4CDHA

Crystallographic structure of the human igg1 alpha 2-6 sialilated fc-fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Basis for Selective Recognition of Endogenous and Microbial Polysaccharides by Macrophage Receptor Sign-R1
pubmed doi rcsb
molecule tags Immune system
total genus 34
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cdhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cdhA01
1JNNL 1ZT7B 1M6OB 1UT9A 1F4YL 3VFPA 3TCXA 1KEMH 3VWJA 4GW1B 1HH6B 2WBJA 3LQMA 5GS1B 2VIRA 3CU1A 4I8DA 4NHUB 1OSZA 4TSCH 4N0FB 1F4XH 2NXYB 4S1RL 3KNBA 4NQDA 4MS8C 2DB8A 4RGNB 3HAEB 4ODHH 4C57C 1WWAX 1OQXA 5CP3H 2FIKB 4KQ4H 1OAKL 3LD8B 1QEWA 3HB3D 4RGMB 3RIFK 2EYTB 5GISL 3AMLA 1CDJA 1AP2B 5ENWB 3EFDH 1GAFL 4GKNA 5L2JA 4HH9B 2W92A 2VLKA 4Q0XL 3ZKQD 3FJTA 1P1ZB 3PE9A 5F9WC 5D8JH 3ROLB 2HFGH 4LPCA 3PWLB 1ZT7A 1M6OA 1MY7A 5EIQA 5GZOD 5A2JH 3NACH 3T0EE 4U6YB 1HH6A 5GS1A 2XY2A 2UVEA 2DJUA 2YHGA 1A6PA 4O4YH 4JFFB 4OFYD 4GXUN 4OIAA 5FYLD 4D8PB 1RUKH 4GLRH 3EYSH 1DBAL 2FIKA 2QEJA 1KIUA 1PDKA 9CGTA 3NFSL 1ETZB 2LE9A 4X98B 3D0VB 3L3DB 1OT1A 2EYTA 4XVUC 3BZFB 4BELD 4GKOA 5JMRA 1AP2A 5ENWA 4HZAA 4HH9A 4U4BA 5MEND 4LCYB 4TUOB 5F1IB 1RMFL 5H37H 3VXUE 4KI5F 4YQXH 5E2UL 3ROLA 3H7LA 3QDJE 3PWLA 3UC0L 3QJFA 2Q3ZA 4HK0B 1J10A 5DVNA 5I1JL 4JDTH 4U6YA 3NZHL 1NGQH 1P4BH 4XNUH 3FN9A 4KKCC 4O2FB 5I0ZA 1ERNA 1V7ML 1XZ0B 2IPUG 3RFZC 5FUCC 2C7UB 4E9LA 3CLEL 4JFFA 1CVSC 3OAYH 4PJEB 2VLJA 2YD1A 4HXAH 5DJ6B 3WS6A 4TQEH 4WUKH 1CDUA 1ETZA 3D0VA 3L3DA 3VD9A 3BZFA 5EU5A 5LGHL 1F13A 3MXWL 4KV5F 4MQXD 4IRJB 4I0PC 2GJ6E 1EVTC 2E27H 2BNRB 4MGXA 3ZDXF 4LCYA 4PJGF 4TUOA 5F1IA 5IW1A 5FB8B 4TVPE 1T6WA 4HK0A 4RMQA 4CUCA 5JW3L 3LEYL 1MRFH 2G75B 1FZKB 4XPFL 3QFDB 2PO6C 2EZ0D 4PTTB 2DWEB 1XZ0A 2WM0A 2UY7A 2C7UA 4PBXA 3LEXA 1BJ1J 5HHVH 2Q86B 1VFAB 1V3KA 5DJ6A 4OQ1A 4XCEB 4LF3B 1E4WL 1OTTC 3QEHA 2FDBP 5LCVH 5JZ7D 1JPSL 4JFPB 5IFAH 3HZMB 3BKYL 4XGZB 2XZQH 4MB5A 4HHAB 3V5KB 5EU6B 3OKDB 1N6VA 3B3IB 5FB8A 4RAVA 2NNAB 3QULB 5CEZH 2G75A 1KPUB 5IUSA 2NY6B 1A4KB 3NIGE 1GGUA 1JWSB 1KUMA 2FECI 2DWEA 2W60A 3MBEC 4PTTA 5TF1H 4HS8L 5KJRH 1P9MC 5DHVB 1FYTE 2J4WH 2ZG3A 4JZNA 2BVQB 2Q86A 1VFAA 2LAGB 32C2A 3R0MA 4XCEA 3S37H 5IMLB 4LF3A 1WZLA 3M1BB 2DKUA 1KT2B 4U7MA 3R8BB 4J6RL 3S6CA 5C07E 4JFPA 2Z8SA 1UWEL 2GSGB 3PWUA 2FO1A 4FOMA 4QOKB 4MVBC 4XGZA 1NDMB 5ACZB 5TQ0L 4XX1E 4HHAA 3V5KA 3MQIA 3OKDA 1IGFL 2AJXH 5DO2D 4L3ED 4EN3B 4EXKA 4M8VA 1LGVA 2NNAA 3WHXB 3QULA 4M03A 1CBVL 2DKMA 4KKAC 4JKKA 3G9AB 1HE7A 1KPUA 3BGMB 3TT3H 1A4KA 3VMNA 2XZAH 3QEUB 4HJGA 4F9PC 1JWSA 5ALCH 1BVKB 2BC4B 4YDVB 1KFAL 3Q3GB 1J8HA 1U8JA 3VD5A 3JSSA 3HC4L 3FN3A 2ZUWA 4HKBB 3WN5A 5BXFB 5IMLA 1FFQA 5K9QG 3M1BA 4EI5C 1KT2A 1BFSA 5B4MC 4PJIB 4R7NB 3QUZD 2AXFA 2GFBB 1A8JH 3LDBB 1Z3GL 2GSGA 2CMRL 2VDOL 4QOKA 4XP4H 5CBEA 1NDMA 5ACZA 3VFTB 1BQUA 4IIQB 1X9QA 1UB5B 1OB1B 5AYUH 5T1MB 1TZIA 4Q58C 1IT9L 4Q74A 4UNUA 3W82A 4EN3A 1XCTB 3BFOA 3GKWL 5JOPD 1F97A 3SGDI 4LSUH 5SX5K 3WHXA 3VMOA 4P9ML 3V9FA 4U1HB 1RK1B 3BGMA 3KR3H 2ZCLH 4XI5C 4L9DA 1BVKA 1IAKB 4LASL 4YDVA 1JGUL 3Q3GA 4N5ED 4FG6D 2VL5B 1RZJH 4LQ1A 1EZVY 1KJ3H 1Y6MR 3W81A 1NAMB 1PG7W 4HAFA 3I3EA 4HKBA 5BXFA 2EDDA 2P5WE 3TBVA 5C0JB 4L8SB 1OP3K 4RMWA 2X4UA 4PJIA 4R7NA 4G6FB 4QHKJ 4OJFH 3SO3C 1IC5L 2GFBA 2JCCE 1N5YL 4DVRH 4WFED 3VFTA 4IIQA 2FJFB 2Q76B 1UB5A 5T1MA 3RTQC 3PWVB 3O2VH 4LPTA 1XCTA 4MA7L 4JR9H 5EO9B 2PW1B 2NY5H 2R4RL 3MUGB 3FT2B 5T1LB 5D6DA 4U1HA 1RK1A 2FWOA 5C0AD 4BM7A 4KFZC 1X4YA 2ZCKH 1IAKA 5I73B 3DV6B 3GK8H 2OR9L 1N0XH 2VL5A 3BISA 4YUEH 5F44A 4ZAKB 4QXUH 3P0VL 4DN4L 5INDB 3O6FC 1NAMA 1G7PB 2D7OA 2DJ4A 3ARUA 1A02N 1FDLL 5C0JA 4L8SA 2HVJB 1WQVT 3ZTNL 4WTZG 3L9RB 3QUXC 4AK1A 2P5EE 2NW2B 5C92A 3QG7H 2JLLA 4F7EB 4L4VE 1H15B 1U95B 3MRMB 5D1QB 1RZFH 2FJFA 2Q76A 4Y5XB 4F57L 2QQLH 4NGHH 1G0DA 3T4YB 1N64L 1I7UA 2YKLL 3P40A 2XYCA 4OCLC 4O2CB 3NA9L 5EO9A 2PW1A 2C5DC 1A7QH 3FT2A 3INUH 3VFWB 1ZT1B 2V5SA 4YR6B 2JJTA 4Y16D 1E4XL 4LAQH 3DV6A 3MZTA 4JFZL 1CIDA 4P3CL 4ZAKA 1FVCB 2Q8AH 3UDWA 4POUB 5INDA 4JY4B 4ZFGL 5DD5L 4HQQL 3E1F1 1F4AA 3AU1A 2R1XB 1JCKA 1JJUA 4PRHA 2IPUK 4TVPH 1MCDA 2IPTL 1OARH 3T77B 2HVJA 1CWVA 4K8RC 3L9RA 3IDIB 4OCXL 4P5KB 4PP2B 5K9QI 2NW2A 1Y0LB 4CJ1A 5FOJA 4YXKH 5IMOB 1WEJL 3IRPX 1H15A 4M7KL 1RUPL 3MRMA 2D7QA 4HWBA 1QVOB 3V6BR 4FQCH 5TH2B 2ENYA 3K3QA 4O2CA 3PL6C 1AGEA 2Y25A 2VDKL 1QSEE 2PTVA 1WTGT 3D2UB 4OM0H 3VFWA 5E8EB 3GFUA 1ZT1A 5GRUH 4YR6A 1ZGLM 2V9TA 1ODAA 4J1UA 4XMKL 1FVCA 3KS0J 5KTEH 5D70L 4HKXA 5JIIA 3MOBL 4JY4A 4KI5E 4FQ2H 2FB4L 1YDPB 3NA4A 4PRNB 1HKFA 1WAAF 3CSGA 5I1CL 4PD4J 3IDIA 2XKUA 1IGYB 5JORB 4HJ0D 1Y0LA 2R69L 3MV9E 5IMOA 1CL7H 3LKQB 4J12A 5KZCB 1KLFA 1FAKT 3QAZB 5D5MA 3C6LB 1GGCH 4KK8D 5D7SH 3H9SE 5TH2A 1P84K 3TJHC 1J1XL 5JR1L 1G9ML 2NY3C 4LCWA 5BV7B 2AK4B 1QACA 1QG3A 2E6QA 3PHOB 3MV11 1RUQL 4KV5E 4YEEA 1MJ8L 4OCNC 4XNZB 4R2GD 3ZDXE 1K3IA 2BNQE 1EEUA 1W2KT 4MMXC 2Z35B 5L8KB 2DTSA 1QNZH 2NX5E 3D25B 1YDPA 2B2XL 2J2ZA 2YUZA 3B9KD 3DXAE 4PRNA 4JPVH 3WFCH 5I6XC 3RPIB 4E0RB 2DQCH 2PCPA 1CF8L 1IGYA 5JORA 3KLDA 4MXWL 1N2RB 2I26N 1U93B 