4OV5B

Structure of hla-dr1 with a bound peptide with non-optimal alanine in the p1 pocket
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Susceptibility to HLA-DM Protein Is Determined by a Dynamic Conformation of Major Histocompatibility Complex Class II Molecule Bound with Peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 42
structure length 189
sequence length 189
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ov5B01
4F57H 3GSWB 3MV9B 3VXUD 5E4EB 1FNGA 2PW1B 5KSUB 1CZ8L 5F96H 2QADB 5EIVA 3V5DB 4FMKA 1TVDA 4P59L 5C0AB 4UT7L 3ULVF 2BVQB 1KLGA 3S35H 4ONHA 1E6OL 2ZPKH 1MHPL 3SOBL 5C0NC 4BH7A 5DK2B 5E95B 3DX7B 5K9QI 3T0AA 1BWMA 3WDJA 1IC7L 4OGXL 4OKVA 3CFDA 4OCYL 5I75C 4S1SH 4XCEA 3WKMH 4U3XA 2JELL 5F7WC 2X5PA 3QPXL 4XPAL 4OZ4A 3E6HB 1S7RB 2NLJB 3RPKA 4DK3A 1KPVA 3DROB 4RFOL 3SGDH 1HQ4A 2WINA 4J6RH 4PJ7B 1NJ9B 5GGVL 5GIRA 2DLEA 1Q9LA 5CIPH 2FLBT 1T1WA 4MLSA 4YNYA 3TJEL 4K9EH 2OJEA 3LVEA 4OUUA 3FCTA 4ZD3H 2R23A 4LIQH 1AXSA 3GRWA 1U8IB 4IRSD 3ZDZE 3LKQB 2FL5A 3QDGB 4GKOA 5ACLA 4Z0XB 3MREB 2FD6H 5C0CB 3ZT7A 3U9UA 5FYLH 1C7SA 3IJSA 3C8KA 1ONQB 3WD5L 5LGHL 5T1DH 5IMMB 4Q9BA 4U7MA 3FRPA 4M62L 5E1AA 4KAQH 5ICZB 3BMWA 4X7SL 4CRPA 5IQ7H 2A77H 5MEQA 3ARPA 1QD0A 4G8IB 1FFQA 4ZUTB 4WI9A 1M71A 1B4JL 5DEFA 3WNPA 1C5DB 3I2CH 4ZAKB 1TIUA 3G6JA 4ONGH 1YN6A 3I75A 4ZNEA 1CE1L 2A9NL 4E5XA 3UC0L 4OFYA 2IFGA 3TYFA 4NWUH 3VFTA 1CR9H 4DN4H 4AH2A 1C16B 1G7HA 5DWUH 2FO4B 5HHNB 4WFHE 5SX4I 1NAKL 5IF0A 3L3DB 4UIMB 4XWOC 2H8PB 4Y4KB 3TNNA 4P46D 2B5IC 4PJFA 1OTUD 1A5FH 2VDMH 1KLUB 3WJLA 2DLIA 2C3HA 2F5BH 1J0KA 5GRJH 2P5WD 4Y5VC 1OAUH 5BVPL 1AQDA 2QV2A 3NABH 3UTPD 1U8QB 1NMAL 2X70B 1YEGH 4QNPE 2CDFA 3QCTL 3DUUA 2CIKA 3SKJL 1F4AA 4K3DH 5DRNB 5DQ9A 3ARBC 4GG6E 2H1PL 3K7UA 1AXSB 1KCSH 4V2BA 3GI8H 1RIVH 4LCYA 3U46B 3WFHB 4HJ0C 1DBBL 1U0QA 5IOPA 4JQVC 1LHZA 4WEUD 1X5ZA 1IKNA 4L4VA 2AGJH 5FV1L 3M8OL 1BZ7A 1D6VL 1GGTA 1CFNA 1VACB 3PF2A 5CS7A 4R96A 1IAIM 2XWJB 3FFCE 1NCAL 5J13C 5I16A 2V7HA 2AK1L 4HS3B 5CP7A 4YE4L 1B0RB 3OKDB 3DOSA 3W5MA 4OZIA 1HHHB 2FBJH 3HAEB 4NCC1 1EEZA 1C08B 3O6LH 4KKNA 5HHNA 4QF1B 4YWGH 4GW5A 3HFML 2BNUA 2FYYA 4XNXH 4O2EB 5EZOL 1IM3B 1JHKL 1R3HB 4UINH 3C5JA 2GAZB 1I3RB 5GGUA 3ZTNL 2QR0A 2BY2A 2P5WA 3LCYA 4C4KT 2EDBA 1UADC 3NCCB 3J7HA 3SGKC 3MRGA 4DZ8A 4U1LB 5DUPL 5JW5B 4XPHH 2LU3A 3QEHA 4K9EL 2VDNH 3BUYA 2ED9A 4WEBH 4RIRB 3RVWD 5DZLA 1M7XA 1REIA 3RHWF 1Y18B 4N8VA 1F58H 4H25B 4QTHB 5JHLH 3GUTA 2CIIA 3L9RB 5JA9A 4M6NL 4X7TA 3MLWL 4BQ6A 3K4AA 2GT9A 4ODHL 1EJOH 3SKOA 3TEUA 4MQTB 1T03H 3P0YL 4GRMB 3VG9B 4QRQA 5KW9L 3QUMA 5CMAA 4GBXC 1X3DA 1KJ3H 3THML 1X5IA 4TRPL 4ALAH 1OQOA 1ZT7A 4HUWB 4LMQE 4OFVA 1Q1JL 2B1HH 3DYMA 5KG9A 2YHGA 2VLLB 4PGCA 4P5TC 2J1KA 4RNRA 5IP4A 3VGAC 5E2VL 3X13B 1CR9L 1T6WA 3NIDE 4ENED 2GFBB 4PGEB 3ARGA 4JFQA 3RTQB 5L7XL 1VSCA 3QJFB 4JFHD 5D72H 1WFUA 4NC1C 1TTFA 1UCBL 1T1YA 4NZJA 1GZQA 2XN9B 4CVZB 2Y9RT 3CZFB 4HIHB 4UB0H 4QCIA 2WZPD 1PQZB 4X5WB 5DMIL 4KHXL 1NGZA 2H26B 5HHPB 3QG6A 1RI8A 4XMKH 4HIJB 3PQYA 1MOEA 5CLTA 1MCLA 4Z78A 1CD0A 3VFNB 1HHJB 5E2UL 4H5SA 3P4LA 4FHBD 4IIQB 1R5IA 5C9JB 3BO8A 1X5AA 2OP4L 4HK0B 1ZWIA 2F74B 5BVPH 1FZKA 5IB1B 2XNAB 3VI4E 3JVGC 1HIML 3OBAA 4XNYL 5D6CB 2GJZB 3VXUA 4HS6B 4JPKH 4O58L 5EDXA 3WL9A 4HG4J 4N0UB 2YPKA 3ULUL 4FQLH 1PDKA 3UTZB 4MQXD 3G9AB 2BOCA 2P4AB 4GBXA 4BYHA 4LHQB 1ZLUH 4KK5D 3TYGH 1PKQE 1QKZH 5LKNA 3BDXA 5EZJB 1CT8B 3PXHA 5IVZA 2O93L 3E8UH 2Z9TA 3EIFA 3H42L 1DBJL 4OFKA 3ULVC 5FYKH 1EGJA 3RGVA 3LKSA 5E00B 3G6AB 3V6FB 4OTXL 3ECBB 3EKCA 3ZTNH 5F7KC 5ID1B 2XKUA 2EECA 4HKBB 3W0WA 4DTGH 5EIIA 1IQWL 1ZLSH 4X5WA 1YY8B 1EV2E 3UYPA 1MREL 1HSAA 2BNQD 3V8CA 4JVWA 2Q8BL 4UV4H 3KYKH 2Z31B 4K7PH 1BJ1J 4V1DE 3QXAA 5FXCH 4PRDA 3NZ8A 5C1MB 1CWVA 3ETBF 5JXAL 3WS6C 4OZFH 5T1LB 2R2BA 5FUOL 5MP6L 4WO4D 3MBED 4ONFL 2V2WA 2IAMC 2BNRD 5JR1H 1LDPH 1YJDL 1CD8A 1S7QA 3EFDL 1IAKB 2ICEA 5JHDE 3CUPA 4HMDA 1N4XH 4ISVA 3VFOA 4PJFE 1CDUA 3SPVB 2XY2A 5KSUA 3KWWB 1G6RB 3NFSL 1FAIL 5T3ZD 4PJ9D 4L4TA 4MA1B 1N6UA 3T2NL 3W39B 5L2KE 2X10A 4OLWH 2FHFA 3CXHJ 2E5EA 2NNAB 4DGVL 4Y1AA 4PJCB 3BKCL 3WD5H 4JCLA 5F9JA 5DC9B 1RIVL 1XFPA 1J8HB 4KKBD 3G5YA 2FJGB 5GHWH 1FNEB 1YNLH 5DJZA 1FZOB 3X3GL 4DZBA 1WISA 4ZS7H 1N6QL 1G84A 2H32A 1HH9B 4J7RA 5HYSB 1S9WA 2KDGA 1I4FA 4I0KA 1FNGB 4XWOD 1ZA3B 3TO2B 5CJQL 5IEKA 1KB9K 4LDLB 1G7PB 2ITCA 3MJ9L 3NIGE 4R4BB 4FTVB 1AH1A 5DWUL 3ARDB 4XCNB 5EOQH 5E7FA 1QBBA 4LFHG 1N59B 3CDGB 4LLMB 3LH2L 3FMGL 1AO7A 4MX7B 5KOMC 1LEIA 4LCUA 2BOBA 4Z7OE 5I73C 1DL7L 1V3LA 4Z7NE 1RURL 1WZLA 2PYFA 4ZSOE 1JZ8A 4Y5XB 2BVPA 1LGVA 5E2JA 1G7LA 4X7SH 1XIWA 4LSRL 3T2QA 2ZSVB 3HTLX 1QHOA 5ADPL 4JRXA 4G7VL 1D3CA 2AABL 3HKFA 1E6JL 2ADIB 2WIMA 3MLXL 4YNYB 3MRHB 2VDKH 1R3LB 4Y5YC 1U8IA 5EU3A 2DM3A 4X8JB 4Y4KD 4IRSC 4P46B 3QHTC 3HPJB 5J1SC 5HHXL 3FB7B 3RWJA 2H1PH 4PJEE 5JO5A 1MJJA 2WQRA 3T65A 4LSQL 3O4LD 4I4WB 5DI8A 5FA4B 2FWOB 5CINL 1OP3K 2HT2D 4KKLC 1A7PL 3B2VH 3VFRB 1NMAH 5DHVA 4Q7DA 3QCTH 2ESVB 5EFIB 5IEHA 4M4PA 1FNAA 5E8NA 3D18A 1J1XH 2APWA 5MEPA 5MEND 2E7CA 3VRIB 1UZ6F 4JFEE 4E41E 1NL0L 2H9GB 