2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
4A2EA 1JXDA 2VM3A 4HCIA 2GHZA 5AFAA 2FTAA 3KW7A 3H4HA 3EHBB 1J9QA 1MDAA 2XUWA 2BP8A 4YSEA 2XV3A 2ZONA 3FPXA 1KBWA 1R1CA 1GS7A 2GIMA 3DTUB 1OE2A 3EH5B 3U25A 1GS6X 3NJGA 3JTBA 4KO6A 4KNSA 4BWUA 3CDZA 2PPCA 3ZDWA 1AG0A 5I6MA 3MX0B 4G70B 2R7EB 1A4AA 1XB8A 3OMIB 3NJHA 1PLBA 5B7EA 4DP1X 2FNWA 1ZPUA 4UANA 2CUAA 3D12B 3CVCA 1AS8A 1WA0X 3NJMA 3TU6A 2PP8A 3L45A 3CVDA 3X1GA 1ILSA 2N0MA 2TSBA 4Q8BA 2HZHA 3AG4B 4KO5A 2TSAA 4TXVB 2FWLB 2YAMA 2YAFA 4DP2X 5TK2A 1CC3A 1PMYA 2YXWA 4BWWA 1X9UA 1AS6A 3ZBMA 1AR1B 3PAUA 1J9TA 1IUZA 4HZ1A 1WS7A 4ZK8A 3FSVA 5D4JA 3FQYA 5I28A 2QPEB 3NJNA 4YSTA 3AY2A 3ASNB 2XVBA 4GYBA 2BWIA 3KW8A 3T6ZA 4W1TA 4YSQA 2UXVA 3EF4A 2EIKB 2I7OA 1FA4A 1JZGA 2PLTA 5F7AA 3WNIA 1RZQA 3AG2B 2PPDA 5B7FA 1L9SA 2PPAA 4GP8B 1NWPA 2BHFA 1ASOA 3QPKA 4KNUA 1ADWA 1EZLA 5I5IA 3FYIB 2EINB 3FSWA 5I6LA 1CYXA 3ABKB 1SHWA 3PAZA 2BW5A 1KV7A 1PZBA 2VSKB 4N4YB 4YVUA 2W88A 6PCYA 1T5KA 2HRGA 3PXLA 4HHGA 3BVDB 3FU7A 3FT0A 2CBPA 1AIZA 1AZNA 3SQRA 2VN3A 3S8GB 3GYRA 3NJFA 4BXVA 4E9TA 2VMJA 5TK4A 3FQ2A 3QQXA 2WO3B 1AZUA 1L9TA 1AQ8A 1J9RA 5PAZA 3FS9A 2BZCA 3N55A 1TU2A 4HALA 4DPAX 1BEXA 3T9WA 3QJQB 1JOIA 2X88A 3BQVA 4HAKA 1PNCA 1DZ0A 4F2EA 1W8EA 4N8UA 5ANHA 1M9WA 5I5MA 2IH8A 2UX6A 1TKWA 1NPNA 3CG8A 4YSCA 2BO0A 2J56A 2YAQA 2OV0A 1TEGA 4E9RA 3SBRA 6PAZA 5B1JC 1NWOA 4KO7A 3TA4D 3ZIYA 4HCGA 5B7MA 1AACA 4G7RB 1E67A 2DY2A 3AG3B 1RZPA 3SBPA 2B3IA 1PLCA 4FAAB 1ZDQA 1JXGA 1JVLA 1OCCB 5D4HA 1ASPA 1TEFA 3T6WA 3DKHA 2YAOA 1AAJA 2FQDA 1QHQA 1WA1X 3AG1B 1ET7A 3NSFA 2H3XC 2OJ1A 1OCRB 1N68A 4PCYA 5I6OA 3FSAA 3FSZA 4YSUA 1BQRA 4A2HA 1JXFA 3WNJA 4DP7X 2EILB 1MZYA 1PAZA 4GP4B 3TASA 2DYSB 3T6VA 1WS8A 1IKOP 2PPEA 4NERA 4E9YA 4PAZA 4K9JA 4P5RA 2HX7A 5I6KA 1HAWA 2CAKA 1NIBA 3PAVA 4Q89A 4YSDA 4AX3A 3PLYA 3DIVA 1X9RA 5B3SB 1CYWA 1IC0A 3HEIB 2P80D 4KOCA 1GR7A 2XLLA 3IE9A 4ENZA 2HXAA 1PNDA 3V9CA 1ET8A 2AZAA 1RCYA 1J5DA 2HX8A 1AS7A 1GY1A 2LLNA 3QJVB 4HHWA 3IN2A 5I6NA 2DWTA 1BXUA 3JT2A 3S8FB 3G5WA 3CVBA 1ILUA 1PY0A 4F2FA 2BP0A 4X4KA 2IH9A 2QT6A 1NIAA 3UAAA 3IEAA 1L9RA 3SBQA 1MG2C 2XV2A 3TBBA 2RACA 2AVFA 1QLEB 4YSPA 1HFUA 4YSRA 1OV8A 4M3HA 2XX0A 1OCOB 5AZUA 4E9VA 3X1EA 1NIDA 1SNRA 2ZWNA 2IWFA 3UACA 1AOZA 1W6WA 4DP0X 5EHFA 8PAZA 2UX7A 1UATA 3S3BB 2I7SA 4G72B 4A2GA 3H56A 2H47C 2VW7A 1MZZA 3NJLA 4G7QB 2BZ7A 2Q9OA 3T71A 4M4RB 1V10A 4DP8X 2IDFA 2J5WA 3WKQA 2FT6A 4KO9A 1A8ZA 4NAJA 4JHUA 4G7SB 5A7EA 3QJTB 3FQ1A 4BDVB 1EHKB 1AZRA 5AKRA 2IDUA 2GSMB 1JZFA 1KDIA 1YLBB 1IBYA 5B1BB 1ZDSA 1OE3A 3NSDA 1JZHA 5B1AB 3UADA 4E9XA 1A65A 1RKRA 4YSSA 1A4BA 3NP3A 4CSZA 3V9EA 2XV0A 3EH4B 3ABGA 1PZCA 1NICA 5E9NA 1SDDB 2YAEA 1E5YA 2EIMB 2FT8A 2FT7A 4YL4A 1CURA 2IAAC 2HLEB 3GDCA 1SFDA 1ASQA 1HAUA 2WO2B 2Y69B 4KNTA 1KYAA 2IDSA 1GS8A 4AKPA 4E9SA 3TBCA 1ZIAA 2ZXWB 1NZRA 2PPFA 1OOWA 2NRDA 1L9OA 1ZIBA 2J55A 3PCYA 1OF0A 5I6PA 1L9QA 5FC9A 3OD3A 1XMEB 2PCYA 4UF7C 4DP5X 3OMNB 3X1BA 2HX9A 4G71B 1SFHA 2XXFA 1JZEA 3OQRA 1FWXA 2VW4A 3S3CB 3H4FA 2VM4A 1GY2A 3OMAB 1NIFA 1ET5A 4WKXA 1B3IA 1A4CA 5PCYA 3CZUB 1MG3C 3UGEA 2BP8B 2YAPA 2B08A 2YQBA 2AZUA 4BWTA 3ASOB 2H5UA 3HB3B 4P5SA 1AANA 1ETJA 1WA2X 3CDZB 2GB2A 5D4IA 2XX1A 2PCFA 3PPSA 2GI0A 3AW5A 3X1NA 1NIEA 4DP9X 2P80A 2PP7A 2UXTA 1BQKA 3QJRB 5I5JA 7PCYA 2BWDA 1W6LA 1IBZA 5B1KA 3GXUB 3C75A 4JHVA 4AKOA 1NTDA 2Q5BA 1ID2A 