4CDHA

Crystallographic structure of the human igg1 alpha 2-6 sialilated fc-fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Basis for Selective Recognition of Endogenous and Microbial Polysaccharides by Macrophage Receptor Sign-R1
pubmed doi rcsb
total genus 34
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cdhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cdhA01
4OCRH 2CO7B 5IJKC 1R3JA 4P9MH 1KCKA 3A67L 3BPOB 1LO0L 5DK0A 1W8NA 3FO1B 1JZ6A 2PXYA 1FZJB 1Q1JL 3X11A 5D7IE 5GSRB 2UWEE 4RAUA 1N5YL 3JBG7 4ONOA 3H8NA 4CN4A 5C8JA 3FN9A 3SQOL 2OBGA 1Z2KA 4WFGE 3O0RH 4Y2DD 5EO9A 5ALCH 1EBPA 5MEQB 2O26U 5FM8A 4OGXH 4D2NA 2O5XL 1U8PB 1RUKL 3VFWB 1C5CL 2EXYD 5D6DA 5T5NG 4YGAB 3ARBC 4PRHB 4U1JB 4JAMA 2D7QA 4XNZC 4RA0C 2V2WB 1CG9B 2DKMA 3OF6A 2IAMD 3MV9D 3QIWA 4G6ML 4PIRF 3WEXA 5IQ7L 4KI5D 1KULA 3VFRB 2VZSA 2J6EL 2ATPA 5F3HB 1ROWA 2VR4A 4YX2L 3S88L 4G6KL 4KH2A 1KUMA 4N0UE 2E8YA 2I9TB 2YC1B 3BP5B 3O4LD 4LSVH 4K8RC 1A64A 3HZVB 4QXTB 5I6XC 1U8LB 2VLKB 4XMPH 3TNNA 3G6AB 2BNRD 3MCG1 1I8MA 4JPIB 1ACYH 3SY0A 5FDWA 4JREB 1JZ4A 4X7FC 1M71A 2LABA 2MCG1 1IILE 3HC3L 5TQ2H 4MMZC 3VXMD 1IL1A 3K8LA 2X9WA 3IS1X 4F7MA 5GQBA 5LVEA 3ELAT 1U3YA 3SBWC 4D8PB 5IWLC 1YMHA 2BOCA 5GRZA 1UH4A 3S4SB 5DRNB 2XFXA 1E28A 3U4BH 4H20L 3FFDB 3MRPB 1MHEA 4JO4H 2X10A 1ZLSH 3L5JA 2XKSA 4QT5A 3QT2A 2HLAA 1CBVH 2GK2A 4S0TD 1FVCA 1DBJL 4MA3A 4M48L 3DETC 2CPCA 1R5WB 2DL9A 4MX7A 1NLBH 1UWGL 4RA3A 3RPIA 4CN6A 5IFAL 1S7WA 2X7LA 1JWUB 1NFIB 2X9XA 2HFGL 3TA3D 1A5FL 2XN9D 4K2UH 2J2ZA 3FAWA 1CFVH 1QOKA 4IIQC 5JNYB 4NP4L 3W82A 1KIQB 4YWGH 1U8NA 4KQ4L 4JFHD 2A77H 4HWEH 3UX9B 2D9CA 3Q0HA 2UZXB 5JXED 4DEPB 3CFDA 5I74B 4BYHA 3TH4T 4X7TA 2DLFL 1QR1A 3T4YB 4ZO6A 5DURB 4HGWA 32C2A 4QY8B 4F58L 4QGTA 1A47A 1SJHA 1T83C 2AVGA 3BMVA 4F7CA 1IGMH 5DC0A 1YPZF 2J5LC 3CUPB 5LWYL 1VB9A 2EDHA 5IBTL 4PJBA 4N0RA 2A2QT 5KJRH 3QA3A 5EA0H 3HCVB 5HGBA 3SGJC 4QHUA 1OAUL 2EE2A 5F9AC 3SGEH 3DVNA 5EDXA 5F1NB 2CKBH 3WFHB 4LAQH 2C26A 4UTBL 2EDNA 2IBZY 3HRPA 3WNKA 5BO1L 2O5ZL 2A1WL 3CVIH 1ZT1B 4JRWA 3BKJL 3FO1A 2Z4QA 4BFBD 2RHEA 3TFKD 1FZJA 4I3GA 2ADJB 1FFNA 3B83A 4IRZH 2HRLA 4GUPB 4OFKA 3CSGA 3RI5K 1NLDH 5HDBF 2JJWA 4J3TA 4LP5A 1YC7A 4N90D 4LHQB 5D1ZC 5ENWB 3CX5J 3L3HA 3VFOB 3WFEH 2NNAB 3LOWA 5I1DB 4U1GB 4YHKH 3I3EA 2R29L 2XACC 2C4FT 1RUPL 4LCCB 3S8WA 1U8PA 3BP7B 2E7CA 3NCYS 3WV0A 4RGOH 1FGNH 3VFWA 3OKOB 1FLRL 2MQ3A 5L8LB 3L5XH 3EOTH 2V2WA 3LN4B 4B7LA 3KYNB 4OCSL 1FC1A 1S9VB 4BQ8A 5F3HA 4KK9C 4CADB 3EYVB 3KJ6L 2Y23A 5E08L 4PJHA 4X7EC 4Z77B 3ET9F 2XWBB 4JGUA 4JFPB 1BWWA 2H41A 2YC1A 2YUXA 3BP5A 2YN3A 4MA8L 4RISH 4JHWH 3D25B 4QXTA 5D72H 5F1IB 1C7SA 4FQCH 2VLKA 4WHYG 3G6AA 1EO5A 4JPIA 1A4KA 5HHOE 5I1KL 3MROB 4L4TD 5DWUH 3K1KC 3KPSB 5CWSA 1K2DB 5D71L 4XBPA 4XT1C 5C6WH 4XNYH 4WUUD 2X5PA 4NKOA 3ECBB 4HJJH 5JZ7C 4NO2B 4GG8B 1JNNL 2QQLL 3EYFB 4JN2A 5DRNA 2HH0H 3FFDA 4XAKE 3MRPA 2ZCKL 4LARL 1S3KH 2YXFA 4UIKH 5JXAL 1KCUH 4P2YA 1HCFX 1RURL 1XGUA 4JG0H 1OGAE 2XICA 1OAXH 2ESVB 1KJ2L 2DQTH 3HAEH 5GJTL 4N8CL 3DVGB 2AS5M 4I9WD 5I18L 3UTZB 1UT9A 2V17H 2V7NB 5E2TL 3IAQA 3UO1L 3MV11 3ETBF 1EPFA 1ZT7B 1S5HB 1KIQA 1MCFA 5CBEB 5CSGA 3HS0B 3G5ZB 1K5NB 4OQTH 3I9GH 4NQEB 4IHOA 5IBLD 1S7TB 2WWKO 3MRHB 3O2DL 2KQMA 4XC3L 3U36B 2F19H 4UB0L 3NCBB 2R4SH 5FK9B 3ZYZA 1NMAH 2LTQB 3HI5H 1BD2E 5TE6H 2AK1L 1YY9D 2HLFD 4GJTB 4PRNB 1JTTA 1J0HA 3PGFL 3H3BC 2KZ1B 3W0WB 3O6LH 3J8F7 1YPZE 1A3QA 2VXUL 1NSNL 2FLRT 2FO1A 3RQ3A 5SWSA 4FTVB 5L8JB 5JHLL 5D5MF 4HZLB 2APFA 3OB8A 3U79A 1OLLA 5F1NA 3G6JF 4K3HA 1P4IH 5IKCA 1J8HB 2RQ8A 3QWRD 4GSDL 1SM3H 2VUOA 1S7RB 2VLMD 1ZT1A 3GB7A 3LPGA 1CK0L 4LK4A 2PO6D 1JRHH 5L88H 3QBTB 4GUPA 4PJFB 5BOPA 3OKEA 4YHZH 3I50H 3TVMC 3OG4B 1I1AC 1BHGA 5ADPL 2AJSH 4QF1B 1OLZA 4Y19D 1M7DB 4PJEB 5ENWA 5FUOH 3RY6A 1ZT4B 4UT7L 4ZAKB 2NNAA 2QQQA 5DSCB 1Z9MA 3STLB 4XP6L 1MJ7L 3DV4B 4JVPA 1Q9OA 3LKSB 4OZHB 4LCCA 5HBBA 3BP7A 5IIEA 3OKOA 4N0YL 3ILQC 3NCJL 3MJ7A 3VFUA 3MNZA 3UZVB 3P4OA 2VN7A 5JLZB 4ENED 2ED9A 1DUZA 3KYNA 1A6VL 5DTFB 1YEKH 4OQ1A 3OKNB 4CADA 3HE7C 5E2UH 3EYVA 4Z77A 3CXHK 4L8SB 2AK4E 2XWBA 3ORJA 1G1CA 4JFPA 5BRZD 3GMNB 5F1IA 1J1XL 4U3HA 4MNHB 1ZHBB 1I85C 3GNML 4R4NC 1L9NA 1DQDH 3N85H 3OX8B 1MHCB 2ZUUA 4ZS6C 4JFFE 3QQ3B 3KPSA 1QYGL 1K2DA 2Z8WC 3OKKA 3RIAF 3U9PL 4KTDH 3VWJC 2QL1A 4LSRL 5TFSL 5DGQA 4NO2A 1VFOA 1SBSL 2FH8A 4EUPH 1JNHB 4QRTB 4GRLB 2Y4SA 2HRPH 2XV6B 4YUEL 3EYFA 1CFTB 4G6FB 4P59H 1A3RL 5IEHB 4GRMA 1I9RL 2Q3AA 4G9FE 5EU6D 1B0WA 5TF1L 1UJTA 4XTRC 5JOFB 5D93C 3QRGH 4M6OH 4MD0A 5IGXL 1R3HB 1R3KA 4HF5L 1F4YH 4OCXH 1F58L 2VKXA 1TENA 1T20B 2Z8RA 5FYKD 4JFED 3SDAB 1HZHH 3UTZA 2ENYA 5DZLA 2V7NA 1IGFL 5IHZB 4LLUB 2V5RA 6FABL 3MJ6A 1YYMH 1S5HA 5CBEA 4ZMAT 3DXAD 4OTXH 3HS0A 3G5ZA 1K5NA 3MLVL 3HMWH 3UTSD 3BH9A 2KPNA 1S7TA 5CILL 4OLVL 5GZOD 2P5EA 3HG1E 3QPQD 4MNQA 5KW9H 3M17B 5FK9A 3S9DB 1E0OB 1F4XL 4PRNA 3W0WA 3VXSB 3FB5B 3VFSB 1T22A 3V6OE 2ZKHH 1PBYA 1G84A 4WI6A 2DI7A 3C8KA 2D03L 1PW3A 3AROA 1UACL 4FQXD 4PY8J 4WCYL 1ZGLP 1RFDH 4Y5VC 4OGAD 1OTUD 1P9MC 1V5JA 2OL3B 2VWEE 3G6JE 3MV8D 1TDQA 5DUMH 1FCCA 3T0ED 