3UPCA

A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords heavy chain variable domain
publication title General strategy for the generation of human antibody variable domains with increased aggregation resistance
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3upcA00
5I8EA 4N8CH 5MP6H 3B83A 3I50L 5LGHH 4KZDH 1F02I 3RI5F 1UM5H 1NGWA 1SHMA 4KJYA 4ODBD 2R1YB 4G42A 5B3JE 4V1DE 2OJZL 1DSFH 2WK2A 4R97B 2ZSWA 3T2OA 4Y0GA 3CDGA 1DUYB 1MJ7H 3QHZH 5C07E 4IIQA 2BVQB 4WWKC 1A1NA 2W9DH 3A67L 5KS9A 3QBTB 3ULUL 3FOLB 2PR4L 5ID1B 1OW0A 1QUNA 5F7EL 2NY2D 4OZGF 3TLRA 3BX7C 2PTUA 2DJUA 2CPCA 3O9WA 1J8KA 4LKCA 4PJBB 5FM8A 1PQZB 2EYSA 2AQ3A 4TOYL 1AY1L 3RIAF 4NQCB 2VOTA 3UZEA 4KU1A 3FJTA 3KPQA 1JV5A 3LV3B 4LLYB 5DUBA 2F53B 2YK1L 1FNSL 2A73B 4ZYKB 2XQBL 1XF5A 1RIVH 4YNYB 5EO9A 2W0FA 5D7LE 2E6JA 2Z31B 3ULVH 1E27A 1HXYA 2VLJD 3MRKA 2IAND 2Z8SA 4LPXA 5E5MA 5I66B 3BJLA 2Z93B 5D96C 4LPVA 4YHYB 4HWBH 4Y4HD 5DUPH 5KVFH 5CGYC 3VXNB 5DRNB 1MAKA 4QXTA 5CSGA 3WFDL 2BCKB 3DO7A 1JF6A 3VFTB 2E9BA 4H26B 4CW1B 1CK0H 1W72H 4UAOB 1HHIB 2I9LB 3HZMB 3IDMB 4KDTC 1GGIH 4B0MM 3VXRD 2W65A 5F7DA 5IB3B 1AKJA 1AHWC 1TZIA 5KTEL 3UTPD 2PTTA 4IEFB 4RAVA 2IPUG 2C1OB 4GO6B 2YPVL 3FONA 1H8NA 2BNQA 3QEHB 2AAVA 4WHYG 1D6VL 3OF6A 1N64L 2DQIH 2OXHA 1NMBL 3QISA 2XPGB 1ZA3A 1LEIB 1MFAL 4QHKI 1BVKA 4X99B 5EUOB 4Z7OF 3TN0C 5J13C 5F7WC 3JBG7 5JXEA 3H7BA 2F58H 2W0LA 4F7EB 1L0XA 1U8PA 3GMRA 1JF1A 3S88H 5DHVB 5DWUL 3IJYB 3AMLA 3MV7D 5F9WB 1DQJB 4OGZA 5SWZB 4WDIB 3LDBC 5ANME 1GC1C 3IFLH 1VENA 1S7VB 4GKZA 1UACL 2GT9B 4L8CA 1K6QL 5MEOB 4QHKJ 2ARJQ 4NRXA 5F21B 3OKEB 3GMMA 3FN9A 5DJZB 4PJGA 3FT3B 1BVLB 3VD5A 2ZG2A 2EZ0C 5JA9A 4JANB 1J8HD 3DX9B 1FL5B 1KOAA 1P7QD 4PJ9A 4WHYH 1KCUH 3TA3B 3BWAB 4RFNB 5FYJH 5IFAH 1U8KA 1E4XH 3RX7A 1KJMB 3SGJC 1T04B 4XPAH 1TCRB 4XT1C 5HHOA 1FC2D 4OQ1A 3WUZA 1YYML 3NCCB 4OFIA 4MXWH 1K8DA 1T0PB 3X14B 4NKIH 5LQBL 4RNRA 2A6KA 3QPXH 1W0VB 3TBVA 2VQ1A 2R1WA 5E6IC 1LEKA 4M61A 3JXAA 3OX8B 3RWHA 4JFOA 2DI8A 4YXLH 3WFBL 5SWSA 3GBNH 1AGCB 5IK3A 1HQ4A 1JNLH 2G9HB 3FHAA 1YMME 2FWOA 5T1LB 4S11A 1FGVL 3EDEA 1NBZA 2R0ZL 3VFRA 2EDDA 5F96L 4R4BA 4C4KO 1OSZA 5IFJB 3QG6B 1KACB 2HJFA 2Z35A 3PGDB 4G6JH 3GM0A 3SGEI 1KN4H 4HS8H 4TSCL 4I3SL 5EU4B 4TN9A 3OKYA 5EIIB 1AQKL 4J4PC 4YFLI 4JQVC 1ADQH 1OCWL 5GZND 4DEPC 1OD9A 4ALAH 2IQAB 3KLAA 4L4TD 1UJ3B 4OF3A 4NRZB 4MQTB 1QKZH 5TFSH 3BDBA 4QGTA 3B9KB 4PJ7B 4BFIB 4FFZL 3IKCA 5IMMA 5JPMB 4FTVA 1N5AB 5FYKL 4LSQL 3V6ZA 4Q9RH 5DSCA 4TSAH 1KELH 2KL6A 3MA7B 3HI1A 2JCCE 4PUBL 5LKNA 5T1MB 3H7LA 4XGZA 3MRCA 3CFKB 3BYYA 1FGNH 4ZUTA 1HXMA 1X6NA 4J8RA 1S9WB 1MI5A 2GJJA 1Q9KA 2EEBA 3HUJF 3A6BH 4UTAL 5FYLE 3NOIA 4JFXB 3LS5H 4M00A 2FYYA 4XCYB 2YOCA 3MGAA 3WS3B 3HNSL 2FRGP 3OBAA 5DJ0A 3AC0A 1NFDF 4Y88A 3MA9H 1FFPA 2ZUWA 1MLCA 4FQJL 4BJLA 1DBMH 3BEVB 1MFDL 4R3SA 4N90E 2FX9L 1MNUL 2VDOH 4OLWL 3ZYJA 4R26H 5D4QA 1A0QL 1X5JA 1T1XA 3BD3A 5DJ2A 5F93C 3LEYH 4QRRE 1CDIA 4JDTL 3OAUH 2NY7H 3RDTC 2HTKD 5TQ0H 3S34H 2CDFA 1V3LA 5HHQA 5HYJA 1OGTB 1CGUA 3QEQE 4X7SH 3LQMA 3BSZL 1FNEA 3RWEA 3SKUD 5IR1B 2NY4D 1KFAL 3QCVH 4LVNB 5GGUB 5IFHH 2J8UA 3DXAA 3MYZA 1KCLA 4L9LC 1B0RB 4EUPG 1OWRM 1F97A 3CGTA 4I9WE 3LAFA 1EO8L 1KULA 3EFDH 3VGEA 4KHXH 2CUHA 4HMCA 5GGQH 4I0KA 4NBYB 3SKNB 3SJVA 4NRYA 2NNAB 3MXWL 5L0QC 2A9NL 5DD1H 4P3DA 4K3HA 1YMHB 3ROLA 2PO6D 4H0GA 4NWUL 4OZIE 4MAYD 2KQNA 1UH3A 3D39B 1CD0A 4UT6H 3VGFA 1IAII 1N4XL 1R5IA 2AKRA 5C6TH 1QSFA 1S7WB 1BWMA 3QIWD 5D5MF 3LRSB 4QRPE 3UJJH 4LEXH 5D7JA 1X4XA 4C59B 3I6LD 1T1WB 5FGRA 5CHNB 2Z8RA 1CFSA 4L3CA 2JJSC 5E4EB 2R2CA 1JGDA 4N0UB 1MCPH 1I75A 5HGDB 4PREA 1BGXH 4HFWB 4WFFE 2WUCL 4WGVB 4HF5H 2H3NB 4IRJD 4OB5L 5GS3A 3CX5J 3G08B 1H3GA 2RBLA 3UPRB 3VA2C 3VFSB 4M3KB 4LSRL 2D31A 1QRNE 1AQDB 1YY8B 3CFBA 1JMXA 3C8DA 3QZWG 1UQSB 5DGRA 5BV7L 2CSPA 4JY5L 4KAQH 1S7RA 2GTWA 1NMCB 5F3BB 5IW1A 4IIQC 3TIDB 1KN2H 1T83A 1WEJL 3IB4A 2C3VA 4G80B 2ARWA 3B5GA 5D1XB 5IBLD 2XI9A 1J11A 4M62H 3IAQA 1D9KA 4Y4KD 1A7OH 1OW0C 4OJFH 5HYQA 1PD6A 1CICD 2EO9A 3HNTH 3OJMB 1SY6H 4JFHE 3NZHH 4Y5YB 1WICA 3F7PC 3IDNA 3UTTD 3T2NH 4NO0D 3S35L 2VL5B 3EOTL 4LCWE 4AJ0A 4AIZB 5I1GL 4GUPB 1UM6L 1ACYL 4M8QA 5FO7B 2PCPB 5FO9B 3T3MF 1MF2L 1HILB 4G8IA 5ICYB 1KJ3L 4NZRL 3V52H 1FZMA 3CZFB 1LO5A 2NTFB 5TH2A 3PL6D 4JGMA 1ZOXA 4HK3J 1XGYL 4NFBA 1E0OB 3L5JA 3TYGH 4JPWH 4X6DF 4DK6A 1F5WA 2G5BA 3W81A 4BH8A 4X6CB 4X8JA 1MHCA 5GRVL 4ZD3H 3DUSB 1FBIL 5AWNL 1Q9LB 1Z0MA 3KPNB 3PWNB 4TSBL 3RNQB 3GDBA 5ISZD 4P3WA 1UWXH 1H8OA 1EX0A 3IS1X 4PJCA 3EOBA 4GRWB 2MOVA 1T2QL 2VDQH 3LD8C 3NGBC 2VZUA 1A6VL 3FRUB 1IGJB 5A16A 4WFHE 2HRPL 4GG6F 4QTIL 4OKDA 4D8PA 1FNLA 2DLHA 3F62A 2DAVA 3QQNA 4GKSB 2EIZA 3I85A 3D25B 3DROB 2J88L 2AV1B 2VXSL 5JXEC 3FN0L 2X4NB 3PWPD 3U7AA 4CADA 3QDMD 2X5PA 5I17A 4NQVB 4P5TC 1U3HD 4YHIB 3VE0A 4IBLT 1UVQB 2ATPB 4Z7UA 4LF3A 1KLFA 3QUKA 4QTHA 3L3IA 1YZZA 4ZXBB 4LLDB 1B0WA 1UA6H 3T0ED 4IDLA 4DCQB 3CDCA 5DT1L 3T0VA 3T4AB 3F7VA 1YC8A 3ZKXC 4ELMA 3EJYD 3U7WL 1J1XL 1INDL 4JDVA 3GBML 5FCUL 5BOZG 3QA3A 4MNQE 3PWLB 3KYKL 4FFVD 5EBMA 4M43H 1T80A 3BO8A 