4OV5B

Structure of hla-dr1 with a bound peptide with non-optimal alanine in the p1 pocket
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Susceptibility to HLA-DM Protein Is Determined by a Dynamic Conformation of Major Histocompatibility Complex Class II Molecule Bound with Peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 189
sequence length 189
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ov5B01
1AQDB 3V6ZA 3W0WB 3ZKND 4ODVL 4XNYH 4LHUB 3KJ4B 3VFOB 4M7LH 1V05A 2JF1A 2R1YB 4IHOA 2EDEA 1ZV5A 4XNMB 4EOWL 4OI9A 4JM2F 1H3XA 3BH8B 1X4XA 1LD9A 2R0LL 1EAPA 1K3ZA 1S7TA 3R8BB 4JPVL 4TRPH 1QACA 3TO4A 4WO4D 4OZHE 1KJ3H 2AK4E 3DXAA 1MAML 1CU4H 2VAAB 2JJTA 4K94C 2VE6B 4JRYB 4I1NB 4LFHD 1CTNA 5SX5K 4H8WH 3U7WL 3MRCA 4DVBA 5IW3A 3BFOA 4DKEH 3CLEL 4LSQL 5DQDH 4RWHA 1IZJA 4Z7UB 2KQMA 1A8JH 1FAIL 3QULA 5CUSL 1AKJD 2WWMD 3BPNC 1MLBB 4IRJD 3SE9H 1INQA 1ZA6A 4PP2A 2CGRH 4HWZA 2NY5H 5I18L 2M8XA 4PRAA 4OLYL 4PJIB 1YC8A 5I2IB 4KTDH 1FNEA 4LCWA 5DRNB 5D7JD 1BWMA 2Y5TB 1BBJA 1EEQA 5JLZB 2BY1A 4R3SB 2JB6A 3CXHJ 4HKZB 5D72L 5HJ3A 1PBYA 5I0DA 5CP7B 3VWKB 4PJBB 4PRBA 1YY9D 5MI0C 1F90L 4JKPL 4NHUA 4NP4L 1DUYB 2A6IA 5E56A 5DGQA 4YHZL 5DK0A 1AY1H 1DSFL 1OSPH 2BNRD 5HYQB 3QWQB 4ODHL 4EI5C 2E9JA 4PFEA 1IEAB 5E8EA 1T21B 2ZJSL 3UJJL 2HN7B 4NN5B 3MV9D 1IQWH 1AGBB 2AKRB 4DKDC 5F88A 2CUIA 2NW2A 2GUOB 1JYNA 1I85A 1U3YA 2EE2A 1A1NA 4E0RA 3OKNA 3KPLA 1IC7L 3LB6C 3MZGB 4PBVC 4PJXB 4BQ9A 4NDMA 5DS8B 4JHAL 2EC9U 1T83A 4XBPB 2EDDA 1VA9A 4GW4A 4WWKB 2JIXA 4X80H 1IKFL 1V7MH 1T2QL 4M6OH 3IT8D 4K7FA 3AREA 3V5HA 3IDJB 1M4KA 4CMMA 3TNNB 3QDGA 4K3EH 2QADD 1RI8A 2QBWA 1A7BA 2PW2A 3E8UL 3QCTL 3H6JA 5IJKA 3O45B 4X9FA 1T5XA 2OZ4A 5JPMA 1H5BB 4MJ2A 1IEHA 3BE1H 4WI3A 5J56B 3O9WB 5IVXF 1C1EH 5SWZE 3PNWB 3JV4A 4FP8H 2FX7L 2Z91A 3GMNB 3T1FB 1NEZB 4FRWA 2BVPB 4U1SA 1RFDH 3IS0X 2R69L 2VL5B 4AEHL 4RIRA 4PRIA 3OXSA 3CFJB 2DMKA 2QEJA 3I6GA 1YEGL 3PWPB 3TBTB 3CDFA 3VD4A 4F7PB 5A43C 1KJ2B 3B2UC 3OJMB 1BJ8A 3EYVB 3BJ91 3MRRB 3VRLF 4XP1L 5GRJH 1LVEA 1PDKA 3A0OA 4OM1H 3OZ9L 2FEEI 5D5MB 4MB3A 4LU5L 2ZSWB 5E08L 2BNUB 2XFXB 1FNAA 2FSEA 1N6VA 2DS4A 4OCRH 4X9GA 2HJFA 2V7HB 2VLRB 4W70A 5DT1L 2NX5A 4HC1L 4POYA 3JTTB 3VGGA 2W92A 4XHJD 2CR3A 4BZ2L 2IPTL 1WQVT 1ZEAH 3VXSD 1I7UB 1B6UA 2K1MA 4Z77A 4YFDB 3NGBC 1MRFH 1MEXH 1XR9B 4XCEB 1LQSR 5CBEA 2J6EA 2OR8A 5DGRA 4WRLA 3ARSA 4GKOA 2WK2A 4MXQC 1WITA 2HH0H 1E6OH 3QCVH 2EEAA 1KEMH 1SBSH 3IFLH 3EJZC 3IKCA 4EDWH 4HCRH 5AZEL 1TENA 2O61B 4JZOB 3O3AA 3K81A 4X99A 2AV7A 1SJEA 5JMRA 2VWEE 1LDPH 2HFTA 2FD6H 2WANA 5I76A 4Z7VE 5DEFB 4ODWB 4XC1L 1Z6JT 3U0PA 5KJRH 4ETQA 1S7UB 1EO7A 3LIZH 3QDJB 1LO5B 1DBAH 5C0GB 2FLRT 4YUEH 3DX6B 1KJMB 5I74B 4PJ7B 1EO5A 1KJVB 3QWRA 2X7LA 5F97E 4UT9H 1HDMA 1OSZA 3L7FA 1XCQA 2P8MA 4LBEA 4OB5H 5KVDH 1KCVH 4GRLD 2E27H 4LIQH 2HRPL 4R4ND 1LP9B 4RRPA 4XNZB 3BXNB 1T1XB 1G7JA 1PX4A 3IDIB 4UAOC 3PIQB 1U36A 4XCNB 4KDVA 4DW2H 3RWGB 2IWGA 2W60B 3H3PH 5J3HC 4WO4A 1QRNB 1NGQL 2OMBA 3PWNB 2HKHH 2QSQA 1M05A 2WNGA 5DK3A 4OLVH 5IQ9A 2EYTA 4QY8A 3QQ4A 1RJCA 5FUZL 4PJFA 4HWEL 1UACH 1X5YA 3RWIA 5SX4H 3FB7B 4MMXC 5F3BA 3QEHA 3WIHA 5A2KH 1OHQA 5HHQA 5MEOB 1V7NL 2JCCE 4OZHF 4H5SB 3DHJA 1CFQB 2R2BB 3UJTH 4CVWA 1AKJA 2Y06L 4YO0B 4IRJA 4S11A 3FFCD 2COQA 3ORJA 4YHLH 1HKLH 3QIUC 3LEVL 1E4KA 2VXVL 4X9IA 3ARWA 2BOCA 3PWUA 2AK1H 4BK5A 4LASH 5D7JA 4ONOA 5FUCC 4FQXB 4PGDA 1YEEL 1ZLUK 5HHOB 1OAQL 4MAUL 2YPVH 3RAJH 3CCHB 1SJHB 1AC6A 5SX4I 5CIPH 5LG1A 3BIAX 2IALA 5I1LB 5HYSB 1IGJA 2A6JB 4XWOD 5IGXL 1UGNA 3SKNA 5D96C 2BNRA 1XZ0B 5H94A 3ROOA 2L4OA 5JIHA 2LE9A 3NPZB 5EUOB 3UC0L 2FBJL 4OCLC 3KPMB 3H9SE 1CR9H 1H3UA 1MCRA 1MWAL 4ODSH 4ZS6D 3QCUH 2E9BA 2H8PA 4NHCL 4RWYL 3C9NB 3V4VH 4OI7A 3NH7L 4K8RC 2EH8L 5ID1A 5FYJL 2N56A 3BRDA 2MPAL 2CO6B 4PGCA 3NTCH 3QBTB 1PJ9A 5TE6H 5CGTA 4MJIE 4YGAB 3NCJH 3SKMB 4H0HB 3T09A 3RY4A 2J7LA 4OUOA 3QZWA 4QRSB 4PGEB 4QTIL 1IT9L 2ZCLH 3VW3H 1K5NB 5F6IC 3T2NL 3REVB 3ULSA 4XI5C 4DN4L 4LLVA 1SY6H 5IMOB 1TQCC 3MMEB 1RZJH 1V8HA 2Z4QA 1A3LH 2NLJA 2NY1C 4JR9L 2EE6A 2A74A 1ZT1B 1JGLH 1VB9A 4BFBD 4ZTOL 1U91A 3MO1B 4WCYH 1PVHA 2GTWB 4L4VD 3MLPA 4D0CA 2W0KA 3BSZL 2BSTB 3JWNC 1HKFA 1QA9B 5KVFL 4LSSL 3GIZH 4L8SA 2UUDH 5FA3B 3O6FB 5DZNA 3VFWB 2I5YL 4CADB 2ATKB 3QIBA 4IRZL 4PRPE 4TTDC 3VFSB 2YEZB 3W2DL 5FF6A 4QWWD 2GFBA 4JKWA 3VD5A 3U4EB 2OJEB 3DRTB 3DWTA 3O4OC 3O3UN 4HG4K 3TJHD 2AJXH 3ARGD 4FQ1L 2Q8AH 4O4YL 2YZ1A 1R0AH 2FWOB 1G6RH 3G6JA 4Z7WB 4KKCC 3UTQB 3HAEH 1IGCH 1CLYL 3R06B 3T0EB 1VFBA 4LSUL 3T4YA 4D8PB 2MQ0A 3LPWA 1IKNA 3AAZB 1MY5A 2DLFH 2V2WA 3WFCL 4LLQA 4HH9A 3GB7A 1HN1A 3RVWC 5D1QD 4ODTL 3HG1B 4YPGB 3QXDA 4EI6A 3DROB 3VXNA 1KSRA 2A0LC 5KSAD 4YDVB 2MCG1 1D5MB 1B6DA 1CXLA 4IIQB 4AG4H 5C3TA 3L95B 1G7HB 4HUNB 3QIUB 1KN4L 1UB6B 3RNKA 3QUZD 2R1WA 4HBCH 5FK9A 3CUPA 3LS5L 4MD5A 3TPKA 3T4AB 1E0OB 1K8DA 3QNZA 5IEHA 3SDAA 4NQSB 4HLJA 3HUJA 1A1MA 3M1BB 4WFHD 4NNPL 5E2TH 3DRQB 5EIQA 3AUVA 1S9WA 3DX9B 2R4RL 3S88H 3U4BL 2X6MA 1LO2L 2IG2L 3MRDB 1JV5A 5AZ2H 5MEPA 3WFDH 5IMMA 1RK0B 5DJXB 3MPCA 4OLXH 3K4ZA 1YEKL 5D96B 3A6CL 4XBEL 1OAXL 