1Q38A 3KR3L 3BE1H 4HKBB 4CVWA 1NEZG 1WBYB 3QEHA 4NN6C 5T3ZE 1TVHB 5C3TA 1AO7E 5HHXL 3V52H 1EUUA 3AM8C 4DAGL 4GAYA 2WW8A 4JPVL 1TTFA 2O61B 5C0FB 2QHLA 4QF1A 5C0JB 1IGYB 3M07A 4KTEH 1XR9A 2OR9H 4PJ7A 4PJEA 4YXLL 4O2CB 1BQLL 4GMTL 5CJXC 1AR1C 1XCQB 3GEWB 3STLA 1ED3A 3RWJB 1ZLUK 5CKAA 2L7JA 4D9RE 1QRNA 1WITA 2PN5A 2YMXH 2XTJC 1N7ML 3LKSA 1UZ8B 1BWMA 3TN0A 2RBLA 5C0DB 3V4UH 4XBEL 3RWEB 3NIDF 1OPGH 2AEPL 3AMLA 5L2JB 2CKBB 3BDYH 3GI8L 4X9HA 5A16B 5JLZA 4WEMB 5LJYH 5JHDD 2BVOB 3L5IA 4N0CD 35C8L 3RTQB 4L8SA 3SCMB 5C1MB 2XZCH 1FAKT 3GMNA 4Y16C 3EDJA 3BIKB 1VACB 4G6JH 1ZHBA 4HUMB 1AHWB 1FL3A 5E6ZA 3FQXB 3TO4C 3OX8A 1MHCA 1HCVA 4PJIF 3RUGA 4ELMB 5ISZE 3D39D 3B2UD 4NM8L 4MA7L 4HULB 3OZ9L 4JZJB 4QHNB 1I3GL 4E41E 1UH3A 1JE6A 5DMYA 2ORBH 1JNHA 4QRTA 4GRLA 3LQAH 4UI2A 1CFTA 3D3VB 4JPKL 5IEHA 1QFOA 5BMFH 2XA3A 4J4PD 3VU2A 5HVHB 5JOFA 3FMGH 1R3HA 1INEH 4J3SA 5C0NC 1FO0H 4P23D 4TRPL 4ORZC 4W6WB 3FOLA 2B20A 2FJHB 2LQRA 4WWKD 1IEBB 5T3XE 1IC5H 3QAZB 1HHGA 2A6IB 4N9GB 1BX2B 1MIML 4EN3D 5IHZA 4O2EB 2MPAH 3BO8B 1HQ4B 5ESAA 1XT5A 2V5MA 1UB5B 3LV3B 1TQCC 4MXVF 5BVPH 3C8DA 4PS4H 4ODVH 4MAYC 2OX5A 5C70A 4JQXA 1G7QB 4UV7H 2ZNWA 4NFCA 2G2RB 3QUXC 1DANT 2HJLB 1MH5A 1CU4L 1NFKA 2P4AB 1UXSA 2V9QA 4OIAA 5J1TC 3IJHB 1JPGB 4M7JL 6CGTA 1E27B 2BFVL 2IAMB 3MV9B 4YDKH 4Y1AE 3CAFA 3X14A 2HT4D 5I8CB 1B4JL 3BZEB 3FB5A 4AZ8A 2F53E 3HNTH 3U0TB 3QO1B 1A21A 5BJTB 2W0FA 3MQIA 3O4LB 3HAEB 5J6GA 5D7SH 4TTGA 4NKMB 1GCFA 2VXTL 1N2RB 1MJUH 3NA9L 4YFDB 4YDVB 4RWYH 4HC1H 1FYTB 1ZV5A 3EDKA 4WTZA 1U3HD 4R6UA 3VXMB 3SGDH 3T2QA 4R4BB 3K81A 5F9JB 3OQ3B 1QLRB 1TVHA 4U6HB 2YPVL 4LSSL 3TP4A 2FD6L 4PRAB 5JOPE 5HGDA 4KJYB 3DRQB 5ESQB 5JW4N 5F96L 4CMHB 1DBAH 4LHUD 5DEGB 4OZIB 3QFJE 3KG5A 4Z7UB 5D7JD 3RBSA 2X05A 4O2CA 1EZVX 3U7WH 1AQKL 4JZNB 2R0ZH 4ERSL 1XCQA 3MGOB 3RWJA 1YMMD 4IDLA 5ABDE 3TA3B 5BV7C 1WAAA 2XN9B 2ICEB 4XPGH 1UZ8A 4FXGB 2MQCA 2GSIB 3QFDB 2B2XL 2QR0B 5EU7C 5L2JA 1UXWB 2EYRA 3NIDE 5A16A 3C09B 1B6UA 4APQC 1OY3B 5J57B 4MA1C 4NKDB 5DR5L 2W9EH 4FZEH 2DIJA 5F6IC 3S36X 3TF7C 3RTQA 3SCMA 2BSTA 3ZT7A 4GKZA 1VACA 1VA9A 1AHWA 3FQXA 4NPYB 3IFNL 1FJ1B 3I6GB 4PGEB 4Y4KD 1U8QB 1QVOB 4PJIE 3HNSH 3RZCC 5KSBF 1ZVYA 3SDDD 5EOCH 5D70H 2VXVH 4QHNA 3K74B 4CDGC 5FCSH 5HHMD 5D7LE 4G8EA 3ARDD 1TXKA 1IJ9A 2F5AL 3RIAK 3VWKB 1XF5B 3IRPX 4L9LC 3MOBL 2CMRH 4MJ6B 3D3VA 1MQ8A 3FT2B 3QEQD 1KN2H 5DJ0B 4IOFC 4RX4D 2EO1A 4PGCB 1CE1L 1MRFL 5MHSE 3EJJX 5K9OB 3MYZA 4ZOAA 3B2VL 5EWIL 4KKLC 3QDMB 4G9DB 3T65B 3WNLA 4LSQH 2FJHA 3ULSB 1IEBA 3SKNB 3KXFE 1JHKL 5D8JL 3FRUB 1U8HA 4NFDA 4N9GA 4OF3A 2YK1L 4TVPE 4YHNB 1HQ4A 4H5SA 3LV3A 3VG9C 1FIGH 3MRMA 5FHBL 1WFTA 3FB7B 3MREB 4MXVE 5KG9A 4GLRI 1G7QA 4OLXH 4GS7C 3ILPB 4Z76B 3P77A 4ODHH 1JYNA 2G2RA 4Y4HC 1G6RL 4JFDD 1BM3H 4P9HH 3ZL4L 2I60H 5JIIA 1VSCA 3VXUE 3O6FA 2IH3B 1FE8H 3QR2A 1JPGA 3RL2A 1AGEB 3LPWA 4Z0BH 1UM6L 1E27A 3JV0A 4YK4B 5IOPA 1A6PA 2ENSA 1D6EA 4XNQB 3BZEA 1DBKL 5HYSG 3L3JA 2EYTA 2HN7A 5L0QB 3UJIH 2X4NA 3VI4F 4ODTH 3H0TB 2ZCHH 1RU9H 3JWOC 1CE6A 3O4LA 3MCKA 3BKMH 3HAEA 4L3ED 4NKMA 2CD0A 2DQJH 2DB8A 1T2JA 3FQRB 4L4TB 4CNIB 4U1LB 1FYTA 5TE7L 5CJBA 3VXMA 4WUUB 1CDHA 1CLZL 4R4BA 1D5IL 3LS4L 5F9JA 1WUNT 5SX5H 1QLRA 4LOUD 2A6DB 2BVPB 3RBGA 5IB4A 4OQTA 2BY1A 3MBEC 4PRAA 4KJYA 3KYKH 3HNVH 3I75A 5I30L 3DRQA 2EIBA 1T66C 3MLYL 1B0RA 5D2LF 5FO9A 3HUJB 4M1DL 5DEGA 3GHEH 4OZIA 2WQ8A 1X5XA 2CIKB 4FN0A 4RSVA 5F9WB 4JZNA 4MMXC 3MGOA 5I1IH 3VD5A 1QLEH 1WCBB 3PQYD 2V7HB 2V6HA 4WV1A 2XN9A 3BZDA 2ICEA 4R4FL 3QDHA 3RX7A 3BJ91 3OKMA 1OM3H 3V0WH 1AGCB 4ZOEA 4N0FB 2GSIA 3BT2L 5IT2H 3QFDA 2R2EB 2QR0A 3KYMB 1UXWA 4KKBC 5DA0B 1ZTXH 3T09A 1LQSR 3NCYP 4NKDA 2VITA 4NRZB 4XMLH 2W9LA 3EO1B 2P8MB 2XQBH 2ZSWB 3HB3C 5GS0D 2D7OA 4LVHC 1T7ZA 2QQNL 3PGDB 4RQQB 5FGRA 1BFOA 2YD8A 2ZUSA 4CVXB 1ZVSB 4H0GA 3QCVH 4V2CB 4LCYA 4UZGA 4Y5YC 2UV3A 4FABL 4NPYA 4LRNL 1AP2A 2XRAL 1N0XH 3WJLA 1FJ1A 3I6GA 3LMJH 1KNOB 4PGEA 1QVOA 2JJVA 4HPOL 2X1PA 1OF2B 5D9SB 5KSBE 4FFZH 1HSBA 1OSPH 2X4QA 3ULUL 4AIXA 2KKQA 1MFCH 1OD9A 3VWKA 1XF5A 4NQSB 5CLTA 3N1MC 2UY6A 3LZFH 5CBAA 4MJ6A 5DJ0A 1G7LB 3QULA 5F1OB 3QIBA 4PGCA 5K9OA 4L5FH 3M1BB 3VRJB 3QDMA 1NGXA 2MNUA 3HFML 4KPHL 8CGTA 2DIAA 4DUVA 2NY4D 3T65A 5ACZA 2VAAB 3ULSA 2YPKA 3SKNA 3MR9A 3SKMB 3FRUA 5E2VH 2ERJB 5TDPB 3V2AR 1MAML 4Y19B 1JP5A 5JW3H 4JO2H 2HTKC 4YHNA 1G9ML 1ETZB 2HMID 3GSNH 4LNRB 3UJTL 1VADB 1T7XA 3U0WL 2HWZH 4OFYA 5FECA 1AD0B 4NRYA 4FQ1H 3ILPA 4Z76A 1OAQL 5DK3A 4PRBB 2ARJB 4BFEA 3SO3B 3GGWB 3QWOB 4NUJB 3QG6B 4EUPA 2IH3A 1NC4D 3S35H 4M62H 1HK6A 1NCWL 5HSFA 3UYRH 3FL7A 3D2UD 5B38A 1YECH 3MNVA 4XNQA 3BZFA 3NCFB 1CDCA 3IYLW 5DHVA 1R5VA 3I6LD 5E9DD 1CZ8H 1AR2A 4HKZA 3AREB 1X4YA 3H0TA 4UDTA 4HK0B 5D1XA 3VI4E 5BRZB 1FDLH 1FO0B 2DOCA 2X4RA 4JE4B 1U2HA 1RUAH 4OT1L 4J6RH 5CEYB 2OJZL 1OT1A 2H1PL 3FQRA 1KB9K 1BF2A 4JGMA 4L4TA 3CDGA 4U1LA 4CNIA 5ADOL 1MI5A 5IW6A 3DPBA 1A1OB 2FRGP 4XP1H 2VDNH 4G8FB 2A6DA 2BVPA 4KK8D 1XIWC 4OAWB 5SX4H 2VZTA 3ARWA 4NNPL 1T2XA 2NYYD 4KGJA 3GZKA 4ALAL 3R8BB 5EU6B 1AJ7H 1WWCA 3HUJA 4OM1L 2E27H 4QRPE 5D2LE 4WU7A 3WJJC 1MLCB 3UXFA 