1OAXL 3NVQA 1GVIA 4MNHA 1TJGH 4PJ9C 2OYPA 1CGSL 1A3RL 4PTUA 1A6WL 1TVBA 4PD4J 5JZ7D 3O2WH 5FHBH 1J1PH 3RTQB 2EXWC 4U6XA 4HDIB 1IAIL 4GBXA 1C5DB 3RUGA 1V3MA 2ESVD 1XCTB 3MGTA 2EYRA 5JDSB 4NNPH 5GISH 1XF3B 2UWEB 4FFWD 2CKBH 4TYUA 5FYLH 4POYA 5C0RL 5C86A 1ND0A 4K8RD 2QADB 1P4BH 4ZAKB 5INCA 5ALCL 1SM3H 1BX2B 4PP2B 4PRIA 1KEGH 1HOCA 2I07B 3BAEH 1F8TL 3LKPA 3FQWB 4XNQA 4XBGA 4Z0BL 4RWYL 3FB5B 2IANB 1Z9OA 1KJVB 4HH9B 4TTDC 3TZVC 3MJ9H 2BNUA 2EDBA 4F7MB 4UI2A 5C08A 5CKGA 1BD2D 3ARTA 4Y4HB 4P2QE 1PLGH 1JGVH 4IHOB 3GHBH 4ZUSA 1HSBB 1D5MB 3RWFA 4DGVL 4E9LA 3VXRB 2EDHA 1FZKB 1XFPA 3KJ6L 1UJTA 2BNRA 3OXSB 4YDVB 4LLVA 1BIHA 1E4WL 2R4RL 3TNNB 5JHLL 3MOAH 5F1IB 3VMNA 2F19H 2BMKB 1S7SA 4U05A 1B0GB 4NZTH 4J3VA 5SV4A 3ARDD 4MYWB 4LU5H 2AJZB 3I3DA 2X70B 4XHJC 1QFOA 1F3JB 2Q76B 1H0DA 3BQUD 3VXOA 2CLZB 3UAJD 1HWGB 3GZKA 4N5UA 5BMFL 2IEPA 3DVNB 1KG0A 1N5YH 4I1NB 1QFHA 3G6DL 3P0YL 1JRHH 5HYIA 1OB1B 1T3FB 3JVGA 3MV7B 3VXMB 1AIFA 3FN3A 5DD6A 3O6LL 4L3EB 1UZ8B 2AERT 3CLEL 4WVRA 2XWJA 1KPVB 1RUKL 2R29H 3LN5A 4HJ0D 1BFTA 5TE7L 4UZGA 3BH8B 4HIIB 2FJGA 1M6OA 4WW1B 3AM8A 1MCNA 3ZHKA 4RDQG 3SDAD 2DI7A 1J8HB 5KSBF 2EE6A 4UINL 3H9SE 2V2WB 1ZLWK 2R8SH 2CKNA 4O02L 4U2YA 5HHNA 4PGEB 3R06B 2IH1B 1A21A 3T09A 2EDNA 4XAKE 4S1RH 2L7JA 1JTOA 2Q8AH 4AYFA 4G7VL 5MHSD 4NSKB 1SYSB 1FRGH 3RIFF 4Z7WA 2ZOLA 1NDMA 5EOQL 3D0VA 1LO2L 5EBGA 3RJQB 4OLZH 4MJ4A 4NWTH 3PG2A 3WIIH 1YDPB 3LH2L 5I71B 3EYVB 4PJDF 1ETZA 4X80L 1OF2A 4HC1L 5F72S 4FNLH 1OLZA 3KVQA 3ZKMC 4AENA 2OK0H 2D4FA 2XNAB 5D2NB 1P4IH 3O3EB 5IIEA 4P57B 3QG7H 4Z7NE 3FTGA 5D7JC 1LWRA 4PB9L 1TITA 2Q6WB 4M4RA 3ZKNC 4ZFFB 1XF1A 3EYOB 5IHUL 2XRAH 5KSAA 3MJ8B 5DMYA 2EDTA 2A9ML 3ULVF 3QEQB 3QPQD 5C1MB 5HGBA 4FG6C 1REIA 1MFNA 4NN5C 4QKXB 5CZXC 5DXWA 4AQ1B 3V9FA 1IM9D 1OARH 4N68A 3TT3H 3EOAA 4WHCA 3DGGA 5IBUB 3NN8B 5E5RB 1M05B 3OG4B 2HKHL 3K3QA 3L3JA 1G9ML 1XIWA 2R2HB 3WO3B 3BKJL 4ZO9A 2X4UB 4ODXB 1T83C 5EIVA 5DLML 5I75C 1YEHH 3NIFF 4UQ2A 1B4JL 2EDJA 1OGAA 3OB0H 3K1DA 4ZNEA 1S7XA 1D9KC 1FZOB 1GZPB 4N8CL 3C5ZB 5CS7A 5MP6L 3KYAA 4JRYA 1K4DB 3G5YA 4Z78B 2IH3B 2OLDA 4OZIB 1UM5L 1K8IB 5C0FB 2IAMD 4Q6YA 2AJUH 3MUY1 3QP3A 2GY5A 4RGNB 3MCLH 3Q0HA 1IGFH 5I0ZA 2VSDA 1F6FB 5IVZA 1DSFL 2CRMA 1BQSA 4ZUUB 1BMGA 2OCFD 4JFYA 4OGAC 1MJ7L 4FXKB 3GEWB 4HGMA 1RZJC 2P46B 2IC2A 2W9DL 3SDCD 5ID0B 3VXUA 2AJYH 3PNWA 1W8OA 2CR6A 3BIAX 4ERSL 4GAYA 2NQCA 1CXKA 2YN3A 4I2XA 3OKNA 4K71B 4HCRH 2VDMH 4NO5B 2ENSA 4HUXA 1PX3A 4F15B 5B39B 3DWTA 4P4KD 3L3OB 1HHJA 3BPCB 3MYJA 4PS4H 1XF4A 1WTLA 2ICES 3NTCH 3QDJB 4KJPC 3BUYA 3N1QC 1RIVL 1UC6A 1NC4A 4EZMA 2P5EB 4NC1C 3ULVL 1BZ9B 4NGHH 1G7QB 3RVUC 5KVDH 3WDHA 3UTZA 3HZKB 1AO7B 3SQOH 1VGEH 5EOCH 5J9PA 4M6AA 3PDDA 5DUPL 5KVFL 1WV7T 3ZE2F 4JR9H 2D4DA 2NLJB 2ATKB 1FO0B 3GSNB 3UROR 3D69B 4JGUA 1GGIL 1KJ2H 3EYQD 4H0IA 4HIHB 4HWZB 5D2LB 1V05A 4F3FB 3I75A 3D85A 4CVXB 2VL4A 3QUMH 1PY9A 5T5NG 1HH9B 2GK2A 1KIPB 1KB5A 2X9WA 5DEFA 1CFNB 3PP4L 1XGPA 35C8H 1QLFB 1Q94B 4PPTA 3K46A 2DQIL 4QRQB 4K9EH 5CBAB 3X12B 2VLKD 4K2UL 1D5XA 1QPXA 3GIZL 2VXUH 2FX8H 5C2UB 3LSOB 2P7TA 2R1YA 3U82B 2V7HA 2NY1B 5GS0H 1W8NA 1MHHB 1MWAH 4O5LH 2F58L 4N0YL 1B2WH 4MZ3A 3S88L 3VXPA 3BN9D 3P11H 3KHOA 1DUYA 5F9AC 4RMSA 4GBXC 3W0WA 2BVQA 3VGGA 3K2UH 1ITBB 2UUDH 1G0DA 2ADIA 3IFLL 2VXTH 2VDKH 1KCKA 3QIBD 4EXPX 3FOLA 3KLSA 5C70A 2AVGA 4ZOBA 1SYVB 4PJBA 5TJWK 5JPNB 2B2XH 4DUVA 2NY0B 1QSEE 1KIQA 5F89B 3KPSB 1I85A 4NQCA 4OZFG 4RMRA 4TNWF 1KCUL 2OTUA 5KANI 5C0BD 5IFAL 4LLMB 1E4XL 3LV3A 1OAKH 2F53A 1JGLL 2OI9C 1MCBA 2CIKB 4ONHA 3WNOA 4Z7QE 3ULVD 5I66A 3CPLA 4D9RD 5IB4B 5EZIH 2C3XA 1WWWX 5KVEH 4MXWL 1JZ3A 1T1ZB 4JY6B 2HYMA 4MQ7B 5GJSH 2XY1A 2YD7A 2HP4A 4NKIL 5C0ND 5B3JF 2AXFA 5DRNA 2BCKA 3VFTA 4CW1A 1IGCH 2HFEA 5C0DA 4K3DH 3T8XB 2I9LA 5C09E 1JZ5A 4YXLL 1CQKA 1S78D 5IB3A 3GBNL 3LPWA 4Q7DA 2X7LB 4K7FB 4BM7A 1EGJL 1IC7H 5EA0H 3QEHA 3QUXB 4KRLB 4OT1L 4LQFH 2O5YL 3HHRB 3V7AE 4G6JL 5E5UB 1KN4L 4HS8L 3PWPB 2FO1A 3MTRA 2UZXB 2ZCLH 4RCAA 5FA3B 2EYTB 2R2EB 3RI5K 1U3HB 3MCG1 3JVGC 4PJFA 4X99A 5EUOA 5E6YA 1ADQL 4P2RE 4ALAL 4IRZH 4C56E 1MFBL 5DQJB 4XPFH 4LLAA 2WBJA 5FUZH 4F7EA 1IGYB 5E2JA 4N5ED 3T0EB 1QKZL 5DHVA 5TFSL 1RMFH 3DRQA 3ARFA 2OR9L 1KJ2B 3IJYA 5GRZA 5FAAA 3CFJB 4K07A 3AM8C 1A9EB 1UYWH 4Q9RL 3QUMB 4TSAL 1KELL 4U6HA 4WDIA 5SWZA 4EN3B 2WLYA 4LSSL 4CN4A 3H8NA 1FGNL 4LLWA 1BAFH 4YHPB 1H3UA 3MV8B 3OKMB 4UOJA 5DJZA 2UV3A 1FL3B 3QXUA 3BGMB 5L2JA 1II4E 4JFDD 1YQVH 2YWYA 1ZEAH 4BZ1L 3EHBC 3OB8A 4YXKL 3WDIA 2GSGA 2Q3AA 3MA9L 2W0KA 4XPGL 3KNBA 5FYJD 2DQUH 3TA3A 3BWAA 4CL7A 4YO0B 2VDOL 4R26L 4XPHL 3VXSB 3ZDZE 2Z9TA 1KC5H 1KJMA 1NFIB 4R96B 4RX4A 3LEYL 3BW9B 3OAUL 2NY7L 3REWB 1TCRA 5TQ0L 1KBGL 5HJ3B 1I9JL 1NAKL 4KKLC 3UPCA 1MELA 5IVXB 5IUSA 3QCVL 3TBSA 1U3ZA 5IFHL 3X14A 4K94C 2PUQT 2NY6C 2F74B 3Q6FA 1W0VA 4IRSD 2P8MA 1FZJB 3EFDL 1EUTA 3RU8L 3OX8A 3S35X 2VLRA 4P9HC 5GGQL 2MJWA 5C2BH 2VQTA 4RISL 2E9WA 1AGCA 4DKAA 1P2CA 1ZA6A 1DBBH 3W9EA 1IGIH 2ZCKL 3MRGB 3ZTNH 5KSAC 1FYTD 4MA1C 5DD1L 3BPNB 2LU3A 1CR9H 3VFNB 4GXUN 5BZWB 5EWIL 1QFWM 5EU4A 4I0CC 4UT6L 5IHLB 5BQ7B 