2AANA 3IBOA 4YVNA 2CCWA 2R7EA 3X2QB 4DPCX 3EH3B 2BW4A 2GC4C 4A68A 3S3DB 2BP0B 3FPYA 1V55B 4GY4A 4UAHA 4DPBX 2UXFA 1BYOA 2YAHA 2FJSA 1OE1A 4BXSV 1E30A 1BXVA 4DP6X 3NYKA 3NT0A 4QLWA 1A3ZA 5I26A 1CUOA 3WIAA 7PAZA 5B1JA 2IWKA 1JZIA 4A2FA 1JERA 1F56A 1NPJA 3ABLB 2FQEA 1GSKA 1KCBA 5F7BA 1URIA 1JVOA 1JZJA 2QPDB 4CSPA 2GBAA 1VLXA 1NINA 2XYBA 1J9SA 4A2DA 1OCZB 4AKQA 3QJSB 4GXFA 3NSCA 2IDQA 1GYCA 1KBVA 2DV6A 2QDVA 4MFHA 2FQFA 2EIJB 1AZBA 1WAEA 3AZUA 1V54B 4NB7A 2XWZA 2W8CA 2WSDA 1FFTB 4EF3A 2DWSA 2E86A 3UAEA 3WKPA 3FU7B 5LDUA 2PP9A 3NP4A 1SJMA 1GW0A 2JKWA 1BXAA 2YARA 2Y1AA 1QNIA 1J5CA 3ABMB 2AFNA 2IDTA 3WG7B 4YSOA 3RYMA 4BK5C 5IY5B 2XU9A 1E65A 1SF5A 1SHXA 4A66A 4BDVA 1I53A 1SF3A 3WI9A 2X87A 4JKNA 1N70A 1M57B 4GP5B 4HCFA 3N2JA 2I85A 2CALA 4A67A 1KCWA 1AG6A 2ZOOA 3UABA 3FU9A 2IWEA 2JXMA 4E9WA 1XB3A 1BYPA 1E5ZA 2DYRB 2FQGA 1SDDA 3NJKA 1M56B 4HIPA 1AZCA 2J57A 3IN0A 1KGYE 1BAWA 2MRYA 2MTAA 1BQ5A 1PLAA 2XXGA 3NSYA 4W9ZA 1ZV2A 4DP4X 3FU8A 1L9PA 3NJJA 1PCSA 1PF3A 3FYEB 2A3TA 4AI7A 2JFCA 2GC7C 2UXGA 1KDJA 3QJUB 4L0PB 9PCYA 1XB6A 4WTQA 4FA7B 2VW6A 3OM3B 2VSMB 4KOBA 3X1FA 2CJ3A 2OCCB 2QDWA 2YXVA 3MBWB 4QKTA 3ZX1A 4AZUA 3NJIA 2HRHA 4E9QA 4F7KA 1NDTA 1PZAA 3ERXA 4RH4A 1DYZA 4YSAA 3T6XA
chains in the Genus database with same CATH superfamily
1IAII 2QQNL 3DUHA 4F3FA 1UWEH 3KXFB 5DQJA 1YQVL 4XMXA 4G1MB 3QRGH 4L3CA 4W9EC 2O5NA 1E5BA 4PBDA 3TYGH 2OXGA 5DMGC 2QMJA 1AG0A 3QDHA 3ZO9A 2DJUA 3GS4A 5EU3B 3VD2A 2VYRE 4HJGB 5GISL 3TA3C 2A0LD 3MJ8B 5F7HA 1C16B 4TULH 5HGAA 5D6CA 2FNWA 5DRWB 2JH2A 1UCBH 2BVPA 4Q74A 1S9VB 4XMPL 3WNLA 5IB5B 4BBWA 1V5JA 1ILSA 2TSBA 4Q8BA 5FYKD 4QRQA 3DVFA 4AGPA 2TSAA 4NHUA 4GW5B 5KYUA 5IMMB 2YN5A 4UNTA 3QXAB 2ZXCA 4L8BA 2E9JA 3II3A 1UT1A 5D5MF 5HVHB 1TITA 4H8WL 3TO4D 4IHOB 4FCHA 2OULB 4B0MM 3VCLA 2O26U 4N1EA 3KPPA 4IRSD 1Y0LB 4KQ3L 1ZS8A 2PW1B 3TNNA 4C55A 5FYJD 3TBSB 5DEFA 3QWRD 2WSKA 3KWXA 1OAJA 3T65A 4BHUA 2GAZB 2A74A 4KROC 3T6ZA 4GSDL 5BS0D 1DBBH 4HJUA 4KTYA 3STZB 4OV6F 1KY7A 2CA3A 2DEWX 2DIEA 5TFSL 3RTQD 3RGVC 4K7PY 5B7FA 1L9SA 2D7MA 2RGSA 4HIJB 4KHXL 2VDLL 4UOQA 4K3DH 2LU5A 3QPKA 2DKMA 5IZ7A 4L3ED 3IDYB 3ABKB 4M7KH 1ZEAH 2QR0A 4KXCA 2WTRA 3KEDA 1AO7E 3EBGA 5I71C 1CVSC 3O3EA 3X14A 3FTGA 1RLWA 1LD9B 2W9EH 1X6LA 4IK6A 1PCXA 4R90H 2IQAB 4GLRH 4ZTPH 1HI6B 1UKSA 4FF9A 4UDTB 4ZUUA 1MRCL 3BEVB 3REVA 1X5IA 1EMTH 1HSBB 1NFDB 4FFYA 4PY7A 2GJ6A 5IOPB 3RFZC 3SDAD 3WKYA 2OKMA 3BXNB 2XQ0A 5ALBL 5EU4A 2YD6A 2J73A 5EO0A 4POUB 4P46C 3FTZA 5AD0B 2VNCA 1FZKB 4OLYL 3ILPB 3VRLE 4P4KD 2JTDA 5CR8A 3UJTL 2JQMA 4HJJL 1YEKL 2R69H 1RUAH 1BEXA 3G6DL 4ODTH 1GZPA 2AEQH 3QJQB 3GBNH 5C0GB 5AVTB 1UJ3B 4F2EA 1L7TH 3RVWD 4Z7NB 1TZGL 3GSNB 3V0FA 3QNZA 3OHXC 1O5PA 4FJ6A 1RH8A 3CG8A 2EDDA 5DQ9A 3T04D 4NQSB 3MBEC 4FFVD 1JE6A 1SY6H 1XXFC 2V9TA 4TN9A 4WWOA 5EEUA 2A73A 4LU5L 1TZHB 2JJSC 1KZYA 4ZXBC 1FNAA 5GRYA 1TPXB 3IMWA 1P2CA 1VPOH 4P5MA 1CCZA 4A2LA 5KVFL 3ARFC 3AS2A 4HZAA 3VFVA 1QVOA 5D4HA 4HVBA 5J89A 1WFJA 4KX7A 3FQRA 1QO3B 3MHZA 2XT1B 3PS6A 5FYLH 5AW0B 3SE9H 4NZFA 3K6OA 1WC7B 4Y5YB 5ACZB 2XZAL 2VQUA 4HSAC 4AG4H 5FB8B 3D2UD 3JV4B 3RU8H 3BUPA 2SODB 2OJ1A 4XVTL 4TUJA 3WIFA 1SPDA 3H6AA 5F7WC 3CSYB 2AJVH 5B8CA 3LPWA 4PS8A 4KDTC 2CD0A 4CU7A 3BZ4A 3MJGX 1AGFB 2ODHA 3N9GH 1QSZA 3IETA 3HC3H 3MBWA 3HMWH 1MQ8A 1UOKA 1T21B 2EC9T 2N56A 1KTDA 3J7HA 3RY4A 4P2AA 4R5XA 