2EE6A 5DGQA 1GC1L 2J5LB 1FQ9C 3QPXH 2ICWI 3NCYP 1T7WA 1LDSA 4DKEL 3C6LA 4DN3L 5I9QC 1ND0B 3D3VE 1LHZA 4NQCD 1FZMB 3NBNA 1W72A 1IKFH 1CGTA 1T1ZB 1Y18B 3GSVA 4I5BB 2F54B 1SEQH 2AK4A 5IHZB 2F53A 3O8XC 1F02I 1W8OA 1OAQH 3PHOA 3FFCD 5T3ZL 3ZTJH 2ZUTA 4X5XB 1Z9MA 3BP4B 2WBWB 1JF6A 1QLRB 4MZ3A 5I30H 3G6JF 1ONQB 1E6OH 1RJLB 3W9DB 4PPTA 4DGYH 4Z7WB 2Z35A 4CAGA 3S97C 1J1OH 3D25A 5JXED 1UEYA 3RGVD 4TSCL 3QI9D 3MV7D 1FCCA 4JFEB 4E0RA 1HSAB 2L0DA 2ADFH 4TTDC 3I84A 1N2RA 1DLHB 3LAFA 1LVEA 4YHOL 4ZSOE 3EOTH 1KBGH 3TEUA 1ADQH 3ULUC 5MP6H 1ND0A 1U58B 4NSKB 5DD0H 1T1ZA 3UTOA 5EG6C 4I5BA 4M1CC 4OAWB 4PUBH 5FO8B 1HOCA 1L7IL 5E6ID 4ELMB 4X5XA 1NL0L 3BP4A 3JV5A 2W9EL 1QLRA 4M3KB 4JHWH 4X6CA 4XCNB 5D8JL 2IFFL 1INEH 1LEGA 1PKOA 1RJLA 3RVTD 4AM0B 4Z7WA 3IFNH 1XF1A 4YDKL 3WNKA 4WUUE 3MRQB 3O4LD 2BVTA 2BSSB 3EDDA 1U3JA 4JFEA 1HSAA 4M5YL 4Q9RL 4DZBB 1RUKL 2ZUQC 1A6VH 3EYSL 3B2UC 4WI8A 3BAEL 3RVXD 1GHFL 1U58A 4GJTB 4NSKA 3RL1B 2IJ0C 5EC1B 3BGFB 4OAWA 3WFHA 4CNIB 5FO8A 5C08A 3DVFA 4HSQA 1X7QA 1P53A 2AW2A 4ELMA 4KK5D 5SWZE 4PBWD 4OCYH 4YBLC 2MCPH 2X9YA 2DI9A 1HILB 2R15A 2OZ4A 3OTTA 5C0RH 3QNZB 1NGQL 3MRQA 2J12B 1U8QB 2BSSA 1H5BB 3P0YL 5TFSH 4HUWB 4N8CL 1MCIA 3MCKB 4ISVB 4DGIL 3B5TA 4DZBA 4HXAL 4ONFL 4OBSA 3PHSA 5E2VL 4EZMA 1KJ2L 3QYCA 4JANB 4JVPA 3RL1A 1I3GL 2DTMH 5EC1A 3S35H 2CQVA 4CNIA 1G1YA 1D7FA 4PS4L 3GSRB 5F6IC 5HD8D 4U2YA 4LRIC 2PTUA 4JM4H 3ARGD 4Z76B 3FKUS 5C09B 2MQCA 2NZ9C 3BWAB 5DTFB 3AAZB 4FXGB 2APBA 2FH6A 4N0RA 2H3NB 3BSZH 3VXRB 2XTJE 3TM6A 4JFOB 2V7HB 3F12B 5L8LB 4HKZB 2Z31C 1XR9B 4U6XB 5EULV 5HYJD 1H5BA 5C0FB 1UM4H 4HUWA 4PJ8C 4ESKA 4ISVA 5CJ8A 2N7AA 5HHVL 3R4DA 4L4JA 1MFDL 1Z9OA 1AC0A 3T0XA 3WFDL 3EYVB 5GGVH 1FBIH 4JANA 1MOEA 4G42A 2ZUXA 2BSRB 4OZGB 3S37X 4BFEA 4M6OH 5IFAL 3HN3A 1SY6H 3CCHB 3I75B 2XZQL 1F4HA 3OB0H 3GSRA 1YEGH 1FORH 3NPSC 5IVXB 4PJ7B 3ULSB 1EHNA 1FG9C 4Z76A 4OZIF 5C09A 3T8XB 3UEZA 4PIRF 3S34L 4FXGA 5CEZL 1CFBA 2EXWC 1RHHB 3QQ3A 4W70A 3VXRA 4POZD 1BD2D 4JFOA 2V7HA 3F12A 3UAJD 1AY1H 4HKZA 4XAWL 1XR9A 5TF1L 4Y19B 3EHBC 5E8PB 3ZHLA 4L9LB 5CCKH 4WO4D 1TQCB 5CZKA 3OBAA 2I24N 1MREL 4KUZH 1EZVX 5C0FA 4KMLB 3OR7B 3V0VB 4C55A 2AQ3A 1N8ZB 4QY8B 5CGYC 4ZS6D 1D9KB 3S37L 3EYVA 4NNXB 5T1KB 4NNPH 4ONHB 2BSRA 4OZGA 3C2SA 4WWKD 3CCHA 3B9AA 5IWLC 3I75A 1VHPA 5CZVH 3OAZH 4HCRA 2IANB 4NZUH 2Z9TA 3ULSA 3CUPA 5E70A 3S98A 3T8XA 3V52H 4Z7NF 2K3TA 3N1PC 4JREC 2DQHL 4KK6D 4JE4B 1RHHA 4F7MB 2AEQL 1JYXA 3WNMA 3TT3L 1MPAL 1CS6A 1IGJA 2F5BL 5D2NB 2FX9H 4Y19A 5E8PA 1NANH 4L9LA 3X14A 2X05A 1MCBA 1OM3H 4DJMA 3OR7A 3V0VA 1UENA 3E6FA 3ULVC 1N8ZA 4QY8A 1D9KA 4J4PA 5I19H 3GMNB 4NNXA 1CXHA 4ONHA 4PJAF 4JDZA 2NYYD 5D72H 2RHEA 3TESA 3TA3C 1J87A 4K71C 1QSFA 3ILPB 3WDIA 1I1AB 2R1YB 5AYUL 1MCFA 3WUWG 4LBEA 4R4FH 3IJHB 4ODSL 4LSUL 3Q0HA 2QLVB 4OZFG 1WGOA 4XWOC 5E4EB 3VG9C 1HSBA 1RIVH 3OPZH 2ZCLL 5D2NA 4M9PA 5CGTA 4CU6A 2B5IC 3VWJC 3P11L 2QSCH 2AXHA 1CR9H 1RZJL 2FNBA 2WBJC 4OZ4B 5INCB 1U8IB 3GRWA 5GGSB 1UXWA 4XPGL 4IRSC 3VG0H 3GMNA 3HTLX 4DUWA 4OJFL 2NY0D 3N1QC 2FEDD 2YD4A 1RVFL 4LPVA 3BQUD 4X9IA 3ILPA 2R1YA 2BVPB 3HAEH 1FNSL 3IJHA 1OGAD 4XBEH 4QRRE 3V6OA 3IU4L 3DNKA 3BPOC 3GK8L 1FC2D 2YMXL 4X4ME 4J3OC 3WLWC 2FGWH 4OZ4A 1U8IA 3PGCB 1JF1B 1A1NA 5B38B 3TC9A 3LQAL 4JCMA 3E0GA 3UPAA 1CZ8L 5IQ7L 3FO0L 4YFEA 4LSRH 1QOKA 3VXMB 3EAKA 3QG7L 5IW3A 4PP1C 5FHAH 1LEIB 4LKCB 4RMSA 1JZ4A 2ESVB 3QUKA 4JRYA 2QQLL 2BVPA 4B50A 3LKRB 5FA4B 5IB4A 3IYLW 3FB8B 1NEZB 3HNSL 5I71B 4JY6A 2MJWA 3INUL 4Y1AD 1OOAA 5ERWB 5ILTH 4LAQL 2VXTH 1HWGB 4YDLC 1EGJL 3W11C 1YPZE 3G5XB 4ERSH 3DURA 2Q8AL 2D0GA 4NJ9L 3PGCA 2AJZB 1JF1A 5B38A 2WUCH 3HG1D 4CVZB 4L4TD 3TO4C 3LCYA 4JM2C 1IQDB 3IDUA 4MAUH 1A2YB 3WS6C 1NC2D 4OCRH 2BNUB 3EYQC 3KPRB 3NH7H 3VXMA 1U92B 1LEIA 4P48A 5IM7B 1Q1JH 2BCKA 4J2XA 1IVLA 4KI1A 2ESVA 3WD5L 5A2FA 3LKRA 3IKCB 1CE1H 5FA4A 4BFGA 1MRDH 1U8NB 4K3DH 3FB8A 1ZLVH 4P23D 2B39A 1IGMH 5GRUL 4OQTH 4D3CL 4GG6F 1VADB 4X6DB 2FEEL 4C83B 2RIKA 5FUCE 2V7NB 3RU8H 3CC5A 3VDCA 1S7QB 3G5XA 2QQNH 1KXVC 1NQBA 2AJZA 3P77B 3EZ8A 1RZ8B 4FQ2L 1MRCL 1MFCH 4CVZA 4EUPH 4JY5H 1DQDH 2QADC 2DL2A 1IQDA 3VWKD 1A2YA 1MEXH 2Y72A 1QLEH 2BNUA 3IGAB 3KPRA 4OZHB 1YEJH 3C2AL 1CQYA 5FYJE 3RWCA 2AKRB 5SWSA 1U92A 3X17A 1YJDC 4R4NC 5IM7A 2NPLX 3BKMH 4G9FD 1U91B 4NZRH 3VXNB 1GGCL 3NMEA 4DUXA 3IKCA 1TJIH 1U8NA 1T20B 4BSWB 3Q6GL 3IXTB 2BY3A 2W1NA 1LE5B 4EI6A 1VADA 4X6DA 1IC7L 4C83A 5I1KH 2HJLA 2XKNB 4I77H 5LXGH 1Y6NR 3U83A 4Y8AA 5IIEB 5D7IF 1N4XH 3KLHD 1RZ8A 1K4CB 2PXYD 1K85A 4ZOAA 4YFLI 4JJ5B 3WFCL 4LL9A 1RULH 2OR7A 3IGAA 4OZHA 4X0KB 5I76B 4EQ2A 2AKRA 5F9OL 4MNQD 1DQJA 2KQNA 3IVKB 4RX4D 5DHVH 3LN4B 1KLGB 2CR3A 5DFVD 2OL3B 4NZTH 4UBDC 5DC0A 1N5AB 1EBAA 4BSWA 4PJXF 5B8CC 3FRUB 3SCMA 1SEQL 3PIQA 5IVNA 1RD6A 1WFNA 2WAHA 3ULUF 3QDGD 3TN0B 1FE8L 2IQAB 3ZZ1A 2F74B 4X5WB 5IIEA 3HC0B 3T0ED 3WFBH 1B88A 1CICB 3MR9B 4OZIE 1SMAA 1K4CA 1R0AH 5EOTB 3B5HA 2AQ1A 3PWPB 1AR1C 2PNDA 2MKWA 2F58L 4M1DH 2P42B 3CVHA 3VA2C 3WN5C 5D7LB 1JGLH 5CP7B 3PG2A 1A6UL 3H42L 4X0KA 3BMWA 4OFKA 3L5XL 4G6MH 4JO3H 4HWNA 4HEPG 2I9LB 2BERA 1ADQL 1KGCE 2DWDB 