4OD2B 5EIIA 3FO9B 1LNUB 3PWVA 2P49B 4L4VB 4G5ZH 3SDDA 1UJ3A 3G5ZB 1CFBA 4LEXL 3MFFB 4YBQC 4YC2C 5C0AB 1XIWC 5A2LH 2A77H 4NOBA 5H8DA 3V8OA 2OTWB 4BQBA 3MLTB 4DW2H 3B9KA 4PJ7A 4PGCA 4MDIB 1CXFA 5JPMA 5IM7A 4PJIE 3AAZB 3F7YB 5KJRH 3SKMA 2BRRH 4QXWA 1MCPL 5T1MA 1LK3H 1BGXL 3MO1B 1ROWA 3MACH 5DUMH 3TWCH 1ZVSA 4HH8A 5D7IB 1KB9J 5TDNA 3I9GH 4JFXA 3H0TB 1J5OH 4XCYA 1G6RB 2K7PA 3DTXB 5D1QB 5GGRY 2PXYB 2VJXA 4JO1H 4Y1AB 4MSWB 3D6GA 3UBXB 2E9JA 1NAMB 2GY7B 4KAQL 3IF1B 3LHPL 1KN2L 5I8OL 4X4ME 1KLUB 5F7MC 3JUZA 4M1GH 4N8VB 1OGTA 1T21B 2H32A 3CCHB 3QQ3B 4OJFL 4UT7H 5GGUA 3HNTL 1EEZB 3EO1B 1AXSA 3VWKD 2R4SH 3NZHL 3T2NL 2NY3B 4P46D 1WBXB 3L95A 2YMXH 3O3DA 1I8LA 2NW3A 3KYMB 4XMKH 4HAGA 4M5YH 5FKPA 3R0NA 1CLCA 1M71A 32C2B 3JWDC 1YNTB 1TPXB 5FF6B 4WI3A 3FO2B 3SKNA 2NNAA 4U6TA 4JPWL 2JCCF 4PP1C 2A74B 1YMHA 3PP3H 3X3GH 4EKXA 1JPFB 4O00A 5D7KE 3MV9B 1F3DJ 2XKSA 4J23A 4ZD3L 3RVTC 5CJ5A 1PFCA 4XI5C 3V7AG 5JW3H 1AE6H 1HNFA 1S7WA 4XCCH 1QHOA 3OG6B 3MLUH 3EZ8A 1ZS8B 3OL2A 3SDYH 1QLEH 5CHNA 5D7LD 4IMKA 3QCTH 1JCKA 2ADFH 3Q5TA 3M1BB 1EGJA 4WUKH 5ESQB 4Z6AT 5HGDA 2LVEA 1GGBH 1I4FB 4HFWA 5DJDB 4EDXB 3LKOB 5GGSA 4Z7VE 3K4ZA 5CEZD 3G08A 2OXGA 3OAYH 3VFSA 2DQGH 2CDEA 4Y2DB 4NYLA 1DBJL 4LQ1A 3NPSB 4G9FD 1T7VA 5A40E 2H45A 1UQSA 2ENYA 5HHMB 2G2RB 3WHXA 2JB5H 5F3BA 3TIDA 2Q7YA 5TDPA 2C7UB 2IAMB 3BP7B 5E99H 1GAFH 3QQ4A 4WU7A 4L29B 4G80A 4WU5A 4JAMA 4X6EA 4OZIF 3DYPA 1N26A 4WO4B 3M8OH 1I3GH 2VL5A 1IJ9A 4M43L 2VLLA 2FATH 5FO7A 1TJGL 4HIEB 3L7EB 3O2WL 5FHBL 1O7SA 1J1PL 3HR5A 2CK0H 3CD4A 1RPQA 2R15A 3QUZA 3IVKB 1NH6A 1F4AA 5FYLL 2CKBL 4EIZC 4X6CA 1HHKA 4M9PA 4ZO8A 3DUSA 5GRVK 1U8JB 1UT9A 4YHYC 1P4BL 1Q9LA 1RZGB 1SM3L 3KPNA 4LHUA 2DKSA 3PWNA 5HI4D 3RNQA 5I8CB 1KEGL 2EKSA 5GJTH 1NBVH 3FOMA 1JUFA 3NCJH 4UQ3A 3AMKA 2E3VA 3WNKA 4QYOB 3CFCH 4KGJA 3OHXB 4QHUB 5C3TA 4JCMA 4MLIA 3BP6A 4BZ2H 1NC2B 1A6PA 5IVOA 3L5HA 1PLGL 1JGVL 3TT1H 2VDRL 3C09B 3FRUA 1IGJA 5IOPB 2AW2A 2DYPD 1MCWW 5FKAB 5DJ6A 4U1SB 4W70A 5K9QG 4JFFE 4GKSA 1IEBA 3DMMB 2Q87A 1RZIA 2W9LA 5D7SH 3U36A 1TTFA 5MEND 4EI5B 1Q9OB 1A6AB 2X4NA 1R3JA 3M07A 2PYEA 1L4IA 2WBJC 3BKYH 5ADOL 3FFDB 3MOAL 1AGEA 2F19L 3L7FB 2MPAL 5ITBH 3ARFC 4LRNH 3F12A 4KK8D 4NZTL 4QRSB 2FIKB 1YMMD 2WANA 4W6YB 3UTSE 1DP0A 4MMZC 3HTLX 3WEXA 2ATPA 1G9MC 2NY5L 2M8XA 1JYXA 5F9WC 1I1YB 4UU9A 3VI3E 4ZXBA 5C0JB 4PGJA 3AS0A 4GFTB 4DCQA 4R7NB 2AK4E 5DRWA 4RAUA 3T4AA 1RHHB 2F8VA 4IJ3B 1ZT7B 4S0TD 4ZNCD 4OCYH 3O6KH 3GSQB 3DV6B 5FA4A 3T0XA 3TA3C 1N6QH 1IGMH 2H2SD 4ACPA 2RAMA 5D8JH 3RTQA 5I1IH 3X13B 4PFEA 4XAWH 4HDIA 3RNKA 3RFZC 4NQXB 1C5DA 4ORGA 2W92A 1S7TB 1XCTA 8FABB 1LE5B 5JDSA 2YD3A 4LMQI 3WJLA 3U4AA 2R8SL 2BY3A 3SY0B 4XVSH 5C0BB 4S1RL 1FVDB 2HT2D 5HHPA 1BX2A 1AFVL 3LRGA 5BVPH 5E8DH 2SEBB 2Q8AL 5F9OH 2BXZA 3EGSB 2Q1EA 1PYWB 1FRGL 2IANA 5DF0A 3DHMA 1KJVA 4HH9A 4QRRD 3SCMB 4OLZL 2LVCA 4Y4HA 4NKQB 1GCFA 4IHOA 3F58H 5GRYA 4C54A 4M02A 1D5MA 1GHFL 3VXRA 3BVNA 5DMIH 4DN4H 5C0CE 4FNLL 4I9WD 4J3XA 3T2PA 1FO0L 3ILPA 2MCPH 2OK0L 3DOSA 5JW4R 2WINA 3SDDC 1EJOH 1P4IL 3WFHB 1QFUH 1UJ3C 3QG7L 4IOIB 2AV7A 2R69L 1JI1A 2W59A 3MR9B 1B0GA 3B9KC 1CU4H 1EZVX 2MKLC 3F6IA 5BVJB 4ODUB 1F3JA 1QP1A 4NM4H 2CXKA 1H15A 2CLZA 4HV8B 1OAYL 1E6JH 4N0CC 2BJML 2XRAL 5L2KE 3VD4A 4X7TA 3RBGA 4FQQB 3RHWF 4H8WC 4F7PB 3SDXE 3JUYA 4IS6A 4KI5C 2ZKHH 3ARED 1IAMA 3DVNA 5DURD 2PYFB 3X17A 3FQUB 2GSIA 4NN6B 4G6FB 5LJYH 1OB1A 1T3FA 4HUVB 3MV7A 1XZ0B 4QRPD 5E2WH 1RHFA 4U6YB 4ZUVA 4L3EA 1UZ8A 2GI7A 4FQLH 3AROA 3M45A 4OUUA 4MVBC 2OBGA 3BH8A 4HIIA 4RIRB 2V5MA 5TF1L 2R39A 4X6FA 3LEVH 3BMVA 4P2OB 4KKCC 5B38G 1YEHL 5JLZA 3NH7L 1KSRA 4JFDB 1J8HA 2FEDC 1P7QA 2GITB 4RMQA 4LVNC 5TE6H 3S96B 3R06A 2DLTA 1XGRB 25C8H 2AJUL 2VN7A 1QRND 4C57C 3DNKA 3KLHD 1QNZL 2P8LB 3HAEG 4AEHH 1C16B 1CN4A 4MS8C 4LCUB 2VKXA 1ED3A 2NW2B 3UBXI 4MA3B 1AR2A 1U93B 4IRSB 4OIAA 3EYVA 3PABB 5HGAB 3R4DA 3C8HA 4HCRL 2VDML 2QQKH 3PHQB 2FBOJ 4X9HA 3TBWB 1S3KH 4ODWB 2XNAA 4HQQL 5D2NA 1QEWB 4PD4K 5CEYB 5T5NF 4OKVA 3CDFA 2YPLB 5I6XB 5J7CC 3VWJB 4PS4L 3S3JA 4I8DA 3X11A 4ZFFA 4IMKC 3EYOA 5E4EC 3Q2CA 3MJ8A 1OQXA 1U8QA 2Q7NA 3T2QA 4NGHL 3T77B 1CCZA 2YPKB 4L4TA 1DJSA 3SQOL 5EOCL 4XMPL 3GHEH 2H2PD 3P4OB 1X5AA 4JR9L 2VDNL 2DICA 4UNUA 3NN8A 1M05A 1R3LB 4N0FB 5TGBB 1KJ2L 4O2CA 4QWWC 1BVZA 3I84A 4PRHE 3GB7B 4GW1B 4FZ8L 3QUML 5F7UA 2XTJB 3L6FB 1BJMA 4OZHB 2VDPH 4LNRA 4O2FA 35C8L 5BS0E 4WFHD 1D5ZB 3WHE1 1A6TB 1P5VA 1LDSA 2AEWA 1FZOA 4K9EL 1GZPA 1XGUA 4OSUH 3C5ZA 5E1AB 5FV2A 5JOFB 4Z78A 1H3PH 1S5HB 2IH3A 4Y5YC 1TQCB 2VXUL 3S3SA 4E42A 4J3TA 5GS0L 2EICA 3MUGB 4WIQA 1KIUA 1MWAL 4O5LL 4Z7NF 1B2WL 4R2GC 4IM8A 3P11L 1FFNB 4ZUUA 3U2SA 4FXKA 3ZYOA 2AEIT 4P5KB 3L5IA 3FRPA 3MROB 3QUZC 3SO3B 1JGUH 4U6VH 2VYRE 1IAIM 4P46B 3U4BL 5ID0A 2VDKL 4H1LH 5BZDB 4MQXC 3ARBD 1IC5H 4WI4A 4F2MB 3BP5A 4LSDA 4OCMC 1J10A 3WBDA 3CMOH 1P6FA 2XZQH 3BD4A 4UIMB 4NO5A 2B2XL 2GJ6B 2BSTA 5IW3A 2F54E 2QQLH 3L3OA 3BPCA 3GMQB 5LVEA 2PO6A 1OAKL 2BY1A 2LE9A 4D9LL 3QUYB 4MAYA 4U1NA 1MCOH 2F5BH 1IARB 5EU3B 3FZUD 3U46B 4BELD 5EZIL 3QIWA 3P4MB 4JVUA 5EZOH 5KVEL 1AO7A 1MVUB 