3GK8H 3NFPB 1KCVH 3D48R 5CUSH 1R0AH 3TJHC 4C59B 1KGCD 2IFFL 1QSFD 2V7HA 4JFEB 1DSFL 3RX5A 1IRAY 1ADQH 2BHYA 1NAKL 3MRIB 1Y18B 1AGCA 1EFXA 3FQWB 3DO3A 2R2EA 3DXAB 4OJFH 1S9XB 4S1RL 5JORA 1HDMA 2VAJA 2DKUA 1U92B 4ZSOE 4P2OC 3NTCL 4NRZA 5DQJB 5CGYC 3IDXL 2ZSWA 4KRPD 2LFGA 5B8CB 4KVCL 2AJ3B 5DRXB 1JMXA 4BFGA 5HDQL 2EEBA 2BZDA 2VC2L 5FOBB 1RIVH 5FYLD 3SJVE 1ZVSA 1MY7A 2QHRH 4GG6F 3HI6H 4K9EH 4HIXH 1KNOA 1C5DB 3ZKQD 2R1XA 1IAIM 4PBVC 3ZKNC 2FL5A 5D9SA 3O41B 1A9EA 1R3IH 4FQXB 2EIEA 5GRVL 1IC4L 1UENA 5FA4B 2AV1B 4LCWE 3PL6D 4NQSA 4R8WL 3MYJB 5DJ2B 5HGGS 2GTZB 2PXYC 3T0BA 5C0IA 1FNLA 3QWRA 3MV8B 4FOMA 1D9KD 1LGVA 1JVKA 5C6PB 1T6WA 2R0KL 3T0EB 4MQXC 1WCQA 1YQVL 3M1BA 3CXDH 3VRJA 4QOKE 5GS0H 1BQHB 3WSQL 5IMOB 3VRIB 2PYFB 4AEIH 3GSWB 3IDIB 1CDYA 1UYWL 2DBLH 4XWOC 1WIUA 3IGAB 3SKMA 1E4KA 1MAKA 1UM4H 1BREA 2W0KA 5TDPA 4MWFB 4Y19A 1KIPA 3SE8L 1NL0H 1ETZA 1YEFL 4R97C 1VADA 4U7MA 3IKCB 4CU8A 4DZ8B 3VXNB 3W5NA 1DQML 4MLIA 5D6DC 4TOYH 2F8XC 1GGIH 4JVWA 5D6CB 5KSUB 4MYWB 2ARJA 1WLHA 4KHXL 4BZ1L 3U30C 2GW5A 3MRBB 4U6VL 5IVXF 1RI8A 4MLSA 2OTWA 4NZRL 5HHVH 2JJTA 4R2GD 1KTKE 4WO4D 1EEYB 1CFSB 5JHDB 4YIQB 4V1DE 4R0LC 1ZLVK 4JQIL 3QCTL 3AREA 1JL8A 4RGNE 4HK0A 4R90L 5F9OL 3NACH 4OD1L 5BRZA 4IRJD 1EXUB 5GRUL 2B4CL 5SWZE 1FO0A 3H9SA 3P4NB 4K71C 3FB8B 3D85D 4JM4L 4J3OC 1VEOA 3SDCD 3NABL 3MODL 4U1IA 2X89A 1SBBA 4JZOB 5CD3B 1VHPA 2BSRA 3D39B 3BRGC 3UMTA 1A1OA 4S1SL 5GZND 5CEXB 5I1HL 5TE4L 5DD0H 5FO7A 2P49B 2H45A 2OXGA 3QWQB 3GMQB 5ANMB 4OAWA 3G5XB 1K8DA 1HINL 1TJHL 4Z18A 2CGRL 5HVWA 2A9MH 5JQ6L 1VFUA 3WUWB 5EU6A 4DUWA 3DMMA 5I71C 4AEFA 4HSQA 2WLYA 5ACLA 2V2XB 3BWAA 4PJAB 4W6XB 1T1WB 4Z5RA 1CDUA 5F1SA 1NGWB 4EJ1C 1YEIL 1L6ZA 5FXCH 3KHQA 3NFPA 5GISL 3ZZ1A 4LPVA 4WWKB 4MZ2A 3VFGL 3ESVF 3MLWL 1OTSD 3HC0B 1Q9LB 4MXWL 4EN3B 5D1QA 1Y18A 5KTEH 2BNUB 4ONFL 3FQWA 2VISB 2MJWA 4JFQB 2VDMH 1XGYH 4ZO8A 1A7PH 4LU5L 4PGBB 4GAJH 1S9XA 4S0SD 1QBAA 2ILLA 2Q20A 4K3JL 4JO3L 1U92A 4QRQB 4HC1A 3P30L 3KS0H 4UQ3B 2J8OA 3KPMB 4JY4A 4RFEB 5DVNA 5B4MC 25C8H 5B8CA 2DLEA 2NY0D 1A4JB 2AJ3A 5DRXA 4JLRB 5FOBA 4KK6C 5C0CB 2Z93B 2Q8AH 4I4WA 3VXRD 5KVFH 2BMKB 4GW5A 4GG6E 2AAVA 3QSKB 3H3PL 5MENB 1C5DA 1QHOA 1MFAL 1KLGA 3EYSH 4S1DC 3VDCA 1MCSA 4YDLB 1NMCB 4OZFH 4HJGA 4AG4L 2XNAB 1ORQA 1NMBL 3O41A 1S7UB 4YDIH 5EBMB 5FA4A 2AV1A 3BPOC 3B9VA 3QEGH 4GBXD 3UC0L 3MYJA 2NX5D 3PABA 2PR4H 3LKQA 4YFLI 5SWQB 3MXVL 4OV5B 1D5ZA 4X6DB 2IANB 4HZAA 1XR8B 5CD5D 2HJFB 1RY7B 4HW6A 3VRIA 2PYFA 3ZTNL 3GSWA 2PNDA 3TJEH 1CR9L 5FYLH 4D0CA 3IDIA 3X3GH 2N7AA 3IGAA 1MCPL 4XPFL 3KAAA 4QRRA 1F5WA 4LHUB 4QXGL 4YC2B 4O58L 2YRPA 5D7JB 3V5HB 4ODBD 3C6SB 4QWWC 3IKCA 1TETH 1RUMH 4DZ8A 3VXNA 4X6EB 1YMMB 1MREH 4HQQH 2Z8VC 2RIKA 5F72S 1MCDA 2FATH 5KSUA 4HEPG 3AUVA 4TTDD 1JZ5A 5AAWA 1LDSA 3C60D 4K7PH 1U41A 3H9ZA 4WW2F 4X8JB 5IMLB 4KKCC 5IVXE 3VXPB 5T1MB 3Q6GL 2H2PC 1EEYA 1CFSA 2R23B 5K93A 1YA5A 3VFNA 4N1EA 4K3EH 4R3SB 1SEQL 4XH2B 2Z0BA 1J7VR 5E24E 1P84J 3RAJL 3MJ8B 1CICD 1WSST 2XTJE 4JREC 1EXUA 2V5SA 1CT8A 4MGXA 3K2UH 3NZHH 1KBGH 2B0SL 2NR6D 2Q76B 4WVRA 4JZOA 5CD3A 3O11B 4Y4KB 3WFDL 2YRZA 2VXQH 3UPAA 5IB3B 4PJDA 3SDDB 3ZKMC 5GGSB 3GSNB 5HHMB 5IR1B 1KN4H 4KY1L 2WBJD 3GMQA 5ANMA 4ELKA 2HJKA 2BJMH 3ARDB 1NC2D 5GPRA 1MFBH 2EDOA 2EIZB 3ESUF 3WUWA 3DARA 2A73B 2ICWI 3EGSB 5GJSL 2NTSP 2MHAB 2WSKA 1I9JL 2V2XA 4PJAA 1BVKB 4PLJC 1T1WA 4OGZA 2ZOLB 4OV6F 4HWBA 4R26H 5C7XH 1W8OA 3QI9D 5HHOD 4U6XB 1S8DA 5IFHH 3R8QA 1SVZA 2DQUH 3HC0A 1Q9LA 1KB5H 1XF4A 1S78D 5J13C 2BNUA 2ADFL 2VISA 1JK8B 3QDJE 3QIUD 1MPAH 3QHZH 3QJFA 5DC9B 3L6FB 1KT2A 2Z92B 4OUUB 4PGBA 1LO3H 4PB9H 3U4BL 4XAKD 3SE4A 5FF6B 1ZLSL 4QRQA 3W39B 5A3IC 3QDAA 4UQ3A 3KPMA 5AUMB 1CBVL 4I2XB 4G42A 4JFDB 2G60H 4DGYH 3ARGD 3UZEA 1WFUA 4H0HB 1OGAD 3MLXL 1A4JA 2ZUWA 4JLRA 4PJ8D 1M6OA 2FBJH 5C0CA 2Z93A 4GOSA 2B1AH 3MRQB 1U8IA 3F58L 4XVJH 4P4KD 4K2UL 2FEEI 2CR6A 5MENA 3MRGB 4FG6C 3IDMB 3V6BR 3HRZB 2DQGL 4JKPL 5BXFB 2XNAA 2ZP0T 1HIMH 1J0YA 1S7UA 5F97E 1H15B 4L3EB 2DMCA 3F6IA 4WTWA 1J9CT 5EO1B 5HYSA 3RKDD 5SWQA 3LKOB 4OV5A 3GMPB 1KELH 1A7NH 5M95B 5C71A 5IHLB 2X2YA 2IANA 1S7VB 2X1WL 3K8MA 4HXAH 4A2LA 2FJFA 1BD2D 2QV2A 3IDYB 1V3KA 4BZ2L 1IGML 2X70B 2VSDA 1GGBL 1CGTA 4HUWB 4P46B 5IEKB 4XAWL 1LE5B 3RY6C 1MWAB 4HJ0D 4TSBH 5KJRL 4LHUA 4L29B 3MRDB 3V0VA 4U1GC 5B3NA 2Q6WA 4HUVB 1FG2A 3V5HA 4ZPVA 2EH7H 4LCCC 4UIMA 4LSTH 4X6EA 3PQYB 5CSZB 5I19H 3IDNB 3FTGB 1YDPB 4S10A 2XXCB 5CMAB 1ZWIA 5KSVB 3CVIL 3WS6A 4YHOH 1LO2H 3MBXL 4X8JA 3VH8B 5IMLA 3T3MF 3TCXA 3VXPA 5T1MA 1V7NH 4TSAL 5L9DH 1MNUH 3B6SB 3QQ9C 5JMRA 2WK2A 3P3YA 2DJ4A 4XH2A 1U58B 3MJ8A 1G9NL 3WFEL 4D9QE 3N1FC 3KPTA 4LSUH 5TQ0L 5FM5M 2C4XA 3D5OF 1GPOH 1WICA 2WIMA 4Y4KA 1QNZH 4IEFB 3AS2A 5T33H 1EHLL 4OCNC 5IB3A 4HBCH 5DFWH 5GGSA 5K9QG 2D9QB 5GSVB 1KEMH 1T4KB 4KMQA 2GITB 2AGJH 2XA8L 4QLRA 5C0AA 1ES0A 3MXWL 3HE6A 4AIOA 3WDIA 2C3HA 3VFPB 4NT6B 2YN5A 2A73A 5ALBH 4WEBL 1WIOA 5GS2D 2AK4D 4TSCH 4EDWH 3WL9B 1GH7A 4FHBD 2XG5A 2ZOLA 4RISL 1JZ7A 1K9TA 3A6CH 3PJSA 3RGHA 2NY4B 1HHHB 2WBWB 4U6XA 4JFFD 3UAJD 4POZD 5DWUL 2SEBA 4XPTH 5FGCE 1RPQA 4ZXBD 3HZMB 