3MBED

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
236
structure length
236
Chain Sequence
AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSWDRAGNTLYFGEGSRLIVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 236
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeD02
1X4ZA 3MV7D 4PBVC 3EGSB 1YMMB 1ZMYA 1CIUA 3OAYK 5I1EH 2IPTL 3ARFC 2VLJD 3SGJC 1IKNC 3S36X 1RUMH 1EERB 3UTQB 2R8SH 1BM3H 2EDNA 4HLZG 3WLWC 3PDGA 2GUOA 5L88H 1QEWB 5IQ7L 5EC2A 3K81A 5FV2A 2GHWB 3MPCA 1RJLB 4WHTB 1R3KA 3SGKC 4KTDL 4LVNB 3A67H 3F6IA 1CVSC 1S7TA 2JK5B 2YPVL 3PXHA 5DRWB 4PB0L 2DI9A 1KULA 3R1GL 5HHPA 1IGCL 3D69B 3CU1A 2MCG1 2XFXA 5KSAC 4Q74A 2NMSA 1S5HA 1OT1A 2EC9T 1BQHB 4F2MB 1FAIH 4DN3H 1TJIH 3OL2A 1MHPL 5I66B 5H37H 2ZPKL 1AQKH 3RIAF 1E4KC 2DQHL 1MELA 1DQMH 4G8FA 2NXYB 4JM4L 2VLME 1UCBH 3ALWA 4HWBL 1A6WH 1VENA 3OKNA 2CXGA 1LO4H 4IMKC 5I1IH 4IIQC 4LVEA 3UDWA 4GXUN 4QRPA 3QPQD 1I8MA 1HHGA 3C9NA 5DMGD 5IVXB 3STLA 1CFTB 1XIWA 4JQXC 1OAYH 1EAPA 1U8NB 4JAMA 2F15A 3OTTA 3VGGA 4XI5D 5CSZA 4YGVB 3EJZD 1N5YL 5C0AA 5CLWA 1FYTB 4UOJA 4HK0B 3TT3H 3HS0B 2VJXA 1FH5L 3WUWB 1FFOB 3NIDF 3OXSB 1HOCB 2HVJB 3OAUL 4CVXB 5BQ7A 1KFAL 1KEML 5EU6E 1XR9A 3CFIC 4PJDF 2APBA 4PGEA 1HNFA 4TRPH 4FQPA 1FZOA 2BOBA 3LD8C 5TDOB 5F7EL 2ZCLL 2CDGA 1U8PB 5CWSA 1MIML 2H26A 2HJLB 4L4VB 5T1KA 2JCCA 1JYXA 1T22A 3QDJE 1LDPL 1GGIH 3CU7A 2FB4L 3BWAB 2E27L 2KL6A 2W07A 3VD7A 2H1PL 2EDFA 4APQB 3OBAA 4S1RL 2QV2A 4RGNE 5BVPL 3ETBF 4YWGH 3T0EB 2HYMA 1TJGL 3QXUA 3VG0H 3VXOA 3WD5L 3PV6B 5DO2C 4EN3C 4OZGB 4TYUA 1PVHA 1F3JB 1V7ML 3KPTA 1V3JA 2ZJSH 3NACL 1BFTA 1QR4A 4X0KA 3F62A 3LAFA 3OXRB 3KDMA 5MP6H 3U7YL 3DECA 4WTWA 3ULSB 5JHDA 1U95B 3QG6A 1IL1A 3HC3L 3RL2A 5FDWA 2R2CA 1D6VH 4DZBB 1FE8H 3STZA 3FO1A 3WFCH 2QLVB 3Q1SH 2EDEA 1HI6B 2PKDA 3MRPA 1KELH 4RZCA 3WNMA 1K6QL 4K71C 1EVTC 2VQTA 4OUOA 4QRTA 5DRZB 1WJ3A 3OKYA 4WY7H 3E8UL 1H3XA 3W0WE 2WSKA 4PLJC 5D7IA 1X5YA 1OP3H 4LOUC 1BJ8A 1G9MH 3QQ3A 4HD9A 1QQDA 4XPTH 4M1CC 1G6RA 4QXUL 4F7TA 3VFOB 1V3LA 1S78D 2XQBL 3VI4F 4GAYA 4EVNB 1MVFA 5KW9L 4Z7UF 3CFCL 2UWEE 3DIFB 4HFUL 4XNMA 5D1QD 1JN6B 3B2UD 3MFFA 1OM3L 4J1UB 4R4ND 3LN5A 4J4PD 3ZSTA 1GPOH 4QCIB 4MXQC 4WFFE 2E7BA 2VITA 1U6AL 1VEMA 5B22A 1JF1B 1MQKL 1X7QA 1HWGB 2BNRD 2I9LB 3C60D 2VDMH 1NFIA 3THML 5I17A 1E28A 2CRZA 5GRJL 4ZFOA 2AJXL 3QXAB 1V7NH 4Z95H 5T1DL 3P9MA 5EZLA 2EYRB 2P4AB 1IE5A 3AS2A 4EDWH 2B8OT 1E27B 4IRSA 4PJIE 5ETUB 5GHWH 4XVJH 3TBVB 1JPGA 5E7FA 3BN9D 3MLPA 1TVDA 2NTFB 1DANU 3HC4H 1JPSH 4RAUA 4FQXD 5E2TH 5IHUH 5HY9B 2E9WA 4M02A 5TPWH 3N1FC 5E6IB 3L1OL 4U1GB 1Q0XL 2LVCA 4W70A 1NMCC 3ZDXF 1INQB 5TGBB 3VA6A 4PY7B 1C5BL 2LTQC 5IMOA 2YMXL 3MODL 3S96A 4RMQA 2J8UF 3U82B 5C0FA 2NX5E 4JFEE 1T03H 2FGZA 4KXZI 3OKLA 1BVZA 1QA9A 1S7QA 4I5BB 4R90H 1MY7A 5ICXB 5LBSH 1E6JL 5K9JL 3GBML 4PJFE 3QIWC 1ZSDB 1U36A 3DX9B 3MJ8A 5FHBL 4BSVA 2VXTL 4G9FE 4F33A 4N1HB 2AJYL 5A2FA 4MCZB 2APTA 5F1NA 1NCBH 3O4OC 5F3BB 3SQOL 3IU3A 4IHOA 3SCMB 3L7EB 1FZMA 1QFWL 4ONFH 3GK8L 5DVOA 1YEJH 3KNBB 2R2BB 3UTZA 1CDJA 1NCNA 3SO5A 5J9PB 5CMAA 4MJ2A 3DX6A 5DGQA 2GEEA 1H8NA 4YEFA 3DO7A 3P73A 1JZ8A 4R96A 3AC0A 4Q6YA 2HT2D 4C4KT 3LEVH 3O6KL 5JMOC 5A3IC 5INDB 2EE9A 2B1AH 4YDJA 1FCCA 4U1SB 5IWLA 4YIQA 3MACH 5ALBH 3EZ8A 3MV7B 3DUUA 5ICZA 3GSOA 2Z93B 4LL9A 5L0QC 4QRRD 5J3HC 5L8LB 2VLJB 4M43H 4GW4B 5F88A 3T77B 3U7WL 1KJ2A 1W72L 3BKML 2Q3ZA 4H0HB 3D3VD 1G7QA 3H7BA 2DQGH 2GCYB 3R06B 3VWJA 4RFEA 3TVMC 3UO1H 2BNQA 5EBLB 3PL6C 4ZUWA 4OCWH 4LBEA 2YD5A 3CVIL 3KVQA 1FN4B 3T04D 4R4BA 1QBBA 4XB8A 4OLXL 3RWFA 2LVEA 3QULB 1JRHI 2P5EE 5MERA 3DX8B 5FYKE 4NM8H 4M9OA 5EOCH 3RGVA 4LLDB 3UYPA 4WWKA 4MQ7A 2Y06L 3LKSB 2KZ1B 1KUMA 3K4AA 3V9FA 4WEBH 3EUUA 1LO2H 5DJ0B 5IEHB 1HILB 2AK4A 3RKDD 4TULL 5TH2B 3B5TA 3C5ZC 1X44A 3EJJX 4YBHA 1YECL 1JI1A 4ZDHA 1SJVA 2COQA 1UWXK 2EE2A 3HMXH 3JV6A 3UC0H 1RSFA 5I18L 4HGWB 1QRNE 1LD9A 1AC0A 4NQDA 1IEBA 4LU5L 4GSDL 5CJQH 4FS0A 4JB9L 4YBQD 4WFED 1F45A 5ACZB 1NGWA 5CP3A 2GAZA 3PJSA 5IUSA 1CT8A 3DV4A 3DLQR 5GJSH 2A1WL 1P69B 4UINH 8FABA 1OAQH 1KYOJ 1C1EL 2A0LD 4OCXH 2ZOLA 2XOTA 1D9KC 5D2LA 1Q9OA 4ODTH 1OTUC 1RMFL 2HFGH 1A7RH 5D7KD 5JA9A 1ZVYA 1GZPA 1F3DH 1Q9KB 3RPIA 3DARA 5I1JH 1KOAA 2XKNB 3BDYL 3H9HB 3U9PL 3R0NA 4PFEA 3BEWA 3AREC 4RAHA 1I7RB 1JWSB 3AROA 3BGMA 4LF3A 1DE4B 3EZJB 3U30C 2X70A 2EXYC 4L8CB 3VWKA 1HDMB 2YK1H 3DWTA 1DBJH 3GJEA 3QDAA 4GS7B 2G2RA 3F58L 3IJSB 1TQCB 5T1MB 3WFDL 4PBWD 2IEPA 3QCTH 1JNJA 1N7ML 3WUZA 4R26H 4RNRA 2ZCHL 5C0BD 1JGUL 4TOYL 1QO3B 1HKFA 3TZVC 3LPWA 4YK4C 5FK9B 1DJSA 5HXMA 4LVHC 1YEGL 1AD9A 3TN0C 4Z76A 3BQUD 3CZFA 3BXNB 1MEXL 4JPWL 4UNVA 2KKQA 5ERWB 1XF2A 5DEFB 1VFUA 3FAWA 4MA8H 5E2UH 2J2ZA 5EB9A 1WBXB 1R0AH 4CU6A 5BW7C 3VDAA 1ETZB 1S3KH 4MS8D 3KPPB 5GGRA 3ILPA 3V5DA 1BJMA 3VFMA 1MHCA 1OLLA 3GSQB 3TH2T 3UP1A 4OGAD 2UZYB 3S35H 1EK3A 1P4IL 4KK8D 4PV9B 1I7UB 4YH6A 5EUOF 1OP9A 1FNAA 4WUUE 3RU8L 5D1QB 5CEYB 4KRLB 5H35B 5DC9B 2IAMA 4M5YH 4S1SH 4L4TD 1A7QH 2XRAH 4LRNL 4JY5L 1LNUB 2GKIA 1O0VA 2XWTA 2BNRB 4FQIH 5E5MB 3VRLE 1QSZA 3FT3B 3C60B 5C70A 1RK0B 3L95B 1U92A 4R0LA 