4TVPL 3MC0A 1RUPH 5GJSL 4PV8A 4QCIB 3NZ8A 1WSST 3CU1A 1RSFA 2NLJA 4XP6H 1FO0A 3GSNA 1GRWA 1F3RB 2HH0H 5FOBB 4K3DL 3TM6A 2WP3O 2VUYA 5D2LA 4X9FA 4IRJA 1IC7L 4P2QD 5EA0L 1VB9A 1UH2A 1CFNA 4JZOB 1BWWA 4ZXBC 2GUOB 4LQFL 1Q94A 3MSPA 2NZIA 4XTRD 1DZBA 2YA0A 3TYFB 1SMOA 1CGVA 1NGZB 3IU3A 1G6RL 3PQYE 2ZCLL 4LL9A 1ORQA 5FUCE 4QHLB 5GS0D 4IRZL 2R0WL 4WFEE 4XPFL 4JHAH 3GSVB 4QOKE 5B22A 5KN5B 4OCNC 5JIHA 3RTQC 3RWIA 5F3HA 1CICA 2B1HH 4QXUL 3UTTA 4NO0A 1S9XB 3IDGB 3SGKA 3WJLC 2CGRL 1Q72H 4LAQH 3RQ3A 1GGYA 1BAFL 4KMTH 3VCLA 1EZVY 4JO2L 3W11C 3LY6A 2QADC 1MCHA 3GKWH 1SYVA 1ZEAL 4J3OC 2J4WH 5JPNA 4F58H 1XH3B 5F89A 4KTDH 2AJ3B 5KG9A 4NIKB 2DQUL 1WK0A 4LLMA 4W81A 1KC5L 1FLTX 2CIKA 3QZWB 2UY7A 5E1HB 3Q6GH 3BP4B 4Y4HC 3H9SD 4X6BB 5ISZA 1G7MB 4MNGE 4NQTA 5IB4A 2A0LD 4JFEB 4OF8A 3HCVA 3S5LA 4ODTH 4JY6A 4MQ7A 5FDWB 1IZJA 1ZGLB 1N2RB 1UKTA 4M6MH 2GK0B 5JUEH 1R0AH 3H9ZA 2BX5A 3CAFA 3DX6A 1GC1H 2X7LA 4K7FA 1DBBL 5DD5H 1IGIL 2EDRA 3RY6A 3ZTNL 4MZ2A 1CE6A 3QWOB 4NHUA 4WTZA 5MENB 1CR9L 1X4YA 3DURA 3PWPA 5J3HD 3MLVH 3QDMA 2XFXB 5EN2B 3U48A 1CGYA 1U3HA 3M17B 1PEZA 3UZQA 1ZK9A 2IGFH 4G5ZL 4NNXB 5E2UH 3VFUB 4NDMB 5DQJA 1XMWA 1IGYA 4L8DB 3T0EA 4KRPB 2A77L 2XICA 2BNQE 5C6PB 3VI4E 3CFJA 5KJRL 4P9ML 3ESUF 2BRRL 3DPBA 2MHAB 4YIQB 1YECH 3FQTB 1LK3L 4JRXE 3TWCL 5CEXB 4LGRB 4BUHA 4X4YB 1NGQH 3MV8A 3OKMA 1J5OL 4OFKA 2W9EL 3IDJA 1FL3A 4MD0B 3QI9D 4OCXH 1RUMH 1ERNA 4YK4B 5C0EA 1F90H 4JO1L 1ZSDA 2NMSA 1CGTA 3NACH 2ESVA 1TZGH 3TGXA 1YPZE 4P5MB 3VXSA 1FCCA 1WWCA 3RY5A 1IC1A 2A1WL 1NFIA 4GXVL 3HMXA 4R96A 5FHAH 3PV7A 3REWA 3RA7L 4M1GL 4U1KB 5HJ3A 4C83B 4PJGE 1XGTB 3SDXB 5CJXA 1LDPH 1X5IA 5D96B 1A64A 5I71C 1U2CA 4JN2B 5GRUH 4UT7L 3FB7A 2R4SL 5CILH 5C3LD 5CAYB 5DZNA 1IQWH 1VADB 1YNLH 4X0KB 2XWBA 4R0LA 5D2NC 1BD2A 4JFPB 2X4QB 2XZAL 4XMKL 5GGSY 4M5YL 3TP4A 1HYSD 2ZJSL 1NJ9A 2OMBA 1L6XA 2VH5H 4P4RA 5T5FH 4PJEB 4BK4A 5GZNC 2HVKB 3GSOA 3X3GL 3VU2A 1I3RB 2DQCL 4APQD 3VFNA 1UM4H 3HPLB 4HUWA 5BZWA 3CZJA 4H20H 4HAFA 5LGJB 3GNMH 4JM2F 3TN0B 5T3XE 1P9MA 5J1AA 4XNYH 5JW3L 4DQOH 3BQUA 4L4VA 4CUCA 1AE6L 5SWSE 2YUWA 3MLUL 3G5ZA 5C0AA 5LWYL 5DURB 3ARGD 4ZFZA 4K55A 3MLTA 3SDYL 4KK5D 1QLEL 3PV6B 2YEZA 1ZLSH 1A6UH 3ZDZF 2QQNL 1JE6A 3QCTL 3AAZA 4MD5A 1TJIH 2V9TA 2ADFL 2NY5C 3HE6B 5T1KD 1GGBL 3LZFH 3MO1A 5I73C 4OLUL 3C5ZC 4OCSH 1N8ZA 5D7IA 4KVCH 3MQIA 5AYUL 3V6OA 5K9OB 2BSRB 1ONQB 2CDGB 1G6RA 2XV6B 1R5WB 1V7MH 1XAUA 2ZSVA 5AD0A 4RGNC 4YAQA 4XC1H 3P0VH 2PXYA 2YRLA 2DQGL 4NO2B 4FFYH 3HG1B 4Y1AA 3WLWD 5KOVC 3UBXA 4BYHA 2ZUVA 1LP9B 2E8ZA 1IBGH 4G3YL 2W91A 1NAMA 2FD6H 2DQFA 2NY4C 5E8PB 5DRXA 5F70A 1GAFL 3C6LB 5DS8B 3CIQA 2C3GA 4HK3N 2ED9A 5F7FA 5GGTL 1EAJA 1VKXB 3CCHA 5CIPB 1FNAA 3EO1A 2ICWB 4K23H 3O6FD 4UMGA 3MBEB 3H2WA 5E6IB 3M8OL 3MRHA 1WBXA 5F44A 1URLA 3I02B 4F15C 4OD3H 4PJAB 3WKNA 2E9IA 2VZSA 2FATL 3KGRA 3KYMA 4GG6A 1I8MB 1IAOB 1MCDA 2PO6C 3HA0A 4U1MA 4HS3B 3OKOB 3HLAB 4MAYC 4HIXL 1YNTA 5FF6A 2CK0L 5HYJE 5I1JH 4PJIF 3CSPA 2X40A 4XP1H 5E00A 1J88A 5DQDH 1MREL 1U8LA 1EXUA 2A74A 3BZDA 3QIWC 3L5WB 3DXAE 4X83A 4M5ZH 3DECA 3INUL 1MH5A 1G84A 3Q48A 1KCRH 1QSED 2RQ8A 4C4KT 5E8NB 1R3IH 5J56B 4Q0XH 5GJTL 3UC0H 1NBVL 3NCJL 3B6SB 4G43B 3W5MA 1DLFH 1JTPA 1UWXK 3ARWA 4MCYA 1ZS8A 1EFXB 3SJVE 4G6AD 4IRJC 3ZKSD 4KTYA 1BQLH 3NIGE 1PKOA 1IM9A 1CLYH 1ZLWH 2X4OA 3M1BA 3TT1L 5ESQA 1I4FA 1Q1JH 4Z18A 5KAQG 4UV7H 2XIDA 4EDXA 3LKOA 1JF5A 4LBEB 5FGBA 1GPOL 4ONFH 4Y5VA 1RFDL 1FFOB 1KYOJ 3NPZB 3VMPA 4G7YH 2NY1C 5E9DE 5C09D 3BKYL 1QACA 4B7LA 5ITBL 5EUKA 4LRNL 4WHTB 1DVFD 3EDDA 3DX7B 1CICC 3OAZH 4DTGH 2CO6B 2PW1A 2VZVA 2IAMA 3MRFB 4LHJB 5JO5B 2DIAA 1DE4B 1FHGA 4L29A 5FFLA 4G8EA 3SGKC 4JE4B 5JMOC 2VN4A 5C8JA 3T0DA 5INDA 1J0YA 3D18A 4L9LB 3G5VB 4P2RD 4GLRH 1JZ8A 4C56D 2FEEI 5DJXA 4WO4A 4WNQA 1KTLA 2WUBH 3BJ91 3D2UD 2NY0C 4OCYL 3VD7A 3O6KL 3SDCA 1IGML 4HIEA 1RY7B 4KQ3H 2Y07H 3F5WB 5D8JL 5I1IL 5I9QB 4XAWL 4J3UA 3KHQA 5HI5D 3WHE0 2AEQL 1NLDH 1MHPH 2FL5B 3K7UA 4TRPH 3CFEB 1MLBA 4JM2D 2M2DA 4Z7VF 5F8RC 4P2YA 5DVOA 4XVSL 1U8JA 2BSED 1NCWL 5I8CA 2FH6A 2DF3A 5BVPL 5E8DL 5F9OL 5AZ2H 4RAHA 1J9CT 1UXWB 4PGBB 4QYOA 1FJ1B 4HX1B 4QOKB 1WFNA 2DLGA 3OHXA 4QHUA 1E4JA 1P84J 4CVZA 3DYMA 1AD0B 1CD9B 4GSDL 3RY6C 1OT1A 3ISWA 1EEUA 2Q3ZA 4HWNA 4F7TA 5IOPA 3VH8A 1NGWB 5FKAA 5J4MA 2DD8H 4KJYB 1U3HC 4G42B 5DMIL 1A7NH 4XP4H 4JZNA 3DMMA 1WFOA 2MCPL 4J6RH 3SEPA 4EI5A 2ZSWB 1Q9OA 4PJCE 1CF8H 3RVXD 3FFDA 3W2DH 3CDGB 3T0EC 4P23D 1Q0YH 4QRSA 4AMKH 1CU4L 2QHLA 4NC1E 2VLKA 3EJZD 3EJYC 4KV5E 4NM4L 1I1YA 1E6JL 1DN0A 5KS9B 2XWTB 4W6XB 4CU8A 2V2TA 5C0JA 2IBGA 4MJIE 2ZKHL 4FFVC 2ILLA 4R7NA 3O9WB 5T3XH 4YUEL 3BOVA 4LKCB 1CD1B 4BSVA 1RHHA 4XMLL 1FG2A 5JZ7C 4NHCH 1ZT7A 4OF5A 2EYSB 1G1CA 1CLOH 2J12B 1YNKH 4FQLL 3DV6A 4WUUD 3MZGB 3CFDA 1WZLA 4OGYL 4PJDA 1XF5B 1Y6MR 5EO9B 4JHBA 3LEVL 5M7QA 3P30H 5FYKE 3X13A 4ZTPL 3QDHA 4NQXA 1HXYB 5E5MB 5E7FA 4DZBB 3O2VH 2XY2A 1J18A 1S7TA 1LE5A 4ELME 5AZEH 5CJXC 3WNPA 3C6SB 2JLLA 5GGTA 1WF5A 2ZNXA 5AAMA 5TE6L 1EHLH 3S4SA 4ODSL 2W1NA 3HB3D 4QXTB 1FH5H 3ARQA 3O4LD 5C0BA 3DO7B 4M7JL 4M6OL 4JO4H 1BQHG 3KPRE 1CXLA 