2Y9RT 4PJAE 5E2VL 4P5TC 3HMWL 1QEWB 2ADFH 1VESA 4E41D 4QRQA 2R56H 1QFWM 4KQ3L 4GRLA 4M3JA 1HIMH 4Z7VF 4JCMA 1VGKA 1FRGL 3QQ3A 5E8NA 5KAQF 2PETA 4N0UE 4ZNCD 4TNVF 3PP3H 4DAGL 2I9LB 5DEGA 2IMNA 3VFMB 1U3JA 5BQ7A 3N85H 2A6DA 2AEIT 5E9DE 5BS0E 1LE5A 4JDTH 5C86A 1J8HE 2XKUA 4X6DE 2DOCA 5MERB 4BFEA 4DUVA 4MAYB 2ESVA 4RCAA 1JF6A 3NFSL 4PV8B 1IGML 2WUCH 5F1NB 5BW7A 2IGFH 3DNKA 4MD4B 2Y07H 1QSFB 5F6IB 1EGJH 43C9A 1IGYA 3C6SA 1ZHBB 5ETUB 1TQCB 4EKXA 3EOBB 4IOFD 4J1UA 4N1EA 1RZKC 5C0DA 5I1AB 5KW9L 3RX8A 5JDSB 3WHXB 3WUWA 2IFFL 2C3WA 1WCBA 5HHMB 3FFCA 5CJ8A 4GAJH 4PY7A 2A6KA 1Q72L 3U82B 5DQJB 1MI5A 5J11C 2J8OA 2DTML 3MJ7B 2GK0A 4XMPH 4KKBD 1UZ8B 2DF3A 1VFAB 2NXZB 4X6CE 1CXFA 2OJZL 5HYIA 4NWUH 5I1HH 3MC0A 4MXWH 1F3JA 2GJZB 2MMXA 2JCCF 7FABH 2HRLA 5IM7B 3MODL 4NQXA 3O4OB 4Q97A 4LLWB 4W4NA 25C8L 2OXGA 4HAGA 5BJTB 4WFFE 2Z92B 3ULVL 3BH9B 1L0QA 1RUPL 4L1HA 2RAMA 1JN6A 3MUY1 4K3DH 5I1IH 4XVUD 3CPLA 5JHLL 1KB5H 3FJTA 3V8CA 1KBGH 3O3EA 4JFZH 2XKNA 4J6RH 3ZKSD 5GRUH 1YNKH 4KDTA 4GBXC 1Z3GH 3UXFA 1QBML 1J10A 4U3XA 5C2UB 5E5MB 5CJOL 1YY8A 3S96A 1AXSA 3GSNH 2AEPL 4R26L 1FAKT 4F33A 3CDCA 3SJVD 2KPNA 5IW6B 1D6EB 4XAWH 5HGDA 3TP4A 1W0WA 1WBYA 4LF3A 4PJ8C 5D1XC 2ADJB 5MENB 2X4RB 5IBUB 2OSLA 2KL6A 2ICWB 1EEZB 1RSFA 1D3CA 3QXTA 2K7PA 4Z7NE 4YLQT 1EH9A 5LQBL 2FGWL 3QXAA 2QQNL 4X6BA 2F53E 5HYJB 1JWSB 5I1EL 2BVUA 5CHNA 3N1QC 4KAQL 4JLRB 5JO5B 3VDBA 2DI7A 2V9TA 5IB3B 2VYRE 2EKSA 1GOFA 1PG7W 3SOBL 2RFXA 1FC2D 3Q48A 3UBXG 3L3HB 4XCCL 3MRMB 4U1MA 2DQDL 3BYTA 3GBNL 2B8OT 5BO1H 2VZSA 3DUUB 4U2ZA 4HS6B 3DMMD 4NQCE 2A77H 4XPAH 3BAEH 3V95A 3G5VB 1I3VA 1MJ7H 4ZUSB 4L4VA 3MRQB 4P5TB 1GGCH 4MQ7B 4PLJC 3BKJL 4M7JH 2WP3T 1Z9SA 3INUH 5L88L 5I15L 1M71B 4G8EA 1QLRA 4HZAA 4TUJB 3SE8L 5EN2B 1LK3H 4PTTA 4LDLB 4JY6A 1OAUL 3QDME 1XIWD 5CIPA 5I1JL 2E7LC 3WDJA 3GHBL 1KCRL 3PGCB 2G75B 1BAFH 2H9GB 3G5ZA 3O2VH 4MJ6A 4HW6A 3MRKA 1MCCA 4FXGA 1F6LL 1XGUB 3TT3L 4ALAH 1I1YA 2C4FT 4XH2B 3KPRA 2D4FA 5FGCB 1CLOL 2NTFB 4YHML 4HJJH 3QRGL 5MP6L 1I9IH 2EIBA 4IOIA 1ONQA 1FBIL 1WBZA 4HIXH 4NQED 4WTZG 4NN6C 2OK0H 5CBAB 1KG0B 2N7AA 3BWAA 2YS4A 4QRRB 4JN2A 1FN4B 5EO0B 4ZQKA 1F4WH 1DDHB 2CD0A 1N64L 1NUFA 3FB8A 1ZK9A 3IF1A 4S1RH 3CZFB 5GRVL 4F7CB 5D2NC 5IJVA 3IXAB 4GAFB 1NBQA 1LNUA 5T3XL 3RVUD 1A3RL 4HZLB 4HK3N 4HJ0D 4P4KA 2Z31B 3MJ9L 4YHNA 1KIUA 2K9UA 5F9OL 2YC1A 4PV9B 1UJ3C 1ZSDA 4RFOL 5KS9B 1HHIB 3LPFA 3HE7A 2ERJC 4UILL 3MBED 4HUUB 1SY6A 1P7HL 5CILH 4PJEA 3CFBB 5TH2B 2HFGL 1DN0B 1T0MB 1RURL 2YK1H 4GBXB 4G5ZH 1S7SB 4ACPA 2VLJA 5FIEA 3LN5B 4YX2H 5DJ0B 1HH9A 2BX5A 1YEFL 1MSPA 2VXTL 5EC1B 4ZG1A 3KVQA 1MFEL 1P6AB 1UH4A 4L4TA 1ZVSB 1BQHA 2XT1B 1B3JA 4PJ8B 4I18C 5ACLA 1DJSA 4D0DB 3MLUL 5DMGC 2PCPB 3VJ6B 5AG9A 2NCMA 2DQUH 1A6WL 4EZMA 5ACZA 3WSQL 4PJAF 4JO3H 5I8EA 1XGPB 3QG6A 5LGKA 1JPSL 5T3ZE 4XCYA 4OZGA 2I60L 2Q7YA 3TJEL 2YD7A 1BX2A 4NCC2 3HAEA 1VDGA 3JUYA 4TNVK 3AROA 3E6FB 1A7OH 1CLCA 5IMKB 4P2RD 4S2SA 4X9HA 4XWGL 4ZAKC 5A3IC 1AD0B 2X4SA 3MOAL 5T1LD 3SE4C 3FT4B 2XTJE 4GAYB 3I6KB 1YNTA 3F7VA 1RZGB 4NQDE 3C08L 4X6DF 5HGHB 2BSRA 1IGFL 1OGTB 1HWGB 1PW3A 1DVFA 4WIQA 4C54A 4M6MH 4LVOB 1AR1D 2D7MA 1B0GB 3S37X 1UXSB 4U1LB 5EOTB 4PJGB 5JHDD 4MS8C 3H42H 3RTQA 3LEXA 3C6LC 2UYLA 5IB2A 1GJIA 1HNFA 1MRDL 1U8LA 3QWOA 1Q9OB 1ZANL 4LSPH 1PEZA 1AO7B 1CE6A 3KHOA 5ERWB 3NCYP 4CW1A 4XNQB 3SDYH 3D3VB 2E7BA 5EZIH 3RUGA 2BMKB 3WIFA 1HEZA 2HAZA 1A6AB 4Y8DC 1BECA 4G6FB 1HWHB 4X6CF 1HXMB 5B4MD 4LMQI 3DVGA 1A9BA 1LK2A 3I75B 2BSED 3QH3B 5J6GB 5CGYC 1NGZA 4P3CL 3ARDB 3SJVA 4TPRH 2PTVA 3EDDA 2DTSA 2XRAL 5SWSB 5I1DB 3IVKB 4N8VA 5EC2B 2HJKB 1CD0A 3BPOC 4NN6B 3I3EA 4F57H 2DQJL 3PABA 3VCLA 4Z7QE 3A6OA 3OKMB 4U1JA 3W0WD 4KGJA 4G8GB 4LHUD 3H9HA 3HPJA 2GJJA 3IDNA 1ORSA 5D2NB 1BFOB 3P0YL 1PX3A 4OF5A 3QA3B 1I8KA 3RU8H 1KF9B 2A9NL 3GMPB 1XCTB 3ULUE 4RISH 1EGJA 1CFVL 4HHAB 4Y0GA 1JCKA 2YD4A 3IFPA 3KPQA 1EA9C 4BSWA 4MX7A 5HHXH 1ZT7A 4Z7NF 1IEBB 3DV4A 1ZA3A 4YXHL 4FTVA 4WJ5B 4W6YB 1G9NH 1J0IA 3O0RH 3WXVL 4JRYD 3NPSC 4I9WD 5KANI 1T66D 4TULL 3U9UA 3ISWA 1WAAE 4XVTH 1T22B 4UU9B 3SDCA 3SDDA 3MV11 1NLBH 1WFNA 2LABA 4NRZB 4NSKB 5EU4B 3ILPA 3KWWA 1T7VA 4DTGL 4M43L 5GS2H 3FQRA 4P59L 3ARBC 3QNYA 5HPMA 1XIWA 1IGIH 1FL5A 5JW3H 1HQ4A 1ZLSH 3EDEA 2VLLB 1FFOA 3QO0A 1IFHL 4KJYA 4M4PA 4D9QD 5C0AB 1KB5A 4J8RA 1G7LA 1BVZA 3HR5A 1P7QA 5I9QC 1KACB 4M7KL 3I9GL 1U8NA 2HG5A 2X05A 5F93C 5HVWA 5J9PB 4HXBL 4P57B 1FO0L 4XRCB 2VQUA 4LCCB 5EU3B 5I1KH 1UQSB 3GSNA 1MCLA 4ZAKB 1I1FB 2X10A 3VWKD 1NCAH 2CRIA 3WLBB 1MHCA 3EDFA 2HYMA 3V52H 5AD0A 1OTTD 5LGJA 3SGJA 4K94H 2EDRA 2VITB 3ZT5A 1K8IB 4O2FA 3OKLA 2H45A 3ALWA 4O51A 1MJJA 2IH3B 2FATH 2CO7B 3X12A 2XWBA 5IFHH 3LKPB 1U42A 1PYWA 1T80A 3I84A 2R0ZH 2PYFA 4UDTB 3C6LB 3BJLA 1S7XA 2WM0A 2F19L 2X4OB 2DM4A 2FGZA 4G43A 4Y5VB 1A7NH 4JPIA 5CZVH 2R15A 3SQOH 1G7QB 3GNML 1NCBH 4Q0XL 4QCIB 5B38A 2FEDD 1TCRA 3HC4H 3UDWA 5IQ7H 1N8ZA 3ZYIA 4B5EA 4HFUH 4P3WA 2DI8A 2EE3A 5F7WC 3HNVH 3WN5B 3BIKB 1MHPL 1YN7B 2AJUH 3DO7A 1Q9WB 1U8QB 4RAUB 5TFSH 1WC7B 1A6ZA 1JNLL 5DHYB 1TTUA 3DX7A 2BXYA 1W8NA 2ICEA 4PUBL 4KDWA 3O9WD 3NAAL 4RBPH 4HGKC 