA 5K9JH 1BJMA 2I9LB 3FQUA 5AZEL 1GYAA 3HG1B 1TJIL 2IANE 4FC3E 4GKNA 4TS6A 5GGVY 3DMMA 3F5WA 1WFUA 2DJMA 1UWXK 1NFDE 3RL1B 3HAEB 5IEKA 5H37A 1SJMA 5HYSB 1BVLA 2BSSA 3NH7L 2IOIA 2XTJD 3QO1A 4PLJC 2X9ZA 5D71L 3WHE1 4F1ZA 4TNFA 1YECH 3BHBB 3PXHA 3KWWB 1FYHB 3RVXD 5AKVA 2WJ7A 1BHGA 1YCSA 5A2CA 4H8WH 3BN3B 1RP8A 3K72B 5FYLH 1MCWW 4F57L 1L9RA 4U4IA 3BWSA 5CS7A 3EH5B 3FQWB 3JVFC 4P05A 2QVMA 1J5DA 3QIBA 3JZYA 5LBSA 1URZA 3FZUD 4Q6IA 5DJYA 1JVLA 2FO4A 3N42B 2ZX9A 3G5YA 2J20A 5IHBA 4XT1C 1VGEL 2ZUUA 2EDHA 2VM9A 1H5BB 3IB4A 4S1SL 2E9BA 2VCOA 4A7SA 5KBNC 3GJEB 1BYNA 1JCVA 4UM9B 5I9QC 2HTKC 2VLRB 4MB1A 1G9NC 2D7QA 4ODVL 1AC0A 1KUMA 2R23A 2XX1A 3P77A 5MEPB 3DX3A 4AKQA 1UXWB 1JF1A 2R2EA 2A1WL 1CBJA 4Y1AB 3VH8G 1EGJH 2OTWB 2OMXA 2XXCB 4JRYB 4CDHA 1PFCA 1YHPA 5EU6E 2QMJA 3VFNB 3LXBA 2BVTA 4G7QB 3NFSL 4FFYH 4P2QD 4P59H 1U8OA 4WJ5B 5D8JL 5BPPA 5D6DC 4W9KC 1OM3H 3QIBD 3DX4A 4Q2ZB 4JPWH 1HL5A 5KSBA 1FNFA 2Z92A 4H26B 3D87B 3GSXA 5FM8A 4DVBB 1P4IH 2VDRL 1II4E 4K15A 4OJEH 1AY1L 4KKRA 1L6XA 4MJ6B 5F89B 2CIIA 1CLZL 1J1XL 3R4RA 3T0EE 2A9MH 1RJZB 2ZXWB 1YUHB 2YXMA 3X1GA 4RESB 2NSQA 5EC1B 4LLWB 4HIPA 4HJSA 2E9JA 5EO0A 4RZKA 4YHZH 3FTSA 4M3HA 3U83A 1MCPH 1RIHH 1TEYA 1TITA 5BCAA 5F0MB 2X4OB 1MAJA 1JSYA 2OTUB 2X7LB 3U79A 2WN2A 3C87A 4MAYC 1OEZW 2ZXEB 3VYOA 1DQJB 1M7DA 1NEZB 4TSBL 3VUAA 1QBBA 4P5SA 5D2LE 4ZPVA 1E8WA 5C1MB 1OK8A 2XETA 5C0CE 1NGYA 2WLJA 1WZLA 1LK3H 1T04A 2V0AA 2WAQA 2VLKB 3NCBB 4KROB 3X13B 4PJAE 3NIDE 3L7FA 4Z7AA 4NKOB 4WI4A 1RZKL 5IKCA 4OZHA 3CLFL 3MRKB 1RULL 3GXFA 4Z7UF 2OXGA 3NIGF 2WLLB 1R6VA 3LRGA 4AQOA 5GS0H 1ERNA 2NOYA 3ORJA 4XP5L 2SODB 6FABH 1BEXA 4OFQA 3SE6A 4X4XA 5IREA 1N8OE 3JBG7 3EFDL 4P49A 2R2BA 4UDTB 3JWDC 4WNJA 3VYNA 2OJ1A 1WCBA 3SDXA 3U30B 1CDBA 1S78D 4PQXA 3QWQB 4GUPB 3PNRB 3VXSA 1LO3L 1MWAH 1OQXA 5FGSA 1JUFB 3WIHH 3U2SB 3A21A 4WI2A 2ZF8A 5IQ9B 3DO7A 4FYRA 4ZDHA 4Z3GA 3WTWA 3KLLA 2ZYHA 3B9KD 3FB8A 3L13A 1IIKA 4ZMWA 2D73A 3N2JA 5EIVA 2QV4A 3DPBA 2AW2A 3TBVB 4JQIL 1OLZA 3IJYA 4KPHL 4LVNC 3O2VL 3FQRB 5D72L 5IW1B 1YZZA 1FGNL 4OCXH 5EU7C 5C0JB 4JZNA 1PNCA 4IIQC 4ADIA 4J1UA 5CFHA 4HULB 3QISA 3ULUL 5LBVA 3FB7B 5C0RH 3LHPL 1PDKB 5LG1A 5HDQH 3VXSD 1EJ8A 5CZVL 2B5IB 3RUGA 2XN0A 4PWFA 2F19L 4CKQA 1E5AA 2I85A 3D3VA 4K7FB 2Q8AL 1KXVC 4XMZA 1RKRA 4HMDA 3G6JA 4XP6H 4AQ1B 4NQQA 5GS0C 3S98A 2J8UA 5MERA 1Z7JA 4O2EB 3AQXA 4AQZA 3ZN6A 3VACA 2OMYB 1HINL 2X28A 4ZO7A 1Y0LA 3BD4A 1H0DB 5CM1A 4BZ1H 5E6ZA 5D6CA 2ERJB 3WUWG 3CHOA 2YMXL 4LRIA 4BFKA 3ZUCA 1RD6A 4K5OA 1QI5A 1TG8A 5G4MA 5I6KA 4V2CB 1KCKA 4J23A 3ZW3A 2VE6B 5HI3D 4U1KA 2AHIA 1ZT1A 2C1PA 3O6FC 4B9ZA 5I6MA 3RVUC 2APWA 3L3OC 1KJ2B 4BIKA 4QXUH 2AXHA 5GZNA 3N44F 2IH1B 2Y4SA 2DTMH 4B5ZA 4PHXA 5CBEB 3CIQA 5FGBA 4WK0B 1PZBA 1VEOA 5TQ0L 5D1ZB 4PJ9C 2FEEL 4D0BB 5E56A 4I18A 1WF5A 4YPJA 1SHWA 4JFDE 2E47A 4B9PA 2VXTL 3VGHA 4LOUC 4ZNEA 3B3BA 4PRNA 3DLQR 2DQHH 2H0PA 3HLKA 3VXME 3HAEG 5I28A 1M05A 3QNXB 1T03H 1R3JB 4H8HA 5D2NB 2HJKB 5FFOA 5K1VA 5HYSG 2E7LA 3Q8CA 3HJEA 2OK0H 2AGJH 5DD1H 3RVTC 1I1AA 1YMHA 4KHXH 4LT7A 2EILB 2FEEI 4YUEH 4ZUUA 4FMFA 4CJ1A 1AFVH 4HAGA 5I8OL 4KX8A 3U9UA 5ISZD 5IHWA 3LSOB 4YHIA 1UCBL 2CKBA 4H0GA 5GZND 1NWPA 1SUJA 2D3JA 4YDLB 1MFNA 1OSZB 1SOXA 3EOYG 1R24B 2CK2A 3BQVA 3SHSA 3CFUA 4AQEB 2VRAA 3HG5A 2WYTA 3EYFA 5E99H 4LPWA 2QKIA 3BE1L 3FQUB 4DEWA 4GKNB 4Q97A 3UBFA 3NZUA 5IMLA 3DMMB 3F5WB 2NW3A 4HUMB 4GI9A 4FNQA 5IEKB 1RUAH 2R4RH 3FO0H 5F7DA 1FF5A 5BO0D 1BVLB 4F8PA 1NIEA 2BSSB 2O26U 4OJDH 2XVGA 2VDQB 4PEEA 5J4MA 3QO1B 3BLPX 1CFVL 4U1GC 3ZR6A 5JXAH 1MRFH 2QBWA 3TWYA 3A3YB 5KJ7E 1E50A 5EOCL 3L95A 3Q06A 3EZJB 3QIBB 5AALA 1A47A 1JZ5A 3CFDB 4YNYA 2DWEA 1HXMA 4CDGC 5DJYB 2J44A 2GY7B 2FO4B 1OP3K 2AQRA 4JFFA 3G5YB 4X0KA 2JV6A 2ZCHL 5L9DL 1SM3H 1F41A 3LKPA 2D9CA 4KQ3H 3NJNA 3TVMD 5IGXH 1GIGL 2N7SA 5D1XC 3KJ6H 1I9EA 5BQDA 3WTTA 3VWKA 3O3AA 3BW9A 2F1EA 2RH0A 3N40F 4NS0A 1SHSA 2V9RA 5EFIA 4YSDA 2DI8A 3TJHC 3WNOA 3E8UH 2R0LL 2R23B 3UBGA 4DK5A 3P77B 4FQHA 2EDQA 1EZUA 5LCVL 5JW3H 1JF1B 1TENA 2R2EB 1ZPUA 3EADA 4Q14A 3U2JA 2OMXB 1NEZG 4PSRA 1K9TA 2BOBA 2YAQA 3B9VA 1TQBB 1UM5H 3PU7A 3QS3A 2F15A 2BERA 1SJVA 5E5UB 3S3JA 4P9HC 1U8OB 2EDLA 3PJNA 3SO5A 2HG0A 3VI4F 4PRIE 1URIA 3G6AA 3OSVA 2WUBL 4WTZA 2EE9A 1A8ZA 1CFQA 3UXFA 4M48H 5KSBB 5AWNH 3OF6A 5HI4D 4K8RD 4WFFD 5C6TL 1XGZA 3FOMA 3MLZH 3T2NL 4JFFD 1J5OL 3GSXB 4WRLA 3V6FA 3BKJH 1OAZH 3BKCL 5I8CA 2Y1ZA 5AOJA 5AW2B 4B53A 2BZDA 2CIIB 3IU4H 2VR8A 1GHFL 3KGUA 2JKSA 3TIDA 