4LGSB 1F45A 2SEBA 2W65B 1AKJB 2VLME 4AEHL 5F8QC 4IDJH 4NQED 4XCEB 3EGSA 1F6AA 1MRDL 3RUGE 2D03L 4YPGA 4FZEL 3NGBB 2NXYD 1PDKA 3QDGB 3MODH 3VI3F 2WMPA 4KKNA 1WCBA 2HMID 4ORZC 2EDFA 5JXAL 3I50H 3U7YH 1UWEL 1BVKB 2AJVL 1P9MC 2X42A 1I7RA 3O8XD 3UYOD 2QQKL 3H7BB 4JVPA 1QBLL 4Y16D 1S3KL 3RGVD 1JBJA 3UAJC 3GMRB 1TETL 3OXRA 2R0KL 4R4ND 3BI9X 3MR9A 5TF0A 1WZ1L 5E8EB 3FT4A 5E95B 5BVJA 4ODUA 4OZFB 4HV8A 2EO1A 2FEEL 4L8CB 1DBKH 1SJHA 3LKQA 4NRXB 3QHTC 3GMMB 2LAGB 2PR4H 5D7KD 1EMTL 5F7EH 5F6IB 1TDQA 3ZKXB 3V6OC 2PYFA 5C9KA 3FQUA 1ZAGA 1CI5A 2WM0A 1L7TH 4HJ0C 2VB5A 2PXYC 3GHEL 5ERWB 1M1SA 2MKWA 1EHNA 2YBRB 1VDGA 4NC2B 4PJ9B 5IMKB 1JTTA 4G8GD 1X3DA 1RU9H 3U9UA 4RFOL 5HHOB 5I74B 1Q38A 1A1MA 2QHRH 2VDPL 3IETB 3QI9B 2DIJA 3PIQA 4JFDA 3SGDH 5AYQA 4LCCA 1K8DB 4OSUL 4DKEH 3B5HA 1H3PL 2GITA 1KGCE 3GSRB 4OV6F 3D0LA 4RNRB 1DEEB 3S96A 1PZ5A 3TBVB 2VQ1B 2R1WB 1XGRA 2NY3C 3BDYL 1C5CH 1LEKB 2CO7B 4GQPH 5F6HI 1IRAY 4JFOB 1KF9B 5KTEH 5SWSB 5F1KC 1C16A 1PSKH 2V7NA 5IK3B 1HQ4B 4YDKH 5CMAB 6CGTA 2FWOB 3QFDA 5D70L 2YPVH 2COQA 1NBZB 1OSZB 1JGUL 4U6VL 2Z35B 2HJFB 4MA3A 3DSFL 1NMBH 3SDXF 4IRSA 4O58H 4A6YB 1ES0A 1NANI 1IC5L 5DO2D 5F6HJ 4LSUH 4MXVE 3CMOL 5ACMA 3UJIL 2XZQL 3PHQA 1IT9L 3BHBA 1NGYB 3TBWA 5GIRB 4ODWA 3RKDC 1H5BA 4Z7WE 3MUHL 1QEWA 5CEYA 2QQLL 2ICWI 4WY7L 4XP5H 5DWUH 3NMEA 3NBNA 2YPLA 3IKCB 5IMMB 3QPQC 4FTVB 2Y7QA 2DLIA 3VWJA 3V6ZB 3RKPA 1MCOL 5DSCB 2F5BL 3HI1B 4ZUTB 1K6QH 1MI5B 4MXQD 4FQXD 3LB6C 4QHMA 2FYYB 5EZOL 4PJXF 2YPKA 5F1OB 5L9DH 4QEGA 5DJ0B 1RUPL 4WI6A 4UDUB 1OQOA 3S97C 1MLCB 4PRNB 4D94A 2P42B 2HH0L 3NPSC 3WD5H 4CMHB 1RZJH 5EU6D 5FM4A 3GB7A 1T1XB 5DJ2B 4L3AA 3L6FA 5HHQB 2CDFB 2IAMC 2LTQB 1YYMH 1D5ZA 5DHXB 4OZ4A 4JFFD 5E1AA 5EFIA 2J8UB 1A5FH 2JE8A 5JOFA 5A43C 1C7SA 5LQBH 1CDCA 5K9KA 1WISA 3MCKA 3RPIA 4WO4C 4XB8A 1DLHB 1W0WA 5MEQA 1JPTL 2RR3A 3QXAA 4D0CB 4JHAL 3SE4A 3WE6B 3ZMRA 1HK6A 3UTSD 1X5GA 1A7RH 1KLGB 2H26B 3UXFA 1ZTXL 3SJVB 4NRYB 4YBLB 3W5NA 2V5RA 4GG8B 5F96H 2Q8BL 4P3DB 3MROA 2B1HL 1M4KA 4JRYE 4LSPH 4P46A 1LD9A 4TSCH 4XBEL 3STLA 2AK4D 1FAKT 4KROD 3TVMD 1QR1A 1Q72L 4KPHL 4LAQL 5BZDA 4KMTL 1Q9WB 3ZSTA 5JA8B 1AQKH 3IGAB 4DUXA 1Z0NA 1QSFB 3GKWL 2J4WL 4J3WA 4F58L 3NCYS 5D7JB 5DR5H 1MUJA 4KTDL 5ESAB 2EDWA 5FYJU 1FORH 3GMQA 3QYCA 1LE9A 1CFSB 5FYKH 5KOMC 1JGDB 3QUYA 1ZKAA 3BUTA 2OZ4L 4URTB 2AGJL 3VXUE 5EU3A 3CXHJ 2FECL 2GCYA 5DI8B 3U46A 3U0TA 2UZYB 3P4MA 4NN5B 5IB1A 4ODTL 5GS1A 1MVUA 3OJVC 4JEGB 1A14H 3DMMC 5K93A 3V8CA 1M7DB 3WL9A 4YFDB 2D31B 4RMVA 4EI5C 4FQJH 5D7LA 2DTSA 4ETQB 3GSUB 3HE7B 5FOBA 5JUEL 4WWKD 1R0AL 2FX9H 2GTWB 5CWSA 4OLWH 4EUPA 3RRQA 1GC1L 3TFKD 5I75B 1HYRC 5DD5L 2C3VB 2Z0BA 2C3WA 3BSZH 5HYQB 1J0JA 1KFAH 1DQMH 4POZD 1NMAH 4G9FA 4KTEH 5C0CD 3S8WA 4QHLA 4IJ3C 1ZE3C 2A6IA 4R8WL 1JZ6A 1T0NB 3JV6B 2IGFL 5E2UL 3AVEA 3KS0J 1C5BL 1FZMB 2ZP0T 4LEOA 4AM0B 1LO5B 3TCLA 4TTGA 1RVFH 5KN5A 2FHBA 2KPNA 5IEKB 3P0GB 4KKAD 1P53A 1MHEA 2G5BB 1S9XA 4X8JB 1ZHLA 1Y0LA 4HEME 4NWUH 2QQQA 3GM8A 5AUMA 4YR6A 3BKMH 3QWRA 5DC9B 1N4XH 4WJ5A 2Q86B 1RUML 4KJWC 3O0RH 2OL3A 4D3CH 1F90L 1LVEA 2QL1A 3AU1A 4OI7A 1XH3A 5LXGL 1CYGA 2AJ3A 3EOBB 1TZGL 1AP2B 2X1XR 2RJMA 3W0WE 1P7KB 1G9NC 2NPLX 4DAGH 4XCNA 3TO4D 2D7MA 1MAJA 3ZDXE 4OFVA 3QZWA 1T2XA 5A16B 5J89A 2WUCH 1G7MA 2NR6D 4KK9C 4KH2A 1XT5A 4GRLD 1LDPL 4ISVB 4OB5H 5ESVB 4JFEA 4RRPG 2Z8VC 5GRUL 2DM4A 3J7HA 4PJBE 1OAUL 2NXZB 1S78C 2H9GA 5CILL 1X5KA 5FDWA 4LSRH 3FT2B 1IQWL 1F6LL 3PHSA 4NQCE 4E41B 4RMWA 3KDMB 2GFBA 2F53E 4JY5H 2YRPA 2J6EL 4Z7UB 1QYGH 4LF3B 4CMMB 4QTHB 3QO1B 2YD5A 2BVTA 4A2MA 2VH5L 5T5FL 1FYHB 1AGDA 1XR8A 4N9GA 4I48B 4QXGL 5MENA 4EVNA 5HBBA 1UM4L 3F7VB 2EZ0D 4H20L 3GNML 4NN6C 5EN2A 3DUHA 2AQ1A 2NX5B 2G60H 3EOTH 1OP9A 1YMMA 1R24B 2C4XA 3ZTJH 5I1GH 4XNYL 1UM6H 5EBMB 4DQOL 3FHQA 4U1LA 4NNXA 3BO8B 4J1UA 3VFUA 4PTUB 1N6UA 3GJFB 1TZHB 1BFVH 1TVBB 3RWCB 4WW2F 4U6XB 4GBXB 1ZVYA 2H41A 4GS7B 3R0MA 1ZLSL 1A6UL 5DEZA 1A22B 2EYRB 4RQQB 3MLZL 4TUKH 4WI2A 4K94H 3LZFL 3ET9F 4OCSL 5CEXA 5EUOE 4KVCL 4FQIH 4JZJA 4X4YA 1PG7H 3D9AH 3QIUB 3DI3B 4PRIB 4TSBH 1HOCB 2CQVA 4Q2ZA 2V2XA 4XNQB 3ZKQD 4P9HH 4FFYL 2JCCA 3LMJL 5IHBA 2HKFL 3K8MA 4PRHD 1IBGL 1J05B 2BNUB 2FD6L 3LKRB 2XXMB 5C08B 2XACC 5SWZE 3Q1SH 5BS0D 1RUQL 3O4LB 2HRPH 3CNKA 4U1KA 4IRSC 1XGTA 1IAKA 4FP8H 1U92B 4OFDA 5J0BA 4EBQH 3L3HA 2E7HA 4NQEB 4XPBL 2VXSH 2BNRB 3MJ9A 4LLVB 1W0YT 4OLXL 4QRRA 3GSXB 4X0KA 4AL8H 1H5BC 1WIOA 4OD3L 1V3JA 2WAHA 2MWCA 2X4QA 3REVA 3EFFA 1IE5A 1ORSA 5I6XC 4DOHB 1H0DB 4N9OB 1VFBA 3VWJC 1KNOB 3THMH 3VI4F 5T3ZE 1B90A 4U7KA 4XP1L 5DQDL 5HSFA 2HA1A 2HVKA 3STZA 4NQDD 5DT1H 3HPLA 4AH2B 1HIML 4NCC2 2HN7A 1J1XH 1TLKA 3GBMH 5E2TH 5DD6B 1KCRL 3GMLB 3K80A 3KYKH 1MCKA 2WQRA 3UC0L 2F54D 2RHEA 1OAXH 2XWJB 1ZLVH 2HT3C 1CGSH 2D7TH 4KQ4H 4YX2L 3LN5B 3EYFB 2R0LH 2FJGB 1M6OB 1K5NB 1YPZF 3AREA 1ULVA 1CZ8L 1SEQH 2XTJC 1BFOB 1FG9C 3K4DA 3HE6A 2YC1A 5HYSG 4N1HB 3G04B 1Q1JL 4PJGF 3BPOB 4UV7L 4G8GB 4L8SB 4N0RA 4GRMA 4ONFL 1ONQA 3A0OA 1TQCC 2D9CA 4G7YL 3HG1A 3BD5A 1G7JA 2DDQH 3SE4C 2DOCA 3JWDH 4PJ7E 4Z7WB 1LP9A 2ZOLB 2V5YA 5E8PA 3DVFA 5HVHC 