5BRPA 3DIFA 2QEJA 1JZ3A 1IT9L 3PV7A 4QD2E 3QUXB 4OFVA 4OM0L 3OJDB 2WXHA 4NO3A 1HZKA 5DDHB 3HG1D 5G2NA 3P2TA 1OTTC 2HKAA 3AT9A 1MCFA 1RCYA 1XGUB 5HHMD 1J5DA 2XVGA 4MB3A 3S36X 3I6GB 3IN2A 4NUGL 4ZZFA 1USQA 2WOBA 3S8FB 4MAYA 1Q9OB 1RLBA 4IKLA 1B0RB 3K4DA 4PJEA 5EMYA 1JRHH 1FNGA 3KMDA 3EO9L 1KB5B 4ANKA 1IC7H 3LN5B 4K15A 2R0WL 2NYKA 3LHAA 1QLEB 2DQTL 4Z7VB 1P9MA 3L1EA 3H8NA 1CGSH 1NCAL 3L1OH 3Q48A 4YQXL 5DJYA 3U9PL 2NXZB 4JO1H 1WAAF 4E9VA 4Y8DC 5BUAA 1F58H 2ED8A 2GBVA 1D3CA 3SQOH 2R27A 4EIBA 1FJ1B 4XP4L 1HHHA 3D18A 1T03L 1ZT7B 4HD5A 4EEEA 3LNDA 1OAQL 3T71A 1NDGA 4M4RB 4FL4B 1FNLA 1V10A 4GKSB 4CADB 3RUGE 2JJUA 4NAJA 1TMCB 4PLJD 1R5VB 4JQVA 2MPVA 3JWNG 4XNYL 2FE0A 3A23A 5I16A 1JZFA 1KDIA 1LEKB 3HCVA 1H15B 1JPTH 1G84A 3HE6D 5E5MB 4YS4A 1NCHA 1JPGA 1XR8A 4CMMA 4LL9A 4OBSA 4L37A 3FTYA 4E9XA 1IE4A 3VB9A 4HGMA 4DFHA 5J1SC 1U3HC 4X9IA 2X40A 3GSQB 5HHOA 1WTLA 1F4XL 4X80L 2XV0A 1PZUB 2N4IA 4MYWB 1OWWA 5J11C 5EBLB 4F9LC 4Z18A 2EE0A 4F8TA 3G3LA 3AU1B 1ROWA 1RERA 4N0YH 4W93A 1SBSL 2R59A 1DZBA 1LEGB 1G6VK 5A6LA 1KXTB 4YDZA 3SGEH 2QKIB 3MJ7A 2EVIA 3GSWA 2ITDA 4LCWD 1OAKL 2LHAA 4PV1C 4JFFA 2DQJL 3GMQB 4QXVA 3PWNB 1A1OA 2VR7A 2J43A 1CLOL 4YHIB 2OJEB 4PHZA 2KL6A 3P3RA 2QPSA 3N1MC 3QS2A 3UXFA 3B1TA 4L5FH 4YC2C 3CMGA 3Q1SL 3MMEA 1P4LA 2ZCKH 2P47B 3KR3L 4JRXB 4PJDE 2X9YA 2BC4A 4DKTA 4JFSA 4KK5D 1F3JB 1FDLH 3L4CA 2HX9A 2W5PA 4G71B 1X5XA 3LIZL 1FWXA 3DX6B 1OGAB 4NKMB 1PZ5A 5E94B 3H3KA 5HHNB 1L6ZA 2Q8BL 4DGYL 4R96A 3ZL4H 5E51A 4NO5A 4PD4J 4LNRB 4KZDH 4ZRGA 2YAPA 1A1NA 5H2BA 43C9A 4XGZB 4HIHA 2FIKA 1ZT4A 5C7XL 1GYWA 2OBGA 2XN1A 4KVCL 1REIA 3VMPA 2DKSA 4NHCH 3VQ2C 2IPTH 4CDGC 1J8KA 1CB4A 1N6UA 1UKQA 5FF6A 3OLDA 1N59B 4PV9B 1L0YA 4KMQA 1SOKA 1AMYA 5HDOA 4JQVC 3VXUE 4E5XA 4RRPA 1JZ2A 4K7PL 3M17A 3B2UC 2FYYB 4UT9L 5E4IA 2R4RL 1MJUH 4WNQB 5D55A 5IMKB 2FWOA 2VXVL 5E1QA 1WD8A 1SYVA 3E7JA 1T7ZA 4PJXE 4DGUA 4CA4A 3V79C 2J3SA 3MODH 5FECB 3PWVB 4PR5A 4R0LB 2MCG1 2YO3A 2B2XH 4PJIF 3PJNA 1UA3A 1KT2A 3FB7B 3KYKL 1E2WA 1OK0A 1E0OB 2GYSA 3NCFB 2NLJB 2BH0A 2Y5TB 1N6VA 4HETA 3CC5A 4QOKD 4RZKA 1E4WL 5E7FA 5JIHA 2PW2A 5FKPB 1BPVA 4YDLC 3Q0HA 4DP6X 3P73A 3DVIA 1AXSB 3HUJB 4KHTH 4XPFL 4D0CA 5M95B 2NNRA 4A2FA 4OW6A 4HJ0D 4FZ8H 3WXVL 5DVLA 2V2XB 1ZS2A 2V17L 1JDCA 2VXQH 1VSCA 1HE7A 1L4IA 4PJCA 1F86A 1XF2B 5BQ7B 1I8UA 1XGTB 1CL7H 2OTPA 4OZIB 4G6FD 4P5KA 3NN8B 5E6IA 1NC4B 3VMOA 4EXPX 1NGPL 4NN5B 1GPOH 1PDKA 2KLTA 2X44D 4UCFA 3IS1X 3FQUA 2QDVA 5CHNA 5ABAA 5TE4H 5K39A 2VGLM 4IMKC 1M71A 4M48H 4D0BA 1HCZA 3TP4A 2OQJB 5E99L 2AJXL 2ZUVA 1CLZL 2VDNB 3T77A 4WGVB 2VQ1A 3FUIA 3QDJA 3CWGA 1Q1JL 3JWDL 1NLDL 1T20B 1QSEA 5ANMB 2X4OB 4NQEA 2XWTB 4JFVA 1UWGL 4FQXD 2AJSL 3MCKA 4A39A 3PNWB 3RVTC 2HKFL 4NQCD 2KI6A 3WLWC 2G9KA 5HSFA 1E4HA 1U92B 3QULA 1QBAA 1YC8A 4ZO9A 3VXQA 3EOTL 1RHHA 1NSNL 2Y7NA 5IWLA 3BP4A 4BQBA 4F7TA 1MHCA 2AP2A 4Y7OC 5L2JB 3BH9B 4XN7A 3N2JA 1D9KB 3PP3H 2EVJA 3U4BH 1LMKA 5HYJD 4FZEL 4Y4HC 4ENEC 3RWEA 4IRJA 5K9KB 4GXVH 1RY7B 4RWYH 2MTPA 3CFUA 5L4FA 1ZGLA 1BYPA 1Q0EA 1SDDA 2WMPA 3MN8A 4QRPE 3CLEL 3LV3A 3LOWA 4BA8A 4XP5L 1XGRA 3GJEB 1IGCH 2DTMH 1O6SA 1S7QA 2KH2B 3CH1B 3SBWA 5JOPE 1ZJAA 1XIWD 3B2MA 4WHDA 5D7KD 4M7LT 5GPRA 2NY7L 4JJ5B 4HJSA 5KSAB 3I6KB 4I2XB 5F88A 1OARH 4TTGA 5T5NF 1UOVA 5IQLA 4JLRA 2DBLH 3D4YA 3NJJA 4ABVA 3WBDA 2UY6A 4NPYA 1G7MB 4XVOA 2NW3B 3QIBC 1WT5A 2O6EA 