1RJZA 5DVOA 5HGBB 2P8PB 3N1GC 3DBXA 5JW3H 4OGZA 3RZCC 1DN0A 1K2DB 1PKQA 1DANU 2C5DC 2QQNH 4U1GB 4ZTPH 4F7CB 1AGBA 2UZXB 4LPTA 3UJIH 1NCDL 1NBVH 1P4LA 5DZOA 2OI9C 2IQAB 1QRNB 4XP4L 3GBNL 1V5JA 1BP3B 5TDOA 2DAVA 5DSCA 5IGXH 5K59E 4OBRA 2Q8BH 4X9BA 5F9WB 1T89C 4C57C 1A02N 1EHNA 3HG1E 1PG7X 5E9DB 3ZE0F 1LEGA 1JWMB 3OJ2C 2RGSA 3JV5A 4DEPC 2XICA 4LQFH 2M1KA 3ARGD 3TT3L 1MPAL 3TO4C 5HYEA 1TETH 3VWJD 5C08D 3QB7C 2JJTC 4HW6A 4K3HA 5E8PA 1QA9B 1OAZH 1UZ8A 2DTSA 1RZJL 2NY4B 1QKZL 5IB5A 1GPOH 1Z3GH 4HUXA 4Y2DD 4W4OC 4Y5YA 3BISA 4IRJA 1AE6H 2WMPA 1OP9A 1RZJC 3NCYS 2I25N 4L8BA 3LHPH 4WW1B 5ISZE 3BH8B 5DJCB 4AEIH 4HH9B 4PP2B 3G5VB 4YPJA 2DMCA 3SJVB 2CUIA 1I1YA 3RWGA 2Z0BA 3TESA 1T7YA 4GUPA 4KKAD 1OAKL 4U05A 3ARTA 4FQPA 4HGWB 1AQKL 4OF7A 3BD3A 4XCEB 4JJ5B 4FMFA 3I50H 4R7NA 5E4EC 1EAPA 2K3TA 3PDDA 3FB6A 2G75A 1JCKA 1OWWA 4APQA 3E0GA 2GUOB 3GUTB 4KROB 4PJBE 2D03H 2YWZA 5F9DC 5JOFB 4P59H 4WUKL 1MFNA 4F7TA 3C08L 3EFFA 5MHSE 4KJPD 1H5BC 1VFOA 2VZSA 3IS1X 2F53B 5EUKA 5E7BA 1S5HB 4MA7H 1IT9L 4O5LH 4QOKB 2P5EB 4NNYB 1F6LL 3L3OB 1FP5A 4WV1A 4LCWA 4EXPX 1L9MA 2VDML 3QEUB 3ARGC 5LVEA 1NUNB 4EUPA 2DLFH 1AGEB 3L7EB 4TVPH 4WTZA 3RNKA 5I1KL 4FNLL 4HAFA 3ROLA 2WUCL 3EO1B 3NFSH 1UCBH 2BSSA 3MRDB 3QO1B 4HF5L 4BQCA 4OI8A 1Z0MA 3MRKA 3HR6A 4JHAL 4FFZL 3BKYH 1UM4L 8FABB 1ZA6B 2DYPA 3A6BL 1T5WB 4TUKH 1F4XL 2ATKA 1FFPB 3L7FA 5IROC 1BQUA 3U4BL 4OM1H 4A2MA 2DI7A 1KB5L 1IGJB 4QYOB 3EYSH 4P5MA 5DD6A 4Y5YB 4ZSOA 5GGTL 3PL6D 4IRJC 5IJKC 1MLBA 3QQ4B 1UFUA 5BVJB 1JF5A 1T6VN 3VFGH 1VDGA 5I71B 4KQ3H 2FJHA 1NL0H 3KG5A 5FUOH 1GZPA 2JE8A 4JKPH 4HT1H 2UV3A 5F71A 2UY6A 4ONOA 4X98A 3IAQA 5JXEC 3U0WL 4ERSH 1MI5D 3PGDB 2VLJE 4WJ5A 1A7BA 3BGMB 4Z7NF 1E4XI 4KMQA 5F1IB 4EI6A 1P84J 2GCYB 4Z95L 3TCXA 4X6CF 2QSCL 4TSCL 5C7XL 5HYJE 3AAZA 1JZ3A 5JW4Q 2J5LB 1P4IH 1QFUH 4M4RA 1X7QA 3SN6N 4A2LA 4P9HC 1HNFA 5C86A 2CPCA 5HHQA 4PGBB 5BO1H 2EE6A 2P7TB 5GSRA 3SY0B 1M1SA 1UYWL 3IFOB 4Q9CA 4R2GC 1JVKA 4UTAL 4XHQA 1CTOA 5EBWA 4NO3B 3BT2H 3I6LE 1N8ZA 5GGTH 1FDLH 4LOUD 3L3IB 5ALCH 3VI3F 4W81A 1SY6H 1G7IA 3UPRA 3VXTA 3QIWB 1EDQA 1XH3A 3B9DA 3REVB 3OKOB 1CF8L 2DBLL 4JDVA 4JFFD 2VZ1A 5L0QC 2A73B 5B39A 5AZ2L 2YA2A 1BBDH 5GRUL 2VZVA 1G9MC 4P4RA 3O6FA 5KANI 3K8LA 2FX7L 1WCBA 3T3PF 1NCWL 2G5BB 4OT1H 2J8UF 4MXQD 3N85H 1OT2A 3HHRB 1T04A 3EHBD 3DRTA 2D9CA 3FAXA 4JM2A 1WIUA 2HG5A 3CFJB 5D1XD 2YZ8A 3NPSB 1EERB 3GIVA 2SEBB 1OB1B 1T0MB 4ODSL 12E8H 1F2XK 2XWBB 1MFEH 2KBGA 5DMJB 1KOAA 5C0AE 5EU7E 3DMMA 4LKXA 4DKAA 1L9NA 3TV3H 3MO1B 4MS8C 3UX9B 3WLBB 1RY7B 5BMFL 1SY6L 3KLAA 5I0ZA 4LASH 4OAWB 2KQMA 3S37X 3JWNC 2NY0B 1FYTE 4BZ1L 1AJ7L 3V7AG 4PJGB 2HRPH 2ENSA 3W9DB 3ELAT 1P5VA 2FB4H 4LSQH 2FIKA 4K3JL 1YPZA 4KJQD 5D7IF 4NKMB 4KK8D 3GK8L 5FYJL 1HE7A 3X14B 3ULUD 1FSKC 3S5LG 1OAYH 3FZUD 3GMPA 1SJEA 1MWAH 5I1GL 4YFDB 2V5SA 1JNLL 3Q5YA 1F42A 3TN0A 3EOAB 3U48A 5I30H 1XGPA 4DN3H 2OK0H 1K8DA 1MFEL 3RWCB 4ODHH 4X6CE 2YZ1A 3MJ8A 5IG7B 1OW0A 3W11D 3PWNA 3CFKA 4LQFL 3HRZA 3EYUL 2Q20A 4PG2A 1C5DA 4KI5D 3SE9H 2CSPA 2X4QA 5CSBA 4KZDL 3ALPA 3DETC 4YHIB 5IEKB 1WVZA 3QRGL 4WEMB 3UTSA 4GS7B 3ZMRA 3BW9A 2HWZL 1Z0NA 2NXZB 4JM2C 4BKLB 3M1BA 1S5IL 4IOIA 1KXQE 5GS0C 2FB4L 5CZKA 1Q9KA 5ALBL 5T3XE 5HVWA 1NCAH 3MOAL 3VFMB 2Y6SC 1AD9B 4LLUA 2BVPB 4QHLA 4H88H 3U7YL 5CCKL 5BS0A 1JFQL 2YUZA 4PJAB 5HD8D 2A6JB 3ZKXB 3BT2L 3BMVA 3BPLC 5ADOL 3HI5L 5LXGH 4RZCA 2BRRL 4FFZH 4AT6B 5E6YA 1DFBL 3B6SA 3MRBA 4AYFA 3VH8B 1AXTL 2DQTL 3ZKQD 4XP1L 5M95B 2ESVD 4FQXD 5JMRA 5D1ZC 3BKMH 4DKFL 4XAKE 1DTUA 4LVHC 4NCDA 5C0BE 3MGAA 4QCIB 4YXLL 4NQSB 2W65B 3E6FB 3O3EA 4X5LA 1PLGH 3HZYB 5HI3D 4P9HL 3UTQA 2IGFH 1RZ8B 1T20A 4WI7A 4PREA 2ARJQ 1TNNA 4NKQB 4ZFOL 3GSNB 2HFEB 2PXYB 3MBXL 4YDIH 2VN7A 2UUDK 1CGSL 3QI9A 1KGCE 3AY4C 1A5FL 3SDAC 4ZOBA 3S36X 1P4LB 3MRLB 4HXAL 5EC1A 3OAYH 3MC0A 4J3VA 1K6QH 2AXJA 3R4DA 4ZUUA 5SWZB 4NQDE 5HDLA 3T65B 4XPAH 1DBKL 3OWEA 3OF6A 5EOQL 3PWLA 4BH7B 5IM7B 1AGCB 4XXDB 1IJ9A 2EKJA 3VH8G 1IC7H 4OD1H 2AQ3A 2CLRA 2YXMA 2JCCE 3EOBA 2DB8A 5JLZB 3FRUB 4JHAH 1RHHA 4RAUA 5H94B 4OTXH 2H41A 1QEWB 1MCIA 1JYNA 3FQUA 5FGBC 5D2LF 3NOIA 2FBOJ 3TA3B 4E0RA 5BOZG 3GSXA 1IE5A 43C9A 5LCVH 4GRLC 5JPNB 1AR1C 3LIZL 3C8HA 2FJFB 4D3CL 4IRJB 4J4PD 4Z7VB 2Z4QA 5CJ8A 4YO0A 4LNVA 3C5SB 1BQHB 4LIQE 5D6DC 3VH8A 3ZL4H 3MV8B 2E3VA 5LBSL 4GRWB 5DJXA 2GJ6B 4PIRF 1SBSL 1QBAA 5DGQA 5CZXC 3WHE1 5L88H 5ID1A 1NBVL 5JR1L 4XP6H 4PV8A 3MJ7B 3AS1A 5EPMA 1J05B 3N1MC 4Z9KB 3QUYA 4RDQG 5F7HA 3I6LD 3AREB 2CKBB 1HQ4B 1FNEA 5DDHA 4MB3A 4ZXBA 1RPQA 2R4RL 4PB9L 1ETZB 2ZNXA 4YEFA 1GOGA 4HBCH 3CCHA 5GGSB 4APQB 4MA3B 1UKTA 5J1TC 2NY4C 1RULH 3GMRA 4HBQA 4MNHA 4UDUB 3AY4A 5E8EB 3LSOA 1UKSA 3T1FB 4GKNB 3OHXA 1QBMH 1WWBX 3EYSL 3MBEB 3BPNB 2X05A 2CDEB 5I17B 3V0WL 4ODVH 1CFSB 5DEGA 3UC0H 3ULUE 4Z18A 1PQZA 3OTTA 4LARH 2PF6A 3RY6C 1VFMA 4UU9A 1FZJB 4MX7A 4LL9A 4TTDD 1FAKT 3UAJC 2ADFL 3ZKND 1UM6L 4OZFG 2DRUA 4EQ3A 3GBML 1U3ZA 4MNGA 3KYNA 4N5UA 5FYLD 5FO9B 2VLJA 1TZIA 4X6DF 2VIRB 3FN9A 5DT1H 1DP0A 2ICWB 1YMHA 3TT1H 2XZAL 1CDJA 1FO0H 4C54A 3QDJB 4MZ3A 4GSDL 4CVWA 2VYRE 2GY7B 1KLUA 2VXSL 4M6OH 2BFVH 