4XNYL 5C09B 1X5FA 1AI1L 5C6TL 1JK8A 4HJJL 4JB9L 1RJLB 1QFWI 3TT1H 2Z92A 3JWDH 2HFFA 4OUUA 4O4YH 4PYHA 5HVFB 2R69H 4ODXB 5FF6A 3W39A 4G9FD 1S3KL 3BESR 4YJZL 4PG9B 5AUMA 5AEAA 3WNOA 4JFDA 5DJYB 5DS8A 3VFMB 5EO0B 1KCUL 4OBRA 4Q6IB 4KQ3H 4JG0L 5K9QI 1QBML 1M7IB 5C08E 2CRMA 3WIIL 1NC4B 3SDYH 2DQTL 4TQEL 3TESA 3D2UB 3O8XB 4NHCH 5DRWB 3MRQA 1L0XA 3ZYOA 3HR5A 5LGHH 8FABA 1CL7H 3PGCA 4P48A 5E9DB 1PG7W 1UCBH 2WNGA 5F7YC 3IDMA 3HRZA 1AKJA 2Z8SA 1V7ML 1YNKH 5HI4D 1CFQB 5BXFA 3RVVC 4AQ1B 4JM2B 3P9WB 3TYGH 4OQTL 1H15A 1T21B 1KTRL 3LSOB 5DJAB 4LLYA 4ZNEE 1ADQA 1A1MA 1U0QA 4JQVA 2VXSH 3HG1D 3I85A 1UH2A 3C6LD 4BSWB 1CXKA 4JR9L 4KROB 2Q3ZA 1C1EH 4HUUB 4HLJA 5FUZL 5B3JF 1JFQH 3VFVB 3GRWH 4HUWA 4OLYH 4P46A 5LBSH 1T1ZB 2XQYG 4Y5XA 1LE5A 3C2AH 5IJKA 3CFCH 4ZAKC 1YNTA 4PB0L 1DEEB 3X3FL 4L29A 3MRDA 3ULVL 1CXIA 3NCCB 3FRPG 2XZQL 1T7YA 2NY3D 3H7BB 3KLHC 3RVXD 2A38A 5K9JH 3TN0C 1YN6A 1C16B 1QSFB 1RJCA 3DYPA 4IM8A 5H94A 3FTGA 5CINH 1MIEH 3P0VH 4FFYL 4NQVA 3LHPL 5FHAH 4OZFB 1HYRC 5T3ZD 1AO7D 1KG0B 3QP3A 3VH8A 3IFPB 3MLSL 2ZSVB 4FRWA 4L8SC 4NQDE 5HYFA 3A6BL 1E6OL 5H37H 5HYQA 4XPAH 4YDJB 4M03A 1N59B 4XCEB 4KRPB 3U4EB 4ETQB 3JTTB 2OJEB 1CCZA 1DLFL 1U8KB 2BSSB 5FUOL 2W0PA 1K4CB 1RMFH 1H3WM 1G6VK 4WDIB 1JPTH 1Z6JT 2RFXA 4DVBB 3V7MA 3MLUH 4XB7A 4I3RL 5C0BE 4PLOB 2JTDA 5GRJH 4CDHA 1EA9C 1FCGA 1WT5A 1I8IA 4GRLC 4JG1H 1MRCH 3QXTA 4JPWH 3EJYC 3TBWA 1PG7H 5JPNB 3T2NL 4Z7QF 1KEGH 5GSVA 3P0GB 4HCRL 1T4KA 3GJFK 3PL6B 4FFWD 2ZNXA 1YEKL 2HTLC 1PY9A 4NT6A 3CLEL 1CI5A 1D9KB 4YPGB 4Z8FH 3BH8B 4KXZI 1JYXA 1YEEH 4GRWF 3GMLA 5T1LD 5D2NB 2K3TA 2E7LA 1PKQB 3V6ZB 3IVKB 3N85L 1DQDL 1HHHA 1I1RA 1C7TA 3SDXA 4PRIE 5ISZD 5FKPB 3S3SA 4PP1C 4PJXF 3HZMA 5C09A 5EIQA 4JQXC 3N1GC 2JB5H 1EAPB 3MOAL 4E41D 2B7DT 2IQ9L 3RWIA 2DTMH 2FGWL 1RJLA 1HQRA 2Q7YB 4XHQA 4DWHA 1JJUA 4P59L 2VQ1B 1NDMB 3OGOE 4EBQH 1DVFD 3BAEL 4PG9A 1JN6B 3G9AB 5DJYA 4ACPA 2R56H 3VFMA 4IIQA 5EO0A 1PD6A 2NW2B 5E7FA 4Q6IA 4EZMA 2VDLH 4P2RA 3AU1A 3EZ8A 5D7IB 4OCXL 5E94B 3O8XA 4X5XB 2UWEB 3CFKB 5DRWA 4WO4B 3VD7A 1HE7A 4HS3B 5L6YH 2YR3A 1U2CA 4J8RA 1NQBA 2YRLA 1ZSDB 3O3AB 4OLUL 4QXUH 1GHFH 3U6RB 1YYML 4IRJB 1GXEA 5KN5B 4FQ2H 1Z5LA 4JM2A 1XCTB 1IGCL 1BVZA 5DJAA 5J3HD 1Z3GL 4M8QA 2PYEE 1KB5B 3MNWB 2IF7A 1CQYA 2NXZB 3LDBB 1LDPH 2XT1B 3IAPA 2XKNB 4Y1AD 3VFVA 1T1XA 5B3JE 2DF3A 1T1ZA 2EDDA 1T04B 2F53D 2VE6A 5HD8D 2VRAA 4N0UB 4G8GA 3NN8B 2CSPA 5JIKA 4R9HA 1X5ZA 5KVEL 3TBTA 4QHKJ 1G7MB 4LQ1A 3H7BA 4PV8B 4OCYH 4N5EC 3DBXB 1OP9A 5FYJL 3KJ4B 4QTIH 5F6HJ 4RMTA 1QSFA 2Y9RT 4XCYA 4M3KB 1U42A 1HYSD 3V5KB 3AS1A 5D1ZA 2OXHA 4PLKD 5DVLA 2VOTA 4M1CC 1KG0A 5FM4A 3EO0B 5DO2D 3IFPA 5JOPD 4NM4H 2ZSVA 3RTQC 3SCMC 4EOWH 1NUNB 2W91A 1Q0XL 1D5XA 4YDJA 2B1HL 1AHWC 1N59A 4XCEA 1P6FA 1ORSB 3BYTA 3QFJD 5E95B 2OJEA 3NPSB 4XXDB 4DZBB 2NY0B 3PWLB 2F5BL 1K4CA 3DSFH 4BK4A 4Y0GA 3E6HA 1MFDL 4WDIA 4JZJC 4I48A 4UV4L 2VDOH 3V6FA 1U8JB 1FSKB 2QSTA 3QQ4B 1F00I 5F8RC 3GIZL 1RZ7H 3MTRA 2VYRE 4TNWF 4NZDA 1IFHL 4JFYB 3THML 5DJ6B 4NWTH 4G8IB 5T3ZH 4Z7QE 3BDYL 2CLZB 5HVHC 1GC1H 1MF2L 5DJXA 5CCKL 3RGVD 1LNUB 2LU4A 4DN4L 1MCHA 3UTPE 1D9KA 3OSKA 4YPGA 1MCLA 5AZ2H 3BH8A 1SHMA 4NUGL 4TUKH 2BY3A 4U0QB 4LLQB 5EFIA 3QAZC 4XCFH 1AGDB 4C54A 4GRWE 3NIFE 1PKQA 2GFBB 3BISA 1MUJB 4O9HH 3IVKA 4FXKA 2EDBA 2ITDA 3CSBA 1HXMB 1JF6A 5H35A 1N0LA 3BDXA 3ULUF 1MCOH 3ZE1F 1IC7H 1IQWL 1T1YB 4N8VG 4WFEE 2Y5EA 5F7LB 2MFNA 4K94H 5KSAB 3O9WD 3IFLL 1YEGL 3ZYJA 4DTGH 4EKXA 1D5BB 3LS5H 2IBBA 1ZANL 2VQ1A 1T03H 3KNBB 4OD3H 4WI5A 1P5UA 5EOQL 1BZ9B 1JN6A 1FZOA 1BEYH 4FMFA 2NW2A 1JPFB 3B9KD 3C60B 3DX7B 4MJ2A 1JGDB 4LBEB 2ZOKB 2I27N 1N4XH 5D7IA 5E94A 3KXFD 3CFKA 4DN3L 1EAJA 1U8MB 4HS3A 3RVUD 1CGYA 2N4IA 2YZ1A 1NBVH 2VL5A 4L4JA 4TVPD 1ZSDA 2OMBA 1CICB 1F6AB 4IRJA 5BVPL 1X3DA 1MCBA 3Q1SL 1XCTA 1YYLL 4KUCF 5HY9B 3LQMA 1HHKB 3K1DA 2CUMA 4PJHF 4UV7L 5JW5B 1VPOH 1KB5A 2F9BT 1VFMA 1NAML 3MNWA 1H3PL 4NNXB 3VXUD 3BSZH 1TJIL 1FNGA 2C4FU 2WBJB 2OLDA 4E42B 7FABL 3QCUL 5T3XH 3ROLB 1NC2B 4ONHB 4LIQL 4IOIB 4RFNB 5HGHB 1BGXL 3HNTL 4O5LL 1X5HA 3QO0B 3NN8A 5D96C 4WW1B 3TA3C 3VXOB 2IADB 4D9LH 1G7MA 4PV8A 3FQUB 2DBJA 3ISWA 3QI9B 5TF0A 5HHOB 1A02N 5CZVL 12E8L 3L3KB 4RWYL 5FKAB 4NQCA 1WC7A 2IBZX 4KDWA 3WXVH 3BKCH 5GS3A 3C09C 1P4LA 1MJ8L 3QIUB 5I15H 3LRSA 5A2KH 3CJJA 4TUOB 1BP3B 3EO0A 4I0PD 2PW2B 4LVOB 3VGBA 4Z9KB 1ONQA 4K8RD 4XNUL 5E8DL 1ORSA 4HUXA 3TWCL 3WIHH 2HFTA 3IXAB 1I4FA 3FQNB 3WJLC 4UNVA 4PJ8B 2R0ZL 3QEUA 4FQJH 3OG6B 4P4KB 3BGFB 3V5DB 1U8JA 1OP3K 3QQ4A 1BAFH 1FYHB 2Y25A 2RB8A 3I2CH 3VWKC 4JFYA 1NCCH 3QDGA 1F3JA 2BVQB 4G8IA 1NEZB 2CLZA 5E1AB 3DETD 4P2CG 1IM9D 1I85A 1PLGH 2BDNH 3WNNA 1JZ2A 5FCUH 3I3DA 3CZFA 3TFKC 3ZTJG 1EVTC 4GXVH 4M7ZB 3ZE2F 3VWJA 3UTSE 1BD2B 1AGDA 2DQIH 4KRNA 2GFBA 2EC9U 3GM0A 4LL9A 1UCTA 4LLDB 4F8QA 3S37X 1YPZB 3O6ML 3NFNB 3HNSL 4LASL 1T1YA 5DD1H 2EE9A 5DT1H 3ULUE 3ZE1E 3PHQB 4KI1A 5C0RH 5KSAA 5AZEH 3U0PB 1NCDH 2NTFB 2CMRL 2D7MA 3KNBA 3N9GH 4XWGH 3U4AA 3H9HB 2HAZA 4YK4C 1X5LA 1JPFA 3C60A 3DX7A 1JGDA 1ZXQA 3S7GA 4LBEA 2ZOKA 3DUUB 5L7XL 5C86A 1S5IH 5T1KB 1C5BH 4HPYL 1U8MA 2DDQL 3LIZH 