2CBMA 2J1XA 1NCDH 2PCPB 3T2QA 3VXPA 5JW4R 3AXLB 4WTQA 4Y2DA 1ZA6B 3US9A 4U2YA 4FQ1L 1J9CT 3L95B 3O4LB 5FYKL 1LK2B 1VFAB 3RQ3A 3VXTA 3ZX1A 2OW6A 4AZUA 4E9QA 2JLLA 2ATAA 2IBZY 2VLJD 3ERXA 2FATL 3QIWD 2EEAA 2CLZA 1TQSA 2EH7H 4H8WC 4MZRA 2KT6A 5DJ0A 3EHBB 4FXGC 5CJQH 3SJVB 1DQDH 4AENB 2OLDA 3O8XC 1MWOA 1NCUA 5D1ZC 4HUXB 4N6RA 2MSPA 5J13C 4WFFD 5TGBA 5CIPH 3T4AA 3ZE0E 4KK9C 3GK8L 1NCNA 3QO1A 5FIEA 1HIMH 3SPJA 5E8NB 2WBXA 3IKCA 3GRWL 5H37A 1J0HA 3OVUB 5EFIB 4DERA 1ZPUA 5DR5H 2ZSWA 3D0LB 3CVCA 3K5SA 3P77A 1ZTMA 4XO5A 4K7FA 5K9OB 1PD1A 4P5TC 1UM4L 2Y2WA 2G4EA 2HZHA 3IAQA 4G8EB 4KO5A 3VM7A 2H1PL 1UA6H 3V8CA 4JPKH 4JY6A 4PJ7F 4JM4H 4OFPA 4JM0A 1A9EB 3AWFA 1JNHA 3KLDA 3LPOA 3GIZL 3LH2H 5JHDD 4JKMA 4XP6L 1AS6A 4OZFA 1WFOA 2DZEA 2FWUA 2VM9A 1J9TA 1UACH 1IUZA 1SLUA 2WQSA 4TLTA 1FGNH 3M6DA 5DA0B 4EZKA 3IKKA 4QR7A 3FQYA 3OKMA 2P46B 3CHQA 1SM3H 5LWYH 2BNRB 2EDRA 3P9MB 1YZZA 3HLAA 4UU9A 3RWHA 4N68A 1Z66A 2J6WA 1NEUA 4XMVA 4WDIB 3QYNA 1ADQH 5CMAA 4D8PB 2XN0A 5KS9E 4QCIB 2VDOL 3DURA 3OG6B 4Q6IA 4LQFL 5IBUB 3IPFA 3ZR6A 3ZTCC 3AG2B 1KJMB 4O2CA 4DF9A 4GG6F 4BQ9A 1MHPH 2MCMA 1Q4NX 1T0MA 4HKBB 5JR1L 3BPLB 2KS0A 3QUYC 5GRJL 4U1GB 3ARPA 4QLRA 3IF1A 2HVBA 4NFBA 4I1RA 3ZHLA 5HHXH 3KPQB 3ZHKA 1VFMA 2VSKB 3LXCA 5D7IE 1IGJB 4JFED 5FK9B 4DVRH 2I24N 3TL5A 4BZYA 3L5XH 4WI0B 4BE6A 4UZUA 3TM6A 4G6KH 2PXYD 4NDMB 5LBSH 3VG0H 1ED3B 1V27A 1JWSA 1QBLL 2VO8A 3V0IA 3BO8A 3OZ9L 2WO3B 5FGBA 1UGKA 5CJ8A 3D25B 5BQDA 5JXED 2EO7A 3VU1A 4WSGA 1KPUA 1AKPA 3S9DB 2PR4H 2IJ0C 5GRUL 3I75A 1ORSB 4LRNH 4EOWH 2A6JA 1FBIH 4E5XG 4WWID 4RRPG 3V0JA 4FNQA 1K5NA 2VABB 2YN3A 3KYOA 3S35L 5A2IH 5KN5B 2OL3L 3CU7A 2XZZA 4OLZL 4JFOB 3D39E 5D71H 2XV6B 3QHZH 4NNXB 4YUEH 2V8LA 3RX7A 3VGEA 3M1BB 4PSPA 3NIFE 2CGZA 3UBHA 5BJTA 4ELME 4XNZC 5F97E 4Y19D 2Q2LA 1ASPA 3BESR 3P0YL 4LLUA 5ISZA 3MV9B 3U0TA 3T6WA 5I0YA 1G6RB 2Q3AA 4MD0A 5CM1A 4XX1E 3R1GH 2HKHL 5I1GL 3JZYA 1DCLA 1LDPH 5D5MA 3BGFC 3MR9B 1T4KA 4LLYA 4R7NB 5CZVH 3VDCA 1ZY9A 3B83A 5GJSL 2VR8A 1JHTA 1CE6B 5DURB 1NEZB 1V3MA 1XO8A 4P0DA 1Z5LB 3FK3A 1G87A 3FSZA 3RDTA 3GTTA 1NGXB 1NA8A 2NX5E 2QSQA 1UZ6F 3GMMA 5AAWA 3H9HA 3F7LA 1MZYA 1L5GA 5GGSY 5GS2H 5F9AC 4XAWL 1IKOP 5GJTH 1NFDF 2BM3A 1JZ4A 4DUVA 1F1AA 3LIZA 2VN5A 3KM2A 1D5IH 1DUYA 1S7VB 4MA7H 3TZVD 5DJXB 3QVAA 4NJAL 2EIEA 3VRJB 2EEFA 2GVYA 2E4FA 5D72H 2ZXEB 3AMKA 5C07D 1FAIH 2GPZA 3AWEA 4Z7NF 4I0CC 1PNDA 1NBVL 4LEEA 4E41D 3V9CA 3C87A 1YECH 1U21A 4F9PA 1T3FA 2NY1B 3CZSA 5JIQA 5CCGE 1K6QL 3AC0A 4BJLA 3LN4A 4N9OB 4XN8A 5F44A 5ACLA 1LXMA 3AREB 4X8JA 1DBAL 5E2TH 4M6ML 4F2FA 1YEHH 1MAMH 5FO7A 1PQZB 3QCTH 1U8QB 3IEAA 3KBEA 4UT9A 3A6CH 2XV2A 5FUCC 4JDEA 3BW9A 1KGCE 1OCWH 3K72A 5BXFA 2FEDD 4P05A 2CUMA 4CBZA 2OMUB 3CN3A 2BRRH 4Z7IA 1QA9B 4MTMA 3TVMB 1NMAH 2K70A 1QAWA 5E00A 2EP6A 3HI1A 1W6WA 1AQDA 4J4PA 3TEWA 5T3ZE 5DZ9A 5K59E 1BECA 3NH7H 1HU8A 1X4ZA 3NZUA 3DX7B 2X1WL 5I17A 3EYQD 2C9XA 4HKZB 4MJ5A 2QV2A 5EU5B 1JGLH 5D7JC 5DO8A 3MA7B 3QPQC 4CC0A 2VR3A 3RL1A 5FA4B 4Y4KA 3NFNB 4TLKA 1AFVH 3LNGA 4OV5A 1B88A 1BVLB 3WU1A 2AK4B 4BQCA 1BJ1H 1MRFL 3L3OC 3SKJH 1NGWA 1YLBB 3H7LA 3JVGA 5J7CC 3MRMA 5HVWA 3O45A 2WM0A 5E5UB 4EIUA 1CXEA 2ADIB 4DW2H 2CCVA 4YSSA 2VB5A 5E08L 4LCIL 3NP3A 4NQDB 4Z7OB 3V5DA 1KLFA 5JW3L 5BVJA 1C5DB 3ARGA 4NRXA 4PRHA 2YEQA 4FNLH 1LP9B 3KPRB 4XVSL 3C5XA 5FUOH 3QQ3B 3CBJB 2FYVA 5JZ7D 3CFJA 2R0KL 