4H0IA 1V5JA 4NZJA 4RGNC 2DQCH 3MRKA 5EOTB 4EJ1C 4U05A 3O3UN 2VDLL 1I9JL 4L9LC 2D03L 4I0CC 5IB1B 2IPTH 5IV2A 3TGXA 4IOIB 3RDTD 1X5HA 2ZUXA 3MV9D 1RAMA 2Z31A 4HZLB 2H2SD 2WWMC 1S7VA 5IQ7H 1UA6L 1EUTA 2Q20A 5J4MA 2APFA 2YD1A 4OFDA 3DMMD 4NKDA 4MQXD 5C7XL 3FFDB 4KTDH 4P46B 4C56E 4X5WA 4X98A 1RZKC 3UPCA 1P2CA 4PB0H 4BQCA 2WNGA 2GSIA 3QHFL 3R1GH 2N56A 3UTTD 4ZUSA 5GISL 1IGCH 1NDGA 1RUPH 4XC1L 3OZ9L 4M5ZL 4HUNB 2IALA 4PRAB 3GSXB 5TF0A 5SWZA 2KPNA 5A16A 2JJWA 5FO8A 5CSBA 1L7IL 1OL0A 3QIUD 5C0DA 3EJYD 1MHPH 5ISZD 1IAMA 2DQHH 2PTTA 3GUTA 3CXHK 4LRIC 4JM4H 2XTJE 5C8JB 3ROOA 1CICD 4HWBH 5C07A 3WO4C 1KB5B 3VXSD 4KDWA 2HLFD 1RI8A 3LSOB 1CG9B 4N5ED 1J8HE 4KKAD 2K7QA 3CK0L 5FKPA 4KROD 4IS6B 2A6IA 1TQBC 1ZHBB 4W6XB 3WL9B 3MV8D 2HFFA 1G0XA 2KQMA 1N5YH 1PKOA 1ZV5A 1FH5H 4K3DL 5GRWA 2GY5A 3OAUH 3G5YA 1HH9A 1W0WB 4PJ9D 1KFAH 1TETL 1KEMH 2DLGA 2ZUVA 1SVCP 1OP5K 2C7UB 1L0QA 4PJ7B 3QUZD 1FQ9C 4JQVC 4HC1L 3BKCH 1XGUA 3P4OA 2ICEA 1WV7T 1ZT1B 4QRRB 4KK9C 5F7EH 2ZCLH 3V6ZB 1KN4L 4Y5YC 2UY6A 2E7HA 1MIMH 3D3VB 3GI8H 1RU9L 1PD6A 3TNNA 1LDPH 2DD8L 4QNPF 4PRNA 4TVPD 2FB4H 2ZNXA 2E27H 1R3LB 2VIRA 1ZS8B 2XA8L 4S1RH 4OCNC 4UBDC 4D9RD 5BVPH 2L7JA 3QEGL 3G6JB 4FXGB 3MGTA 4X6DE 3QXDA 4L3CB 3CAFA 2ED7A 3CZJA 3RZCC 3TCLA 1PGRB 4L3ED 3MC0A 3N1QC 4I4WB 3ELAT 4NUJB 1V7MH 4XRCB 4LLUA 1RFDL 1X4YA 3NACH 3U7YH 3L3JB 2Y9RT 3I6GB 4PP2B 4ZPTA 5F7MC 3O2WL 2E7LA 4KH2A 2Z92A 4GG8A 3ARGB 3SDXE 3HC3H 5C6TL 1UADC 2DIAA 1A2YB 3BPNC 3QWRA 3MRMB 4ORGA 3BUTA 4M1DL 3TH4T 1BOYA 4XBGA 5SWQB 5DD6A 1XF5B 3CFEA 5IHBA 1FDLL 2RFXB 3S35X 2I07B 1W8NA 1K6QH 4ZTPL 3BKYL 4G6JH 5DUML 4IM8A 3CX5K 1FVEA 1VB9A 4JFDA 4OBRA 3ZE1E 3ULUE 4MX7B 3ARDD 4DGVL 1CTNA 1DEEB 3OR7B 2FCBA 4HJ0C 1J10A 1SM3H 3WS6A 3F7VB 3KYNB 2XQBH 2Z4QA 1U8QB 5KW9H 3ZE2F 4BH8B 4L8SC 1JZ3A 5I1AA 4HFUH 5IG7B 3IJYB 3G08B 3VXTA 4N0YL 3PGDA 3UBXA 1WSST 1JGDA 1EJOH 2A83A 4CDHA 5C2BH 12E8L 3QEQB 2VR5A 4Z7UA 4NNYA 2N1KA 1U6AH 1CD1A 1MQKH 3WNOA 3SDXB 3THMH 3P30L 2GI7A 5D1XC 5GRJH 5HGAB 2AJXH 3SDDC 2VOTA 2R2EB 1UZ6E 3KXFA 2N4IA 1C16B 1NDMB 1BIIA 2UUDK 1I75A 3LS5L 3ALXA 5K93A 3W39B 1FL3B 3QHTC 5CINL 1PY4A 4V1DE 2PO6C 3E2HC 4HW6A 4HIHB 3WN5B 4M62L 4U3CA 5IVXF 2IQAB 3VD3A 5C0BB 3RX5A 5HGHB 5HI5D 1AGFA 3L1OH 5IROA 3INUL 1K5NB 1Q0XH 5INCB 5BOZG 3DUHA 3T4AB 2P5WE 2HFEA 1C5BH 4E42A 2YMXH 3MODH 3QIBC 4NBXB 4YHYB 5BO1L 4JE4B 4PJGA 3A0OA 1AXSB 1AIFB 5E5RB 4KI5E 3M45A 1UH2A 1E6JH 4ESKA 5K9JH 3GBMH 4PIRF 5IMKB 1ZA6A 4V2BA 1ADQL 4X5LA 2VXTH 4CU8A 4HUXB 5DRXA 2AJYH 3P40A 3WIFA 3MBEC 1QBLL 3IDYC 1OARL 2JIXA 2X1QA 4O9HL 4OM0L 3V6BR 5FA4A 1I8KA 1OLZA 3SQOH 4OFYA 35C8L 1QFWH 1T89A 4DFIA 3L5WB 3BPOB 3GSRB 3HB3D 1DP0A 2YEZB 4LP5A 1QSEE 3S88L 3CDGA 4L4TB 4I48B 3DXAD 4YE4L 4D0CB 3KLHC 4AIXA 1IEAB 1J0ZA 2KDGA 4GOSA 4OZGF 5IBUG 5D96C 5DURD 3VD9A 4I77H 3O6KH 5GS1C 5IIEA 5I6XB 2HTLD 3FFCB 1G7IB 4ZXBC 1EO7A 5MEND 3HAEB 4P23D 5F93C 1AFVL 4AM0A 5E08L 1DTUA 3RDTB 4GBXA 1VFAB 3MV9B 3U7WH 1W72H 3BKMH 1BD2E 1KIRB 1YEEL 5CGYC 3HRZA 2BX5A 3I50H 3REVA 1T1XB 3O6LL 1PKQE 3QUMB 3DMMB 3CVIH 2NPLX 1P5VA 4KKBD 1A3LL 4QOKA 4ZS7L 2EE6A 5KVDL 3UTTB 3NPZB 3KJ6L 1L0XA 3QAZC 4BKLA 5SX5K 3FB8A 1WBZB 1OTSC 3MYJA 2V2XA 4K8RC 4LHJB 3JWDL 3L6FA 5E9DA 3QIUB 2HRPL 1P4LB 5EO1B 5ISZB 3MJ9L 4NN7C 2L7UA 2C9AA 5FGSA 1I3UA 2H8PB 3CJJA 3IDMB 2XTLA 1CICB 3LDBC 4MNQE 5E2VH 3CFJA 2AJ3A 3L3HB 1XAUA 3VXRD 4ODUA 2V5YA 5HI4D 3VXSB 4ZUVA 2VC2L 2CJUL 2VL5B 2WINB 2ITDB 1NBYA 1U58B 4WNQB 3ARFA 3PWLB 3UPRA 1IKNA 3TIEB 4BK4A 2OTWA 1ROWA 3EYUL 3MV8B 3DRQB 1MHEB 2ESVE 3FAXA 4GSDH 5A40E 3RBGA 4GRMA 4JB9H 43CAB 1I7ZA 1NJ9A 2I24N 1A7PL 2QHRL 1OSZB 1NGQL 3SGKA 5HVFB 2HLAB 2IC2A 2A1WH 3NA9L 2Y5TB 4PJ9B 4GQ9H 4OIBA 3LQZB 3VXPB 2EDWA 5K9KA 4JN2B 5KSAA 3QUZB 4WEUD 3T2QA 5T1LD 5B38A 3WSQL 1RMFH 1YEHH 2X1PA 3VMOA 3WKNA 1CYGA 3WIHA 1E4KA 1I1AB 1NEZA 1ZAGA 4L1DA 1RJZB 2H32B 5FF6B 3NZHH 1W72B 1F6AA 4P0DA 3V8CA 2NZ9D 4ZYKB 2XZQL 5I76A 5EU4A 5L2JA 4IIQA 2YD6A 3U9PH 4U6YA 3P77B 1T3FB 4CW1B 4L3EB 3PWPA 4FMKA 2PW1B 2ZUQB 3F58H 3ZKMC 1AKJB 1NLDH 1T66D 2ESVB 3H3BC 3MRHB 3WFDH 4HIEB 3V79C 4H0GA 1UQSA 2Y4SA 4M1GL 4LLMB 1F11A 1N7MH 4OCRL 3HUJE 4X9GA 4OUUB 1JZ7A 4Q6IB 1JGUH 2H9GA 1XGTA 3PIQA 4TOYH 1DQJB 3GGWB 2ICCA 4IJ3B 1FIEA 3WNLA 2BRQA 3HE7D 3VFNB 4ZO9A 2ILLA 1MEXH 5EFIA 3TPKA 2EKSA 4CKVX 2ZSVB 4J7RA 4JFFA 3GMRB 5AG8A 3S3SA 4I3SL 1TZIA 4OKDA 4MCYA 3TV3L 3DVIA 4MA1B 3ARDB 5JORB 15C8H 3BMVA 1KLFA 4NQED 5IJVB 1U8IA 3H9YA 1N8ZA 5HHVL 4NKOA 1P4IH 4HH9B 1MWAL 2AJSL 2OCFD 3UTSA 3ULVE 1NBQA 1M6OA 3RU8H 1UJ3C 1T5WB 3QA3B 3LRGA 4F3FB 5HDBF 4GW5A 4JY4A 2A77L 1RY7B 2ZUUA 3BAEH 2FHFA 4YC2C 4NN6B 5D6CB 4LRNH 1EGJA 1A4JB 4QT5A 4JY5H 1ZHKB 1EO8L 2G9HA 3WDJA 1YPZA 3SY0A 5D7LA 3VFGL 4EIZC 2VDLH 1I9JH 2D03H 1FO0B 1MJ7L 1ZE3C 2YN3A 1DN0A 4EBQL 1F8TL 1QPPA 4LNRA 2W59A 2AXFA 3C09B 4YDLB 4PJXE 3MRFB 1LP9E 1UA6H 4RIRB 5J13B 3SKMB 4Z0XB 5C7XH 3TPUA 4XT1C 2C1PA 1CXIA 1T04A 2MTPA 3OGCB 3QHFH 5GISH 2ADGB 4XC1H 3OZ9H 4M5ZH 5CBEB 2X4NB 3BW9A 3HG1A 3QDME 1M7IB 1T7VA 1L7IH 1T4KA 5BV7C 1ACZA 4JPVL 4NO2B 2VXSL 4U3XA 4MAUL 3MFGB 4XP9H 