5C0AA 4LVOC 4JANB 3VXSB 5HYQB 3BPNC 3D3VE 1IGCH 3VD3A 3TC9A 1UKQA 2VQUA 4N0UE 4Y4FB 5DFTA 4QXGH 4L9LB 3ROOB 2QHLA 2C4FT 2AKRB 3QRGH 2B0SL 3O6FD 4PGDB 3QUYC 4IRSB 4LSTH 4P46C 4ZUVA 4LHUB 4ZXBB 4LLMA 3CFBA 4OLVH 2W91A 1PKQB 3OZ9L 1QR1B 3ARDD 5H35A 3V0VA 4CKVX 1LK3H 2W0PA 3G6AA 2BNUB 3T2NH 2OK0L 3MBEA 4NWUL 4XHJD 5A16A 1AP2B 1F4YH 2ED7A 3IFOA 4JZNA 3QXWA 3MCLL 4HIIB 1VHPA 3IB4A 1KJ2H 1FLRH 4DVBA 4NQCE 1SQ2N 4NQDA 4P2OA 5HHOA 5T1KD 2UUDH 5C2BH 3IDXH 3FB8A 1F45A 4V1DB 1F00I 1MCJA 1HH6A 1OGAD 1NMCB 2BDNL 2JB6B 1UA6H 4PJXA 4F80A 4S0SD 4F9PC 1HYSD 4MD5B 3TWCL 4A6YH 1DEEB 3T0EC 1CBVL 3F7PC 4N0CC 4WWKC 4TNVK 4JKLA 3TVMA 5GGRA 2BSRA 5JHDB 1QPXA 5HDBE 2NY7L 2XRAL 2VDLL 1DN0B 1K2DA 4OJFH 1II4E 1XGQB 1YPZF 2A9MH 3O8XC 5ACZB 1NCTA 3VXPA 1M7DB 4CAGA 3V5KA 1T1XA 5AZEH 5IK3A 4N0RA 5BRZD 4KHTH 3HMWL 3WNKA 1KBGH 2VAAB 4AEFA 3JZ7A 5L2KB 2E27L 1EGJH 5GSVB 3MROB 4FS0A 2JTDA 2NY0D 1IFHL 2OL3A 5D7LA 1VFBA 3CSGA 3HFMH 3DHJA 2HTLD 4JGUA 1FH5L 5KOVC 5DD3H 3WS3A 4I3RH 4JG0L 3OAZH 1MI5A 4TNWF 5D72L 3MLVL 4KKAC 4CMHB 2K7QA 4YX2H 4LP5A 1HNGA 4OQ1A 5I8EB 3U4EB 4MJIA 3RNQA 5E2WH 4PB0L 3BP7B 6FABL 5LWYL 4IMKA 3VGBA 4HIXL 4AIXA 2DQDH 2EDEA 5EORL 2XZAH 4KUZL 1HH6B 3BKJH 2P8MA 2Q86B 2XQYG 3QWOA 3FO2A 4YHLL 1NAMA 4OF0A 4HLJA 1KPRB 2XQBL 1WBYB 2PTVA 1QLRB 4M7KL 3MJ8B 5M7QA 1A7RL 1UB6A 3CFKB 3LEYH 2PYED 5FO8B 4QHKJ 1QLFB 2DQUL 3RL1B 2MSPA 1S9VB 2AJUH 2ZSVA 5FHBL 2R2EB 3P4MB 1TVHA 4PJDF 4HLZG 4CDHA 3KPSD 4JZOA 3ZDYE 3CLFH 2G60L 1YEGL 1K8IB 5JQHC 1S7UB 3IDYC 3C6LC 3QG7L 3AVEA 1YMMA 1KCVH 4JY4B 3WSQH 3QWQB 3VFPB 1BX2B 4WWKB 5E4IA 4Y1AE 2I07A 2J8HA 3WIFA 2BVOB 3EGSB 2Z92A 5AWNL 3QXDA 3SDXF 4QOKD 4AJ0A 4R90L 1W72A 1J1PH 3MNZA 4LLQA 5CCKH 1RJYB 1A6TB 1QVOB 3I3DA 2XTJC 5D8JH 5GISL 3FOMA 3RAJH 5CEZL 3NVQA 1JPSL 4DCQB 2IQ9H 4HK3N 5HI4C 5GSRB 3SY0A 1NJ9A 4TVPD 2CRMA 3CNKA 4FZEH 1T1WB 2Z93B 3MV7D 1T66D 3V79C 4GG6A 2H6PA 2ZG3A 1KJ3L 2ADGA 3QEQE 1MREH 2Z91A 3V0WH 5C0AD 4PB9H 5SX5K 1YEDB 1V7NL 5K9JH 3G6JE 3CPLB 1KACB 1CICB 1JGEA 1VA9A 5EOCH 4JN2A 5ANMA 2FX9L 2IG2L 4XWGL 4NQUA 4F58L 1JK8A 2OL3L 3NIFE 5ITBH 2VKWA 2DQHH 3B6SB 3HLAB 2EKSB 3VWJC 4OF5A 1XGYH 4QT5B 4DGYL 5GZNC 1V3JA 1DSFL 2C3XA 1T04B 5FFLA 1YDPB 2L7JA 1NPUA 4QRSA 4RGNE 3H9YA 3GK8H 3DMMD 1U3HD 5L6YL 3P4NA 3IETB 3QEQD 3RVTD 5CJQH 4CUCA 5ISZB 2LTQB 2YUWA 2OX5A 5HHQB 4HCRH 3B3IA 1BQHG 5D93C 3NA4A 4PD4K 1DBAL 2VL4A 3DURA 1Q0XL 1SMAA 1T0NB 2BMKA 3MJ6A 3NCJL 3LD8C 3ESUF 5D6DA 3QIUD 1ZGLB 2KUTA 1Q9WA 4Q2ZA 3TIEB 2ZCHL 1DUZB 5A2KH 3L3HB 4LPVA 5CSZA 2HLFC 4JG0H 1JZ6A 1FNSH 3WIIL 5TJWK 5F7FA 4NPYA 5E5MB 1YNTA 1LO3H 3GMLA 1OSPL 3DYOA 1MFCH 5F9OH 3I6KA 3P77A 5C0DB 3C60C 5I18H 5D1QD 3CH1A 2IBZX 3MXVH 3WXVH 4KRPD 4QOKE 4XMLH 3R06A 4CVXB 2A0LD 1WAAF 4TVSa 5C09E 3PGCB 4HEPG 1LP9E 3OV6A 4JRYB 3BZEA 5K9QG 4WDIB 1Q9OA 2IAMD 3FFCA 2EEDA 3TN0B 5HVHC 4C59B 5CAYB 5E6ZA 1ZA3A 2EC9U 1FBIL 3I3EA 1MCPH 1MY7A 2Z4QB 1FFNA 2VXVH 4N5ED 4FQIL 4KK8C 1A14L 3HS0A 3QH3B 1D9KA 2P44B 5EO9B 1AD0B 3BO8B 4HD9A 5CEZD 3FQWA 1AQKH 3CAFA 4GOSA 1XGRA 1HXYB 2P5WE 5DHVB 1KTKE 1QLEL 4YHNB 2YPVL 4LAJH 5SWSD 4NRYA 1XEDA 3DI2B 4NNXB 1CXIA 2DM4A 1UCTA 4I2XA 2XI9A 4HWBH 5CHNB 5DS8B 4M3JA 2ZZUT 5EBLA 3ULVE 3BPOB 5D5MA 1U93B 4QWWC 1T22B 2MQ3A 2X4PA 4HFUL 1KIQA 3QFJD 2QADC 1GAFH 1A2YB 1AGFB 4U0RB 3F7YA 3LKNA 4POUB 2CR6A 1N5AB 1M6OB 2DQCL 4QTIH 4F3FA 4MXVF 2C7UA 2FEDD 2MPAL 5TE7H 4XCYB 1T7VA 3KWWA 1GVIA 5IB4B 2QSTA 4D2NA 5L8KB 4U1IA 5L8LB 3UO1L 2IFFL 4P3WA 3MOAH 2AP2A 3S96B 3RWDA 1KCKA 2J2ZA 1DQQB 4B53A 3FFCD 1HDMA 4KROC 4O2CB 4XPGL 1YN7B 3O2DH 1J12A 1HSAB 2JIXD 1FVEA 1X6LA 3RDTA 5CZXD 3RWFB 2APFA 3M1BB 2E6JA 2FDBP 1PYWB 1U3YA 2CO7B 3ARSA 3V4PH 2O61A 5AYQA 1XH3B 1U6AH 3P9WB 4Y2DA 2H32B 4PJ8A 1BAFL 1ZHNB 1E6OH 3C60B 5DRWB 3X3GH 4WI2A 3VGDA 3EYFA 2YWYA 2V5MA 1IGYA 1RUQH 4LSDA 1K4CB 3BQUB 3ZDZF 4XMPL 3ARUA 5E1AB 2H3NA 4UDTA 4Y8AA 3HAEH 1B3JA 3U7AA 3WE6B 2X9WA 4U0QB 4QGTA 3RU8L 5L6YH 5FEBA 3EOBB 4G7VH 4XNQA 1UH2A 5C7XH 3ME0A 3V4UH 3ARRA 4Y4HD 3IDXL 3C8KB 5J7CC 1FAIH 4Z7QE 1ITBB 1N64L 4BUGA 1VENA 4N9GB 3UBXB 4NBZB 1RURH 1T83C 5H35B 4LKXB 3F6LA 1CIUA 5DQ9B 5FYLL 3EJYC 2LAAA 1QBLL 2IMNA 4NZDA 5ICXB 5AD0A 3TO4B 2YC1B 1SBBA 1BJ1H 1YMME 4YFLI 5DJ6B 2XKSA 4G42A 5IJKA 4ZUWB 2BK8A 5JW4M 3SGJA 2RBLA 3OB8A 5INCB 3A6OA 5DJAB 4YX2L 2NY7H 4HZLB 3A6CL 4PJGE 1FBIH 1M7DA 1JL8A 3U2SB 4FQQB 3IDNA 1UJ3A 1NGPL 4BELD 5BV7B 1I7UB 3QHZL 3RVXC 3SDYL 4RISL 3KPNB 3EDDA 1EFXD 4PRBB 2JJSA 3IGAA 5CJXA 2VOTA 5DRNA 4L1HA 3DBXB 3OB0K 4WTWA 4HC1L 2NX5D 1HI6B 4Z7QF 1JE6A 2P5EA 5LBSH 3LKSB 5FAAA 5F96L 4X6CB 4Z5RA 1LE5B 3KPMA 4B5EA 3DVGA 4O02H 1Z3GL 5C0BD 3HNSL 4JQXC 3Q5OA 3NGBB 4YXHH 5DVLA 2FATL 3DVNA 1YY8A 3NIDF 1P4IL 4KJPC 3C09B 3OL2A 4M48H 5EU3B 2HA1A 4G9DA 1U8KA 4RGOH 1KUMA 4NCC2 4H1LA 2A83A 3MV8A 4IOIB 2XWTB 4HWBL 1I7TB 4NUGL 5IHZB 1G7QA 2F8VA 2PYEB 4U1NB 1GGIL 3HB3D 3LN5A 1WZ1H 1RUAH 5CILH 3U6RA 2E6QA 4RGNC 3BDYH 3MV8D 4U1KA 1EPFA 4I18A 5ITFA 4LVHB 1DQJB 4KK6C 3HMWH 1JNHA 5FOJA 3OR7B 4XBEH 4LIQL 1M7IA 1OW0C 3QDJA 3NCEB 2AGJL 5JW4R 4YBHA 2FJHB 1MNUH 5CMAB 3HUJF 4FG6D 3C5JB 5LJYH 4PJAE 5F88B 4AENB 