4OD1L 1UWFA 4LCWA 5D7EA 5CZKA 5FCSH 1E7VA 1FFTB 3U0TA 4KXCA 5EO0B 1T6WA 1ZPLA 2BNQD 3TBYA 2UZYA 2M26A 1D9KA 5C7ZA 2FT8A 3T2LA 1K8IA 2P5WA 3Q1EA 4CVZA 4W93A 1RZIA 2DBLL 2ED9A 4GH7B 3MLYL 5GHWL 4AEEA 3ZVVA 3R0MA 4GIAA 1M7DB 4JFWA 6PAZA 4KTGA 3NSCA 4BK8A 2WXQA 4ZPVB 2NYYC 4GXVH 3EYOA 4Y2OA 1NGYB 4AYGA 3FT4A 1T04B 2CO7A 2EECA 4G6KH 3AU0A 1JL8A 3AVEA 4DPCX 3L7FB 4EJ1C 2WXFA 5IKCB 1FQ9C 4MASA 4OZHB 1ADQL 2Y6SC 4R3SA 3JWNH 2OXGB 2NQCA 4EBQL 1OAQH 1NCIA 3RWIA 1HS6A 5EZLA 4LCWD 5BRPA 4J3OC 1DQDH 5I5JA 1Z66A 3B6SA 5C3TA 4X4XB 1IE5A 2BCMA 3APCA 3FQTA 2CLRA 2R2BB 2AABL 3CN2A 2O5YL 3NGBB 1WCBB 5JHAA 2P5WD 3SDXB 2H1LM 2I7SA 5HJGA 3V4UL 1R3IH 2K45A 3CBJB 2BS9A 1KPUA 1OSEA 1FVCA 4JUTA 1YNLL 3LZRA 4PVMA 4LCIH 2R0KH 3VXSB 4K3GA 4OF3A 4ZX3A 2R0WH 5CCJA 4WGWB 2QQKH 3DO7B 1N5AA 4RGNB 4L4TE 4ZDHB 4KKCC 4OZ4A 1SBSH 3FB8B 4JEGB 5SWSE 2P80A 2AJXL 3K6IA 3GSUA 3DPBB 3IJYB 3JV6A 3K6NA 1I1YA 2BY3A 3SODB 4Z76A 3L3KA 2KZBA 3FH7A 3GNML 1JGLH 2GJJA 4RGMC 4BH7A 4B3VA 5GISH 3K4AA 4JZNB 2IQAA 4J1UB 1BGXL 2CIKA 1ZSHA 2XBTA 3AG2B 1SFDA 4FFZH 1ZVSA 3PP3K 4M93C 4GMSH 2Z31C 2ZOLA 5MEQA 2Z4TA 4HPOH 5JIMA 2NY0D 2WKOA 1YO4A 4IRJA 3IWVA 1AKPA 3HN3A 6CGTA 5I1JL 3QEQD 3RUGB 4OIIH 2P42B 2DEYX 1GTFA 5T33H 3D3VB 4ICXA 5C09A 3SDCD 3HMXL 3G6JB 2UZPA 3GIVA 3KVPA 2ENJA 2R2CA 4IHOA 5MERB 2J8UB 2P4AB 3A4AA 4DVRH 3FN9A 2GJPA 4Z18A 3BSZL 3P0VL 1AD0A 5FYKL 3EJYD 3T3ME 3B8YA 1Y0LB 4K3EH 4XVJH 5DMIH 2XVKA 5DS2A 2UV3A 5D6CB 4OGQC 3ARVA 2L7JA 3KG5A 3DUUA 5JIIA 5SWZE 1H8NA 1ETB1 8PAZA 1AE6H 4IEFA 5HDOA 2ILLA 3GGWA 1QSEA 4IRJD 4U1KB 1ZT1B 4YX2L 2C1PB 1KC5L 3C5XA 2JE8A 4H2AA 1MCQA 2K8QA 1IAIL 1RZQA 5TE7H 3VTAA 2IADB 3AJ7A 1LTXA 5CGTA 1YEKL 1DJYA 1CICC 1JNNH 2QHRL 4J2QA 4HF5L 4JM2F 4DN4H 5KYWA 5CLYA 2IAMC 4I18B 5AB9A 2EIDA 3UOAB 4QR7A 5IROC 3B2XA 3LIZA 4N8CH 4PRNB 1OGAD 3QQ4A 1IAII 2KPWA 5DGQA 3MNWA 1M05B 3KHQA 5H37G 1RZFL 2J57A 4ZMZA 1LK2A 1T22A 4OM1L 4MMXA 2OA9A 1OV8A 3OKNA 1I1AB 1YMHB 1QFWI 2F7IA 3LS4L 3OR7A 4A7TA 4ZUUB 3GM8A 3LVTA 2BIMA 5LGYA 2NY1C 3TXAA 4PS8A 2F61A 4DGIL 2E7MA 3TA4D 1BYPA 3KYOA 4L8SA 1NMCB 1TXKA 3EF7A 1TQSA 4MDRA 3U9UB 4ABVA 3VD5A 5T1JA 5IFHH 2DQFA 1CD0A 4JFUA 3L7EA 4YHIB 2CKBB 5C0ND 3SO3C 4QXGL 3VSUA 4NQTA 3L5XH 2YFOA 5CXPA 2O6PA 1IB5A 1CIDA 3AS1A 1NLBL 1WBYA 3QS2A 4PB0L 4S0HA 4MXQC 1E3XA 3ZE1F 5KBLA 4XPBL 5I1CL 3EYFB 3QA3B 2A0LD 3OJDA 4IIZA 2FCBA 4KAQH 4LOEA 3KPTA 2QKIB 3O9WA 1I8LC 2PYEA 4S1QH 4XPHH 1DLHA 1CGWA 5IMLB 4RFOL 2CJUL 2NW3B 5FDWA 4AJWA 1EXHA 4GQRA 2X1XR 3GPEA 4R7DA 2E7HA 1IEBA 5F7DB 4X9IA 2CZNA 4GW5A 4CSZA 5BXFA 4XX5A 3CDCA 3WHE0 3GO1L 2ZJSH 4L1LA 2FJHA 2HG5A 3BMVA 5EEUA 1OCWL 4AEIH 2H26A 5DLML 4AG4H 3V4PH 4EZJA 4L18A 1FA4A 4PMEA 2NNCA 3L95B 4P2RE 1EDHA 4UZGA 4L4VA 2ZOTA 4K3DH 3MXVH 4HALA 2Q86A 4YNYB 2DWEB 2AEPL 1HXMB 1OB1A 1UT2A 3VI4A 2WIIA 5E08L 1DJGA 4TV3A 3SBPA 4NNPL 4RETB 5IWLC 4JFFB 4X0KB 3NJGA 4M1GH 3LKPB 1E7UA 1NBVH 1XV8A 4DN3H 4OV6F 5I1GL 2N59A 2DMHA 2GCYA 2HAZA 3DVFA 3MYJA 4LPCA 3VWKB 3VXTB 3O3AB 4ZMXA 3BW9B 2ARJA 5EFIB 2GIMA 3TCXA 2C9XA 2V33A 1YEEL 5T3ZL 43C9A 4FQHB 1SLWA 2X09A 4WFHE 5KJRL 4TVPD 2BOBB 5B1CA 3N04A 5EUOE 1VAHA 5CIPA 2K6WA 3PAUA 3MOBL 5FUCC 4NT6A 5GGTL 3MCYA 1NGZA 5DWUH 5I5MA 1MY7A 5I8KH 2IG2L 3G6AB 4HIJA 4NQCA 1CFQB 1DFBH 3CVHA 3PHQA 5T5FA 2B0SH 3BVUA 3C5ZC 2UX7A 2D2OA 2XPGB 3FOMB 1D5XA 4XVOA 5E7FA 5HJ3A 1EO5A 2ZCKH 3UABA 1KTLA 4GSDL 1Q72L 1DL7H 1U30A 3V6FB 5BOZG 1E9QA 5I8CB 4YSSA 1F97A 3KEHA 1KDIA 2EC8A 4WWID 3TIDB 4LCWB 2Z4QA 3IMUA 1FDLL 1MHPH 4PWJA 3DGGA 2W91A 3U0TB 5B1JC 3AXIA 1MFMA 3TBYB 2GSMB 2UZYB 1D9KB 4CBPA 1K8IB 4PRHE 3ZQXA 4WI0A 2P5WB 4CVZB 5EEZA 3POCA 4CMHC 5FYKE 4NQDD 1RZIB 1UACL 4TQIA 1WZ1H 4R90L 4DQOL 3D51A 5T1KD 3CGTA 4L5FL 2D0FA 4Y9CA 4MA8L 2VDKB 3NCJL 3EYOB 4Y2OB 3FT4B 4MNHB 4ENED 4YFEA 2CO7B 2OL3A 2HZHA 2MCPH 2WTRA 3R18A 1OGTA 5CUSL 5KYUA 1R75A 5I66A 3S35X 2TAAA 2KKQA 1QA9A 1YQVL 1A1OA 4G7YH 1R46A 4OT1L 1THAA 2C9AA 4XP1L 1IX2A 3BUDA 4KK6D 4R3SB 4YFDB 5J5EA 3RWIB 3ES6A 5EZLB 4YWGL 4A68A 4A2HA 2VR7A 2NCMA 3B6SB 3OG6B 4DGUA 3DX0A 3FQTB 4A2MA 2CLRB 3IM1A 2QKSA 4AGPA 3SIKA 1P69B 4EQ3A 3GRWH 1N67A 5ADPL 4ZXBA 4PP1D 1BQ5A 3RKDC 2NY0B 1H3TA 5CD5C 4A2DA 1KPUB 4HLZH 4LQFH 5D70H 5D7SL 3UGXA 4EZKA 2ZYRA 3TZVD 1CXLA 1FVCB 2PP7A 4W9LC 4QJ5B 5M7QA 2DQGH 5B3JE 3QUYD 3RB5A 4GAJL 2YHGA 1A3LL 5DGRA 4LRNL 3CQQA 5DJ2A 5EF2A 1N5AB 2NDGA 4ORZC 1JMXA 3IPEA 3LZFH 4LLVA 3LPWA 4OFVA 3RY4A 1A3QA 2XA3A 2J56A 4HOZA 5LDUA 3K91A 3GSUB 5AVVB 3CNKA 1KEGH 