4DTGL 3BYTA 1WZMA 3IXAA 4KI5E 5DS8A 4P46C 4NKDA 1R6VA 3QULA 4L8BB 1VKXA 3RVVD 5HI3C 5CIPA 4PLNC 4LLQA 3AY4A 3W9DA 1QLRB 4AENB 1TQBB 3V0VA 2F8OA 4D0DB 1TXKA 4LVOB 2VR5A 3VGDA 3FTGB 2PN5A 2R1XB 3B9EA 4G9DB 1KT2A 4M7LT 4PJAA 5B3NA 1I8MA 1KB5H 4I18B 4OIBA 2D9QB 2Y07L 1VACA 4HS3A 4Z0XA 3QUYC 4POUB 4MA1B 3PGFL 2XN9D 1JNHA 4O4YL 4CVWA 3T04D 5IESH 1B6DA 1DQLH 1MHPL 4PLKC 3UX9B 3L5WA 5GS1C 2HWZH 4BSWB 4EXKA 4PG2A 1HQRA 2Y4SA 4QHNB 3CLEH 2Z92A 1FAIH 3L3JB 3PDGA 3BRGC 1RZ7H 4NKMA 4CNIA 1WTGT 4H5SB 4M8VA 4KZEH 3LEXA 1EFXA 2R2BA 4XVJH 3IS0X 2J6EA 1P7HL 4UQ2B 1OGAB 1S7XB 1K4CB 2IWGA 4UINH 2JIXD 4UOW1 2JF1A 3D39E 3G5YB 2DWDB 4JDZA 4O02H 5BRZD 2DD8L 4LBEA 4I4WA 4Z77A 5EU6B 1A7NL 5IVZB 1CXIA 3PJSB 4JHZA 4J6RL 4Z5RA 2E7BA 1FCGA 4N1CA 1CF8L 1I1CA 3QEUA 4LDOB 1XF2B 2LU4A 4JFYB 4X4XA 3LQAC 4N0UE 3DX7A 1AXTH 2ADGA 4YDLB 2R23B 3BEWA 1DQQA 3MRFA 1DE4A 1T0MA 1WITA 3PNWB 3SN6N 1HN1A 5JORA 4AEIH 3MRIB 3HN3A 1V3KA 4JN1H 4NFCA 4HFUH 4I2XB 2YSSA 1I3VA 4NHCL 3JV5A 4OD1H 4CRPA 2FLBT 3Q5OA 1PW3A 4YHML 1CLOL 1T5WA 1HHJB 4NC0B 1YNKL 3MYJB 2BNQD 4PB9H 1NUFA 3HS0B 3QXWA 3BUYB 3TF7C 3ARBA 3F5WA 4HMDA 1HCFX 1NC4B 3P30L 1JP5A 3NIGF 2YD8A 4JRXD 1H3WM 5AZEL 3CFEA 5ACZB 4O2EA 1CTNA 5JXED 4KFZC 2L0DA 4HGKC 2P24A 3GJEA 4LDLB 4YEFA 1ZXQA 4P5TD 3TO2B 2IFGA 4JO4L 5DHVH 5I30H 3I75B 1G9MH 1R3KB 1T4KA 4IDJL 3BKJH 1NUNB 4PGBA 3WSQL 1FJ1A 3WNLA 2AS5M 5DEFB 5DLMH 1CXHA 1XGPB 5FO8A 3ARPA 3MODL 4FOMA 4X6CE 3KWWB 1TCMA 3U7YL 1D5XB 4ZPVA 2P7TB 1L9MA 2V7HB 5LBSH 5JHDD 2H6PB 2MFNA 3QFJD 3VXPB 2EXWD 4GRWE 4KRPC 3G5XB 5CGMA 4M7ZB 3W0WB 5T3ZH 2APWA 1V8HA 3E3QC 3BFOA 2ADIB 2KZ1B 2P43B 5L8KB 5LGKA 5DFWH 2XWTA 1DBKL 2DKMA 1U8OA 1FNGB 2E7CA 4JKKA 4ERSH 4U1IB 5T3XD 3N1MC 5IB2A 1CD1A 1VPOH 1YEKH 1L7TL 2Q20A 1F2XK 2DJSA 4BFEA 3QB7C 3QO0B 4FMKA 4HEPG 4I0PD 4YK4C 1KIQB 2EEDA 2I24N 3TZVD 2IG2H 2OTUB 2CK2A 4PR5A 1RU9L 4PY8J 4K7PY 3VD9A 3NA4A 3U30B 4ONHB 2CLVB 2UYLA 2Y25A 3D87B 3ZHDA 2OMNA 2QHRL 3CPLB 1N6VA 2HT2C 4DZBA 3K2MC 4LPUA 1KEMH 1CT8B 1MJ8H 2A2QT 5AG8A 2AP2A 4DKEL 3C6SA 2ITCB 1H3XA 2NZ9D 4M48H 2WIIA 2AXFB 3VFPA 1C5CL 2HFEB 5C0DB 4PJCF 2HTLD 3JWOC 1WBYB 4HKZA 3H9SA 2D7OA 2W60A 2CRZA 1PSKL 4XCEA 4YDKL 4GRLB 3OKLB 1WAAA 4H8WH 1X5YA 3B2VL 1QA9A 3U0WH 1NEUA 3PP4H 4KV5F 3I6KB 3D1MC 3QDGA 4NFDA 2UWEE 2QR0A 4K3EH 4ZG1A 3BZEA 4O58L 4K2UH 3B3IA 4PJFB 3GIZH 2WBWB 4LSUL 1IZKA 1BIIA 5A2JH 4N0YH 2WBJB 1FVCA 2IANE 3DRQB 3ARFB 4XP5L 3V5DB 5E8EA 3AREC 5FECB 3G6JB 4U6HB 4OZFA 3KLDA 3ARRA 3H42H 4LLWB 3HE6C 2VRAA 3ULUD 3DXAD 4HUUB 5GS2H 4ELMF 3VXRE 3SHSA 1HH6B 3UTPE 1QVOB 5L9DL 4OFPA 5L2JB 5I2IA 2X4RA 4PRDB 5FM5M 3P4LA 4NQSB 4XBPA 5ERWA 4V2BA 1ZT4A 2GSGB 2VR9A 2YBRA 4ZSOB 4F33B 3KNBB 5IMKA 1J0KA 4MGXA 3CLFH 3WD5L 4ZS6D 1RZJL 3RUGF 1JGLH 4NJ9L 4ZFGH 3H3PH 1FC1A 5DEGB 3C6LC 3IETA 3QI9A 5DVNA 4KDWA 3QR2A 4LP4A 1GIGL 2YN5A 3TBSB 4LNVA 1A5FL 3MV7E 3VXME 5H37G 1FQ9C 3GSRA 3AY4C 1DEEA 3HZYB 3Q6FB 1VEPA 3P9MB 3MBEC 4L3EE 2YD4A 2P8MB 5E9DD 2VLRB 1OP5H 4Y19B 1A7RL 1QPPA 1P2CB 5BOPA 5CMAA 1ZA6B 3W9EB 1AD9A 1EGJH 1ZWIB 2QEJA 4OT1H 2VDLL 5CLWA 1U6AH 2YUZA 1J8HE 1DEDA 2O5YH 4HJJH 4LSPL 5CZXD 3DVGA 3QDAA 4AZ8A 4PRPB 1E6OL 4A6YA 3MBXH 4M4PA 4PG2C 3TPUB 3PWVB 1TTUA 2WWKO 1BJ8A 1NKRA 2EDQA 3SDDB 1MFBH 2FSEB 1NGYA 5GIRA 1KIRB 1QG3A 5DR5L 2OR9H 1FORL 4PGCB 4APQA 4HPYL 4NQDB 5IM7B 1JI2A 3QHFH 3MLSH 1E28A 1Z6JT 2GTZA 3SKMB 4YXHH 5H37H 4LSSH 1BZQK 4W4NA 1ZVSB 1H9VA 3UCRA 5TDNB 4KHTH 3V4VH 3QQ9C 4UDUA 5FIEA 5D2NE 1A14L 3ARGA 4BZ1H 4YXKH 4UT9L 2JTDA 3MNVB 3B9AA 4L5FH 4PRNA 4XPGH 4LPYA 4HIJB 3MX0A 1YEGL 4XPHH 5EPMA 3BT2H 4YQXH 2QKIB 3ZT7A 5DD0H 1KBGH 2BHZA 5DDHA 1I9JH 1NAKH 2H32B 4L4TE 3SBWA 3KPOB 1DQML 3UDWA 1AXSB 3HFMH 1NMAL 4KTEL 3L95B 4MXVF 1G7HB 3RZCB 3O3DB 4U31A 4DK3A 1CGWA 1DLHA 4YLQT 5KANG 5JW5B 2NW3B 3RU8H 4WI7A 3I6GA 4GRWH 5AEAA 4D0CA 4Z7WF 4Z95H 3WE6A 3CMGA 5FKPB 2WWMD 1M71B 4RISH 1KLGA 2H26A 5EBWA 1RVFL 3ARBC 2ZCKH 2DBJA 1RAMA 2FR4B 5I9QC 2C9AA 3RVUD 3VFGL 4GG8A 4YFLF 3D3VD 3O6FA 3CDYA 4MJID 4HKBB 4LASL 5EWIH 1LK2B 5HHVH 2PW2A 1Q9WA 4RGNE 3BKML 2V5SA 3IGAA 3VJ6A 3LKNA 4Y4FD 4BUGA 2X89A 2DQTH 3O0RL 1MCJA 5HDOA 4D3CL 4LRIA 3MMEA 1I8KA 1TNMA 1HINH 2ADJA 5ESAA 4LPWA 1KTRL 1LO3H 4DAGL 5FYKD 5JQHC 1Y18B 3PF2A 4HPOH 5GGSB 5DI8A 2G75A 4JQXA 1KTKE 3DX8A 1GZQB 1BOGA 3T1FA 4NUGL 1L0YA 3B2UD 2CDEB 3SQBA 1M7DA 3KPRD 4NYLB 5GXBB 1HWHB 2VLMD 3HPJA 3EAKA 4ETQA 3GSUA 3HE7A 3QDJE 3LHPH 3WHXB 1QYGL 5BRZB 1NCNA 2Q7YB 5TDPB 5I8OH 2P5EE 3P3YA 4BQ8A 3JWNC 4EQ2A 3QQ4B 3NCYP 4WU7B 5EZJB 4AEEA 4WU5B 4JAMB 4GH7B 5C0GA 1AO7E 4X6EB 5C09A 4NPYA 5F9JA 5CJQL 3O9WC 5DD3H 3I6LE 5K59E 4R9HA 5H2BB 3TNMB 2G60L 1T0NA 3JV6A 3IT8D 1DVFA 2YA1A 1UG9A 1FPTH 3HC0B 4LK4A 5CP3A 2VLLB 5D2LE 4R2GB 1N3NA 1BFVL 5DZOA 2BFVH 3WO4C 5TQ2H 4XWOC 4AM0A 3HR5B 4M1CC 1QFPA 3KXFD 3QUZB 5DGQA 5IEKA 1QSZA 2P5WD 4PRBA 2A38A 1T7ZA 4TUKL 5CJ8A 4K94L 3D2UA 1HHKB 1CS6A 3C9NB 4FQIL 1PG7L 3D9AL 1WJ3A 1RULH 2PKDA 4LHUB 1EK3A 2Q86A 2EKSB 2PF6A 3FOMB 1JUFB 5HHXH 4UQ3B 4P9HL 1AP2A 4MCZB 3BP6B 2A0LC 1P7KA 4HHAB 3WFZA 4NN7B 1DUZA 3Q1SL 4KC3B 1MCEA 3FB8A 3P9LA 4HWUA 