3LN4A 4G5ZH 1KLGA 2VAAB 5F89B 1UWGH 3L3IB 5GJSH 1N5AA 4OLWL 1FSKC 3LKSB 5I2IB 4ZPTA 1R3JA 1BPVA 3VXUD 1X3DA 5E9DD 5JLZA 4OGAD 4S0TD 3TN0A 5HYFA 2IQAA 5I1AB 2F74A 3IFPB 4PJFB 3HC0A 5CD3B 3TIEB 1G6RA 1CICA 3MR9A 4MLIA 4Z7NE 1ZA6A 3PWPA 1P7QA 3QDMB 1B0WA 1TJGH 4JQVC 2LU7A 4ZUSA 5D7LA 1H8SA 5CP7A 2RB8A 4PLJC 3KXFA 3JUZA 1MLBB 1FN4A 2VWEC 2I9LA 3HPJB 1OLLA 2YD8A 3RWHB 4OF5A 4B41A 2DWDA 2VAAA 4R6UA 3VW3H 4G9DB 4ZNEE 5GGRY 1OLZA 1JN6B 3L3IA 5I1DB 2CUHA 5A2KH 2GJ6D 3LKSA 1TJHL 7FABL 4PJAE 4ZDHB 5C6TL 3NAAL 4X99B 3S35X 1INQA 5F88B 3KPOB 4TVPD 1AO7E 3HS0A 3UO1H 5BRZB 5I1AA 4IOIA 3QIUC 5IMMB 2CSPA 3IFPA 2BDNH 4PJFA 5CJXC 3TIEA 1CG9B 4QRPB 4WW1A 4JN1H 2DD8H 4MA1C 2A2QT 2OXGA 1IEAB 1WV7T 2FX7H 1G7HB 3GM0A 3HR5B 5C7XH 3DI2B 3MRNB 1NLDL 2VLME 3G6DL 2JJSA 1MCOH 4Z7VF 3SE9L 4JQXC 3VXSE 1MLBA 3CXDL 3HPJA 3LH2H 3OGCB 3RWHA 1NPUA 5EBWB 4G9DA 5DK2B 5AZEL 4LEXH 4RRPG 1OP5H 1JN6A 2N1KA 1BFVH 5I1DA 3ARTA 3ZKMC 3U0WL 3S35L 1ZSDB 4P4KD 5GZND 4ONOA 4MA3B 2P7TA 4PB9H 2APVA 3G04A 3EGSB 3L3JB 4LVOB 4LKXB 2MNUA 4JM4L 5F88A 1QP1A 3HC3H 3KPOA 2XA8H 3MV8B 4YBHA 3UTZB 1AJ7H 4G8GE 2JJTC 1D6VH 2VRAA 5IMMA 2OTWB 1CG9A 3BSZL 4QRPA 4YLQT 1IEAA 1HHGB 4GLRI 4H0IA 3HR5A 1MCWM 3MRNA 1VACB 3A6CL 4D9QD 2X4QB 5EIIA 1BBDL 2CDGA 3FOMB 3O9WC 2V5TA 1A0QH 1T4KB 2WMPA 4KHXH 3T3PF 3W0WE 4FQIL 3OGCA 3TH4T 3ECBB 3QDHA 1T0PB 5HHOD 1HHHB 5EBWA 4MQ7A 5DK2A 3U48A 5GGVL 3QFJD 1FBIL 4NQEB 1S3KH 3P2TA 5IBLC 5FUZL 4EKXA 5FIEA 1ZSDA 5AEAA 3TFKD 1SY6L 3RWIB 3AVEA 4MA3A 3BZ4A 1ZXQA 2AJVH 3MRRB 2VUYA 1ZHNB 4UV4L 1FORL 3BX7C 3L3JA 4G6AD 4LIQE 4LKXA 5FYJH 4WU5B 3MV8A 5I74B 3UTZA 4HULB 1UACL 2DQDL 2ZOLB 3TBYB 4HLZH 1P7KB 2OTWA 4UB0H 5HI4C 4APQA 4RBPK 3TPUB 2NTSP 2YPLE 5D1XD 2LVCA 3QH3B 3RDTC 1X4ZA 1FG2B 5E2WL 2X4QA 1DUYB 3UPRB 5I8KH 5C0CB 5IEKA 1T89C 4K9EL 1T4KA 5DUML 1EV2E 4NIKB 4WNQB 3K4ZA 3ECBA 4KVNH 1HHHA 4R97B 5TE4H 4BFIB 4ZMAT 1A7NL 2Q6WB 4HGWB 1DBJH 3RWIA 1RK0B 5EIVA 4WV1C 3WJJA 1SM3L 2EIZA 4M6NL 5CZVL 1ZHNA 4NZUL 1TVDA 2VDRL 5B22A 4XCYB 4LSTL 4WU5A 2G2RB 5DFTA 3V52L 4JPKL 5CLWA 4H88H 2QSVA 1MCPH 4YO0B 1DQQB 1IM9D 4KK9D 3VH8G 3QH3A 1I8MB 2HT3C 4M48L 4TRPH 1D5MA 5KSBF 1FG2A 3PWNB 2CIKB 3ISWA 4GS7C 1AI1L 1LNUB 3S4SB 3UPRA 2CRZA 1R6VA 5ISZE 2R2BB 4C58B 4WNQA 3EDJA 1TVBB 3T2NL 4JRXB 3FQWB 4QRSB 2LVEA 4XXCA 4BFIA 2EO9A 4EOWH 1EEZB 3U1SH 2Q6WA 4HGWA 2OX5A 3RI5F 2R0WH 1GSMA 4XVTH 1RK0A 3MXVL 4ODUB 2QQKH 1LK3L 3DUUB 5TGBB 5DXWA 3BKJH 2OK0H 2YA1A 4XCYA 3GEWB 3SKJH 2NR6D 2G2RA 2BX5A 4MJIB 5GGTH 3SDDB 2P47B 1DQQA 4JFQB 1RIVL 4R8WH 4I0KA 5HHME 5DRWB 1J0YA 4HGMA 4OBRA 5IFJA 3PWNA 3SPVB 2CIKA 1LNUA 1LO0H 2YUVA 2R2BA 4HFWB 3W39B 4FFVC 5TE6L 1TVBA 3FQWA 4QRSA 2VDLL 4EEEA 1C7SA 2P5ED 1DQLH 4H8WL 1EEZA 1X5GA 2CPCA 3UYRL 5B3NA 4L4VD 3T2QA 5TGBA 2ZSWA 2A74B 3PV7A 4PJ5D 2YBRB 4U6HB 4S10A 3SDYL 1NFDB 4KKBD 4MJIA 5DZNA 4OLZH 3PXJA 5EOQH 4JFQA 4FP8H 4KRPB 4L8DB 1IAIM 1YA5A 5DRWA 3WCYA 1MVUB 4QRQB 3QUYC 3SPVA 3FQXB 3TZVD 2FGWL 1QFWL 3WIFB 1OTSD 3ULUE 4LOUD 5FM5O 2NXZB 4HFWA 3W39A 2IG2H 2D7PA 1ZTXH 1T2QH 3KG5A 1AHWB 4HIXH 3BIAX 4UDUB 4LSRL 2VQ1A 3ARED 1CFNB 2YK1H 4OFYA 5L9DL 2YUXA 5FHAL 4XWGH 3RWJB 3UTTE 2ICWB 2A74A 4LLMB 4JM2F 4R0LB 2YBRA 1NFDA 1Q9LA 3PGDB 4TPRL 5KOMC 4OKVB 4X83A 1QZ1A 4L8DA 3L7FB 1WSST 5ILTL 5J8OA 1FVDB 1KV3A 5MENA 1MVUA 4QRQA 3BPNB 4ERSL 1OPGL 5AUMA 4JG1H 4KROB 3EZJB 1EH9A 3KHQA 1Q0XH 2AERT 4P5MB 1AHWA 1G7IA 1MIMH 3SOBL 4QNPF 4NN7C 2YXFA 1RUAH 4OCRL 4Z9KB 3MV9D 3NH7L 2YXMA 1CFNA 5C2UB 5T33H 4M93C 3K8MA 1P5VA 3MMEB 4BH8A 4GXUM 3LEVH 4WTZA 1A14L 5CEYA 3RWJA 4FABL 3ARRA 3H9SD 5CLTA 1B9ZA 2ICWA 1Z6JT 1CE1L 3GI8H 4R0LA 3BUYB 4QTIH 2DMCA 4LSDA 3NCJL 3PGDA 3F58L 3MTRA 1JRHH 3KDMB 4OQTL 4P46D 4UT7H 4BFBD 2IFGA 2HKHH 1FVDA 3WYRA 2NQCA 2BNQD 4MHHG 3NIFF 5EZIL 2QQNL 3IDYB 5KAQG 4LIQH 2MPAL 1F45A 1NKOA 1T1WB 3WFEH 4JY5L 1DQDL 3QRGH 1K2DB 1JPTH 5C1MB 3IXAB 3RWEB 3ZE1F 3MO1B 2IPKB 1QLEL 3MJ9L 3TVMD 1URLA 1L4IA 3OV6A 3C9NB 3MMEA 4Z7VE 3BKML 5F7FA 4HEME 5JIPA 4JZJC 4HS3B 4WFFE 3GMRB 3BUYA 5IKCB 4PGBB 2PN5A 2HMID 2X4PB 4HIJA 4AL8H 3HI6H 4CU7A 4HFUL 3F8UB 3KDMA 3CMOH 2FJGB 3UZVB 4GRLC 3QHFH 4ONGL 5KSAC 4FNLL 4I77L 1DUZB 43CAB 3WSQL 3WXVH 5BW7A 1YECH 5I17B 5D1ZD 4PG2A 2NZIA 1T1WA 4O9HH 1K2DA 4OCSH 1CFTB 1OGTB 3IXAA 3RWEA 3MO1A 2IPKA 3TH3T 2HT2C 3S88H 3MRJB 4G8FB 4LSPH 3V8CA 5E8NB 5IT2H 1F90H 1EXUB 1YUHB 4OGZA 4Z7UB 1JHLH 1C1EH 1EX0A 1SJHA 5IKCA 5ETUA 3BH8B 2X4PA 2DQTH 3QUZB 3BKCH 3U4BL 2VLKD 5GGUB 4PRBB 4RMTA 5T3XE 2B1AH 2FJGA 3DOSA 4P3DB 2VH5H 1HXYB 3PABB 5IBTL 3AS1A 4JG0H 3GI9H 4FQHB 43CAA 4L3EA 2BP3A 2HKFL 5BS0B 5EU4B 1RZKL 4WUUD 4UQ3B 3D48R 4TUKH 1R0AL 2VXUL 1I9IH 1VENA 1CL7I 5AZ2L 2VE6B 5DVOA 1OGTA 3RUGB 2E6PA 1D5IL 2FJHA 4PBVC 1T0MB 4LPXA 2NXYD 1CD1A 1BWMA 2Z8RA 5F70A 1RQ5A 3MRJA 4G8FA 5E8NA 4G6ML 4JO3L 1B0RB 4LRNH 1EXUA 1YUHA 5ADPL 1UWGL 1JGVH 3KJ4C 3FQTB 3BH8A 1MCLA 2R0LH 1XGPB 3QUZA 3NFPB 2X9XA 3FQUB 1NUNB 4PRBA 4P3DA 1HXYA 4PJIF 4XPTH 5FGRA 1KPVA 3G08A 3RY4A 1ZA3B 3DMMC 3BN3B 4FQHA 4WDIB 5E95B 1OAUH 3ULVE 1MLCB 5DS8A 5BCAA 2MQ3A 2Z93B 4UQ3A 4MHHI 4LLVB 4ORGA 3SDCC 5C0AB 3RUGA 1T0MA 