4UBDD 1MEXH 1F2XK 3W2DL 4X9IA 3RDTB 3ZSSA 1CICA 1F6AA 3W81A 1X4XA 1CLOH 4OLXL 4KMLB 1RVFH 2H8PB 2V2TB 1ZGLM 3IB4A 3CVHH 1L7TL 5JW5A 4M4RA 3C5SA 3VXTA 2VN4A 4PJHE 1XF2A 3A0OA 3CMOH 4NNXA 5K59E 4IRSD 1MRDH 3PF2A 1A6UL 5DVMA 3TH3T 2VLKE 3D9AL 1XZ0B 4NKIH 1IKNA 4MHHG 2Y72A 4HWBL 3MLRH 3UTOA 1PSKL 4E42A 1FGVH 2NY7L 4KJQC 2DYPD 3ROLA 1NC2A 4ONHA 4QCIA 5I17B 1HHJB 2Z31D 3UJIL 5F9WC 4ZFOB 1EERB 2MKLC 2AK4B 4TVPH 3QO0A 1KPRB 4WW1A 2C9AA 4OSUL 3VXOA 3BRFA 5JR1L 1GGCH 3VCLB 3G04B 1FNAA 3FQUA 2P45B 3AM8A 3IT8D 5KAQF 1OT2A 2W92A 5FKAA 3PDOB 5I66B 1LVEA 3GMMA 4XVUC 2NW3A 4ZXBB 5TPWL 2CRIA 1DLHB 1QACA 4TUOA 1D6VL 4Q0XL 3E3QE 2PW2A 4I5BB 4KV5F 1TNNA 5E5MB 2A6JB 3M8OH 5LCVH 5C0GB 4GW1B 4P99A 5HPMA 1E4XH 3SKOB 3ZT6A 1TZIB 2L4OA 3IXTB 2XZAL 1YY9C 4QRPD 4CMMB 4HH9B 3IXAA 4ZDHA 2HKHL 3CDCA 3QZWA 4MHHI 3GRWA 4M6MH 3OR7B 4F37F 1OAKL 1NUGA 3V5DA 3JSSA 1EO8H 3NGBB 5JDJA 3CK0H 4F9PA 4UAOB 5IT2L 1DE4B 2XWJA 4KKAC 1EV2E 3ROOB 2BVQA 4BQBA 2CR3A 5E1AA 1SYSB 4ZS7L 2NLJB 4NJAH 4NYLB 1OARH 4HWZB 4JRXA 2AABH 4LVNB 3ABZA 1HOCB 4TNWK 1IKFH 4JKLA 3U82B 3HG1B 5L2KA 1YEJH 5FYJU 5JUEL 4PRPE 5SWSE 3FFCA 3EKCA 4WENB 4X4ZA 3ZE2E 2R0LH 4Y7MA 1E4KC 1NEUA 4JO1H 4QKXB 2ERJC 3SJVD 1JZ8A 1PKOA 5MEOA 3QCVL 1JPSH 2FGZA 3VXQA 4LLDA 5CP3H 1YPZA 1QSZA 1N0XL 3LMJL 4C83B 3DHJA 1FPTL 1A6AB 2R8SH 2R1YB 3UCRA 2OZ4H 1MHHB 1UWXK 2C5DC 5D5MB 2NY3B 1LD9A 4NGHH 3U0PA 3GSRB 1SEBB 4LCWD 2NTFA 3SO3C 4DKEL 1GYAA 3LZFL 1TCMA 1IBGH 3G6JB 4OLWH 3BI9X 4YZFF 3LQAC 1XF3A 4PJ7F 4ENEC 4L5FL 3H9HA 2JJTC 3P2TA 4FQIH 4OFDA 3S37L 3NA4A 1YN7A 4NO5A 4QOKD 3REWB 4EIGB 3GUTA 3SE9L 1AO7B 1UWEH 2A9NH 2BCKB 5BVJB 3AREC 3LH2L 2OTUA 5T1KA 5E2VL 3T0AA 5KOVC 3QUXA 1OL0A 3CPLB 4NN7B 3RDTA 3GSVA 5CIPH 5I75B 4GMSL 3AC0A 1A7OH 2UZIL 3FB6B 1CD1B 2H26A 2H8PA 4X7DC 1OQOA 2JCCA 1IT9H 3BEWA 2EDXA 2IPTH 5IV2A 3DROA 1TZGH 2PTTB 5IB5B 3GO1H 1F2QA 4BELD 2PKDA 1TTUA 1Q72H 1P1ZA 3DMMC 1J0KA 1OW0A 4ONGH 3RUGF 4F3FA 1KXQE 3FN0L 4V1DD 1NCAH 1R5IB 4HKJB 5I17A 1LP9F 1HHJA 1CZ8L 1XF1A 3D0LB 3TZVD 4RGND 4OUOA 1JV5B 1ITCA 5SWZD 1AY1H 3OAUH 1P7QD 5T1LB 5CJOH 3CU1A 5D1QC 3GKZA 3G04A 3B5GA 1X5AA 4UT9H 2WLZA 3PWNB 3CH8A 3CFIC 3UJJH 5ISZB 3PDOA 4TULL 5I66A 4JY5H 3MUJA 4OM0H 3WKMH 2EDWA 5CHNA 2VDNL 1DLHA 3HE7D 3QUML 5DJZB 5GZOC 2C3GA 3LN9A 4XNXH 1BFVL 2WWMD 4I5BA 3BVNB 4NQUA 5E5MA 4BFIB 2A6JA 3QPQC 4KV5E 5B8CC 3V95A 1I1CA 4POUB 1DVFB 3IXTA 3O6KH 4AEHL 2B8OT 1OAZL 3BZ4B 4ZS6D 4CMMA 4U6TA 2CJUH 1Q94B 1LEGA 3K46A 2NMSA 3QEQE 3B3IB 1EEQA 2DM4A 4Y8DC 1IVLA 1R0AL 1JGVH 3OR7A 4APQA 3PP4H 2JK5A 3DYMA 1HN1A 1WTLA 2NPLX 1X6LA 3JUZA 2P5EE 4CN1A 4MNQE 4LGSB 2WBKA 5IB2A 2BC4B 3S4SG 4XC1H 5JIHA 1DE4A 2DICA 1GOHA 1OTUC 3ROOA 1K85A 3QH3A 1QZ1A 3TEUA 1SYSA 4XRCB 1F8TH 4C56A 3T0EC 4XMKH 4HWZA 1QD0A 1HOCA 5T5NF 3MRJB 3HG1A 4D3CH 3JTSA 3KWWA 1MQKH 3B43A 3IFOB 4KVNH 1Y6NR 3I02A 4JCMA 5HYJD 4Y1AB 2GCYB 3Q6FB 1YJDH 4HT1L 2AJZB 3E0GA 4UMGA 1FZKA 2DQEH 4C83A 1IAOA 4HG4K 2F53B 1A7RH 2R1YA 3TV3H 4OB5L 4LLVB 1MHHA 4YQXH 1KFAH 4ODSH 4M6AA 5D5MA 1X9QA 1H9VA 3GSRA 1KJ3L 1SEBA 3SGKA 1O7VA 1G0XA 4UT6L 5F7UA 3MUY1 5FOJA 2JIXD 2DQHH 2WZPD 3JV4A 1J05B 3Q2CA 1GZPB 1AD9B 2VSCA 4P3CH 5DVOA 1Z0NA 4YZFE 4PJ7E 5M7QA 3REWA 1BJ1H 1AO7A 4N0CC 3PWJB 2BCKA 4AEIL 3MO1B 3PHSA 3P73B 1A0QH 5BVJA 2ZPKH 1QRNE 3BQUD 2VLLA 2GK0B 2DBLL 2QQKL 1H8NA 4K7FB 3ZSTA 4NZUH 1WF5A 1AXTH 2LAAA 4HMCA 3ZKXB 3CPLA 3HMXL 3QFJB 2VR9A 4UOJA 4U1SB 3B2UC 3MRNB 1N8ZB 1PZUB 2W1NA 3WLWC 3GSUB 1CD1A 1W72H 5DMIH 1CDBA 1YEDB 1P69B 5J6HB 5J7CC 2HKFH 2PTTA 5IB5A 3VFTA 4QHLB 5GGVH 1KLFA 1CTNA 4P9HC 1RHHB 5HHVL 3P4MB 3DVFA 4X8XA 3RUGE 3RGVB 1R5IA 1AR1D 3PIQB 3RNQB 3BIBX 4WWKC 2XTJD 1JV5A 1YQ2A 2EDTA 3CCHB 4ZTOL 2GKIA 5IROA 5SV3A 3W11D 4EN3C 3OXRA 5H2BA 3M45A 4U1NA 3TO2B 5FIEA 4H25A 1BBDL 5ISZA 4JKKA 4PJIB 4OZGA 4YGVB 4Y4FB 4XP5L 3A67H 1LO0H 1B88A 4WI9A 1EDQA 3G9VA 4G5ZL 3SE4C 5DD0L 1Q1JH 5D7LB 5DJZA 4XZUA 5ESVB 1T6VN 3BVNA 4BFIA 2GT9A 3CVHB 3PP3K 4Y16D 2J88L 3ARZA 2DS4A 4HS8L 1CFNB 3EHBC 3T8XA 3TO4D 5A2LH 3D69B 4HIEB 3SQOH 3BZ4A 4LCIH 2HT4C 3B9KB 1Q94A 3VGGA 1N64L 2DD8L 2HT3D 3KXFB 1H3UA 1NMCC 4JDZB 4ESKA 1UJ3B 1RUKH 4BH8A 1C5CH 4Z6AT 2A74B 5KTEL 3QDJD 3ARVA 2BC4A 1XGYL 1YNLH 1KIRB 1UC6A 4F37K 2C3VA 3S34L 5IQ7H 5J4MA 1KCLA 4XRCA 5KAQG 2VDPL 3RL1B 1PVHA 1MHPL 5DRZB 5CJQH 1T0MA 2J6EH 4P5MB 5ILTL 3DGCR 4YX2H 1IZKA 3VGHA 3S88H 4G6KH 4H1LH 1I75A 3VXUB 4M5YH 4MDJA 3IFOA 1AQDA 5CEZH 5HGAB 3BYYA 1P7KB 1N6VA 4PJGF 2C7UB 4Y1AA 1FNSL 3RZWA 5KVFL 2AJZA 4EI5D 1E6JH 3HC3H 1RAMA 3EYSL 1CDIA 4HHAA 4KMTL 4W6YB 4HKXA 2J12B 2BRRL 2YUWA 4U1KA 1DEDA 4IS6B 2W9DH 4P3DA 4H20H 2BNQA 1K4DB 2DWDB 3WS6C 3SPVA 5EZIL 1J05A 2Y36L 1AD9A 1C12B 3B8YA 3DX6A 4M48H 3PNWB 2C3WA 3WFBL 4R96B 3FAXA 1UWGH 5IFAH 4I0PB 1IGJA 4L4VD 2HFGH 1A5FH 3X3GL 3ULVF 4K7FA 1KOAA 5EULV 4XBGA 2CK0L 2JE8A 3WS3B 3Q5TA 4Y4KC 4KQ4H 3KPPB 3SDDC 1XGQB 3O2VL 4HQQL 1G7HB 4HFUL 1OTTC 2FATL 2DLFH 5FDYA 5HHQA 1XH3A 4M02A 4K7PL 5J06A 3HE6C 4JJHA 5J89A 3GHBH 3N50A 1R3LA 5LWYH 3F7YA 5I1EL 3G6DL 1IM9B 3RGVA 1UM5L 2RGSA 4K3EL 1IQDB 3RNQA 1FV1A 3ZDYF 1HXYB 1DQJB 2RJMA 1OAUH 3CCHA 