4P2YA 4E9YA 3JV6B 5EOQL 1I1YB 5F7MC 5G4OA 1FJ1A 1ZD6A 3L3KB 4Z76B 3LEVL 3VMNA 3S3BB 4M4RA 4EOWL 4BH7B 5D2LF 5L2KD 1HN1A 2H1XA 2IQAB 2ZXAA 3D4CA 4OB5H 2XFGB 2YUVA 4TQEL 2CIKB 4ZMVA 3K8MA 3M86A 1ZVSB 3CAFA 3OJ2C 4A7VA 4JKPL 4L3AA 2X70A 3KLHD 4ZXBD 2ZOLB 4PJAF 3NIDF 3STZA 5MEQB 1GW0A 5KSUA 4POUB 3VFWA 4FI8A 4IRJB 3ZMNA 3D06A 1J9RA 1LWRA 2G5UA 5BRZA 2PNDA 1MELA 3WXWL 1A1NA 2VR3A 3CLEH 1AP2A 1I8IA 1KCSL 4XAKE 2HPTA 4PP2A 3T4AC 1RZ7L 3H7BA 4JZJC 5C09B 2COVD 3CDZB 2D2CC 2R29L 2XY2A 3SKUD 3EO0A 3GIVB 3N44B 1CGSH 1VFBA 1DDHA 1AXTL 4IHOB 4XMTA 1JDAA 1AD0B 1LO2H 1PCSA 2RD0A 2WP3T 3NT0A 1GMEA 3MUY1 2CK0L 1RIVL 4MA1C 4ZW6A 2FJSA 4DKTA 2W92A 4YHOL 3DUUB 3GSWA 1AXIB 4XC1H 5L4JA 3ROLA 2PXYC 4QAMB 4YDKH 2AV7A 1UWEL 4IEFB 1XTMA 3GGWB 2BNRA 3O6MH 3ILQD 1QSEB 5PAZA 1IFHH 2B1AH 2F1AA 2YAOA 1QX1A 5E70A 4I9WD 1NIDA 1IC7H 3BPNC 2B3IA 2V2WA 3SGJA 2AZUA 4WFED 1J12A 5DK3A 5KUKA 1H8SA 3MVSA 2ZPKL 3RWCA 4AV4A 5LHDA 5KYWB 2AQSA 2AK1L 5IFJA 4V1DA 4P5MA 4O02L 4JM2D 1TETH 4MYWB 4BK5A 4JDVA 2CSPA 5AAWC 2OX5A 3ASWA 3QQ4B 3AQYA 3MNWB 3CC1A 3QQ9D 2ZUYA 1G7JA 1G9NL 1LK2B 1T22B 3W57A 1MN4A 1FZKA 3RILA 4MMXB 3LRMA 4WWKC 1DSWA 3ARDC 3OKNB 2MKLC 4WENB 3UTTD 3MLTB 3OR7B 1N6VA 3H56A 5AW1B 3K5RA 2UWEE 4LLDA 2PPFA 3KYOB 4L8SB 3N06B 1QZ1A 2BHZA 2CGZA 1RLWA 2RMNA 1OARH 4FULA 1YYML 2DQFB 4W6WB 3L7EB 3DJTA 4HCFA 4KH9A 1WVZA 5HDLA 5DDHA 4AC4A 3FFCA 2DYSB 5CSBA 4AIZA 4BD4A 3RZCC 4LLMA 4KY1H 4OGYH 1WBYB 2ED8A 5GJTL 2XDHA 4V1DD 2EC9U 3F58H 4PTUA 3OJDB 1E6OL 4FJZA 3O9WB 2PYEB 4XNYH 2K4WA 1DLHB 3BLKA 1OSPL 4ZW7A 1SQ2N 3QRBA 4N2AA 4O4YH 5FDWB 3QXWA 3PY9A 3SE8L 2N3JA 4R7DB 1IEBB 1G6RA 5I6OA 4GW5B 5BXFB 1UH4A 3T8VA 2FJHB 2HG5B 1DJWA 3FQXA 2VH5L 2H26B 4P5TA 3LN4A 4HCRA 4WTZG 1W9XA 4A04A 4PJBF 4L4VB 3KWXA 2YEVB 2VSDA 1MSPA 3VXRD 2EVJA 1JPST 5BW7A 4GXUM 4OFIA 2IANA 1IAIM 4KQ4L 5EORL 5GGQH 2Q86B 5CZXC 5A6IA 4YLQT 4MLIA 1OB1B 3VI4B 4Y5XA 2WIIB 4E9TA 5JQIB 1CWVA 3L08A 1NFDA 4WVRA 2EXWD 3WNNA 1BXXA 2VDPL 4JM4L 5IESH 3MU3A 4BZ2H 1QFWM 2YOCA 3QGVA 4PTTA 1BQUA 1MRCL 2G3MA 5B39A 1BQHA 2GCYB 2HUHA 4N2LA 3MYJB 4EVNA 3Q44A 4F15C 2ARJB 3FUFA 3N1QC 5HHPA 3ATEA 2X4PA 3D85A 4FOMA 1DFXA 4YVUA 1Q9OA 2YA1A 5DRWA 43C9B 1EWHA 3K2UL 1NPNA 5CILL 1IBHA 3HAEH 4PR5A 3Q2NA 5BV7L 5IP4A 1U8CA 2X2YA 5CIPB 4NT6B 1AI1H 5JQ6H 3D2UD 1NGZB 3U82B 4WTXA 3US0A 2DI7A 1IUZA 1P4UA 5CJ5A 3QPQD 4HIJB 1KBVA 4NQCB 4YEFA 4XMKH 3CVHB 3PHQB 3BQUA 1N6UA 5HJ3B 1D5XB 3BGFB 1KTLB 2ALAA 1E9QB 4KNUA 1I75A 2IMMA 3IKKA 3MLUL 4Y1SA 2IC2A 3HA0A 1JZ6A 4J39A 4MQSB 2HFGL 4HWBL 1T21A 4ZD3H 3VD4A 2Z4QB 1MAMH 5EU6A 5FDYA 1A7OH 2EUVA 3DGGB 3D9AL 3D85D 1U8HA 2XZCL 1MFCL 2A9CA 4FQCH 4LASH 4QPEA 4QRTA 2HKFH 4NP4H 3BUPA 2NY5L 1QLEL 4WI0B 2SEBA 3CFJA 3EOAA 4KO6A 3U1SL 1TCRA 4KTYA 3SPVA 4L2YA 1TMQA 1YPZE 3TNNA 4FS0A 3S8FB 5KTEH 2ZYIA 4U2YA 2WV3A 4V2BA 1BMWA 1CYGA 3QUYB 3T0EA 2EO9A 5AZ2L 1BWWA 2OL3B 3MMEA 2DOCA 4HT1L 3JT2A 2WTRB 2UXFA 1OGTB 4CSTA 5I66B 5KYUB 4TLKA 1QA9B 4Y2DA 1A1OB 1NAML 5H4ZA 5E51A 4CILA 4ANXA 4ZO8A 5EU4A 1B4JH 4DF9A 2H7WA 3ES6B 3VVWA 1FL6A 3CPLB 4FG6C 2HFFA 5TGBA 2FRGP 4KNTA 5D2LA 3HI6H 3MV7E 3SE4A 3TFKC 5C0CA 4ZXBB 3QORA 1RHHA 1AHWC 1ZLDA 4EZMA 3N0PB 5LAPA 1FNHA 3P3UA 2JELH 4PJAA 2FQFA 1A6WL 2WZ6A 4X8GA 4XP9L 1N7ML 4AQ8C 1FLRH 3T0ED 2XHNA 3S8WA 3WG7B 2CUAA 5EBMA 5DJ2B 3MOAL 32C2A 4YDJA 4HVBA 4LLVB 3TOPA 3VA2C 4K23L 4Y2DD 2B9BA 3KPOA 3QW9A 2O6CA 1NCBL 1PSKL 2L7QA 1Y18A 3GHEH 1FJ1B 2CMRH 1I9IL 2KT6A 2TRHA 4M4RB 3FU8A 3QUZD 3H7LA 2GTZA 3DC0A 4MJJA 4NNYA 5INCA 4DK6A 1GPOH 2PETA 4F2EA 4JQXC 1JF5A 2A6DA 3OMIB 4HAFA 2CUIA 4YHML 2X70B 4YQXL 3FSAA 1INDL 4HSAC 3STZB 3WTVA 2QADD 3V10A 4KDWA 5KSUB 2OMZA 3VFWB 4EXPX 4Y16D 4JY5L 4M5ZH 3ZKSD 5BRZB 5CN3A 1A1NB 3KH3A 4U3HA 3VQ1C 1AP2B 1I8IB 2WXPA 4FKHA 1U9KA 4PP2B 3H7BB 3PHOA 3ZTJG 1A64A 3EO0B 1Y1UA 1S9YA 1VGKA 2H3XC 4HQQL 4XMPH 1VFBB 1DDHB 3NAAH 3VMOA 5KVFE 4Z3HA 1Z5YD 3SBQA 4IGBC 2Y6TE 2EH8L 3SBWA 4TM9A 2X4NA 2XT1B 3MAWA 2WCGA 1ZLWH 5L6YH 2QFRA 3GSWB 4KJQD 1E90A 3ROLB 1BFTA 3V4LA 4FLHA 1RHFA 5A2LH 1XO8A 2AV7B 3BAEL 4LDEB 4C56E 4DUWA 4APQC 2BNRB 1NL0L 2GEEA 5FHBL 3LKRA 3KPMA 1C7TA 1DVTA 1XDTT 1PGRB 1DVFA 3MREA 2NY6C 2V2WB 5F8QC 2VERA 2WZPA 1I82A 1UHVA 4XPFL 3O4LA 1ZTXL 3QG7L 3DV6A 4YSRA 5E2UH 1BJ8A 3PFQA 1BD2E 2VKWA 2Y72A 3MLXL 4W1TA 3DSFH 4FCAA 3RWCB 2OW7A 3GBML 4P2AA 5IFJB 4V1DB 1R3LA 4P5MB 1YN6A 1OTTD 3L9RA 4JDVB 4NM8L 5JOPE 2OX5B 4MHHI 3BVTA 1DCEA 1ML0A 4DOHB 1HWGB 3ZYIA 2ZYSA 1G7JB 5I1AA 2WZ0A 1T2QL 