2SEBB

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
189
structure length
177
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (mhc class ii/superantigen)
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 177
sequence length 189
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2sebB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2sebB01
5LGJA 3RNKB 1S9VB 5CLTA 4LCWB 3QISA 4Y4HC 4Y5XA 1A21A 3ZHLA 5TDPB 1UZ6E 4U1SA 2F54B 2VH5H 5MEND 4O9HH 3TT3H 4R0LA 1QTYT 5F7FA 2X1WL 3ARDA 1VCAA 2ZZUT 4PD4J 2EDXA 1G7HA 2EXYC 4KHTH 1AGBB 2GT9B 3PP3K 1UG9A 2A0LD 3KXFB 4MVBC 5BQ7A 3NH7H 3TNNA 1OTTD 3BQUD 3LS5L 1QYGL 4K71B 4WFED 2HFEB 3CFJB 4GQ9L 1FG9C 3X13B 4Y2DA 4ZOBA 3ARDD 4PP2A 1CGYA 2X4TA 5GSRA 3RGVB 4LRIA 1T21A 1DQML 4CAGA 3SKJH 2NW3B 3V6ZB 5JORA 3AXLA 4PIRF 4HUXB 3IDGA 3LKQA 1KULA 4GAYA 4PJGF 4K07A 4Y2DD 3MRFB 3MA9H 5C0RH 3VFUB 3BZDA 4GG6F 4LPYA 4E41E 3OG4B 4NIKB 1ZLVH 5E0QA 3HZKB 2R69L 3FO1B 5F3HB 1CGVA 3G6AA 3LY6A 1OAKH 1ZA6B 4YBLB 2WIMA 4OGAD 2X4SB 3U0WL 5F6IC 2VJXA 3VXPB 1DSFL 3E8UL 4ZMAT 3ZYOA 1PG7X 1ZHKB 1UXWB 4GFTB 4M03A 1MY7A 4DZBA 2BVUA 3RX8A 5A2IH 4IS6A 2A74A 5DMJB 3GJFH 5ELIA 4LCUA 1G1CA 3H2WA 3QPQD 1MAMH 2HT3C 3C5SB 2ADIB 5LWYH 4YAQA 5KOVC 5HI5D 3HMXL 2G5BB 2ITCA 5DMYA 3DX9A 4ZUTA 2BNRD 5IQ7L 4MNQA 4FQJL 2DWDA 5CEXB 2Q8BH 5IEHA 1A0QL 4MD5B 2EDNA 3CNKA 4L4TB 3BKJH 1RJLB 3BIKA 1GVIA 3UBXB 4QHNB 4IIQC 5FCUL 4MNQD 2PYFA 1LP9F 4R8WH 4ZFOB 3BPNB 4PRBA 5EUOA 2OJZH 1VSCA 1GYAA 1MHPL 1N7ML 3S4SA 4HK0A 5C07A 2XWJB 2YD9A 4GRLB 3NA9H 4YWGH 2OP4H 4HKXB 3LKPA 3MRGB 4S2SA 4Q97A 1AH1A 2D4DA 1F4WH 1SYSA 1V3JA 2F53B 4JQXC 3C60C 5LGHH 4YHYB 1BD2E 3J8F7 4O9HL 2QQNH 1FGNL 2NXZB 1UACH 2CDEA 2L0DA 1Z0NA 3FQWB 2EDEA 3PHOB 1BOGA 5L6YL 3QHTC 1KJ2L 4X6BA 5FAAA 2WWMD 2NY4C 4R7DA 4BSVA 1J0HA 3TM6A 3QUYC 5D6CA 3RL1A 3MV9B 5IP4A 4V1DE 4RBPH 2XZCL 5FDWA 3QNYA 2DQDL 4PJBB 2AJ3A 2P7TA 1WICA 2DI8A 4HGWA 3WIFA 4XMPL 3JWDH 3SKJL 3G5ZA 3MV7E 5CMAB 2VXUH 3MLRH 2A6DB 1JNHB 1O0VA 2VITA 4OD3L 4UNUA 5HHXL 4JHWH 1UKQA 4UINH 1MRDH 4QXGL 1FFQA 5DVOA 1QLFB 5EUKA 4U3HA 4K71C 4KMTH 2Y5TA 5E56A 4OD2A 2C5DC 5JXAH 3RGVC 4PJHA 1A1NA 1OWWA 4DGYL 3ULVD 4X6DE 2NLJA 1BLNB 2X1QA 3UTSB 2OSLA 3SE3A 2BDNH 3QUKB 4YHML 2C3WA 2C3GA 5A16A 3W2DH 2VZ3A 3V4VL 1QSFB 4ZS7L 1WGOA 3MRHA 3OZ9H 4GS7C 4Y16C 3BRDA 4JN1L 1EHNA 2A6KB 3FHAA 2ZUYA 3FOMB 1B90A 5KW9L 1MAML 4HWEL 3MRMA 2EDFA 4FQIH 5LWYL 4YGVA 5HDQH 4YHIB 3UTZB 1I7UA 1OD7A 2DBLL 3S35H 3CFDB 3QEHA 4YBLC 3QXAB 2E5EA 2Q8BL 5EU6B 1YUHB 3EJYC 2G75B 4J7RA 4Q9CA 4F9PA 4BUHA 4D3CL 4BH8A 1RUAL 2PW1A 2WUBL 1LEGB 4LMQE 4GKNB 4JY4B 3QA3B 3O2DL 4UOW0 1SYVB 2RB8A 4HIEB 4ZS6D 5DVNA 5D2LA 4NN7B 2IBZX 2H3NA 1MFCH 1NBZA 4LQFH 2CKBL 5JIKA 1HYSD 5C0EA 1BWMA 3ARGA 3NIGF 1J7VR 1W72L 4JFFE 2X4PA 3H7BB 2RJMA 2HRPL 3RL2A 1IGJA 3MMEA 4OZHF 3LV3A 4R96A 4LRNL 2QQNL 4NT6A 3VD4A 5I76B 4JRXA 1N0LA 3BPLB 3QO1A 5F88B 3ARGD 3OXRB 2FZ3B 3S5LA 3DO3A 2W9DH 4UOJA 1T0PB 3PL6B 1FO0B 3NZHL 2AEIT 1FDLL 3IDXH 1AD9A 4GRLC 2C7UA 3BJLA 2OTUB 1NUGA 2I60L 1MWAB 5BRZE 3QWRD 4W4OC 3ILQC 1YJDH 1RIVH 1VADA 4U2YA 4JRXD 5CJOL 1QBMH 4OCXL 5HSFA 2VXSL 3NCJL 3HLAA 3QQ4A 4JKWA 4PJ8C 5HBBA 1BZ7B 1TCRA 1WBYB 1WZMA 2P5EA 4UINL 2E9WA 4ALAH 5E2UH 5EU7C 1RZKC 2BK8A 5CILH 1OGTB 3IJYB 4Y1AA 1EJOL 1VB9A 5FCSH 2X70B 2Z8SA 3FCTA 5ILTH 4XPBH 1LD9B 4Z0XB 3O6ML 4QKXB 4HUUB 5JXAL 4QO1A 4Q74A 4J3VA 5KANI 5CSZB 2PO6B 1BJ8A 43CAB 3G5XB 3GSVB 4R4BB 2P5WE 3NCFB 3LKSB 2VWEE 3ZTJG 1U8JA 4NO0A 3W2DL 4ETYA 4WIQA 5DD3H 2WINB 2JELL 1R3KA 3P30H 3CLFH 3OR7B 2X4RB 2X5PA 3S3PA 4WUUD 3MLUL 1IGFH 5GJSH 3BKCL 25C8H 2Z35B 3MLVH 3SE8H 5HYFA 3QCVH 5HPOA 4YDVB 2O61A 4LSRL 4NO0D 2QV2A 1FZJB 1JMXA 1JF1A 1ZWIA 4HIJB 5IHLB 4HS8H 4LGPB 4O2EB 4PP1D 4LLWA 3TBWA 3H0TA 1FRGL 3W5NA 3KDMB 5CJ8A 4OQ1A 1CBVH 3MBEA 1DVFB 4YFEA 4ZXBB 4U7KA 4X98B 3AU1B 4JKKA 1CWVA 5DT1L 4GW1A 5ISZB 1JPST 2DICA 4U31A 3V5HB 3FL7A 5ID0B 4CBPA 2APTA 1NGQH 1GGIL 5DC9B 3I02A 5EZLA 5CP7B 4NNYA 1K8IA 2QQLL 2W59A 2VR4A 3MBED 4NQEB 3TLRA 4JFOB 2CK2A 3IS1X 4Q0XH 4F9LA 2DQHL 2GY5A 1F4HA 4G6KL 1S7WA 1MJ7H 2VAAB 5ACLA 1ADQA 2FIKA 4NCDA 3TEUA 4YHKL 3VCLB 1T1YA 3ROOB 1YEJL 5L2JA 1I9JL 4O02L 4DCQA 4ZD3L 5FGRA 4X9FA 4YPGA 1MEXH 4S1SH 3P11L 2IEPA 2R2HA 2Z92A 3ULVF 3BHBB 2Q3ZA 3BT2H 5EOQL 4LBEA 1QEWB 1P4BL 3WHXB 4LGRB 1IC5H 3X14B 1ZHNA 3G6JF 3GSQA 3UTTA 4NUJA 3GMRB 5F7UA 4ZFOL 3V5DB 4PJ5E 3BPLC 2GK0A 3TBTB 4XC1L 4PJHF 3WS3A 3PJSB 3PL6C 2AV7B 4OFYA 5FO8A 3OX8A 5CILL 4U6XB 3IFNL 5SWQA 1YMME 1T7XA 3UTTD 4YBHA 1YMHB 3NIFF 3X17A 2EYRB 1N5AA 1E27A 2J6EA 2NY3D 3WCYA 2AJYH 1DLFH 1HHJB 1C16B 2ZWLT 4HKZB 4N0CD 5FYLE 4PLJD 3TV3L 3FQNB 2AEPH 5K9OB 1E4KC 4OFYD 1T20A 3VE0B 5SWZA 1CLZH 4Y4KA 5DD3L 1RZKL 4BZ1L 4JJHA 1A3RH 1YNLH 5EIQA 1FC2D 1H3TA 3HUJB 5INDB 5JOFA 1QRNB 4NO5A 1CFTA 4JFXA 1E6OH 1INDH 1ORQB 1D6EB 4FG6D 3EYUL 2H1PH 3KYMA 3LIZH 2DQCL 4LLDA 2PO6C 5SWZD 4ONFH 4IEFB 4Y4KD 1YN6B 3VMPA 3LQAL 3RWFB 1IKFH 3L3GA 4OD1H 3LEVH 3RDTA 5GS1C 2I07A 1QFWI 4I0PB 2YWZA 5HHME 1PKOA 4O4YH 5CZKA 3RVTC 3FJTA 2X42A 3GBNL 5D1ZD 5D2LF 5IB4A 4ONHB 5GGQL 2AV1A 1MJJB 