3L48A 5EC1A 3EFDL 1SN0A 2WLYA 2ADFL 2ZG2A 2Y3AA 1UD2A 4YDVB 4YDJB 2AXWA 4Z7VF 4AQOA 1S9YB 2BDNH 2J8HA 3BVXA 2KERA 1DQLH 1LVEA 1KELL 1OB1B 3OX8A 5D7SL 1LWRA 5T1LB 2J55A 3G5ZA 1V7ML 2C1PB 5FYJU 3NGBB 2XWRA 2EABA 4JO3L 5H37G 2ZX9A 1H5BB 2Y22A 5I19L 4W9CC 2F54E 1FFPB 3OB8A 4PMFA 3RIKA 4UAOC 5C0EB 1MCPH 3TIEB 2CO2A 2BCMA 2OFQA 1CQYA 3MUJA 3JWOL 1B0WA 2XC8A 4MGXA 1MFDL 1XGPA 3WGUB 1EPFA 3DMMB 3MFFA 2EDFA 4J27A 2K6ZA 5PCYA 3CDFA 4P23A 3KBHE 2AVGA 2OSLA 2FX7H 4RFOH 2R2CA 4KMTH 3HB3B 2CO4A 1XHHA 1AANA 1ZTXE 2NUPB 2ZXBA 4OZFG 4MLSA 4PRNB 5JW4M 1CS6A 1WAAA 1NFIA 2YBRB 2WWNA 2Y7QB 3EGXB 1XD0A 4JDVB 3NACH 3A4FA 3DX9B 5I9QB 1WCQA 5I1EL 1B0GA 3RURA 3JQOB 4IIQA 4MXQD 2OW7A 3K6SB 1TTUA 2GY5A 1BQKA 5HI5C 4UIMA 4M61B 1BVKA 3LPGA 1G9NC 5IP4A 1UWEL 2LOEA 4D94A 3R0MA 5KEZA 2BY2A 4G8AC 4QHKI 4G9FB 5GRVK 3QRGL 3QORC 4N25A 3TYGL 2OAAA 4L9DA 2X0UA 3BZEA 3HI5H 2NY3B 1M7DA 3X2QB 2CKNA 2WLKA 3HN3A 3DI2B 3EXLA 3G6JE 3G7TA 4X7FC 5JO5B 1TTGA 3AITA 1NLBH 2OR9H 3MV8A 2YPLB 1EZUA 1M6UA 4QHKJ 4S1SH 5F70A 2ETWA 3QFDA 4ZS6C 5F96H 3HNSL 1BYOA 5KAQF 4TULL 1MUJA 5AVVB 2H7WA 5DQDH 1UCBL 1SEQH 3MRGB 4YLBA 2AXJA 1R6VA 3RVXC 2IWKA 4YFLF 1RL1A 3GRWA 2RCSL 3OR7A 2EYRB 1RVFH 2Q76A 5HI3C 1GYUA 3IDXH 3D69A 4TSAH 5JORA 3BDYH 1RUPH 2VLRA 4YWGH 2GBAA 4GS7C 5DI8B 1MCSA 1NINA 4K94C 3DRQB 3B7UX 2PTUA 4XWOC 4LHUA 2AV1B 5D4QA 4JAMB 2HFGH 5GGTH 1U93A 1DEEA 1GYVA 4I0PA 3WJMA 3UGXA 4FLHA 3RFRA 3LKNA 2YQGA 4N2MA 4P2QB 3L2NA 2NOYA 4AYID 4XC1H 5C0JA 2I9LA 1HL5A 1DBBL 2G5UA 1SLXA 4U1LA 1GJUA 3CN2A 3GZKA 4ELKB 1Q9WA 3UEZA 1JZDC 3U0PB 2G3NA 1AXIB 1F11B 4PHXA 5DJCA 1PLGH 4ZDHB 4MA1C 3BUIA 3GMRA 2WOYA 1OT2A 4K3DL 4MNQE 1ML0A 5GRVL 1OTSD 1VACB 5TQ0H 2Z92B 1AH1A 2LU7A 4PUBH 5JW5A 2A0LC 3DI3B 5I0WA 4M7KL 2W0PA 1ZEAL 4GKZA 4DZBA 3HRZB 3S6CA 1I75A 4JZJB 1J7VR 4JZOA 1A1MA 2L0DA 2W9EL 4OCNC 3VXMD 4ZTPL 5MHSE 3WEMA 3HC0B 5KVGH 3U6RB 1EMTL 2IDCA 5EZLA 3KJ4C 3GHPA 3X3GH 3HUJF 1RV6X 4BKLA 3L4TA 3FO2A 3FU6A 2BIOA 2FGWH 3TO4C 4EI5A 4YFEA 1HJBC 1EAOA 3CSBA 1X7QA 3V0VA 3TIDA 1QI3A 4ZAKB 2JNZA 5DRNB 1CD8A 5CAYB 2R69L 1ID5I 1RUAL 4UUJA 1BQ5A 1NQBA 1JIBA 2AEQL 2HH0H 3FHAA 4IRSC 2GHWB 5E23A 2H3NA 4OZIF 3P9LB 4QRUA 1L7TL 2CO6B 1WFMA 1IEBB 4HC1A 4I88A 2E46A 4OUUB 1MFMA 4KITB 3Q6FB 3GO1H 4F91B 1N5YH 1IQDA 5F7DB 4WJKB 3UO1H 5KBDA 2GFBA 5J1TC 3PP4L 5CO1A 5GIRB 4AI7A 1IKFH 1SY6L 1PEWA 5E70A 4L8SB 4AC4A 4FP8H 1KEML 3RTQC 2MHAB 5TDOB 1T1WB 1VPOL 3LEXB 4PJ5B 2VSMB 3ABZA 3W0WE 3TT1H 2J8OA 4JMXA 5IQNA 3EOYG 4JDZB 3X1FA 3NMEA 1SEBA 2OL3A 3NJIA 2H45A 1BD2D 2KHAA 1EAPB 1CFNA 4AQZA 1YN6B 5T1MA 5FYLL 2F1BA 4TNWF 3FKUS 3SE9L 4Z7WB 2MCPH 4Y2OA 4AG4L 3RX8A 1S2EA 2FTAA 4ICWA 3RU8L 1HSAA 1UB6A 1A0QH 1JXJA 2AJVL 2UY7B 1IFHH 2CO7A 1OE2A 3DTUB 4K8RD 3E8VA 3NJGA 3S48A 3EIFA 3SDAC 3CX5K 1UGNA 3N9GL 4ABUA 4O9HH 4AYGA 2YSSA 4Y16B 5JIIA 1F6AB 2CKBH 3HC3L 5C7ZA 3RLSA 2QVTA 3BWAB 2CK0L 2CHZA 3FUNA 3JWNE 5I1LA 3LZPA 1I7TA 3NJHA 3SDDB 1MCNA 4MJHA 1CLYH 5D1XA 3RVWC 1BOYA 4MMYA 4WUUE 3WNPA 1KXQA 4NYLB 3RI5F 3ZTJH 4A37A 1QLEL 3MVSA 3O6FD 2Y7OA 2PO6D 2N59A 4FLSA 3OL2A 5E9AA 3ZMRA 4WI4A 3ULUF 1IAIH 3S8WA 1OWRM 4NIKB 5TK2A 2JKLA 3T0EA 2ZYRA 4Z9KB 4FFWC 4DHLA 4AUJA 2I9TB 3OGOE 4OF8A 1EHXA 4OF6A 4LOUD 3WHXA 1JRHL 4J3XA 5DUPH 3EOAB 1QRNB 1UH2A 1X5YA 1WO2A 4GRWB 3TPUA 1NUDA 2K1MA 3NJNA 5DZJA 2FD6H 5FX3A 4PW9A 2E27L 4LF3B 2GG1A 5GS2D 1CGSL 