1FZKB 3G5VA 2VMFA 4N6RA 3QPXH 1G7LA 4H44C 3UDWA 3H54A 4HHAA 1NUDA 1N70A 1E6JH 2WY3B 3H42H 2CHNA 2Y36L 5EU7E 3TEYA 4P9HL 3Q43A 3NSYA 1ITBB 3T3MF 2WZPD 4JFDA 1PZSA 1UOKA 2MCG1 4Y7MA 1KV7A 4XCYA 2O5XL 4OLWL 5DDHB 1FHGA 3FFCB 4AIZB 1KJ2H 2C4XA 4GAAA 4LLMB 2LE9A 2I25N 1J87A 3D69A 4YXKL 1KN2H 4BFNA 1QLRA 2CQVA 5EUKA 3UO1L 1KGWA 2VDMB 2MKWA 3VFTA 2VITA 2DLHA 3MGAA 2F53E 2WWNA 5E7BA 2NUTA 3AXLA 1DEEA 4NUPA 1GJUA 1TJGL 3ISRA 5KYXA 4GG6F 4XN2A 4PWHA 4X6BA 5TPWH 1G6RB 1GCFA 3BRGC 4WHDA 3S34H 3LN5A 2VDNB 3GQFA 4GAGH 4JM0A 2ZKMX 3OPZH 1MFBH 2VQ1A 2VNCA 3CMGA 2WXMA 3FQXB 4N0CC 2B5IC 3TH2T 4P5TB 4E9QA 3SGEH 3LN4B 4JFDD 2LFGA 1AO7D 4H0IA 3FYEB 1JPTL 2DQUL 4LAJH 5A3ID 3TNMA 3QJUB 2L3BA 4L9DA 3VXMD 1UGKA 3A47A 2IANB 4JO3H 3V6BR 4NWUH 3U7YH 4MCZA 4Y5XB 5AVQB 1NFDB 4AYMC 1L7TL 5E4EB 1L5GB 3UMNA 5FYJU 3F6JA 2IWGA 4HUUA 4PTTB 5B39B 1BQHB 3M1OA 2A6IA 2FE0A 4KNSA 3SJVE 4I3GA 3U9PH 4EVNB 1R0AL 4W9EC 2EXYD 4NI3A 3OD3A 2HT4C 5HHPB 4F91B 3CSFA 2X4PB 3D85B 3PS6A 4GW4A 1Q9OB 5IY5B 1IGIH 1S7TA 4F27A 1N4XL 3CZNA 2X1WL 4QAWA 12E8H 3OZ9L 4PR5B 3CHSA 2DWXA 4XH2A 2CR6A 1KGYE 5H37H 3CX5K 1U8CB 2VDQH 4HIHA 1AANA 4NP9A 3Q8EA 2YZ1A 5FUZH 3FH8A 4RAVA 4EIUA 1U4EA 4U6VL 4MVBD 3WY1A 5TFSH 3SDAC 5IG7A 2DIAA 4L05A 4N5UA 3BQUB 5ES4B 2R0ZH 3FT3A 4Y4KA 2ZAHA 3NRFA 4FYSA 2D9QB 4XCEA 5LBSH 3GWJA 1MFEH 4AXWA 4GFTB 3ETBJ 4QOKE 3FTGA 3A23A 5CGBA 1MFUA 2YLHA 3NCEB 2EVGA 3T77A 2DB8A 3J8F7 1T21B 3TO4D 4LSSH 5EU6B 1FP5A 2GI0A 1QW8A 1U8HB 4LCCA 1C9SA 3SGKA 2K6YA 4QRTB 5LGHH 4Q56A 4PRIA 2GEQA 3H9SA 2SEBB 3OR6A 3W2DL 3CFJB 4F58L 1JHKL 2Y3AA 1TCRB 2JKTM 1S2EA 3SPVB 4ERSH 2YGQA 4ACPA 1NGQH 1JF6A 3TNNB 4G6FB 4UINH 2YXVA 3GXDA 3A0OA 3W5NA 2DBJA 3T0EB 4XP4H 2YSTA 4QHKI 3L9BA 3MMEB 2MNWA 2QL1A 1TJHL 3HZVA 3P9MA 1MDTA 3QRFM 1IC4H 1NGPH 2D3LA 5LG6A 2B20A 2K0RA 2WVSA 4IOSA 5CINH 4Y2DB 3TN0D 5E2WL 1IL1A 2LTQB 4GB9A 3VVVA 1I8UA 5EUOF 4JG0L 5EU4B 2Q8BL 3OPUA 2QVFB 4WI5A 5EZPA 4JLRA 4BFFA 3FTZA 1FL6B 1A4KA 1ZTXE 3DGCR 4GY4A 3S35L 2WQ8A 5E1IA 5JZ7C 2HFFB 5HVFB 5TGBB 1CDHA 5D2LB 3T2OA 1M1XA 1PZAA 4YO0A 5DJAA 3VI3E 4UTAA 3FFDA 5C0CB 5D1XE 3QORB 1GJWA 2DQEH 3FS9A 3TJEL 4YR6A 1B88A 4U4BA 4PJAB 3NIDB 3VX1A 2UUDH 3ARWA 4X5WA 3WDIA 5ANHA 3MLPA 1U3JA 1RSFA 2XIBA 2Q20A 4IKNA 4MD0A 4Q6IC 5E9NA 3HBPA 4KTEH 1PU0A 1IBYA 2RALA 4DQAA 5EBMB 3FO1A 32C2B 4L9LA 4YDJB 3N1MC 5T3XL 1QFUH 4FNLH 3OKDA 4IK7A 1CFNA 3AT0A 3H55A 3KPOB 3U4EB 1JJUA 2JH2A 1W16A 2N0KA 4NN7B 3V0HA 3KW7A 5C0AE 1AQ8A 1Y18B 2DEXX 3TYGL 1AACA 1D7BA 3KYKL 3VSVA 1NKRA 3ZKNC 1OD9A 2GTZB 2IGFH 3IN2A 4NNYB 5INCB 4AEHL 3A67H 2FO1A 1NQBA 2A74A 1UFUA 5ERWA 2E46A 1L0XA 2OMZB 3A4DA 3V4VL 3V95A 3IGLA 4L4TA 4GYBA 6PCYA 1Y6MR 5SWSA 2ZSWA 5E9DE 2YD4A 2VXUH 2ADIA 3D30A 4UAOC 2O5ZH 5AVTB 1B4RA 5LQBL 4AVHA 2EO1A 3PHOB 3OG4B 4R4ND 4X7TA 1FSKC 1S9YB 4AENA 3DUHA 1QG3A 4W9HC 2NY4C 2VJ0A 1T0PB 3NESA 3V0DA 2FB4L 1LD9A 3ZOAA 5DMKA 1F56A 3KVDD 1KNOA 4R7XA 4WY7H 2DWYA 2IGLA 2X4NB 4QHUB 5B3JF 3ALWA 4RWYL 5IB1A 2VABA 1KSRA 3I6LE 4POYA 1GC1H 5HTSA 6TAAA 2BW4A 2JQZA 4JR9H 4OCYH 4HCGA 4L4TD 1UD4A 1C5DA 4ZW5A 4ZODA 3RFZC 2X0VA 4HUXA 3LKRB 3KPMB 4JE0A 4D7BA 3MUGA 1DVFB 3MREB 2DIEA 5DUPL 4D3CL 2D0HA 2LQRA 2YS4A 1TUPA 4UAHA 3O4LB 3QRLA 4NUQA 3ZSSA 2RFXA 3DV6B 1CL7H 2O93L 4JNXA 2E9WA 4G9DA 1M57B 4WU7A 4NLHA 2Z34A 3KCPA 3OAYK 3HC4L 5SWZA 1YN6B 4B27A 2FECL 5D7JA 3L9RB 1PG7X 4OLEA 4W9ZA 3AU1A 4YSEA 5J7CC 3KYAA 3GLDA 3ARBD 3GINA 3A22A 1FORL 2MOGA 4QO1B 2NDFA 3LTVA 4M7JH 1DBAL 2KZ1B 5I1AB 3G5VB 3S36H 1P7HL 4N6RB 1PZ5A 4G7VH 4Y4FD 1G7LB 3WSQL 1CI5A 3GM0A 2DF3A 1C5BL 4HHAB 3ATAA 1XL4A 5I74B 5JW4M 2WOBA 4D0DA 3KPSA 4P2CG 5ETUA 5LCVA 4OCWH 2JKJA 5ABDE 1HEZA 3QFDB 4RWHA 2A9NH 4TRPH 4JFDB 3EHBC 4UTBL 4RGNC 4XCYB 1G7HA 1WIPA 4FXTA 4AZUA 2GC7C 2HLFC 3D69B 4L37A 3W81A 4D7PA 1QLRB 3FSVA 3W11C 4WU5A 5EUKB 5B39G 4Y88A 4F2FA 2AC0A 1BEYL 3VFTB 2VITB 1GC1C 2Y69B 3DDFA 2FATH 1CLYH 3HCVA 4WCYH 2NUTB 1FPTH 3AXLB 1DEEB 1U33A 5KYXB 5KEZA 5I76A 4X6BB 3JWOL 3MLWL 5IBTH 3ZHKA 3LN5B 4KI5D 1S7WA 1KPRA 5JPMA 2JXMA 1WEJL 3RLSA 2VQ1B 4NSKA 4Q9QH 2MMXA 2C3XA 1KBGL 3C08H 3QVAA 2YBRA 3VG9C 2QTVA 2EDYA 5IQMA 2WN3A 3ARPA 3W37A 1BM3H 3TNMB 3V6ZA 1FIGH 1JGDA 2CKBH 1EX0A 3DJSA 4OFKA 4JN1H 2Y1AA 5GRVL 4XODA 4N6QA 3NCCB 4MCZB 1J10A 3A6CH 4APXA 3QEGH 2UWEF 2YQGA 4JRFA 4PI2A 2DQCL 3ARFD 4TQ8A 3SD5A 4TN9A 1U4FA 5LNDA 2H4EA 2ZX7A 4HUUB 4LF3A 4K7PY 3EJZD 4LEBA 1E67A 4YE4L 1ADQA 3O8XD 2A6IB 2VGLM 4PJFE 1JYNA 4XMLL 2JKNA 4MJID 1MJUH 4BWWA 4EN3D 