2GKIA 2V17L 3SGJC 3G5VA 3FJTA 4WWKD 5CINH 4MA7L 4AEIL 1GIGL 1IBGH 4QHKI 1Q94A 1TXKA 3DPBA 3QUXB 1IZKA 2W0FB 4PP1C 2Y36L 1T2JA 4KRNA 4HIEB 5DVMA 5EZIL 4O2EA 3U4BH 4HDIA 2K1MA 5ICYB 5INDA 4AEHL 5I1EH 2XV6B 1UXWA 3QUZB 3IXTB 4M6MH 3GRWL 3R0MA 2J88H 5D71H 4Z76A 5J57B 4YK4C 1JV5B 4JVPA 4WY7L 4C83A 1J5OH 1MCSA 1R5VB 4EBQH 4YZFF 2DIAA 2EDFA 4ZO9A 1FNSL 1U92B 1ORQA 3L5WB 4LPXA 4M43H 4P57A 2VL5B 2VR4A 2OJZL 3QI9D 4N9OB 5C0IB 2GY5A 5D7LD 4RNRB 4Q6IB 5EO1A 5IB5B 4IS6A 4RWHA 4RMRA 2DWDB 2NY6D 3UTSE 4PRHE 3N0PB 4I48B 5SWZE 2GW5A 4Y1AD 1DANT 1FQ9C 4DN4L 1AHWC 2HJFA 4XC1H 5B21A 4LEOB 3IU4H 1MCRA 3NPZB 4F2MB 3BVNB 2HYMA 2X4NB 2WIIA 1DQML 1TCRA 5KVFL 2CKBL 2PR4H 1PG7H 4NQEA 3JV0A 4LVNC 5C3TA 3G5XB 1BM3L 3O4LA 4HKZB 3P0YH 5BO1L 3BWAA 2PW2A 4UT6L 2AXHA 5H2BB 3C8DA 1L4IA 2MNUA 3O2DL 1NANI 1LNUA 1KJ2A 2OBGA 4R0LA 1KEMH 2CO6B 1UACL 5CEXB 4LQ1A 5D93B 2DQHL 4LARL 1FL3B 1LO4L 4JRXD 1R3LA 2OTPA 5DMIH 2APBA 5GS2H 2GUOA 2HKHH 4NHCL 2ADJA 4D0DA 3MX0A 4P46A 4DAGL 2V5RA 5IBLD 4EEEA 1DLHB 2W0FA 4KQ3L 1QSEB 1HOCA 4PLOB 3V5HB 2EYRB 4F9LA 4U6YB 3RGVB 5FCUL 1LP9A 1HSBB 3P73A 3NBNA 3OJMB 3SDXA 5IKCA 5FYJH 1LO2H 1BEYL 2FBJL 2AAVA 1J1XL 3ARDC 4IHOB 1KG0A 1A3RH 3DSFH 3MFGB 5DDHB 3QUMH 1NCCH 3OX8A 4XAWH 1ES0A 1VB9A 4HK0A 1ROWA 1S7RA 2DQFB 4OCXL 4R7DB 3NAAL 4RGND 1HXMB 1HK6A 1J0JA 2BOCB 4QXTA 4NFDA 3BKYL 3N50A 4N0FA 2WW8A 1HEZB 3IRPX 1SJEB 1QHPA 4GG8A 4PJHE 1QRNA 3IDUA 4XP4H 4QRUB 5L8JB 3H9SD 4TVPL 1A6ZB 4Q6YA 2HLAA 2NW3A 4WCYH 2IPTH 2W9LA 3TN0D 4XVUD 5CEYB 3GHEL 3LIZH 1KTDB 1AHWA 1IAIH 4MDIA 1FG9C 1NBZB 1AR1D 4L9DA 3GFUA 3GSQB 4ZPVB 5FO7A 2HFFB 3D0LB 5FUCC 1J0IA 4MXWH 4MD0A 2DQEL 3DV6B 4F7EB 2L0DA 2VAAA 1LNUB 3GMNA 4QHMB 4QNPF 2B5IB 3V7AE 1TZIB 3TBVB 3GHBL 5IWLA 4WEBL 4U6XA 4MA1C 1ZLWH 4U1JB 2GK0A 2H32H 3NH7L 1R6VA 2XZQL 5D1QC 3QDJE 5CGYD 1NFKA 4RMTA 1P6AB 3E6FA 1MH5A 1J86A 1OHQA 3O3EB 2MHAA 4GRMA 4NUJB 4OGYH 4G6FD 5L2JA 1KIPA 4LGRB 2YN3A 4KTYA 2X4SB 2R2BB 1XF5B 5IQ9B 5AAMA 4G6KL 4XZUB 4YHKL 1OP5K 5CWSA 4M48L 1MCDA 4KJWD 5CIPB 3ZE1E 3KPLA 3HZMA 4H8WL 2WM0A 1I8IB 5HI5D 1AQDB 1LEKB 1U6AL 3BHBA 3CD4A 1MIMH 4O58H 2GFBA 1OARH 2CLZA 3DUSB 2LU7A 1S7VB 3O9WC 4TSBL 2D7PA 2OMNA 4U1SB 4NOFA 2BCKB 3RWHA 2CQVA 1NDGB 4F7MB 5EU4A 3GHBH 1Y6MR 2GJJA 3STZA 1NLDH 2QSQA 4R3SA 1T4KA 1FZMA 1IGFL 3N85L 3CLEH 5B3NA 4K94H 3NFNB 4HX1B 4JFDA 4YC2B 3O41A 5DYOA 1NGXB 4NQCB 4ODUB 5HHOD 5T1KA 4JFYA 3CK0H 3KPSB 5EUOF 4Q9RH 1JNLH 5E0QA 1B88A 3SKJH 4OGAD 3BP5B 1FJ1B 5HI3C 5DRWA 2ZUXA 4J4PC 2VWEE 4WI5A 4HJJL 1NEZA 4GS7C 1IGYB 3EOTL 5F7DA 3ZE1F 1BOGA 4ZS6D 5HYJA 3VFUB 4LCIL 2UZIH 5LGJA 1KB5H 5IMLA 3RVWC 1W72B 2YN5A 3BW9B 3HA0A 2O5YL 1KPUB 1RK0B 3DX7A 2VZTA 2AJVH 4PRHD 5CJBA 4ENEC 5GS1B 1FVCA 2F53D 3RDTB 4UT7H 1NCCL 1ED3A 2IC2A 2VLRA 4NKDA 1IC4L 3RUGA 4NGHL 3GI9H 3KYOA 2UWEF 1JWSA 3VWKA 5CWSB 2DTML 3DROA 3ES6A 1DFBH 3GO1H 4KTEH 4HKJB 5IBUG 4FQ2H 5KSBE 2VLMD 4IM8A 4AEHH 5KZCB 4JM2D 1IEBB 4Z7UB 5CBAA 1SVCP 1UWEL 2VUOA 3S37H 1AFVL 3ZYOA 5DRZA 5TH2A 4ONHB 5KVDH 3JV6B 3JWDH 1JGEB 3RUGF 5DK2A 5HYSG 4NQVA 4M5ZH 4WENB 4TQEL 2JCCF 4OCLC 4XPTH 2AEQL 1BBJA 3RGVC 2Q3AA 4Y8DC 4KVNL 3BD5A 3TCLB 2B4CC 2CGRH 5HY9A 2Q8AH 1IEAA 2EE2A 4C56A 1MHHB 2PTTA 3E2HC 4NC1E 2EIZA 5CGYC 5I8KL 4I0PA 3U1SL 3S88L 4WU7B 2VLLA 5HHVL 2V7NB 4PJGF 2ESVA 4EI5D 3VFVA 5IVXB 3IU4L 1NFDA 1XMWA 2YC1A 5MENE 4KRMB 2DJSA 5D1ZB 5TE6H 5F9WC 25C8H 2YD1A 2C1OA 5EUOA 5ISZD 4LCCC 1FIGL 4WFFD 4X7DC 1ONQA 2VDOH 4LEXL 1I9IL 5D96C 5I8OL 5FGSA 3V9FA 3CZFA 1TJIH 2GTWA 5ESAB 3HZKB 3IDNB 1RK0A 2VRAA 1Q9WB 3LB6D 3KXFA 1IKFH 3HC4L 4R8WH 5TGBA 2NTFB 5C0CA 2VR9A 4X7TB 3DGCR 3MZGB 3MUJA 4X0KB 4NKDB 5E6ID 5E5MA 5GRXG 1CG9B 1BGXL 1MJ8H 4XPFH 5I1IL 4G8FB 3IAGC 4E0RB 4QRQB 5T3ZH 4F7TB 5GJSL 4ELMF 1TTUA 1YEJL 1GHFH 1JRHH 1AP2A 3VDCA 2ZKHL 4OFPA 4J6RL 5DJXB 2OJEB 3RWDB 4Q9RL 2PNDA 3MREA 1UQSA 2FIKB 3FTGA 3L5IA 4MCYB 3S5LA 2BSSB 3MRDA 2JB6A 4LHUA 4XCFH 1U8JA 5SWZA 1ACZA 3U7WH 5BXFA 1OAKH 2OSLB 4YE4H 5LAXB 4I0PB 4M6AA 3ZO0A 2V2TB 3QFDA 4I18B 2MCPH 1IQWH 2V7NA 2VWEC 1GGCH 1PYWA 3MBXH 3O4LE 4QYOA 4LOUC 1MHCA 3UTSD 3GSRB 1CU4H 3CFCL 5DLMH 4HWZA 2F19L 3FRUA 4CU8A 4JJHA 2EYTA 4JAMA 1S7SA 1JNNH 1XGTB 2P8LA 2Y72A 1MELA 2X4PB 5DTFB 1KIQB 4H1LG 1NBQA 3MXVL 3PV6A 3GSVA 2X1XR 4P2RD 5ABDE 2AABH 5JOEA 1BD2D 4J3OC 5C0IA 1DQLL 2X4OB 1CFSA 5LCVL 1R5IB 1I1FB 5FYKD 3GO1L 4KTEL 5TQ0L 5C9JA 4CMMB 3O6LL 2R1XB 4MD4A 1HN1A 9CGTA 4X4XB 2PW1A 4UQ2B 1A3LH 4L8SB 3QDJD 1EH9A 1YYLL 2W38A 5I0DA 3ULUH 3O6FC 3G5XA 1K3ZA 1R5VA 4HPOH 3TZVD 5HI4D 2GYSA 1WBXB 4QRRA 1QSFD 4X6FA 4OSUL 2VLKE 3EZ8A 2QKIB 3RL2A 3QJHB 2X44D 5I74C 2I9LA 2VISA 3FAWA 3RBGA 5JIPA 5I1KH 1IM3A 1R3HA 1G9MH 5C0CD 2XPGA 4GRWF 4LHUD 2JKXA 5HHVH 4P23D 5FHAH 4QY8A 3BYTA 4KY1H 3UTTB 5EOCL 1RZIB 3QWRD 2R1YA 3FTGB 1YNLL 4MCYA 3GMMA 3FO2B 4P48A 3C5ZC 3GGWA 3GMQB 3V2AR 4PGDA 2K7PA 4LVNB 3B2UD 4IEFB 1QRKA 3LQAL 1WZKA 1X5LA 4M7LT 5DZNA 3V95A 3RVUD 2NW2B 4UB0L 3VXMA 3TLRA 4B0MM 4GAYA 1S9VA 3LPWA 3TBTB 1BJMA 1H3UA 4X7EC 5DJ2B 2ADFH 2YKLL 3U4EA 1QSVA 2EH7L 3DRTB 5D7KE 1T5XB 3SCMC 3MRIA 3PDOB 3HAEA 1N8ZB 5KSAA 2ADJB 4D0DB 3QIBB 4N0FB 