3GB7B 3BN9D 3JUYA 3KPSE 4NUJB 1FNEA 2AXJA 2X1QA 5DF0A 1CT8B 4R96B 1B0RA 3LN5A 3NGBB 4LP5A 4JDVB 5LJYH 4XP5L 3OL2A 4TULH 3VW3L 4LAJH 1I9JL 2Y23A 3MBXL 1IGIL 4OM1L 3ULUH 5M94B 3JVGC 4S1DD 1ULVA 3FB7B 4U1GC 1XGPA 3D5OF 3NFPA 4Z95L 3FQUA 2AK1H 5C9JB 3TT1H 2MSPA 1H0DB 3ELAT 3KPLB 3V6OC 1MLCA 1MI5B 2XTJD 1G0XA 5KS9E 1CK0L 1T83A 2P8PB 2Z93A 3AS3A 3C5ZC 3SDAC 5C2BH 2FX7L 4HGKC 4D0BB 4LLVA 2R9HD 5C0AA 2GJJA 1DTUA 1H3UA 1X5AA 4Y16B 4NCC1 3GB7A 1MCOL 1U8PB 3O45A 3EBAA 3RL2B 3GJFH 2PF6A 4NUJA 3N0PB 1CT8A 4R96A 5L7XL 1T7XA 3LH2L 2F5AH 1MCQA 3O6LH 4JDVA 4FZ8L 5EBMA 4PJDA 2H32H 5D2LE 1I8LC 2VNCA 1FCGA 2UUDH 1JWMB 4IRJD 4Y4HD 3QUMH 1CGVA 2CXGA 4FFYH 3LOWA 4ODVL 5C9JA 2BNRD 3JWOH 3W9EB 3T0DA 1UH3A 3FO9B 1Q9KB 1X5HA 4XC1H 1G9MC 3MFFB 1H0DA 3KPLA 3HC3L 2XA8L 2XZCL 1U0QA 3AY4C 4WTXA 1D6VL 2DICA 1BOGA 1MI5A 3QCVH 4QWWC 2F15A 1T0NB 3CFKB 1WTLA 4ZFZA 1OAXH 3ARBD 2P8PA 4WRLA 4NRXA 4D0BA 3ARXA 5H8DA 4Y16A 1T7VA 4CGTA 3MREB 1U8PA 3RL2A 4YH6A 5HPOA 1C16B 1WCQA 4XCFH 4O58H 2F19L 4X6FB 4LMQE 3MLRH 5EN2B 3MC0A 1GC1C 1JWMA 5T5NF 5EU6D 4P49A 3W9EA 4LCUB 4U0QB 1KTKE 4N8VG 3MFFA 3U30B 2GI7A 4NZJA 1VGEH 1GH7A 1GCFA 4ETQB 1T0NA 4JFFE 5CGMA 5D5MF 4QHLA 4QXTB 3QCUL 4JHAH 3EJZD 2VLJE 4I4WB 4X4XB 2GT9B 3MREA 5GSRB 1JK8B 3WO4C 3BVNB 1BHGA 2VQTA 4R2GB 5JA8B 5DMYA 1J11A 4NM4H 3HNVL 3CK0H 3N9GH 1X6NA 4XP6H 2MQ0A 4BH7B 5IV2A 1BF8A 5EN2A 4Q2ZB 3RWDB 4M02A 4KZDL 2ARJB 2OSLB 4M6AA 4QNPE 3FQNB 3VI4F 3PNWB 4PRPB 2AVGA 1KN4H 4LVEA 2ERJB 2FIRT 4LCUA 2E6JA 2CLZB 5A1AA 1JI1A 4IDLA 2VDNH 3L3OB 4K23H 2APTA 3C08L 2HTKC 3NZ8B 4ETQA 2AJYH 4HJJH 1MCPL 3SGEH 4QXTA 5KOVC 3BHBA 3WFZA 4CVWA 4I4WA 4X4XA 4F58H 3DHJA 3FFCB 2X09A 2GT9A 4QXGH 5GSRA 3U0PB 1JK8A 3BVNA 1HYRC 1AE6L 4UT6H 4YWGL 1FFOA 4HUUB 4RGOL 3NIFE 4IRZL 4XP9H 1TPXC 5DR5H 1KB5B 3HAEG 3TF7C 4O51B 3RGVB 3KPQB 2FATL 3VFOB 3B9KA 4EOWL 2AJUH 1BREA 3PQYB 3QI9B 4G3YH 4Q2ZA 3U1SL 4JQIH 2ARJA 4HUXB 3PNWA 4PRPA 3U4EB 3ZE1E 1N3NB 3LKPB 1ZLSH 2CLZA 3BKJL 1Z0MA 3SCMC 2XWTA 4QRRD 2X4TA 4NQCA 4BSVA 2E9BA 4MXQC 4X5LA 2OL3H 3WUWB 1HZHH 1Q8MA 5DVLA 2YN3A 4R8WL 3EYUH 3IAQA 3M8OH 4MS8D 4M62H 5GS0H 3CGTA 1CFVH 3FFCA 5E6IB 2VZOA 3D39E 3K1KC 4RMUA 1LO0L 3UTQB 2A1WL 1WISA 4HUUA 4LLYB 4LDEB 3CJJA 3LIZH 2NY1B 3OAUH 1JNHB 3ULVH 1KB5A 4X6CF 3O4LB 4HXBH 4O51A 1QR4A 3KPQA 3RGVA 3VFOA 3NTCH 4S0SD 3MNVB 3QI9A 1QFHA 3MV7A 3V7AE 4Z7WF 3OB8A 3SKMB 5FM5M 4HUXA 3BW9B 5E99L 1N3NA 3RIAK 3KPNB 3FB5A 5FUOH 3CH1B 1MCEA 4MYWB 5J56B 4EDWL 5I8OH 3C8KB 1HHIB 5GGQH 4RZCB 1J8HE 5T1LD 3VGAC 1KJMB 4O5LL 5DD1L 4JFHD 4OLZL 3I9GL 3WUWA 4OV6F 1CXKA 3SQOH 4KJWC 5E6IA 4ZAKD 1CICC 4WI3A 2APFA 5HGBB 1GXEA 2UZIH 3WUZA 4A6YL 1GJIA 4W81A 1SVZA 4ELMF 2DI8A 5CILL 1W0VA 4LLYA 1T2QL 4K55A 2WLZA 4K3JL 4LSVH 5DJDB 4HIXL 1JNHA 4KDTA 1FZOA 3MV01 3O4LA 5F8QC 1VFBA 2VSDA 5EO0B 1MHEB 1N6QL 2HFEB 3BW9A 5D1QD 1EO5A 4P2QD 3JTSA 4XWGL 1G7JB 3GHEH 4CMHB 1Z5LB 5JW4R 3C8KA 1JYVA 3GO1L 2FBJH 4KKCD 1KJMA 3I6GA 1BEYH 3HZKB 4GQ9L 2RBLA 1NBVL 1EHLH 5I1IL 3DIFB 3OWEA 1HDMB 1T80A 5AD0A 3ARGB 2VWEE 3MNZB 4WHYH 1JWUA 4PJIE 3DX8A 2CLRA 4ZFOA 2JJSC 3ZKSD 1XGYH 2AP2A 2KPNA 5DJDA 4AIZA 4I0PD 2N56A 3B8YA 5FYJD 2YPKB 4NJAL 4BZYA 5EO0A 3DYMA 3OB0K 5T33L 4OD3L 2D03H 4NWUL 3QHZL 4P5TD 1IEBB 4P59H 1HIMH 5EDXA 4HWEH 2EO1A 5DUPL 2PO6D 3D2UD 2J8HA 1OP9A 1MJ7H 1JRHL 4O02H 3O6KL 3QISA 5HDBF 4G7YL 3DX9B 1HDMA 3ARGA 1TTFA 3MNZA 1B4JH 3Q5TA 1OTTD 2GCYA 2OI9B 2YA0A 3WFEL 3BMVA 1JPTL 1BD2B 1Q0YH 1T6VN 2YPKA 2ZOKA 4PRID 5HYJA 4WO4B 2ATPB 3OAZK 5CD5C 3TV3L 4K8RL 4H0HB 1IEBA 4ACPA 2E8ZA 4EQ3A 3KYOB 4M7LH 3NPZB 1NCUA 4G6KH 1NC4B 4PJ9B 3ARPA 4YE4L 3DTXB 4WI6A 5IEHA 1NBYB 2JB5L 4WWKB 2D0HA 3VRJA 4OLXH 3DX9A 3WKMH 4PRHE 5IGXH 4APQC 5BOZG 5AG9A 4N0YL 4UI2A 1JV5B 5I16B 5L6YH 5C6PB 3L5IA 1BD2A 3U7WL 3MRFB 4MVBD 2D0FA 2BJML 4WO4A 2ATPA 1GGIH 1PAMA 3WMSA 4AEHH 1KGCD 3C6SB 3V4UH 3KYOA 5MEOB 5ICXB 2JKXA 5F3HA 2D4FA 3L3GA 1JHLL 5EU3B 3WJJC 2CKBL 1U3HC 3SDXE 2F54D 3OR6B 4G43A 2N7BA 1UJ3B 3PF2A 3T65B 1NBYA 3BKCL 4WWKA 2VDPH 5C3TA 1U3ZA 3GI9L 2DQUH 4CRPA 3BD4A 4JO2L 4D9RE 1YYMH 1JV5A 4YHYB 2VXQH 1QYGL 5D93B 5D5ME 5CP3A 3U9UB 2JB6B 3LQAC 1B0GB 2HTLC 4R97C 5F7LB 4X6EB 4XXCC 3C6SA 3C8DA 2MTPA 4LCWE 5MEOA 1S78C 4ZTPH 2O61B 3D9AH 3OR6A 5E5UB 5D96C 1WFUA 2R0LL 4XI5D 2NY0B 1UJ3A 4DCQB 3ZYOA 3VGGA 3L5JA 3VXOB 1FPTL 4B53A 5F9JB 3BQUB 4XPTL 3E2HB 4OGXH 1WICA 4P3WA 1TZHB 4PJBB 1IMHC 2CR6A 3RNKB 3HMXL 5C0EB 5CSBA 1MY5A 1O7VA 3MUHL 4GAJH 4WW2B 2PYFB 1KCSL 4IDJL 2Q7YA 3RWFB 3S5LG 2NY2C 4HUNB 3U9UA 3NN8A 4GAYB 3HCVB 4LSSH 4PY8J 5DRXB 4DEPC 1FYHB 5MHSE 4I1NB 1WFOA 2BVUA 4KY1H 4ZQKB 3RTQD 3LMJL 5I1HH 4KUCD 4NYLB 2AK4E 2F53E 1CFSB 4TULL 3Q5OA 3U6RB 1MFEL 3ULUL 1T21B 1IAOB 2O61A 1DL7H 1MFBH 4Y5YA 3U7YH 3IDMA 4WI7A 2R56L 1BJ8A 3O2DA 4DCQA 1NCDH 3HRZB 3TT1L 5SV3A 1IC4H 5F9JA 1UYWL 3BQUA 1TZHA 4BSJA 4PJBA 3O3EB 3BE1L 1OGAA 2ATKB 2PYFA 1EMTH 4NC1C 4ZFFB 2APWA 2PKDA 1F00I 3RWFA 2DJSA 5JHLH 1GZPA 4WI2A 3RP1A 4LLDA 5FGCB 3F7QA 1E27A 4U1SB 4GAYA 3HCVA 5DRXA 3BDYL 2XQBH 4ZQKA 2WWMC 1MWAL 3T0AA 2F5AL 5FCUL 5FCSH 3O6LL 1BBJB 2E7HA 1F4WH 3DBXA 1EAJA 1NCBL 4BUGA 