3QRGH 5DJ6B 5HXMA 3SPVA 4LCIL 1KGCD 5ESVA 4ISVA 2EH7L 4FP8L 5I76B 1IEBB 5ICXB 4EBQL 2KH2B 3MRPA 4HULB 1NBYB 1RZIB 3U36B 1ZGLM 5F7YC 1R3JB 3FT2A 4WGWB 3OGCB 3KPSE 2PYEB 1DBJH 1OT2A 2IF7A 4AL8L 3K8LA 1AGEB 1FSKB 43CAA 4E41A 1JWUA 3CUPA 3KDMA 1RZKC 3F12B 3WEXB 5GZOC 3VG9B 3THML 4UU9B 4CMMA 3VFVB 1I1AD 3QO1A 3SE9H 2DLFH 1EAPB 3QFJB 2WP3T 1EDQA 4I48A 5DRWB 5T33H 4KI1A 4RAUB 5F6IC 4O9HH 3EHBD 1G7LA 1Z5LA 5CD3B 1LQSR 2OS7A 2NX5A 1MCCA 4P23A 5E2TL 5SX5H 3H9YA 1R24A 3GKZA 3O45A 5FA4B 1BREA 2D7TL 4KQ4L 4FABL 3GJFA 1TZHA 2HLFC 3RWCA 4C55A 2R0LL 4XNXL 2NY2B 2RCSH 3RNKB 2AJSH 1SEQL 4ORGB 3CXHK 3ZDXF 2IADA 5I74C 2JJWA 3QI9C 3PWPE 4RQQA 2GJZA 2UVEA 3DETC 2NY6D 2WNGA 4XZUB 2N56A 4WUUA 4PJBF 5HHPB 3QIUA 1XCQA 4PJIA 4XPTH 3T0EE 4JREC 2DDQL 2VLJB 3JWDL 1EEYB 4LMQE 1J05A 3KPPA 5DJCB 5HGHB 3LKRA 1INQA 1HEZA 4P59L 3R1GH 2VDRH 3E6FA 3O4LA 2HJKA 5GGVY 3MV8E 3WIHA 1EV2E 2DKUA 3BVNB 1U92A 4NQEA 2BVYA 6FABL 3ILPB 3SKJH 2WINB 3IYLW 1XIWD 1OTSD 1KTDA 2AV7B 3GSXA 5ADOH 4JKLA 1UEMA 3ECBA 2OR7A 5B39G 2MPAH 3VXSE 1KB5L 4APQC 5I0DA 3JZ7A 2NY5H 1H15B 1KNOA 1A3QA 1TIUA 1F3DH 4X7TB 4JRYD 4F9PA 5IVXE 2YD9A 4WWID 5IESL 4IS6B 4ODHH 1DQLL 3RGVA 4Y16A 4RSVA 2GSIB 4NT6B 5EUOF 4AH2A 3CH8A 4PLOB 2HWZL 3DVIA 3FAXA 3ARGC 1HHHA 4KK5C 2EDXA 2FJHB 3GMLA 4ZUVB 1RJLA 4O51A 5DMGC 5EC2A 4B53A 1FAIL 4OUUB 1RZ7L 2VZTA 4CMHC 1WC7B 3CXDL 5FB8A 1AC0A 1YY9C 2LAAA 3EYFA 4X6FB 4KZEL 4MJ6A 1K5NA 5CGTA 3GSWB 4XVJL 5JLZB 1BFOA 2AQ2A 3VXUD 2LTQC 4PJHB 1NDGB 3MLRL 2JJVA 3SBWC 1P7QB 3WLWC 2WW8A 3G04A 3MRMB 3UDWC 3FB6A 4G8GA 4P3CL 4L8SA 4TVPE 4L4VE 2HLAA 1AFVH 1OVZA 3VFMB 5IW6B 3MUZ1 3V4UH 4YHNA 5C0AE 2O5ZL 1V7NH 3FFCD 1FL6B 1JWMA 3OGOE 3MLXH 1ED3B 5GQBA 5JDJA 4YBLC 1YJDC 1AXTL 3OAZK 3MZTA 3O6FC 5DK2A 3RVTD 3GI9H 5D7IE 1X4ZA 3V6OE 3MRQB 1GHFH 3RP1A 3O6MH 4L8BA 4AEIL 3OQ3B 4JN1L 1CD8A 4HFUL 2BVUA 2MCG1 3TCXA 4HUMB 1FO0H 1MQ8A 3GSNH 4Y1AE 1QLRA 1SBBA 4OD1L 2XXCB 4D0DA 4LRIC 4OKVB 2R69H 2R1XA 4JHWH 5I1LB 4HBQA 4G9DA 1FLRH 4I18A 4GW5B 4PTTB 3X11B 2WLZA 2FGWL 4QT5B 1OAYH 2BJMH 3DUUA 5IQ9A 3I3EA 1U8QB 5L88H 5HY9A 4NO3B 4MD4A 3QRFM 1CIDA 4L4TB 5MHSE 1TFHA 4JRWA 4JQXC 5B38A 1AXIB 5TPWL 1U8IA 3C8KA 4BSWA 1RUAH 4MAUL 3WLBA 4G6AC 1EIBA 2R9HD 4I3GA 4WTWA 4YZFE 5I30L 4QHNA 4O2CB 5I19H 3HE7C 4PJ7F 4OZGB 4H5SA 1PGRB 5EO1A 5TF1H 1A4JA 5IV2A 3UJTL 1OM3H 4O2FB 4LNRB 5JMRA 3HAEA 3NH7H 2CUIA 3ZLQC 3DJ9A 4KI5F 4YDJB 1K4CA 3MV9E 1XGUB 5I73B 2DWDA 1JVKA 3TBYB 5HD8D 3J8F7 4WEBH 3GRWA 2I26N 4CDHA 5EU6A 4E42B 4NQCD 5LBSL 3BGAA 2F8XC 1DVFC 3PJSA 1L7IL 1K3ZA 4OIIL 1QNZH 1CE1L 3VDBA 5EORH 1XF2A 2OM5A 2NY4B 3UO1H 3OWEA 4I3RH 5JIIA 3U2SB 2Z31D 4JFFA 5T3ZL 5KZCD 1RQ5A 4J2XA 4F9LA 2R23A 4X5LA 4PGZA 3O41B 3GIVA 3TH2T 1G7IA 4OCLC 3BP5B 1LGVA 3MRIA 4DZ8A 5JW4N 1U8NA 1OTUC 3NFNA 1VPOL 1YEKL 4HQQH 5ENWB 2BSTB 2IG2L 5HI5C 5EOTA 3D3VB 3DHJA 1HSAB 2PO6B 4MJ2A 5HHME 1AGFA 4MAYB 2AK4A 4U1NB 3TVMA 3HS0A 1JWSA 1T89A 3QIWB 5J1SC 3G6AB 1F13A 1KEML 1MJ8L 2J5LB 1AR1C 5ACZA 4WENB 4PV8B 4XMPH 4U33A 4M48L 3FO1B 1FIEA 2NXZC 3NZ8B 2CXGA 3CJJA 2VDNH 4G6KH 3TO2A 4OF0A 3MLYH 3DRTB 1R3KA 1B6UA 4FZ8H 5MI0C 4IRJB 5FUOH 1X5XA 4H8WL 2YUXA 3U0WL 4KKBC 3GMNA 5B8CA 4K3EL 4OGXH 1X5LA 3IU3B 2CJUL 4WEUD 3KWWA 4XC3H 4JJHA 4ZFOA 1ORQB 1FDLH 3RVXC 4ZQKB 4WWKA 5JR1L 4P23C 3NFPA 4F37K 3TA3D 2H6PA 4PJ5D 4OCWH 3ZT6A 3EJZC 4JY4A 4OI8A 4WV1A 4OM0L 4RA3A 4Y4KB 1PEWA 3HMXH 2ITDB 3RWIB 2I5YH 5F3HB 3G5XA 1CICB 1I8IB 1WCQA 4GS7C 3UTTB 1YUHA 4NO0B 3K4AA 3U4BH 3H42L 4LPTA 1JJUA 1BJ1J 3BKCH 3VCLB 1FNGA 1PKQB 5DMJB 4U1IA 4EOWL 5JOPD 2EC9T 3DV4A 3QIUC 2OSLA 1RIHH 3PL6B 3QO0A 3KXFB 4HGWA 3PDOB 5SV3A 4TUOA 5KG9B 2E7MA 2XZCL 3CLFL 5T1LD 3UBXG 3NA9H 3FQXB 5J12C 4D9LH 1UFUA 4ZFGL 3H3PL 2CLVA 2DRUA 4IOFD 3HB3C 4J7RA 2I9TA 5CZVH 4HG4K 5ISZB 4TNVK 2W38A 3IDIB 4X6CF 3HCVB 5IHZA 5CFHA 3S5LB 4N8VG 1CT8A 4GT7A 4TVPH 2I25N 3ZYIA 2ITCA 4JKMA 4XB7A 5E0QA 4HSQA 3ZHLA 3TO4A 2D0HA 3B9KD 2NXYC 5GPRA 3DX6B 3HUJB 4S1DD 1WBYA 4GRWF 1SVCP 2CD0A 3MNWA 4PJXA 4GRLA 3OKLA 5HDQH 4YJZL 3DSNA 1NFDB 1CE6B 1QFWI 4NHUB 1U6AL 4F9PC 3I6KA 4HJJL 2X09A 3DURB 3RGVC 4Y16C 1G6RH 3CSGA 2O26U 3QDMB 5BV7B 1RJYB 5C0BE 4OQTA 3MBXL 4MA7L 3QCUH 2VIRB 1UB5B 1NAMH 2R0WH 4MVBD 3HRZB 1C8PA 2VC2H 3V5DA 5FECA 4DVBA 3QHFL 3MLSL 4QXUH 3G6JA 4YXHL 5DQ9A 3ROOB 2CGRH 4HUUA 4NNYA 2EC9U 3BPOC 4KHTL 4JO2H 3V4VL 1HH6A 4L8SC 4S10A 3IDJB 1QVOA 2B4CC 5IEHB 3PWUA 1DDHB 3CVHB 4PRDA 5C0EB 4DKDC 4C58B 1ZSDB 4NQSA 1MY5A 4MS8D 4L5FL 2ESVB 4ZSOA 4F33A 4HWEH 1U36A 3MPCA 1OSPH 1FV1B 3LN4A 3QJHA 3JV4B 1JMZA 2N4IA 2P48B 4LVHB 3GO1L 3BT2L 4YQXL 5MERA 3O2DA 4M7KH 3VGAC 5DD0L 5D5MB 4ZOAA 3N1PC 3D39D 3F7RA 5DEGA 2UWEF 2BOBB 1I1FA 4DGYH 5CCKH 3RGHA 2XYCA 5FGCB 3WYRA 3FB7B 4RWHA 2ZUQB 3HFML 4PRHA 1RZFL 1UZ6E 3STBA 1DQTA 3HZYA 4OV5B 1TQBC 5HDBE 2XWBB 3P9MA 4R0LB 1BD2B 4LVOC 1QOKA 3PUCA 1SQ2N 3KPTA 4Z95L 5GSVA 4H25A 4Y19A 1UCBL 5D9SB 4I18C 2AXGA 1NJ9B 4RA0C 3HI5H 4P4RB 1ZWIA 4JFDE 4XH2B 1S9KC 3QJFA 2BVOA 3GSOB 3U6RA 3W82A 5IGXH 4HUWB 1RURH 5D1ZD 4PRPA 1MEXL 4NOFA 5HHVL 4P49A 3V79C 5J1AB 4WEMB 3ARDB 4R7DA 3TPUA 5C0IB 3BQUB 