2WK2A 4ZAKA 2VDOL 5DURB 5F7YC 1NMBH 1TITA 1N4XL 1G7JA 2FZ3B 1X7QB 4E5XB 1Q38A 3NCJH 1NFDE 3QWOB 1IL1B 4JHWH 4PRPE 3ORJA 5C8JA 2XOTA 2ZOLB 4JKKA 1LWRA 1KPRA 4M5YH 3CH8A 4R4BA 5LGKA 1LQSR 5E08H 4ZO8A 5MHSD 5JPMB 1JPGA 1FGNL 3BXNB 2P5WB 3V4PL 5GQBA 1BLNA 3VXSA 2NY6C 3U36B 3BPLB 4JN1L 4D9RE 3UJTL 5KTEH 1BVKB 4ZS7L 2Y23A 1WC7B 1IEHA 3IAPA 3CJJA 1H15A 2AV7A 1DE4B 4G8GE 1B2WH 1P53A 4KJYA 3T77A 1CTNA 3RWEB 5I6XB 2OR9L 1U2HA 35C8L 4BFGA 4QHUB 2AXGB 5FCUH 3T4YA 4J3WA 3SE9L 1TZHA 3GIVB 2R39A 4KZDH 4RFEA 4U6XB 2A6KB 5CGTA 4Z78B 4TTDC 2Y4SA 3GSWA 4Z7UF 1WJ3A 2ZUYA 3QZWB 5FK9A 4X8XA 5IFAL 3VXOA 1DBJH 3V5KB 1OGTB 5FYKL 3FT4A 2N56A 2H26A 4AK1A 5F6IC 2PO6B 2NX5B 4IRZL 4HIJA 4QOKA 2CKNA 3BAEH 4PGCB 1OVZA 3QUZA 5FDYA 5DQDL 5KSVA 1H5BA 1P1ZB 1IAMA 5IOPB 3FQRA 1JN6B 1VEOA 4Z76B 2OXHA 2XXMB 2EDOA 3WIHA 5E99H 2AV1A 2BRQA 4GKZB 5KVMC 3UBXG 2J12B 5EB9A 4PBWD 4Y19A 4JFZH 4HHAB 3QCUH 2P49B 4OZFB 1MCHA 3NAAH 3CX5K 2A74B 3BZ4B 3ZHLA 3GJFH 4MA3A 2DLGA 5J1AB 3BRGC 1OLZA 4OCWH 3T0ED 3UPCA 4UAOB 1CI5A 1FYTD 5D7JC 4LCIH 1B0RA 3SGKA 3INUL 1CT8A 3RVVC 1AI1L 2J88L 4HH8A 4U0RC 2P43B 5D71L 4BJLA 1AD9A 4LLUB 5FYJD 2PUQT 1RVFL 4YDKH 4X83A 1HILA 1S9YA 3AS3A 2M8XA 15C8H 3VXME 1CYGA 4HFWA 5EIIB 1JHLH 1URLA 4MA8H 2G60H 5E5RB 3MV9E 1FZKB 5F21B 1R24B 3QNYB 4JFXA 1MFCL 2DQUH 4IDJH 1UWGL 3QNXB 1AFVH 3HRZB 4U7SA 4UBDC 4APQD 1N26A 4OCSH 5FYKE 5J11C 1YMMB 5KAQG 2ZCHH 1OD9A 3VE0B 3UXFA 3VG9C 3NFNA 5I1DB 4M7LH 4P4KC 4GBXB 5KBNC 1EUUA 4U6YA 2NY2D 3INUH 1RZFH 4PBVC 4K71B 4G6KH 4HJ0D 5HYSA 3LKPA 2IPKA 1FFNB 5GGSY 1P9MA 5KJRL 3G6DL 4PJ7E 3CVHH 4OCMC 2OI9B 1CK0H 2ARJA 4N68A 3FB5A 2WUBL 3MLSL 5TDNA 1UC6A 5D1XA 4OF8A 4HJGA 3R8QA 4YUEL 4N0YH 2YKLH 3LQZB 3O8XD 5E9DA 3CX5J 4DUWA 5M94B 3DUUB 3ECBA 1FL5A 1NEUA 1GYAA 1IC5L 3IFPB 4UI2A 3MRFA 1JUFB 3KPMB 1FG2B 1JPFA 3VGGA 2F53A 5EUKB 2WWMC 4WI6A 3MNVA 4XP6L 4R2GB 1A9BB 1A0QH 4XNMA 3NCFB 4EI5B 2EH8L 3EJYD 4YQXL 4K8RC 3GSQA 3QG6B 4LPYA 5DD5L 1ERNA 1RJLA 2W9EH 4OLYH 4YHZL 1S9XB 5TDPB 4L8SC 4JO1H 5EC2B 4ZD3L 1D9KB 4PG9B 1EHXA 5EC1B 2DQCH 4UIMA 4JREC 4LDEB 1IAKA 4MJ5A 5D7LE 4X99A 1YQ2A 2PYEE 1UXSB 3S34L 1DEEA 1KCRL 5CD3A 2VITB 1GGYA 3S98A 5FA4A 1EMTH 2XNAA 5EOTA 4OCYH 4HPYH 1ZT1A 1XIWD 4ETYA 4ZYKA 3L3KB 1DQMH 2VNCA 3QIUB 3UJJL 3L3JB 2V9RA 2ITCB 4OV6F 3ARDA 1KXTB 3DX8A 2A0LC 2VDQL 4ZAKD 3VXNA 1EHLH 5E03A 4NO0D 1FHGA 3UTZA 4D9RD 4HIEA 1HQRA 1JWUB 2BMKB 3RPIB 4HULB 4HQQH 1Z9MA 5J6GB 1YA5A 3SGDI 1FO0B 3MUHL 1NC4B 4WW2A 2A6DB 1UVQA 4WJ5B 4K7FA 1OGAB 4OZGE 3LRSB 1KIUA 1R3IH 2UY7A 5D1XC 5T3XD 1YEDA 5FGCE 2G2RB 2F19H 4NHCH 4DAGH 43C9B 4LPUA 5DVKA 1JGUH 4NN7C 3WKNA 1VGEH 4M7JL 3MV11 2IWGA 1CFNB 1VACA 3BH9A 3S36H 4PLNC 1JUFA 2J8UE 3SCMB 1CS6A 1G7PA 2MCPL 5ALBH 43CAB 4Y19E 1TQCC 3KR3H 4ODWB 2BXYA 4XPHL 1EO8H 3L1OH 3LEXA 4OIAA 2HJKB 1PVHA 2F5BL 3UTSB 3J8F7 4NIKB 5D70L 3P11L 5FF6A 3GSOA 2Q6WA 4PJ7A 2B4CH 3HR5A 5IHLB 1JF1A 5E8NB 4KZEH 1NAMB 4G80A 3B3IB 3ZKMC 4U6HA 5EA0L 4HWZB 4ZQKB 5FA3A 1YEEH 1YNKH 4P2RB 4YHMH 1NC2A 1MHEA 1J0YA 5KVDL 4MS8D 2I24N 4NN5B 4XPGH 2LVEA 3PQYE 4BK5A 1XGRB 2VDKL 32C2A 1F4YL 3SDCA 2X42A 1Q72L 4XPTL 4H8WC 5E24E 3HE7A 1I75A 1XF3B 3MUY1 4P4KD 1P5UA 4Z7WA 4FFWD 1A6VH 4UZGA 3U79A 2A77L 3IDMA 2PCPA 1XF2B 3L3GB 1SY6A 4JFFA 1T22A 5D7JD 3R1GL 4LLWA 4MQXC 1WEJL 4I3SH 3VFTB 2OYPA 1G9NC 2J5LC 5MEPB 2I07B 2X1PA 5E2UH 4L29B 3QHZH 5EBWB 1I7ZA 3TIDA 4EN3B 1MCCA 4WDIA 3TH4T 5DEFB 2V2XA 1DBKH 4Y4HA 4KY1L 3TJEH 4JO4H 3X17A 3PWPA 3JSSA 3L3OA 1U3HC 2E9BA 4N1HB 4ZODA 5SWSA 1UB5A 2YRLA 2H45A 1YECL 3SHSA 4XMKL 2V5TA 4P5TD 4U31A 2PR4L 3UJIL 1RHFA 2VDLH 2BFVL 3IKCB 3C6LD 1K5NA 4YWGL 4HGKC 1RZGA 3UTTA 3TO2A 3IDGB 4M8QB 1MVFA 1EHAA 5FDWA 2FIRT 1XIWC 2VR5A 4DKDC 3MJGX 1F3RB 4WHTB 1BFOA 5I1IH 3CC5A 3D2UB 4PRAB 2XN9E 1F4WH 3JWDL 4JKWA 4JFDE 1CDYA 4IRSA 3DVNB 5DK0A 2YK1L 1F3JB 4BH8A 5ENWA 4TYUA 3T0BA 1DR9A 3H8NA 3SDDA 5EBGA 4HC1A 4YXLH 2E7LA 3RFZC 3V6ZB 3TBVA 2GTWB 3ARWA 1PGRB 1XCQB 5I1JL 3VXRB 3LKRB 1FFRA 1UM6H 1YDPA 4NDMA 3KLAB 5DEZA 5EBMA 3T04D 8FABA 2Y5TB 3IDMB 3C5SA 3O45A 5C0BA 1XR9A 1X5JA 2HT3D 3V4VH 4HCRL 3SDCD 2Q7NA 3Q0HA 2NMSA 2BNRE 4LP4A 5CBEA 3PP3H 3VCLA 1WFOA 3RI5K 2XWJA 4XZUA 5BVJA 4ZUSA 3MRNB 2X4TB 4GAJH 4W6YB 3RVVD 5DO2D 4M93C 4XTRD 3L7FB 3ULSA 4KGJA 3O6ML 3H9ZA 1AGBB 3EO9L 3OKNA 2HJFB 5IV2B 3BEWB 4KKCD 2DI9A 3LS4L 3OB0H 1SYVB 1XGQA 3MPCA 5T5FL 1I1RA 2CDEA 1MEXL 5BQ7B 4GXUM 4P23A 1U3HB 4JZJC 5GGTA 4FQCH 1HINH 3PGCA 3HAEG 4K2UL 3TBSA 5L2KA 1MHCB 1Q9OB 5CZVL 3NCMA 5GPRA 3UTQB 1I85C 1WCBB 4XVSH 4CADA 2F5AL 2BNQA 1P7HL 5D7IE 2A6KA 5I1GH 4LSPH 3SE8L 2IQ9L 2VXQH 4HUWA 4PJFF 3TPKA 4NQDD 4P2OD 1WLHA 5I1EL 4CGTA 4FQHA 4YHYC 1YEKL 3VXRA 2HTKC 1EJ6A 2YOCA 4O00A 3OR6A 1Y0LB 2E9IA 1GGCL 1RUPH 2BVOA 3EGSA 1NUDA 4H1LB 4I1NB 3ESVF 5EULV 1JI1A 3LN4B 5BS0D 3D25A 4JANA 1S9YB 4IOSD 3VWJA 5HYFA 5DJDA 3O9WD 4WGWB 1JMZA 2C1PB 1ES0B 2OZ4L 1LK3L 4UV4L 3V7MA 1KCRH 1KB5A 2EDDA 2AKRA 3PWVB 2F54A 3T0EE 3WNMA 5MEOB 4OZHA 5F3HB 1YMMD 4JFFE 4PJEF 1NMCC 4XX1G 1N5AA 4B7IA 5C6TL 3S6CA 2D0FA 4L3EA 4I0PD 5HPMA 1D6VH 3RGHA 5DR5L 3AGVA 2W92A 4I9WD 4I3GA 2J4WH 4PJCE 4LBEA 