2E27L 5HHQB 3PQYA 1X5JA 3I50L 1WC7A 5E8PA 2F74B 1S7TA 5B8CB 5IJKA 1MIML 4JRYE 3RDTD 2VRAA 4LAJH 3VD7A 5DD1L 3GMNB 1BQHG 2IALA 5DR5H 5A2JH 1NUNB 4S0SD 1KTDA 1L0QA 5H35B 4MJIB 5J0BA 1SM3H 4QCIA 1DVFC 3MRQA 4ZNCD 2QHLA 5DLML 3PQYD 4G6AD 3FN3A 3QJFA 4I18C 3VGAC 4K7PH 5TPWH 3OHXA 3SKNB 1QBAA 5EBLA 2OTWB 3SDCC 4KRLB 1UZ8A 2XY1A 1KLUB 4O00A 5I1JL 2AEWA 3D25B 2XRAL 1ZVSA 1FFPB 2VDML 5CEYB 3RVXD 3ZE1E 2P46B 5F9DC 1N0XL 2IPKB 1FH5H 4QEGA 1TJIH 1RY7B 1L0YA 1RURH 2C4XA 2F5BH 1IQDB 2XT1B 4M3KB 2V5TA 3V4PL 3MJ8A 1HQRB 3BMWA 1A9EA 5FM5M 15C8L 4P23B 1NEUA 1CCZA 3N9GL 2KZ1B 2DQIH 5GRJH 3NFNB 4KKLD 4EI5A 1X4XA 3U0TB 4G6ML 4A6YB 4RGMB 3AFLA 1I3UA 3I3EA 2CQVA 5DS8A 1QR4A 1L7TH 1J5OH 2LU7A 3QZWA 4X4XB 5JPNB 1B0RA 5IFAH 1YY9D 3K46A 2JCCA 3BW9A 2WLZA 1MCCA 4BZ2H 3RHWF 3HPLB 1G7JA 2J7LA 1J1OL 2ZCHH 1OAYL 1FO0L 1MVUA 1CLZL 1BJ1H 3O8XA 4XBPB 4EI5D 3QFDB 4YHNA 2J4WH 1BQHB 2HLFD 4JVWA 4C54A 1I1RA 3B2VH 3CDYA 1MWAL 4MDIB 3RWGA 5EO1B 2AJSH 4XX1E 4UDUB 5J1SC 3TWCL 2GUOB 3TCLB 1UADC 3STZB 3EGSA 2VUYA 1E6OL 3HE6A 1INDL 3TYFA 4M5YL 3LKNA 4DN4L 3TCXA 4GXUM 3LIZL 5ADPH 1DBJL 3REVA 3MGTB 5L8JB 3O8XD 5DEGB 4L29A 1PVHA 1N64L 1QFUH 4E41B 4JM4L 3UXFA 5FKPA 4OD1L 4QOKB 3RP1A 1A6ZA 5I19L 3S96B 3R0MA 4XVUD 3JVGC 2CJUH 1G0YR 3DLQR 5CBEA 3SDXA 1R0AL 2CR6A 4M1GH 3O3EA 2K7PA 4ODWA 5L0QB 2NXYC 1PX3A 1QNZH 3O0RH 3VFPB 3OKDA 3K4DA 3GDBA 3GB7B 4Z7NF 2FSEA 4D0DA 4X8XA 2NX5A 4ZQKB 1AHWA 2VDLH 5F21B 5TQ2H 3VXUB 1ZVYA 1GHFH 3WYRA 1KIPA 4EUPB 1TPXB 2C4FU 3CH1A 3KS0H 1TVBA 4PRIA 4Z7WB 1ZV5A 1EEQA 4MQXC 2FX9L 4XCCL 1GJIA 1KTLB 2PKDA 4H88L 2NX5D 4JG1H 3WXVH 3BMVA 4RCAA 1EUTA 3CVIL 5TPWL 5ID1B 2VNCA 5FM5O 2FB4L 3VFWB 2MQ0A 2VR5A 4YFDB 2FEDD 3PDGA 4RWHA 5FM4A 5B8CC 5HDOA 4PRID 3QULA 5HYJE 1E4WH 4J4PC 3WLWC 5DEFA 1DN2A 3KPOB 5JLZB 1P69B 4TNVK 4OLUL 4C56A 5A40E 4JY6B 4MDJB 3DECA 4WI8A 1C1EH 2H2PD 3GHEH 5ABDE 2F5BL 4U1NA 4E0RB 3OXSB 4P46A 1C12B 3KHQA 4PV9B 4N0FA 1Z3GH 3PWNB 1P84K 5LQBH 3QXVA 1SHMA 5DJ2B 4C56D 1BD2B 4KI5F 4O51B 4QHLA 2DQIL 5DFTA 1KT2A 3AAZA 5HY9B 1NGZA 3BIAX 5LBSL 2OZ4A 5HYQB 1TXKA 5J1AB 2PXYD 5DTFA 4P46D 3S35X 2K7QA 2QKIA 4HKJB 5AUMA 2OK0L 1F58H 3LQMA 5ENWB 1ZSDA 4KZDL 5CS7A 2DRUA 5FUCE 3WS6C 4AEFA 3T0AA 4P23C 1HQ4B 1KXTB 3MNWA 3UJTH 1U42A 3GMLA 3VGGA 4K3HA 2FBOJ 3L7FA 5EBWA 1CFSA 3X3GL 1OCWL 2IANA 4Q2ZB 3BGMB 4X99A 5JHDB 4PD4K 2ZCKH 4L5FH 3UDWC 1RUMH 3IFOB 1HH9B 4Z78B 4DK3A 1OPGL 1ND0A 2BSRA 1HE7A 1QFWM 5DO2C 3DBXB 4OM0L 4HHAB 4U1HA 1JPSL 4N0YL 4KZEH 2IAND 4KROB 4HCRA 2GIYA 1ZEAH 1KXVC 3OKLB 1XGUA 4JZJA 4A6YH 1XGRB 3VXMA 1NFDE 3O0RL 1NUFA 2ZG2A 1A6VL 4UZGA 1UCTA 2VKWA 3ES6B 5IMMB 1NAMA 2CLZA 4OJFL 2BMKA 3BEWA 2VABB 4YO0B 3FRPG 3TJEL 2JK5A 3QWOB 4WW1A 3ULSB 5KS9A 4UU9B 4L1HA 3VXMD 3IJHA 4XMLH 1SJHA 3MR9B 5ITFA 2M1KA 3KPMB 3G04A 2GAZA 3VFMA 4JG1L 4ELKA 1NLDH 5F9OL 4YNYB 3MOAL 1NPUA 2MPAH 2EEBA 2OXHA 4XNQB 3JXAA 4P2QA 3BP4B 2F19H 1DE4B 1YPZA 4TOYL 3RAJL 5D93C 2H8PB 2DI9A 2F5AH 1E4WL 4G43A 1J8HA 2AK1H 5DZOA 1U8HB 2GCYB 3MJ7A 4PJGE 1GC1H 2P1YA 3QEGH 3O6FB 2IG2H 4HH8A 1NL0L 3MRDA 4P2QD 2A9NL 5C2BH 4DGIH 4JFFB 1DUZB 4GG6E 5J7CC 5E2TH 1I3VA 1MJUH 1NCUA 1J8HD 3Q5YA 5JW4N 4Q9QH 1VENA 2ATKB 4ZUWB 1JPTH 3GSNH 2VLRB 1G6VK 3P40A 4XP9H 1IAOB 4OIIL 5I30H 1FZOB 3EOYG 4ODUB 4UT9H 2X89A 1JWUB 5DK3A 5IG7A 3UO1L 1MRCL 4PUBH 2F58H 1JK8B 4MAUH 3RPKA 1KJMB 1EFXB 4YZFF 5D71L 5F7MC 1IM3A 5K9JH 3DXAD 3FFCA 4FFZL 2X89D 3GIVA 3SPVA 1IEAA 1X7QB 2XNAB 4CU8A 1HXMA 5I0ZA 4U6HB 3MRCB 5JZ7D 4LK4A 1ETZB 4G8EB 1MCJA 4M61B 1LHZA 1I3GH 1S7RA 1IC7L 3QEUA 5DHVH 3WJJC 4LLQB 5IVOA 5E8OB 1RUML 5I1LB 5BZWA 1LK2A 1IT9H 3FFCD 2IPUK 2YPVL 3MRNB 3VJ6A 3RBGA 5LXGH 4BM7A 5GGUB 4LPXA 3UTPD 1YYLH 3MNVA 4JKPH 3QT2A 3CX2A 1LP9E 3PABB 1QO3A 2V17H 1GGUA 4TSBH 1KTRL 3O4LA 5I1IL 1S78C 5HI4D 4A6YL 1Q0YH 1FNEB 2FX8L 1F2XK 4I48A 1X4YA 4H5SA 4LLYA 3MLTA 4Z18A 1TLKA 1ZTXL 4DUWA 3BSZL 4P4KB 2D7MA 3U9UA 2J5LB 4WHTA 3VXSE 4NZRL 3O4LD 4KROC 3ZDZF 1HHIA 1TQCB 4S1QL 4P2RA 5GGVL 2E9JA 3RFZC 2BY3A 1N26A 3JV4B 3TNMA 1I8KB 1CG9B 3C8KB 5E4IA 2B2XL 3DURA 4NKQB 5I66A 1MH5B 2BNQA 2P8PB 4JO1H 1XR9A 3FTGB 3NCCB 1UT9A 4OZGF 3K4AA 2UUDH 1V7MH 3HMXA 4JFEB 4C58B 1OAUL 3V8OA 1U2CA 1BBJA 3UMTA 5JOPD 3OAYK 4QRSB 4MQTB 5DI8A 1WTLA 1V05A 4XVSL 3RY6A 5E5MA 2FBJH 4XBEH 4ODXB 3QSKB 3F8UB 1YQ2A 4PRPB 2BNQD 2BHYA 5D1QD 1N5YH 2YD4A 4PJAF 5C2BL 3FT3A 4Z7VB 5J6HA 3V6OC 1AP2B 4FQHB 1XF2A 2AJXH 3L3HB 3V5KA 2VE6A 2VIRB 5E1AB 1CT8A 3SO5A 3V52L 2EH7L 4TVPE 2XI9A 4NZDA 1QSEB 1QSVA 4UIKL 2ENYA 3PGCB 3EZJB 4ZPVA 3TBVB 3T2OA 5IW1A 3CFKB 4KVCL 3IETA 4Z0BH 4QY8A 5CEZE 4U0RB 4PUBL 4J3XA 4LVOC 2DI7A 3EYOA 4RFOH 1F8TH 4B53A 1S7QA 4PJIA 4KDTA 2ZUWA 4MAUL 1IBGH 1A6TB 1QFPA 4HJJH 3CU7A 1I7RA 4NM8H 2A6IB 5C0GB 2HRLA 4NFDA 5DD6A 4I2XB 2NY6D 2Q86B 1F90H 1KJ2A 3DTXA 4PJ5B 3MJ9H 1NCBH 3A6CL 3BUYA 3QDMB 3VXQA 4JPKL 4KAQH 5MENE 5AZ2L 4IMKC 3IF1B 1T5XB 3FT2B 4XI5C 4XXDA 5F1SA 4JO2H 1C5CL 5LXGL 1IRAY 5FGBC 5M95B 1YYLL 4YHLH 12E8H 2BSTA 4M3JA 3IDMA 3ZTNH 5HGHB 5IMOB 4K7PX 3CFBA 2YKLL 4WFEE 4NGHH 4OKDA 5JNYA 3B5TA 3OR6A 4NKOA 5D6DA 3U0PA 2NCMA 3NIGE 5KS9F 3VGHA 3VDAA 