1CFSA 3ESUF 1ZLVK 4L4TB 1ZS8B 5DLMH 3U6RA 1P84J 2DQJL 4PJHB 1NC2B 3IDJB 3QUML 4X6CE 1YNLH 2E7LC 4FFYL 4ZS7H 3HRZA 1L9NA 4HPOH 15C8H 1KYOK 3EO1B 2YOCA 4HPYH 3J8F7 4Q6IA 2ENSA 4UILH 2IF7A 4LHQB 3OKYA 2QHLA 2YWYA 2ATKA 3DX7B 1OAXL 1CVRA 1YEFH 4P23B 1J0HA 3GSNH 2I60L 5GS2H 4DQOH 1CU4H 4Y1AA 2WWKT 1ORQA 5J12B 5C0GB 4DKFH 1KCRL 4RFEB 1LD9B 3ZE0F 3BGAA 1EO7A 4MD4A 1BBJA 2RAMA 4DWHA 5C08E 3IS0X 3HG1A 5ESQB 3MLRL 4L4TA 1ZS8A 4LGSB 4H26A 4TOYL 2O93L 2A9MH 5EORL 1FFPB 1V5JA 3VWKB 8FABB 4FFWD 4LQFH 4YHKH 4HIIB 4PJHA 1JF5A 1NC2A 3IDJA 4WFHE 1R3LB 3PGFH 4RRPA 1XR8A 4AT6A 3EO1A 2HRPH 2DLIA 4MQXC 1WZKA 1VGEL 1KEGH 5A3IC 1IKNC 3DX7A 4RSVA 4P23A 1S5IH 4Y19D 1MIEH 1F3DH 4XVJL 5ISZD 5C0GA 3MCLL 3E6HB 3BJLA 5ID1A 2BFVH 4H5SB 4RFEA 1LD9A 5MEPB 4X6DF 2EZ0C 4LVHB 1A5FL 3G9VA 3TJHD 4XP6L 5CUSL 4MAYB 5T1KD 5CSGA 4RFNC 5JW4N 3FZUD 1FFPA 3VWKA 2R8SH 8FABA 3I3BA 1PD6A 2ORBH 2IADA 4HIIA 1R3LA 2OLDA 4Z0BH 4AG4L 5LKNA 2BHUA 2IAND 3V5DB 1DN2A 5EOCL 2DQGH 4U2ZA 2HP4A 3GIZH 4U3HA 4X9BA 4NO5B 4MZ2A 4X9GA 2VDNL 4K23L 4Y8DC 1U8KA 1IAIH 4XMPH 4GSDH 1CGYA 3FRPG 4V2BA 1I9EA 4QXGL 5K93A 1MH5B 4GKZB 4YHIB 1MUJB 3E6HA 1KJ2H 5HDBE 3FB6B 5T3XL 4H5SA 5MEPA 3T0EB 3OHXA 3TIDB 1PEWA 5CEXB 2ZUVA 3CFJB 4Y4KC 1UZ8B 4XP9L 3MRPB 1A47A 4DVBA 3K46A 4G3YL 2R29L 4S1RH 4JQIL 5C09E 1ZHKB 3MJ7B 2ZUYA 4I2XA 4FQQB 1I1AD 1NMCC 4MNQA 3VXRE 4RX4A 4ORZC 4H0GA 2E7MA 3S36H 2VL4A 4KRNA 4JKLA 4K3EH 1A1MB 3TYGL 1J0JA 3DUSB 2R0KL 2DMBA 3MROB 3A67L 3NCEB 2PYEE 4TTDD 2IMMA 3ARZA 1F6AA 4U3XA 1VGKA 5JXAH 4GW5B 2XKSA 1PVHA 3VXUB 1MH5A 1EHXA 4GKZA 2IAMC 4AJ0A 1OTUC 3QDGA 3QDJB 2GIYA 3FB6A 3VH8A 5J13C 3T0EA 1MJUL 3TIDA 3WIHL 2EICA 5CEXA 3CFJA 1UZ8A 4I3RH 4CW1B 3ULVL 5TJWK 3CFBB 3BH9B 5CIPH 3M07A 4AIOA 1JYWA 2KKQA 3NTCL 2ICWJ 4YPJA 3BRDA 3BOVA 3MJ7A 1UGNA 1XGQA 4U33A 4XNMA 4L29A 5FUOL 3NFSH 3GDBA 3MX0A 2V17L 5I8OL 2HFFB 3ZKXC 3VE0B 2XQYK 2GJ6B 3MROA 1GGTA 4NPYB 4OFDA 1RMFH 4ODXA 3VXUA 1TMCB 4K94L 5E9DA 1F3JB 1ORSB 3UC0H 4R90L 3B2UD 2ICEA 1E28B 1FIEA 4Z18A 1OP5K 4LSVL 2X4OB 1V7MH 1S7VB 3BH9A 1QSFE 4YIQB 5SV4A 3CLEH 4LLAA 3KVQA 4JKWA 4LK4A 4W4NA 1WWCA 1EIBA 1UQSB 5DJCA 3GHEL 3LV3B 1JGEB 4HT1H 5LGHH 4MJ4A 3VE0A 1BEYL 2GJ6A 5E6YA 4P4KB 4CJ0A 3PXHA 4NPYA 1S7XB 5HVHC 5J89A 1T83C 1XFPA 3CDYA 1F3JA 1ORSA 3X3GH 4NO3B 2W0KA 5JW3H 1TCMA 4M1GH 1XGYL 4XPFH 4TNWK 4LCIL 4OT1L 5HSFA 1CD9B 2HG5B 2X4OA 1S7VA 2RCSL 4K9EC 2H26B 2Y07H 4WEMB 4IJ3B 4YIQA 4ZUUA 3VRLF 2DM2A 1QA9B 1FYTB 3MLUL 5DQDL 4UV7L 2D03L 3DROB 1YEIL 5DEZA 3IDXL 1HIML 4JEGB 4WFFD 1E4WH 3V6OE 3WIIL 4RAHA 3EO9H 2HAZA 3QFJB 2EDRA 4OLUH 1NMAL 4YZFF 3SGKA 1MAJA 5C07B 3BKYH 3LRSA 5F21B 1XCQA 4P4KA 1MJ7L 4PJCE 4BUHA 5IJKA 1FFNB 4GO6B 5DK0B 1S7XA 5FGBA 4KJYB 1ZVSA 3I6LE 5IK3A 4NO3A 1B4JL 5JPMB 5FEBA 4P57B 5DUBB 5HBBA 5HGHB 1X5FA 5M7QA 4HS8H 5D1XB 2AS5M 4JRYE 3CLFL 1QA9A 3QWOB 1WT5A 4JB9H 2GSIB 3DROA 4IOSD 2X40A 5DURD 5IB3B 4GRMA 5HHPB 3MA7A 5H35B 1I1YA 1P4LB 1SEBB 5JDJA 4XP1L 2DLGA 5HHOA 3ES6B 2JE8A 3HE6C 4Q6YA 3RAJL 5GS3A 1T2XA 4J6RH 1B6UA 1JGDB 3QFJA 3ZKNC 1JUFB 4G6KL 5C07A 1UWEH 2GAZB 1F6LL 1YQVH 5TQ0H 1FFNA 3ROOB 3Q6FB 3K4AA 2Z91B 1IGFH 3OKLB 4UTAL 5CGYD 3WS3B 4OUOA 1CBVH 5JPMA 3L5HA 2NLJB 3GMLB 3VXME 3U2SB 1BLNA 2Y4SA 4P57A 5DUBA 5L6YL 1A6ZA 3C5JB 5GRJH 5HGHA 5A40E 4F33B 1H3GA 1KFAH 3MYZA 5D1XA 1OW0A 1SBSL 2P43B 3QWOA 5IQ9B 3HC4H 2IWGA 2GSIA 5CBAB 4UAOC 2EE9A 5IB3A 2P5WB 5HHPA 1I8IB 4YHZH 5FV1L 1SEBA 3RA7L 4F7TB 5H35A 3ES6A 5GS0D 1YJDL 4HJ0C 3ZE0E 1JGDA 2JCCB 2VOTA 2CMRH 1N0LA 4NHCL 1S9WB 4E42B 4DUVA 2GAZA 3L95B 5EUOA 4Z0XB 4KK8C 2VDPL 3Q6FA 4JO1L 5DYOA 2Z91A 3OKLA 2PETA 3ULVD 4W68A 5KSVA 1Q9WB 4AEFA 2DQUL 3VFMB 1DSFH 3WS3A 2O5ZH 1X4XA 3HRPA 4P9MH 1PX4A 1MAKA 2XRAL 3U2SA 3ALPA 3ETBF 5AWNL 4WJ5B 1I1CA 3ARDB 5SWSE 1IM9A 4LASH 3JBG7 2V5RA 4MJ6B 5D7LD 4F33A 2DDQH 5HDLA 2EXYD 3B2VL 3LHPL 3Q1SL 1YEKH 5J11B 2CO7B 5IQ9A 1N7MH 2D31A 5CBAA 3B9KC 3MLTA 1I8IA 3I02A 5ICZB 1ED3A 3EOYG 4F7TA 4XWOD 2EYSB 2RQ8A 3C09B 5BVPH 2P5EB 4I9WE 4D94A 5C0DA 2JCCA 1FGNH 4L4VB 3L95A 4F7CA 4QGTA 4F9LC 1EJOL 1ZVYA 2R4SL 4HDIA 5C0IB 3VFMA 1A3LL 3QEQE 4X9HA 3I6KB 4I48B 2R4RH 2GUOB 3QNYB 3ZE2E 2ZPKH 2P48B 4XCCH 3QDMD 3UMTA 1X6LA 3BDXA 2ZUUA 1A9EB 5B38G 5JOFB 2YRPA 3C60B 3R0NA 4DN4H 4Y4FC 1TVHA 1II4E 3TZVB 5JXEC 2YD3A 4P2CG 1FDLH 5ICZA 4FQPA 5HI5D 2EYSA 2Y5TA 3ZTNH 2P5EA 3F6LA 1G7LB 5F9AC 1NJ9A 3U7YL 1YNTB 3AREB 4L4VA 3WLWD 2P24B 1NEZG 4F57H 4RNRA 5BRZD 1GYAA 4OTXH 3UTSE 5C0IA 1N64H 4LU5H 4PJ5A 2YKLH 3NA9H 4I48A 1QSEB 3QNYA 4RA0C 2G9HA 5D7JB 3ZHDA 4OF3A 1E4XH 1A9EA 1AC6A 3QXVA 1BZ7B 3H3PL 5JHLL 1VDGA 3U7AA 3RVTC 5JOFA 4PP1D 1NFDF 4GQPH 4P3CH 5I66B 4LVNB 3PP4H 4NKIL 1RJYA 3MZGB 4KDTC 3TZVA 2XQBL 4HQQH 5DD5H 3VFNB 2YZ8A 3P73B 3F7YB 3OKNB 4OCMC 1FLRL 5E2JA 1GGYA 3BO8B 5J3HD 5DLML 4HZLA 4OCXH 5HGGS 1G7LA 1T1YB 1YNTA 3MV9B 3AREA 1WEJH 5LGJB 3W11D 4M7KH 1RUPH 3MA9L 3RVXC 2BRRH 5MI0C 3PWPE 3H9SB 4JN2B 1BQLL 3TO4D 4JM2D 4MJ2A 5HVGB 3H2WA 3O3AB 3IF1A 5E1AB 1HXMB 1QSVA 1YEFL 1G7MA 4KK5C 2A77H 5KN5B 3KXFE 3BPLC 5F72S 5FF6B 1CU4L 4P46B 1FV1B 3LSOB 4GRWF 5I66A 4XMKH 2WIIB 4YDIL 2BNQB 1FO0H 