3GI8H 3HHRB 5HDQL 4WU5A 2F8XC 4H1LB 2WIIA 3S7GA 4GG6A 4I3RH 5GS2D 1A47A 3ARFA 4ESKA 1X5JA 2M2DA 4KVNL 2IJ0C 4G6JH 1HH6B 1WZ1H 1NLDH 1DL7L 1BWWA 3PWPD 1MWAB 2VUYA 2XZQH 4JJHA 1Y0LA 4F8TA 5C0JA 3MXWL 4HIJA 3CU7A 3RPKA 5IW1B 1YMME 1MVUB 3LDBC 3QXUA 4YWGH 5DUBB 2WINB 2HWZH 2DQIH 1MCQA 2VXQL 4LEXL 1EFXA 3ILQC 4QT5B 4JQXC 5T1LA 4F3FA 4HIEA 4NO2A 1S5IH 1ADQH 5TQ2L 3W39B 5TPWL 3VXOA 3BGAA 2VLRD 2P5WB 3G6AA 2DYPB 4IEFB 3GHEH 4B53A 4X83A 2HVJB 4N5EC 1H15A 5ESVA 5FO9B 3D2UB 1KV3A 3RQ3A 2LAGB 2PR4L 5I0ZA 3NZHH 4PRIE 1S9VA 4WFGD 3WNMA 3Q6FA 4JAMA 4U1HB 5GS0L 1R3KB 1JPGA 2J6EL 5AWNL 3JV6A 1Q9KB 4RRPG 3TIEA 1K4DA 3TV3L 4Z76B 2F54B 1TITA 3LQZA 1I7RB 1MFAL 2GK2A 4OV5B 3B5TA 3UYRL 2AJZB 5FV1L 1F4YL 1DEEA 5E8PB 1FVEB 5C0BA 3AS3A 4BKLA 1DUZB 1CF8H 4J2XA 5E2WH 5I9QB 3O6LH 4DKFH 3WIIH 5D4QA 4CVXA 4MQSB 2R39A 1TPXB 3BW9B 3CMGA 4JB9L 3U0WL 3ULVC 4Q9RL 3HZYA 4I48A 5HBBA 1YJDH 2R2HB 4LFHG 2GIYA 1YA5A 4PD4J 5DD3L 1Q94B 3QDJD 4LNVA 4WI8A 4JFHE 2FZ3B 1E4JA 2X1XR 3PHQB 4YR6A 2F15A 4LLYB 3W0WA 1TZIB 2BP3A 5JR1H 5EU5B 4POZD 5K9JH 4JO1H 2HFFB 2R29H 2J88H 5HVFB 2R1YA 5FHAH 2IFGA 3AXLB 3BH8A 3LB6D 2LAAA 4D0BA 4D9RD 4GOSA 3ESVF 4Z7QF 1KELH 3SKJL 3ZYJA 3JV0A 1A7RL 5DRZB 3CSPA 5DI8B 1QRND 3SDXB 1TMCB 1XF2A 43CAB 5EZOH 2VAAA 1NEUA 1P9MC 2CMRL 5GGTL 2VE6A 2X70B 4JRYA 4UT7L 1MCOH 4JFEE 3SGKC 4Z8FL 1KIRB 5DO2C 3ULUF 1Q0YL 2JB5L 2X4UB 4LDOB 4P2RE 1JGUH 4UDUA 4NFBA 4BYHA 4K71C 2JTDA 3K8MA 4OJFH 3IRPX 4Z7UA 3QUXC 1JYXA 2ZCKL 5IHZB 5JW4N 3MGOA 3TN0C 2XACC 5GGVL 1J05B 2XQBH 2WQ8A 3ZE1E 4WUKH 2VQ1B 4PJIA 1WAAF 1HINH 4NCDA 5I2IA 3GMQB 4BH7B 4QRPD 5F7KC 3B8YA 4FQXD 5E00B 3IETA 5DRXB 3LDBB 1C7TA 2R1XA 3QFDB 5DJDB 2BVQB 3LQMA 2VDPH 5HHOD 4WI6A 5E5RB 5CP7A 3VWKA 4U1KA 2W65A 3QZWG 4TVPL 5ALCH 4FFYH 1U8IB 1MHEB 3MUHL 3WE6B 3IJHB 3C2AH 4PRDB 2EECA 4UTBH 4LPCA 1HHJB 3GK8L 4P9HL 5HYQA 2B1AH 3VFPB 3C87A 1FVDB 1FORH 1E28B 1IEAA 3F7PC 1T21A 2HN7A 4KRNA 5ITFB 1OY3B 4QYOB 2AKRA 3UPRB 1CICC 2X4PA 4O58H 4AM0A 2GUOA 4OUUB 1FFNB 2X9XA 2UZIL 3RHWK 4CAGA 1FQ9C 1KC5L 1T2XA 5AEAA 5DS8A 4WU7B 3PGFL 4XBPA 4MXQD 5CEZD 4WWKA 1H8SA 1OAYH 2WBJC 3Q1SH 3WL9A 1D6VH 1NMAH 2Y1VA 5FGBC 4P46B 1H9VA 4R0LC 2O5ZL 5ICZA 2Y7QB 2EKJA 5B39G 2IMMA 2YRPA 4M03A 4JVWA 4Y2DC 4HS3B 5HHVL 1H5BA 3RRQA 3L5WA 4KK8D 2BNRE 3O9WA 1OQXA 1CK0L 1E4WH 4MZ3A 1YECL 2NYYD 3LCYA 2BJML 4MA1C 4H8WL 5CJXC 2DQHL 4Q6IC 3MV9E 3L9RA 2ZPKL 4MDJB 1NEZA 4QOKB 3ZO0A 4XT1C 3RWFB 4FMKA 2BVPA 4MJ4A 4DKEL 1QVOA 2VL5A 4QKXB 1GGBL 3P73B 5DQDL 3CFJA 3ROLB 2X41A 4XP4H 1LO3H 1F42A 1JTOA 4M8VA 2AJ3A 3TBTA 3MJ8A 4G9DB 2AXGB 4HKXB 5TF1H 3L5JA 3EYVA 3MRRA 3BRGC 1QLFB 3CH8A 5EZJB 5HSFA 1GOGA 1FZMB 2AEQH 3AM8A 2ZSWA 2A9ML 5J3HD 3GSOB 1ZGLB 2G5RA 2DBJA 1N5AB 5FYKH 4IDJL 3HLAA 1VSCA 2VO5A 2VLRA 4ONGL 4X4YB 3H9YA 3T0ED 3S97C 2H3NA 2QQLL 2NNAA 4JFQB 1EHLH 1E6JH 1T3FA 5DMIL 5IB1A 1OSPL 1WLHA 2CKNA 5F70A 4C4KO 4XCEA 3PJSA 3HN3A 4K71B 2VMFA 5KSBA 3WS6A 3SGDH 3HG1D 4R9HA 1YDPB 3V6OE 3EYQC 1KYOK 1M7IB 2APWA 3FZUC 3QUXB 5D7IA 3CX5K 4Q58C 1S9YB 4LGPB 1N0XH 2ZCHH 1OAZL 3TC9A 5LGHH 3GKWH 3HE6B 4NZUH 1UADC 1UA6L 3QIUD 4NO5B 4P3DA 1SVZA 4JG0H 3KPNB 1TETH 5C8JB 1DBBL 2O61A 1G7PB 4JZOA 3KLHC 3NBNA 2ZKHH 5DMKB 5DMJB 1JP5A 5D7LB 1MREH 5ITBL 2W38A 3E6HB 3DVNB 3G6JE 3EO1B 5DEFA 4ODWA 3TBVA 1HILB 2FR4B 3HZVB 2VDRL 1RZ8B 5F7DA 1JRHL 1S7UA 3VXSE 3TM6A 2YOCA 3QDJA 3CMOH 1LO5A 4U6XB 3QEGL 3DX6A 1KJMA 3SGDI 2VXSH 3ULUC 1S9XB 4PJ7A 4JDZA 5TJWK 5ANME 1KIQA 1IAIM 4JDVA 3BP5B 1C5BH 3M07A 1WEJH 3VFNB 3BZDA 1RFDL 1H3GA 1LP9A 2ZUUA 4Z6AT 1PY4A 3BXNA 1T1XA 2GAZB 5T33H 5IT2L 2NQCA 3IDIA 5GRYA 1T89A 3PDDA 4JHWL 4XCNA 3RWGA 5DJ2A 2F74A 4D3CL 2W60A 4K8RD 2XY2A 4Q9BA 4LARL 3MOQA 2HVKB 5IVZA 3HUJE 2GQHA 1SHMA 2CXGA 2F5AL 1QSEB 4ODXB 1ADQA 2NY3C 3JZ7A 4MAYD 5FYKD 1BD2B 5CD5C 2FB4L 1A64A 1MHHA 5EZLB 4JPWL 4UT6L 1BBDL 3PHOB 1QSFD 1CXIA 3BKYL 1FDLL 1NGYB 2OS7A 3FB7A 1DANT 2EDHA 2HT3C 4PYGA 3WFEL 1ZHNA 1R5IB 4RA3A 3Q5TA 4A2MA 1ZEAL 2NY0C 3IU3A 5EBWA 2IPUG 3T0BA 4L9LA 3TO4C 6FABH 3UTPD 1CFQA 1FC1A 2R2BA 4JM2B 1MEXL 4YO0A 2ICWI 5HHMD 2JJTC 1CS6A 2YWZA 1ACYL 4OGAC 4U6VH 2HH0L 1YPZE 2NXZD 4G80B 5DUMH 4BJLA 4MNGE 4FQXA 4JQIH 5BMFL 2WWKO 5DUPL 4ODVH 4OD2B 4F7MB 4X5XB 3CCHA 3MACL 2XNAB 1OF2A 3KLDA 1A6UL 4N0YL 5I1LA 5HYSA 2HMIC 3NCYS 1W0VB 4EOWH 1OLLA 2D7TH 3T8XB 3ZE1F 1B0WA 4KKCD 5IBLC 3L3JB 1T6WA 3NA9L 4GKSA 4YUEL 1MVFA 3S4SB 3W9EB 5F3HB 4WY7H 4ZS7L 1ES0A 3KPMA 4QXTB 1WICA 1MAMH 3RVWD 3ECBB 3FFCE 3KYMB 1AR2A 4KHTH 1Y6MR 3MLTB 1VACB 1QQDB 1I9JL 2VLMD 2A0LD 1KCVL 1C5CL 4L1DA 5KVDL 2E27L 4X8JB 5MEND 2XN9B 3BGFC 4HX1B 3U7WH 1IE5A 3WNPA 3C2SA 3QHTC 1HHGB 2D0FA 3MLSL 4RFEB 1G0DA 2FH8A 3RI5F 3CLEH 4G6AC 4LSQH 3SKMA 4L8CB 5HYJD 1I9RL 3U30C 2KZ1B 3VXMA 4QRSA 1FAIH 2R2EA 3BO8B 4PGEA 3DGGA 1I85C 4LQFL 4ZUTB 3RBGA 1K5NA 5CUSH 4GAGH 3REVA 1CD1B 1T0PB 5A2LH 3OBAA 5IMOA 4XPTL 1NJ9B 4LVHB 3MMEA 5ACMA 5BZWA 3STLA 1T83C 3OB0H 5IMLA 2M1KA 3MR9B 3SCMA 4OLYH 1UACL 5GJSH 3L3KB 1ZT1A 3STBA 3P11L 5F1SA 3AREC 3ETBF 3P4MA 3MO1A 4P9ML 2GTWA 4P5TD 5D72H 2BSTA 5BRZB 1R3IL 2OP4L 1F90H 4JKPH 3KS0H 1EXUB 4NP4H 5IJKC 3O6FA 