3IU3A 4PFEA 4HPOH 2BVPA 1F3JB 4MVBD 3TA3A 4G8FB 4FP8H 3A67H 3LAFA 2D0FA 2OL3H 1RULH 3SDYL 5ESAA 3BYYA 5C0CA 1LO0H 1S5IH 1S7VA 1RVFH 4WGWB 1YPZF 2VWEC 1X5AA 4N90D 1UFUA 2FIRT 3EHBC 4OI9A 1U8KA 3EO9H 3SKOA 3TA3D 4EN3A 3NN8B 2BVYA 4P4KC 4DUVA 4CNIB 5EU4A 1YEDB 1YQVL 3DSFL 3MV8B 5F1NB 5KSUB 3ESUF 2VTFA 3ME0A 4K2UH 1HHKA 5E94B 1BFVH 1A7PH 3U46B 5C0CD 3C8HA 5F1IA 4ZFFA 3KYKH 5J8OA 2AKRA 1TQCC 4KJYB 5TH2A 2IAMB 2IBBA 4OBRA 3WSQH 4EN3D 1RAMA 5C0IA 4PJFA 1EGJH 2ILLA 4JM2A 4XVJH 3P4NB 4XNUH 4XX1G 1MLCB 3QRFM 4R9HA 4ENEC 3O2DA 2AJXL 1C7SA 1DQJA 2GEEA 4YXHL 1JZ8A 4L3AA 3KPPA 1MCQA 2YBRB 4K3JL 5E9DA 5J56B 1S9KC 4I3SH 3K2UH 2CKBA 2UZIH 4KPHH 4JM2D 1NUDA 1W72A 1II4E 4KH2A 4Z8FL 1N59A 1IL1B 2QSTA 3U82B 3CXHJ 3NACH 3TPUA 4MNQE 4HWBH 4ZO9A 2YHGA 3QWQB 4IIQA 3MRJA 2B4CH 1OP5H 1WUNT 1H5BA 4NM8L 3K3QA 4OZFA 2APWA 4KV5F 2Y23A 5EZOH 3CDFA 4Q6IA 3OWEA 4OCRL 3RVUD 4KK9C 3B9KA 2FLBT 4G9FA 1FIGL 3STLA 3HKFA 2R1XA 5MERB 4EKXA 4U0RC 5EUOE 1TZIB 5EOCH 2A77H 4UQ3B 4BYHA 1ZE3C 1T1ZA 3CVHH 4MCZB 5C07E 4RX4A 2PCPA 2QJDA 1IGTA 4OF6A 4OLWH 3T0WA 1U8LA 4P5MA 1RD6A 3B9KD 4G9FD 5FK9B 3SKMB 3LEYH 1OAQH 5L9DH 4XC3L 1ZKAA 5TFSH 1BFOB 1EFQA 3H3BC 1UH2A 5IV2B 4NGHL 1HI6B 3RNKA 4R4NC 5C0AB 4LSUH 3C60D 1S9VA 3NCMA 4RMQA 4RX4D 4LCWA 4P9MH 5D7SL 1RIUL 3SQBA 5KJRH 5TDPA 2F54A 3L3KB 1UJTA 1TNMA 4NOFA 5SV4A 1JNJA 6FABH 1CK0L 5T3ZH 4U6YB 2XKUA 3MTRA 1AGBA 2GT9A 1GZQB 1LK3L 5DJAA 5BV7B 1LO2H 3KXFA 4K9EH 1U8QB 3KJ4B 5D7LA 4LCWD 4L9LB 1Q9KB 4HF5L 3WJLA 4XAKD 1Z9LA 4DKEL 2NY1C 2F54D 2ESVB 4IOIB 2HFEA 2ADFH 3CFJA 3J7HA 4P59H 1HEZB 3ULVE 1FYHB 4NQSB 5SWSB 1FSKB 1KENL 3HB3C 3RGVA 1AC0A 3KXFD 4TUJB 4MQSB 3C2SA 5KVDH 3FQTB 3G6JE 1HSAB 2XZZA 3V6ZA 1A7PL 5JW5B 4HGMA 4HUXA 4JZNB 3EYSH 4KY1L 3EYVB 4DFHA 1HH6B 2CDFA 4DVRH 4PJHE 4BZYA 3MRFA 3RUGB 3RRQA 3RGVD 4RA3A 3VFUA 3W0WB 1R5WB 4OCNC 1ZS8B 3DJ9A 1P5VA 4P57B 3HZKA 4PJ9B 4GAJL 3FO1A 3SE9H 4M62L 5EIIB 3CSGA 3P4OB 3TVMB 2ORBL 3QI9C 3VXPA 4XNZB 3HC4H 2V9TA 4HFUH 1DANT 4I3SL 2UZIL 1ZHKA 1UXWA 4JFHD 4NRZB 1HINH 3F58H 4WHYG 5CIPH 4RMRA 3T2NL 5FECB 2IQAB 3C5SA 4LLUA 3U4BL 1KACB 1RFDL 5TE7H 2ADIA 3KHOA 2G5BA 3EJYD 1DBBL 1CXLA 3UJIH 1CU4L 4JDZB 1NEZG 5EZOL 5CEXA 5DMGD 4NUGH 4MD5A 5GGRB 1RHHB 4L4TA 1JZ3A 1RJLA 1OHQA 4F57L 3TPKA 1GOHA 3HPJB 3UBXA 5D2LE 3IFPB 3K80A 5GGTH 4QHNA 4U1LB 2XTJE 3N1MC 1N6QL 1K4CB 3W9DB 4ZFOA 1MCWM 5DD0H 1CDUA 5EDXA 4L4TD 3BP5B 5KVEH 1UWXK 4I3RL 2XWJA 4HXAH 4GRLA 4POYA 1LQSR 4AMKH 4HKXA 5L7XH 1T89A 1U8MA 3QAZB 4GXVH 4JRXE 4K23H 4TUKL 1KSRA 2MCG1 4D0CB 3MRGA 4G7YL 2OI9C 5KJRL 2MQ3A 4K94C 2APXA 2HAZA 2F53A 5JO5B 5BS0B 3D5OF 1FFRA 3IU4L 4UTBL 5T3ZL 1MCBA 3AY4A 3FQWA 4GRLD 5GRVL 3IT8D 3DMMB 4HZAA 5CD5C 2KQMA 2XQYK 3BP6A 1ZT1B 5JA8B 2F53D 3KLDA 3MV9A 4LASH 3HR5B 2YD8A 1QLRB 2NXZD 2P5EE 4PJBA 5IR1B 1A1MB 4OUOA 4H8WH 3JUYA 1NFDB 2VISB 5F89B 2YD5A 1MLBB 2E7CA 3N85H 5CMAA 2VQ1B 1JNLH 4RZCB 3VFRA 4Y1AE 5BV7C 2A6DA 3CLEL 1E4XI 1NEZB 2FHFA 3MV9D 1QLFA 5IBLC 3U36A 2ZG3A 1QVOB 1P7QB 5IT2H 2HT4C 4HIHB 3KPRB 3VFSB 4CDHA 2E9BA 2RQ8A 3RHWK 3IDYC 1BLNA 4S1RH 5FEBA 3UTSA 2Z0BA 3QUKA 2CK0L 5DJ0B 1KCUL 1VPOL 1QSFA 4UV7L 4KJWD 4M6NH 2FYYB 3ZHKA 1YDPB 2W1NA 1C08B 2A6KA 3FOMA 3K8MA 2IPUG 1JHTA 2BFVL 3RVWD 5I9QB 1IGIL 3UTSD 4U05A 1IAKB 3ET9F 1M7IA 1BM3L 4PJGB 1RK1B 5GRUH 1OB1B 4YHIA 3UTZA 1IE5A 1QSFD 2FWOB 5ITBL 4IRSB 5GIRB 5GSVB 2Y9RT 3CFDA 3TVMC 5I15H 3QXAA 1LE5B 1YUHA 5DVKA 2G75A 1YEIL 5GPRA 1YNKL 5B39G 1Q38A 1FVCB 1J1PL 1A4JB 5DUBB 3ZT6A 2WK2A 5DJ6B 1LEGA 3QDJB 2WV3A 5DHYB 4GKNA 4JY4A 2X9YA 3QA3A 4WTZA 2BSSB 1HWHB 5KTEL 1I1FA 4Z7NE 1SYVA 3E6HB 5EU6D 1RZFH 1ZHLB 4PREB 4HIEA 1ZANH 5IB1B 3ZYJA 1UM5H 4JLRB 4EDXB 1KTKE 5ESQB 1PX4A 1GZPB 1FGVL 5E8DL 5CAYB 1IC4H 3H7BA 2NY0B 4AQ1B 1A6UL 2OBGA 5HGGS 3KLSA 1XIWB 3LCYA 4KKNA 5HHVL 5I76A 1X44A 3TIEB 5J9PA 5F88A 3OXRA 2FZ3A 4ZUVB 3PL6A 4MA1C 1FO0A 4LLMB 1YYMH 4GW5B 4KRNA 3UTTE 5I2IB 5FUCC 1B2WH 1X9QA 1DJSA 1LP9B 2V2WB 2OTUA 2A9ML 3IKCB 1MWAA 5FYKL 4YH6A 3N06B 7FABL 1WFOA 4UT6H 4WI3A 1WEJH 1YEFH 4H8WL 3PL6D 5DQ9B 3VGBA 4M6MH 3L3IB 3CC5A 3Q6GH 4CGTA 1IMHC 1BZ7A 1WBYA 3PGFL 1RIHL 4MWFB 5DSCB 2YC1B 2ICWI 2I5YH 1OGTA 4N8VA 1FFOB 1INQB 4JG0H 2X70A 3VFOB 4NKMB 4LKXB 2D7OA 2CXKA 1LD9A 4Z0XA 5C2UB 2AJZB 3PF2A 4HUUA 5SWZE 5JIPA 1DEEB 2R2EB 4MXQC 3C87A 2R0WH 4FQXB 5CSZA 1CL7L 2PO6A 43CAA 3G5XA 3GSVA 5BV7L 3QUMB 3LKSA 4OLXL 3HE7C 4HLZH 5EU5B 3R4DA 4RAVB 3PHQB 4PGBB 3S98A 4LEOB 2WINA 3OR7A 2X4RA 4KWUA 2PO6D 3UYRH 4BK5A 2Z35A 4PJDF 2R0KL 4KTDL 3RVVC 4YDVA 4HG4J 5GRUL 5D7JB 1FZJA 5A1AA 1T04B 4HIJA 3ARRA 4O2EA 1BEYL 3RVTD 1TNNA 4AEHH 2CDGB 2OX5A 3DUHA 3KDMA 5DRZB 5AWNH 5EIVA 4BK4A 3PQYE 3WKMH 4RA0C 5B3JF 1DVFA 1D9KC 1JHKL 2L7UA 1GL4B 1HDMB 2VMFA 4WU7B 4ZXBA 3GBLA 3U83A 5I9QC 3AU1A 5ISZA 3KYNB 5SX5K 3WO4B 4NBXB 1BP3B 3Q3GB 4FQ2H 5ID0A 4DKFL 5C0JB 2HKHL 2PYEB 1MNUL 5EU3B 4XP5H 5CP7A 2R1YA 4N8CH 5T3XL 3NAAH 4NQEA 4F7MB 2JLLA 4GMSH 4JFOA 1MFNA 1DVFD 1NAKH 4ZNEA 4MYWB 4ZXBD 1EJ6A 3AUVA 5GJTL 4ETQB 2ZOKA 5MP6L 5ISZD 1JN6B 1SVZA 3FO0L 3L9RB 4FFWC 2VAAA 4ZPTB 3ARVA 3QCTH 4LIQH 1EAJA 3ROOA 3V0WH 2DJUA 4NQED 