2J7LA 2DQTL 2H8PA 1PG7X 4U3CA 2FSEA 1KIRA 1HINL 4ZFZB 1G0XA 1LO3L 1FP5A 2YEZB 4NQDA 2A6JA 5D1XD 4MD5B 4X7EC 2D7NA 2VSCA 4P9MH 1M7IB 5DTFB 4HPOL 2XQYK 1T66C 2FHCA 3GK8H 1BEYH 1N8ZB 5J8OA 2BP3A 3S37L 2W9EH 2ZSVB 5AD0B 4YAQB 3JTTB 3S9DB 4OFYD 1YEFL 4X6DB 3MNVA 3SDAB 2YPLE 3GJFK 2FH8A 2DQFB 2XG4A 4HIJA 1DR9A 1YQ2A 5DRXB 2A1WH 4GXVH 1RZ8B 2QKIA 4YDLC 3BH9A 3RA7H 4ZDHA 1NGXB 3KPOA 4ZO7A 4YBHA 2YZ1A 5DD3L 4V1DD 1KUMA 2FX7L 1X7QA 4YHOH 3MRHB 1G7HA 3RZCA 5GSRB 1FPTL 5JW5A 1S9YA 2QTEA 4GG6B 2BOCB 4FS0A 2XZAH 1AGBB 1DTUA 2BFVL 3BIKA 4U1MB 5C07D 2XTJE 2IJ0C 5TQ2L 2ZJSH 1BLNB 4OZHE 4AT6B 5E00B 5FDYA 1T2JA 1VFOA 2FR4A 1U8LB 4PB0H 4G6MH 1T89C 3EOYG 2X2YA 1EXUB 2IMMA 2DQCH 4HKBA 1MCRA 1YN6A 4UILH 3ARXA 3ULSA 1LK2A 3C2AL 3RWDB 4PYGA 1MH5B 1KENL 1RULL 5I18H 1I7ZB 4QY8B 1G6VK 2OQJA 5HHXL 1A2YB 3F8UB 2XN9A 4KK6D 4QRUB 3VGBA 2GW5A 4MCYB 5LWYH 2OX5A 1FN4B 4X98B 2ICEB 1ZHKB 5K33A 3V5HB 4ZXBD 1JPSH 2QQNH 2VR4A 3UZVB 2H1PH 2OTPA 1Y18A 1IM9B 3ILQD 4NUJA 2X4OB 3OZ9H 4EI6B 5B8CC 3QRGL 2X1PA 4OLUH 3NIDE 1R5VA 4YH6A 3AUVA 4LHQB 4Y5VB 5AYUH 2IBZX 4WW2A 1GZQA 3FCTB 2GJ6E 4W4OA 3EYUL 2HT4D 4KUCF 4I13B 1P5UA 5F88A 1BM3H 3TFKC 3VXQB 1F2QA 5I1DB 2M26A 3IFOB 1OOAA 4WV1C 4G3YH 3RTQD 4GW4A 4MNGA 5EUKB 1BECA 1UXSA 2JIXA 4L4JA 3V7MA 5BRZA 4HXAL 4M7ZC 4YWGL 2PW1B 5I1HL 4POZC 1PX4A 1IC4H 5EZJA 4G8EB 3SE9L 5GGTH 3W11D 5C8JB 2DLFL 3IRPX 3TJHD 2QADD 5INDB 1E4KA 4ZAKD 5T33L 1OWWA 3D18B 2Y9RT 4O9HL 2B7DT 2N7BA 5IKCB 3ARUA 1NCAH 5DJXB 4WNQB 5H2BA 3TNMA 1KTLB 1R3HB 5KZCB 2BZDA 3BGFB 3HC0A 4KXZI 4QRTA 1I85C 4KKAC 1G9NH 3SDCB 5C6WH 5CEZE 3IFPB 2RCSL 3U30C 2D7QA 4HIXH 3WIFA 2UVFA 2AJSL 2Y6SC 2XG5A 3GUTB 1MREH 1QTYT 3RWGB 3QXVA 3LPFA 1MLBB 4R90H 4G9FE 4P4KB 4LOUD 4CU7A 3INUH 4TVSa 1U2HA 3C9NA 4F80A 2CLRA 2HFTA 4OLVL 3TO4C 2JKXA 4XPTL 1S7QA 2FGZA 1NKOA 3AGVA 2UZIH 4JRXA 5E24E 1DL7H 4CVZB 2NR6C 3FQNB 1ZHNB 4GRLC 4MCZA 5H94B 4HHAA 3R1GL 1WVZA 4FQHA 1GGTA 2EDEA 5C7XH 3BISA 4F7TB 5IQ7H 4P5TA 4WTXA 5D71H 3VH8B 3VXMD 1GPOH 1RFDH 1L6ZA 5I76A 5ICXA 1YPZA 4JZNB 4D9QE 3DO3A 1NBYA 4L3ED 5K59F 3SKJL 4YDIH 1J7VR 1IL1A 1QRKA 1CDUA 1PJ9A 2LQRA 3OGCA 5KSBB 5D2LF 5ACLA 3T3PE 3N1FC 1JZ7A 5EO0A 1YYLH 5E8OA 2YKLL 2VLKB 5L8JB 2M1KA 1DN0B 3P9WB 4PJ8D 1U3JA 3VFVA 3WUWG 1T7YA 2V2TB 1N7MH 4JFEE 5JHDA 4ODHL 4PJ5B 4UIKL 1EAPA 3QFJA 4A2LA 4MB5A 3QAZB 4BSVB 1FG2B 3O81A 5CD3A 3NCMA 2DBLH 4IMLB 4HLZG 3U4EB 4X5XB 5MEPA 3OKKB 1DBAL 4ZPTA 1QBMH 3CFDB 1J86A 1C1EH 4PJDB 5JIKA 3QIBB 1ZLVK 3ZDYE 2JJUA 3IDUA 1B88A 3VFWB 2AEQH 5MENE 4K7PH 3CX5K 3LN9A 5FYLD 2XT1B 4I0PA 2R56H 3TZVA 3S4SB 2DTMH 4IOSD 4XZUA 3QXDB 4LIQE 2AXHA 1NCWH 3H3KA 4M9OA 1YEEL 4U1JB 3V4UL 1U91A 5I1CH 4N90D 4M03A 1BF8A 1V7NL 2VLJA 1EEYA 1F6AB 3UPAA 3Q5YA 3MLXL 1IQDB 4YPGB 3E3QE 5DJCA 5HGHA 4GSDH 3QEQD 2AABH 2MNUA 1WCBB 1BOYA 1N0LA 1P4LB 4ZTOH 4HLZH 1W72B 3GI9L 3C60D 3O6ML 3HC4H 5CSZA 1I7RB 1UEYA 5EB9A 4KUCD 1HHGA 3GSNL 3MREA 2YS4A 1S5IH 3T1WA 2EH8H 3OXRB 2VERN 4ZMAT 4JHWL 4F8TA 1VERA 1KV3A 2QSQA 3FT4B 1FLRL 2X4SA 1JHKL 4KJQD 5CJOH 2IPKB 3C5ZD 4XXCA 1SJHB 3E0GA 3LKQB 5L88L 3L3DB 5T1DL 4UV4H 5L8LB 5CP7B 1LMKA 4RGND 4YUEH 4NT6A 1CG9A 4XMLH 5J6HB 3JTSB 1RUAL 5DFTA 2F5AH 2FJHA 4R4FH 3ZSSA 1KXQE 3N85H 5I19L 3U9UB 4OGYH 1WC7A 4PLJC 2PNDA 3V6FA 1HZHL 1BQHA 1OM3L 3IU4H 4ZTPH 3GSWA 4PJEE 1A1MB 1VESA 3VFOA 3PIQB 4WFFD 5B4MC 4PJHA 2BY2A 1D6EA 1NDGA 2C3HA 4LCCB 1U42A 5I1EH 5J11B 3LRHA 4GMSL 3D0LB 3MRMA 3PWJB 4AG4H 1PZ5B 4ODSH 4WEBL 5SX4I 4PY7B 4M6OH 4M7JH 3VFMA 1CWVA 5E94A 3RZCC 1I8LC 5IW6A 5TE4H 1JZ4A 3EO9H 1J1OL 3N50A 1N0XH 3TV3H 2IBZY 1P6AB 2V7NB 2Z91A 3HNVL 3QDJD 5EORL 2FDBP 1FL6A 1MRDH 3QFDB 2DQHH 3UO1L 2D03H 4I3RL 2P5ED 4PYHA 4FZEH 5FUCC 3RVVC 5EZLB 3T08A 3EYSH 1JGEA 1AO7D 5IVXF 5JXAH 1J0IA 1ES0B 4OI9A 5E9DA 4LPCA 3W39A 2ZWLT 3MRQA 1UWEH 1U41A 2YUVA 3MRRB 4JFHD 4MQSB 5CBEA 2IFFL 2AJVH 4BFBD 1MSPA 4LCWD 4EDWL 3BHBB 3HG1E 1QBLH 3T0WA 5TDOB 1H5BB 4MJ5B 1LP9E 1TETH 1FYTB 4EUPH 2R0KH 1NL0H 5I1LA 1WZ1H 1MQKL 5CEZH 1DQDH 2Y7QB 4Y8DC 5D1ZB 5JQ6H 4GW5A 4PTTA 3GGWA 4OUOA 5K9JL 3RVWD 4QT5A 4X4ZA 2HFFA 1H3VA 2ZPKH 4TQEL 1EMTH 3CK0L 3BPLB 4NO3A 4QHMB 1U8MB 3BRDA 3G9VA 1U8HB 3OKDA 4WW2C 1SJXA 4JO3L 1MAMH 1BBDH 2NY1D 1UADC 4AK1A 4HT1H 1L0QA 5KVGL 4W4OC 2VZ1A 4H1LG 3N9GH 2DQDL 4G6KL 4PJAE 5H35B 2Z8WC 2ZUUA 2HG5B 3MLYL 4CKVX 4PG9B 5EU5A 1RJZB 2ZUXA 2VABA 3LQAH 4OZGA 5BXFA 4DWHA 4RFOH 2J1KA 2VXQH 5FUOL 4MDJB 2EECA 2KDGA 4OZ4B 4OGXL 5D7IF 4YDJA 5EFIB 1E4KC 4XC3L 1X9QA 1FDLL 2QV2A 3CVHL 5F1NB 3TBYA 2OL3H 2AEPH 2NY0D 5GGRA 3MCKB 5K9KB 3KYOA 1MCIA 4UB0H 1X6LA 3RPIB 4X9IA 1W0WB 5MEQB 3BDYH 3MRLA 3KPSD 1GGCL 3DIFA 3JV0A 2HJLB 3QXAB 4RMUA 4OCWL 1RIUH 4CU6A 4DN3H 4U2ZA 1EHXA 2IQ9H 2BVEA 3V0WH 1RD6A 3HMXL 5D70H 4K8RL 3FL7A 2CRYA 2I5YL 5HVHB 3GFUA 5F97E 3VWKB 4V1DB 4JKWA 1LD9B 3DSFH 3RBSA 3O41A 3STLB 3BKCL 4ENEC 1QR1B 2ZUYA 2BHYA 3GMOA 3U1SH 5C07B 4MNQD 3SOBL 1OLLA 4XP9H 3UJIH 5JOEA 1IT9H 1QQDB 1RIHL 2IALB 3C5SB 4RFEB 4S1QH 1MUJB 5ENWA 4YZFF 4WY7H 1WFUA 3P40A 3LQZB 2FBJL 2AJXL 4U3XA 2FNBA 3D3VA 1LE9B 4MJIA 1HSAA 3NA9L 3QUXD 4NN7C 1ACZA 4DFIA 1OTTD 2C5DC