5F1IB 3RWCB 3VFWA 5ALBL 3MA7A 4CADA 4YHZH 3WNKA 1DSFH 3KPSB 4H20H 1KB9K 4ODHH 2Z35A 3U4EA 2OJEA 1ED3B 2ZJSH 4WNQB 3ZKXC 3UCRA 3AGVA 1W0YT 3V5DB 2B20A 1BREA 3LY6A 2YA2A 2NY3B 5F44A 1RULL 3RAJL 1IC7H 4Z7WA 2KH2B 1FJ1B 3R06A 3T0EA 4JHAH 1RHHA 4D8PA 1OD9A 1NCUA 4H26B 1CFTB 3IFNL 5ICXB 3AAZA 4MYWB 1T7ZA 2KBGA 1IKFH 1T2QH 1LD9B 5BVJA 4LVNB 4L4VE 4EIZC 3PQYB 4FFWD 3HG1A 4YPGA 3S98A 5GGSY 4NQVB 3E8UH 3QCTH 4ZOEA 5I19L 1D5MA 3DXAB 4IIQA 2XZCL 1U8KA 1BQHG 4QRRD 1UB6A 1VADA 2QL1A 2G9HB 1RIVL 3BUYA 2P1YA 3T4AA 4DVBB 2FX7H 1LO4L 3NTCL 3RX7A 1YMHB 5GS0C 3M1BA 2Z31D 3VRJB 4AEHH 3HC3L 1KXQE 4OCWL 3DX9A 1YEGH 3MLRL 3GO1L 3HAEG 3H7BA 3VW3L 5D1ZB 1NC4B 4DVRL 4OI8A 3QJHB 1ZA6B 4FQHA 4XP1H 5DJXA 4APQA 1U8JA 1SY6L 4HWZB 3MREB 2VNCA 2AERT 5D6CA 5C08B 1RZJL 4FQIL 3OZ9H 4PRAB 1MAKA 1T1ZA 1FO0B 4LCWB 4GBXD 3TCLB 5BV7L 3L3GA 5E08H 5B8CA 5EBGA 2J8HA 2JJUA 5MHSD 1BBJB 5D2LE 4J4PD 3LVEA 3G6JF 2JB6B 3UAJD 4YK4B 5GGSB 1A4KA 2EIEA 5DT1H 5HJ3B 4HC1H 4PRBB 1AHWA 4KQ4L 2I9LA 4F58L 4BZ2H 4PJ8D 2VB5A 5D1XD 2IPTH 1O7VA 1UKSA 4Y19D 1GC1L 5K9QI 4LEOB 4WFHE 2HP4A 3S3SA 4PYHA 2YXFA 5MERA 4DWHA 4MAYA 2VDNL 4Z5RA 15C8L 4MD4A 1CFNB 3RA7H 2VDML 1A1NB 2ED8A 4PJEE 5FCSH 3OKNB 5DJZB 3VXUA 3KPLB 1KXTB 2C5DC 1ZHBA 3L3IA 3ZHKA 4PRNB 4UOW1 5GSVA 3EOBA 5AZEH 1BLNB 4PREB 3HUJF 4E41E 3ARUA 2VERN 3EIFA 4WO4C 2DLFL 4ZDHA 5JDSA 3R0NA 2EIDA 1PZ5B 4GRWE 2XZAL 1UM5L 4XC1H 3T2QA 1QZ1A 1KEGH 1UZ8A 1VFAA 4LCYA 5JPMB 4O2CB 1NKOA 4Y4HB 1JI1A 2GJZA 4DGVL 4MDIB 3KYAA 4O02H 3LEYL 4XMKL 5IM7A 1TVBB 2Z91B 4LLWA 2GJ6A 5BJTA 3V79C 4JG1L 1AO7D 4U1SB 3NABL 2HRPH 5A2IH 5E03A 5E2TL 3D3VD 3SPVA 2WWMC 4IRJC 3F7RA 5GS3A 5F71A 3I6GB 1E4KC 4OZHB 4G6FD 1YPZF 5E5MA 5D7JC 4OLXL 3WFHA 4OZFB 4KY1L 1NGQH 4CN6A 3N0PB 3R4DA 2OMNA 3VFVB 1YY9C 1HIML 2E6PA 1A6VL 1XGQB 2B4CL 2ADJA 2RJMA 4XP9H 5SWSD 5MENA 1S9KC 4HULB 5CEXA 4EVNB 3VGBA 5FUZH 5KBNC 1LDSA 4HWEH 3HTLX 4MB5A 1QR1A 2ICWA 2NX5B 4FQQA 4M7ZC 3QDHA 2J4WL 2QQQA 2IAMB 4G8GD 4Y5YB 1JWSA 1V7NH 2VQTA 5JO5A 1DQJB 5IB3A 1UH2A 3C60A 4UOW0 2Q7NA 2WUCL 2IGFL 3H3BC 5A16A 1YEIL 2QR0A 1IARB 5F7FA 3HRPA 1DCLA 3OQ3B 3O2WH 3HNSL 5EWIL 2YD9A 4ISVB 4ZUSA 3SJVE 1OAQH 2QADC 4MAUH 3RWEA 3O3AB 5DFVC 2R8SH 1AD9B 2MFNA 1FSKC 2C4FU 2WIMA 4PJ9B 2CPCA 2WWKT 2NMSA 3W9DB 2ZUXA 1UWXK 1S7QA 1M71A 1TFHA 4GAJL 4H8WC 1NCTA 5IGXH 4CVZB 5JZ7C 4XMPL 1WFUA 4ETQB 2X5PA 4TUJA 4Z95L 5EN2A 5DMGD 2FRGP 3D25B 5F7YC 1XH3B 3UC0H 5DMYA 2FBJH 1OGAE 2MTPA 4XMLL 4WTWA 5J8OA 4RZCB 3GMOA 2X7LB 1NDMA 1MWAH 1HDMB 1OSZB 3K8LA 2V2XB 4LBEB 3ZTJH 3PGCA 1ZLWK 4NHCH 4L8SC 4RWYH 2G75A 1XF5A 5C0AD 2NY5C 2DD8H 5FYJH 2OCFD 3QIBC 5IFJB 3H2WA 2MPAH 4MCZA 1XGUA 5FM8A 5IF0A 1FNFA 4UQ3A 1M1SA 3AB0C 4P48A 4XPHL 1WGOA 3EYFA 4ZAKD 1EAJA 4NKMA 1CZ8H 5A3ID 2NW3B 3FOMA 2ZUQC 5IWLA 3ZKQD 3JUZA 1H0DA 4QTIH 1IT9H 2P44B 1M05B 3T2NH 2WLYA 5ICYA 4JFFA 2EYTB 4QRRA 4QY8B 4DN4H 3QQ4B 4PJ5A 1JHTB 5EOCJ 1LE9A 1V3MA 1IKNC 3IJYB 4F7CA 3G5XB 4MS8D 3WJLA 1OP3K 3GJEB 5F3BB 2Z31A 3CSYA 4ZTOH 1MLCB 2YKLL 3C6LD 5F21B 1G84A 4OCMC 5HHQB 3BSZH 4I4WA 4PV9A 3EFFA 6CGTA 4LSSH 4YFLF 1NCCL 3DVIA 3QAZB 2I5YH 4IRZH 3VRIA 3W2DH 1J5OH 5T1KB 3CFBA 1YC7A 1BVLB 2BOCB 1T0MA 3FONB 1LILA 4UV4H 3SDAC 3MROA 4PIRF 3BAEL 4LAJH 2APTA 4PGDB 4X7FC 4NQEE 2C7UB 4FQ1H 4LKCB 4J4PA 1FV1A 1MF2L 4O4YH 5EC1A 3QRFM 2IQ9L 3S34L 1P84J 5L7XL 1CLYH 5FO8A 4LSUH 2DJ4A 4D0DA 5J12C 3VJ6A 3R0MA 4JHBA 4XTRC 3SKNB 3UROR 3WFCH 4LOUD 1VKXA 3ROOB 4WV1A 4ZNEA 4ODTH 4IRSB 5DHVH 4K3JL 2DQFB 5D2LF 4GRLC 4DEPC 2V5RA 4K23L 5FHBH 3KYKH 3UZQA 1R3JB 5IESL 2EYSA 1UWEL 3E6FA 2H8PB 5FYJD 1KN4H 5INCA 3HS0A 2DQTH 3LS5H 5ID1B 3FHAA 3RL2B 4WHYH 1EHAA 3FT4A 1Z9MA 4GAYA 3I6KA 3BDXA 4XAKD 5HGHA 1IC4L 4AMKL 1OGTA 3CZJA 2QSCL 5ISZB 2P5WD 2R4RH 4HJJL 5KN5A 1V3LA 3U4BH 5JW4M 2DYPD 1B0GA 1FSKB 4XP6L 5BW7C 2IG2H 1JPST 4HXAL 4RGNB 4U1LA 5EOTA 4PJGA 3AMKA 1S7WA 3D2UD 1YEKH 4XBEH 1V3KA 4LHUG 5SX5H 1OAXH 4S1RL 1H8OA 2DMCA 2IADB 4U6HB 3HMWH 5E2VH 3OGOE 2Z4QB 2NLJB 5IFAH 2A74B 2VZ3A 1AO7A 1F4AA 5ERWA 5C07B 4JFXA 1QHPA 3RZWA 4XNQA 3D3VA 2F54D 1EEUA 4GRWF 1JF1B 1FRGH 4HGMA 5DC0A 5F9WC 1DBJL 4D0CB 1A6AA 2Q6WA 4DAGH 1EBAA 4L8SB 1J86A 1HXMA 4QTHA 1DQTA 3LD8C 1JZ2A 1YNLL 5FF6B 3I75A 5DD0L 1UJTA 5J6GA 4N9GB 5GIRB 4U33A 5H2BA 3ARDA 1INDH 1KPRA 1S7VA 3GI9L 3I50L 4TSCL 4X7EC 3ZT6A 2YSSB 2HLFD 2BOBB 4NT6B 4PGBA 2ZUQB 1IGMH 5SWSA 5I1DA 4HC1A 3IVKA 5I8CA 2HJKA 4XWOC 1MIEH 2OI9C 2HT4D 5JHDE 4JZNB 2GI7A 4KRPB 4X4XA 4Z9KB 3OKMA 3DI2B 4N5UA 3T4YB 4KDTC 4O2EA 1ZE3C 2DQUL 3RP1A 5KW9H 3QA3A 1VERA 3SO3B 4JO3L 2YPLA 2IFFH 3LQAH 1T4KB 4JM4L 1KIPA 4KU1A 5DF0A 3QXDB 3VXNB 1Q72H 1XCTA 4HHAA 2DTMH 2J12B 5F7LB 3VA2C 4EDXA 2OJZH 1EBPA 1QBAA 2XPGB 4DZBB 1IEBA 4OT1L 3RNKB 4RGOL 5CAYB 3LH2H 4X7SL 3EJYC 3B83A 4PLKD 2F58L 4WJ5A 1K8DB 3OF6D 2XI9A 3PWLB 4BSVB 25C8H 5IEHB 3SDAB 1OQOA 5SWQB 4U6YB 3ULVH 1A1MB 5C0NC 4LRNL 4JREC 1RUPH 2H6PA 3BPLC 4Z18A 1T22A 4MA7L 4UU9A 5JHLH 5K93A 5CWSB 3W0WE 5KANG 3K8KA 4NRZA 1JL8A 5EU4A 1JV5B 3OAUL 2YR3A 1QBMH 3LRHA 1HHHB 2FJHB 5CJOH 1A14L 4PJDA 2AEPH 1L0YA 4R26H 4OIAA 2YA0A 2VLLA 3O3BB 5HVGB 3VFRB 4LSPL 1UKTA 