1ED3A 2P5EE 2WYHA 3B37A 3BAYA 4P2RA 1S7TB 4G70B 3DXAE 3OX8A 4ILDA 2AKRA 2X6BA 5FOBA 4XH2B 5I1IH 3HG0A 3FN0H 5E1HB 4G6JH 3WMSA 4KRPC 4GQPH 1RU9H 1TTUA 2EZ0D 2B1OA 2HX7A 1TZOA 3QJOA 4HIHB 3FCTA 5DHEA 7FABL 1GCYA 3IDYB 3FOLA 1KDJA 4RAVB 5DQDL 1JWUA 2C9VA 2CJTA 5DJDA 2AQQA 4UQAA 2DQIH 5IG7B 4NEHB 4Z8FH 3VFMA 3FT3B 5D93B 3HC3H 1TJMA 1ZE3H 4F9PC 3DRQA 2O72A 2QPUA 4FXGC 2ZUWA 1DBJH 1UC6A 3MRJA 1EHNA 3RPKA 4AXWB 5KUMA 1RMFL 5EF1A 1B6DA 2BZ7A 3FTGB 3K6DA 4K8RH 4PB9L 5IQOA 2FUQA 1KLFB 3JZ7A 4W9GC 1J1OH 4IOFD 3ETBF 3T77B 3UIZA 3IDXL 4M7KH 1ZIAA 1JHTA 5EUOA 1IQWL 4FJ6A 4LCCB 3V9EA 1RP9A 4P2RD 5A2BA 5LO7A 3DO4A 2YPKA 4PRIB 4FFTA 4B96A 3OR6B 4ZX4A 3VRIA 1EJOL 3F3HA 1UB5A 5E2TL 3F00A 4IMLA 3QQDA 4RX4A 3DRTA 3QDMD 2JIXD 1KTRL 4H8PA 4DAGL 3GBNL 3N1PC 1PNDA 4QLRA 4HWEH 5DU7A 2B1HL 3R06A 3EH4B 3UAAA 3HZVB 4ZPTA 3P9MB 1WT5A 4P9ML 5K9QI 1Z9OA 4DEPB 3BDYH 3HMXA 5BVPL 4AQAA 1U36A 3HE7C 3RDTD 1IL1B 2QGCA 4Z7IA 1BQSA 4WFHD 7TAAA 4PRHA 5I73B 2BWQA 1NTDA 4JLRB 3KHOA 3FUNA 1A4KB 5C86A 3MV9D 4K9EH 2QV2A 4UOJA 3WNKA 3C09C 1XBRA 3ZE0B 1NCWL 3ERXA 3O4OC 1M1XB 5DJAB 4PRDA 4YO0B 1GJIA 3FFDB 4H0LC 1YNKL 4KZ0A 3IFNH 1MREH 5I75B 1XGPA 3HS0A 4RX4D 4LCUA 4YR6B 2I69A 3H2PA 3NMEA 1UYWL 4X5WB 3U36A 1JV2A 1NGWA 2ZX5A 3OVUB 4MD0B 1QD0A 3OWEA 5KS9E 3FO1B 4YFLI 1HYSD 1XX9C 4L9LB 1MNUH 1RXLA 2VDKH 2CO1A 3OKDB 4HJTA 5ANMA 3IXTA 1AIFA 1CFNB 5FUCE 5CLXA 3VD9A 1RUKL 4Q7DA 3AUVA 1KF9B 1WFTA 1YPZF 2CCWA 1JS4A 5D5ME 4G8GD 4ODHL 3LMJL 3BDXA 4KJWD 1U3YA 4R2GC 3FQ4A 1KXQE 4P3CL 4N8VG 1TU2A 2HKHL 4OUUA 2A74B 4KHTL 1T66D 1YEGL 2QEJA 4LAQL 5ERWB 3QCTL 4XWOD 1YEIL 2AI0L 3CQPA 4L4TB 1C8PA 1KY6A 1EPFA 2VIRA 3VCLA 3LEXB 4HJUA 1V3KA 1Z9SA 1QLFA 1CE1H 2FBJH 2A4CA 2ZSWB 3I85A 4YXLH 5SWSB 2PW1A 3V0WL 1A4JA 1AG6A 2ADIB 3A6BL 3U25A 1GAFL 2HRPH 4OIAA 4DJMA 2P7TA 5E6IA 1DZBA 4X7TB 4AENB 1NFAA 3BI9X 4K9EC 3SYPA 4QRSA 4O5LL 3KPRA 5EG6C 3I9AA 5DMKB 4J4PC 3D0AA 4U7MA 1XIWD 4LB8A 5F7YC 2IDUA 1KNOB 1OT4A 2G3XA 2W95A 2ZE0A 3FU3A 3PF2A 4Q8BA 4CC4C 3HBGA 5IB1B 2VABB 5F7EH 3KPNA 3H3KA 1YY9C 4Y4FB 3VXUE 5KVGH 1P84K 2BY2A 1LYQA 5EBWA 4OQTA 4DP2X 2DL9A 2WBJD 4UT9L 1C5DB 3EGDA 3ZDYE 1AQMA 1EHXA 4PS4L 5E4IA 1OK0A 2V3FA 1QASA 1Z3GH 2WXHA 3QJXA 4HUXB 3MUGB 3QI9A 3LB6C 4PS3A 1MLCA 4ZUSA 3IAGC 3EFFA 3WEBA 4YOKA 5IB5B 3UG4A 1UD3A 2PYFB 2RFXB 3T3MB 3BPCA 3NSJA 1KENH 4G9DB 1WGVA 4N2GA 1JYWA 5L0QB 4WU7B 3KCPB 2R9HD 5KW9L 3WN5C 2P24A 3AREA 5SWZB 2AP2A 1JPSH 3CHRA 1I9RH 5D7JB 4E41A 1DUZA 2APSA 3AU1B 1Y7VA 2VUYA 3HNVH 2M2DA 4DP0X 5BO1H 5I17A 3SQOH 4DUXA 1U3HA 5MENE 1BQKA 2ORBH 3PAZA 3AROA 4L29A 1BVZA 5DD5L 3HI5L 2R56H 1DVYA 1PZ5B 3BO8A 4FZ8H 4LSUL 5D1QA 3GF8A 4XAKD 5E4AA 2EAEA 4FI7A 2CO4A 2O4EA 4NGHL 1VFAA 3MDJA 3FU9A 1MCHA 5DVPA 4D0DB 2WTPA 4MYPA 5E6YA 5ETUB 1YQ2A 1HEZB 1KELL 1JRHH 4M6AA 1V3LA 3N9GL 4N8UA 1G7HB 3UJTH 5GGTA 5I1KH 4PD4K 4MA7L 5DC9B 5TK4A 5F8RC 3BVXA 3Q7JA 4Y2NA 2V7NA 3GXPA 4B9JA 4L37B 1RPKA 4X5XA 2PPEA 3BH9B 1TLKA 4WU5B 2IPTH 3CX2A 2P8PA 4GSQA 2DQTL 3ARFB 3UTOA 3M1BA 4KVPA 2EP6A 3F12A 3HCVB 2UWEA 4P46C 1CCZA 3ZTJH 2B16A 4X98A 3W9EB 2RR3A 2ITEA 3O8XB 4GJTB 1GH7A 1NMAL 3CZSA 3LIZH 3PV7A 5I76B 1KGUA 5ALCH 5I1HH 5J9PA 3HMWH 1S7WB 1FAKT 1KPRB 2F8IA 3D52A 3IPBA 3WD5H 2JXMB 3O6KH 3WXVH 4ZFGH 5JPMB 3FPXA 2EDKA 4TTDC 4NSKB 4C59B 1ACXA 3KJ4C 1YJDH 4FN0A 2YBRB 4OM0L 4JL2A 3MCLH 2AV1A 1MPAL 2HT2C 2E9GA 5HHXH 2Z0BA 1U6AL 3V6ZB 1CQKA 2AVFA 2E27L 3ZUNC 5CAYB 1JGDB 4ZZFA 4WFGD 4WO4D 1G1CA 4I3SH 3T6ZA 4BE6A 2PR4H 4PGCA 4I3RH 3ZT7A 1EBAA 3K1KC 4LSRH 4RBPH 4X2UA 1V7MH 4W4NA 4APXB 5C0BE 2JF1A 1RJLA 4OCSH 4N68A 4YHKH 3WIIL 3WAJA 3WE6A 4LF3B 2H2SC 4M7LT 5HVGB 1E8YA 4GRLA 1BBDH 4QHKJ 4MB5A 4TSAL 3WJJA 5BJTB 1IGCL 4HIXH 1XVSA 4JPQA 1ED3B 3ABMB 5CGYD 2IH8A 3P0YH 3IE4A 3P69A 4P2RB 4YL4A 4FTVE 4OY9A 3B7YA 5JIPA 4Z0BL 3OX8B 4X99A 2NLJA 2AKRB 2HT3D 3HHRB 2WWMD 4N9GA 4OTXL 5FOBB 1MJ8H 3QWRD 4KO9A 3TPKA 2HJFA 2OSXA 3FCTB 1WQVT 4GUQA 4RFEA 4G6AD 2K8MA 3UZVA 2FX7L 3MTRA 3FOLB 1PKQE 4F9LC 1JWUB 1VACA 5T5NF 2JKWA 1T0NA 5DJDB 3V5HA 4HLEA 1EIBA 4PJXE 4JFEA 2W60A 3ALXA 4XE5B 3VFMB 2WQWA 5D4QA 2QTEA 1QUNB 3DRQB 3MRJB 2ICEA 1DANU 5A2AA 3WS6C 2D7PA 3VFUA 4B41A 3D0LB 1NH6A 3GMPA 3H9HA 3C8HA 2ZWNA 1LO4L 1YJDC 1A7NL 5FYKU 3VD0A 1JHTB 4KK9D 5EUOB 4XOAA 3X12A 1H3PL 4B60A 2H3NA 4X6DF 2IDFA 2YPKB 3TT1L 5I8EA 1I3RB 4ZTOL 1XB3A 5EZIH 4PJIE 3GMQA 3CD4A 1RK7A 2W0LA 1HZHL 1UB5B 4KXZI 3VRIB 1KXTA 3WKMH 5HD8D 4IMLB 3QQDB 1XH3A 1C16A 2YMOA 3DRTB 3GK8H 4O9HH 1RUQH 