1XGQA 3L1OL 4UM9D 1FLRH 4ANVA 1AGBA 4JO1L 4DFIA 1JFHA 4X6EA 5KW9H 4PREA 1MW3A 3GUTB 4POYA 3UBXB 1F58L 1JBJA 4OJFH 1LWJA 1E28B 3P4MB 2EKJA 3SQOL 2RALA 3GMNB 2PYEA 4ODXB 4D0DB 1ANUA 1KNOA 1UENA 4K3EL 1F41A 5AW3B 1N2RB 1K4CB 1M7XA 2WGXA 2YFNA 4HGWB 2XG5B 4N0UA 4N8PA 3T0XA 3T09A 3UTTA 4G8IB 4I5BA 5LGJA 3QO0B 1NC2B 3VFRA 1WVZA 5GZOA 1A7PL 1U91B 4FTVE 2P5ED 2X6BA 4HHGA 1T1ZA 3AY4C 3T0AA 4CW1A 4S0HA 3QEQA 4IGBB 2EXSA 4QTHB 5JPNA 1RP9A 1X4YA 2CBPA 1JPTL 3BPNC 2ZUQC 4JW3A 2EAEA 4KKCC 1TQCC 2XZQL 4XZUA 1GTFA 4HSQA 3QQXA 4KRLB 4AC2A 4X6BB 1RXLA 2ZCLH 3FS9A 4DN3L 1HHIB 1VFBB 2ZUTA 1HXYB 1XQ4A 1A64A 2V3FA 3X11A 3BZDA 3FFCA 2ZYSA 4WJ5B 5ABDE 4OI7A 4MMXB 4HAKA 3VWKA 3B37A 1UXMA 3EH1A 5KVEH 3MLSL 5HDBE 3V6OA 4N0YL 2GIYA 2J56A 5A2AA 2KZBA 4GMSH 4ONFH 4JB9H 2BSSB 2OV0A 3VD3A 5SV3A 1CGUA 2QQKH 2YEVB 4IOSA 3NCBB 4XNQB 2W94A 3D34A 2P5WB 4HCGA 3GSRB 3T0EC 3A67L 3AG3B 4JHZA 5DU7A 4E68A 2FBRA 3A5VA 1Z9MA 1ZDQA 2E7MA 3OAUL 4YLQT 3P11H 2ZCKL 5TDNB 4Q52A 1OOAA 3IU3A 4PJ7A 2DWEA 3ECUA 1FDLL 2LVCA 4PLJC 3F64A 3NAAH 3KLKA 3RDTD 4YXHH 5CF3A 3U4AA 4U1HA 5J6HA 3GM8A 3M7OA 2X9WA 3HE6C 2EC8A 4XE0A 4JRLA 3ZL4L 2JIXA 4PVMA 4KZDL 4M3KB 1FZJB 5FA3B 4BYHA 1WDAA 2ROYA 3I02B 2YD5A 1MLCA 1YNTA 3KEHA 3EDDA 4FXKB 4PVBA 1T0NA 4NHCL 2IPTL 4LHUG 3DRTA 4B9IA 1NBZB 3O2WH 2Z7UA 5EU6B 5BVPH 3HJ0A 3RZCC 2HTKC 2P8PB 4R83A 3JXAA 1ULVA 2DQUH 3KXFA 4O58H 4GG6A 4DGWC 3SKMB 3E0GA 5DK2B 4ENZA 3Q2NA 4G1MA 1K3IA 3EYOB 2A99A 3IDNB 5JPNC 5IK3B 1MJUL 3V4UH 2EEXA 1DHKA 4LKCB 1F90H 4HJGA 3V0DA 5DMJB 3GGWB 1UFGA 3MJ8A 4GIOA 1C16A 1R3LB 3RI5K 2B2XL 1NIAA 3CC1A 1JNLH 3NCWA 1EZVY 3SBQA 2Z3FA 4KK5C 1S9VA 3PP3K 1EXHA 43CAB 5IB5A 1NGQH 3A21A 3KL5A 1LO4H 4NRZB 5CEZE 5F6HI 4GW5A 1BSIA 5IMMA 1U4EA 2F61A 3QXAA 2APSA 4X98B 3V6ZB 3R4DA 3K91A 4NQVB 4KHTL 4CN6A 1A6VH 5BW7C 2FL5B 3CVHH 4G8GD 4CRPA 2EXWD 4IHOA 5F6HJ 1RP8A 3DTDA 2VXQL 4G7QB 4ODVH 3MNDA 3NRFA 1AIFB 5E2UL 1Y0LA 5EH1A 2PW1A 1T80A 1CL7L 5CP3H 3TBSA 3DGDA 4EN3A 2W0LA 3AADB 4Y4KD 1JI1A 1GKOA 2DQFB 3GI9H 5CUSH 4HK0B 1SQ2N 5TE6H 2GAZA 1ND0A 3STZA 4PB0H 5TE4L 5HHQB 2X1XR 3BRGC 4ORZC 4Y0GA 2XKUA 2X2UA 2CHNA 2LW3A 5I6XC 3E38A 4M48L 2IV8A 4HIJA 1JZHA 2OSYA 2VR4A 3N1FC 5FUZH 3EYSH 3AMLA 5M94B 4B27A 3DJZA 1SRDA 2E0PA 2ZICA 4PJGA 4G6AD 1U6AH 4DUWA 1KULA 4OZHA 3EH4B 3BLPX 4CMHB 3WN5B 4ZUWB 2ZP9A 5SWSE 4U6HB 1LD9A 4WW1B 1CTOA 1WHPA 4U6TA 1V3LA 2DLIA 1JK9B 1HSBA 4U7MA 1V8HA 4XP1L 4CNIB 3BXNA 3WKNA 2PWDA 3MRFB 3RY5A 3PPEA 2GJJA 5AD0A 3G9VA 2FAUA 2D7PA 3S37X 4ZOCA 4GXVL 4HJ0C 3ZKXC 2NQ3A 1YDPB 5IMOB 3CSTA 5BRQA 3Q9PA 5E8EB 3KWVA 3LZNA 5C0GA 4TVPL 1LMIA 3V0EA 5IHLB 1UJ3A 3GSNA 3HN8A 1IGCL 4X99B 2DTML 2M1KA 3ZRFC 4D9QE 4N20A 2OR8A 1I9RH 4NQSA 1DFXA 2CM6A 3Q8EA 1JZEA 2F8OA 3SE3A 2R23B 2PTVA 1OARL 4JR9H 1DJWA 1QSFB 3L6FB 1TZHA 1I3UA 5HHOE 3R8QA 5K5YA 2DB8A 2RHEA 4OKVB 2NR6A 3AT0A 2PWFA 1OAZH 3ME0B 5E6UB 1TR7A 5FCSH 5TTRA 3PL6A 1NCDL 1AD0B 2NDFA 1QO3A 3SPHA 2VDMB 4Y5YA 3SODB 1B6DA 2WAQA 3BIAX 1WWAX 5FB8A 3JV4A 4JFFE 3C5JA 1GC1H 2BVQB 4N22A 4O02H 5T3XH 4Z7OF 1EHLH 4I1NB 2QPFA 4R7XA 3CSYA 5AL0A 1OF2A 4AIXA 2I60H 3Q2VA 4Y9GA 4KTGA 3T1WA 5G4NA 2JKJA 2ZAGA 2EH7L 1LP9F 2XWDA 4Y89A 3TO2B 1AGFA 5CILH 4G6MH 1X44A 5CJQL 2DQDH 2HLAB 1DQDL 3MGTB 4L05A 4L1SA 2F08A 1PU0A 2AANA 4XMLH 5T5NG 4D9LH 3F58H 2CCWA 2QGDA 4U6VH 1I1YB 1GSMA 2ZOLB 1YEIH 4KI5F 1FPTH 1HIML 4ZFZB 4PV8B 