3CC5A 4D9QD 3QHFL 1S9YA 2D0HA 1QLFA 3VMNA 4OFVA 1JNLL 4PREA 3D3VE 4HWUA 4F9LA 1ZA3B 5GGQL 4UTBH 3H6JA 4HWNA 4X4XB 1AC6A 3EW3B 1OCWH 4I1NB 4PJIA 3EOAA 4M4PA 1OWRM 5BO1H 4YGVA 2O5ZH 1HHIA 4Y4FA 2A1WH 1RK1B 1M7XA 4IOSD 4JFZL 4F7PB 3D0VB 5CIPB 3BKJH 5KSBB 2WIIB 1KTLB 3MA7B 4BQCA 1KN4L 4A2MA 5D7LA 1J11A 2OK0L 5J0BA 1U8OA 3T0VA 3IU3B 1QSEA 2FIKB 1H8SA 3CVHA 1OOAA 3G5VB 3DYOA 2FSEB 1LILA 1G1YA 1CFNA 4PP2B 5K33A 4O02L 3D69A 3PV7A 4ISVB 1F4AA 1PQZA 1QR4A 3RZCD 3JV6B 2C1OB 4R26L 4NWUL 2Y6SC 3WYRA 2VB5A 1RUPH 1UJ3A 3BUYB 4F33A 2DQCL 1DBML 4IOFD 3X17A 1KIRA 4WNQA 3PV6B 1EUTA 4JQVC 2JJSA 4AH2B 3CXHJ 3AAZB 5ICXA 4OCSH 4KKLD 3RL1A 5DRZA 1EJ6A 1BZQK 4P5MA 5F88B 4LOUC 4RMVA 3IDYC 3KJ6H 1ITBB 1DDHB 5E08H 1NGZB 5TH2B 2J4WL 3IF1B 4DGYL 4IRSB 1Q0YH 1ZEAH 4MA8H 4P46C 3VXUA 4HIJA 5I9QC 3O3UN 5C08D 4Y5XC 2YBRB 5HGAA 3FHQA 4M61B 2FBJL 1P7KA 5EBWA 2C7UA 3PHOB 5IESL 5I1KH 4PJGE 2DYPB 5D71H 5H8DA 2FEEL 1FYTE 4ZFGL 2Z31B 2E5EA 5K9KA 3OPZH 4ZUSB 1U6AH 4NJ9L 4Y4HD 3HLAA 1XGPA 3GIVB 4GQ9L 4IS6A 4R7DA 2ZCKH 3PWPE 2OMNA 5FM5O 1H5BB 3O81A 3WD5L 1BOGB 1FNHA 1KELL 1C12A 4FQLH 5JXAH 5DC4B 2ZUVA 4OZIE 1JI1A 3DX9B 1RURH 1WWAX 2GY7B 3WO4B 1KJ2H 2ADGB 5GGTL 2UZYB 3E2HB 5GJTH 4N8CH 4NBYB 5IM7B 2YD9A 5GS0C 5I18H 2KBGA 5E2TH 2VDQL 2CO6B 4XCCL 4HDIB 3UO1H 1IZJA 3ULVE 4QRPB 5D2LB 2X4OB 43C9B 1A6TB 3WS3A 2GHWB 4G43A 5KVGL 1WT5C 4NNYA 1WVZA 3KPPA 4WTZG 5CP3A 5I19L 2AJVL 4YR6B 1KENL 4X4YB 3MJGX 3O2DH 1OAYH 4R0LA 2FH6A 2O5YH 2OZ4A 1QO3B 5LQBH 1D7FA 3NCMA 4B7IA 4FQHB 1A14L 1T66D 4YHOL 3UPRA 2AK1H 1TPXC 3PGFH 3MGTA 2VR5A 2YD5A 3S96A 4NQDD 2CDEB 2HP4A 5L9DL 4ZSOB 1MNUL 4MD5B 2VXUH 3FO0L 5ID1B 1NSNH 1IQDA 2E7LC 2Y07L 3NFSL 1NFDF 4U1MB 4KZDL 5ICZA 3LN5A 3ZDYE 1RJZB 2A6KB 1YUHA 2CLRB 1DBBH 5KZCD 4ZUWB 4DVRL 1MOEA 3EDFA 4LSUL 1EHXA 1VFAB 5DF0A 3V4VL 2EC8A 5I8KL 5C0BD 1ZA3A 4GSDH 4X4XA 1QNZL 4P4RB 1RK1A 4XNMB 3QDME 4O00A 5LGJA 1KTLA 3MA7A 1CK0H 3VXRE 3F7QA 5BQ7B 5B39B 5DA4A 2QJDA 1NDGB 4LKXB 5DI8B 1W72B 2OL3H 4L3CA 3ES6A 4KAQL 4Q6IC 3G5VA 3T3PE 3MRCB 5ADPH 3L9RA 3D18B 2QKIB 3OAYH 3JXAA 5ALBL 4PP2A 1ZHKB 4TSCL 5HJ3B 3O8XC 2NY1D 3ZHLA 1A6ZB 1QBLL 4QOKB 3C08L 4UT7H 2NX5E 1ND0A 3JV6A 5DXWA 3A6CL 4Z7VF 1S9KC 1MJ7H 4PRID 5E00A 4PYGA 5EC2B 1GAFL 4JM2C 1BJ8A 4FS0A 4N0YH 4PJCA 1P2CB 1OD7A 4XCNA 3NCJH 2L0DA 2YD6A 3TT1L 1QFWL 4AIZB 4AH2A 1GVIA 1QRKA 3AAZA 4WI3A 3MV7A 3TPUA 2Q8BL 2R69L 1U91A 4KROC 5F88A 4GKSB 1H0DB 3SGEI 1DDHA 2Y7QB 3MSPA 1NGZA 3AMKA 5TH2A 5A1AA 3IF1A 1KF9B 4KQ3L 4PTTB 1U95B 2YBRA 1J1XH 4M61A 2HTKD 3GNMH 1JGUL 1A7BA 4BJLA 3FOMB 1W0WB 3Q5OA 5F1KC 3VW3L 2VLJD 4DGIL 1MI5E 1J86A 2Z31A 4WUKL 1JF1B 3TZVB 4RGNB 5TFSH 1YNKL 5GSRA 2YD2A 5SWZB 1SBSH 2IG2L 3GIVA 1LK3L 2Q87A 1MCWM 1N6QH 5BZDB 1A3RH 1I9RH 2PYED 2HT2C 2VXSL 1H5BA 5TF1H 2Z35B 2QSCL 3HUJE 1BOGA 4MNGE 4KZEL 4MZ3A 2R2HB 3DX9A 1BZ7B 5MEQA 1IAIH 2ADGA 4Q9CA 3HE7B 1DN0B 2QADD 3KPRE 1JFQL 3CFJB 5CS7A 4KRPC 4OLYL 5LBSL 1S7QB 1SYVB 2UY7A 4U7SA 4YBLB 1IGFH 4H1LB 3CFCL 4PRHA 4U1JA 4HDIA 3HAEG 4AEEA 1CG9A 1TJGH 3HPLB 2AEWA 2X4OA 5DMGD 43C9A 1A6TA 4F2MB 2AEQH 1RZIB 4HEME 3VFRA 5F89B 5FYJE 3MLVH 5ELIA 4NO0D 5CILH 1YC8A 3QUYB 4YR6A 1I7UB 4OLVH 2I9TA 4X4YA 4I3SH 3R4DA 1ZVHA 3HZVA 3P0VL 1QO3A 2EKSB 1U8LA 5EORL 1BF8A 4FQHA 3PL6C 3T77B 4G80B 5DHYB 1F4XH 2OP4L 3BPLB 5EUOF 1D9KC 1P53A 3NPZB 5C9KA 4MD5A 1JZ3A 4XXCA 2HVKB 3ALXA 3AGVA 5D2NC 4PTUB 3TJHD 3UDWA 5KVDH 4U1MA 4ZNCD 4D8PA 4BA8A 1CGVA 3MRLB 3S4SA 1NFDE 3C5ZD 1RJZA 4ZFZB 2CLRA 1UACH 1BQUA 1CYGA 1IEAB 4PV9B 3KGRA 4E9LA 4WCYH 4ZUWA 5GGSY 2GIYA 2MSPA 1VFAA 2DLHA 3MLZH 4GG6B 1EH9A 3K2MC 3MACL 1R5WA 1SQ2N 5GIRB 4JG1L 4P2OD 3KR3H 1JWUA 5EPMB 1NFIA 4FP8L 5BQ7A 4I18B 5HHXH 5CGYD 5IF0B 1NDGA 5DI8A 4DAGH 4RZCB 2UYLB 3ARFD 5JNYA 3UTQB 3X13B 3BGMB 2JIXB 5DMJB 3FO2B 1UEMA 1CGSL 3UTPD 3D18A 5KS9F 1ZHKA 5HJ3A 4O51B 1YEEL 1A6ZA 1TIUA 4WO4C 4YXLH 4NOFA 1BQLH 4GMTH 1MJJB 4HUKB 3CMGA 2EC9T 4LGRB 1PDKA 3BQUB 4Z7VE 2I24N 1N7MH 3T4YA 4JHAL 4IRJC 2XXMB 5EC2A 4PBWD 4QY8A 1EJOH 4L1HA 4WFED 3O4OB 4Y5VB 1P2CA 4XBEH 3ZLQC 3CUPA 2DTML 2AEPH 5I8OL 3IU4H 3GI8H 4WY7L 3HCVA 2NXZC 3PWVB 4Z7WB 5GZNC 4LAJH 3LDBC 1NKOA 1H0DA 35C8H 1A3LL 2R56L 4MCZB 4DK3A 4NC0B 3WFHA 4HH8A 1U95A 3H9SE 5TDOB 3CLFL 4KJPD 5AAMA 5IVXB 1MVUB 3R06B 3FOMA 1H3GA 1JWMB 4PJDF 4NM8H 4MA7H 2YWZA 1YZZA 3OZ9H 2ZG2A 4K3DL 1JF1A 1JRHI 3ZKSD 3TZVA 2ADJA 4KJWC 1I3GH 4GAGH 4KRMB 3KJ4C 2XTJB 2CDFB 5SWZA 1OTSC 3OF6D 3QJHB 3QIWD 4K3GA 2B5IB 1HWGB 4JPKH 1HSAB 3BKYL 4I77H 4XHJD 4OD2B 5BV7L 3VFOA 2Z35A 3ZE0F 4HK3N 4EUPG 2GTWB 2D0GA 1OQXA 2R2HA 4OF0A 1ACZA 1BZ7A 1NCBL 2IJ0C 1MCIA 5B38G 3F12B 2Y5TB 5C3LD 5I1DA 4TRPH 2VIRB 2P5WB 1A8JH 3CFJA 3LEVL 4LIQE 2J6EA 4Y16B 2C1PB 3NPSC 2VUYA 1SYVA 1PEWA 4H1LA 3TO4B 3LN4A 4G6AD 3RJDA 3RVTC 4MJIB 2NXYD 2D7TH 1RZIA 1FNEB 1S9VA 3GMOB 1FSKC 1BOYA 3WE6B 4NBZB 3QUYA 2CK2A 1I7UA 3GSOB 4X83A 2UUDH 1K3IA 3OR6B 3D25A 1CU4H 4F57L 2OM5A 5F7WC 3QDJB 3T77A 4QHMB 2GUOB 4G80A 5DHYA 4M7JH 3MROA 1LO5B 4NM4L 5MI0B 1B4JH 5F7KC 5EUOE 2ADIB 1TVBB 1SY6A 1WK0A 5EUKB 5CD5C 2R0WL 3ECBA 3AFLA 2E6QA 2HVKA 3QG7H 4GG8A 1DQTA 4PTUA 4NCC1 