5TE7L 3VFNA 2X9WA 3P73A 3QIWC 1QFWM 2NX5B 3BD5A 1RZ7L 1SY6A 3OKNA 4W6WB 3DXAB 4NQED 4ETYA 4DOHE 4NQTA 5E00A 3GBML 4Q9CA 5I1CH 3O81A 3FOLB 4LQFL 2CK0L 4ELKB 3GJEB 1T1YA 3PGFL 2R69H 3MV9A 2F8OA 5LGJA 3QPQD 4FTVE 5FKAB 2HRPL 3D3VB 3H9SA 1GOHA 4JN2A 1UM6L 4NCDA 1J1XH 1KEGL 5JR1H 5KVEL 1G9MH 2C3GA 2QADD 2ITDB 1XEDA 2NY7L 1PSKL 1IFHH 5HD8C 5KN5A 1S5IL 1RUQH 5FF6A 2A73B 2FD6H 1JFQL 4L1HA 3IU3B 4P46A 3LSOA 1MIEL 3STZB 5ABDE 3T1WA 4RWYH 1MJ8H 2D9CA 3VFSB 5C0CD 4LCCB 1RAMA 4R4ND 1RPQA 5DJ0A 2BNQA 1SJXA 4MMZC 3RVVC 4KPHL 4X4ZA 3EFFB 4OKDA 4ZO7A 4GT7A 3F7VB 1NGZB 5D1ZB 2VJXA 3QDAA 1QBLH 3RVWC 3H9HB 4F15B 3N1FC 2ORBL 3C87A 3GJEA 3TVMA 4Z0BL 4ZSOB 1GC1H 3GUTB 3U82B 4HWBL 2DQGL 1TCRB 4DKEH 4FZEL 1H3WM 3BT2L 5FKAA 3AMKA 1W0YT 2ITDA 2HWZL 2OTPA 3ESVF 1MCCA 1R5VA 1E4KC 1IAIL 4U0RB 4XMPL 3EDFA 3GSOA 4OI8A 4YZFE 3S36X 2A73A 2A0LC 3VDAA 3IU3A 2HT4D 3FONA 4ZODA 3D39D 3VFSA 3S3PA 5IB2A 2X4SB 3LRHA 3KAAA 1C12A 2YN5A 4UBDD 4JRXD 3MRBB 3EFFA 3F7VA 1NGZA 4WUUB 5D1ZA 3SE8L 3H9HA 3WLBA 5JQ6L 1V7NL 4GBXC 2EYRB 3O2WH 3BI9X 2ZCHH 4ZSOA 4M7ZB 4OB5H 4YHOH 4FQXC 1Q72L 1HHKB 4ODWB 2FO4B 3GHBH 4ZPVB 3S8WA 4EVNB 4MJID 3S36L 3SDDD 3W2DH 1F58L 4B5EA 4K3EL 3RZCC 3UBXG 5DMGD 2CD0A 1TQBC 1L7IH 1AXIB 3MRCB 1NL0H 5SWZB 2W9EH 4LARH 1R3IH 5JXAL 3REVB 3QBTB 2IFFH 2X4SA 2OYPA 3RJDA 5BVJB 4YDKH 4N0UE 4GW1A 4MCZB 2DKSA 4I3RL 4WUUA 2RR3A 4NHUA 1VEMA 4N0FA 1ES0B 4Y5VC 2EYRA 4M5YH 4Q9RH 3HAEA 1S7UB 1M05B 4S1SL 3VGHA 2VABB 4ODWA 5K59F 3SGEI 2FO4A 1XT5A 3BAEH 5D7KE 1GHFH 1W72L 3B8SA 4J8RB 5F9DC 1ROWA 2HVKB 2EC9T 5CZXC 2J6EH 4KRPD 4AQOA 1PYWB 2X10A 2WWKO 1MHPL 3MRCA 3GJFK 5SWZA 1P1ZA 3U0TB 5AG8A 1PG7X 3O3DB 2NXZD 3P9WB 5BVJA 2XTJB 4PRDB 4MCZA 2UUDK 1HHJB 6FABL 1YEHL 4YK4C 3D85B 3P0YH 1ES0A 1DBBH 1KIPB 4N8CH 1ZLUH 1PW3A 2WK2A 4MCYB 1HCFX 4DGIH 4D8PA 4ONFH 1M05A 3QIUD 4Y5YC 3IKKA 5E2VH 5GS2D 4XPHH 2NY0C 3KGRA 4NKOB 3EDKA 4X98A 2FEDC 4ZTOL 4HT1L 1I3GH 2XG5A 4M7JL 1IE5A 4J8RA 1KCUH 3OX8B 4Y4HB 4PS4H 2CIIB 1FNGB 1PG7L 1LO2L 4KHTL 4PJDF 1MVFA 2J3SA 5HI3D 4XXDB 4IOFC 5DQ9B 3DVIA 3U0TA 4EUPB 4M5ZH 4KROD 2MHAB 3CSPA 3O3DA 3MPCA 1ACYH 3X3GL 1G6VK 1G6RH 1PFCA 2C4FT 3QQ9C 5DEGB 5E08L 4L8CB 4M1GL 4PRDA 3QIBB 3ARBB 4O2FA 1UADC 3ZDYF 2Y07L 3MLWL 5GRVK 4WENB 1KIPA 4MCYA 4PJEA 4LLQB 2WP3O 1IGCL 1MFDH 3ZT7A 3WFDH 3GSXB 1FVEB 1DE4B 4NKOA 4OQTA 3EO9L 1PBYA 4YC2C 4OLUL 4NC1E 4PLOB 4U1JB 3OX8A 4IRJA 1LILA 4Y4HA 12E8L 4Q6IC 2CIIA 1FNGA 4OD2B 4OI7A 2BNRA 3UBXI 3O9WD 5DQ9A 5C0NC 4QO1A 2EH8H 5IFHH 3G5VB 2MHAA 5E94B 2GHWB 3S34H 2OZ4L 4L8CA 1FZKA 3QIBA 3ARBA 3QFDA 4XAWH 3C8HA 5FYLE 2OR8A 2FH8A 2X6MA 3UPCA 1LO4L 1MREH 3PP3K 1AD9B 4KXZH 4JB9L 2I5YL 4LLQA 1AFVL 5E8DL 3BD3A 3K2UH 5MERB 3GSXA 4I3SL 3LKOB 1HI6B 3O0RH 5HI4D 3MYJB 3WJLA 5DWUL 3CMGA 3L1OH 4N5UA 4XMLH 4U1JA 5MENE 2W0PA 3HZMA 3VXPB 4X7DC 1NLBL 3RDTD 4NC0B 4DKAA 1YQVL 5EU6A 2GKIA 3PJSB 3VFVB 1OHQA 2A6JB 4MNGE 3B3IA 4I3GA 3G5VA 3O11B 5E94A 3K74B 4D9RD 2DQHH 1SJVA 1GOGA 2AEQH 5ACLA 1MPAH 5GGRB 3S4SG 4DFHA 5GRJL 2F5BH 4NN6B 3OF6D 1FL5B 4WVRA 5DHVA 1DN0B 3R8QA 5IESL 3T4AB 1KENL 5K33A 4AENB 4TNVF 1AD9A 2BVQA 5HGAB 4GRWE 3V7AG 4U6TA 4YHZL 4PY8I 1DVFC 3LKOA 3HUJF 5GXBB 3MYJA 2EEBA 1OSPH 1G0YR 4G8IB 3VXPA 3VFRB 8CGTA 1SVCP 4ZOBA 2X5PA 3VFVA 3PJSA 2YSSB 4XTRD 4U1NB 4HK3N 2DLFL 4ODSH 1DSFL 3O11A 2O5ZL 5BS0D 4QRRB 2WANA 3VD3A 4P9HC 5IB5B 3OGOE 3RKDD 5J6HB 5TDPB 3NCYS 3QEUA 2EDJA 2EE2A 1WK0A 2BC4A 2R1WB 3UZQA 1ZV5A 5MHSD 1DN0A 2DDQL 3P11H 3T4AA 1YEKL 2PXYC 5L0QC 1N7ML 5HGAA 1AGDB 3O4OC 4QKXB 4XPGH 4O00A 4JAMB 3IFOB 4KTEL 3MLSL 1JVKA 5L2KE 5BVPL 2W38A 4G8IA 1FGNL 1WBXB 1RVFH 1R5IB 2R23B 2CRMA 5DFVC 3VFRA 2UWEE 5BOPA 1K8IB 2YSSA 4PB0L 3EJJX 5F9WB 1OB1A 4U1NA 3HI5H 5AAMA 1FNSH 1RSFA 3RI5K 4QRRA 4W4OC 4HLJA 3BEVB 2ZPKL 4XCCL 5IB5A 4PYHA 1A6AB 3IU4H 1AKJD 2XACC 5EO1B 3F62A 4GOSA 2R1WA 5F97E 2VYRE 2YMXH 1AD0B 5FA3B 4X4MA 5IBUB 3QO0B 1YPZB 3EJYC 1MFAH 4FQJL 1RURH 3F7RA 4B0MM 5EWIH 3S5LB 2EDLA 1AGDA 1QFPA 2D7MA 3LQAH 3QWQB 3SEPA 1CZ8H 4JAMA 1CXEA 4NN5C 5IQ7H 3FO0H 2YC1B 3L3KB 5JIHA 2AGJH 1U8OB 2AI0L 2NY5C 1NEUA 4XPAH 1WBXA 1R5IA 2R23A 2W65B 4L3EE 5JNYB 1I7RB 3QUYD 1K8IA 2BY1A 5CS7A 4P2QB 1PKQE 2JELH 3K4DA 3PWVA 1BVLB 1MHHB 5DJ2B 4OTXL 2EDBA 5DJYB 1MI5D 4LU5L 3HNSH 43C9B 1IGTB 1U42A 3MUGA 3VGDA 3BEVA 3DECA 5T1LA 5M95B 1S7WB 1A6AA 5JUEL 4JCLA 4OGAC 1HEZB 1VPOL 5EO1A 2FHFA 5FA3A 4HS6B 1EGJH 3QO0A 1YPZA 3PP4L 4PY7B 4NJ9H 5BQ7B 3S5LA 3UTPD 3SGJC 1G7PA 1YZZA 2XWBB 3SJVE 2YC1A 3L3KA 5L88L 4Q9QH 2FX8L 4I0PB 1UA6L 1VERA 5TPWL 4F7EA 3WEXB 2Y1VA 5I15L 4NNYB 2WZPD 2IMNA 1KELL 1U95A 5D1QA 4YFLF 4P2QA 4P5TB 4Y5XA 5JPNB 3WD5H 2PTTB 2BRRL 5TF0A 1MHHA 3T4YA 5DJYA 3PUCA 4HF5L 5K59E 1YYLL 43C9A 5J9PB 2ED8A 1MAML 1QFUH 1PLGL 1WFTA 2PO6B 2WQ8A 1S7WA 4D3CH 2A77L 2Q3AA 4LPWA 4K7FB 1HEZA 1RI8A 1Z9LA 1ACZA 4NRZB 4PY7A 4Z8FL 3NVQA 4M61B 5BQ7A 1FO0L 1MRCH 2R1XA 1X5ZA 4MB4A 2XWBA 4NRYB 5GRXG 3T77A 4K3HA 4I0PA 1B2WL 4P5KA 4PP2A 3C2AH 1U8LB 4PRIB 3WEXA 4YHNB 1MSPA 4NNYA 4JRWA 3SGKC 5CJQL 1C8PA 4P5TA 5JPNA 2PTTA 1QVOA 4P2OC 5DJXB 5JMOC 4P4KC 5C0AE 5IJKC 5GZNC 3Q6GH 2ZZUT 5J9PA 5FGBC 3SHSA 