4EBQH 3QUXA 1XIWC 4KK6D 3OJDA 2NW2B 4AEHH 5F0LB 4W9JC 3QIUD 5DR5L 3OB0H 4QTFA 2HRPH 3WENA 4LRIC 4MCYB 3MLUL 1BP3B 2X41A 2AHIA 3I6GA 5B1JA 1MSPA 2ZNWA 3HHSB 3AS1A 3FDWA 1WUZA 1AHMA 4OF3A 4H0HB 2GSGB 1UA6L 2YUWA 2L04A 1FC1A 4JPKL 1KB5A 4JM4L 4Y9FA 3QQ9D 3ZW3A 3LN5A 3O9WC 3UMTA 3KYNA 3LH2L 4Y2LA 3QFJD 4H1LB 1QACA 3DJRA 2FZ3B 2PWEA 4Z7VA 4PWHA 1UACL 1FGNL 4U2ZA 2IDQA 3D2TA 2X1PA 4LPXA 3GS7A 2Q6WB 3SY6A 1SM3L 5LWYL 5AKSA 1IM3D 4Y4FD 1AZBA 4Z3GA 1WAEA 3TTYA 4PJDB 1ADQL 3LSOB 1FJ1A 1GZQB 1TCRB 2EE6A 1SJVA 2NSQA 3DROB 4KH2A 4NQQA 1ZT7A 3WNMA 3PUUA 5BO1H 1DVUA 3MLVH 5LVEA 5I1KH 4XO4A 4M4RA 4FYSA 2BNQD 4GKSA 5GSRB 4PJBB 1HZHH 1HQ4A 2FJFB 1MHPL 4CADA 3RAJL 3RJOA 5IY5B 3SE6A 3DVGB 4Y9CA 3FFOA 4ANXA 1HXKA 4MAZA 2IBBA 5HHXL 3MOBL 1H15A 5LCVH 4PBVC 5E5MA 4GP5B 1KG0B 4PJCE 2UZYB 2NDGA 3NIGE 4K5NA 3UABA 3P02A 4RBPH 1C5CL 1OD9A 1BOGB 3L5XL 3O11B 1IVTA 1YG9A 3F6LA 4G6KL 4OCYH 4PRPB 1TENA 5LBSL 3VG0L 1PFCA 3VXUB 4FXTA 5EBLA 4X6FB 3T4YB 1QTSA 1KZQA 1PL3A 1UWXH 5BPPA 2D0GA 1MY5A 3AU1A 5C2BH 3SYCA 4H2AA 4ZX6A 1LEGA 4F7EA 1KXTA 3B7RL 4HIQA 2J1KA 2PR4L 4PJXB 1G0XA 4LRNL 3MJ6A 3BYYA 2QQLH 3QDJE 1FBIL 3GMQA 3KLQA 3L5JA 3VVVA 4DP4X 1QSEE 4J12A 3TH4T 4ECNA 1R33A 4YHIA 2OJEA 2FJUB 3NIDE 2ARJB 2DYPD 2JFCA 2BOCB 4HMEA 2WQUA 1S9WB 2FO8A 2VDRH 5T1DH 5D71L 1YNKH 4JRXA 3H42H 5G5DB 3HG4A 2E7DA 5K33A 3WUWA 3HBGA 4YUEL 2XIIA 5AWNL 1F3JA 4FEMA 3D4CA 4KOBA 3SCMB 5KYNA 3RWCB 4CUCA 1AC0A 4EIZC 4GH7B 1FNHA 4L4VA 1H0DB 3DX6A 3BAKA 1OGAA 1PZAA 1G5GA 4YFDB 1DYZA 4NKMA 5E94A 4HKXB 1CU4H 5HHNA 3I9PA 1LDPL 2VM3A 4HCIA 3SY0B 1I9IH 1MPAH 1NGZB 3ILQD 4A1RA 5CZVL 1IGTB 4AQ1C 1J9QA 2XUWA 4LNRA 4QRRD 3ZSSA 2V37A 5DSCB 2XV3A 3FPXA 1R1CA 2DN7A 4PJHE 5DHMC 5I23A 1XX9C 1CF8H 3GBMH 5C08D 5CGTA 5D1ZI 4HFWB 2PXYC 3FOLA 2ZP8A 1IC5H 3EYFB 5HYSA 2X89A 2YSTA 5GJTL 2QV4A 3CIQA 1N59A 4PV9A 1A4AA 4BA0A 1BWWA 5JXEC 1D5IL 4MA7L 4QRFA 4GKLA 1PLBA 5D7LA 3SYPA 4HIEB 5C97A 5DD1H 3ARBA 2FYYA 4WNQA 5IMKA 3N42B 3L45A 5D72L 1YMHB 1FAIL 1LNUA 4AJWA 4JFDE 2GEQA 3UYPB 2EKSB 4DN4H 4CU8A 5FECA 2Q3XA 3PWVA 4HS8L 3P3SA 3P69A 4WFHD 4XMWA 1MFVA 3FB7A 4PWJA 2X70A 3ELAT 2E7HA 2NLJA 2RFXB 4ZFOB 5E2TL 4HZ1A 5E5RB 1YEHL 2YGQA 1QUNB 1YY9C 1I3VA 3F2LA 3QCTL 2ZX5A 2FB4H 5EOCL 5KVFE 4F8PA 3FAWA 3A6CL 4K5MA 1MCWM 4YSTA 1AXSA 3HUJA 1KTCA 4QRPB 3ZE1E 3HE7C 2GCYB 4DKEL 3F7VB 1NMBH 4MNHB 1YEEH 2WB1A 2V2XA 2YUVA 1DVTA 1NMAL 3WNIA 4Z7WF 4NKIH 2L7JA 2DQCL 1XF2A 5BQ7A 1XGTA 4OZIA 3GC3A 1JGIA 3N85H 3K1DA 3NN8A 4Y88A 3NH7L 2JK5B 4ELDA 1NC4A 1QKZH 5DD0L 1KGWA 1NCBH 3OC5A 4N9GB 1JGLL 1H6TA 3PAZA 3TZVC 1C8QA 1AFVL 2D4FA 2D8KA 3WXWH 1MHEA 2XXMB 2OQJA 4W6YB 4FQCH 1CFSB 4FTDA 4YAQB 2AJZB 3SKJL 2Y07L 3MUY1 3OBAA 1T20A 4KVNH 5ANMA 4WSJA 2XWTA 4KDVA 2P4AB 2IH3B 3PWUB 2VMJA 2WVVB 4JX0A 4S2SB 3PNWA 4DW2L 4N2AA 1U92A 4DETA 5JPMB 1H3WM 4LVNB 5LXGH 3CXDH 5J56B 1JOIA 1DVYA 5EN2B 3VWKD 4N0RA 5L2JA 4E42A 2EDHA 4P9ML 3BH9A 4GXUN 3ARBC 1D9KA 5E1GA 3BDXA 3MV7D 5LN8A 2G0KA 2RQEA 4IJ3B 5FUOL 2FEDC 5I1DB 3D4GA 2X5PA 2NY2D 5K9KA 4GRWF 3MUGB 2Y7MA 4M5ZH 4E9RA 1P53A 2A83B 4LDOB 4BV1A 1S7TB 1JF1B 2X9XA 4KFMA 3ZIYA 5AOKA 2BDNL 2LLGA 2VJ0A 3GJEA 1DQLL 1E67A 1QLFB 2DY2A 1DQVA 3CH1A 4PRIE 3EYQC 4FQPA 1KIPA 4K5PA 4JJ5A 4XRCB 5EB9A 3SDYH 1XF4B 3I6KA 4AW7A 1ITBB 3LZFL 4I2XA 3Q06A 2IH1B 1N4XH 2ENQA 3ISRA 1KJ2H 2YAOA 4U3XA 1F4AA 4NX0A 4WU7B 3L4XA 5ESVA 2C9QA 