3BEWA 5T33H 1OTSC 3MO1A 4UT6H 5DJZB 2VXQL 3A67H 4JDTH 1XZ0A 1A1NA 2P45B 3HI5H 5GGVH 3RX5A 4PRIB 3W9EA 2R56H 1OF2B 3MLSH 5CKAA 5FHBH 4LSRH 4LLQB 2DQTH 5DHVH 2Y7QA 3QEUA 2W60B 1J0ZA 4GSDH 5EU6D 3MGOA 4PGEA 1IMHC 2NCMA 4RSVA 4GXVH 4RWYH 2EIZB 3C87A 2QADD 4FTVA 2F9BT 2NY6B 3UROR 3WIFB 3KS0J 3QCUL 2FCBA 1MSPA 1ZE3C 4HJGB 4BQBA 3ARBD 4HKXB 3UAJD 2DI8A 4KUCF 5IVXE 5IMOA 1MWAB 5LWYH 3OMZA 4PG2C 3O81A 5JXEA 2N4IA 2OTWB 3MV7E 3WJJC 3OAUL 4UIKH 3BXNA 4R4NC 4YBLC 2BVTA 5HHME 3O2VH 1U8NB 4TTGA 1KFAH 4NM8L 1JGLH 1IGFH 1SEQH 4LVOB 1MCEA 1HHIB 1YQVH 1E27A 1U91B 3D85D 3S4SG 4LCWD 5ACMA 2AXGA 5SWQB 4QWWD 1TDQA 1CXFA 4YZFE 3C2AH 1L7TH 1P6FA 3BN9C 1V7NH 3W0WB 1GIGH 1IBGL 1T4KB 4MDJA 3VD9A 3UPAA 1QFOA 1MIML 1UENA 2YPKB 1OARL 4C56D 4O2FA 3LPFA 4LPCA 3WNOA 5D2LE 5I6XC 3ZKNC 3BQUD 3MRCB 1KJMB 3OJDA 4AL8L 4NT6B 1WTLA 1I8IA 1MRCH 2WAHA 3FQRB 5E2WL 1N5YL 1Q0XH 2V9TA 3HZVB 2OR7A 3QIBD 1DUZA 2LTQC 3MRLA 2XA8H 1K8DB 3MCLH 1YYML 5MP6H 1ZHLA 4IMLA 3UPRB 4OZFA 2DKSA 1EEYA 4KPHL 1N0LA 4IMKC 2V6HA 1J0HA 3S4SA 3BZ4A 3K2UL 3O4LB 3KYMB 4OLYL 4YHZH 3M45A 5EUOE 3IJYA 4PD4J 3SO3B 4RRPA 3QG7H 4NJAH 1MWAA 3F7VA 3MJ9A 4YFLF 5F7MC 2HKFH 3MLTA 3JTSB 4I2XB 5CHNA 2VLRD 4OV5B 3ZHDA 4YXHL 2VDRH 3ZYIA 1UACH 1JP5A 4OLZH 5D7IA 1G7MB 4XTRC 1U8OB 4GW4B 4MJ6B 5DD5H 2XY1A 1CVRA 1ZAGA 1AGEA 3L7EA 3EO9H 4X4XA 4P3CL 4C55A 2V2WB 5JDJA 1NLBL 5FK9B 2J6EA 1IEBA 4XAKD 5CBAB 5C0EB 5DGRA 3WNLA 3FT4B 1A6WH 3VFPA 2XRAH 1HOCB 5IBTL 4MAUL 3HMXH 5JW3L 4L3AA 2JK5A 4RMSA 2RCSL 1A7OL 4P2CG 1ZLVK 4EIZC 5DFWH 4PTTA 4FZEL 3SJVE 2VLKB 1MF2L 1BZQK 1S7WB 3I85A 5GJTH 2DKMA 2ZUQB 1D5ZA 4PJ5A 4YHLH 2AEPL 3F8UB 2R4SL 4YHPB 4F37F 1CXKA 3PHOA 1OTTC 3QUML 1A1OB 2O26U 4RBPH 1HXMA 2MQCA 3RA7H 5HSFA 5TPWH 3GSUA 1OT1A 2YD8A 3PP3K 4U2YA 1P84K 4JG1H 3ZT5A 1AO7B 2ZSWB 5D2NC 4EI5C 3O2WH 1I8LA 4NQEE 4CNIB 5LGHH 4TUJA 1K4DA 5DHXB 4KK6D 3U0WH 1AHWB 5TDNB 4NKIH 4JY5L 4I5BB 3B8SA 1KCVL 2GJ6A 2V2XB 2CK0H 1IAOA 2P5EE 5CSGA 4PJIF 1I4FB 3STBA 5F8QC 3RWCA 4HFWB 3VJ6A 5IW6B 4G8EA 1INQB 2D2OA 4PJDE 1ORQB 1ZHKB 4HUVA 3FO0H 1K5NB 4XMLL 5GS3A 2J8OA 4Z7WB 1DLFL 2BP3A 5BJTB 1BQHA 2IBZY 1GL4B 1KBGL 2PCPB 3S35X 3G08A 4YC2C 5FDWB 1CG9A 2HT4D 1GCFA 3TFKD 3D2UD 2C4FU 3VDBA 4OLUL 3LY6A 5I73B 5DYOB 1A6PA 4DW2H 4JZJB 5DD0L 1K3IA 4ELMB 3CFDB 3TNMA 3GI9L 3PWPB 2APTA 3BP6A 1SJXA 4NUJA 4OIIH 1UB6B 4LSUL 3IYLW 4NC0B 3MMEA 3PJSB 1IGML 1XAUA 3UZEA 1NQBA 5HYQA 3TT1L 4I3SL 5HTSA 3KLHC 5LQBL 3LPGA 5C6PB 1FN4A 1A8JH 3JV4A 3O6KL 3OKMB 5CD5D 4NRXB 4HUUA 3ZL4L 4JM2B 3MLWH 2VLJB 3MGTB 2DLFL 2SEBA 1FCGA 2FSEA 1KTLA 1JWSB 4DFIA 4ZS6C 1D6EA 1HI6A 2I27N 3BE1L 4R97C 4XC3L 2VC2L 3GMOB 5D2NA 3CH1B 4JKMA 3SDAA 2MQ0A 3TP4A 5SX4H 1F3DH 3M17B 3VXUE 4EDXB 1Z2KA 4U1GC 4F8TA 1JPST 3HZYA 4X6BB 4G6MH 3ZE2F 4JKPL 3I6GB 4NO2A 2YD2A 1ZSDA 1BWWA 4CW1A 2VZUA 3T1FA 3REVA 5FB8B 4OCRH 2N7BA 2JELH 43CAA 2HP4A 3O0RH 5CJ5A 4PJXB 2BHZA 1T2XA 4KJWC 3ULUF 4KVNH 3IF1B 2FLRT 3GJEA 5DJ0B 1NKOA 3LS5H 5JOFA 4KKBC 2G5BA 1DQJA 1QFHA 4ZYKB 1FVCB 4PGJA 1MJ8L 3ALWA 5IB3B 3EHBC 1H3XA 2OQJB 1OSPH 4HUMB 4R7NB 2XZZA 3T3ME 3MRQB 4K7PY 2EICA 2NY0C 5C09A 3HMXL 5GS0D 1DQDL 3JUZA 2EXYD 1SM3H 3T0EA 1EBAA 1TCMA 2BVUA 4YJZL 4YDJA 5F6IB 1PFCA 3CDFA 4PV9B 3STLA 4P2QE 4ODBD 4NQTA 5IB2B 3U0PA 1EIBA 1BFVH 3V4UL 1I9JL 3PIQA 1NC4D 3C08H 1DVFC 3O9WB 4AIZA 3SKMA 4WGVB 5E8DL 4AZ8A 4DVBB 1KTLB 4JPKL 5IBLC 4GQPH 4WUUA 4NN6C 3OR7A 3GM8A 1BZ7B 1KC5L 3KPQB 1QO3A 3QZWG 5HYJD 4N5EC 1LK2B 2Z93A 3P4OA 1FVEB 1G1YA 4UOW1 3W82A 1ZSDB 1CFBA 1HHHA 4M5ZL 1MIEH 1LD9B 3PXJA 1S7VA 1KSRA 4PRID 3NMEA 2YEZB 2BJML 3DMMC 3QEGL 4WIQA 3CGTA 3WN5C 5J9PB 3MNVB 3VXPB 1QZ1A 4R3SB 3Q3GB 1B90A 3LEVH 4J12A 5ID0B 2ZOKB 4QT5A 2OR8A 1BD2B 2MPAH 2WBKA 3MGOB 4UU9B 3RA7L 2QJDA 3IXTA 5K93A 5KSAB 3C5ZD 4I77H 4DQOH 4K3GA 1CGYA 3BN9D 1G9EA 2VSDA 2AK1H 2V7HB 3VRLE 1S7SB 5L7XH 4P4KB 2VXUL 1I9IH 2NZ9D 5HHMD 5I8OH 4PJ9A 5IMKB 2GT9B 4B7LA 3MCKA 1OTSD 3P30H 1QSFB 3QQ3B 2B2XL 3WBDA 1JHKH 5ACZA 2AK4A 2Z35B 4OJFL 1LO5A 3D39E 1NLBH 2CDGA 2HJLB 1OTTD 2EIBA 3KGRA 4MAYA 2DQJL 5B22A 5C0FB 1LK2A 3V6OE 4LHUG 1NAMH 3CMGA 3GNML 3WYRA 2R8SH 3RX7A 4H25A 5SWQA 5DMKB 1ZLUK 1A6UH 4PBXA 1NGYA 4JQIL 3CFBB 5FO8A 1OGAE 5GZOC 5GHWL 1QR1A 3Q48A 4YHOL 4OZGB 4NKIL 3HI1A 1FVDA 5FGCB 4D3CH 2NY3C 4C58B 3TZVA 3P73B 1ZEAH 5E6IC 2EDKA 3QRFM 4WFED 2DL2A 2J8UB 5AYUH 1CGUA 5A16B 3T8XB 2DIBA 1A7QL 4JO3L 4Y19B 2UVEA 5MERA 3DO7B 3NFPA 4YHKH 5J56B 3ZDYF 4Y0GA 4RFNC 1U8KB 2XG4A 4QXTB 4B50A 3MA7A 2JJUA 3OZ9H 4IJ3C 3BSZL 3DX6B 2XZCH 4H0HB 2QSVA 5T5NG 4NKMA 1WBZB 2GK0B 5E2TL 2NXYD 3LS4H 5D1ZA 5A2LH 4ORGA 1TETL 4PLKD 3F12B 3CVHA 4BFIA 2PXYC 4PRNB 3KPRA 3NIGF 5DQDH 4Y7MA 2JCCB 3IDYB 4HXBL 2UVFA 2X4TA 4JHBA 2ZOLA 4FQIH 4IOFC 3CMOL 5CJOL 1KIPB 3PQYB 2EDQA 1G7MA 3LKNB 3AB0B 1HCVA 3K80A 3CDCA 4MLIA 1AY1H 4X8JA 4TSCH 3LZFH 4YIQA 1G6RH 4OD3L 3HC0B 3IFLL 4LF3B 1P7KA 1ZWIB 2F74A 5J3HC 3WFDH 2X2YA 1UEYA 5GSVA 1IC5H 3MV8E 3EJZD 2MJWA 2GJ6E 1YEIH 2ILLA 3QUYD 2E9WA 4G6AC 1B4RA 4UNUA 4M62H 4UINL 2X4QB 5D1ZD 4G6JL 1KULA 1MCOH 2G9HA 1QUNA 3G5ZB 2BC4A 1J9CT 3TZVC 4F7CA 3PDOA 5EU6A 2QQKL 3HCVA 3C60A 5C09D 