2PO6A 1IJ9A 3D2UA 1IFHL 3MBEB 5DRNB 5E8EA 1AQKH 2DBLH 1QRNE 1OD7A 2FD6L 1IC7H 4KMQA 4K7FA 4LPYA 4RWYL 3BXNB 2SEBB 3KYKH 4PJDE 1IM3B 5FO7B 5A16B 4D0CB 4M61A 4PJGE 4OZIB 1A7OH 4ENEC 2X1WL 3H9ZA 3RGHA 1WT5C 1QBLL 4NRYA 5EZJB 2YZ1A 3M45A 4PRPD 1U8LA 1ZHLB 4GRLD 4PRIA 4U31A 3ZDYE 3JZ7A 1XH3B 4I18C 5F9OH 5KSAD 3I50L 2JJUA 4D9LL 3LKQA 3CX5K 5DJXA 3CVIH 3TFKC 4GRWH 1VCAA 4GXVH 2PYED 2EDOA 1PJ9A 2W91A 4NC2B 5DRNA 1XIWC 4OFIA 1P9MA 1JHTB 2NMSA 1FE8H 3V6ZB 4WFGD 3LZFL 3QG6B 1IM3A 5FO7A 5LG1A 2XPGB 4D0CA 1XGRB 4LEOB 2QQQA 4EI5B 4F2MB 2F58H 1CCZA 4B7LA 5EZJA 3IB4A 3PQYD 2BMKB 2WIMA 5DZOA 3RPIA 1HINH 4ALAL 1S9KC 1A6UH 3H42H 3UJTH 3O2WL 3L5XH 1U93A 1ZHLA 2ZCHL 3B9VA 4OB5L 1XH3A 2H2SC 1GPOH 5GGTA 3GHBL 4NBXB 1ZGLB 4FRWA 5K9OB 1FZMA 2G5BB 4OLWH 3W2DL 3GMMB 1Y18A 4Y2DD 2C26A 2F54A 5IHZA 4R3SB 4PJAB 5KVFH 4X7TB 3MNWB 1JHTA 1M7XA 2IBBA 1R3IL 4LARL 1AO7B 4G6JH 3V6ZA 2UY6A 1ONQA 3QG6A 3FRPA 3W9DA 2XPGA 2H45A 2C3WA 4LEOA 1KPRB 2NY1D 1GOFA 4L1DA 3BRGC 4Z5RB 2O5XH 5ID0B 3SO3B 2BMKA 2JJVA 4F8TA 3OJDB 2FYYB 1DLHA 3DV4B 3VXSB 4MX7B 3KJ6L 5IROC 1A7RL 2EDEA 3LQZB 2XZZA 3DMMD 3RTQB 5C0BE 1ZGLA 4ZNEA 2VXVL 4LPUA 3QSKB 3GMMA 3SDCD 1LP9F 1HH9B 4L5FL 2V9QA 2J6EL 1TJHH 3HUJE 7FABH 4PJAA 4U05A 5C6TH 1TNMA 3NAAH 3MNWA 1E0OB 1KSRA 5I1EH 4NQXB 1S7TB 4XPBL 2ZG2A 3OKKB 3DSFH 3O6FB 4XCNA 2GITB 2BVOB 2CXKA 3BYTA 2IEPA 4AM0A 1KPRA 2L7JA 1DQML 5ADOL 5J11C 4Z5RA 3WDHA 4PJBF 1EO8H 3CVHL 3QUXB 1NLDH 3G6DH 1K6QL 3LPWA 1DBBL 1QLFB 3SE9H 3TCLB 3OJDA 2FYYA 4JGMA 1A6TB 3W0WB 3CXDH 4NQCE 3LQZA 3RTQA 1BFTA 2EKSB 4XC3L 5F3BB 4XPHL 4F8QA 1C5CH 3ILQD 5AZEH 3SDAD 5HYIA 3C5ZD 1TDQA 3MOAL 3U0WH 3VXQB 1KCUL 3AS2A 1U36A 2FCBA 1ZWIB 3QQ4B 3QZWG 1KXTB 4NQXA 1S7TA 1QBML 2BSED 4M5ZL 5F8RC 2BVOA 4MA8L 5F93C 1ACYL 2VXSH 1G6RL 5LWYH 5BO1L 3MV7E 1HILA 1XAUA 3QNZA 1I85A 2YPLB 1U8QA 3U36B 4L3CB 1XF4B 3A6CH 4LOUC 3TCLA 1BBDH 1L7TH 3MCKA 4LNRB 3GNML 1YC8A 4FQIH 3JV4B 5F3BA 5A43C 3PL6B 1ZT4B 1TITA 5FUZH 1DJSA 3VXQA 2CKNA 2Q87A 4BZ1L 1ZWIA 4HUMB 4UV4H 1PZ5B 1A7PL 2HRLA 4XHJC 4RISL 1UACH 2DQDH 2EH8L 3BWAA 5DTFA 5IFHL 1RZGB 3AAZA 3MLVL 1UH4A 4DK3A 2H3NA 3MRHB 2X1PA 4LVNC 4G7VL 4U6XA 2FECL 4L3CA 5E2WH 3FMGL 4WTWA 3AXLB 5ISZB 4K9EH 4ZXBC 4LNRA 3H7BB 5DUMH 5JIKA 3K2UL 1OD9A 3KYNB 4WHDA 2GTZB 2Y5EA 4BQ6A 4CN1A 2FLBT 5T3ZD 1OL0A 1A7NH 1NC4D 1ZT4A 2JJWA 3O0RL 4PJ9D 2NY3B 3L1OL 4WY7L 4Y88A 4XMLL 5CINL 3B83A 5DGRA 1SM3H 4M6NH 4P2RE 1BM3L 1PZ5A 5IVXA 2VDRH 4PJ7A 4U1KB 3MLPA 4MXVF 4LSTH 1RZGA 4JPKH 1I75A 1K9TA 3HE7C 4P46C 3DRQB 3MRHA 4NQUA 2VZTA 3ZSTA 1FNAA 3WHE0 5I6XB 5IP4A 5ESVB 4S11A 5E03A 5HHMB 2C3HA 1R3KB 4M48H 5GRWA 3AXLA 1AI1H 5ISZA 1U8MB 3H7BA 3P9LB 3VGEA 5IVOA 3KYNA 3P4NB 5I9QB 3T2NH 2GTZA 1BJMA 5H94B 3TVMC 4I9WD 5T1KA 2D2OA 4FXLA 1JPFB 1OSPL 1OCWH 3O8XB 3CFDB 3VU2A 2OP4H 3LRGA 3G5ZB 3HMWH 1NBQA 1WAAE 3MXVH 4OF7A 3V5HB 5MEQB 3QJHB 1LK3H 2DLTA 1UZ6F 1WIUA 2IANA 4HIHB 3D6GA 2WW8A 4Z78B 3DUHA 3QEQD 4XNXL 1QFOA 1J0ZA 1WCBB 3FTGB 1KTLB 3DRQA 5HYJE 4J3XA 4F7MA 1J8KA 1RIUL 4NT6B 2C1OB 5ESVA 4K94C 4IHOB 5CJOL 1J18A 1R3KA 4POYA 2ADGB 3RHWF 1IRAY 4NKQB 2Y06L 5EPMB 1U8MA 5CMAB 1UFUA 2E9JA 2IALB 3P9LA 3QNXB 4LFHD 5F96L 4F15C 3P4NA 5TE6H 2VDLH 3RZWA 4MXQD 1IAMA 1REIA 4H8WH 3RX5A 1JPFA 5FECB 2QHRL 1OAZL 3DPBA 3CFDA 3UYRH 2EDKA 3O41B 5JW4M 3G5ZA 3V5HA 3OKMB 2ADJB 2EC9U 3QJHA 4MDJB 5MEQA 4TSBL 1I1AA 3A6BL 5EU7C 3HI5L 1BGXL 3ZT6A 2MCG1 3CFIC 4H1LB 4ZO6A 4U0RC 5FYKU 3SDYH 3ZL4H 2HN7B 1WCBA 3FTGA 1KTLA 1EDQA 3GJFB 2YEZB 4NT6A 2C1OA 4IHOA 4FMFA 1DZBA 1JP5A 4YHMH 1K3ZA 1C5DB 1MFAL 1NCAH 5GS1C 2ZUQB 1QFWH 2H32B 5GGSA 5INCA 1RURL 5CMAA 2D9QB 5EWIL 3G6JE 3GM8A 3QUMB 2NXYC 5FXCH 1I4FB 2B0SL 4RGNC 4EIZC 2X2YA 3ZHKA 5DMKB 2AGJL 5FECA 3QXTA 2VUOA 2UV3A 3OXSB 4XPAL 3LD8C 5L9DH 4RGMC 2ADJA 4MDJA 3G6AB 5JDSB 2JELL 4YBLB 4DW2L 3HNTL 1U3YA 1WZMA 4J3SA 4XHQA 3T0BA 2HN7A 4DGVL 4OIIH 4TPRH 1BOYA 3GJFA 3B43A 2C4FU 2YEZA 3X13B 2P45B 3QEGL 4J7RA 2VZUA 4Y2OA 1C5DA 4UU9B 3DARA 1OPGH 2CJUH 4AQ1B 2H32A 2CLVB 2GK0B 3QUMA 35C8L 4JO4L 3SOBH 2R0ZL 4XRCB 4Q9QL 1Y6KR 5DMKA 4XZUB 2H2PC 1JMXA 1PQZB 5CEZD 5ITFB 5F6IB 4Z7VB 4LKCA 3M17B 4FTVD 4E41D 3G6AA 4I0CC 1A14H 1P2CB 3P0GB 5JDSA 4C4KT 4FABH 5I1LB 1P4IH 4S1DC 2ITCB 2VTFA 3JXAA 2VDQL 1YNKL 3MGTB 3QA3B 1NEZA 3NCJH 1QFUL 3F58H 1I3RB 1DEEB 1UEMA 2Z31B 3X13A 4TVSa 1YN6B 1AQDB 1LP9E 4OZFH 5ERWA 1CLOH 1SMOA 4PJ8B 4U1IB 4UU9A 5KVDL 1FH5L 5EZIH 1HYSC 3ARFD 2MPAH 3E8UH 2R9HC 1XF3B 1HCVA 1UWXH 3JV6B 3AGVA 4HC1H 4XRCA 5H2BB 3MRLB 1CYGA 3MJ9H 4AIXA 4XZUA 3H8NA 1PQZA 5FYLL 3NPSB 5ITFA 3EO0B 4LRIA 1OGAE 1P2CA 5DURB 4OD1H 4IRJC 5I1LA 1QPXA 1E4XI 2ITCA 5JW4Q 4ZOEA 1KN2L 2LABA 3MGTA 4L3AA 3Q5YA 3QCTL 1YEDB 4M3JA 1Q94B 4W6YB 1I3RA 4F37K 1DEEA 3CDGB 4HFUH 3WE6B 2A6IB 1AQKL 2DBLL 2CGRH 1YN6A 1AQDA 5CD5D 2E7CA 2V7NA 1X44A 4ONGH 4FNLH 2DYPB 4PLNC 1NCTA 1S7QA 3EUUA 2ICCA 3KYKL 3WHE1 3WSQH 4X80L 4ZYKB 3FQRB 2UZYB 2XIDA 3P77A 2X44D 1I9RH 1A7OL 4MAYD 4F3FB 5J57B 3OJMB 1QRKA 1MQ8A 3IAPA 4JPWL 2DQEL 1C08B 1YQ2A 5HHNB 5KAQF 1U91A 1A3QA 3VXNA 3CVIL 1BMGA 1X5YA 4JREB 4Y1AE 5DHYB 1T20A 3IXTA 1JIBA 1YEDA 3AS0A 4KGLA 