3U0TB 1CLZL 4HCRA 5EUKA 5F70A 2YWYA 2FJHB 1RZIA 5BS0A 4ODSL 3I84A 3GSNA 5JQ6L 2OR8A 1N0XH 3OAZK 5JOPE 1G6RL 3HCVA 4JG0L 1A5FL 3CFKB 3MOBL 1HQ4B 4M7KL 3CK0H 4OZIE 3CSPA 3JV4B 5FXCH 3TNMA 5EIIA 1VHPA 5E00B 3V95A 3UROR 2P8MA 4EUPG 3QPXH 3FRUA 2NXZD 3D0VB 4X8JB 3V0WL 2R29H 2X4OB 1WIOA 5GRZA 4K3DH 2DWDA 5KZCD 4UNUA 1KPUB 1RK1B 3Q5TA 2VE6A 4C54A 3ME0A 3CCHA 4N5UA 1TETH 4AIZA 5FECB 5IM7B 4LSRL 5C08B 4PJBB 5MENB 2F5BL 4Q9QL 1HXMA 2ED8A 4HC1H 1G7LB 4P23B 3V4PL 1KN4H 4DAGL 1VACA 3CC5B 1KT2B 1CWVA 4XTRD 3MLZL 4P2OC 1RU9H 5CZKA 3QIWA 3SDCD 1Q0YL 5DQDL 1WAAE 2DD8H 1NGZA 4HKXB 1AD0B 2C3VB 3SE8L 5I0DA 4G43B 2XWBA 1IM9A 4HWUA 1CR9L 1YC7A 3HR5A 2XA8H 4XPAL 4EZMA 4WI7A 1FSKC 3OMZA 1T20A 2OQJA 1L6XA 3QEGH 4FG6D 3RWJB 2PXYA 1WWBX 3Q6FA 1RFDH 4JFXA 4QGTA 4I9WD 4ZFFB 4KI5C 2VQUA 4XZUA 1ZTXL 3RWDA 3O6ML 5HI3D 1NSNL 4RSVA 1JHKL 3O2WH 4KJQC 4KU1A 1S7XB 3CDFA 2X40A 3VRIA 1M1SA 3ROLB 1BF2A 2K3TA 4P2RA 5C6TH 5IVOA 2A74B 4AL8H 4NO3B 5T3ZL 3VXRB 4M1DH 1E6OL 3MO1B 5T5NG 4M8VA 4ZQKB 1FDLH 2MQ0A 3SE9L 5ACMA 5GZNC 5GRVL 1YNKL 4ZTPH 3BKYH 5DUMH 3SKJL 1AO7A 5M7QA 1ZLWH 3ARYA 3MRNA 1OTTD 3FJTA 3RTQA 5I1KL 3QZWA 3QNZA 5B8CB 4RWYL 2XN9D 4P4KB 2NY5L 4DGVH 3PL6A 1NFDE 1CXHA 3HNSL 3MNWB 4RBPK 2F54D 1A6TA 3M1BA 4PJHB 2GT9A 2GTWA 4JRYB 2XNAA 1MI5E 3B5HA 1BVKA 4L8BB 4OZHA 5I74B 5T1LB 2K1MA 3ZTJG 3I6LD 3QDGD 4LHUD 4N0YH 3PWUA 5J6GA 4E9LA 2AV1B 1EFXB 3LRSA 2PN5A 4PB9L 4J2XA 3OKDB 4I2XA 12E8H 4QXGL 5MHSE 5E70A 2P8LB 3VFVA 4B50A 4TTDD 5ITBL 3C5ZA 4HV8A 3Q2CA 4GH7B 1QKZL 1ORSA 3P30H 5AWNL 4QHMA 5DMKB 4HLJA 2Q86B 3EYOA 1JGVL 3I3BA 1RIHL 3TA3C 4WW1A 3QWQB 3ZHKA 4H8WH 1LK2A 3UJTL 1LK3L 4NO0D 3FQTA 3MLXL 1B0RA 4N0UB 5DZLA 1WIUA 3VRJB 5HHNA 5CINH 4U1JB 1M7DA 1HYSC 4JGMA 3LKPB 2Y07L 5TDPB 3WFBH 1K2DA 4P5MB 5AD0A 4JN1L 4M8QA 3EW3B 5JPNA 3INUH 2MHAA 2D0FA 3HE7B 3DVGB 4WI2A 1D9KA 3PQYD 5BO1H 4Y19D 8CGTA 4CADB 1OCWL 4CMHC 3WFZA 2V9TA 5IOPA 3GKZA 2Q76A 4OD3L 5J6HA 3DV6B 2OR7A 5MEOA 1ADQH 1MCPL 2JB6B 3BIAX 3VGAC 1WF5A 3EOBA 4NQEB 1QBLH 2ZG3A 4GG6B 1OARH 4OM0H 5KS9B 4QRPD 2M1KA 3V6OE 3H0TA 3LKRA 4AJ0A 2WV3A 4POZC 3AREA 4RFOL 1ODAA 1XIWD 2CGRL 1A6AB 3L3OA 4KKNA 5C0AD 1OAUH 1NMBH 3VFPB 4QHLA 3DX7B 3G6JF 3S88H 4YBLC 5I8KL 1KSRA 25C8H 1RUKH 4X6FA 4OQTA 5DHVA 2JF1A 5J56B 3TZVA 5F9DC 5I1DB 1QLFA 2CLVB 2YUZA 2UV3A 2FECL 3TN0A 1QFUL 2YPKA 3MOQA 1AFVH 4WV1C 3GKWH 5AUMA 4KV5E 5EO9A 5BW7A 3P9WB 1JNHA 4ELKA 5JW5B 1B0GB 1ED3A 4MA7L 5D8JL 1UWEL 3O6LH 3DVFA 3T1FB 2HFTA 3OKKA 4XXCC 2EC8A 4GAGH 1A3LH 4JO2L 4O58L 3V4UH 1D7FA 2XY1A 2R23B 4ZS7H 4RDQF 4ZFZB 3HZMB 5KVDH 5CJBA 5TDNB 1QLRA 4BFGA 4R7DB 5EU6A 3KJ6H 2YZ1A 4AT6B 1SQ2N 3MREA 3HZVB 1UXSB 1EHLL 4HHAB 4KRMB 1JV5B 1J87A 3JWDH 1A9BA 2EO1A 4X6DF 1H5BB 4OZ4A 4GKZA 4XVSH 4PJ5D 4B5EA 5F89B 2DJUA 3QDJA 3MJ9H 2AGJL 1A6ZA 5J57B 4G8EA 5GGTA 3RHWK 2V7NA 1MSPA 4UU9A 2OSLB 5FM5O 3AS3A 4PJCB 3SE3C 3C2AL 3EYVA 4KDVA 2OP4L 1WQVT 3VE0A 2FZ3B 1JGEA 2VC2H 4MJIE 3WFEL 4AIOA 2CJUH 2OYPA 5ADPL 1AP2B 4PBXA 3SDXF 4P5TB 2VABA 2V7HB 1OAKL 4F7PB 2VLKE 4NNXA 5B38G 1UM4L 4OGXL 4FP8L 1BX2B 1MH5B 5B4MC 3OKEB 5CKGA 3TBYB 2NXZB 4D3CL 2C3HA 5KVGH 1A7PH 2QHRH 3J8F7 1NGQH 3M8OL 1NEZG 4U1MA 1MHHA 3B4NA 5I1GL 3NA9H 1JHLL 4E5XB 4J12A 4TPRL 4ZNEE 3ULUF 4U1KA 1VESA 4XC3L 3DURA 4FQQA 4P59L 3WSQH 2VH5L 2Q7YB 4PGBB 1XGPB 3C8KB 3W0WA 2WBJA 1DUZB 2D0GA 1YY9C 3SDCB 3HPLB 2ED9A 4OB5L 5IB4B 3IDGB 5IK3B 1M7XA 2C5DC 1EBAA 3WDIA 4ZG1A 4YPGA 4IRSD 3HRPA 4MJIB 4ENED 3O9WA 2UWEA 5H2BB 3Q5OA 4Z7VE 5FYLD 3VFTA 1NQBA 1WFNA 5GGUB 2DL2A 1R5WA 1UZ6F 1XR8B 3PABA 3EOAA 5FA3A 4M1GH 2E6JA 3TO4C 4XPBL 4IOFC 4OCRH 2BVOA 3IDIA 1U3YA 4GW1B 1IRAY 2X5PA 5EU7C 3BMWA 4KI1A 5DD0H 3DRTB 3L3IA 1FJ1B 3GMQA 2A6KB 2AQ1A 4M6ML 4GO6B 3F12B 2GJ6E 4JQVA 3GJFA 5IP4A 2HMIC 1WEJH 4BSWB 4Y1AE 4PJIA 4ONHA 1Q94A 4Y5YA 4OJFL 4I3SH 5I16A 3EO1B 4JZJA 2XN9B 4MHHG 1QVOB 4XMLL 3QJFB 2F54B 1W0VA 4Z6AT 1Y0LA 2YC1B 2CSPA 2YN5A 1WCQA 5HHVH 1FNGB 1J88A 1MWAH 1PG7L 2AJSH 4UDUB 1V05A 4MXVE 1U8KA 1PDKA 2NX5A 4JFEA 1ACYL 3BP5B 3QDGB 4QYOB 3SE4C 3ZDYE 3MLTB 5JUEL 4MZ2A 4PJFA 4YAQA 4MJ5A 3HZYA 1S9WA 4RWHA 2VR9A 4APQC 2R56L 4G9FA 3IF1A 1EO8H 1U91B 2JJSC 1B0WA 5GGVY 1OY3B 1U42A 4M3JA 4PYHA 4YHLL 4KAQL 1CXKA 3VFGH 3D39E 4EQ3A 4YFEA 1IT9L 3L3GA 1MJ7H 3T3PF 1S7RA 2GUOB 4R8WL 1J0HA 4X99A 3TWCL 4S10A 5EC2B 1Y6NR 3ZE0E 4EBQH 4S2SA 2BNQD 1BLNA 2LU7A 3KPNA 2PTVA 4KKLD 5JO5A 1R3KB 2EC9U 4UIMA 3U0PA 1S7TB 4YDKL 1JHTA 1IGFL 1KENL 2F8XC 5DJ6A 5HHPB 4X4YA 5C3LD 2LQRA 3RGVD 2XFXB 3FZUD 4WWKD 1S5HB 5DEZA 2FGWL 2X4UA 2Y1VA 4JM2A 1QFHA 4K3EL 2YKLL 3V6FA 5J1AA 5JXAL 2LFGA 3KWWA 3QEUA 4PLKD 4HUVA 4FFZL 1I1FA 3FTGA 3IFPA 2NNAA 4JPVH 4Q2ZA 2VXSH 4G8FB 4MAUH 3ALPA 2X9YA 1H15A 3TJHC 5IB3A 3V5KA 1CLZH 3RVVD 4MAYC 5TQ0L 4QRPB 3SDDA 1I8MB 1HHGB 2RGSA 2W1NA 2P5EA 3C9NB 4URTB 3STLB 4PJ8C 1XIWB 1EAPB 1G6RH 4NQDD 4JAMB 4JG0H 1A5FH 3MOBH 4Y7MA 4M7KH 1NBVL 5CSZB 2D31A 1F4WL 5C0AB 2ZUYA 1MWAB 2VISA 5ILTL 1D6EA 3ZKQD 2EDRA 3T08A 1MCLA 1A22B 3K2UL 2PO6A 3V0WH 3UTPE 5BQ7B 4HBCH 2X4SA 3QWOA 2DS4A 3P3YA 2AKRA 4F9PC 1XR9B 4OCYL 1AHWB 3NPSC 4PGEB 1JMXA 4WI3A 