1INEL 5HYJE 4IRZL 5CCHE 1N10A 1Y6NR 5CIPH 2ENQA 3R06B 4F7PA 1NFKA 4EDWL 3FSWA 4ZPTB 1VZHA 5B8CC 3O9WC 5GGRY 1F4YH 3MV8E 1F8TL 4AQAB 2TSBA 1D5ZA 4XWGH 3CVHH 5T5FH 4LLQA 3X3GH 4E9WA 4S11A 3LPPA 4PRHB 1OHQA 4XXCC 4DCQA 4KK8C 3MLVH 3D0VA 3GEWB 2Z7YA 5JHDD 3Q13A 1MIMH 1P4BH 2IVFC 5E24E 2WC7A 1X5KA 3IVKA 1YPZA 4M03A 3GHBH 1T7YA 2WSPA 3FO9A 4GSUA 4PRDB 3ULSA 3JYBA 1MAKA 1EZVY 1V8HA 2K78A 4ALAL 1OKEA 4OLUL 2JCCE 1XGPB 3HS0B 4LCUB 4JPSA 4ZFZA 5ICUA 2WXIA 3U36B 1ZGLM 1JV2B 4M62H 3V55A 4N2KA 5AW6B 3UTPD 4MJ2A 2MCAA 4WO0A 2WQXA 2AITA 4NJAL 5LB1A 2K70A 1W0WB 3KL3A 1KGCE 5ANMB 3IXTB 1AIFB 5L4MA 3SYAA 2OL3H 4PRPE 3MV7A 3IGFA 1Q0EA 2AZAA 4O02A 2PPDA 1U8NA 3Q2CA 3VFGL 2HA1A 5BZDA 1EHKB 3C5SA 5DFVC 2Q3AA 4YXHL 1XQ4A 3NJJA 1TU2B 2A3TA 3WMPA 4JVUA 4OUUB 4PLJD 4L3ED 1KN4L 5AVWB 5HSFA 4NO3A 1YAIA 2VIRB 3VCLB 5GQBA 4A7QA 4HP5A 1Z9SB 1QLFB 4XAWL 2XJKA 2PW1B 3K81A 3E3QE 4HGKC 3RX7A 1A4JB 3VW3H 1DLFH 2WLKA 2P7TB 2R1XA 4CADA 2AJVH 4PG9A 5IBUB 1S8DA 3VI3F 4QRSB 4UMSA 4ACTA 3KPRB 1ZV5A 3NABL 1QYGH 5DS8B 4POZD 5EWIL 1BAGA 4EO5A 3GJFK 1V7NL 1A9EA 2HTKD 1OE2A 4J27A 2VC2B 4DIXA 3KPNB 3NP3A 4N0YL 3HG1E 2DKUA 4K9JA 4NQEA 5C0IA 5EBWB 3HN5A 1MCNA 4PS7A 1HK6A 1N12A 4MFHA 4PJ8D 3EGDB 2H0EA 4KOBA 2Y06H 3I9GH 4NKMA 4MAYA 1GKOA 3RY6C 3QI9B 1MLCB 4ZUSB 3EFFB 2GUYA 3EBHA 1NCDL 1KLUA 4ANKA 3BPCB 2NR6C 1A0QL 1K4CA 4RMRA 5E23A 2EH7L 2IDSA 1ZKAA 5DD0H 4F3FA 5EU5A 3J7HA 4FF9A 1E5BA 5KSAA 1UASA 2P24B 3AREB 1TQVA 2O30A 1KJ3L 4HC1L 4E41B 1DUZB 1MHCA 3SPGA 5BUAA 4C56A 4KFMA 5I17B 1YYLL 4HV8A 1U3HB 4L29B 2NY3B 4P06A 5FYLD 2QGBA 3BO8B 4LLYA 5BS0E 1PG7L 5D1QB 2XX0A 5F93C 4EQ2A 1J5IA 3ZXAC 2FZ3A 1VFAB 1BD2A 1DBBH 2W0FA 3ILDA 3AUWB 3LQZA 1RLBA 1BAWA 2WXRA 2Y1VA 3MJ9L 4J8RA 2GBAA 1XF5A 3PWPA 4LHUA 2NY7H 3ARZA 2WBWB 1U3ZA 5A7BA 2V7NB 5CZRA 4X5XB 2YRBA 3CC5A 1U8IA 2P8PB 4YHLL 1QBLH 3M1BB 4J3OF 3S4SA 3F12B 1CDCA 2YIHA 3AW5A 2UWEB 1TVHB 4NUGH 4X50A 4X98B 2D03H 2VJXA 5A43C 1HEHC 4HK3J 3AACA 4AE1A 3BAXA 3WFEL 3BUQA 2CGYA 4R83A 4IIQA 4HWBA 4H4NA 3ARQA 5C0EA 5J9PB 2AJZA 2A5UA 4H8QA 3GXIA 4MRBA 5AVUB 2HLEB 3Q2WA 4GSRA 4QD2E 1DJHA 1C08A 1G9MH 1HL9A 2EIMB 2VMCA 3OKMA 1H15A 2XKNA 2AV1B 2BJMH 4HIEA 5JOPD 2D8KA 2PWFA 4JZOA 3WDJA 2F53A 1KB5A 1A7QH 1KYDA 1KXVA 1L9OA 4QYAA 4PGCB 1WFJA 2IBZY 4GPVA 1XF3A 2AS5M 1SLVA 1CUOA 3MV01 1RJLB 2EDEA 5I15L 1PLGL 3KWTA 2VLKE 3MODH 4HOXA 3WE6B 1IKNC 5IW6A 2OS7A 1NAMA 5EA0H 2VDMH 2GW5A 1YMMD 2JQMA 1PD1A 3RA7H 5FIEA 3U0WH 4TMPA 5F9AC 1EXGA 4G3YL 5H35A 4Z95L 5MI0C 4U1HA 2VKXA 2EDMA 4FERA 4X99B 2NLJB 5IEHA 1G6RH 4GSXA 2W88A 4N9GB 4FNUA 4AW7A 1MFAL 1NMBH 2VDNH 4FL4B 2HJFB 3S97C 3L3OA 2GFBA 4RFEB 2NW2A 3UZVB 3RQ3A 5HGGS 3BUYA 2IH3A 4G71B 3NUKA 4G59C 1VACB 2V17H 4LU5H 2DWDA 1T0NB 4HCRH 3V5HB 3WJLA 3LH2L 5AYQA 5ABZA 2GITA 4JFEB 4FX5A 5GS0D 2W60B 1ZS8A 4PJ9A 3SJVA 3BC9A 3QRGH 3EJPA 3UTSA 1DQVA 3A4EA 2V5YA 4TVSa 3S37H 3ZSTA 4HZ1A 3QZWA 4AGOA 2ICEB 5FYLL 1AMYA 3A5VA 1OAYL 5T1DH 4BKTC 2X4QA 4FA7B 3GMPB 3H9HB 3MBEA 1G9MC 4AVIA 2CHDA 5F9WC 3MZTA 5GSRA 2E76C 4ENZA 4NX0A 3X12B 5EDSA 4HUVA 2A9AA 4OJCA 2H3NB 3B2UC 2EUXA 4OD3H 5I8EB 1VDGA 2ZUSA 3GMQB 3O6FD 2APFA 4OAWA 3AM8C 4ONGL 1W72A 1KXTB 1ETJA 3CHPA 4OU3A 3RVUD 4DEUA 1XH3B 2Z1PA 1C16B 1UM6H 1VEMA 3PYCA 3VNYA 3TLRA 4PJFF 5KVMC 2X4RA 3S6CA 4QOKA 1BAFH 4MAUL 1NPJA 2DLFL 4NZRH 2WTOA 4KWUA 4BQ8A 4F7PB 3SJVD 5F1KC 1BQLL 4Y19E 4BZ1A 1JBJA 1UT9A 3Q1SH 1D5ZB 1WA2X 3FCSA 4LLQB 4AW4A 2HSIA 4FFYL 4DCQB 2RBLA 2PW2A 4FLSA 3D0VB 5J11B 5I30L 4KTDL 2XWXA 4Q4IA 4HJ0C 2CKNA 3RVTD 3IVKB 1YPZB 4M8UA 5L8LB 3I2CH 5FWQA 2XN1A 1U92A 2FUTA 3FO9B 1ZJAA 2CE6A 3ABLB 4P5TC 2G2RA 3T6WA 3ULSB 1P4IL 4EEEA 5LJYH 3S5YA 1T6BX 1HCZA 3O0RH 4X5RA 4IKIA 4ZFZB 3ULVH 1VESA 3FFOA 2Q6WA 4F7CA 3QBTB 3LQAH 3GTTA 2NY2C 4QOKD 5F6HI 4J3TA 1DSYA 3DHPA 2IDQA 1JXGA 2WANA 1PZCA 4PW3A 1AZCA 3MNDA 5E4EC 2C4FU 2WLNA 2XN2A 3DTUB 3T0WA 1MF2H 2XG4A 3L3DA 5MP6H 4BFJA 3O2WL 4EI5A 3E7JA 1EH9A 3MV7B 1R5WA 4PAZA 3VI3A 4O02B 1U8NB 3E2HC 4YVNA 5BZDB 3C5SB 3T71A 1IARB 5I9QB 4DGVH 1NOLA 1SBBA 5D4HA 1SLUA 3DX2A 2AFNA 2J88H 4KO7A 4XBGA 4MBOA 5HHVH 3QDGA 4KXDA 1FG2A 4NBZB 4XTRC 1F6FB 1Q94A 3G3LA 3IDJA 4NO3B 2BWIA 1KB9K 1KTKE 4Y4HC 3FSZA 6FABL 5ITFA 1EAPA 4LOVA 1ZWIA 2R1XB 3ISYA 3UPRA 2XV6B 3B5TA 4YSCA 4XVTL 4CADB 3CFKA 3KWVA 1TSRA 4PG9B 4TQHA 1S5IH 1S8DB 1VA9A 5LGJA 1DJXA 2YGOA 2P45B 2IDTA 5CU9A 5LBGA 4RMSA 1UUSA 5D1XD 1F1DA 1SRDA 3WIHL 2ZAIA 4HJJL 1A9EB 4M6MH 4N2BA 1C1EL 4WI8A 5KS9F 5E9DA 3ULVC 4ODTL 4MRCA 