3IDNB 1ODAA 3X11B 3L3JB 5FB8B 1IGCH 4ZTOL 2JJTC 3ZYZA 3HNTL 4H20H 1S7XB 2DQTL 4HLJA 4PJBF 4NHCH 2HMIC 2GFBB 4NM4H 4RQQB 5ACZB 4Z7UF 5LGJB 2Y7QB 1D6VL 3MLWL 3BHBA 1ZLWH 1W0WB 1AGDB 4Y5XB 3QO0A 2YPLA 3X14A 2NY0C 2AXGB 1FE8L 1U41A 1JYNA 2F8XC 4R0LB 1P5UA 4HULB 3GMRA 4UT6L 1FORH 4L8SB 4M8VA 1WEJL 3VFGL 2W38A 2IBGA 3V5DA 4RIRB 4GBXB 3C09B 1MCIA 3QIBA 4JQIL 4YJZL 4L8CB 3BGAA 1LO5B 1K6QH 3PJSA 4OZHB 2YXFA 2AV7A 1JPFB 1RMFH 1CICB 5IFHH 4U6XA 1T83A 2VLKB 4XWGL 2I5YL 3OJMB 1ZGLM 4XAWL 2N7AA 1YMHA 4EEEA 2EYRA 3BE1L 1T21B 3TBSB 2FD6H 1YEKL 1HHJA 1MQ8A 1C16A 4HKZA 3NCBB 3FQNA 5K9OA 2YA1A 1T03L 2XWBB 3LKQB 4ODHH 3S4SG 4GAYB 1NMCB 3VE0A 1E6JH 4R97B 1JWSB 4GKOA 4ZUSB 4M93C 3RA7L 1RZ7H 2VYRE 1AC6A 4WEUD 4WY7H 5INDA 4X80L 1QRNA 2DLTA 4ERSH 1PLGH 4PB0H 1RUPL 3VW3L 1ORQA 2YPKB 1D6EA 3GKWL 3LZFL 4NNXB 1TZGL 2PR4L 3HNSH 2ZCLH 1HIMH 2QADB 1YN6A 2C9AA 4FXGB 4KDWA 3RWFA 3L1OH 4KI1A 4PRAB 3QNZB 3P9MB 3RBSA 1QRND 1CGSL 4FQLH 4I0PA 3T1WA 1S9YB 4IS6B 2NX5E 5E2JA 5EULV 1MJJA 4RISL 5DGRA 3SEPA 4PRIE 3JV6B 5HHQA 5DJDB 5D7JC 1JRHH 2GQHA 4QGYA 2F74A 5B8CA 2B1HH 2XPGB 4N8CL 1NMAH 4I0PD 4OF5A 2BY2A 3H9SA 1A7OL 3GMNA 4LAQL 5C09A 3PHSA 4QXUL 5DFVC 3ZDZE 1A3LH 1NGWB 1A7RH 5KAQF 5H35A 1MHCB 4R90L 1MAJA 5J3HD 1VFMA 2D7QA 3U7WL 5CLWA 2UZXB 2BERA 3SKNA 4ZFGH 1CIDA 4PY7B 2MKLC 2O5XH 5SX4H 2R39A 3INUH 5MHSE 3GFUA 2R29H 3WLWD 2OTWA 4C56E 1KLUA 4XPHL 1TENA 4OZGE 5K33A 3D25A 1FNSH 4MJID 5C07B 1FFPA 1AXIB 4F33B 1D5ZB 3CAFA 5CEYA 4FFYL 3QG7H 4AM0B 2J88L 2Q8AL 1QPXA 3O41B 2IPKA 3ULUL 4KTEL 5C0BB 8CGTA 4F8QA 1IQDA 1VEPA 2Y6SC 1G7PB 3ARQA 1HQRA 1I8IB 2IPTH 3Q5TA 2VXVH 3C6SA 4P23A 4EOWH 1K6QL 2WZPD 5C70A 1MCKA 2A0LC 4HZLB 3F7RA 3L5XL 3O2WL 5F70A 1PZ5B 5TF1L 3QCUL 3H42L 4Y5XC 3T3MF 3U0TA 5F9WB 4A6YA 3UDWA 3BESR 3CK0H 1M6OB 5L8LB 3QPXL 3C2AH 4R0LC 5FHAH 3WIFB 1CFQA 4P23D 4X4XA 4ELMB 5JPNA 3JWOL 4PY8I 3S8WA 2X44D 3QNXB 2IANE 4GBXC 3NA4A 3C09C 1S3KL 3HPLA 1TJGH 4WCYL 1A22B 35C8L 4XBPA 3MSPA 3QFDA 3G6JB 4FQ1L 5H8DA 4MDIA 1RZ7L 4UDUA 5FKAB 2VDKL 2GUOA 3TCLA 2X2YA 4Y2DC 3STZA 1JUFB 3VH8B 2M26A 3BFOA 4PJHB 5DO2D 4LRIC 3DVFA 1OT2A 3IXTB 1F3DH 3MGTA 5DEGA 4GKZB 3WIHH 3VXME 3S5LG 2O5ZL 1AR2A 1JZ2A 1J86A 1NMCC 2XQBH 3BZEB 4QOKA 3UZVB 3LH2L 1KN4L 3S96A 3VFTB 4HIIB 2V7HB 4OGAC 4HT1L 3LHPL 4DTGL 4G3YL 3NBNA 3EIFA 3MRMB 2A83B 3ZYIA 5JDJA 5KS9E 4M5ZH 3GB7A 4E41D 3QPQC 4WTXA 2BOBB 1A6WH 4QOKD 3QUML 5IWLA 5TGBB 3ZE2F 4ZQKA 4J3UA 2IFFH 3QEHB 3VXUA 3S88H 2LU4A 4EUPA 2XQYG 1OQOA 5D8JL 1QKZH 4TVSa 4Z7WA 5I8OH 4KJQC 1G7QB 3LN5B 1DBAH 1KTLA 4MA8L 4LFHD 1YPZE 3VXOB 1EMTL 4KGJA 1FPTL 5ID1A 4R2GB 3VFWA 3VXUD 1J8HE 3V0VB 4KTYA 4OLVH 4K7FB 1DBML 1L6ZA 4RAUB 1KUMA 2YUXA 1INEL 1ITCA 3PIQA 5D2LB 3RY4A 4ODSL 5GZNC 5FYJH 3CXHK 1VGEL 3KPOA 5KSAB 5JLZA 3QG7L 4Y19B 2EKSB 4JY6A 4MDJA 2DQGH 1G6RB 2B0SH 5IVXF 4N5UA 4EJ1C 5I1DB 3PP3H 4ZG1A 3H7LA 5JR1H 3OXSA 3NFPB 1BJ1J 4XP6L 1C12A 1BVLB 4PV9A 3SDDA 1M7DB 2EO1A 2XXMB 3PWNA 5DJ2A 5JPMB 2WSKA 2OTPA 4O51A 4WWKB 2JJVA 5JQ6L 4PGEB 2AK4A 1DEDA 4M1DH 5HY9A 5IVZB 2WWMC 5HYQA 1NH6A 4FQPA 5J1AA 4HKJA 5E24E 3UTPE 1ZLSL 1AR1D 5ENWA 3HI6H 4AEIL 1BD2D 3QQ4B 1TCRB 4F7TA 1TJGL 2P5EB 1JWMA 4PLKC 1TETL 1NSNH 2H9GB 3TH4T 4KV5E 1P53A 4XT1C 1PW3A 3V4UH 1O7VA 4Y1AB 4B0MM 4Q2ZA 3BGMA 5JHDA 3GI9L 1CGTA 3O81A 3IFOA 1HH9A 3QDGE 4Z78A 3LKOB 1XF5B 5ANMB 2KKQA 4OIAA 1EX0A 2DLFH 4HWZB 3KS0J 1CR9H 1CQKA 3O4LE 4P9HL 3VG9B 3ULVC 1DDHB 3DBXA 1XGTA 4OCWL 4XHJC 2DLEA 4MXWH 3WNMA 3DUUA 1I7ZB 1S78D 3L95B 1WQVT 3KJ6H 1GRWA 5HI3D 1NGPH 1U8PB 5JHDD 3CMOL 3OKLA 3WD5H 3BAEL 5T5FH 4F37F 2A1WH 1XGRA 2H32H 3OJ2C 3L5JA 2EDKA 4WHDA 5EN2B 4IRJB 4DOHE 3ES6A 5IMMA 4KROD 3SE3C 3S3SA 4P2RE 2VABA 1AKJB 4XNYH 1H0DB 4YO0A 3QWOA 3ULSA 3IYLW 4UU9A 3DIFB 3M17B 4W4NA 1MJ8H 3CSYB 5DUMH 2BNQE 3M1BB 4JY5L 1ZT7B 3DGCR 5AYUL 5CINH 5I8CB 3O4OB 4H0IA 1B0GB 1X3DA 4LCIH 3BDYL 4YNYA 3V6OA 4I9WD 43C9B 4MA7H 3BP4A 3K4ZA 2H8PA 3DRTB 4ZS6C 1U8HA 2GCYA 1CVSC 4JO3H 1N4XH 1YECH 3O6FA 4M48L 1CD8A 4YHOL 3HTLX 3VWKB 3WUWB 1DUZA 4JANB 3LQZB 1DFBL 1X4ZA 1UENA 4YDIL 2VSCA 5IGXH 3PNWB 2ATKA 1A6AB 3WHE0 4HDIB 4PJ7B 3S36L 4OTXL 2XTJC 2VLRA 3BWAB 3O6FD 2KL6A 1IAOA 2VERN 5KN5B 5KSAC 4PJIE 5E08H 5GQBA 1FZOA 5IESH 3TO4B 4ODUA 1GIGL 1JWUA 3BO8B 2J2ZA 2D2OA 4M02A 3B8YA 4JFFD 5AZEH 1NC4B 1OARH 1ZOXA 3CZJA 2GSGB 2DTMH 4IOFD 3T09A 1JK8A 4P49A 1KJMA 1EFXA 1EPFA 4MXVE 5DMIL 3LOWA 4TNWF 3I75B 1PBYA 1CS6A 4XP4L 1X7QA 1RZ8B 4LARH 2XNAA 3KLAA 1CFVH 4MQ7B 2KDGA 3R0NA 4U6HA 3MRCA 1ETZA 4G8EA 4M61A 5DJ8B 4MJ6B 3TH2T 3B9VA 1EFXD 4LLQA 5E8OA 2C3VB 5I1LA 4OGYL 4XH2B 1XCTB 1WLHA 2EIZB 1A5FL 3MODL 5GHWL 3MRNA 1K5NB 2MOVA 3P73A 1C5BH 5GGUA 1ZLVK 3RWHB 2UYLB 2WBWB 3PABA 4JFDB 2FJFB 1AQDB 2VN4A 4N90E 3NGBB 3OAUH 4R26L 4LSTH 4JJ5B 2A1WL 3I2CL 1FNEA 1ZAGA 4NO5B 2FJHB 2R4RH 6CGTA 3OB0H 2R0ZL 4WFHD 2BVOB 3KYMB 5I1HH 4P4KA 4LLDB 4UV4H 5C0CE 2BVTA 4J6RL 2I9TB 4NZUL 4PY8J 3EHBD 2NY2B 1J0IA 1AGFB 1QLEL 3MRIB 4DGVH 4P4KD 2MCPL 1T4KB 2VZUA 3JV4A 5I74C 3GK8L 3D0VB 4L3CB 1I8KA 4IRJC 1XGQB 1CG9A 3F5WA 3QZWG 1MH5A 2P8PA 4HWBA 4QWWC 3FTGA 4WJ5B 4OGXH 4JFEA 4NP4H 1I3RB 