2GFBA 1FZOB 2IG2L 1YYML 2BOBB 3IETA 4WIQA 5KVEH 2CDGB 1LGVA 4NT6B 1ZK9A 4LSRH 5CWSB 5AG9A 2F5BH 1G0YR 3QNYA 4Q9QH 2H26B 5T1KB 5D7IE 1QRNA 2JCCB 4JKWA 1T22B 4DAGH 4KQ3H 4YXKL 2UY7A 3MLZH 5JDSA 4G8IA 2DI7A 5ICYA 4ZAKC 3O45A 1Q0YH 5DQDH 1KTLB 5E6IC 3SE8H 3AM8A 2W9EL 2B7DT 1MFDH 2CKBL 5FYLH 1CR9H 3VXOB 4XPAH 2VSCA 1P53A 2Z0BA 1I85C 2DLHA 4X7TA 1N3NA 3VWKD 3F7YA 5IJKC 1SY6A 3K80A 3U6RB 4KUCD 4X0KB 3KDMB 2G5RA 3D18A 2FX9L 4Q58C 1C08B 2C3GA 2ICWA 2NY2C 3WCYA 5JHDB 3G5VA 5A1AA 1IL1B 3MOAL 3RL2B 3IDNA 4OV6F 5FDWB 3FQXA 5DD1L 3QZWG 5DJYA 3F8UB 1QSFD 4YFLF 1ZLVK 3STZB 3FO1B 1G9MC 5D5MB 5EWIL 3SCMC 1G7HA 3MRPB 4RZCB 1E6OH 4QEGA 2CMRH 4QRTB 5DFVD 4ZXBA 3SE9H 2VN4A 3QUXD 5D7IB 1YNKH 3VXQA 1UXWA 5E4EC 3OKMA 3SKJH 3QQ3B 1QQDB 5I1KH 5L7XL 1G6RB 4NZTL 4F7TB 1DBKL 1G7MA 4LPUA 4QF1B 1U8OA 2NY5H 4G6KL 4GAYB 1MAML 4DKFL 1G1YA 3HNSH 1L7TL 4BELD 5KVMC 4EXPX 4XNMB 1G7PA 2FO1A 1F90L 3MFFB 5T3XD 1DEDA 2MCPH 4LSQL 2IAMD 4X6CE 3LN5B 3RNKA 5JOFA 3W9DA 3L5XL 1S9XA 4POUB 2VITB 5EULV 3MNZA 1X7QB 4QXGH 3ULVF 1NFIB 5I17B 1E28B 5ITBH 5B39G 5IFHL 4H26A 3K0WA 4ZFOB 4WWID 5JLZA 1QKZH 4O00A 5AWNH 3P9MB 5EZLB 5F71A 1FVCA 2R15A 3VFWA 3MX0A 5EIVA 1JGVH 4IRSB 5DJ8A 2RQ8A 5DD5L 1GJIA 1EPFA 4YUEH 1XF4A 1JPGB 4WUUA 3UYRL 3O2DL 2Z31D 3NCBB 4D94A 3PDDA 3UJTH 1LK3H 3MLXH 43C9A 5KN5A 1UKTA 1YQ2A 4NQXA 4PRDA 5JW3L 4RAUB 3G6DL 3DGGA 4OCMC 1A1NA 1EMTL 4HEME 4UV7H 2HVKA 1RIVL 2Y07H 1FNFA 4HPYL 5IMOB 3S96B 4JN1H 4KY1L 2OM5A 2CRIA 3V0VA 3RWGA 5IFJA 1GC1H 5JW4Q 1S9VA 3QPQC 3OKLB 5SWZD 1QA9B 1S7QB 5DMGC 4RGOL 1FPTL 2P1YA 3MJ6A 2Y23A 3P11L 5FHAL 4XI5C 3NIFE 3KR3L 3MRGA 5EO0A 3IFNL 4BSVB 3EJZC 3MJ8B 3BI9X 1RZJL 2KUTA 4F33B 1AGDA 2CK0L 4PJBF 3MA7A 5LXGH 1MCPH 5C07D 3EYFA 5F1NB 1NUNB 2ZCKL 2X4QA 2BSSA 1LWRA 2E6QA 3IU3B 1ITCA 4IHOB 4RQQA 3RP1A 1U3JA 1FZMB 3RUGE 2FJFA 4C56A 3BPCA 2ZWLT 1I9RL 3UTZB 4ISVA 2FEDD 1NUGA 4RCAA 5CMAB 2J88L 2CGRH 4W4NA 5CIPH 3DX6B 1QNZL 4LKCA 3RY6C 3DO7B 3P73B 1AXTL 1Q72H 4R96B 2X10A 5I8KH 2BFVH 5ENWA 4K07A 1A0QL 3ZKSD 3DSFL 1KIQA 4YDJB 4M4PA 4LLQA 4YIQB 4YHZL 3FRPA 2G60L 2ADIA 4HULB 3DUUB 5E8EA 1KN2L 5ICZB 2L0DA 3GSOB 4NZRL 3WE6B 1UCTA 2WP3O 3GO1L 3NCYS 5F88B 3R8QA 1QFUH 3KPRE 4MQSB 1KJ2B 1ZA3A 4XGZA 3WNPA 4PR5A 1J8HA 4I0PA 1G7QB 3H7BB 3NCCB 3IFOA 3HNVH 3JTTA 4RFEB 1TQCC 1L4IA 3TYFA 1NUFA 4I1NB 2BNQB 4ZUWB 5A43C 3FB7A 4LBEB 4R4BB 1E4WL 4MA7H 3RWFB 5D8JH 1UWEH 1C5CL 5CEZL 5MERB 4BSJA 4P9HL 4JO2H 1I7TA 2DF3A 3RGVB 4WWKB 5LVEA 1YC8A 4MQ7B 3FQUA 3ARXA 2WUBL 1UJ3A 3OJVC 4P2QA 3BPLC 1Q38A 2H6PA 4Z77A 2AK4B 1VFMA 1EHLH 3DGCR 4PJHF 5I15H 2QQNL 4G3YL 3VXUD 4JKMA 5FGBC 4ZDHB 1OW0A 3Q0HA 3JV6B 3U79A 2AGJH 4BFEA 1P9MA 3HKFA 4HQQL 4LEXL 2AP2A 3C2AH 1ZGLA 5D1QC 1K3ZA 2OP4H 3B2UC 1JTPA 1LD9B 3WFEH 4AMKL 4NQDB 1IEBB 2V5SA 5ADPH 5IW6A 1Y18A 3SO3C 5CJ5A 4J4PC 4JFDD 3PP3K 1OAKH 4F80A 2AJZA 3CIQA 2WIIA 4CN6A 2HJKA 1KCRL 1UM4H 1NGWB 3FCTA 4OGXH 5BZDA 2GAZB 1JTOA 3PJSB 3IKCA 1CT8B 4D3CH 3DV4B 2QTEA 8FABB 1KCVH 2F58H 4ZUTA 2E9JA 2ZOLB 3M8OH 2CXKA 5HVGB 1KTKE 5D2LB 5I1GH 1JHLH 5F6IC 1Q9OB 1CK0L 5AZ2L 4HPOL 3V7AG 3PHOA 1NLBL 3IS0X 1NFDF 1WZLA 4P59H 1T1WA 3RZWA 1AXIB 2VH5H 3BN9C 4GQPH 1GZPB 2XXCB 5F96L 3S5LA 4FQXC 3RPIB 4LGPB 2I25N 1CTOA 4KZEL 1ZLUK 3BEWB 1OAXH 3KXFD 2NY4B 3CDYA 3BGMB 4LF3B 3IU4L 2X70B 3Q48A 3VWKB 4CMMA 4O2CA 3GJEB 2G2RB 2A9NH 2R0KL 5HHMD 2Y6SD 3C2SA 4MDIA 4GG6F 5HVHB 2PTUA 5KS9F 3VI3E 5CKAA 4X4ME 2J6EL 5FGRA 7CGTA 4RNRB 4P9ML 1KCUH 1K4CA 1UEYA 2HG5A 2BVYA 4WDIA 2PYEA 3CPLA 4XPBH 1FNEA 4WHYG 4Z5RA 1AD9B 4Z76B 3JV5A 2JB5L 3CZFB 1XF2B 3RVTD 1HHIA 4JR9L 1L6ZA 5E8OA 2D4FA 4M6MH 4NOFA 5E2WL 1NEUA 4HS3A 4OF5A 4HWEH 4X5XA 1TXKA 5GGRB 3ILPB 3V5DB 4OZFA 3FMGL 3BRDA 5KANI 4OJFH 4P2OA 2AJUL 3VFMB 1HK6A 1MHCB 1T80A 5CEXA 2HT2C 2JIXD 4XMLH 4V1DA 4K7FA 5DJZA 4FMFA 4RAVA 5LKNA 2PF6A 4OFYD 5F7HA 1FFQA 2P5WA 2X44D 5E5UB 3T2PA 2IAMB 2B4CL 3EAKA 2O5ZH 5DJCB 1ACYH 5JW4N 4C83A 1NBZA 3MSPA 1EH9A 3RRQA 1A7NL 4PREA 2XWTB 5D6DC 5JUEH 3NN8A 4N1EA 2CLZA 1U92B 4R0LB 4P2CG 4PRBA 2R56H 3MRKB 2W92A 4LASL 1XH3A 2M26A 1FVDA 4XNZC 5IV2B 2VKWA 4QRQA 3QFJE 4YHLH 4KAQH 2OR9L 4OLVL 3P4LA 5F7DA 1DLFH 4FFVD 2Z31B 4X9FA 3MUZ1 5B3JF 4NJAH 4OV5A 1S7VB 3TWCH 4UILH 3K3QA 4ZUUA 4PJCF 3RKDC 1MIEL 3RIFK 1QSEA 4NKDB 1JIBA 4WFHE 3MLUH 5DQJA 4QOKD 4YDKH 3BESR 5C9JA 4X5WB 4RMRA 4X98B 1IGFH 1P2CB 3P0GB 4E41D 2GSIB 4KV5F 4MSWA 4ZUSB 5CP7A 3VDBA 1NDGB 5DWUL 4F8TA 1U8MA 1LEGA 4PGCA 4LPTA 2IALB 5SWZB 2YKLH 5C0CA 2IF7A 5A16B 5FO8B 1I1YA 4GXVH 5E9DD 5C0DB 1LE9A 5E8PA 2FR4A 1JE6A 1H0DA 4KJWD 4FFZH 3S4SA 2IFFL 2VXUL 3GUTB 2F5AH 4ZS6D 4K23H 1BD2A 1G6VK 3ROOB 1KIUA 5C07B 4Q9BA 2NLJA 4GAFB 1PKQA 4HIJA 1FZKA 4CNIB 2A0LC 4NO5A 5TQ0H 3L5IA 1KJVA 4DQOL 3ARFD 5FKPB 4AK1A 1RJCA 1NBVH 2HFFB 3WLWD 3CVHA 1F4WH 4Z7QE 2D7MA 1CFNA 3DXAE 1WGOA 2KBGA 2DKMA 5ILTH 4N0RA 4ELME 2OL3A 2OMBA 3K2UH 4P4RA 2DIJA 5DJ2A 3G5YB 3IXTA 1HH9B 4YGAB 3VU2A 2VXQL 1BPVA 4KTEL 5LG1A 4MNQA 4OCYH 3RY4A 4M48L 5KSAD 1XGUB 3P4OB 2ICEB 1NC4A 2BP3A 3X14A 2IG2H 1YYMH 3TP4A 1WT5C 5T33L 1IC5L 3O8XD 1CXFA 4I13B 1NCAL 4LP4A 4KHTL 4X8XA 3KPMA 4YXKH 