4QRQB 3STZA 4DEPB 4L4JA 4M1GH 1KT2B 4NNXA 2QQKH 1MQKL 3QQ3B 5B3JE 4QWWC 5A40E 5J9PA 4XRCA 5BQ7B 4LCCA 2FGWH 1UQSA 4M9OA 2A6DB 1I1FA 2QQNH 4JRYE 2MOVA 4LMQE 4I9WE 5I1EH 3WLBA 3DBXA 2BDNL 4IMKA 1OW0A 1J1XL 1MCPL 4YNYB 1K8IA 2ESVB 3SOBH 5A2JH 1EIBA 4XCCH 2DQDH 3GBNH 4ETYA 4Z7UE 1NEZG 5FYKU 43C9B 1IGYB 3HB3D 3ZZ1A 3C6SB 3QG7L 2OX5A 1FH5L 4UDTA 2J2ZA 3TVMB 4NKIL 4J1UB 2X4OA 5CEYA 1MCBA 4Y5VA 3A67L 3BKJH 3GSWA 4D9QE 4JVPA 4PJIE 5L88H 3WUWB 4QCIA 4KKAD 1D5XA 1NAMA 1WCBB 2YA1A 2DIJA 5I15H 2FO1A 5L2JA 1BM3H 1F02I 1L7TL 3GM0A 2A6KB 4PY7B 1II4E 5HHPB 1MI5B 5F96H 3WN5A 3FCTB 3BIKA 4PJBE 3SE8H 3DYOA 3LD8B 4JRXA 4P4KC 4RAUA 1HSAB 1OAUH 1F3JB 1H3TA 4LCIL 5DHYA 3ULVD 4NIKB 4OCNC 3GHBH 4C56B 1KCRH 3HE7C 1GGTA 4MQXD 5HYEA 3IDXL 3V0WL 2X1QA 3WS3A 1RZJC 1JN6B 4QOKD 3B9EA 3TT3H 1G7IA 3QEUB 1A7PL 3MGAA 5D7SL 2UWEA 1CLOH 2N1KA 4GW5B 4AEFA 4YHMH 2CIKA 4PJXE 3QRGH 5MP6H 3S96B 1AXSB 1NCDH 5CD3B 1FBIH 1IGIL 3ARVA 5DC9B 3VXRB 1ZLSL 3S37H 1E4XL 5IW1A 5FKAA 1MVUA 3OKYA 5HGDB 4F80A 1N6QL 1Z0MA 3E3QC 2WINA 1IRAY 2MKWA 4RMTA 1N64H 5HGBB 4GH7B 5T3XH 4PJCA 3W39A 1T2JA 3MJ9H 5I1KL 3OKEA 2P5WA 4X6BB 3P2TA 4W6WB 1JMXA 4RFOH 5CHNB 3QYCA 4Z0XB 3V52L 2HVJA 3LSOA 2HJLA 4JREB 3RJQB 4JJ5B 5FO9A 3BPLB 4G9FB 2LV4A 1FNGB 2RFXB 2FATL 3U7AA 4U1MB 4AH2B 3MRHB 4IOFC 4U1HA 1R3KA 1RURH 2FJFB 2R4SH 3PWPE 5JMOC 3QUXD 1AXIB 1EFQA 1Q9KA 4Q9CA 1IJ9A 2Y36L 4Z76A 2F54A 2FNBA 1YEFH 2BNQB 1I7RA 2VXTH 1F2QA 1T7WA 1C8PA 1DVFC 1MFEH 1CQKA 4OV5A 3HE6D 4NN7C 4ONHA 2RBLA 1FVEA 1Y6NR 2Q3AA 4KKBC 1DUZA 3RZCB 5D5ME 3UTSB 1WCQA 5IQ7L 4CN4A 4G8EB 1A6WH 4HFUL 3RTQC 3JVGA 3WSQH 5D7LD 3MRIA 3BW9A 2VLRE 2EYRB 3TZVA 1JPSH 4QXGL 4UNVA 1X3DA 1P2CA 1JFQL 1AGFB 1U8PB 2I60H 3AMLA 4G7VL 3TJEH 1ZLUH 2XTLA 3PHQA 4UQ2A 4OV6F 2DWDB 3BHBA 2CH8A 4XWGH 5EU5A 3RPIB 3MOAH 3RNQB 3IAQA 3HR6A 4FXGB 3GUTB 2HFFA 4LAQL 1CICD 3C08H 4I3RL 4U31A 5DHVA 1I1YB 1IGFH 5FYLL 4POUB 1R3LB 3KPRB 4NJAL 3AXLA 1NLDL 4G3YL 1ZHKB 3IB4A 5A1AA 1FL6A 1ONQB 2XXMB 5DJCA 1EV2E 4UV7L 3AY4A 3D85A 4NKQB 3BWAB 5C9KA 2YD2A 2WBJD 5DI8A 2CRMA 4ZQKB 1QSED 3HRZB 1UT9A 43CAA 5T3XD 1BOYA 3IF1B 4X4MA 3VMNA 4KVCL 3VXQA 1BD2D 1ZANH 2X70A 3FQNB 4HS8L 3X3FH 1ZS8B 1LNUB 4G42B 4P4KB 5HYSG 1PKQB 1XFPA 2GY7B 4Y2DD 2X4UA 4JANB 1P1ZA 2EEDA 4PJ7E 1ZSDB 3AC0A 2HT2C 3HE7B 4RMUA 3SEPA 1AFVH 5IHZA 4PS4L 4JM2D 1LP9E 5BV7B 1X5LA 4P3CH 4E5XA 1PG7X 2D31A 5T1DL 2VLJB 5JOFB 5EA0L 2XRAH 4D9RE 2VQ1A 1HH9B 4R2GB 2W91A 3GMQA 3SDCC 3SDDC 4L4TB 1QRNE 3QHZL 4DJMA 4EBQH 3P40A 4FZ8L 5DRXA 3NCFB 2ZG3A 5DR5L 4O00A 4C57C 2BVQA 4ERSL 1F8TH 3FB5B 3DARA 1HQRB 4DKFL 3P0YH 3FQTB 5KG9A 1MHEA 4PG2A 3WKNA 1XIWC 1A4JA 3IJHA 4PRDA 1XAUA 1BQUA 1X5GA 3QG6B 4PJHA 1JZ4A 2A9NH 1PSKL 5C3LD 1W2KT 4OZGB 1FVDA 5B3JF 2VXUL 3UPRA 3VGHA 2RR3A 1KENL 4OAWA 4OUUA 2CLVB 1KPVA 4YXHH 2X4SB 1NC2B 2IC2A 5GZOC 5J7CC 4JO1L 4LSRL 3WXVH 3FZUD 2CLRA 2MHAA 2R29L 1YNTB 2J88L 3F7VB 2YPKB 4TULH 2XN9D 3BT2L 5D70L 3SGJC 2UVFA 1I3GL 1CXEA 4MD0B 1ITCA 1QRKA 4QRPE 3WXWL 5J6HB 1DVFB 2IQAB 2W0LA 3TLRA 2CUHA 1ZWIA 2W1NA 4RGMB 4M1DL 4Z7UF 5DZLA 5HHOE 2YHGA 4P46A 4RA0C 4DTGH 3MBXL 3RVUC 2Y7QA 3KLHD 4PRHA 4HJ0C 2DQGH 4P59H 5ESAB 1DLFL 2CK0L 3RTQB 4Z78B 4NM8L 4HS3A 5E6YA 5DJ6B 5J1AB 1CE6B 4KJQC 4PJIF 1IFHH 1CBVH 1ZTXL 3RUGB 4LLDB 3WIFB 5EUOE 4O9HL 3UDWC 4QOKA 4M7KH 3I9GH 5GZNC 3RWFA 5JUEH 1INEL 4GQ9L 3LKSA 4XVSL 3ES6B 1FO0H 1AGCA 1GL4B 1CGYA 1QFOA 4PJBF 3P73A 3ELAT 4DFIA 2EDLA 5BRZD 1LK2B 3FTGA 2AXGA 5CEZE 4W68A 2XQYK 5EZJA 5DHXB 2C9AA 1UENA 5HYFA 3QIWA 3D39E 4HQQH 4KI5C 1JNHA 4KTEH 5F9JB 4N8VB 1HINL 4HD9A 3VFGL 3D9AL 2NZ9C 3GSOA 3PABB 4FABH 3VCLB 1RUML 2B1HL 3ARFC 1N5AA 5JORB 2O93L 3A6BL 2VDPL 2NY3D 3H9HB 4PJXF 3WFZA 4KMQA 2F19H 5CD5D 3GNMH 4Q0XH 3C2AL 4V2BA 4UTBL 1BIHA 4JFQA 4N0CC 4WWID 5FCUL 4L29A 1BQLL 2BHZA 1QTYT 1A6PA 3PQYD 4UMGA 2NY7H 3IFPB 3KPQB 1MHPH 1YDPA 3MCG1 4BSWB 4E9LA 1VEMA 4JEGB 1TVDA 3DXAD 2VC2L 3RWJB 3BIBX 1FYTA 1ZA3B 1JNLH 3ARYA 3IDMA 4FTVB 1I1CA 4PUBH 3HE6A 1AR1C 4U0QB 2XWJB 3D87B 3NAAH 3KPNA 3B3IA 4OGAD 4RSVA 3QQNA 5HDQH 4PTUB 2HTKC 3B43A 4JKKA 3IXTA 3SDCB 3SDDB 5DMKA 1AE6L 1NKRA 3Q3GA 3ZHLA 3E6HA 4GMTL 4FG6D 3ZHDA 4Z7WE 1DL7H 2AJSL 3FQRB 1HILA 2FR4A 3HZVA 1QBBA 3T0EE 1RZ8A 3MCLL 1FL5B 1NC4D 3MXWH 1A1OA 4U6XA 2HMID 4CL7A 2ARJB 3QO0B 4KJYB 5D5MF 3EDJA 4M8QB 2OTPA 5C08D 1RMFL 2VXQH 3HG1E 4LEXH 4J8RB 5B4MC 2VN7A 4OZFH 1DANU 1P7QB 2HLAB 3ZDXE 4LCWD 4KK9C 2P46B 2HG5B 5D71L 5TQ2H 5MEQB 1F11A 3B9AA 3FRPA 2GAZA 2ZNXA 4NFDA 1LO3L 12E8L 4XC3L 1T03L 5E0QA 4KJWC 1I4FB 2WMPA 5AD0B 3WEXB 3VGAC 2PYEA 1CE1L 5FUCE 3BQUA 1H3WM 3OKLB 4MHHI 4O51B 1MJJB 3X12B 3QUMA 2XWBB 3JWOL 4ODXA 3P4NB 4G6AD 4NJ9L 5GS0H 1BD2A 3MJ9A 2J6EH 5AWNH 2PYFB 1DE4B 3TV3H 3PHOA 1S7XB 1MFAH 3IDYC 3QUYA 2MCPH 3RVTD 4JPIB 4KKNA 3ZYOA 1BP3B 1F4YH 1R5IA 2APBA 2XV6B 5JOPD 5B38B 1EHLL 1TCRB 1NQBA 3IDUA 1N8ZB 3OJDB 4JM2A 4YQXL 2DN7A 4JB9H 1WBXA 4FS0A 1FZOB 3DO7B 5IBUG 1KPUA 1A6ZB 4ZSOB 4PJ7F 3DTXB 3MCKB 2ICEB 4NZUL 3S9DB 4JG0L 3CXHK 1KGCD 4WI5A 1TETL 3QO1B 4WU5B 4HK0A 5FYKE 4CMHB 4F7MA 1LP9F 4XCFH 4GG6B 1QSFE 3ARFB 1U6AL 3K2UL 4LVEA 4I2XB 4WI7A 4Y16B 