1AGEB 5C08B 1FLRL 1FZMA 1T6WA 3MBEC 5CBAB 2IMNA 5F7DB 1W8NA 1MFBH 1G9MC 4ODXA 2X1XR 1TZHB 4PRPA 1KBGH 1SMOA 4JFZH 5FUOL 3O4OC 1V7NL 4G5ZL 4ENED 4WO4B 1A14H 2MTPA 2YN3A 4Z7VA 4JFED 4S1DC 3K81A 5FV1L 1U3YA 5E9DE 1T2QL 3CVHA 4TSAL 4FQHA 3L3HA 1QBBA 1YY8B 4FZEL 5SV3A 4Y0GA 2VIRA 5E1AA 3CMGA 4RGOH 4N0UB 3REWA 1QSEA 4PRPD 5MEOB 3PGCA 1K4DB 3TBVA 3CFKA 3FKUS 5I8EB 3NABH 3GO1L 1EEUA 3G5VB 1H8SA 2DQJL 4Y89A 5DJCB 1VA9A 1DBKL 3MLZH 1ONQB 2J8OA 1NBVH 1A6TA 4RBPK 4HQQH 4ODTH 1QSED 1JGEA 2A6IA 2OR9H 3GNMH 2HJFB 2OM5A 3CDGB 5C0GA 3ZT7A 2DB8A 3ECBB 1V8HA 4I2XA 2Q86A 3MOBL 3PDDA 3NCEB 3RU8L 4OQTH 3H8NA 1JGVL 3T2QA 4XNXL 1G6RL 2DM7A 2CRZA 3FMGH 3QDMA 2GW5A 1FNGB 4HS6B 1S9XB 3IF1A 1T5XA 3FT2A 5T3ZD 1LO3L 4H0GA 1UB6B 3HHRB 5IJVB 4N0CC 4PJ5D 4LCWE 3DVNB 4NQCB 1TVHB 4DW2H 1OTSD 4R4ND 3QDMD 4XAKE 5HGHA 5IMOA 2F54E 3VG0H 1IVLA 2CLVB 1AQKL 3O3UN 1CN4A 2PF6A 4UB0H 4JGMA 3HE6B 3M45A 5E6IB 3TYFB 1AXTL 5GS2D 3ARFA 3KXFE 4ESKA 4AZ8A 4KI5C 4NWUL 5HDLA 4P5TA 5D7LE 1R3LA 4YUEH 3ARUA 1F3JA 4FG6C 5FYKU 4AT6B 2ZKHL 5L88H 4UBDD 4G8FA 2ZSWB 2DAVA 4C57C 2AXFA 3F6IA 2HH0H 4W6XB 4PR5B 1UKSA 2XKSA 5F7WC 3HB3D 3VD9A 3BWUC 4X6CB 5CIPA 4Q58C 3LPFA 3NN8A 4CNIA 5ICYB 4JFYB 1YEDA 3MV8A 1VACA 5KSUA 4MB3A 2DM3A 2XZQL 1XF4B 3U46A 1KIPB 4YE4L 4PJCB 1EZVX 3RDTC 1PD6A 4KJYA 1FZKB 2IAMA 4X7SL 4NWTL 4HG4K 2FX7L 4OT1H 2W65B 4LSPL 1U36A 3GSUB 1CF8L 1WISA 1MCDA 3MV8D 2EE3A 1EERB 5JMRA 3CXDH 4G6AC 4OCYL 1MLCA 3HI5L 1OGAB 1KG0B 5IJKC 4K55A 4CW1B 1AJ7L 4XPGL 2IAMD 4R3SB 4RGOL 5HYSB 2Y06H 4IJ3C 2YBRA 5IOPB 4TTDC 1EHLH 4DQOH 4PRDB 4F15C 1B4JL 1WJ3A 4WGVB 3JTSB 4OZGB 3X3FL 1BGXL 2YMXL 2B1AL 4GMTL 1IL1A 5AAWA 1KF9B 2AJUL 2I25N 3EUUA 2GTZB 1TQBC 4L4TE 5FYLH 1KB5B 2E6PA 2D03L 4XWOC 4PJAB 3MRBB 1U91B 5T1DL 4JO4L 4WNQB 4PBXA 1Y6MR 5MERA 5B3JE 1TZIA 4KKLC 2X40A 4LPCA 4UQ3A 4MCZA 1E28A 1GGBL 2ZUQC 3VFNB 1UWGH 1MREH 3CSBA 1L0XA 3P0VL 2AABL 3L7FB 5FK9A 3SKMA 3MREA 2DN7A 1IZKA 2F53E 3THMH 1BFOA 4EI5C 3O6KL 5IV2A 1HI6A 2HLFC 2MFNA 5FYKD 1B6UA 1FBIL 5C0AA 4LCCB 4OIBA 3TJHD 2VZTA 3L3KA 5E2WH 5DXWA 5EU7E 2XTLA 4U6YA 4GRWB 5FHBL 5L88L 4HC1H 3LRHA 1JGUH 1GZQA 3MV9E 3O8XC 3PP4L 1U8QA 2EICA 5C0AD 1BZ9B 4PJBE 4L9LA 1Q9KA 3TZVB 4LSDA 1OLZA 4Z7UE 2ESVA 4IOIA 1HEZA 3HE6C 3RWEB 1F3RB 4NQSA 5SWSA 1EUUA 1D5IH 4IDJH 4JR9H 2QSCL 4QRPB 2X7LB 4KRPB 4TUJA 4UUJB 5FO9B 1H3WM 3VXRB 3FQTA 4NFCA 1HSAA 5JW5A 1PY4A 2J8HA 3B43A 4GKSB 4JZNA 2AQ3A 5J11C 3EYVA 2ESVD 1QBLL 1AE6H 2EH8H 1HH6A 1CLYL 4XP1H 3LN9A 2HT4D 5SWSD 1CDYA 3RUGA 1OAZH 3PWJB 3UTSE 1Q9OB 1SJVA 3QXDB 3GI8H 3LN4B 3W0WA 1R5WA 3C5ZB 1ZS8A 4M7KL 1REIA 4TN9A 1A4KB 1KCVL 3QEQB 1QSFE 2AI0L 4P57A 4PJ9A 2NY5L 4LKCB 4BFEA 1AHWC 4DEPB 4WI6A 1BFSA 5EIIA 2FEDC 1CGUA 3P4OA 3TVMA 2DQUH 3F62A 3KPSB 1NLBH 1EHLL 3W0WD 4TULL 5EOCJ 3CFEB 1QRKA 4NRZA 2ZG1A 4K94H 4PJ9D 3GIZL 2IQAA 2H2PC 4HEPG 5EWIH 3TVMD 1HWGB 5T3XD 1SY6L 2E7LA 3CX5J 1XF3B 1EO8H 4W70A 5C0DB 3MQIA 1RPQA 1RHHA 2P8LB 3FB6B 5FO7B 1CXFA 2X41A 2WQRA 3HPJA 3IFPA 4EBQH 4U1LA 4CVUA 1IC1A 4HPYL 1K4CA 2YR3A 1QFWL 3QHZH 3W9DA 3MCG1 5EZIH 1MREL 3UTQB 3EDEA 5TE4L 2YD2A 3BP5A 3PDOB 1IKNC 4YPJA 1G9EA 1OSPL 3WFBL 1U6AL 3DARA 4D0CA 1P7KB 5BZWB 5IUSA 5GGVY 4MX7B 4I3GA 3PWLB 5BS0A 5JO5A 2JJSA 2WIIB 3AMLA 4UAOB 2ATPB 1B0WA 3Q1SH 3QDGB 4YR6B 1QO3B 5DWUH 1OY3B 2Y07H 1YEEH 3DMMA 5CZXD 2Z93A 3MNZB 2FEEI 3HC3L 1ZT1A 1CYGA 4NJAH 5BS0D 1JE6A 3HN3A 3HR5A 3U7YL 4QYOB 1QLRA 4IDJL 2DJSA 1OT1A 4KQ3H 1EHAA 4YDKL 3GSOB 5IR1A 5C0FB 1A1MA 1P4IH 5D70L 4KJPC 3SJVB 4RSVA 1NFDA 2VISA 5D7KD 5F89A 1FAIH 5MI0B 1MLBA 3DMMD 1OVZA 2VQ1A 4RZCA 1MPAH 5I6XB 1KFAL 3UPAA 2G60H 4YXKL 1UM4H 1FNAA 1BAFH 3WDHA 4YC2B 4P2RB 3WLBB 3TZVC 2MKWA 2DLIA 2UVEA 5E70A 1U3HB 1P1ZA 4MXQD 1QVOA 2MNUA 4HIHA 3KPRA 3VFSA 3F12B 3RIFF 4M7ZB 3HE7D 1KIQB 3UYOD 4GRWH 4KRPC 3RZCB 5I1KH 2R0LH 5ALCH 5FF6B 2FECL 5DI8B 1FYTB 2WW8A 3SO3B 3EFDL 1UCBL 1XAUA 2APVA 4FMKA 1P7QD 5J57B 3KPRD 2FYYA 4GAGL 3MRKB 2XA8L 1I8MB 4K3EH 5IBUB 1JFQH 5CUSL 1G9NC 3C5ZC 5DURB 5I18H 1IAKA 4PJGA 1RK1A 1OB1A 4NJ9L 4DEPC 2FWOA 4IRSA 5GIRA 5GSVA 3N50A 3T0DA 3UX9B 2AS5M 3IDIB 4O2FB 4CMMB 4ODVH 3C08L 5ISZE 4JPVL 4NO3B 3MLXL 1MCEA 3P0YL 5GISL 1WZ1L 1WTGT 4X9HA 5K9KB 1FVCA 2MJWA 1A4JA 4HH9B 5DUBA 3X12B 2W9EL 2EDLA 3AS2A 5JHLL 3LKRB 4NQEE 5DJ6A 4IRSD 1CE1H 3WFEH 3QDJA 5I16B 4ZNEE 5DHYA 3EOBB 1UJ3B 5DHXB 3CZFB 2BSSA 1QQDB 2WP3O 3A6OA 2Z31B 4WUKL 3MUZ1 3E6HA 1T0MB 1NBYB 2CKNA 4PREA 2H6PB 3ZE2E 3GUTB 4KK5D 5IB1A 1J12A 4JLRA 4EDXA 1IQWL 2HP4A 2YSSB 1Z5LB 5ESQA 4WHYH 3ULUD 1GZPA 4O58H 5DK0B 3QDJD 4OCSH 1CGXA 4YFLI 2NR6D 3RKDC 4CDGC 4Z9KB 2DQFB 5CP3H 5HTSA 4XXDB 4OF0A 5D7IA 1XIWA 3OMZA 3MFGB 1T5WB 3JSSA 5I17B 2HMID 2EEDA 1KB5L 1XH3B 3Q1SL 4JDTH 2YPLE 4ZUVA 5HYIA 1JRHI 1QPPA 4LLMA 2VXTL 2NY0D 5I2IA 3IKCA 3ISWA 1XIWD 2D31B 2MWCA 3T8XB 5IVXE 4PTUB 4QGTA 1A3QA 3LVEA 3VA6A 4LP4A 5DQ9A 4NKIL 2CRYA 3NIDF 4DAGL 3L3IA 3SDAB 4WWID 1MPAL 4R4FL 4XCFL 2FCBA 1F4XH 4MWFA 1S7VB 1UM4L 5DSCA 2YC1A 4WEMB 5A2LH 1INQA 3GJFB 1U8KB 3O9WB 1FHGA 3SKOB 3VFOA 3ARWA 4LKXA 4NKMA 4LNRB 2IWGA 2AP2A 4PJEB 2ITDB 2AJZA 1DEEA 2R2EA 3AMKA 