4PRNB 2DTSA 2R0LH 3EKCA 4JRXE 5TE4L 4RGMB 2VIRB 4OLEA 4LPCA 2W9EH 2CD0A 3MGTB 3QXDB 2CKBH 4XBEL 3RPKA 3TCLB 5GGRY 2EICA 3BQUC 4ZOEA 4PJAE 3PWPD 1G9EA 5F21B 3GMOA 4LLUB 1HKLL 5CEZD 3GBNL 3GFUA 3ZL4L 4ZPTB 1YZZA 4MS8C 2J12B 3UZEA 2Z92B 4GG8B 1MOEA 4QRSA 1KPRA 1CDUA 3MOAH 2EEBA 4FXKA 5E56A 3NAAL 4ORGB 3MUJA 1B88A 4XBGB 1Q1JL 5DD6B 3CFEB 3TLRA 1A3RL 5EWIH 5F7UA 4WFGD 2RHEA 3BPOC 4JFFD 2NY3B 4PRHE 1NKOA 1DBML 1LE5A 1PG7X 4UAOB 1JYVA 4WV1A 1FVEB 4MZ3A 4JFDB 2BHUA 3C6LC 4FQ2L 5HHOE 3B2VL 4R97B 5L7XH 2CR3A 3K8MA 4NZTH 1DBKH 4PLNC 3MRJA 4G6KH 2Z4QB 2E3VA 1ITBB 3MTRA 3UTSD 1L7TH 4FFYL 3HUJA 3TCXA 5I1AB 1W8OA 3U9UA 2FX7L 3G5XA 1N6QL 5HD8D 4UOW1 3D85A 1F90H 3VXTB 3HFML 3E6HA 3PGDB 3UBXB 2FEEL 1JGDB 4LSQH 3RDTC 2BHYA 2GITA 2R8SL 1ZHNA 2A83B 4H5SA 2GW5A 2V2TA 2H2SC 3L5XH 4Z7UB 5D7SH 4ZSOE 5CBAA 4NNYB 4HUMB 3WJJC 1GOHA 3AXLA 1CD1B 3AU1A 2C4FT 3GBLA 4N90D 4Z7OF 3B9KD 1BWWA 4MXVF 5GRYA 4MQXC 4LSSH 5IFHH 1QRKA 4IDJH 5BJTA 1MFEH 1CLOL 1E4JA 3KXFB 1KJ3L 4JPKL 1JK8A 1ES0B 2CO7B 1MRFL 1BIIB 5DLMH 4B0MM 3D25A 2DMBA 4FFWD 5DD5H 3UYRH 3O2DH 5HHMB 1BOGA 3QG7H 3QI9D 1X5JA 3KHOA 4KJYA 3QIUC 4Z0BL 3EJYC 5JW3H 4M1CD 4NDMA 2IWGA 1T6VN 3G6DH 1F6LL 2NCMA 2OJEA 1AGFB 4DGYL 1QG3A 1RIVH 4M3KB 2HFEB 5E6ZA 4HPYH 4E42B 4H1LH 3ZE0F 3VFRA 4KY1H 2HLFC 5JR1L 4N5EC 3QFDA 4PJGB 3RBSA 1BZ9A 3HG1D 4HH8A 4KROC 1FPTH 3TO2A 4X7EC 3P11H 5FHAH 3AMKA 3KR3H 4MXQD 3IFNH 1ZA6B 3A6OA 4Z8FL 1RZJH 1WC7A 4OLWL 1B9ZA 2PW2A 2NY6D 2CK0H 3MCLL 3WIFB 5DRXB 4PJXA 5HYQA 1LP9A 2JIXB 5EU5B 2YPLE 4X6BA 5DRWA 5FA4B 2ZCKH 1I8KB 5BS0D 2JCCF 1IGML 4LCCC 4XVUC 2R9HC 5JIIA 4N68A 3FO0L 2AABL 4HUKB 2YBRA 1BQHA 2J88H 2AV7A 3SDAD 3CNKA 3CDGB 1QNZH 2XKSA 1NAMA 1FG2A 3L5HA 3PHSA 1NCDL 3RIAK 4JEGB 5CILL 4QTIL 4NP4L 1A0QH 4GRWE 4YPJA 3TO4A 1V3MA 5IIEB 3DSFH 2OZ4L 3W81A 4YHZH 3BGFB 3RKPA 2W0KA 5J11C 2Y7QA 1F4HA 3ZO0A 3VG0L 1AC6A 1KN2H 2FD6L 2FYYA 1TTGA 4AM0B 1X5FA 3TT1L 2ZUQC 3RA7H 1IGJA 5GS0L 4UQ2A 4OZIA 3QIWD 3HRZB 3P4NA 3REVB 2P24B 1IM9D 1E4WH 4QOKB 1U8LA 5D7IF 5CEZH 4P9HH 1JNLL 1HH6A 1SJHA 3DETD 4ZTOH 2FL5A 4L5FH 2PXYD 4BKLB 1WIPA 3EDKA 4J23A 1GAFH 3FB8B 3TJEH 3MYJB 5HPOA 2V2XB 2HTKD 4KZDL 2WUBH 5K9QI 3L6FB 5E9DB 1Z3GL 5ITFA 1C12A 4Q0XH 4P57A 1R6VA 1CGUA 2QQNH 5FAAA 4PD4J 4G3YH 3BWAA 4HAGA 1UM5L 2AJ3B 1RJYA 3CFJB 2E6PA 5EG6C 1WAAA 3S98A 4EEEA 4ODUB 1RZ8A 1JBJA 4ZUVB 5I1CH 1O5DT 2JJSA 2DB8A 4HQQH 4Y4HA 1NBYB 3ARFB 4LEXH 1C7TA 2H3NA 3WHXA 5J3HD 2VERN 3MUY1 3UPRB 5HYJE 2VR4A 1BAFL 1GGBH 1AO7D 2OTWB 5D2NE 2CUHA 3RTQD 1AR2A 4GRMB 4JKPH 1I7ZB 1NJ9B 4NN6C 2IH3A 2ZSWA 2ZG1A 32C2A 1T7XA 2WANA 4LKXA 4F7MA 4LDOB 2HAZA 4Z7NE 2Z91A 3RWHA 3S5LG 3DROA 3MUGA 1IAII 3B6SA 4I8DA 4PRIE 3WIIH 4LPYA 3MRQA 5K9KB 5KSAB 4HGMA 3IDUA 2R4RL 1EDQA 3MJGX 5B38B 2P48B 5AZ2H 1NLBH 3O8XB 2RAMA 1MRCL 5DA4A 5JQHC 4I0KA 5GRXG 4YDLC 4Y2DD 1MFNA 5DMYA 1NEZB 5J13C 5F96H 4CVZA 1SEBA 1F6AB 1S7SA 2I60L 1R24A 5I76B 4ZFGL 5DJDA 5EU4B 5HI5C 5L2JB 4KZEH 1NFDA 1DCLA 4IIQB 2FECI 2EDHA 5E4IA 3SN6N 2EDBA 4U6YB 4MAYA 4PP1C 3BYTA 2D7QA 1JPFB 3PWPB 2VMFA 1MI5A 4PJ8A 3QUYC 5BCAA 4OI9A 2WLYA 2R0KH 4R90L 4BM7A 1UQSB 1JGLL 2J6EH 2BC4A 1CGWA 4OZFG 4P9MH 4JGJA 2H9GB 1XGTB 3PIQB 2NXYD 4L1HA 5FB8A 1YPZE 3NBNA 2D7NA 4D9LL 2MNUA 2YA2A 5D7LE 3MXVH 2JB5H 5EFIB 2EKSB 4UZGA 4JFFB 4JR9H 4HK3J 2G75A 1ZEAH 5ID1A 2P46B 4L9DA 3EHBD 3T0AA 2BY3A 1TZIB 1UB6A 1A4KA 4MXWL 4DK3A 4DVRL 2DQEL 5HDQL 4KVNL 4MCYB 5ID0A 3GSNH 5FYKL 2AJUH 1C8PA 2AEIT 1YNTA 3WFHA 4ZAKA 4AEIH 1CLCA 1U8IB 1N8ZB 4NKOB 2HTLC 1W0YT 3BUYA 3PXJA 3UTSB 4H25A 3BX7C 1M6OB 5EZIL 2BXYA 2V2WA 5F7WC 2DWEA 4M43L 5IJKA 2B4CH 5F6HJ 4GW5B 3OB0H 4JY4B 2Q8AH 2VZUA 2WWKT 2BOCA 4QT5B 2ICWJ 3KPQA 4PUBL 1GCFA 1J7VR 3HHRB 4LFHG 3BDXA 1H3WM 2A38A 1GIGL 5C71A 1A7NH 4OCWL 2G9HB 3RVWD 2VLMD 4EI6A 3TZVD 3HTLX 3AAZA 4KKBC 3ZYZA 3TM6A 1CN4A 1OGTA 3SY0B 1L9NA 2R1WA 4LASH 3TN0D 4O2FA 5HGBA 3IAQA 4NCC2 1P6AB 4K71B 3V6OA 1KJMA 3BYYA 1DN0B 2OR9H 2R2BA 4XNUL 3QJHA 1H8OA 4KRPC 1A6UL 4R2GC 4WEBL 5C0GA 3QI9B 4LNRB 2AXFB 1TENA 1GOFA 4LCWE 5KAQF 4EIGB 4NQTA 4OLUL 1MIEH 1A21A 3S4SG 2C1PB 1T04B 3HMXL 2XYCA 5HI4C 1FNSL 2Q3AA 5EU6D 1AGCA 3GI9L 3PQYE 1KCLA 5DWUH 4Y19E 2I26N 4NBZB 2QSQA 2P7TA 3BW9B 3HG1B 5B3NA 1NGXA 4Q7DA 3BSZL 3JZ7A 1T4KB 2FATL 3UYOD 2D0HA 3SJVE 3R06A 5D2LF 5B8CC 5E7BA 4RMSA 4PG2C 3PWJA 2VXUH 2NY6B 2X89A 5EDXA 5EUKB 3Q3GA 3FOLA 1RZIB 4RGND 5FUCE 5BS0B 4KGJA 2VWEC 3GSNB 5JNYA 4OCXL 3HCVB 3MNVA 4DQOH 2W0LA 3VCLA 3TC9A 5EIIB 3TNMB 5GIRA 2WWMD 2C1OA 2P8MB 3AMLA 3FRUB 5IB2A 2FH6A 4JQIL 1F02I 4PRPE 4OI8A 1N2RA 1AR1C 3DYMA 1INEH 2DWDB 3X3FL 5DEGA 3LQMA 1NMCB 2VE6B 5I1JL 3N85L 1TJHL 2NZ9C 4FABH 3CCHB 4Z7WE 1BECA 2VXQH 4YXHL 1CGVA 4AIZB 4KTEH 2WLZA 3JTSA 4M48H 1HXMB 4UTBL 4YEEA 2XWJA 1KACB 4K94H 3QUKA 1FL6A 1IC5H 2YK1L 1VACB 1T0NA 4XMPL 4A2LA 3W0WD 2WBJD 3QIWB 5FCUL 1NCAH 4KHTH 5JXED 2VLKA 1NGZB 1SYSA 2OI9C 2X4PA 4JFYA 4R26L 2N7AA 4W4OC 1IM9B 4JFPA 5TE4H 1TVBA 4WI9A 5GS0D 4LEOA 2CDEA 4WW2C 1T20B 2OQJB 4DFHA 3VGHA 4BH7A 5L2KE 3D48R 3HE7C 4XBEH 3O9WD 1A1MA 5DMJB 4WJ5A 2PXYB 5DK0A 3Q6FB 4MA8L 5E2UL 3GBNH 4JFXB 