1WF5A 3MLYH 4GXVL 5FGCE 5J6GB 3U4BH 1LE5A 3CDGA 3WE6A 2A6IA 3S96B 4DTGH 5IBTH 2XKNA 3HG1E 2FLRT 2NY6C 3DVNB 4ODTL 4A2MA 4EIGB 4ZYKA 1UCBL 2HKFH 3ZO0A 5EUOF 1NFIB 3FQRA 1RZKH 1FP5A 3EJZC 3MJGX 5IVZB 1JNLH 2VXUH 1AGBB 1F8TL 1U3HD 4F3FA 5AZ2H 2XI9A 1T03H 4JJ5A 1D5IH 4AH2B 3MRGB 1A7BA 4TUJB 1HINL 3KPSB 5IWLA 4LFHG 1MNUH 3UJTL 5I76A 1I7ZB 5DRZB 4K71B 2X89D 5I8EB 4M6MH 1C08A 3IVKA 1GPOL 4YBQD 5HHNA 5J4MA 2AEIT 4WEBH 5H37G 4UDTB 2OL3A 5ADPH 3GSWB 2KL6A 2JTDA 5DHYA 1D5ZB 3VG9B 3FRUA 1IILE 5J6GA 4EN3C 3S96A 1XMWA 1KB9K 1T5XB 5KVFL 4TSAH 2DIBA 4QRTB 3RY6A 2B5IB 1KULA 3UBXB 3QDJD 4G6JL 3HKFA 3DVNA 4AEIH 1RHFA 2A38A 4X5WA 3NFNB 5KS9B 3D18B 3THML 1NFIA 2DN7A 5IVZA 4IRSB 1AGBA 5EOTA 1MCWW 4C56E 4RCAA 2O5XL 5E56A 4AH2A 3NCBB 4N0CD 3MRGA 5HDQH 4G9FE 1I7ZA 3FL7A 2VR5A 3GMPB 4IM8A 1CIUA 5I8EA 4KRMB 4MDIB 5KVGL 4XP5H 1KYOJ 3TNMB 3LDBC 5F89A 1I9JH 1FJ1B 3GSWA 1BJ1H 3MBXH 1IGIH 2LU4A 4OM1H 5D2LB 2FL5B 3CNKA 1D5ZA 1BZQK 4IIQC 2L4OA 4Z95H 1G9NC 3EKCA 5I2IA 3BPOB 5EZLB 1T5XA 4UIKL 4QRTA 1KOAA 3BJ91 5I1EL 4YHPB 1YN7B 3UBXA 5D6DC 3DSFL 1BWWA 1UZ6E 3RIAF 1FLTX 4HBCL 5TDOB 3NFNA 5KS9A 1BQSA 2EIBA 3D18A 5CD3A 1CK0H 4IRSA 4UMGA 3RX7A 4I2XE 3QDMA 2MKLC 1EO8L 2DOCA 4ZO8A 4MNQE 4L8SC 3GMPA 3MACH 5L7XH 4OSUL 3LVEA 3B9DA 4MDIA 4NO0D 3RBGA 5E24E 4FZ8H 3TNMA 1FJ1A 1C5CL 5HHXH 5D2LA 1DP0A 2FL5A 4KJPD 2GW5A 2L7UA 1NFKA 3QDGE 4ODVH 4C54A 3QJFB 2EKJA 3PDDA 5EZLA 4ZDHA 4YDLB 3WNOA 4BZ2H 4JFDE 4X99A 2OS7A 1M4KA 4YHPA 3AB0B 1YN7A 2WWMD 3A6OA 5BRZA 2XZCH 3DETC 4UOJA 3GKZA 2VXSL 5TDOA 5I73C 5LWYL 3TO4B 4JM2B 4WU7B 4ZAKC 2VLJB 3T2PA 3UDWC 1G7HA 2E3VA 3NABH 1FYTD 2EH7L 2ICES 5EA0L 1L7TL 3MGOB 5EU5B 5C86A 2F19H 4UINL 4QHMB 25C8L 3G5YB 3OG6B 5C07D 3VJ6B 5IW1B 1BIHA 5D1QC 1L6XA 3O2DH 4Y5XC 1SQ2N 5E9DE 3F6IA 2EDYA 5JHDE 1X5IA 2YD2A 1FNLA 4XBGB 3EGSA 5ITBH 1V3JA 1Z0NA 4OF6A 5I1GH 4CVXB 3TO4A 3CAFA 4JM2A 3LEXB 3QXWA 2QADB 1H9VA 1WBZB 3QCUH 4WU7A 1HHGA 2VMFA 3J7HA 1YMME 3QHTC 1EUTA 1VACA 2H1PH 1W0WB 1TETH 3QEHB 1ZEAL 3FOMA 2EDHA 3MGOA 1MCHA 3HNVH 4QHMA 3G5YA 1TZGL 5A3ID 4NQEA 4NUGL 4YHLL 3VJ6A 4KZDH 4RDQG 2XV6B 1P7HL 4P5TC 4RAVB 2OMNA 1BVZA 3V6FB 3MRRA 4M00A 1BZ9B 4QCIB 4XBGA 4X8XA 4KH2A 2W60B 1FIGL 2ZOLA 1U41A 3C08H 3TBYA 2R39A 4CVXA 2G60L 5HVWA 1P7KA 3IS1X 1FAIL 2IGFL 4JZNB 1WBZA 3VA6A 5A2IH 32C2B 3TPUA 1KIRB 2J8UF 4DKDC 3JWDC 4GG6E 1W0WA 3D39B 1DUYA 3CDFA 5C0CA 3MUJA 2VLRE 1AE6H 1J1PH 4YWGH 2P5WD 4RGOH 3PWUB 3P30L 4IRZH 5L2KD 1I3UA 2FATH 5B8CB 1OCWL 2DQIL 3QAZC 3C6LC 2OP4L 3HMWL 1O5DT 2NY4D 3V6FA 2W9DH 1X5XA 1BZ9A 1NSNL 4QCIA 3DO7B 5BV7C 2B4CC 1HWHB 4HJGB 4Y4KD 1J8HB 2VLLB 1E6JL 4YGAB 3MJ6A 2IBGA 4QHUB 1U8JB 4YO0A 3ARDD 4KXZI 4AY0A 3NIDF 2QSQA 4XNZC 4D9QE 3L7EB 1KIRA 4NBZB 3WN5B 1JNJA 3EDEA 4KVCL 1I8MA 2EECA 1RUMH 3D39A 5HHOE 3EYFB 3S4SA 1T22B 3QFJE 3EOAB 2A1WH 1INDH 3RY5A 2AXFB 2VISB 1UKSA 4JRXA 4QT5B 4AEEA 5CBEB 5D7IE 1WZ1L 1FSKB 5B8CA 1MCKA 2J5LC 4J3TA 1TZIB 2FR4B 2ARWA 1S8DB 3CX2A 5E99H 2K7QA 4ODUA 1F3RB 2IAMD 3IFLL 3DUUA 1OTUD 2AEWA 4KMTL 3DO7A 1AGCB 2DI7A 4N90E 4EDWH 4PLKD 5HYSB 1PY4A 3ZL4L 2VLLA 3SDDA 4O5LH 4QHUA 5DD1H 4OF8A 5KSUB 3I9GH 4PJXE 3L7EA 1CGSL 2YA2A 2MMXA 3RQ3A 1NAKL 3C60D 4P9HH 4ZUWB 1ZLUK 4YHML 3TBVB 1NCAL 3EYFA 2X4UB 5FDWB 2D3VA 1T22A 3RNQB 3EOAA 2CDFB 4A6YH 4AMKH 4GMTH 5CILH 2VISA 4QT5A 4K3JH 3SJVD 1QO3B 5EUOE 3KS0H 4LGPB 4YFDB 2FR4A 3TJEL 1S8DA 4NM8L 1N6QH 2XN9E 4RWHA 2FWOB 3K8LA 1AGCA 1IARB 3GSNB 3QIUB 4U6HA 4MA1B 5HYSA 1QSED 3GO1H 1U6AH 5D7JD 4OIIL 4DFIA 4GQ9H 4N1EA 5KSUA 3ABZA 1YY9D 4JQVA 1NBVH 4ZUWA 5I1IH 5HXMA 5DZLA 3FQXA 5FDWA 2CJUL 4KI5D 3RNQA 3WIFA 4CMMB 2CDFA 3SBWA 1CTNA 4UT9H 1EBPA 3VRIB 5L8JB 1KB5L 1H3VA 1QO3A 3IJYB 4UDUA 1NGYB 3N1GC 4NJAH 1F2XK 1I7UB 4OD3H 4NWUH 3QHZH 3ZMRA 3JV0A 3BGFC 3I3DA 1P4IL 3GSNA 3QIUA 4LLMA 4TYUA 4XX1G 5CJXA 4OUUB 1CDYA 2D7TL 5DUPH 4PJEF 3IJSB 4L8BB 1QRND 4OKVA 2ED7A 3O6KH 3L7FA 3AU1B 5F7UA 1CLOL 4R4BB 4G7YH 1FL6B 4JQXA 2GEEA 4PRHB 3O9WB 4C59B 2X4RB 1I85C 2VC2L 2NX5D 4CMMA 2BXYA 1H5BC 3E8UL 3DXAD 4NBYB 2LU3A 5DT1L 3VRIA 2A6DB 4P5MA 3KPPB 5TQ2L 3IJYA 1T04B 1NGYA 5HPMB 5F7YC 4HC1L 3OZ9H 1JPST 5F7NC 3S3JA 2OJZL 3TV3H 4PJ5E 4K8RH 1AGEB 3ZTJG 3IAGC 2DIJA 1BAFL 3ARWA 2CDEB 3D3VD 3MODH 4OD1L 3T3MF 1UM5L 1RFDL 1D5BB 4OUUA 3SDXB 1O0VA 2C3VB 4J1UB 3IJSA 4L8BA 2VITB 4K3GA 4YE4H 2KBGA 2JB5H 4HKXB 2KQMA 1KJ2B 2CGRL 1A6WH 2LFGA 3RDTB 3QWRD 4R4BA 1FL6A 3O9WA 4JPIB 1JMZA 2X4RA 4N0YH 4ZFOL 3HE6D 4WHTB 1UCTA 4HX1B 5IF0B 1I9RL 3ZKND 2A6DA 2HYMA 3KPPA 3DGCR 1T04A 3U7WH 5HPMA 5D5MB 3O6ML 5FM8A 2BJMH 1U2HA 4WV1B 2K9UA 2JIXD 4X7FC 3C9NA 2R2HB 4LCWB 1TIUA 2CDEA 7CGTA 1EEYB 2FEEI 3T3PE 4FFWC 4HS3A 2ZSVB 2DLEA 2CKBH 3GMRA 1D5BA 3EW3B 4PGBA 3SDXA 2C3VA 1S9XB 1WIPA 2VITA 3MLYL 5FAAA 1KJ2A 3ZYIA 4OLYL 5C8JB 3RDTA 1D6EB 1XF5B 3L6FB 4DTGL 4GS7B 1T89A 4JPIA 3WXWL 1DUZA 4JO2H 2PCPB 5CIPB 1L0YA 3BIKB 1CDGA 4WHTA 5I17A 4L9LC 1EFQA 4HX1A 1TQCC 1JNLL 5IF0A 3BZDA 1L9MA 4V1DE 1DCLA 1QYGH 1CFTA 1T03L 2VN4A 3OF6A 3OKEB 4M4PA 1D9KC 4J4PC 2IBZY 1NKRA 4WV1A 1MNUL 1W72B 1NCCH 4X7CC 1F42A 5C0BD 4M6ML 2C9AA 1DBML 1IZKA 3GSVB 2R2HA 2YPVL 4XVSH</