1JPFA 1A9EA 5M95B 3THML 3S4SA 5FGRA 5F3HA 3SKJH 3UTPE 1A7RH 1MH5A 2X89A 2JK5A 2OL3L 4S1SL 1OTSC 1FVCA 5HHME 3KYMA 1EFXB 5GGTH 2CMRH 3VWKC 3MLTA 1QQDA 5FYJU 1PZUB 4NO2B 4UT7H 1MJUL 4X8JA 3VDCA 4Z8FH 4U1NA 3MRFA 1Q0YH 2JB5H 2NX5D 1HHGA 3E0GA 3G6AB 3WDIA 4RFEA 3EAKA 3DV6A 4PBXA 2D7QA 4NFCA 2IAMD 4NN5C 3SBWA 4L8CA 4M93B 2I27N 2ZCKH 5FA4A 3BO8A 5GS0D 3PDGA 2OM5A 4ZUTA 5GGVH 2NZIA 3Q6FB 4XXDB 5JA9A 4ZPVB 1NJ9A 3EYUL 4FHBD 5LBSH 3TIEB 3IRZA 3U1SL 1JTTA 2FEDC 3LQZB 4WWKC 3CVIL 5K33A 3L3KA 4ZD3L 3LKQB 2ID5A 1DEEB 1ZXQA 2E8YA 3UTTB 4YHPA 3SE3A 2VLME 4TVPH 4CVXB 1EXUA 4PJ9D 1G9NC 5EPMB 3RWCA 3GK8H 1H5BC 5KZCD 4GW1B 1MY7A 3O9WC 4P9HH 5E6ZA 3KJ6L 5EU6B 3KPSA 1X4YA 5I71B 5EUOF 2APXA 5HYJE 5DUML 4WNQA 3TBWB 3PHSA 1ZLVK 4JQIL 3V5DA 5IVXA 3EDKA 3QWRD 2BRQA 5BVPL 1KUMA 1UEYA 2UZIH 1RU9L 1B9ZA 1KC5H 4Q7DA 1FJ1A 4S1DC 4M6AA 2OTWB 3PGFH 5CINL 4H26A 1CGSL 1CFTA 4OCXL 5ICXA 1T6VN 5JW4R 4M61B 2D7TL 3IDYB 5CSBA 4P2OB 5TDNA 1YEHL 3T3ME 3AM8C 4D0BB 3PQYA 5DVMA 2O5ZH 4K3HA 4WY7L 3PDOA 4NQVA 1Z5LA 1QPXA 2AVGA 1D9KB 2OR7A 3GJFA 4LLUA 1XF2B 1JWMB 5HHVH 4KHTL 1N59A 2ARWA 2P5EB 4ZOBA 1A6TA 1CK0H 5FOJA 2YMXL 2MKLC 1YECH 4HUXA 2BJMH 2G9HA 4V1DA 2DQHH 4AZ8A 3BKML 2ZPKH 4FQCL 1YMHA 2PTUA 1CYGA 4UDUB 2P24B 2NY4C 1GGBH 3VRJA 2GW5A 3WS6C 1M6OA 4FQ2L 1YMMB 3MGOB 3DSFL 5C1MB 3NFPA 5D1ZA 1NC4A 2EDJA 4GAGL 3QJHA 4Y4FB 5HI4D 3M8OL 3MXVH 3MREA 5T1KD 5F9DC 2FJGB 4MB4A 5C08A 3CD4A 2C3XA 3S6CA 5FGCE 4OD3L 1CVRA 1FO0A 5GJSL 3TCLA 1L7IL 2A9MH 1U2CA 4FQPA 3UTZA 1BFSA 1NPUA 2YWYA 3IETB 4TVPD 2R1XB 4Z7WF 3NCMA 4IDJH 2FLBT 3MV7B 4XPBL 5GGSA 4QRRE 4ONGH 4U1KB 2W65B 2X40A 2QQLH 4DOHB 2EO9A 4CNIA 2AV1B 1V3JA 5I74C 5DMIH 4LEOA 1OM3L 1QYGL 4H20L 4Y88A 3ZDXF 3QEQA 4IRSD 4V2CB 3JXAA 4POZC 5JQ6L 5KS9E 5K9QG 2X4PB 4AM0B 1CFNA 4XNZC 2W0PA 4LPTA 3MRPA 4BK4A 2QKIA 5EORL 1OAZH 1T89C 5DJZA 1RUQL 1UA6H 4NC0B 4YHIA 3BKCH 4PRNA 1EUUA 2Y23A 1DBBH 2Y4SA 1BLNA 2NY2C 4PREA 1GYAA 2DKUA 5FDWB 1GAFL 2APVA 3NFNA 3HC0B 5MHSE 1LEGA 3QQ9C 2X1WL 4N68A 5ITBH 3SGEH 3WL9B 1PZ5A 3D0LA 2DKMA 1VFUA 5ISZD 3IGAA 5ICZB 5DFVD 1J87A 2VDRH 4LL9A 1KXVC 1JRHH 1BFVL 4RGND 4Y19E 4M5ZL 3KXFE 4O2CA 3MA9L 3QEGH 5I1CL 3L5WB 4LGSB 2XA8L 4Y4HA 1FLRL 1EEYA 9CGTA 1WK0A 5JZ7D 3L1OH 1IQDA 5AAMA 1JWUA 4MDIA 4ZNEE 4O5LL 4X6EA 1TVBA 3L9RB 5FM4A 4L9LC 4RMQA 1G1YA 2G60L 5C07D 1QVOB 4QRTB 4G8FB 2EEBA 1FG2B 5GHWL 2WUBL 3ARXA 4HPOL 3HNTL 5IT2H 4JY4A 4U1GB 2ZOKB 4LP5A 1SMOA 2DWEA 4JHWH 4JPKL 4J3WA 3MTRA 5DJ8A 4L9DA 4D94A 2AJ3B 4OZHA 2AK4A 2AABL 2KUTA 1Z0NA 2Q76B 3MJ8B 5FAAA 4D3CH 3SGEI 4ZTPL 3QIBD 4LARH 1U8OB 4OZFA 4FQXC 3RIAF 5DFTA 3U9PL 2F5AH 3VFVA 1JRHI 1HCFX 1HOCB 1WZKA 2FB4H 5I75C 2ICES 4JPWH 1XGQA 4UT6H 1BBDH 1YJDC 4UUJB 4EVNA 4PJGE 2DL2A 3HLAB 3BKYH 1DBML 1FDLH 4YBLC 4KRPD 3WFEH 2FYYA 2DLEA 3UYOD 4N0FA 2H3NB 2IANB 3CNKA 4KPHL 2IAMA 3ARTA 2NNAB 4Y5YA 1AO7E 1T3FB 5IB1B 2EDTA 3D3VE 1YQ2A 3PJSB 2NY4B 1DQJA 1XF3A 4QF1A 5KSBB 4GJTB 2FHCA 3OSKA 5D7IB 1ACYH 4HDIB 3RA7L 3MLXL 1RV6X 4BQBA 2H2SD 1QFHA 1FZJA 4P3DB 5BMFH 4XB7A 3BVNA 1G9ML 5DUPH 4URTB 4ISVA 3V9FA 4LRIA 3H7LA 3MUJA 4LNRB 1AD9A 3DOSA 3MACH 3SDAD 1MCSA 4PJ9A 5SWSE 1A6UH 4XX1G 1IZKA 4N0YH 1RZFH 3W9DA 2HKFH 4I3SL 4NKOB 4KK8C 4CVZA 3ZDZE 3TBVB 1JIBA 1KEGL 1YYML 2NYYC 2AQ3A 1Q8MA 5F7DB 4G8GE 3SCMC 3NA9H 2ZG1A 5D2NE 4F37F 5JIKA 3D25A 3O41A 4ONFL 1XH3A 2HTLD 4XTRD 4ZS7H 3QI9A 4WDIB 4JDZB 1DQDH 2X9WA 3Q2CA 4M48L 3GZKA 4ELME 4RZCA 1GIGH 1OCWL 2PO6B 4O02L 1KIQB 1WISA 4JDVB 3LRSA 2V2XA 4Y4KB 1I9JH 1C5CH 2OBGA 3O6FC 3LHPL 5E95B 3VFTB 1AIFB 4QRUA 1QOKA 1MCHA 3LPGA 4DGYL 5IFJA 2F8VA 1HCVA 3MLSH 5DJ2B 5HGAA 2F74B 4F9PA 2NY2B 1JNNL 4NZRL 1Z2KA 5IK3B 2NW3A 1I9RH 5IVZB 2F9BT 5GGTA 5SWZA 1A2YA 4LQFH 3HFML 4HWNA 4X6FA 2ESVD 3Q6GL 4YBHA 1JHTA 4XPTH 1MHHB 4XP9L 3T0EC 2VN4A 5EH1A 5J1TC 4ELKA 1QNZL 1TTFA 5F7HA 4JFDB 3VWJB 3IJYA 4H1LG 4K9EL 2IBZY 5I66A 3NCEB 2ARJQ 3G5XA 3T3MF 3P11H 3GJEA 1ZHNB 1MLCA 4P9MH 3FT3B 3IU3B 5EBWB 2CDFB 2J8UE 1R3IH 2MJWA 1UB5B 2OP4H 4L9LB 1OVZA 5C0AE 1RQ5A 4IIQC 3ZTJG 3W82A 5ALBH 4HK3J 4X9BA 2LTQB 4MJ5B 1MI5D 5T1KA 1NAML 1VPOH 1BVLA 3RGHA 3Q5OA 1CGTA 3FONA 3C5JA 3WNLA 4AIXA 4YIQA 1CIDA 4YDLC 2WP3O 4XNUL 2IH1A 3O2WL 2C7UA 4LKCA 1X4ZA 1N3NB 3BEVB 4I13B 1KCLA 3TGXA 1RULH 4GXVL 2R8SL 3CK0L 4C56D 5I75B 1OF2B 2LU3A 3CVHL 3IFNH 5AYUL 4X5LA 4APQC 2VSDA 4YBLB 1AP2B 5KOMC 1I3RB 5TGBB 4LPUA 4MA8H 1JUFA 5B21A 4GKSB 4OCYL 4IRSA 5B8CC 4LPVA 2DQFA 1ES0B 5I19H 1W72L 2XOTA 3MZTA 1A21A 1I8IB 4YDIL 1R3JA 4P5MA 2XZCH 5E6IB 3VXRD 1AHWC 3G5YB 1RIVH 5HXMA 4Z7VA 2DD8L 2HA1A 3RL2A 1LO4H 5E5UB 4LHQB 1NUNB 1N0LA 1TTGA 3HC3H 4OCWH 5KS9F 3EJYD 1CZ8L 4MAYC 2AXHA 5ISZA 2P47B 1WTGT 3VXMB 3MLRH 2R2EB 3GO1H 4GMSL 3DGGB 2CSPA 5ANMB 5C0ND 3WKML 4NUJB 4DVRH 4QO1A 1R24B 3P9LB 1UJ3A 4G9FD 3WJJA 5K9OB 5DVLA 1TZHA 3V0VA 3STLB 5BZWB 4FQIH 5IMLB 4U6HA 2IADA 3SCMB 5C6WH 5LXGL 5BV7H 4PP1D 2EZ0C 3K74B 2PW1A 5C07A 1CDCA 4PR5A 3P4MB 1A7QH 1JF1A 2BNQD 3SHSA 4KROC 1QD0A 5FYJE 2I07A 3C5ZA 4KQ4H 1EUTA 4F58H 4P23A 1JHKH 5CJQH 3UJIL 3RZCD 3F6IA 2NXZC 3MA7B 3UTSD 2VLKE 1GC1H 3RVXD 2H1PH 1ERNA 4XAKE 1J5OL 4N9GA 