4C59B 4CKVX 1NDMB 2ID5A 4FQXA 4HMDA 4EQ3A 5MI0C 3QUMA 2FNBA 1BREA 1SEQH 5F6HI 4FS0A 1QRNE 5EU5A 4RAVA 3PHQA 3A6BH 4PGBA 4LEOA 1RUKL 4YC2C 2D4FA 4K3DH 3D6GA 4U49A 2LAGB 4K3EL 4FQXD 3SQOH 2XKNB 4JVUA 2HLAB 4M7ZC 3GBMH 4U4BA 5D7JA 2CXGA 1MFDL 4HBCH 3DX7B 1T04A 4RGNB 3H3PH 3RY6C 4F37K 1EEZB 5E9DB 4LSVH 4IBLT 2MSPA 5DRZA 3G5YA 3VXTB 1DN0B 3DO7B 3RQ3A 5F7HA 3E0GA 2DD8L 1WV7T 5D7JD 5E8NB 2HT2D 3KYNA 4TQEH 3H9SE 2HFFB 5C09E 2YZ1A 5C8JB 4HGKC 3Q3GA 5C0JA 2PYEA 3VRJB 5EU3A 2VDNL 3G6DH 5DFVD 4MCYB 2EE9A 4RWYH 4F7MA 4XRCB 2DYPB 3IXAB 4I8DA 3VRLE 2NY6C 4ETQA 4O58L 3STLB 5FYJU 3E2HB 4APQB 1JN6A 1JI1A 4UILH 3RTQB 3L9RA 1SBSH 2PYED 4ZPTA 5F96L 2CGRH 3D39B 5HGDB 4KDTC 3AVEA 5EORH 3TESA 2AGJH 4D2NA 1NMBH 3IDNA 3X11A 4XB7A 3L3JA 5FB8A 5FM8A 1DUYA 2B5IB 4P5MB 1SJEB 3FZUD 1S7XA 2FL5B 3WIIL 2BNRB 4MNHB 4KQ4H 4DZ8B 4OSUH 2GFBA 4RQQA 1Q0XL 4Z95H 5ACZA 1WBXA 3NCYP 1MQKH 2Y7QA 2Y6SD 1W0WA 1AGDA 3BDXA 4FFVC 2AXGA 5IF0B 2R4SL 4F2MA 1J1XH 4L8SA 1DQDH 3MV11 3I9GL 1JPGB 4RIRA 4GBXA 5DJAB 1NCTA 2NNAA 1Z9OA 3WIHA 5CCKL 3HNVH 1HHHB 4L8CA 1LO5A 5D7LB 4OZHA 1JPFA 2JJWA 1CICA 2HVKB 2VLKA 5D6DC 4JE4B 3OGOE 4WI7A 4HBQA 1V5JA 2UWEB 1KCSH 3UBXG 3U1SH 1AY1H 1OTUD 2Z8VC 4GBXD 5C6TH 3TBSA 1T66D 2ED8A 4TNWK 3K1DA 4YIQB 3TA3C 3DVIA 2A38A 5IBTL 4KVNL 4XCEB 3WFCH 1CICD 2XWBA 4POZD 2GJ6B 2XXCB 2VLKD 3P4LA 1IJ9A 3M8OH 2CDFB 4HKBB 1JWSA 3GJEA 4TVPH 4ZUSA 2B39A 5JOEA 2PUQT 3L5WB 5I1CL 2FATL 1RQ5A 3S37H 4EN3C 2WM0A 1CD9B 2YPKA 5HHPB 4QOKE 4NNXA 5CEZH 5IROA 1MUJA 3WFDL 2MMXA 3ULUF 4FXGA 4D9QD 2VAJA 1V3KA 1F2QA 4GLRH 4PRAA 3DROB 3QNZA 3P9MA 2AW2A 5D9SB 4LEXH 5ERWB 2ZPKL 4LDLB 1S9YA 5B21A 1E4JA 4Z6AT 4XNMB 4LLUB 3VXUE 4FZ8H 4JM2C 4JHAH 4Q9RH 2QADD 4M6OL 4YK4C 1GPOL 1Y0LB 1H3PH 3JV6A 4Z7WE 5DJDA 1JTOA 1I9IL 3G6DL 4X5WB 2XPGA 1RU9H 2I27N 4KJQD 2VLMD 1H8NA 1JHLL 4NO2B 4ORGB 5D7IF 1MIEL 4PJDB 2NQCA 1UVQB 2KQNA 4ZOAA 2XWTB 5CJBA 3HAEB 1NGWA 2WUCL 1KEMH 3NCYS 5ADOH 1MHCA 1CQYA 1OM3H 3RVUC 3OKOB 2FGWL 2R56H 2CGRL 2XV6B 3DETC 4KKBD 4LNVA 5IHBA 4PY7A 1S7UB 4YQXL 3SY0A 5GZND 1H5BC 1MCWW 3P4MB 2UZYB 4HX1B 4Q6IC 2W0FA 5IHUL 2NW2B 4Z95L 5HHNB 4F33A 1D5ZA 3B9KC 4AM0A 1HNGA 4HXBH 1U8MB 1Y6NR 3D69A 3E2HC 4QF1B 4U7MA 3O41A 4L1DA 4KK6D 1RZJH 3HG1E 3RTQC 4FN0A 5EA0H 5C0BA 2VH5L 2WWKO 4G9DB 3TT3L 1G7PA 1LGVA 5EC1B 5B4MD 4X5XB 5C07D 3JWDC 1I8IA 3HFMH 2AK4E 5F7YC 3ZZ1A 4KHTL 3F7VB 3FB7B 1U95B 1L4IA 3NH7L 2OR8A 1KC5H 2V5MA 5DRXA 4UT7H 3BP6B 3BXNB 4HZLA 1BF2A 4G8GB 4PJXF 5C0BD 1PZ5A 4XCYB 1WZLA 4NQDB 1M6OA 1U8OB 4CUCA 5HXMA 4WTZG 3RX7A 1HNFA 4ELMA 2CR3A 4Z7UB 4PLKD 3QNXA 3VFRB 3WFCL 1HKLH 3T08A 1DQQB 5JHDE 4LGSB 4NN6B 5KOMC 3DI3B 2FDBP 1VDGA 4ZDHB 3G6JA 3WJLC 5DMKB 3MA9L 5C0RL 3U36B 3GSRB 4GAFB 4RMVA 4OFPA 1G7IB 5L8KB 2V6HA 5FKAA 3BZFB 4RDQG 3STBA 1UA6H 4G7VH 1JUFA 3VH8A 4JQVC 5B38B 2P43B 4XHJD 3IXTA 3D48R 4X6EB 4GKZA 4MA3B 5KAQG 1T7WA 3PE9A 1OAKL 3OKEB 3VI4F 2DWEB 3BZEA 1CXEA 4G8IB 3WN5B 3VFTA 4HIIA 3WFZA 4OLZH 2V7HA 3B8SA 2LU3A 1GGCH 2H41A 4KHXH 2Q6WB 2X4UB 1JHTB 4P5KB 2FO4B 1BZQK 4HJGB 4FZ8L 4Q9RL 1M7IB 2A83A 4CN4A 4I9WE 2UV3A 2BOBA 2OLDA 4MGXA 2VZSA 2VC2H 4M43H 4NNPH 5TGBA 1IAIH 3MACH 1RU9L 2RHEA 5GRZA 3C9NB 1T1WB 3BD3A 3BPOB 3V6OE 4N8VG 3LN5A 1G7QA 1MELA 3BKJL 3DV4B 5DMGC 3NPZB 4F7EB 1RZGB 1ZGLB 1LNUB 4EDWH 1Q8MA 3VXOA 4WUUB 4R8WL 1I1FB 3V0VA 4K7FA 1KLFA 1HILB 4AG4H 4RAUA 4LVEA 4NHUB 1X5IA 3GKZA 2OJZL 4V2BA 2OS7A 1BBDH 5T33H 3UP1A 4WU5B 5J13B 1TTFA 2P47B 2GITB 4LMQI 1URLA 5KSAA 4BFIA 4P2OB 3NA9L 4YWGL 4Y19A 2OP4L 1ZK9A 4R2GD 2EKSA 2E3VA 4WV1B 1G6RA 4LPTA 3FT4B 4C55A 5I1DA 1F4WL 1YJDC 4M00A 5JW3H 3BIBX 1K3ZA 2VLRE 1F6FB 3MBXH 5LGHL 1FFNB 1AI1H 1I75A 2XTJD 3LPGA 1UACL 5J9PB 3NFPA 3HFML 3BPNC 1BVLA 3BYTA 1M7DA 3EFFA 5KSAD 3NFSH 5F44A 4Y19D 2AXHA 5JPMA 1UKTA 4ZAKB 4UTAH 3HAEH 3IGAB 3MLYH 1Y18B 4TPRH 4WWKA 5CGYC 2V5SA 1GAFH 4OZ4B 1T89C 1Z2KA 4PGEA 4MLIA 5IVZA 2LV4A 1F3DJ 5LCVH 1RZIB 1QFOA 3KPNB 3OV6A 5HD8D 4YHYC 2EKJA 3JWDL 2NXZC 3JTTB 3AY4C 2IADB 1AO7B 1V3LA 2VXUL 1A1OB 3CC5B 3MLRL 1HKLL 4NPYB 3L7EB 4JHWL 1JZ6A 1MRDL 1ZXQA 2H9GA 4PYGA 4N8VB 4KMTL 4ZFZB 1SJXA 4WFHE 5IK3B 3TN0B 4H25B 2ZNWA 1MI5B 3LKOA 1XF5A 4LSSH 1N6UA 5ANMA 2P5ED 3B6SB 2BDNL 4HWZA 1A7QH 1DDHA 5TDOB 3LQAC 1A7NH 3MZTA 1I7ZA 3L95A 4IHOB 4Y1AD 1CLOH 1U8PA 3OZ9L 3U4EB 4KJWC 1F4YH 3FO2B 2X4OB 3MROB 1DQLH 4FQIL 5EN2A 4IRJA 1H3UA 2FO1A 4YHZH 4KGLA 5HDQL 3BKYH 4K8RH 3RVWC 3V79C 3SGJA 4YDLB 3S35L 2ICWB 1AKJA 1H0DA 2ICEB 1OP5K 3ZDXF 3VXNB 3DIFA 2DMCA 3M17A 3D3VB 3CSYA 3S34H 3M1BA 3HC0B 4IRJD 3PWUB 1ZT7A 2EDYA 3QXWA 1B6DA 5TQ0H 4JFEE 5I8CA 4QWWD 1U92A 5GGRY 3VDBA 1ITBB 3R8BB 3DPBA 1B0GA 3BKMH 1AKJD 1G0DA 1UWXH 4P99A 3DSNA 2BXYA 43C9A 2R1YB 4PRPE 1MFCL 5MEPB 2VDOH 1JVKA 4LQFL 5IB5B 3ARBB 3DVGB 5DF0A 5LAXB 4Z7VE 3DRTA 2ZOKB 4ONGH 2MHAB 4S1DD 4PBVC 3CX5K 2X1PA 2XIDA 5D1ZB 4TTGA 1DL7H 3D18B 1K85A 4RFNB 4Y5VB 3VWKA 3WUWA 1QSEE 1E4XH 2HFGH 1D5BB 4JANA 5KVGH 3LQZA 3ZDYF 3PNWA 2X9WA 4OB5H 4OFDA 1XT5A 3FN9A 1A6AA 2W9DL 2VDPH 4NN7C 4HDIA 4PJ7A 4NN5B 2VDQH 1JYWA 4ELMF 3BWAA 3IDXL 4N68A 5D72H 5KN5A 4P2OC 1GAFL 3TO4A 2IGFH 5GRVK 4M4PA 