2AJYL 5JW4R 5FV2A 2LVCA 3MRLA 1KJ2B 1GJIA 2NZ9D 3OJDB 3P9MB 2YPLE 1IEAA 4PV9A 5FGSA 4BK5A 4BM7A 1NGQH 2VXTH 1MSPA 3NA9H 5BCAA 4EI5B 5KSAC 1RV6X 5INCB 3OWEA 2ESVA 5I1JL 3EIFA 5GIRA 1J5OH 3TNMB 4P0DA 4OGYL 5FV1L 3DVGA 4NWTL 3ZTJH 4I18A 2FNBA 5IF0A 2YPVH 4LSSH 2X4SB 5B4MD 2FD6H 3MZGB 1F3RB 2ARJQ 1QA9B 4TPRL 2IGFH 4TTDC 4Z7NE 3C60C 5F96H 1ZT7A 3FO2A 4KK6D 4QRRE 4YXKH 4RMQA 3PXJA 4O51A 4NQEA 5KS9E 4DQOL 2DTSA 2XY1A 1UKTA 5JA8B 1AQKH 3E6FB 3MRHA 4S1DD 4AM0B 5C07E 4ERSH 3VA6A 1RZJH 3U36A 2AERT 3O2WL 3BQUA 1CICC 3RX8A 1MCOL 4UILL 3ULUD 2NR6C 4CBPA 3EAKA 4OIIL 1WJ3A 4MD4B 4LP4A 4HLZH 3JWOL 1FRGL 3MJ9H 3ZHKA 1GGYA 3OB0H 4J23A 4DTGL 2V5TA 5INDB 5DJ8B 3X12B 4Z7WA 3PWVA 4FTVA 5DR5H 2BVEA 3JWDC 4HZLA 3EYQD 1LEKB 2GJJA 2WBJC 1IKNC 4MCZA 1BEYL 3MRFB 4JRYB 4RFNC 2VDRL 3GDBA 5TDOA 2W07A 3HHRB 3L3DB 1J8HA 4GRWH 4WW2B 3VG0L 5IVXA 1MVUA 3HC4L 2HVJB 3IFNH 2AQ1A 1FL6B 1S7RA 1JWMA 1E4WH 4PJDE 4F80A 5EBGA 4UNUA 5HPOA 3QI9C 4P2QB 4PJFA 4DOHE 3QHTC 4X5LA 2OQJB 4OF7A 3QJHA 2BXZA 2F5AH 1S78C 3MOBH 1CGXA 1HSAA 1M7DA 4RNRB 3FT4B 3QIUC 2I9LB 4KUCD 1KSRA 5HI5D 2JELL 4LEOB 3R1GL 5I8EB 3TBYB 2UVEA 1ZT4A 2GTWA 5I2IB 5DSCA 4ZAKA 2H2PD 3ZE0E 4PGJA 3RA7L 5LXGL 3F12A 5DD5H 2VLKD 3DV4A 4OZHA 2GSGB 2P5WA 2APTA 1JHKH 2C1PA 5CLWA 4KRLB 1BIIB 5J11B 1RIHL 3T0WA 4QYOB 5BS0E 1EEZB 3ZMRA 5EN2B 4MJIA 5FHBH 4P4KC 3BGFC 1FNEA 5HI3D 5GRXG 5DTFA 1FFOB 1FVDB 3OKNA 3U2SB 4F9PC 3WE6A 4G7YH 2VH5L 2H3NB 3GSOA 1G6RH 2BHZA 5FGCB 5HDOA 9CGTA 3BEVB 3OR6A 3ZL4H 4YE4L 5ITBH 5DD3H 3BKCL 1V05A 4MNHA 5T1DL 3SHSA 3IDGB 3QDJA 1GOFA 2E3VA 4MCYB 3RKDC 1KTDB 1LO5A 3QQ3A 4MSWB 3WDJA 2DM7A 2VERN 4M7ZC 1DBKH 5EUKA 4LCUB 5MENE 4E0RB 1EGJL 1JGLH 1QPXA 1KJ2A 3GI9L 4U0RB 2YKLL 1KB9J 3OJDA 5C08B 3QPXL 3DI3B 4HJ0C 4XVSL 5LG1A 2IMNA 5INCA 5AWNL 1BAFL 5TE7H 1JIBA 2YOCA 3S6CA 2IANE 3KYOB 3I2CL 5JO5B 4GS7B 4R7NB 3WIFB 1CLZH 1D5IH 1PFCA 3LS4H 5A3ID 4PD4K 1T20A 1KCRL 4Y4HB 3SDAA 4K7PY 1JWSB 1LO4L 2X4SA 3ZYIA 5CJ8A 1QA9A 5I30H 1AE6L 4LLUA 3O2DA 3T2OA 5EZOL 5FCUL 1IGIL 4M1DH 5LKNA 4PRPD 5HYIA 5SWSD 4Y2DB 3DTXB 3MA9H 4KDTA 4E5XB 4AM0A 3E6FA 4FG6D 2DQIL 2IMMA 3WNPA 15C8H 4GW4B 3IS0X 3M17A 3RDTC 4R4FH 4EI6B 3NH7L 4X6CF 4MB4A 3L3OB 3BT2H 2YD7A 5DT1L 5J8OA 3VXSA 4MD4A 3IJSB 2PF6A 5FYKH 3VFSA 3WBDA 1KIUA 5INDA 2OR7A 5DJCB 5DJ8A 4LEXH 3N9GL 2I5YL 3P11H 1LEKA 1OW0C 4QEGA 5E2WL 4FMKA 4BQ6A 3MRFA 4YHIB 2BNRB 1MFEL 4YFEA 4JRYA 1XGRB 4RGMB 4JDTH 5F6HI 5C9JB 2OL3A 4L8DB 1UB6B 3B9DA 4WW2A 5JW4Q 2HVJA 3SGDI 1FL6A 1S5IL 3T1FB 4HKBA 1WBYA 1UWXH 3FT3B 2D0FA 3SOBH 4HPOH 1Q8MA 2W0LA 4S2SB 3T1WA 4LLMB 4P2QA 3ULUH 2O61A 5C0FA 3S36H 5KZCB 3VDBA 5C0JA 4ZXBC 5C0AE 4AENB 1IGYA 4M9OA 2G9HB 4RNRA 4TN9A 2I9LA 3GSQB 4NC1C 5I8EA 3REVB 1CGUA 2LU7A 2EZ0C 5LAXB 1B9ZA 1LHZA 1MRDL 2CIIB 3HFMH 3BW9B 4KPHH 1JMZA 5ERWB 3MLRL 3SDXF 5E03A 5BW7A 2AJUH 3KPSD 5C0DA 2BY0A 3RWEA 5J56B 1QKZL 1A7QL 5F3BB 1MAMH 2LV4A 2AJXL 2CKBA 1G9MH 4D0BB 4EQ3A 3INUL 3ARUA 2NY1B 4PUBL 1RUQL 1EEZA 3QUZD 3UJTH 3U0WH 4M5ZH 2BVOA 1FFOA 1FVDA 4Q9QL 3NGBC 3K7UA 1INDL 4UAOC 1OAQH 4JHBA 1FL5B 3LEYL 2DQFB 4P5KB 4PRIB 5F8QC 2H3NA 1RZGB 1CXHA 3BEVA 3BIKA 1B2WL 2B39A 1Z0MA 4CJ1A 3PE9A 4ELMA 4MSWA 5IMMB 3AS0A 3M8OL 3WUWG 1KCSL 3LB6D 5SX5K 4JZJA 1T2QL 2X4PB 4LCUA 2YS4A 4E0RA 4LKCB 3V6OC 1WWBX 4CVZB 4YXHL 1ZE3C 4P49A 2OJZH 2H1PH 3FQTB 5ADOH 1F02I 3BUTA 2P5ED 4MNQD 2NY3C 3HKFA 5A2JH 3RVXC 3KYOA 1RZFH 3SGKC 1TZHB 4R7NA 3WIFA 3WMSA 1G7PB 2E6JA 43CAB 4IDJL 1CDGA 2VWEC 3IDJB 1JWSA 3BX7C 2A6IA 1EBAA 1BX2A 4QXWA 4NNPH 4O2EA 5I1CH 1S7XB 3BO8A 4ALAH 4ZNEA 5IFJB 4PY7B 2PYEB 1UB5A 1A9BB 1NBYB 1LE9B 4W70A 4Z95L 1GC1C 1YEJL 4OM1H 1QFWM 4CU6A 4EVNB 4Y2DA 4RFOL 1I1YB 2R0LL 3IJYB 4AQOA 1TFHA 2QADB 2HJLA 4GH7B 1JPSL 4GW4A 1DSFH 3RVVD 4NN7C 3IJHA 5GGUB 3HPJB 3L3OA 4H0IA 1Y0LB 4X6CE 2IAMA 2AQ3A 2F74B 4X4MA 3MV9A 4RDQG 1M05B 4RRPA 2MWCA 3IJSA 5I8CA 1CF8L 2VDKH 1I3RB 1FP5A 4TUJB 4NO0B 5IHBA 4YFLF 5DJCA 3L3IB 1EHNA 3NTCH 3QO1A 4K94C 3U0TA 5BJTA 1IBGL 3IDXH 4YNYB 1GSMA 4FQIL 1BJ1J 4BQ9A 2BNRA 3KPNB 1N2RA 4FFWC 1XGRA 2VC2H 2P8PB 3EYOB 1UWEL 4YDVA 4Q9RL 2ZZUT 1QRND 4JKMA 3ALWA 4LHUG 3T1FA 3VD3A 3KLHD 2DQDL 3BHBB 2PTUA 2D31B 3FT3A 5IROC 2ARWA 3TN0D 1KC5H 1CLYL 3EOBB 4S2SA 4U6HA 5EH1A 2ICWJ 2LAGB 3C5ZB 4LLMA 3H7LA 5ESQA 1A7OL 4R8WH 4LHJB 3MUGB 1YY8B 4Z7UA 2JJUA 3REVA 3WN5B 4JDVB 2IPTL 2R0KH 4P2OB 3WSQH 3TA3A 2WM0A 4LPUA 5AYUH 4UINH 3GBNL 1Q72L 5ERWA 2P47B 4FXGA 3ARFB 3SDXE 4NOBA 1ZHLB 1CGWA 2FX7L 1DJSA 3SE8H 1I3UA 1FN4B 5C09E 2WUBL 2JKXA 1FBIL 4RBPK 5ID0B 1GZQB 1YEFH 1AY1L 2VZOA 4GRWB 5F9DC 5JXEA 1AXSB 1DQMH 3EJYD 4AMKH 3MX0A 3WO3B 1FL5A 2DQFA 4P5KA 3NAAL 3PXHA 4PRIA 1RZGA 5DQDL 1RIUH 3C5JB 4BZ1H 3BOVA 1NGPL 4PJXB 2HTLD 4YPJA 4P2RE 2DLTA 1KXVC 4NZRH 1U8QA 1JF5A 1MCKA 4RAUB 5T5FL 1MY5A 2X4PA 4JQIH 3EO9L 4D0DB 3QCTH 4R90H 5F9OH 4OD1H 2CJUL 2FX9L 2B4CH 4AL8L 4PP1D 3EYUL 3FT2A 4JM4H 5HD8C 3NABH 3MODH 1UA6L 4OLZL 2M2DA 3PP4L 3RWDB 3FQTA 3SEPA 2FIRT 2PO6B 4G9DA 4KKNA 5ETUB 1TZHA 3MCLL 3U83A 5I1HH 1G7PA 4GKOA 4XPBL 2XPGB 5TE4H 3PP3H 5KANG 4JAMB 4QRSB 43CAA 4DGVL 3IDJA 1HINH 5DK2B 3QIWB 4XVTL 1WQVT 4NBXB 