5GIRA 1X5IA 2Z35B 3OR6B 1R5WB 2P5WE 2YSSA 3EBAA 2PUQT 1SJVA 2OQJA 2BOBA 4UV4L 4NT6A 1SBBA 2VDNH 1KLFA 2VJXA 5IB5A 15C8H 2WW8A 3CIQA 4I0PA 4Z7OE 4TVSa 2VDMH 1ZOXA 4JZNA 2JCCA 4PY8J 4QHMB 5T5FL 1RHHB 1TVHB 2LFGA 5IEKA 4EJ1C 2Y5EA 3GJFK 3RIAK 2C1OB 1BF2A 5BVJB 1FNHA 3VI4E 1T4KA 4CU8A 3KPRD 1YPZB 2Q20A 2XZAH 1UM5H 5E7FA 1XF1A 5FHBL 3KYKL 4GUPB 4PJGF 3X3GL 1CXKA 3KGRA 4ODUB 3T2OA 2DI9A 1U8KB 1X7QB 5L2KE 5L8JB 2XPGA 4DZBA 1VADB 1A22B 2DQTL 4DGVH 3BUYB 3LEYH 4XMKH 4BSVA 3PWLA 1X6NA 4JG1H 4GKNB 5SWQA 4TN9A 4U6YA 1IC1A 3BWUC 4YDLB 4P4KD 3NABH 2AXJA 1QSVA 4NQUA 3C60C 2CIIB 3MNWA 4AQ1B 5DA4A 5CWSA 4B41A 5FOBB 3HE7D 5HDLA 3H7BB 2PKDA 1QP1A 2WV3A 2F5BL 5CLWA 1HHHA 4FQHB 1SEBA 2FJHA 4APQB 1U8JB 5F9AC 4KY1H 1ETZB 3KLAB 5D6CB 5EO9B 1D5BB 1BJ1H 1RJLB 4XNXH 1I1AA 1T1ZB 4H0IA 3O3BA 3VFRA 5IFAL 1OD7A 3L3GB 5B8CB 2VLJD 2R0WL 5C0CB 5L9DL 4AL8L 2DLGA 1A6VH 2B4CH 1KT2A 3DI3B 4R2GD 1JK8A 5IIEB 5LJYH 4PG9B 3ZDZF 3BDBA 3WHE1 1A4KB 2YD3A 1F13A 4L4TD 4QLRA 1AHWB 3BESR 3SDXE 3EFDH 4HT1L 3FB6B 3ZKMC 2J4WH 2JJVA 3MGTB 1H3VA 4XP5L 1P69B 2DLHA 1JZ8A 4ELMF 2GSGA 1INDL 4WUUE 4UIKL 4YNYA 3KHQA 4XXCA 2PNDA 4Z5RB 2H26B 2NXYC 4BUGA 2CK2A 1CDIA 1MIEL 1YEIH 5JOEA 3ZL4L 3VXUB 3MLZL 3U2SB 3QPQC 5TDPA 3L3IB 3NCBB 4HUWB 5GSVB 2WBWB 3HNSH 4FFWC 5EWIH 3TVMA 1NC2D 4PRPA 3TNMA 5A2FA 3H3KA 5IWLC 1XR8A 4ZDHB 3L5XL 1OAKH 3LQAL 4KROB 1DVFD 3L3DA 1XT5A 5HHPA 3IKKA 2D03H 1WIUA 3FCTA 5I16B 2BC4B 4LCYB 4Z95H 2VZ1A 3WJLC 1HSAA 3RTQD 2Z31C 4XMLH 4EQ3A 3LH2L 1YUHA 3B2VL 3GSQB 4C58B 2J8UF 4KMTH 2VIRA 4NPYB 4RFNB 2GJ6B 4C56A 2D3VA 4LLAA 3DUSB 1A0QL 1QKZL 3SPVB 4F9LA 3OJVC 5C2BL 3TCXA 1ND0B 4TTGA 4J3UA 5FEBA 5IP4A 3QEUA 3F12A 4XPHH 2OL3B 3BMWA 5I8OH 4GW5A 4K7PX 5JXED 1YEDB 5I1GL 3WFHB 5CD3A 4KZDL 4J4PC 5EU7C 3RIFF 3CLFL 4L3EB 3UAJC 2D2OA 3QNXA 3VXRA 3WHE0 1KCSH 5EG6C 1U8HB 3BI9X 4YXKL 4M4RA 5C0FA 5J1SC 4KKLD 2AJVL 4M1GL 2E7HA 2ADIA 5CEXB 2QQKL 5C92A 5HGBA 2R9HD 1QR1B 4RNRB 4FQQB 1GOHA 5F8RC 1GCFA 3MX0A 1WSST 3MV01 2L0DA 2YKLH 3ULVE 4Q9QL 4WV1C 2ZG2A 4JCLA 4JVUA 5DXWA 4Z0XA 1NCCH 4KWUA 1B0RA 3FO1B 4PJAA 5EBLA 1WIOA 4QOKE 3MYJB 4JJ5A 4G9FA 3C60B 1FNGA 2EO1A 3X13B 4K2UL 2HT2D 4AH2A 3MRHA 3F58L 5A16B 4OIIL 5C09B 2QR0B 5C6PB 2FJFA 2UZXB 5DVNA 2PXYA 2K7QA 1MF2H 2BNQA 5E9DA 5BS0A 1FCGA 1OT1A 4FTVD 3RWEB 2IQ9H 4LVOC 3S34H 1J8HA 5TE4L 5L7XH 1GPOL 2D4DA 4JN1L 5E4IA 3RZCA 4X6DA 2Z93A 3UTSA 1S7QB 1BM3L 1RZIB 4NYLB 3OXRB 3SDCD 3SDDD 5F96L 1T1YB 4G7YL 5JXAH 4JO2L 3ARRA 3DVFA 2EYRA 5FUOL 5E2UL 4K3JH 1AGFA 4K23H 1U8PA 4BELD 4UI2A 2VZUA 3GMOB 1NDMB 5IESH 1UWEH 1IAOA 5CP3H 2VDLH 2DWDA 1XF5B 2NXYB 4TSAL 4MA3A 1RIUH 3RPIA 1FFQA 1P7QD 3RNQA 1MFNA 4GRWB 4MCZB 3GUTA 5IF0B 1BEYL 4DCQA 1IC4H 4UQ3B 4AMKH 3ARDC 1R3LA 2QSCH 1U3HB 3EYFB 1DFBL 1T0NB 4NKMB 1ZHKA 3FOMB 5GZOD 1NCDL 4JFPB 4XP6H 5CZXD 5HI3D 1H0DB 4Z7OF 1CGXA 4HXAH 3S37L 4OZIE 5ICYB 4JFFB 2I9TA 1KTDA 4PJ5B 5D7LE 1IVLA 4AIZB 4EIGB 3HRZA 3TWCL 1LE9B 4TQEH 4DUWA 2ICWJ 3FQNA 3QUML 3IFOB 1ZS8A 1OTUD 3QP3A 3VI4F 4G42A 4L3AA 4OGZA 3W81A 3KDMB 1MJ8L 1JMZA 1PKQA 3CSYB 4HV8B 4Y5XA 1DBJH 4JANA 4I4WB 5D7KD 1MNUH 1RIHL 3EFFB 1MCWM 4KJQD 3EOTL 3K7UA 3S4SG 4J3SA 2FDBP 1OWRM 3K4AA 3VRIB 1HYSD 1YNLH 5GZND 5DD0H 3O8XA 3BPCA 4UIMB 3GI9H 4TSCH 3I50H 3PGDB 2AS5M 1J0HA 2R4SL 1Y18B 3MROB 5JOFA 1FV1B 4JQVA 4IS6A 4PGJA 2BY0A 3RDTA 5E94B 2F53A 1JI2A 3N50A 5JQHC 1QSEE 4KI5D 5E8OB 5T3XE 5FO8B 5K59E 3BUTA 3FB5A 1BD2E 1HQRA 2NZ9D 3FQTA 3WO4C 1REIA 1VKXB 3U46B 3ARFD 4JM4H 1TDQA 4WV1B 4H88L 3ARPA 4AT6B 1LEKB 3QB7C 1J0YA 1BZ7A 3QT2A 2X09A 4QHNA 4Y16D 4HUVA 1Z9OA 5FECB 4OLWL 3SDXF 4N0CD 2EYSB 4FXKB 5JW5A 4C59B 4YAQA 4GXUN 1BQSA 1YN6B 2ILLA 4B0MM 4OT1H 5INCB 3HS0B 2OLDA 2CLVA 2CKBA 2XWTB 4LCCC 4RGOH 1X44A 4X7SH 3UTOA 1NC2A 2F58H 1EFXD 1HI6B 1WWBX 4EEEA 3KR3L 2A73B 2YPKA 4IMKC 4LRNH 1OW0C 1BHGA 4L5FH 4MD0A 5J6HA 5KN5B 2IQAA 4MA7H 4DGIL 4M62L 3LKOA 4AEIH 4K9EC 1OGAB 4YGVA 3QDMA 1U41A 4WHCA 3OAUH 2VZOA 1S7WB 2HTKD 3JWDL 1RUAL 5ESAA 4Z78A 1A14H 1MFBL 2EH7L 1QLEL 4X5WA 1MFDL 3TESA 1F58L 4LDEB 5DJ6A 5J1AA 3X3FL 4Y5VC 4JFXB 4NRXA 3BD5A 3HPLB 4LLDA 1MQKH 3MRBB 3CDGB 3BZEB 2Q6WB 2CR6A 3ES6A 3VE0A 3WN5C 5C0BD 2E9WA 4N9OB 3UTTD 5JPNA 4QTHB 5JA8B 4JFOB 4TYUA 5JXEA 4KK9D 1AFVL 3VD7A 3P30L 2BDNH 2XN9E 4Y1AB 4GS7C 3BEWB 2H32B 3ZSSA 1J1XH 5H2BB 1S7VB 1KPRB 1MCPH 3O4LB 1DQMH 2ORBL 3C5SA 4LKXA 5EU6D 4M1CC 4PGBB 5F9JA 3CX2A 2P43B 5I8CB 5CMAB 4KJWD 3KS0J 4EBQL 2DAVA 2LVCA 4JO4L 4LOUC 4X4XB 3QG7H 1FH5H 5T1MB 5JORA 1F8TL 1GZQA 4NKIH 4Q2ZB 4O2EB 3LN4A 3VG0L 5TE7L 1T1WB 3A67H 2P45B 2YPLB 1J18A 1KIPB 1L7TH 1EO8L 4OFYA 4P2OD 1ZT4B 4NQEB 2KKQA 5TF0A 4WW2B 5FM5O 5BRZE 3L3OB 4EDXB 4K8RL 3R1GL 3GSXB 4HAFA 3ULVF 5C0IA 1D9KD 3RWJA 3QXWA 2DDQL 4LCIH 4TUOA 2P5ED 3QPXL 4BH8B 4Q6YA 3L5HA 2XWJA 4F7EB 2APFA 4S10A 3IDXH 3V0WH 2BVTA 3KLSA 4PTUA 2H6PB 3BD3A 1UG9A 2Z0BA 3T0XA 1AGDB 3U83A 4J3OC 1A7PH 5D7SH 4PD4K 4WHDA 1VHPA 3K80A 3QFJB 4PLNC 3WO4B 1J7VR 2DQGL 2AP2A 4PJDB 3E1F1 3PWVA 1EERB 4EN3B 3EOAB 5DD1H 4Y4FD 4QHKJ 5IB4B 1IBGL 1E4XH 2JELL 3K0WA 4GRMA 2ARJA 3STZB 1NMCB 1N6QH 2OXHA 4KK6D 3P0GB 1CBVL 4M8QA 5C0EA 