3VU2A 3BO8A 3VWKD 3QO0B 3DX6A 2IQ9H 2YPLB 1NC4A 1YJDL 5T3ZE 1RIVL 4L8DB 4KKCD 4I2XE 3JWNC 1AFVH 1QBML 2GSGA 1MFEH 3D1MC 2E7HA 3MCKB 4POUB 3VWJB 4HJ0D 3QIBB 2LQRA 2RBLA 3ZHDA 5DK2B 3I75A 3QQ3B 3QDME 3TO4D 1BQLH 3EW3B 5IVXB 4ALAL 5E2UL 3ZKNC 1FN4B 1RZ8A 4MQ7A 1NC4D 2GKIA 2RGSA 3QB7C 4HK3J 5DJ8A 1NFIB 1GXEA 4MJ6A 3IJSB 1P6FA 3QIWB 2ZP0T 5ILTL 4XPBL 2C3VA 5GXBB 3NTCH 4XH2A 1XCTA 2EIZA 5ICXB 5C92A 3OSKA 1K5NA 3MLSH 4JAMB 1D3CA 1A7QL 3K74B 3SGEH 5C7XH 3RWHA 4F7PB 2UYLA 4LU5H 4DN3H 4JFDA 4JFPB 2GK2A 5H37G 2FJFA 1AQDA 4LHUB 1G9MH 3P30L 3CLFL 3BH9B 4JJ5A 4MAYB 3SGKC 5T1LB 3HZYB 4PS4H 3GEWB 3CPLB 4KI5D 4W68A 1IGFL 2FJHA 5GJSL 25C8L 4RNRB 3MLVL 4ZTPH 3SE8L 3TN0C 3ZKMD 2APBA 3QCVL 2BVOA 4YHZL 4K8RL 2YD3A 4JFDD 4EVNB 5DD5H 4HS8L 4XVTH 3RWJB 2I9TA 3WE6B 1TFHA 4L8BB 1AIFB 1WVZA 1CBVL 1ADQH 1AGFA 3MRIA 4XPTH 3MV8E 4RFEB 1T4KA 5IHZB 3GHBH 3I6LD 3ILPB 1VKXB 1HYRC 3D0VA 4L3CA 1JL8A 1IFHH 1XGQA 1KJVB 1N6VA 3BN9D 1NGQL 3T77B 1MF2H 5CJQH 4WJ5A 1JF6A 2COQA 1OD9A 3TFKC 2DL2A 1SY6A 1I3RA 2NY2D 3H9SB 4WEBH 4GQPH 5C09B 5KSBB 1AGEA 5C08A 2P24A 4Q0XL 3ALWA 1MHHB 4ONGL 5CBAA 1P9MA 5F7DA 5E00B 4ZXBC 1MJ7L 2CPCA 3RIFK 1TZHA 4OF7A 3FOLB 4PG2A 4WO4A 4DKAA 3WL9B 3VDCA 4XMKH 5C08D 4U1IB 3NVQA 2WNGA 1YY8A 1I1CA 4TTDD 1JZ4A 7CGTA 2VDPL 4N0UA 1MEXL 4S1SL 4D9LH 3S37X 1S5HB 5MEOA 1K4DA 3BT2L 4WO4D 4X5LA 5I8EA 2G2RB 2J6EH 1R3IH 3IDJB 4Y5YB 1IC5L 3U9PH 3G5VA 2F8VA 1UYWH 5DJCA 4RFNC 4HIXH 4Y5VC 1U2HA 3T4AB 4LFHG 1ONQA 5E2VH 2JIXB 4XWOD 3WNLA 1I1YB 1IM9B 2HJFA 3C6SB 3CDGA 4FTVB 5A2FA 2PTUA 4EUPG 4FQCH 1ROWA 3ECBA 4NN5C 4UI2A 5J4MA 1KGCD 5FYKE 2EXWC 4FRWA 5E4EB 1FNGA 3GM0A 2DQEH 4HS6A 3K0WA 1S9XA 2AJYL 1CFQB 3NTCL 1DLFL 3QIUB 3MUY1 1UB6A 2AEPL 3VWJC 2IJ0C 3QIBC 5C0AE 5IJVA 3TBYB 4ZUUB 3DVNA 4GSDH 4NQCA 1TVHA 1A3RL 1YNLL 1T83C 3U2SA 2CLVA 5CGTA 1LWRA 1E0OB 3QIWC 4FABH 5E6IA 32C2B 4MS8C 2QBWA 2Y36H 2H1PL 3LB6D 4PTTB 3O2VH 4NQCD 4ONFL 3UC0H 4B50A 2BRRH 4AT6A 3M07A 1UEMA 2ESVE 1IKFL 1RUQH 2FJGB 2ZSWA 4LPVA 1CL7I 3LEVL 5SWSE 1U3JA 4HV8A 3HE6D 2RFXB 4O4YL 5E6ID 4KU1A 5SX5H 4PR5A 3GSXB 4ZSOE 2E6JA 5GS0H 2GY7B 2JF1A 4OFIA 4X6CA 2HWZH 5JTWA 1VEMA 1UEYA 3FO9B 2XZAH 2MQCA 3RKPA 5ICYA 1LE9B 4JFYA 4MZ3A 4LSQH 1T22B 1M1SA 3RUGE 3JV5A 1XF4A 2YK1H 4M7LH 2VOTA 4PJCA 3GSNB 3P2TA 3W0WE 3NIDE 5LKNA 4I0PC 5DR5L 3PGDB 3FB8B 1FZKA 3DUSB 2WQ8A 1SM3L 3BH8B 4ACPA 2W65A 4PJ7F 2UY6A 3GSUA 4LL9A 4K7PL 1KELH 1PG7H 3HRPA 2NYYC 5J3HC 5T3XE 4X7CC 2DDQH 1BF8A 1EZVY 4QT5B 1OGAA 3PIQB 1KG0A 5ETUB 4CW1A 3HZMB 3UZEA 4YHPB 4R3SA 2EO9A 5HYSA 1CDBA 1FLTX 4NC1C 2VL4A 5IOPA 1LO4H 5EBMB 4PRDA 1FH5L 3JTSA 4OZGA 1TJIL 3U9PL 5BCAA 3HZVB 1RURL 1Q1JH 5DHVB 1OGAD 3MRRB 1R24B 4MMZC 2WANA 2BY0A 4AL8H 3SDDB 1UM6H 1J0YA 2GTZA 3HG1B 5FA4B 2N56A 3D9AH 5MHSD 5ALBH 4LCYB 1KB5A 1CD0A 2ENSA 4Y4FB 4PJAA 4MD4B 5GRJL 3MRBA 3MZGB 4HK3N 1PJ9A 1IKNA 2N4IA 2AK4B 4OLYH 1U91A 2OMBA 3KAAA 1NCDH 4Y5YC 4WNQA 1CTNA 4NRXB 4FMFA 3GMPB 1L7TL 3ELAT 1J5OL 4TRPH 5IFAL 5CZVH 5I8KH 1N8ZB 3VFNA 4BZ2L 4AENB 4F7TB 2JB5H 4CMHB 2ZCHL 1JWMB 1MCPH 4F58H 4WRLA 2JKXA 3SOBH 4OF8A 3EAKA 2J4WL 5AEAA 5DZNA 2WBJB 3W11D 3B2VL 3QXTA 5BS0E 1HCFX 2AJSL 4CVWA 1S8DB 4RGMC 3R1GH 5DUPH 1PFCA 3MGOB 4LCCA 4A2LA 1QZ1A 3QIUC 1FV1B 5D7KE 5ADPL 3ZL4H 5DRNB 5A2KH 1XGTB 1QFUL 5E99H 1MFAH 3DOSA 4PBWD 3DUUB 1F00I 3U30B 1KCLA 2HKFH 2CJUL 2PTTB 3T4YB 5KBNC 1BZ9A 2OYPA 4JN2B 5JQHC 4M1GL 4X7DC 3TZVA 3QFJB 1QNZL 4KJPD 3RWEA 1X5YA 3S3JA 2AAVA 1PSKH 1LDPH 4QRPA 5T1MB 3BDBA 5CJ5A 2X7LA 2VDLL 4UUJA 5FO9A 1TIUA 1Z9MA 2HG5B 3MXVH 5TQ2L 3VXRA 4QRRB 4GG8B 1BIHA 1GHFL 5DJXB 4ISVB 3TZVD 4EQ2A 4GKSA 3KPRE 4BQCA 2AEQH 4YXLH 5L0QC 4I0CC 3NPSB 3PWJA 1MVFA 1Q9OA 4QRPD 3QXDA 3WXVL 3T2PA 3LN4A 5IIEB 3ARYA 4KRPD 1KELL 4JDVB 3VXRD 3C5ZA 2CMRH 3MXWH 1A4KA 3QEQA 2DBJA 5IWLC 3SCMB 4U1JB 4LKCA 1VHPA 5EO9B 3QUXB 2XACC 4FNLH 4I77H 4I5BB 1TPXC 4M7JH 5BXFB 1PAMA 2OZ4H 3KPSA 4HD9A 2DIAA 4WFFD 3UEZA 4TSCH 5HHOE 3C5ZD 3CFEA 3QEQD 3UCRA 1C1EL 3T0EE 3TIDB 2ZUTA 1JNNH 4QNPF 3FN0H 3GHEL 4X8JB 4X4ZA 1B4RA 2E7BA 3EOTH 4AEEA 4AL8L 1ZHBB 5D1XB 4JPWH 3KPSD 1Z3GL 5JUEH 3ZO0A 1JGLH 4NC0B 1IEBB 5LQBL 1KCRH 1NGYB 4UDTB 1XF3A 3ULUE 1BVKB 3QDJE 4YX2H 1UWEH 1I9RH 3BX7C 3FB5B 2DIBA 5C0DA 3V6BR 2HVJB 3LS4H 2P8LA 3FB6A 3RNQB 4U6TA 5FO7A 8FABB 2ZJSH 2W0LA 5D1QB 1F58L 5HGAB 3WXWH 3LPWA 5EH1A 4TRPL 2DMBA 3SDDC 4HCRH 1F42A 4LVNB 2DM2A 2GJZB 3UTQA 4JCMA 1AR1C 3ZE1F 1I1AB 3UJTL 3KLAB 3SOBL 2OL3B 3PDOA 3RKDD 2EDWA 5D7IE 2ZCKL 1J0KA 4L5FL 1NAMH 2VO5A 3B2UD 2R2BB 1P7KA 4HUKB 2UVFA 2C1OB 4MX7A 5F7EH 3P73B 3PWLA 1NANH 3ZL4L 4PGDB 2WLYA 2WIIA 1UGNA 4X6CF 1PGRB 2HYMA 4X83A 4KZEL 5BMFH 1I85A 2ATPA 4XCNB 4YR6A 3QDGA 3BEVB 1ZEAL 4U3XA 3LMJH 1J05B 5HI3C 3MNZA 3KPLB 3I85A 1G9NH 4PJCF 4U0QB 1IGYA 4XPFH 2VZVA 4QYOA 1P7HL 1FL3B 3GSOA 3QDGD 5C0FA 3SJVA 4PPTA 1L9MA 3KYOB 4XMLL 2FR4B 4YXLL 4U3CA 3WLBA 4Y4HB 1U3HA 3IFLH 1NLDL 3SJVD 3F5WB 4L9DA 5TDNB 2MPAL 3F12A 5DQDH 3HMWH 4PB9H 1KIQA 1JV5B 3CCHB 3RZCA 3MCLH 2F19L 2B8OT 5FF6A 4FNLL 4H1LB 4P2RD 4I4WB 2ARJB 1FYTA 1FZMB 2F5AL 5I1GH 4JB9H 1U3HD 4BFBD 2AK1L 2Q76B 4CU7A 4GXUN 1GC1L 5I1AB 