2FJGA 4LSVH 4FQ2H 5FLVA 1JP5A 3LQAC 1MFDH 4NQEB 5DUBA 3HB3D 3PAYA 5GRXG 1CF8L 5C0IB 1MQKL 3D5OF 4G80A 3NJMA 1UWYA 3K5SA 1O7VA 4JDZA 4MAYB 4NKMB 4OCXL 3SE9L 5D5MF 3M7FB 5C0AD 3NFNA 1M4KA 2V37A 4AL8H 1KLUB 2KI6A 3PGCA 1K4CB 1QBAA 3PQYE 4F3FB 5J8OA 5EU5B 1Q38A 2G5BA 2LTQC 1SDAB 3G9VA 4XOEA 2FQGA 1NSNH 3SKJL 1YNTA 5C0RL 5KSAB 1IZJA 1TJXA 4F20A 5HDQL 1MHCB 4JG5A 1KWGA 1MCRA 5D4JA 4C56B 2E7DA 3V5DA 3WLWC 1P7QA 4HV8B 4ES9A 3SE4C 3ZTNH 4XP6L 2QQNL 3KYNA 4GT7A 4LLYB 4FQIH 3QORC 1CF1A 2HTLC 1ZDQA 3GT6A 3MRMA 5AZEH 3U7WL 2ED6A 2FZ3B 2BRRL 2KZKA 1BD2B 4MBRA 2WOYA 2W0FB 1SEQL 4I89A 1B2WL 3LQZB 3DYOA 3MZGB 3UAFA 1LEIA 3SGDI 3ZL2A 1M9WA 3B7UX 3D34A 5I23A 1LO0L 2NYYD 1I3GL 4J8RB 1XF5B 3PWPB 1CGVA 1RIUH 4LHUB 4WEMB 3NP4A 3QWNA 2DW5A 3X1EA 4Y89A 3OHMB 1HSAA 1QRNE 1LVEA 3L4TA 4ZTEA 3FNKA 3I6LD 3RX9A 1WS7A 4D9LL 1GSMA 5D96C 3CC5B 1U8IB 5AB1A 3ZDYF 5C08E 3FRPA 5KSBE 1NDMA 2CCVA 4K4KA 3S4SB 3QJTB 1JPGA 1RZPA 3IDUA 1RCYA 1DN2A 4LVNB 1CD8A 4WWPA 4J3OD 4Z7WE 1KGJA 3TP4A 4EI0A 1H8LA 4IIQB 1FO0L 2YRZA 3U1QA 5C0EB 3G08A 1VGEH 2AJZB 4G9FE 5DFTA 3DURA 4S1SH 1LILA 4AL8C 5CEZE 5J56B 1WUZA 2XV2A 2Z31A 2YPLE 1C08B 3BRDA 4FCHA 3CX5J 1QLEB 3OKMB 4A66A 4M02A 1H15B 2XKNB 3QHFL 4A6YA 2X1OA 4FG2A 3LPFA 3I84A 4HIEB 5KJ4A 4JZOB 2WUCL 1DQTA 4UIKL 1TPXC 2AGJL 2F53B 1KB5B 3CZEA 2A1WH 3OC8A 3PL6D 4RISH 2X4UA 4LFHG 1AGFA 2YA0A 3H9ZA 4YUEL 1S9XA 1L9MA 2WQVA 1XF3B 2IFGA 3JXAA 2H0FA 3NFSH 3NIFE 4UF7C 5D8JH 1KTDA 1WWAX 4J3SA 2XXMB 2I07A 3K8LA 3WY3A 4HXAL 5IW6B 4AMKL 1NAMB 4NPKA 1ILUA 4MCYA 1HL4A 4NWTH 3GKZA 2YD8A 4KUCF 3VGGA 2AEOA 3WL9A 2CM5A 4ATTA 3FDWA 1CLZH 1J1XH 3IDMA 4U1HB 5E99L 4L3CA 5IEHB 1DVFC 4TL5A 3TONA 2OMTA 3L3OB 3DROA 1G9HA 2GFBB 4IJTA 2NW2B 5GS1A 2IH3B 2I32A 3DJRA 1D5RA 1HNFA 1RUAL 2DWDB 3FO0L 4FHBD 4X7SH 1A66A 3CFIC 5E8NA 1BZ9A 1CICA 1KBPA 2GITB 2HJLA 1ZS8B 4PJFA 4PJ9B 3SJVB 4QCIA 3UTSB 1FAIL 2NXYB 2IAMA 3NRQA 3IFLL 1ZHKA 4TSBH 5JXAL 2P5EA 4GRWE 2K9FB 3QZWB 4RGNE 3DXAA 3G04A 2X4QB 1XMWA 3FU7A 4BINA 1JD7A 3MBEB 4WV1C 1FNEA 3O3EA 5GSRB 1RZKH 2PUQT 4YFLF 4HUVB 1JTOA 1HAWA 3CLFH 1RULH 5EC2A 1Q8MA 1LHZA 2BP0A 2QQLL 4FZEL 2YMTA 4KQ3L 3ZDZE 4OAWB 3RAJH 4C83A 1W72B 5IGXL 3C5JA 3Q0HA 2F5AH 3V52L 4YK4B 3EFDH 1UWGL 3V4VA 5GGSA 2WYIA 1HSBA 1MOEA 4TNWK 2X4RB 2DMCA 1NIBA 4QOKB 4NKQB 1OXYA 2J72A 3N5AA 1CICD 3KXFE 3PWVA 3RUGE 3CLWA 5JW3L 2IAMD 1P6WA 5IJBC 1EHLL 1LO3H 3D3VE 2A6JA 3BUIA 3FCSB 4KMQA 3VRLE 1EFXD 3B2VH 3VFRA 1KYOK 1UM5L 3UZQA 1N64L 3DXAD 5IROD 4I5BA 1I8LA 1QFHA 3ECUA 3P3RA 3S88L 5EEYA 3WTYA 2PW2B 4U1NA 1TTGA 1UOLA 3T8MA 4ZNCD 4BWTA 1SXSA 4D0CA 5AWNL 1ZGLP 4V33A 4PJXF 1TTFA 4J8QA 2X87A 2VMDA 3MI6A 3MLZL 4KDTC 2NY1D 4KPHH 1DQLH 3BKJL 2G2RB 4BFGA 3O2VH 5D72H 5L2JA 1FGNH 4U1GB 5EH1A 2OLDA 2RJMA 3NPZB 3IU4L 4W68A 3B56A 1F02I 1F4AA 4LPUA 4DPAX 1OQOA 4F7CB 2Q6WB 2EABA 3TBCA 3ULUH 3HEIB 3N50A 4KJPC 3TA3A 3LHPH 4UT6A 5DC0A 1DBMH 4ODUB 4MXQD 4YC2B 4K94H 4KGLA 1RZKC 4PJIF 5CZVH 1TR7A 2GBUA 5IWLA 1S3KH 1RAMA 2XG4B 3L3DB 4R8WL 2F19H 2K7PA 3Q8AA 4EI5B 2Q8AH 1R5WB 3VI3B 1J9TA 2UVEA 4OGXH 4QRPE 4GXVL 1N0XH 5AD0A 1F58L 3RVXC 4XBGB 4TNEA 1O7SA 1NBQA 1FG2B 2YD7A 4HH9A 4CA4A 3IDJB 3IDYC 5F6IC 4WGKA 2YMXH 4UTAH 4XRCA 3CDGA 3KS0J 3AY2A 4GAYA 2X1QA 4ZUWA 3SEPA 4F8TA 4HAKA 1QAWA 5ITFB 3CFQA 1EAPB 5D93C 4Y4KC 1ZWIB 2QGEA 4UTBA 3UPRB 5JUEL 1RUML 2BWDA 3EDFA 3CFKB 3J27A 1NCAL 5D5MA 1HILA 4KITB 5I0WA 3DVGA 1Z0MA 5LGJB 1KXQA 1JFHA 2JCCF 2VR9A 1GGUA 2R0KL 5TQ0H 2BVQA 1D5MA 2X38A 4K3HA 1JZ7A 1YDPA 2R1WA 5E9DB 5B1JA 1ORSA 2FJGB 4KKBC 4MDJA 5CR8A 3UC0L 3ULUC 4FE9A 4K73A 3PJSA 5DUBB 2R8SL 3AY4A 5AVZB 3RWGA 3KLQA 3ZZ1A 2ZG2A 5DYFA 3EDDA 4ETQA 5C97A 5IHZB 2WWKT 4G80B 3FQYA 4YBQC 4JDZB 4LHUG 1P6FA 1ZANH 4MMYA 2J1KA 2YPVL 3NFNB 2YWZA 3UMTA 1NOFA 2AJUL 3PGCB 2XQ0A 4M6OL 3VE0A 3S9DB 3C5ZD 1NDGA 3RI5K 2G5BB 3S4SG 1UCBH 1YNTB 5F7AA 2E3VA 3BGMA 1UQSA 3Q48A 3VXUA 1A5FH 4FQLL 1L3NA 1IRAY 2YGVA 3QZOA 4KKLD 3IGUA 5G4NA 3V5DB 5ID0A 1L9QA 1P7QB 3BH4A 5DA4A 5T33L 3KYNB 4RMQA 1OF0A 4X9BA 5AW9B 3WY4A 4M7LH 2BOLA 4I85A 3MRMB 5IW3A 5DR5L 3WIAA 3FTUA 1X5FA 1IKOP 5DURD 1MDAA 2HH0H 5FWRA 3W1ZA 3QDAA 5DMIL 4XVJL 1ZGLA 1LEIB 1L9NA 1W0YT 3BEVA 2JB5H 2BXYA 3LZNA 1JRHI 4ISVA 5T5NG 1QZNA 3HUJE 2ZZUT 1AE6L 2ESVA 5MENA 1HSAB 5HBBA 5EOCH 1HCVA 5B1BB 1U21A 1KCUL 3FRPB 1NDMB 5TE7L 1M42A 1JPGB 3OAZK 3IT8D 4M4PA 1QSFD 4N2IA 1A6ZA 3NCMA 4RGMB 1S78C 2XACC 2WVTA 1JNNL 2G60H 5ABAA 5L9DH 2B3RA 3G08B 4IHBA 2ZUVA 1MY5A 5GGUA 4D9QE 3DURB 5DVNA 