3S3PA 2FZ3A 1NMBL 3GBNH 4L9LA 1TNMA 3NFPB 4HS8L 1Q9KB 1KGCD 3THMH 3BGFB 5C6WH 4RZCB 2CK2A 5DD0H 3FT2A 1ACYH 1OLLA 2Y5EA 4NNPH 2OXGA 3VFUA 4I5BA 4PLKC 5IFJA 1JGDB 5DC4B 1D5MA 2DLTA 3QISA 4DQOL 2YRZA 4K23L 2X7LA 2OM5A 1ZT1B 3DVIA 2Q3ZA 1WTGT 4NFCA 5ERWB 1N6VA 2NR6D 1T21B 4OZ4B 3O3BB 4XCCH 3HPLA 2F54D 1KPVB 1SMOA 4ZFZA 2VIRA 2ZPKL 3GI8L 3NA9H 1DDHA 5HPOA 4ZMAT 2NXZC 1Y6KR 3EYQC 1JWUA 1Q8MA 4OI7A 2FR4A 2YPLA 4G9DB 1Z5LB 4FFYH 3VFGL 3IJSB 3CSPA 3DURB 1NEZB 4DKFH 4HWEH 3D39A 5E56A 2PO6A 5TH2B 5HHOE 3G6DH 2AK4E 3MLPA 5HGAB 1H5BB 1P1ZA 3PV7A 5F1OB 3RIAF 2BNRB 3K4DA 3S96A 3VXSE 1FO0L 2UYLA 1ACYL 3D3VB 4YBLB 2FH8A 1L0YA 2ERJB 4JY6A 3W2DH 3NIFF 4TN9A 1P4BL 4XAWL 3FQWB 4NKOB 4Y89A 4LNRB 1AGCA 3RWFA 4AQ1B 4UNVA 2IPUG 1PW3A 3DXAD 2CLRB 4KXZI 2A6DA 3S34H 1GOFA 4YXKH 1NANH 5AYUL 4KZEL 1TJHL 4PJ7F 2C3VA 1S3KL 3T08A 1R5WA 4JO1L 4NFBA 2LQRA 1S8DA 3E1F1 2P47B 4KI1A 3RZCA 1MIEL 2VLME 4WO4C 4H0IA 5J4MA 4MJIE 4TOYL 4NC2B 1A0QL 1J8HD 4MD0B 4PY7A 1C5CL 4QXWA 3FL7A 1AD0A 1NLDL 1T7ZA 3O3BA 1ORSB 4FZ8L 1MI5B 3MRIB 5D7KD 1AKJD 2IAMA 4L8CB 3H3BC 2CKBA 3AREA 3GSOB 2Q6WB 3GKZA 3IXAA 5IIEA 2GQHA 2VH5L 3KYAA 3N9GL 5GGRB 5I76B 5EU5B 4E42B 2LABA 3GKWH 1NCNA 4ZOCA 4KMLB 2DF3A 5JW4N 4OQTL 4WUUE 5E2VH 4PJIE 1W2KT 3OKKB 1CLZL 4NO5B 3BQUA 4MHHI 1BFVL 3LAFA 3DRQA 1ETZA 4NT6A 3ARFB 5H8DA 5BZWB 4OGXH 1I1AD 2YBRB 4QHNA 2D31A 4PJAF 3BE1H 4XC3H 5TFSH 1OAZL 5TGBB 3KPLB 5D70H 3FO9A 5D1QB 3ZKMD 3EAKA 4JFPA 1EMTL 3PHOB 4JFFB 3LQZA 1WT5A 3B8YA 1MPAH 5ESAA 5F7UA 2B1AH 1EEZB 1D7FA 3CLFL 3KXFB 2DBJA 5D96B 3WFBH 3WE6A 4OCNC 5IBTH 3RTQC 3I9GH 2VDPH 4GFTB 2A1WH 1JHTA 2XT1B 1VGEL 4GT7A 3WSQL 4BFEA 2FD6L 4N1EA 3QDHA 2Z8RA 3WFEL 4XNMB 4XVJH 3WEXA 1AGDA 1PSKH 4DZ8B 5INCA 4YBQD 4KK9D 4XP5L 3T09A 4C56E 4APQC 1HZHH 1QACA 1YY9C 4LSSH 3U0PB 2XQYK 3ISWA 5SV3A 1G9ML 2P48B 1N7ML 5ICXA 2WP3O 1MRDL 1HHKA 5TDOB 5DJ6A 1WCQA 5AZ2H 1P7QD 3CFIC 5IJVB 1UGNA 2FECI 4PB0H 1FV1B 1F02I 3REWA 3BDYL 3V4VL 1ODAA 3MSPA 3B2VL 4ODXA 1SYSB 1MQKL 4R9HA 5IVNA 1FNFA 4FQQA 3QPQD 4QRRB 1RUML 3O3DB 1IAII 2PKDA 5F7LB 3LDBC 2OSLA 1HILB 5IHUH 1S7TB 3S37L 2R0LH 1NGQH 4M1DH 5HHMB 3MLRH 4EOWH 4P2RA 1F8TH 1RZJH 2X4OA 4I18C 2R56L 3ARGB 4YDLB 2D7TH 3ILQC 1MFDH 3HLAA 5J8OA 1RIUL 3MXWH 1OGAA 5IGXL 2R0ZH 1J18A 1UWGH 2NY5H 1YJDC 3O4OC 4CVZA 5JZ7D 2KH2B 4DGYH 1UXWB 3RDTC 3WFCL 4UOW0 4Y4KA 4Y5VA 2VE6A 1A6TA 1QVOA 4YR6B 3W0WE 4ZTOL 2EDJA 2BRRH 3MRJA 2QTEA 2R8SL 3B9KB 3HNTH 1CE6B 2EDTA 4LSTL 4GUPB 1VEMA 5KS9A 2IADA 5FM4A 4N90E 5AUMB 4XXCA 2DQEH 2I9LB 5EZIH 1U41A 4MAYB 4JJ5A 1HDMB 1FFOA 5H37G 3G08B 1YN7A 3KYKL 4K7PL 5HXMA 4LRNH 3DGGB 1KENL 5CIPA 3FHQA 3C6LA 1U3JA 5F97E 1UM5L 2ID5A 4Y16D 4OUOA 4Q2ZB 1A1MB 2HN7B 2ZCKL 1S78C 3MR9A 4JLRB 4JO4L 4CJ1A 5IWLC 1ZHBB 4IDLA 1ZHNA 3DSNA 4R97B 1A6AB 2VN4A 4TULL 4DWHA 4JZNB 2C1OB 2MOVA 2XPGB 5EUOB 3RWHB 2OJZH 1Q0YL 4Y19D 2RR3A 5EU4B 1FV1A 2EC9T 5D8JL 2NY2C 1B4JH 4W68A 2NY5L 4KI5C 5I18L 2AEWA 1O0VA 3MODH 5IW3A 3LKOB 5GZND 4W4OA 2NXYB 3NACL 4G6AD 2EDXA 4KAQL 4DEPB 3U6RB 1YC7A 1MCKA 4FQXB 5KSBA 7FABH 5DC0A 2BY0A 2F8XC 3TJHD 3BJ91 3BP7A 1JGVH 1PJ9A 2VLJD 3AMKA 2VABA 3C9NB 5DHYB 1OP3H 2C9AA 2D0HA 3ZE2E 4UV7L 1C08A 2BJMH 1ZVHA 3O11A 4JPWH 4UAOC 1LO4H 5L0QB 3H3PH 1UM5H 4FFVC 4GRLB 2PXYD 3KPRD 4LK4A 3TH2T 3IDJA 2I60H 2J3SA 5BRZA 5A2FA 1N6QH 1I3GH 4U49A 3ZDXF 1G9NL 1DE4A 4KGLA 4U1HB 1A7RH 4OSUH 1OPGL 1JPGB 2ATPA 2AW2A 4ETQA 4NP4H 4XHJC 1DSFH 5CBEB 3RUGB 3AROA 1BZ9A 2WWKT 3KYOB 1AO7E 4KXZH 4TQEH 4HKZA 4C83B 3TVMD 2RFXB 4F58H 1U42A 4Y2DC 4G8GD 2YD3A 4K7FB 2W65A 1KFAL 3WS6A 2ZJSH 4ZDHA 1WIOA 1N2RA 4RCAA 1LVEA 1X6NA 1DEDA 4NZRH 4ODSH 4QRPE 5CEYA 3HN3A 1CZ8H 5C09B 1LP9B 2QQLH 3NGBC 4JRYE 1P9MC 2R29H 4J3XA 1VKXB 4R4ND 5GS2D 1F8TL 1F11A 4PJDB 4Z7WE 3BPOC 5IW1A 1PBYA 4F7EA 3N1FC 4O2CA 4W4NA 2FEEI 4IRJD 3O2DA 4D9LH 4JEGB 4G9FB 4XCNA 3IJHB 4JPIA 1V7ML 2AI0H 5CEZH 3D69A 4OD1L 5IFJB 1GJIA 1JPSH 2VH5H 3N9GH 3B43A 3DWTA 3AXLA 1EVUA 1CFVH 1JFQH 2HLAB 3PWPE 4RRPG 5IQ7L 5GRWA 1BAFH 1V3KA 1YC8A 3ARED 3MFFB 1IGTA 4JRYD 1DUYB 5F44A 2VISB 4QEGA 4ZFZB 4K9EC 3BJLA 5CUSL 1MQ8A 5D4QA 2NXYC 3ZT6A 5JPNA 4NM4H 3ULSB 1V8HA 1I1CA 2BSED 12E8L 3LKPB 4JY4A 2CUHA 1X5KA 3LZFL 1YEJH 5HGHA 4CDGC 4QY8B 3QIBC 1HYSC 2R1YB 2VDRL 1JGDA 1DBMH 3ZHKA 1KN4L 3P9MA 4HMEA 4G7YL 3R1GH 4LLWB 3D0VA 1CDHA 4MWFB 2GIYA 3IFPA 4WNQB 1NDGA 5GRVK 3DV4A 3MV9D 3DXAA 3PL6C 1BD2A 3VXUB 3EDJA 5HHPA 3H42H 3AFLA 3QNYA 1CFTB 4KVCL 5ADOH 5B3JF 3VRJB 2VMFA 1FGNH 3LD8B 2HVJA 1OY3B 4WW2C 4Q6IC 2MKLC 3C5ZB 4XBGB 3OXRA 3WN5B 5A2JH 3EOYG 3T8XA 2DL9A 4MJID 3VE0A 2ENYA 3OHXB 4MXQC 4LLVB 1I8LC 3MCKB 4WVRA 2ICWI 3UYOD 5EZJA 1D5XB 1GC1L 5I1CH 3KLSA 4NZTL 4XPBH 4LLYA 2JLLA 4PRBA 2WIIB 4FOMA 3CC5B 2FH6A 1QFUL 4GW1B 3AREC 3M8OH 1H3PL 2DS4A 5BCAA 4KKCC 1KJVB 2X89D 1WZMA 5C0JA 3CXHK 3UO1H 5E8PB 1V05A 4P2QB 4P5TB 2NR6C 4LRIA 4CNIA 2QHRL 3WIIH 1MJ7L 4KPHH 4MB4A 5AD0B 5C71A 3BP5A 4OD2A 4LU5L 1UVQB 2FEEL 4F57L 3WFBL 1HWGB 1INEL 5EO9A 5B38B 3JBG7 3TGXA 4BA8A 2VITA 2EYRA 1NGXA 4F33B 3FONB 4JG1L 4HKBA 4K23H 4HSQA 3VJ6B 2GHWB 3OAZK 3QDME 1OM3H 4Z8FL 1NDMB 4OM1L 3TIEA 1A1OA 1IKNC 