1PX4A 1TJHH 3BFOA 4G7VL 5MP6H 2CGRH 4C55A 1G6RB 1S7XA 2PYEA 4HXBL 1LE9A 3V9FA 3FB7A 3MREA 5DO2C 4D3CL 4EVNA 4G8GE 5DHXB 1MQKL 3V8CA 1L7IH 1I1YA 1MCNA 2FYYB 1YEIH 3IJYA 4LVEA 4S1QL 5GISH 1I8MB 3VE0B 3VFGH 3ZKXC 5FDWB 3N1PC 3MLWH 2H2SD 4K71B 4ZO7A 1J0IA 2E7MA 5DJDB 5GGUA 4ONFH 1IL1B 1A7RL 1AGEA 1J0ZA 4YQXL 1M05A 2NXYB 4M7LH 1YMHB 1G9EA 1I3RA 4TUJA 1PY4A 1T5WB 4JO3H 1MHEB 4Z0XB 3P30H 1I7TB 2IFGA 2IPKB 1I9IL 4QT5B 2RCSL 4XPHL 1FVCB 1EK3A 4YNYA 5D4QA 1FVEB 5KANI 1CIUA 3KPNA 3RGVC 2EH8L 2M8XA 2P8PA 2X7LB 1AH1A 2WMPA 4WUUA 3H3PH 4MAUL 3BHBA 1MFAH 4OKVB 2W38A 5IBUB 3C5ZA 2N7BA 5EIIB 4F9LC 2ED7A 1U8NB 5C2BL 4Y4FC 1EFQA 3UC0H 1JUFB 2ZJSL 4M1CD 3MUGA 4M93B 1F6FB 3I3BA 2YD3A 3CFDB 3MXVH 2CIKA 4LF3B 2VLRE 2KH2B 3WN5A 1DQLH 4X7TB 1KYOK 3SCMD 1QR1B 5E99L 4X0KB 4DW2L 3N1QC 3VH8G 4KHTL 4LRIA 1WCBA 3MJ9A 3VGAB 3ZTNH 1SJHB 4WFHE 4JN1L 4F7CB 1CR9H 3ARFA 4N0FA 1MCPH 3DOSA 1NANH 5EU4B 1ZHLA 4XPFH 3KYMA 5HGBB 1FN4A 3QB7C 5FO8B 1V3LA 2OYPA 4B53A 2AV7B 1WIPA 5E4IA 4QHUB 3UTSB 3WXWL 1JHLH 1GZQA 1UJ3C 3RVUC 1AXSA 3EO1A 1MWAH 3D3VD 2P8MA 4RQQA 3PGDA 4F8TA 1VGEL 2JJSC 4C4KT 3C5JA 3MZTA 4CVXA 4PJXA 1J10A 2Z4QB 4K07A 3WFZA 2AI0L 1FFNB 1K6QL 1QUNA 2EDRA 3Q6GH 3STBA 4CUCA 5I1GH 3S5LB 1OF2A 5DDHB 1IARB 4D0DA 1SEQH 1T80A 3VGDA 3RAJH 4PG2A 4U05A 4LCIL 3L3HB 4X9GA 3E8UL 1G7LA 4H88L 3GBMH 5J12B 2B0SH 5E5RB 4M1GL 3P4LA 4X80L 3RWDA 3WFDH 5C0EB 4LDOB 2PO6A 3RU8L 5ETUA 3O6FD 1MCCA 2X6MA 2XPGA 2VAAA 1YNLL 1DQQB 2K1MA 4QRSA 4KY1H 5DK2A 3U7AA 1WEJL 1VDGA 4OCWH 5CJQL 1G6RA 3U7YL 1GGTA 4LNRA 4NZTH 2Y1VA 4PJHB 5GJSH 1ZLWH 4I0PC 3FZUD 4XP4L 1I9JH 5A43C 5F7MC 1AD0A 1J1OH 1EHAA 4M5YL 2FYYA 3B9EA 3OGCB 5CEZL 2RR3A 2W60B 4PRBA 5DLML 3VE0A 1A4KB 1B90A 4FXLA 4B5EA 3GGWA 5CWSB 1E6JL 3QWOA 1FYTD 4NQCE 4NUJA 4XBPB 1T89A 3QG6A 3EFDL 5DJDA 2EEDA 2ADFH 4NKOB 1AC0A 5EU3B 3EFFB 3LQZB 2W9DL 4JN2B 2W65B 4YHYC 1T5WA 3PWPD 4Z0XA 1WV7T 1I7TA 4QRUB 2IPKA 1SY6L 1EX0A 3OTTA 3Q3GB 1IM3B 3BPNC 3LD8B 1BJMA 3VDAA 3WHE1 1XGUB 1FVEA 3MLXH 5CEYA 4ZO9A 2OI9B 1X7QB 3C2SA 4DK6A 4OI7A 3F58H 1NCNA 3BWUC 3FO9B 2DJSA 2WP3T 4DKFL 1CDJA 1CD8A 4YHLL 4G8FA 3CFBB 4OKVA 3ULVD 3W9DB 2DQGH 4JKPH 4A6YH 5EIIA 3QDGE 4OCMC 1CLCA 2FB4H 5J13B 4IHOB 4LQFL 1JUFA 3DIFB 2BRQA 4OZFG 3U1SL 4LF3A 1MLCA 4M7KH 4X0KA 4P23B 5E6ID 1AFVL 3SKJL 3DX8B 4JFEA 3OKDB 3GHBL 4MXQC 4BZ2H 1RULL 4GKNB 1GGBH 3MRIA 4AY0A 4XAWH 2WUCL 5D7KE 5GGRB 1HKLL 5EU4A 1N6UA 3EBAA 4QNPF 3I6KB 3DXAA 3S97C 1KPUB 5FO8A 4PRPB 5SWSB 2AV7A 3BP4B 3UTSA 3B9AA 5IW1B 3OHXB 3DV6B 2A0LC 1EMTL 4PJ9D 4UBDC 5DQJA 3VWKD 1CS6A 4UTAL 5IKCB 3QIBD 1IGTB 1OCWL 4U31A 1NUFA 3GB7B 3QDMD 5HYJE 3EJZD 3MBXH 2ZG3A 1MCQA 1U93B 4TSAH 3OKEB 1F45A 1F3DH 4IRSC 3S5LA 3AY4A 5DDHA 5IJVB 3V0AC 4FQXA 2OR8A 1G9NH 2CUIA 5DJ2A 4OFYD 3RIFF 2Z31C 2GTZA 5IHUH 2JCCF 3NOIA 3MV8A 5TQ0H 3ZDZF 1U3HB 3T0EA 1Q9OB 3L5HA 4LPYA 1DL7L 1EHLH 1BQHA 5C0EA 5IMOA 5IIEB 3MRKB 3T0DA 3MJ7B 1DQQA 3QRFM 3VFUB 1A6WL 3MNZB 3P4OB 1H5BC 1DUZB 1P4BL 2DRUA 2XA8H 4MWFA 1AGBB 4M9PA 3MXWH 5DUPL 3WO4C 2IH1B 4N5UA 2E7HA 5ITFB 4MS8D 4WEBH 5D1XD 3E2HC 1JHTB 4ZUTB 1Q0YL 1ZEAL 4B0MM 3OGCA 4OCRL 2W60A 1F4WH 5D6CA 4FZ8H 4P9ML 4ZFFB 2D7NA 3OKKB 1MI5D 3MRBA 1CN4A 2F54E 3OPZL 3I84A 1DFBH 1AI1H 5C6TH 1YJDC 4JB9H 1GRWA 1U6AL 4M6NH 5EU3A 3QUZB 3EFFA 5JHDA 4YIQA 2XIDA 3V7AE 3LQZA 1SVCP 2W65A 4GRMB 4QRUA 3Q3GA 1IM3A 3O0RL 4FQLL 3P4NA 3FB8A 4KJQD 4MD0B 5ALCL 1QBMH 3WIIH 1R3KB 4HAFA 1FH5H 5FUCC 4XXCC 4M00A 4TQEH 3KPRD 3UDWC 4OGXL 1X7QA 3D39A 2QTEA 5AG9A 3FO9A 4ZOCA 5CEXA 5IQ9B 1SJVA 1QG3A 3CFBA 1EFXD 2WANA 3W9DA 1V7MH 3G5XA 3K4DA 4Q74A 4WFFE 3RFZC 1SJEB 4XVUD 3UBXB 3QEQB 5FYJD 4G3YH 4J4PA 3BH9B 4WHYH 1D3CA 1GIGH 3DIFA 4JRXE 3VD4A 1V3MA 4LSVL 1OAYL 2P5EB 3ARYA 5L2KE 2O5YL 1NGWA 4MNQB 5LQBL 4F15B 4P23A 3FFCE 2P8LB 4JR9H 4XMPL 4WWKA 2PETA 2Z9TA 4OKDA 1ACYL 3DX8A 3OKDA 1F90H 5FUZH 2ID5A 3CNKA 5IMKB 4EN3A 4GKNA 4WHDA 5TQ2L 1HNGA 4J3UA 1T22B 5GGRA 4JFQA 3VMPA 4RWHA 4PB0H 3X3FH 3I6KA 4DEPC 1KPUA 4PRPA 4NCDA 5I74C 3C8KB 4LFHG 3BP4A 4MDIB 4QNPE 3ULVH 1FFRA 1DBBL 2XZQH 2R39A 4JO4L 5IW1A 3F8UB 3OHXA 2DMKA 3ARQA 3DV6A 3TCLB 4RFEA 3TH2T 4KKAD 4M43H 1IGTA 2K7QA 4FFYH 3VA2C 1NLBL 3LHPH 4U3XA 4POYA 3QEHB 2BMKA 3MLSH 1CFVL 1U93A 2OL3L 4GAYB 1JYWA 2ZCLH 3A6BH 1E6OH 3E1F1 3QISA 4YWGL 5IJVA 3WDHA 5HDBE 1DLFH 1XR9B 5EBMA 4PJ7B 2A77L 4HWEL 3P9LB 1ED3B 4FFVC 2ICCA 4X6DA 1QRNB 4RGNC 1U3HA 3TZVC 5F7NC 4I3RH 2JCCE 1B3JA 3ZDZE 1XR8A 2HJFA 3TN0B 4B50A 3T2NH 3MRKA 4L4VE 3QXVA 2X42A 2ZWLT 4HCRH 5EA0L 2VZUA 1AGBA 2P43B 3ARRA 2VL4A 2IH1A 1VKXB 3CLEH 5ITFA 1B0GB 3ARED 5D7JA 2J8HA 2WWMC 3C6SA 5IP4A 1JHTA 4ZUTA 2CKBL 4JCLA 4LAQL 1YMMA 3H9SD 1PJ9A 4YBLC 4YO0B 1FL3B 1T7VA 3VRLF 3ZHDA 4ZFFA 2X89D 4OZGF 1VESA 3RUGB 1LP9B 3MOAH 2IQ9H 4IRZL 2FGWH 4NC1E 3QUYC 3QUZA 2R23A 1NLDL 4R3SA 1W0YT 1N6QL 4NCC2 1WFOA 3BAEH 4U33A 5DHVH 3DMMD 3BPLC 3K8KA 1HNFA 3QXDB 3BXNB 2Q76A 4YHKL 1IAIL 5EU7E 4ZPTB 3ZDXF 1QP1A 3O11A 3FOLB 4RGOL 1FGNL 3SDDA 1HHGB 2N1KA 5IQ9A 2YUVA 3GSNA 5D1QD 5IR1A 4OLUH 3L5XL 3EOTL 5ESAB 3O3DB 1TJGL 3ARDA 1ZA6B 2AEQL 1PAMA 1SJEA 3UBXA 3QEQA 2EIZA 1IGCH 4RX4A </