1D7FA 1GIGH 5FECA 2WD0A 5F3FA 2Z31B 5EMYA 4QTFA 3PRZA 2PWHA 2YKLH 5CD5D 1GS8A 4OCLC 1QPKA 2XQBL 4J3BA 4A6YB 1R4XA 1SYSA 4GMTH 4X9YA 2ZCLL 1IVTA 2MTPA 5LCVH 4UQDA 4IBTA 2X4UB 1AGFB 4JZJA 2LU7A 5MEND 1S9XB 3ARGD 3QZWG 5JDSA 3QSKB 1S9KC 1KTDB 5A1AA 4KOCA 3WOVA 5IFHL 1NJ9A 2WUBH 3BSGA 2I07B 2VTFA 3PPEA 4ODBD 4L8BA 3OMNB 4WGVB 4KBPA 5IT2L 3H0TA 1A1MA 1GRWA 4MCYB 2XBDA 5DFWH 3T2NH 3K8KA 1J5OH 1VZGA 3ZDXE 2PXYA 5CKGA 3WL9B 4CC0A 5B22A 2Z8VC 4KUCD 8CGTA 3IDMB 5DZPA 4DO4A 5IJCC 4L3CB 4KAQL 4PJCE 1AVAA 3K1DA 4OD1H 4DP4X 1E5YA 1MCWM 3J2PA 3JTSA 4XPHL 3ZO9A 1A8JH 2JQAA 4XMXA 2MPVA 1GYUA 1RVFH 2OMTB 3DROB 4BBWA 3F2LA 2X41A 3VDAA 5GS1B 3U9WA 1P5VA 4OFPA 1O7DC 1DDTA 3LCYA 5EZOL 3L16A 3RE0A 4Z3IA 1A7PL 1J0YA 1BZ9B 1CICB 5E8NB 2HJLB 3MLYH 4PJFB 2HX8A 4CGUB 1VFUA 1KTJA 3OB8A 4QCIB 2IAMB 1ZHKB 3VD3A 3LRLA 2P5EB 4AEIL 2J25A 1G4RA 4ADGA 1NCGA 2AEQH 3OBAA 4FTVA 3DXAB 5AAWA 5TDOA 1S7XA 3G04B 5F6HJ 1TYEB 3FU7B 4MJHA 5G5DA 2NNXA 2ZTBA 1HHKA 1FNEB 3O3EB 4NZUH 2PXYD 4MTMA 4WWKA 3ARDA 4NB7A 1ADQH 2ROXA 1KYAA 3ARYA 5EC2B 4WEBL 3VFSA 5IOKA 1PKQA 2NY1B 2BIOA 4EBQH 4M1GL 3B2DC 3Q8FA 2BP0B 3BT2L 1RQ5A 2PCFB 4PJXA 2NXZC 4C83B 3EFOA 3EH3B 1J48A 3HFML 4MHHG 1MUJA 3C5JB 4NUJA 5C0BD 4DK3A 2PR9A 3V4VB 4Z7VE 2D3NA 2AABH 3QDJD 5GGSB 3SO3B 2O5YH 1HSBB 1ACZA 1JGUL 4OIFA 1HYRC 1NANI 5TDPA 4WSGA 2EEFA 3BP7A 3V4UH 3RZCA 4S2SA 1V10A 3PWVB 3FQ2A 2CGRL 3HBZA 2J6EA 2O61A 1YNLH 3O6LL 1ZVYA 4W6YB 2A6JB 5C09E 4DTGL 5E6UB 3VFRB 1P53A 3UZQB 1U91B 3CK0H 4I5BB 5I8KL 5DWUL 4PJIA 2KUTA 2DH2A 3DI3B 3WKNA 4PCSA 1EJFA 3HG2A 4H13C 4WWKD 2C3WA 4D0CB 1DFBL 1MXGA 2AJXH 3ARDD 4LQ1A 2FJUB 3LH8A 3QAQA 3UAJC 9PCYA 5HYJA 2XSKA 3M17A 5L2JB 4JFTA 4JO1L 2P46B 3KPQA 4YDZA 5JO5A 4UBDD 3TV3H 4J7RA 4UT9A 1XR9A 3MNMA 3MV8A 5DHYB 3BXNA 4XPGL 1QSEE 4NO2A 3GSNL 3WFDH 4XZ4A 5LXGL 3G5XA 3TA3B 4S1DC 4P5KA 3CZFA 5DC2A 1GGBL 5DZNA 1WISA 2O1AA 1HXYA 5I1JH 3BH8A 5JA8B 1DQQA 1WWCA 4LARL 1WZ1L 3KM2A 3FUIA 1QW9A 5I6LA 3HMXH 3QZNA 4NI6A 2JCCA 3SD2A 1TVDA 5AD0B 5DMGC 2HWZH 3DIVA 3GYRA 4HS6A 1UZ8A 1PS3A 2WW8A 1P84J 1IFGA 4FQPA 5FYKH 4QHNA 5HYJD 4JCWA 2HFTA 4ANUA 4UZSA 1UT1A 4G7YL 2M1KA 4X6CA 4HH9B 4UNUA 2AJSL 3CG8A 1FG9C 3MV8D 3OAUL 2Q3ZA 4XRCB 3CDGB 4CUCA 4GAYB 4ZUWB 3SQBA 1MWOA 3LD8C 5ALBL 1DVUA 1E5CA 2G4EA 4YX2H 3QUKA 1KC5H 4L1BA 1MG3C 5D5MB 1HILB 3LKSA 3DVGB 1B9ZA 1IAIH 2EEBA 3T08A 2V2TA 2QHRH 2DQGL 4HF5H 4NZ8A 2PTUA 1OAJA 1NZRA 4H2CA 1D5MB 2XTSA 4HIQA 4HWUA 1YDPB 2OP4H 2PYEE 2R1WB 4W9IC 1R3KA 2J71A 2ZAGA 4PLKC 1ORSB 1R3HA 1R34A 4MDJB 4NQSA 4ZJ9A 3PJSB 3O81A 3RWGB 4ETQB 1KEGL 1H6FA 3DUSA 4NN5C 4OM1H 4EUPG 1XGTA 1KGCD 3GLAA 2H2PD 1F2XK 1AZZC 3LS4H 4MMYB 4PRPD 4PD4J 1U2HA 4DGIH 5E8PA 1WT5C 5AAMC 4RAHA 4RRPG 3VE0B 5F7BA 3UH8A 3FRPG 1NDGB 2WNXA 4L4VE 4QXGH 3VDBA 2WQAA 3BGMB 5IQLA 3P4OA 2E7BA 1UQSB 3HPJA 3VXUB 1JD9A 4BSVA 2BM3A 4GI8A 4HHWA 3S96A 1OCRB 1Z0NA 1NLBH 5ID0B 4PB0H 4AUYA 2FBOJ 3ZDYB 4XPBH 3KBEA 2XZAL 2IALA 4ABWA 3MRCA 3NDZE 3I74A 3MRRA 2VC2H 2QZQA 4X9FA 1IC0A 1YYCA 1LO2L 4ZYKA 1VZIA 2CUMA 1AHWA 4OQTH 2GI7A 4GBXD 1ZGLB 1UWXH 1UA6L 3BEVB 2WM0A 3SKOA 4ATWA 3GO1H 4C4KO 3GDCA 4ISVB 2XA8H 3O3DA 3L1OL 5AB2A 2DQDL 1SXBA 3LVEA 5DLMH 1X5LA 2ESVB 5MENB 2D4DA 2VUOA 1IFHL 3HG1D 2CBMA 4NQCE 5BS0A 4Y8DC 4TSCL 1OIOA 3NDYE 3FTVA 1A6ZB 2RACA 1XCWA 3B9EA 3N6YA 5EO9A 1XGRA 4NNPH 2WVVA 2B77A 1PL3A 4JQXA 5GGUB 5I1GH 3DARA 4XO5A 1TTCA 1FFOA 2WJ5A 2V5SA 3NCYP 4QGYA 4W6XB 5FECB 4NZFA 1WUNT 4QKTA 4LEXH 1TZAA 3A4FA 3HIZA 2DLIA 2LU3A 2W9LA 4LP5A 5E6IC 4PVNA 2EDFA 1SYSB 1YEEH 5T3ZH 5KJRH 5LKNA 3H6JA 3ZPDA 4JZJB 2IF7A 3V79C 3FUKA 1RJYA 1DEDA 5DZAA 5JDSB 1VKXA 3BZFA 4W9JC 5GGTH 4MMZC 2VQUA 2IG2H 3ZYJA 4ZQKA 4RDQF 4UM9D 4IGBA 1NJ9B 5EOTA 2X3BA 3TGXA 2EUZA 3WU1A 1RV6X 4L8BB 5D7KD 1JFQH 4MZ3A 1XT5A 1HJBC 2DYPA 1CLVA 3GLEA 1A1MB 3H0TB 3PWLA 5DQJA 1BF5A 4OI7A 2A83A 1N6QL 1Q72H 4HUWA 4OGYL 4KY1L 4Y1AD 5I71C 1P4LA 2N56A 2PXYB 2GAZA 4JRYD 4KZDH 3FUEA 3KL5A 4OZIE 3F58L 3MRNA 5IQNA 5C71A 3ARTA 4APQA 3M46A 1MHHA 1UVQA 3QI9C 2XG5A 3DK2A 1B0GA 1NBYA 5KSBF 3ZZQA 3JTSB 3SDCC 3BPNB 2DMKA 1DO6A 2IOOA 4Z7WF 1P5VB 2WSKA 1J0ZA 4JREB 1YC8A 3AREC 3VMPA 3GMLA 1UACH 1SOSA 4XO8A 1SVCP 4DQOH 4R90H 2E4TA 4L5FH 4KI1A 1QUPA 3FMGL 3SOTA 3VYPA 1EERB 3NCJH 4FTVB 2NY3C 3H2WA 3CDYA 1S7XB 5TDOB 5G5DB 2FL5A 2YD5A 2Z1KA 4JAMA 1HHKB 5CUSH 1Q1JL 4OIBA 4JFYA 5D1QC 4QJ3B 4E2OA 1YQVH 1A4AA 4J3UA 4WWKB 3ARDB 5GGQL 1SY6L 1U8MA 2JWYA 4OT1H 3BYTA 5E5MA 1QBML 4XP1H 1ZLVK 1YSOA 2NTFA 3VFSB 1PKQB