3BZ4B 3QEGL 2IG2L 3MRKA 1I8MA 3FN0L 2EC9T 4DGIL 4LP5A 3EOTL 5E2TL 1MJUL 3CVHB 3GZKA 1FYTD 2VB5A 4Q9QL 4KC3B 1JPTL 2A6JB 3GSNL 3IDIA 3REWB 4XP9L 4O2FA 4CMMA 3LS5H 5I30L 3EBAA 1QYGH 3H6JA 3VI4E 3QH3B 4UT9L 4NO3A 1D5XB 4GQ9H 4W81A 5DURD 2PYEE 3O6FC 5K9KA 4HH9A 3X12A 1Q94B 1DQMH 2XN9B 3LKRA 5I16A 2F58L 3WXWL 2HA1A 1LEIB 3EOBA 1UJ3A 3JV0A 3CZFA 5D1XC 1QQDA 1JGEB 5K9JL 4PRHB 1IGMH 2Z31A 4IOFC 4M9PA 4NKDB 1T0MA 1UH3A 1NBYA 2BY1A 4ZOEA 2H6PA 5F6IB 4PRNB 3GUTA 4QHKI 4NQTA 3UTOA 5CD3B 2GSIB 2VSDA 2YSSA 1Z5LA 4DFIA 4GRWF 4CVZB 3T1FB 5DK0A 1I3GL 3QUZA 4GLRI 4OI8A 2Z31D 1IT9L 2DQFA 2R69H 1KN2H 2H2SD 3G08B 5EO0B 1T5WA 4LVNC 5I17A 4JKPL 1XH3A 2XFXB 1PKQB 3MUHL 5KSVB 3MA7A 3U0WH 3C6LB 2V17L 3PXJA 3WFHB 3KNBB 1DSFH 3E8UH 4JPIB 4TSBL 2DMKA 1X5KA 4FFVD 1Q0YL 1N3NB 4MHHG 4IDLA 1ZA3B 3ARFB 1K8DA 2D31A 3IDUA 1TTUA 1JGDB 3T8XA 4P5TB 3HMXH 1R3LB 2WP3T 4OZHE 3T65B 4PTUA 4M9OA 5IQ7H 2VLKE 4HUNB 1NFKA 3EJZD 4FQJH 3SDAA 1BWWA 2AXFB 4X9IA 5JDSB 1A0QH 1NGXB 1FJ1B 3GJFA 2WMPA 3EZ8A 5CIPB 3O9WA 5AD0B 4LNRA 1DCLA 5FCUH 4PJEA 2ITDA 1U8IB 3SDAD 4JO1L 4C83A 1VACB 1NDMA 2J5LC 4D9QE 1V7ML 3MCLL 1MHPH 1N7MH 3DX8B 2EDRA 2ZUVA 4KUZH 3PXHA 2NY4B 1U58B 2GYSA 2FBJL 4KKAD 5KZCB 3QUYB 4XBEL 1VFAB 3BOVA 3O9WD 3OKYA 3BQUA 3P9LB 1N5YL 4NZJA 3KYAA 5BO1H 4BA8A 4QRQB 2XKNA 2VLJE 1FGNH 2HLAA 5FYJE 4M6AA 1I8LA 1JI2A 5DC4B 2B4CC 2PNDA 5L6YH 2JB6B 2VLME 4NYLA 3DX7A 1KJ2H 1KYOJ 4MZ2A 3OJVC 3D0LB 4IMLB 1EEZA 1K9TA 3VXTA 1DN0A 3DO7A 1X5XA 5JMOC 3S7GA 1T2XA 4Z0BL 2XZCH 2DQDH 4RFOL 1F8TL 5E8NA 3RWIB 4GW4B 2QR0B 4XMPH 2HFFA 1IBGL 3CIQA 4OFVA 3VGEA 5C8JA 3BRGC 4HJJL 4RGND 5DRWB 3VRJA 1IGML 5E9DD 3CD4A 4H1LH 3OGCB 4OD3H 2YA0A 5HHXH 4IM8A 4QXGH 4MCYA 2ZOLB 1WCQA 1F90L 4XRCA 2DYPA 4GS7B 4Y16B 3IXAA 1A7BA 3MJ9L 1NCBL 3DWTA 3ZDXE 4PGZA 4APQA 4KAQL 3DETD 4P3CH 3RTQA 2EYTB 4DGYH 1VFUA 3D39A 5HGDA 4BQ6A 5T1KB 1KN2L 3FAWA 1E28B 5GZOC 4JO2L 3KWWB 5IQ9B 3OJDB 4YHMH 2DYPD 3IAQA 4YHLL 3GMQB 3V4VH 2Q7YB 2YRPA 1SJEA 12E8L 4ZS7H 2FL5A 4WI4A 4APQD 3ZTNL 2BNRA 4K9EC 4MNHA 3MREB 5C0BE 4DZ8A 2CD0A 4JN1H 3RTQD 3MJGX 1IAII 3D39D 5KW9H 1OTSC 3WDIA 2AVGA 4HWEH 3QBTB 4L4VE 1JZ7A 3PWVB 5IF0A 1NKOA 2ERJB 4HPOL 5FXCH 1QHPA 1M71B 5JIHA 5BW7A 4U1KB 2DBLH 3PWPB 4FP8L 1JPGA 2V5YA 3A67L 4JFQB 3ZDYE 3C6LC 1HHHA 2OL3L 1RULL 4UBDC 1LO0L 2EDJA 1S5IL 1RVFL 1DR9A 3FAXA 4ELME 2HVKA 4D3CH 1RUAH 2WUBH 2UWEA 3ARFC 3EO9L 3BPCB 4JQVA 2AQ1A 3O2DH 4P5TC 4ZSOB 1M05B 4YIQA 4K2UL 5D7LD 4ZODA 1BFVL 3WO3B 4J3OC 4DJMA 4XCEA 3KYKL 4KUZL 4LLVB 2GJ6A 2VR9A 2CKBH 1ZMYA 2ADGB 1W72H 1OWRM 4BH7B 4HKBA 3WSQL 1KNOB 4DKDC 1J11A 2HRPH 1JF5A 1PQZB 4WVRA 3L5WA 1OF2B 1EGJL 5BO1L 3SN6N 5FGCB 3NIFE 4XVJL 4LRNH 2P44B 4XNUL 4JGJA 5HHPA 1DZBA 4OZFH 2GJ6D 4OBSA 4HMCA 4PJ8B 3WNOA 4QXWA 3T0VA 4RAHA 3NZHH 1FDLH 3QXUA 4HLZG 4KK8C 1OOAA 2IAMC 3DROA 2I60H 1HHGB 3K2UL 4KPHL 5D9SA 5ERWA 2QLVB 3NACL 4XNMA 4JREB 5CJOH 4HWBL 4OCXH 2VXSH 4Y7MA 2B4CL 1Y0LA 5IM7B 3NCJH 5JA9A 3MRLB 4F3FB 4X5WA 4NO2A 4ORGA 4PJDA 1UVQA 2L4OA 2LE9A 4XZUB 2XWTA 4OZIB 3HAEA 3I3DA 4EI6B 3I84A 1EJOH 1JCKA 5CHNB 3OKOA 3O6MH 4P3CL 5E95B 1WWBX 1EHXA 5EBGA 2A77L 5EOCL 3CVHL 3GRWH 1S7UA 4Z77B 4Y19E 4OLWL 3P4MA 3RY5A 2JELH 1S9WB 1HXYB 3LEYL 4HX1A 1OAQL 5L9DL 1MCFA 2NW2A 2YD1A 5TFSL 5HHNA 2RCSH 1T3FB 3MLUH 4B7IA 4LSUL 3MUGB 4QF1A 3BKCH 5JXEA 4P9ML 3UPRB 5KG9B 4LSRH 5K9QG 1AD0B 4G9DA 2KUTA 1L9NA 1RV6X 5EC1A 6FABL 3OB0K 4ORZC 3TJHC 1GCFA 4X5XA 5IW6B 4H8WC 3DYMA 3F7VA 3FB7A 1FRGH 5CGYD 1U95A 1LO2L 1FG2B 4UNVA 4PJEF 4K9EL 5JXED 4GUPB 4L3EB 2Z93B 3BXNA 2QL1A 4G8GA 1EAPB 2ADFL 4P59L 4XCYA 5DT1H 4QHKJ 4JZOB 2EIDA 3FRUB 2ARWA 2A73B 4NQDA 3VA2C 2OR7A 1U8OA 2ERJC 3OAZK 2D7PA 1GGIH 4M4RA 1MHEB 5KVDL 4Z7UA 2QQLH 4Z76B 1DQQA 2UY7A 3EYSL 4G8GD 3KJ4C 4DVRL 4L9LC 2DQHH 4G6KH 4NQDD 4ZDHA 5TJWK 2QEJA 5DMKA 5ANME 3O3BB 3GSRA 1P1ZB 3E3QE 1G7IA 2O26U 4OM1H 1LILA 2GTWB 2WWKT 3BZFA 4YHKH 2E6QA 4K8RD 1FSKC 3QWRA 4U6VH 1YEJH 5B38A 1I9JH 3SE9L 1A47A 3FQUB 4O02H 2G5RA 4ZD3H 2K3TA 1JMZA 1PY9A 4X6EA 4MA3A 3OKKB 3F7PC 2KPNA 1XR8A 3OKEA 3P11H 3OBAA 2DWEA 2JE8A 4G8IA 3WN5A 3HC4L 5EOQH 4HFUL 1ACZA 1P4BH 1HINL 3F58L 3LRSB 1DTUA 2Q6WA 2X4UA 4P5KA 4P0DA 4U2ZA 2FO4A 4BFGA 1JBJA 4HJGA 5TE7L 1O5DT 2NTFB 4PJ9C 3O3DB 2BSED 5HHOB 3NOIA 1I4FB 3V6FB 3T0EB 4XC1H 5HPMB 3FFDB 4F7CA 3RGHA 3UJIL 3C9NA 1T1WA 3TO2B 4NUGL 3IFNH 4XNZC 3EDFA 3RWDB 3SGEI 3KGRA 5D96B 4E5XB 1G84A 1UB5B 3WEXB 3DV4A 3U79A 1OSZB 1RZGA 4F7EA 5I73B 4G80B 1FP5A 4O5LH 3WV0A 1ZGLA 4JREC 1LNUA 3ZE0F 4WUUA 5GGTL 3GRWL 2YWYA 1S7SB 3TV3H 5HJ3B 4X9BA 3SBWA 4X4YB 2E7LC 4GJTB 1IAIM 5E8EB 2J8UB 1HILA 5DD0L 4NHUA 1JYVA 1RZKH 4BZ1H 5KVEL 4WU5A 5GS1B 1SQ2N 1VFBB 4W6WB 2GITA 4HXAL 1RJYB 2RCSL 4P2OA 4AMKL 5L7XL 4K23L 1T1XB 4GXVL 4WENB 4WV1A 3EYUH 3FT4A 4EXPX 4PJ7E 2DQCH 5D7IB 1J18A 2VXQH 1FFNA 2IBZY 2HN7A 3LQAH 2UWEF 2D9QB 4P2OD 4WW2A 4N5ED 2AJVH 4ZAKA 3I6GB 3IGAA 1Y18A 3GBNH 5EUOF 4OZ4A 2FLRT 3QAZC 3ZKQD 2X4NA 5CZXC 4LASL 4I18B 1CZ8H 5GGQH 3VGAB 1BOYA 2E27H 1TITA 2BOCB 1RZIA 2JJSC 3I50H 3KPNA 1PDKA 1WWAX 1NKRA 4BKLB 3SDCB 1MIMH 4H26B 3JTTA 5IKCB 4ZAKD 4QTHB 2IADA 1AO7A