3RX8A 4NPYA 3ZL4H 1HHJA 5A2IH 4XZUB 4DKDC 3GM0A 3RWDB 4PJ5E 3RY6A 1KB5L 5TF1L 5C09E 3VRIB 4HBQA 2FBJL 4P2RB 5LCVL 3U36A 1UZ8A 1SYVA 3T3MF 3NAAH 2F74A 1HN1A 1HZHH 1Q1JH 2CDFA 3VI3F 1A3RH 1TNMA 1P1ZA 5TE7L 3RNQA 3L9RA 3MLWL 5IB5A 1AO7B 1DBMH 1OD7A 1N5AA 4LSDA 4Z7VA 3MRNB 4M5YL 3RTQB 5DVNA 5HPMB 3QZWB 1N64L 2O26U 3QNZB 5EBGA 1A7QL 5M95B 1ZOXA 2XRAL 3PL6B 3PV7A 4U1NA 4FQ2H 5DJXA 5CFHA 3BZEA 3B2VH 4ERSL 1CDIA 4HWZA 1A6TB 1H3GA 4X80L 3M1BB 1QO3A 2GTWB 2GT9B 2XNAB 3MCG1 2DQCL 3KHQA 4G42A 4FFYH 4GLRH 1BVKB 1DUYA 3LHPL 1J0YA 4OZHB 3AY4A 2FX7H 2A6JA 4JREB 1N6QH 4JFED 1RD6A 3HFMH 4MWFA 3PWUB 5DEFA 4U7KA 5DTFA 5J6GB 2DQUH 3CSYA 4OQTH 2GJ6A 3LRSB 4I2XB 3KPOA 2F19L 4Y1AA 4KDTC 4Y2DB 2R2HA 3C5ZB 1RUQL 4HV8B 3MRLA 4H8WC 4G9FD 4HIIA 1ORSB 3D87B 2F53E 4QHMB 1OT2A 4M6NL 3VD5A 5IKCA 4JFHE 1CLOH 3EYOB 1KJ3H 4JPKH 4CRPA 4WW1B 1MRFH 2ATPA 1E0OB 1RUPL 4J8RA 2Q8BH 1LK2B 3FQTB 1B0RB 1FFNA 1CFVL 1EZVY 3O4LE 1P84J 1A6VL 4J4PA 3MCKA 3EOTL 2BRRL 5HHNB 1H5BC 3CD4A 4Z0BH 1M7DB 1K2DB 5AD0B 4HJ0D 2EE3A 4M8QB 4DGYH 5JPNB 5D70L 2MHAB 4JHWL 4JM2D 1FGVH 1D9KB 3CUPB 4I18C 3JVGC 2EIZA 5JR1H 4M6OL 3UX9B 2EDXA 3CLEL 5IOPB 5T3ZE 2Q76B 3MBXL 4XAWH 5J6HB 3D39A 5D2NC 1LEIB 2HT3C 1NCUA 5MEOB 1BQHG 2HRLA 2NXZC 4Z8FH 1XZ0A 4OLWH 1CQKA 2FO4A 3MCLH 3CDCA 3EOBB 4N9GA 4FQXA 5J89A 2V17L 3H0TB 1FRGL 3LKRB 4HDIA 3AREB 2P5ED 1S8DA 1IGMH 5FYKD 3U30B 1IAIM 3BKCL 3L3OB 3FO0H 2AABH 7FABL 4QHLB 3N1PC 3STBA 4U6XA 4F37K 4XTRC 3GI8L 1PBYA 1DZBA 1NCDH 3OJDA 4X6FB 4EDXA 5DHVB 5CILH 4QTIH 4EKXA 4NP4H 5C8JA 1EEYA 1BBJA 2XIDA 3G9AB 3TZVB 4HSQA 1QLFB 1YEKL 3B9EA 2JE8A 4YK4B 2OZ4H 3FT4A 4LVHB 2LAGB 4FG6C 3TN0B 3HLAA 4OD2B 2YPKB 1CG9A 2FD6H 3ULUL 4BQ6A 5AUMB 1QRND 5GS2H 3TT1H 3NGBC 5EO9B 2ADFL 3DVNA 3ESVF 4P2YA 1JNHB 3VJ6A 5GS0H 4ELKB 4BA8A 3EOYG 1VGKA 5HI3C 1ED3B 4A6YA 5DZNA 5EPMA 5KVFH 3OKKB 1RULL 4JFOA 3JWDC 2NYYD 2EDTA 5F97E 1KPVB 3QCVL 1DQQA 4PTUA 1QLRB 1JNLH 3JUZA 5EU6B 1NCWL 4DK6A 4HUWA 4KVCL 4WI5A 3MREB 4JZOA 4HUUA 5T5NF 2BVQA 4G6JL 4TUOA 4KZDH 5IHZB 1A9BB 1Z3GH 5FIEA 4OZ4B 1MREL 4GKZB 1OTTC 5FGCE 1BFOA 3QDJB 3D6GA 1A6ZB 3O3EA 1GRWA 4G8EB 5D6DA 4NQSA 3T2NH 2V7NB 3MA9L 3RHWF 4UU9B 2P49B 1UM5H 1SM3L 1IEHA 1FC2D 4RGNB 3V7AE 4NQCE 3EYVB 2AJVL 2XXMB 3VE0B 1JGEB 4ZXBD 5E94A 3BH9A 4XMKH 5H37G 3MJ7A 2VABB 1BAFH 2HP4A 2APWA 5GRUL 3DNKA 1ULVA 4NNXB 4OGYL 3T8XA 3IAPA 4FTVE 4OF0A 3GMMA 2VDNL 1EJOL 4MJ6A 5C2BL 4XH2A 1SJXA 2Z35A 4PG9A 1FNHA 2EEDA 3RL1A 1GL4B 4U1MB 3AVEA 1MHHB 1PY9A 2ICES 4H88L 4DTGL 4U1KB 2R69L 3DURB 2R4RH 4FQQB 2I9TB 4XP6L 2PR4L 1YN7A 2QR0A 4HWBA 1OF2A 1LMKA 3QUML 4DN4H 3VMPA 2M2DA 1MRCH 2AI0L 3W0WB 2RBLA 2WBJB 2QADC 2ORBL 3JWOL 3LB6C 4JANA 4PJGF 1Q9WA 2IFGA 3SGDH 5LQBL 3W9EA 2I60H 3T65A 3F7VA 4ZFGH 4K2UH 4P46D 5LWYH 3EFDL 4YPGB 1VFOA 4J3UA 4Y5XC 3O9WB 2UWEB 4D0BA 4WUUD 5ESAA 3VFTB 1GXEA 4M93B 1TQBB 4KWUA 4JLRA 1A14H 2R0WL 2BVPB 4X6CA 1R5WB 1IJ9A 4LSTH 3SGEI 3SDYL 3PABB 3EOAB 3TYGL 5FA3B 4D2NA 1JGLH 3BZDA 1DBBL 1QSFE 3H8NA 2BVOB 3IDIB 2E7CA 5I8CA 3ARSA 3UDWC 5AEAA 1RZGA 4D9LH 3P0VH 5FUCC 3L3IB 3T4YA 3GMQB 3LV3A 1B4JH 3GJFB 1EXUA 5C0NC 1WT5A 4PJIB 4ONHB 1Q94B 4Y5YB 1OPGL 5I16B 1FCGA 4MXWH 4JZJB 4DVRH 2DQEH 5HDQH 4KVNH 2YRPA 5D72L 1HXYA 5FYKH 5SV3A 1W0VB 3W5NA 5HHQA 1S7UA 1Y0LB 1MCNA 4I77L 4NC1E 4C56D 1AHWC 1SMOA 5J06A 3ES6A 2R0ZH 5EZIH 2ARWA 3BQUA 1U8KB 2M8XA 2ZG2A 3BDBA 3P9LA 2NX5B 4JFEB 3EO0A 2MKLC 4TVPL 5FM8A 5MEPA 1EHXA 1UWGH 1JMZA 4PJFB 2YS4A 4YAQB 4MJ5B 1YEDA 1S9WB 3HZYB 4PUBH 3I50L 4U1LA 2ENSA 1YDPA 1GIGH 4G9FB 3IF1B 3GIVA 4NYLA 4FQHA 1NGYA 3ZDZE 2VDKL 2XTJD 3NIGF 3BPNB 3IRPX 1PAMA 2GJJA 5E2JA 3RVXD 3NCJL 1P4BH 3H3PL 5HDLA 3OPZL 2NW3A 3RUGA 3L3GB 1J8HD 4I0PD 1S7RB 1NKRA 4GRWF 5J12C 4X99B 5F9WC 4XNUH 5FYKU 4G6ML 1A6UH 4S2SB 1BLNB 3KPNB 5JO5B 2EYSA 4L4TA 3ARTA 5BVJA 4UIMB 4LARL 3U0PB 3C6LA 4OLUH 3TFKC 1JHTB 2VAAA 5DJ6B 4X4YB 1MVUA 2GSGA 1WISA 2VNCA 3ARGD 5E2VL 3QXTA 2X4UB 3QT2A 4JM2B 4UOW0 1FNSH 3V6FB 3GI9H 5J1AB 2NQCA 4QHNA 3KWWB 1DSFL 3OR6A 3QEUB 4HUVB 2F8VA 3KPRA 2XI9A 1I1FB 3BSZH 1QP1A 2GJZA 3FTGB 1Z5LB 4MNHA 2MFNA 3IFPB 2NNAB 2FATH 4Q2ZB 5LAXA 1T2QL 4XXDA 1L9MA 4XNQA 1H15B 4ODHL 4TUJA 5IB3B 3V5KB 2ENYA 1KXVC 2WBKA 2V5RA 4KMTL 3SDDB 2Y25A 2P5EB 2XG4A 2IANE 4GQ9L 4KRNA 3HE6A 2DJSA 3MR9A 1U3HC 4LSVL 1B90A 4Y16C 2D31B 1DVFD 4DOHE 2DN7A 3R0MA 1YEHL 1NAKL 2VISB 3G5ZA 3WLBA 1D6EB 2NY0C 4NN5C 2J5LC 3QEQD 2PO6B 3E2HB 4TUKL 4JQIH 4LIQL 2X4SB 2D9CA 5E8DL 3QWOB 3V5HA 2AKRB 3X3FH 3NZHL 1FO0L 4DKEL 3N85H 1TJHH 5JA8B 2GFBB 4YXHH 4YHPA 1SJEA 3IETB 3DYPA 2X1OA 4IRSC 4OFIA 3NIDE 3WXWL 3QNYB 1KB9K 4O2EA 4ENEC 3LCYA 4UTBH 3K74B 1MLBA 1QRNB 4MDJA 4Z7NF 1HEZA 4G8GE 1GVIA 4PY8J 1FG9C 5JDSB 4XMPH 1NLDL 3DRQA 4PJDE 4G8IB 5ICYB 5FCUH 3O45B 3BD4A 3ULUD 3QH3A 3GMNA 4QLRA 1JJUA 3W82A 5FFLA 3ULVL 2X42A 4XHJD 4FRWA 3ZKND 2YD2A 2MQCA 4X7TB 2AXHA 4F58L 2BJML 2Y5TA 1N3NB 4LCCA 3F7YB 4MMXC 4HT1L 3DBXA 1MF2L 3VGBA 3D18B 4B53A 3ZHLA 5DHYA 2ICWB 4XX1G 3IYLW 4Z78A 3BHBB 3ARZA 3G5VB 4U6VL 1D5MA 3IDNB 3VXUE 5HDOA 3X3GL 1KB5H 3FQXB 4MQTB 5TF1H 2VQ1A 1TPXB 5DJYB 2EIDA 15C8L 2FBJH 