4D9QE 4NZTH 4XPBL 3CVIL 1Q72H 2YPVH 3DX8B 1YN6B 7FABL 4U33A 3O4OB 4J8RA 5F88A 3KVQA 4BZ1H 2F54E 3P3YA 5F1KC 2ZSWA 3VI4F 3HCVB 3U30C 5B3JE 3D85A 3WUWB 1X5XA 1QYGH 3FOLA 5JHDD 4U6HB 3MRRB 4YPGB 1FORH 1W8OA 1MJ7H 3Q6FB 1XR8B 5FKAA 3FT3A 4DZBB 4D0CA 1M4KA 3SDAD 4L3CB 5FO7B 4GMTL 3OSKA 1AGFA 1A2YA 1OP5H 5I30L 2AXFA 4YIQB 2BERA 5T3XL 1KF9B 3HE7B 4RBPK 4ZUUB 3EJJX 3WIHL 1T5XA 3VW3L 1XF3A 3L5WA 5KN5A 3TJHC 1LMKA 4MSWB 1FC2D 4FXGB 4QRRD 1CGXA 2COQA 4PJCA 4EDWH 3VGHA 2DIJA 2B20A 1J7VR 1QFWL 4GW4A 1IKFL 1BBJB 3ET9F 3VMOA 5C8JB 1IAIL 4XNXL 5JPMA 3O3DA 4FXKB 5E8OB 3BVNA 1AGDB 4OGAC 4MCZB 3QUYB 4X6BA 4XC1L 2MHAB 4GG6F 3DTXB 2VSCA 3D39B 4F7PA 1TJGH 1GZPB 3N1QC 4S10A 5EA0H 4CJ0A 2APVA 4UTAH 2O61B 2A6IB 1F90H 5AAWA 5ICYA 4CMHC 2A38A 2AJSH 4Y4KC 3GMRB 4UDUA 1F5WA 1IQDA 4WW2F 4DK6A 4J23A 2CIKB 4F8QA 3MGTA 3NH7H 1FL6A 1J1PL 1EEQA 4OZIB 1MJJB 4FNLH 5DI8B 4OZGA 1GOHA 3RVXD 3CXDL 5ERWA 2DQIL 3S9DB 3AAZB 3A67L 1I9RL 3IFLH 4JR9H 2FRGP 2Y6SD 5AUMA 3TIDB 3FHAA 2GJ6D 3WJLC 1FPTH 3OKEA 1PZ5B 2QR0B 1RZ7H 3DETD 4MVBC 1A4KB 1KYOJ 4Y16B 3CU7A 3DO7A 4HX1A 2GSGB 4KTDH 2FR4B 4HG4K 4PJ8B 1RULL 1OCWH 1AI1H 4XNUL 1N7MH 4KMTL 3BUYB 5EC2A 3CFEA 4GMSL 1EK3A 2P46B 3UZQA 4PRHB 3LH2H 5CP7B 4L4VD 5C0GA 1ORSA 4WFGD 4MYWB 3D48R 3RWIA 3MBEC 5DFVD 4X6EB 3RDTD 1U95A 5KS9B 3UP1A 4XH2A 1GPOL 1I8MA 4PRAA 4HZAA 3H7BA 4JY6B 4HPYL 5E6IA 4JQVA 5JQ6H 4FXLA 5F72S 1Q1JH 2B1HL 3OKLA 5KZCD 4F7PB 3MODL 4H1LH 2I5YH 3L6FA 4IRZH 4XVTL 2DWEA 3QXTA 4UILH 2BHUA 3BAEL 4OUUB 4EUPH 5J6HB 4PJ9C 3LRHA 1DVFB 3OKNB 4HQQL 1B0WA 3QJFA 3QCVH 3PABA 2R1WB 1UH3A 4X6CA 1LE5A 5TQ2H 2ZJSL 1A21A 2YPLD 3MA9L 4HC1H 1QSEE 8CGTA 4ZFOB 3Q3GA 4OAWA 3MOQA 1BMGA 5J12B 3ULVL 5FKPB 2QL1A 4PJ5E 4RISH 5B4MD 1KEML 4GH7B 4UOJA 4DCQA 3FB8B 1G9NH 4ODWA 1EAPB 1INDL 2XWBA 1N0XL 4NWTH 2HJKA 4OCRL 3FB6B 1NCBH 3LN5B 4HXAH 4P49A 4K8RD 2JJWA 3KJ6L 1C16A 5HDQH 4H20L 5ETUB 1DZBA 3FN3A 4EVNA 1ZTXL 3GZKA 4PJHB 4ELMA 2R0WL 4IMLB 4HF5H 5I9QB 4ZUSB 1SBSH 2BHYA 2IH3B 2E8YA 4YH6A 3BIAX 1WWAX 3GGWB 4I13B 5T1MB 2VKXA 4ZAKC 1EBPA 5BZWA 3MLVH 1TJHH 3BQUC 3IF1A 1R24A 3W0WD 1YEIL 4NZUL 3QUKB 2WBJD 1LILA 1HINL 5EZLA 5FOBA 5IR1A 1CFQA 1T7WA 4YUEH 3MRQA 4EZMA 4BKLA 2AJYH 3U4AA 2JJVA 4JRWA 1U8LA 4PJBF 4Q9QL 2DM2A 2CMRL 5BZDB 3K0WA 4Y88A 1X4ZA 3OAYK 1KYOK 5T5FH 4YHOH 1IVLA 1FVDB 1FJ1A 1EEUA 1OAXH 2BNQB 2AK4B 2RCSH 1OGTA 4EDXA 4GXUN 4CN6A 2NX5A 3VD5A 4D9QD 1F11B 4PJDA 3HNVL 5T1LD 1YECH 5FKPA 2QQNL 3BWAB 4ZTPL 4WCYL 3I50L 2ARWA 1CLOL 4M8VA 2UWEE 5IK3B 1CGSH 4XI5C 1TPXC 1E4XL 4QHUA 1X4YA 2VLRB 4N8CH 4HKXA 1V3MA 3REWB 4G5ZH 3OKYA 4ONGL 1WBYA 4PJBA 1VFBB 3BKCH 3IU3A 5FECB 4NBXB 1A9BA 3F58H 3F5WA 3UYRL 4JFHE 4JM2F 1S8DB 1T3FA 1JF6A 4R0LB 1U92A 3JVGA 4OZHB 5F3HA 4K55A 3KJ4B 1UWEH 4AY0A 3H2WA 4MJIB 2C3WA 3I9GL 1BVLA 5HYIA 1ZVYA 3QFJB 4EUPG 4JDTL 4F9PA 1IL1A 3GBMH 3GSVB 3HS0B 3QH3A 3F65A 3KPSE 4FA8A 1FIEA 3MA7B 4LEOA 1XZ0B 1XT5A 2WLZA 4JO2H 4JQIH 1MUJA 1NSNH 3HMXA 3PNWB 3K8MA 3LMJH 3SKNA 2ZP0T 2ZUWA 4XGZB 1X4XA 4POZD 4XNZB 4U3CA 5T5NF 2ZUQC 5JA8B 2ZUUA 4NRYB 4N8CL 4WUUB 4PJIB 4CU7A 3KPQA 3BP6B 2WANA 4HJJH 3B9KD 4P2QD 3I02A 3UTTD 3OJVC 4WO4A 5I2IB 2I26N 4RQQB 1RUPL 4ACPA 1NBZA 2EDYA 3ILPB 3TA3A 4Z6AT 5LG1A 1NC4A 3D0LA 4U4BA 2R4RH 1BECA 3AMLA 5K9OA 4S1RH 1G7IB 5FM8A 2X09A 4X9GA 5JXAH 1F4HA 5D2NE 3WO3B 3L95B 2Y07L 1A6AA 4DFHA 4P5KA 1BF2A 1TZGL 1OOAA 4I0CC 2Z92B 2F5AH 4X4ZA 3KXFE 1QYGL 3CXDH 3AUVA 3BPCA 3LRGA 4M02A 5C07D 4JO2L 3GMQA 4P4RB 1DQQA 4OLWL 2GSIB 1HYRC 2PYFB 4Q0XL 1T21A 4FQCL 3DX9A 3HG1A 4P99A 2NTSP 4YK4B 4POYA 5DURD 1S7XA 1JZ4A 2D7NA 3ZTJH 1VFAB 1TLKA 4Y4HB 1CDCA 4WU7A 3QNZA 5E1HB 3W9DA 4JFXB 2H2PD 1UB5B 2CKBH 3IKKA 5CEZE 4N90D 3QEGH 2HT3C 4MJ6A 2ZNWA 5KVGL 1VKXA 4QRSB 4G80B 5FB8A 4PJ5D 1YUHB 1BQLL 3RJDA 1FRGH 2P42B 3MCG1 5A3IC 4M7ZC 1ZMYA 3NTCL 3FB5B 1JPTL 4R26L 5MENB 5DA4A 1MUJB 4ODXB 4D94A 2BSTB 2JK5B 3ZKSD 2XN9D 2K9UA 3T3PE 3QA3B 2Z35A 3Q6FA 5DD3L 1CICA 5EOCJ 4PTTB 3SO5A 2VQ1B 4S2SA 4XNYH 5AEAA 2ED8A 2NY3D 1FYHB 2HKHL 4PJGA 1E4JA 4FABH 2NTFA 3HZMB 4BK4A 3PWUB 1N3NB 1C12B 5JORB 1VERA 4LHJB 2D4DA 4HWEL 1L0QA 2AERT 1XGYL 5I1AB 2VDPL 1B0GA 3FO1B 1KB5B 2VXVL 3JWDC 2AQ2A 3ABZA 1VPOL 2E9JA 4MSWA 2DDQH 2HVKA 3EZJB 5IFHL 1TQBC 1A3QA 4KHTL 3RKDC 1YNTB 1CLYL 2O5ZH 2FX9H 3IDIB 1Z5LA 4RFEB 3O8XA 5E9DD 1MH5B 3QCVL 3LKRA 3RPIA 2HT2C 3DHMA 2W9DL 1OL0A 1RSFA 4P5KB 2VB5A 3DI3B 4DKEL 2EDHA 4HS8H 2F58L 1QO3B 4PJCF 3H9SA 4CBPA 1E28B 4QRTA 1CBVH 3SBWC 3UCRA 1I8KA 1MRFH 4ZUTA 1RU9H 5J13B 5KN5B 1R3JB 2P24B 4XP9H 2BY1A 1ED3B 1ZT4B 2IANE 4UQ3A 5C0RL 3S7GA 3D2UA 1UA6L 1JYXA 1JI2A 3LDBB 3P40A 5F7NC 4AL8H 4Y16C 5CZVH 1ZHBA 2BZDA 5EU5A 1KPUA 4NJ9L 5IF0B 4OFDA 5AWNH 4FZ8H 4FN0A 3BEVB 3WIHH 2Z8VC 4I8DA 3SDDB 4JRYA 3BZEB 1OCWL 4NWTL 1E4WL 4M1CC 5D5MB 4N0CD 2R0ZL 4WFFE 4JE4B 5CFHA 3SO3C 2W9EL 1FPTL 2YBRA 4QHNB 1H9VA 2XKNA 1P2CA 4ODTL 1AY1L 1ZXQA 2O5XL 2W59A 4G8IA 3QUXD 5K9JL 1H0DA 5BJTA 3O6MH 4HV8B 2ZUSA 1IM9D 3CFEB 3GSNL 4XI5D 2CJUL 3NZHH 1SEQL 1B6UA 4F3FB 3W39A 4YXKL 1P7KB 1NCUA 4P4KA 4WTZG 2OL3H 2L4OA 4JFOB 5IMKA 1JZ2A 1YEFL 5B8CA 4XCYA 4R4FH 3IVKA 5I76A 4N8PA