3PQYE 3CXDH 4NNXB 4N8CL 5D9SB 5M7QA 2HLAA 1MCWW 1J11A 5JUEL 3DXAE 3JVGC 5DK2B 5MEQA 1OTSD 1TPXC 3X14A 3TZVC 4N0RA 5IROA 3MV7D 2HLFC 3FKUS 3OX8A 1T7YA 1FLTX 1VGEL 2ZUSA 3DBXB 1F4XH 4Y7MA 4UB0L 1BVKB 1I4FA 1NDGA 2HT4C 4OLZL 3WEXA 5IV2B 3MLVL 1ZGLP 4HQQL 4KTEL 4DK6A 3S35L 3D69A 3P4NA 4U7MA 1J9CT 3RY6A 3ME0A 2V5SA 5GGRY 5EIIB 4JKLA 3G04A 4FABL 4XGZB 5KOVC 2XYCA 1E4XI 4FOMA 4MHHG 1DE4A 1PG7H 3QR2A 4OBRA 2Y36H 5I8KL 5CCKL 2B0SL 3K4DA 2V2TA 5CEYB 3GSWB 4JFYA 1PQZB 1N7ML 4U6TA 5C08E 2V7NA 2YD5A 1FIGL 5FB8B 2AI0H 4OZIF 4U3HA 1D5XB 1NAMB 3AY4C 4LCWE 4WWKD 5L2JB 4OZFG 3OJDA 2ZNWA 4WFED 5KTEL 3BYYA 1HHKB 4PLKC 2NY7L 4OCSL 2EXWD 4QXGH 5DD6A 1FZOA 3UYPA 1JFQH 4JRXB 4TUKH 1GH7A 1K3IA 4G7VH 4GS7B 4HEME 4ZSOA 1J0KA 3DTXA 4DK3A 3MCKA 4L8DA 3FN3A 4GFTB 3CVHB 4LPWA 2BK8A 1N5YL 2ZZUT 2VDQL 4K3GA 3QO1A 4AENB 3WS3B 1UWXH 3MOBL 4MGXA 2IBGA 3OR7A 1LO0L 3F65A 3VH8B 4G8IA 1MQ8A 4LAQH 1OWWA 1CD9B 1G7IB 3TEUA 2FIKA 2RCSL 1FPTL 2DBLL 5FYLH 4G6MH 2UWEB 5GGRB 1W72B 4NJAH 2CIKB 4G3YH 4I2XA 3O6ML 4S1DD 4P0DA 1U9KA 4Y16A 5JOPE 5CP3A 5ENWB 7CGTA 4UV7H 4GG8A 5FKAB 1ZLWH 1C08A 1EHXA 5K59F 2NY6C 3QDGE 4XBGB 4KVCH 1WAAA 1EK3A 3PL6A 3DPBA 4HS8H 4PG2C 4PJCB 1QFWH 3EKCA 1AQKH 4JGUA 5H37H 3OKEB 4HBQA 4UTAH 1KGCE 3BP4B 1RJYB 3LSOB 4B50A 2BCKA 2IAND 3OTTA 1KTKE 2HJLB 2QSTA 3HB3C 3HZMB 4M9PA 3S35X 2EDKA 4PS4H 2YBRB 1K4CB 2NY4D 3UX9B 4XXDA 2V9RA 3LQAC 5T1DH 3CSGA 4P2QB 4ZPVA 3EYSL 1OP3H 1RZKL 5EA0H 4ZFOA 5BOZG 3BP6B 4KKAC 5CS7A 1FNLA 2FX9L 4GLRH 2MCPL 3TA3B 4OQTA 3QHZH 3LKQA 4FZ8H 4OKDA 4ONHB 2KDGA 1QFWI 1NBYB 5DR5H 3UTTA 4ERSH 5GS1B 4P46C 1YEJL 2EDWA 4A2LA 3B9KA 3L6FB 4XPGL 5EPMA 5IBTL 3MRIB 4NOBA 3KPOA 3TZVB 2NX5E 1RUKL 4GW1A 5IOPB 1P2CB 1PSKH 5EU6A 4MQXC 2XG4A 2EDYA 5HD8D 2VXUH 2VDKL 3TBWA 3OMZA 4K7PY 1OP5K 3TO2B 4UQ2B 4NOFA 4N1HB 2VRAA 1KENH 3BHBB 1JPTL 2PO6D 3DJ9A 4JZJA 4FXLA 5FYLD 4ENED 4GLRI 3OPZL 1KLGB 4LSRH 4Y4KD 4XCFL 2FH6A 3CFKA 5DHVB 2OTWA 2QJDA 3HI5H 3BT2H 5D70H 2GCYB 1FGVL 4KV5E 5TQ0L 1I3GH 3WXWH 4M61A 1IL1B 5ADPL 3QIWC 4P2OA 1FL6B 2Z8VC 4M1DH 1NFDB 1WF5A 3KYOB 5DJCB 2NY2D 3D85B 3QHFH 4IMLA 3MBXH 3EGSB 4I3GA 3LS4L 4YHYB 1DLFH 1D9KA 2CK0H 1SVCP 3QQ9D 4NM8H 1DQLH 4NUGL 1JWMA 1PAMA 2P5EA 3VXQB 1I75A 3GDBA 3NIFE 1MAJA 1GGIL 1ZTXH 2YRLA 4JFDD 3VWJD 2FO4B 4O9HH 3OKKB 2BVYA 1P1ZB 1INEH 2AJYL 4GQ9H 1NBVL 2P24A 4XVSH 3PP4H 3I3DA 1EMTL 3JBG7 5BXFA 2MQ3A 3VMOA 1ROWA 1YMMA 2E9IA 1XEDA 2ITCB 3WMSA 1J1PH 5IG7B 4Y4FA 4J3TA 2BFVL 4E5XB 2QV2A 3HE6C 2D31B 1HK6A 2R23B 1U95A 5LBSL 2FJGA 3UPCA 1JZ5A 4ZXBB 3VFGH 1B90A 2D7PA 5KAQG 3D9AH 1J8KA 2QHRL 4MSWB 1OLZA 3OGCB 1RUMH 2B1HH 4UZGA 2NY6B 3A6BH 3DLQR 3MV7A 3S3PA 1IM9A 5KG9B 4P5KA 3BDYL 3S5LB 1A4JB 1Z9LA 4PJFE 4WENB 4PJHB 2AV1A 4F2MB 5FCUH 4ZFGL 2VABB 1IM3A 2E7MA 4KUZL 1BQLH 3SQBA 4NKDA 3H0TB 3NACL 2C3HA 2CDEA 1SYSB 1PGRB 2Z8SA 1KTLB 2VC2H 4OAWB 1KPVB 5E6ID 2MQCA 2CLRB 2MHAB 1F97A 3DX8A 1SM3L 1U0QA 4HMEA 4NO0A 3Q5YA 2DICA 5FDWA 1QO3B 3HC0A 3BQUC 1JGEA 4TVPE 1ZWIB 2MSPA 4Z0BL 1AE6H 3HI1A 4GMTH 3EO9L 4J12A 2EXYD 2W9DL 2AJSH 4PRHB 1D5IL 3VXMD 1TJIL 3T77A 1WT5A 3MCLH 2CRYA 4JY5L 3FN0H 3LMJL 3QUYC 2Y6SD 4OKVA 4PB9H 1P5VA 1RMFH 3SCMD 3I2CL 3BPNB 2AGJL 3RGVA 5HY9A 3EHBD 5D71H 4JM2C 2DKSA 4OFPA 1UCBL 3LKSB 4G8FA 4QRTA 1FG2A 1AGCB 3LV3A 2X2YA 2ZOKA 4C83B 4HFWB 3RWHB 4JE4B 2VZVA 12E8H 4YHOH 4XC3H 1HSBA 1T03H 1VEPA 3FTGB 3WV0A 2Q76A 3O6FD 3RWDB 32C2A 1JJUA 3UP1A 1U8OA 1CE1H 2BRRH 5MI0B 3MXVL 1FNSL 3QIWB 3DO3A 4KUCD 1JNHB 4JFEA 3JWOH 1RK1B 1HOCA 2QTEA 5ISZE 1YQVH 5DYOB 4NJ9H 3I85A 4P2RA 5GGUA 4RGNE 4UUJA 4EI5B 3IU4L 4JKMA 2VUOA 3AS2A 4FA8A 4AJ0A 3GGWB 1NFIA 4OLUH 1F3RB 2RGSA 3ESUF 2IANA 4ZPTA 5GRVK 3PE9A 1GHFL 4HF5L 4L29B 2J3SA 5C07E 1FFRA 1AC0A 2ZOLB 4YQXH 4DZ8B 1AGEB 1I7TA 3DIFB 4EXKA 3IDGB 1F3DH 5BOPA 4GKZB 1HE7A 1FYTB 4HDIA 4DKAA 3IDMB 3VFUA 5TDOB 5LVEA 3BKCL 1C16A 3JWDC 4RMSA 3B3IB 3EOYG 3C8DA 1P4IL 1WTLA 3SBWC 2GSIA 2ZUVA 4LNRA 1OPGL 2DQEL 1X5ZA 3IXTB 4P99A 3Q3GB 2CLZB 4IDLA 4NKOA 1U6AH 5IHBA 5SV3A 3K2UH 1G0YR 5KSUA 4LVHC 2GITA 3N1MC 4PPTA 2BHUA 5GXBB 2O5YL 1A1OB 3C8KA 4DUXA 3BD4A 4R90L 3THMH 3HMXL 1QBLL 4KRMB 4APQD 2XA3A 2OL3H 3L1OL 4WDIA 4S1SH 1I8LA 4LP4A 2PO6A 3P9WB 3SE3C 2Q8BH 4QRPB 4D2NA 2PN5A 5JNYB 3FQXA 4Y4KA 5GGQL 3VGEA 5C0CD 3WUWG 4XZUB 1MJUH 2KQNA 2BHYA 5DWUL 1F11B 3VFTA 1AIFA 4F7TB 5GSRB 2DJSA 4FMFA 3TF7C 1YYLL 1JZ7A 3DETC 4UBDD 3FT2B 5IK3A 3MV8B 2PYEB 1IC5L 3BX7C 3BQUB 5EBMA 3GSUB 3PXHA 1CFBA 3L7EB 3QUMB 3MV9A 2Z8RA 4HJGB 1S8DB 3NGBB 4MWFA 1IGTA 3MRLA 3EYUH 4YFLI 4KV5F 3OAZH 2P42B 3U1SH 3MRGB 3TFKD 4JFDA 3VWJA 3CVIH 3QUYB 3VXUD 5EIVA 5L8KB 4ZD3H 5GJTL 2UVEA 4LVNC 3FT3A 3WO3B 2CDFA 3MRNA 1SYVA 1UB5A 5DLMH 4NBZB 2BSSA 3D39B 5BZDB 2EZ0D 2ZUTA 3ZMRA 1WBXB 8FABB 4G6KH 4KROD 4MJ5A 3NIFF 5IVNA 1TLKA 3KJ6H 4OSUL 3PV6A 3U7YL 1KPUB 4OF0A 2DIBA 4R7NA 3GBML 1WWCA 1XMWA 4OGYL 1N3NA 5F89A 3BEVA 3FMGL 4FG6C 5BVPH 1EJOL 2ESVE 4HK0B 1RU9H 2GJ6D 3OG6B 5F6HI 1RZFL 5D1ZC 4X4ZA 4QXUL 5CINH 2HKFL 1CGSH 4OCXH 4FNLL 5GISL 2FBOJ 3V6OA 1TQBC 4QGTA 1AP2A 3GMLB 1X5AA 4EUPB 1I3RA 1YEHH 4GRWH 5TGBA 1JPFB 1A9EB 1NBZA 4UAOB 5EOQL 5ID0