5LCVH 1TNNA 4ZYKA 1G7HB 5I0ZA 4Y4FC 4OF6A 1FV1A 4WI8A 4OCSL 2NY5C 1G7JA 4ZXBB 1K8DA 5TE7H 3VXQB 1UXWB 5D71L 3MLWH 3OKMB 1YPZF 4BK5A 1OP3K 2H2PC 1N64H 2YXMA 4R3SA 3DHJA 1G7MB 2ITCA 3BAEL 1U8OB 5F72S 2BVEA 4NM4H 4V1DD 4X4MA 1OVZA 3T0WA 1KGCE 4ERSH 1JWMA 2WK2A 5DRNB 4X80H 1G7PB 3MRBB 5D93C 2G5BA 4KK6D 5EIQA 1KIPA 2P5WD 3FFCD 1HCFX 3LHPH 5ADOL 3RNKB 3QAZB 5JOFB 3MLRL 4UUJA 3VI4E 1UB5B 4MNGE 3S6CA 3W9DB 1O7SA 2V9RA 3TEUA 1EX0A 5CGTA 1S9XB 1OGAE 4KI5D 3MNZB 3RVUD 4JPIA 2F19H 1Q9LA 3O41A 1RUQH 1ZGLM 3FN9A 4H26B 4XCFL 2YUXA 5JLZB 1I1RA 1PYWA 1NPUA 4IRJC 1PZUB 1FFPA 5JTWA 3SKNA 2J3SA 1FVCB 4M6NH 1N4XH 3VFWB 1IILE 5DJ8B 4YHOL 1XF4B 4WUUB 2FHBA 2EO9A 4GKNA 5AAMA 1T5WA 43C9B 5KN5B 1CFVH 4PLKC 1GC1C 2X1WL 1A6VH 4NQXB 4PRDB 2XZZA 1QSED 5DS8A 3DGGB 3EOTH 2BRRH 1A1NB 2SEBA 5CD5D 2HVKB 2QQLL 4G6AC 5TFSL 1A4JA 4CN1A 4XP9L 1MCQA 2P42B 4NKQB 3LMJL 3V0VB 2VLLB 5D70H 3RWGB 5IFJB 1S9VB 3D2UA 4JHWH 2WBWB 5MEQA 1CD9B 1N0XL 3VG9B 4M6OH 3CLEH 3MRGB 3QFJA 3MBXH 4ODXA 1FP5A 4BZ2L 4C57C 2D7TH 3BP6A 1AGDB 3H9SE 3KJ4C 2J8UE 3IXAA 1BD2D 3MA7B 3QPXL 4GKSA 3EYFB 2R29L 4XB7A 2X4QB 1KCSL 2BSSB 4JFZL 3SKMA 4F7EA 5I19L 4RQQB 2V17H 2FJFB 2O5YH 4C56B 3BPCB 1FRGH 4CJ0A 1I9IH 4ISVB 2FSEA 4U4BA 2XT1B 3PGFL 4P2QE 4QRUA 3QUYA 4LPWA 3F5WA 2IBBA 4LKCB 3BRFA 7FABH 4EUPA 5ANME 1IGYA 2A9ML 5ENWB 1KIQB 4GLRI 1I1AD 4YZFF 4LLQB 2I5YL 2ADIB 2D2OA 2XTJB 4MNQD 4YHIA 5HYFA 3LS4L 5E8EB 5JW4M 1D5IL 1YEKH 4HWNA 2FEEI 1QYGH 5KJRL 4DEPB 3VWKC 4NC2B 1ZA3B 3S7GA 4XGZB 4PR5B 1J8HB 3QP3A 3ULUH 1UT9A 4I0PB 3IFOB 3JTTB 3TYFB 3UXFA 5HVHC 1GGTA 2ADFH 4YLQT 2AQ2A 3FB7B 4XAKE 1PZ5A 1AKJD 1DBAL 1II4E 2ESVD 2MMXA 3DXAA 2LV4A 4J3VA 5KSBA 4ELMA 1GZQB 3NCMA 1G0DA 2FHCA 1RULH 5CD3A 1DR9A 1I7TB 1N0LA 4AL8L 1SBBA 4POZD 3I9GL 3QCVH 1LO3L 5FECA 3FQUB 1WZMA 5LGKA 1NCWH 4HX1A 4KVCH 3OHXA 3ARPA 1UJ3B 5GSVA 3QUXC 1B6UA 2H6PB 4Z77B 1YQVL 4RFNB 5E8NA 4CUCA 3K8LA 5E99L 4OFPA 1MREH 4YC2B 3U4BL 2VDQL 4OZHF 4Y8AA 4U1IA 4GRLC 3MA9H 3C5JB 4JRXA 5C0IA 3BT2L 4NC1C 1ZGLB 2AJVH 3OJMB 4X6DB 5IW6B 1X6LA 1Y18B 1DVFB 4FNLL 4PJAA 2GQHA 5GRUH 3RI5K 1J86A 2AJZB 4OGYH 2WIIB 5BZDB 2HJKB 2VUOA 3FCTB 4W68A 2VDNH 3U46A 2VLRE 2DL9A 3IKCB 3JWNC 4PJEE 5A2KH 2VZOA 4LHQB 2PYEE 1MUJA 4R0LC 4XCEA 4ZUTB 3GRWL 4GUPA 5L9DL 4KHXL 1T21A 2CIIA 3HAEH 2BSED 4H88H 4DTGH 4CL7A 4FQ1L 4TQEL 3PHOB 2R69H 2ID5A 4S0TD 2EDLA 4XP6H 3NOIA 1T1WB 2PR4H 4H8WL 4PRHA 3GSWA 3QUMH 4UQ3A 5BV7B 2AI0H 3ARBC 1YMHA 3S5LB 1IMHC 2ORBH 3JWOH 4TVSa 4PG2A 1XFPA 4MA3A 5CZXC 5HGGS 5HHOA 3WFBL 2H45A 5LQBH 2BHZA 5DI8B 2DKSA 5DYOA 4WU7A 3EFDH 5GGVL 3VGFA 4CMMB 5DVLA 2W0FA 4O2CB 2WUCL 3OAYH 3ULVD 2V5MA 2FDBP 4YNYA 3BZ4A 1MJJA 1FLRH 4MDIB 4NRZA 1P7HL 2R0WH 3CXHJ 5BRZE 3G04A 3SDYH 3BFOA 3TYGH 3QHZL 2MJWA 1K4CB 2HG5B 4HC1A 4ZSOA 5GJTL 2PYEB 3CPLB 1DBBH 1FNEB 3B3IA 1KLGA 4MVBC 4Z5RB 4XP4L 4C59B 4WO4D 1EFQA 1HHIB 5E8OB 3HA0A 1P7QA 1JRHH 2VDRL 2W38A 4HS3B 2DAVA 5E95B 1K3IA 3FQRA 4X5XB 5I2IA 1VA9A 1U8JA 4OZFB 1OAUL 1NMBL 1OPGH 4P2OB 1EHAA 1SVZA 4WVRA 5CGMA 3O3BA 2A2QT 5CEXB 5D72H 1QUNA 4V1DB 4K7FB 1FORL 25C8L 5DJZB 1RUKL 2JJVA 4RAVB 4D8PA 4W4OA 5I8EA 1GSMA 3KS0J 2Q87A 3VD4A 3ET9F 1FSKB 4WW2A 5EN2A 2P5WB 1CQYA 2VN7A 3DO3A 5BZWA 1BJ1J 5FEBA 1PQZA 5C0CE 1NUDA 1WZ1L 5C08D 4TN9A 4C83B 3GKWL 3WJLC 4UT9H 2YD4A 1NBZB 3TBSA 3ZHDA 4TVPH 3QDMD 1MCCA 2H32H 5EUOE 4KQ4H 4PREB 1Z0MA 1MFBL 3NN8B 4U1HA 5CJ8A 4F15B 2CLZB 3TO4D 4RGMC 4U2ZA 4PRBB 4IOFD 3OF6A 4Y4KA 3HI6L 3CFBA 1OOAA 2VDKH 1XH3B 4X4XB 4GAGL 1FVDB 2YA0A 1ZVHA 2YPLA 3V4UL 3NCJH 3H3PH 4QRQB 3MRRA 2D9QB 3OPZH 5F7DB 5JOPD 4L8DA 5D1ZA 4ZUUB 4G6MH 3VXME 3E3QC 3SGDI 4WENB 1QSEB 3RIFF 4G9DA 4XVSL 1JZ5A 5DQJB 4LARH 5C9JB 3F7PC 4WHDA 4MSWB 3KPSE 4NHCL 4OT1L 3HC0A 5CP7B 4NSKA 2KH2B 5MI0C 3PWVA 3QYCA 1U8MB 1LEGB 4PGCB 2B1HL 1R5VA 1ERNA 5C0RL 3GEWB 3CX5J 5FYJE 1DSFH 2D7OA 1I1YB 2EXWD 4UAOC 1LE9B 5LGJA 5E8PB 3SGJA 2FR4B 1H0DB 4G80A 3MRIB 3S4SB 1BD2B 1T2QH 4R97C 3V7MA 2NLJB 4P4KD 3PDOA 5KVGL 1BGXL 4LPVA 4ODHH 1PKQB 4HIJB 1FZKB 2GY7B 5EZJA 4Y4HD 4KMTH 1KJVB 4XCCL 3GMLA 3ZKXC 4W6WB 4YO0B 3MRCA 2EH8L 3MUHL 4JRYD 1IFHH 4X7SH 3S34L 4LSVH 5IBLD 2NR6C 3FN0H 3CVHB 1CFNB 1PX4A 1NAKH 2EYTA 2RCSH 1AGBA 4RMUA 1EFXD 2NY1D 2DTML 3GIZL 2OL3B 2UWEF 4P4RB 4TUKH 5DJ2B 4LIQH 3IXTB 1ORQA 2HT4C 3BP4A 1EEZA 5E8DH 4XWOD 5ALCL 4MNQB 1FO0H 1FGNL 2DM7A 4WUKL 4DKEH 4IMKA 4CVWA 1NC4B 3X14B 1J18A 4M7JL 1ADQA 1PW3A 1XF3A 3GMPA 5TJWK 4I18A 3JVGA 4X6EA 5H8DA 3WXWH 4X4ZA 2Y6SC 5HYJA 3LKNA 3C6SA 3GB7A 4JQXA 3KPMB 5D2NA 5BMFH 2V5TA 3KYOA 4N0CC 2DM3A 4EOWL 4Y5VB 1LILA 3VGAB 5L8JB 5IROC 4HLZH 3ULVH 4PJIF 2DMKA 4KC3B 4MAYD 4PGZA 5IFAL 4O4YL 3VA2C 2QL1A 5DD0L 5D7JC 4F58H 2BJMH 4PJ8D 3GMOB 4QNPE 4PRIA 3D5OF 4HT1H 5KTEL 1MF2H 4NWUL 3OSKA 1WEJL 4N0FA 4M6AA 1EBPA 4OLZH 5EA0L 2XQYG 4U6VH 4QRSB 4QO1A 1A6PA 1KPRB 1R5IA 3QO0A 4FXKB 3W11D 5MHSD 4MB4A 3X3GH 4Q9RL 3V52L 2YUVA 3QB7C 2L4OA 4WTXA 1YEIL 2WZPD 4F7CA 1MPAH 1P6FA 3K4DA 3TBTA 4DKAA 2IBZY 1T7YA 1WUNT 1DLHA 1CE6A 4XP1L 4HXAL 3VFSA 4OCSH 4PJFF 1WLHA 1LE5B 2EIEA 3MROA 4WV1B 4EN3A 5D71H 1FIGL 2WAHA 5C2UB 4P3CH 1IVLA 2FNBA 1JVKA 2IADA 4EI5D 4ZAKD 3MRJB 4IRZL 5DC0A 3HZKA 5I9QC 3PHQA 5SWSE 3HUJB 2VB5A 3U9UB 2C4FU 1YMME 3G5XB 3D85B 3PP4L 3E6HB 3MJ9A 5HJ3A 1GGUA 4DGIL 5ADOH 2QHLA 2AXGA 1CFQA 2GITB 4LVOC 1Y6KR 5A2JH 3MLRH 4H5SB 1YJDL 2XZAL 4FFVC 2V2TB 3ZE2E 4BSWA 5CBAB 1WFTA 3AXLB 4OFVA 3AU1B 4JM2F 6FABL 1MCOH 2X9XA 4XCFH 5I71B 2FRGP 5BJTB 4F57L 3EFFA 1JK8B 2YC1A 1GGCL 4NHUA 2PCPA 3D25B 4U0RB 3CMOL 1I3VA 4YHOH 2E7MA 1BOGB 3ZDZF 4KJYB 2FWOA 3O2VL 4LHUA 3QQ9D 2GK0A 4U0QB 2VXVL 4KJWC 1UM6L 4QHUA 1K4DA 4OF8A 2OJEB 4ZS6C 4HS6A 1R3IL 2QQLH 5TFSH 2DLTA 3VW3L 3SKOA 3UPAA 3VFRB 1DQLL 4OAWA 1RZJC 1CDGA 5HHXL 3LMJH 4JO3H 5EU7E 5E24E 5GGSA 3QFDB 4JZNA 4WO4B 1BZ9B 3GSUA 2R1YA 5IVXE 4PGDA 5E1AA 1X9QA 5FKAA 1YEFL 3TO2B 1AJ7H 4P5TD 4NO0A 2W0PA 1BQUA 4BZ2H 1PX3A 5E03A 1WC7B 1FYTE 2PW2B 3UEZA 2X05A 1BVLA 4ODVL 2X89D 1AGEA 4A2MA 4PJXB 5HYQB 1LP9B 2J4WL 4LCWA 4XBPA 3O3DA 5FOBA 4X6BB 4J3TA 1KCSH 3EO9L 4HBCL 4JFZH 5I19H 1Z9MA 1UWXH 4HKZA 4Y5XA 5KVEL 4JVUA 2YBRB 3PQYA 2AV7B 4GJTB 5AAWA 3O8XC 3PGFH 4Y19A 1NAMB 4G7VH 1BZ7A 5FUZL 4L4VE 3T09A 1FG2B 3UAJD 4ZFOL 3QDMB 4KQ3L 1JWUA 3U4AA 1JZ2A 2A9MH 1M4KA 3SJVA 3TO4B 4JHAL 3P2TA 5FCSH 2I5YH 3B9AA 2R1XA 5F9JA 3T0EE 2Y7QB 1MFDL 5FYLL 2QKIA 3LS4H 1NL0L 4N9OB 1D5IH 5HYEA 1CCZA 2FYYB 1MAKA 4NRXA 3MYZA 4UI2A 5KJRH 4OZGE 4MJID 3PWNB 1IGJB 2BSTA 4P9HC 4UQ2B 4NRYA 5CHNA 4OZIB 1U0QA 1F4XL 1M05B 3P4NB 2VLKD 1FL5A 1MWAA 3EYSL 4HEPG 2YRZA 1DBAH 4LGSB 1A9EA 4NQVA 3O11A 1U8LB 2LABA 4PRPA 3JSSA 2XQYK 1EIBA 2CUMA 5ESVA 1NC2A 1HH6B 1SJHB 1AHWA 2FL5B 4CGTA 4Z7WA 3I9GH 3QBTB 4X9HA 4LLVA 1JYWA 1LO3H 1MCRA 2CMRL 3O3AA 4ZPVA 4NT6A 5C0EA 3NH7H 3T0DA 1URLA 2QQKH 1ZHLA 1A02N 1YQVH 5ITFB 3OB8A 2NY7L 1C12B 5CS7A 4P57B 5E99H 2DICA 5IQ9A 4XPHL 4BUGA 3G6AA 3AS1A 3U4BH 3TVMA 2VDQH 1RJYB 2YZ8A 4BFBD 4ZO7A 4OI7A 1RZ8B 2OTUA 1KTLA 4FQJL 4ZOBA 1HQRA 1UGNA 4FQLL 1VKXA 1EO5A 4Y4HB 3BT2H 3B8YA 2H3NB 3WHXB 2IMMA 3FL7A 5FDYA 1J0IA 2Z8WC 1I1CA 1MNUL 5HD8C 5L2KA 3ZT6A 4M61A 2MCPL 3U6RA 4FNLH 4HMDA 1I9EA 2HJFA 1S9YA 1C08A 3QXVA 2A6DB 2IH3B 2NY1B 2ZSWB 3O6FC 32C2B 5F3HB 2CH8A 3RWEA 4PJ5A 3B9KC 4LKXB 1N59A 4F7MB 2Z91B 5C09A 3RWHB 4LSPL 4M7ZC 3V8OA 4PS4L 3DROB 3I2CL 1XGQA 3GRWH 2P45B 3MUGB 5I1LA 4KHXH 4L29A 1KJ2L 3B6SB 5L9DH 3MRQB 5D5MA 4U49A 1XGYL 3LEYL 3ZTNL 3WBDA 4YHML 5AZEH 2ARJQ 4FQ1H 4TQEH 5HGDA 2XZCH 4XCYA 2K9UA 5L6YL 4FFWC 4K9EL 2GJ6D 4YUEL 3VRLF 3QI9C 1JNNL 4Y1AD 2B5IC 2H41A 4MD5A 4CVZB 5B39A 1SEBB 4JCLA 1S7SB 4KPHL 4UV7L 1R24B 4QF1A 5DJDB 1NFDB 1UYWL 4R9HA 1C5DA 4MAYB 4JRWA 3C08L 4XWGL 3UJJH 3EDEA 5KSVA 1GC1L 5GGVH 1MI5B 4PJ8B 2OX5A 2WUCH 4P48A 1U3HA 5I73B 3MZTA 1KYOK 4Y16A 1TIUA 1RQ5A 1ONQA 3FB6A 1DDHA 3WHE1 3LPGA 4UB0L 3FQWA 4KKCC 3NZ8A 3NCEB 5DC4B 2BC4B 3QHZH 2NY6C 2A73A 5FB8B 5GJTH 3OKOB 5LXGL 1MQ8A 1DQTA 4PGJA 3F6LA 2F8OA 3DI3B 1JUFA 1YUHA 4XP4H 4JFQA 1D5ZA 2F53A 3NPSB 1CFSA 3ECBA 4FXLA 2G75B 5ID1B 2VDRH 3D39D 1X5XA 1UB6B 1A4KB 1LO0H 3SDAC 3ZMRA 2EDJA 5ID0B 4IOSD 1G9NH 3O4LA 1HE7A 1Q72L 1YNTB 3M17A 4EI5B 3WFHB 4ZAKB 2Y5EA 2B4CC 2BFVL 1FORH 5ELIA 3BUYB 4H25B 4JVPA 3FOMA 3FT2B 3MV7E 2V2WB 1RVFL 4OSUL 4OGZA 2DWEB 2VLJE 1KTRL 1WZ1H 1F42A 1UH3A 5T1KD 2NY2B 2BOCB 4ZMAT 3HNVL 3KPQB 5CLTA 5BXFA 3CFDA 1MFBH 4EI6B 5DA0B 3AAZB 5HDBE 1OGTB 3HI6H 1ND0A 4K7PH 4DVBA 5EZOL 1HSAB 2R1WB 4O2FB 4ONGL 1Z2KA 1J05A 4Y4FA 2BY0A 4HKBA 5HGBB 3DETC 1KJMB 2PXYC 1YY8A 1IM3A 1OP5H 3QJHB 5KG9A 3KS0H 5C0GB 1K8IA 2HTKC 1FFRA 2ZNWA 5HYSA 1MCWM 5E4EB 2Z9TA 5GS3A 1BJ1H 4R7NA 5CAYB 2BY2A 5JHDD 3C8HA 5I15L 3BVNA 3LEXB 1WFUA 3UTPD 1UENA 5IVZA 2XPGA 1F6FB 4NHCH 4OT1H 5LJYH 4GFTB 4P5KA 1AGCB 1DFBL 1ZT4A 1MCDA 4FZ8L 5I75B 1BQLL 3WE6A 1D5XA 2B1HH 1MLCA 2P7TB 5C0RH 1OB1A 1NGXB 4PV8A 4L9LA 4PLOB 2B0SH 1JL8A 3RTQC 1ZT7A 4WEMB 4MMZC 1CGSL 2VZ3A 3PWJB 1WZKA 4GMSL 4J6RH 3Q3GB 3FOLB 1J8KA 4DCQA 1BGXH 2OS7A 4IRJA 1H3UA 1KCVL 2F58L 5T3XL 1LDSA 1QFWI 5JNYB 3HMWL 3MNVB 4XCCH 4Z9KB 3VCLB 2MSPA 4JREC 3ZE1F 2EH8H 3REWA 3S34H 5GIRB 1ZWIA 2C1OB 5IB2B 3L3DA 3JBG7 5H94A 1N2RB 1VFBA 4Y2DC 2WMPA 2DTMH 4K94C 4XCNA 3GIZH 5DEGB 3VFUA 4LVNC 4AEHL 1QHOA 3BH8A 5ALCH 4LRIA 4BFIA 1OAXL 1FGNH 1QLEL 2HH0H 3JTSB 3V4VL 4WUKH 4NQCA 4PJEF 1DN2A 4M7JH 2XWJB 4XX1E 3QUKB 4YDVA 1FL6B 1S5IL 1T0NB 4UT6L 2A9NL 5D9SA 4LSUL 4JDVA 1F58L 4XHQA 2ARJA 2VLKB 3HPJA 1SYSB 1MCIA 4FTVA 1A7OL 3ORJA 3MV01 2EDDA 2X4PB 4JFYB 1KG0A 4JFPB 4EOWH 1NFKA 1TVBB 5CIPA 1KCUL 3MLYH 1OAZL 1Q8MA 2CDEB 2NXYC 4LEOB 3ZLQC 1ZANL 2WQ8A 4BH7B 4TSCL 3RWCA 1R3JA 4XPGH 3OWEA 1A1MB 5DDHB 5IFAH 4O4YH 4WJ5B 1LEKA 5DK0B 3BEVB 3E6FB 4FZEL 3LQAH 4NPYB 5KTEH 1HHJB 2UUDH 3EHBC 4NWUH 1I3RA 3MGOA 4HWEL 2ZZUT 5F9OL 1A1OA 1AE6H 5EA0H 2XG5A 3U36B 1UZ8B 1SYVB 3HNTH 4AEFA 4Q9RH 2AS5M 3V52H 2F74B 1D5BA 1YEIH 1BBDH 2CDFB 1CZ8L 4KI5F 1P1ZB 1XF1A 3NABH 3RNQB 4XP1H 3L9RB 4HXAH 3LRHA 4PPTA 5IB5B 3TF7C 1N5AB 3RZCA 4Z7VB 1T7WA 1ZLWK 3RAJH 3HN3A 2O5ZL 3DUSA 3L7FA 4LLWA 4KJPC 1FIGH 4O5LL 2JJTC 5KANG 2UZIL 2B39A 4U1NB 3BZEB 5DJXB 4M4RA 1F3RB 1RURL 5JHLL 2GTZA 4HWZB 3C8DA 4IRZH 2BNRE 4HF5L 4YFLI 2BCKA 3RVWC 4G42B 1QSFA 2YHGA 1DUYB 3T0EC 2A6JB 4K7PX 2FIKA 2DLEA 5IMLA