2WWKO 2NW3A 3EJPA 3MA9H 2GUYA 2R39A 4GAJH 4FERA 1QOKA 4PCYA 1ZA3B 4OB5H 4JNXA 2PCPA 3AT8A 1FVEB 2YHGA 3AXLA 2VSDA 2E56A 2FX7L 3L95A 3O4LA 4NERA 1LK2A 1VFAA 4RFOL 4JG1H 2WP3T 1R5IB 4KMTL 1N6QH 2C3HA 4Q9RH 2AMGA 4MXVE 5KS9B 2N3JA 3OF6A 2HJKB 1PIGA 3EOBB 3NACL 1BGXH 2QZQA 4LE8A 4RA0C 3ZYOA 2XI9A 1BREA 2G0LA 3QEUB 5EOQH 4AENA 5JZ7C 4GQQA 1B2WH 4ALAH 1CO1A 4QPEA 4HUXA 4JPSA 1CDCA 2TAAA 5DD3H 2NY0B 4YK4B 5CLYA 4MQXD 5I6NA 5DEGB 4B50A 3UPAA 3AB0C 1WF5A 5I1HH 5D7IB 4RMVA 5D5ME 4UT7H 3MPCA 5DRXB 4AEEA 4ZPVB 3HI5L 5GS3A 4GO8A 4OJCA 5IUCA 3D0LA 4K7PX 4UQBA 2RACA 2MKWA 3QQDA 4M5YH 1NLBL 2OR9L 4YSPA 5FO9B 1I1RA 4Z3EA 1RUQL 2Y0SA 4G8EA 2LFGA 4J23A 1X5JA 5DQDL 5ADOH 1A9EA 3CFBB 5AW5B 2IWFA 3FH8A 1SEQL 3QC6X 3LQAC 2XN9D 3PXJA 4I3GA 3KPOB 2YMOA 4OD2B 5CWSB 3VA6A 4H8QA 1RVFL 3QZBA 3IDXL 2VLKB 4HWBH 3BDYL 4HPOH 1RUPL 4YWGL 4CGUB 1P7HL 3D39B 4O00A 3NFSH 4OFDA 3RNKB 4BFNA 3EUUA 4WDIA 4HF5L 4D8PA 1VHPA 3QJTB 2HFGL 3N44B 4G3YH 4QCIA 3NIFB 3VFWB 4XPHL 2XWJB 3WGVB 1P84K 2AQPA 4E36A 1KJMA 3ZQWA 2F19H 4XC1L 5KAQG 4HKBA 2KPNA 1A65A 3UTPD 3WUWG 3C5SB 3GINA 3KGSA 4OQTA 5AKTA 1DQQB 4QRBA 1M05A 4KH9A 3MAWA 3QUGA 5DUMH 4YL4A 1E5YA 1PLGL 1CURA 2NX5B 3LRKA 3WJJA 1IGJA 4ODWB 1HAUA 5EBMB 5FK9A 2CBQA 5TQ0L 4Z8FH 3VD0A 2Y69B 1XCQB 5I0XA 4WI0A 3S0PA 5KYYB 2DMGA 2O30A 1UXSB 3ZKMD 4NDMA 1ED3A 3U1QA 3UG4A 1ZLVH 1XR9B 4BSJA 3VRLF 3P0VH 2ZAHA 3HI6L 5KVGL 3D25A 5HYSG 4QRTB 5F71A 5JW4Q 1ORSA 3BWSA 5FC9A 2FGWL 2YMTA 4JY4B 2PCYA 2XA8H 4UF7C 3RGBA 1OGTB 1HYSD 4DP5X 4QJ4B 5KN5A 4J3OH 2HH0L 3D7PA 5DGQA 4JFOA 2VM4A 2WXRA 4Z77B 4TUOA 3GO1L 3V9FA 2WLLB 5IVZB 1IVLA 1ET5A 2NR6D 4WKXA 4DKFH 1N5YL 4L0YA 4NNXA 3J8F7 1JF6A 5E6YA 5C0IB 3M1BA 3LVTA 1IKFL 2B08A 4HBCH 5AB9A 4BCYA 1CGWA 3DYMA 4FP8L 4RWHA 3TEZA 3MV9A 1T6BX 1ETJA 4HPYL 4FG2A 3D05A 1BLNA 1JNNH 1KFAH 3JYBA 3TT1L 3MR9A 1BQHA 1OTSC 4RX4A 5JIPA 4GG8B 1NEZA 3QUZB 2G3XA 4CJ0A 1NGXA 4OLUH 2MCPL 5EF0A 1MXDA 1W6LA 3W82A 3PHOB 1NEPA 1JPST 2Z65C 5F3BB 3P2DA 1A0QL 1CDYA 1D6VH 1IFHL 3LZRA 1S7VA 1HJCA 2ICCA 1S3KH 1ZLEA 2FSDA 2AITA 4O9HL 5DJXA 1WICA 2CKBL 3VACA 3QDME 2DI8A 4A68A 4DPRA 4XODA 3S3SA 3VRJA 5B3JE 4DCQB 1CG9B 4R4ND 1TZIA 2OMZB 1WIPA 3PV6B 4ZTOH 1OQXA 3VTTA 1JF5A 1CLYL 3ILEA 1KSRA 1U3JA 1AHWC 1QPPA 3DWTA 4RIRB 4Y1AD 2QHLA 1WAAE 3AREA 2VMFA 5HVGB 3LZOA 1F56A 2R2BB 5AW8B 4EDXA 4NXKA 2DQIH 3DXAB 4CC4A 1IAIL 1PQZA 1S4IA 1ZKAA 1U8QA 2O93L 1Z9LA 2Y25A 2H8PB 1G1YA 2YGOA 5H35B 4NO0B 4PFEA 6FABH 3V0WH 2ZF9A 3IDGB 2MFNA 2O1AA 5LAPA 3L3KB 5DUPL 2OMUA 4MFHA 5FYKE 2AQTA 4FQQB 1QA9A 2FQFA 3L7EB 4YHOL 3TVMA 4P8QA 3VD1A 2FD6L 4EJ1C 4WI2A 4Q4EA 1P69B 2ZJSL 1T04B 4HJ1A 2W8CA 2Z1KA 2MJWA 1FLRL 3ATAA 4G6JH 2SEBA 5KW9L 3MGOB 3WKPA 5EF3A 4X5XB 3U1SH 4HKZA 4K8RC 5EU5A 2EUZA 4LQ1A 3MA7A 1UEYA 1UWYA 4N2LA 4BQ6A 1JMXA 3WCYA 5FA4A 4OJFL 3NFNA 4QRAA 2NY4D 1BVLA 5JHBA 2HPTA 2AK4A 4BK5C 4WK4B 1MFEL 4H8PA 3BPOB 3UPRB 3TWCH 2QL1A 1EAJA 3ULVH 3F84A 4Q0XH 5E6RB 2BXZA 2UUDK 1BVOA 1XGYH 3MJWA 1XCTB 2ADIA 3O6FC 2PO6C 1JN6B 2GIXA 2A9MH 3NCYP 4XB8A 3GJFH 4XB7A 3IXTB 4APXB 4V2BA 1C5DA 3TN0D 3VGAB 1NANI 1EDYA 1VZGA 1LP9A 3KPRA 2ZCLL 5I1CH 3QQ3A 2WBJB 3WEAA 1A14H 4LOUC 4DO6A 1DVFC 1IBDA 5CEYB 3FAXA 5T5FH 4M7LH 5AZ2L 1SOXA 3WFEH 5KVEL 4YDVA 5D2NB 1J0IA 3HJEA 1S9YA 4Z3FA 1AGDA 4R2GB 1OB1A 2YA1A 3G6JB 5ENWB 3GF8A 4GMSL 4NN7C 4JB9L 4ONFL 1B4JH 5T1LA 1H6UA 2QQKL 1HEZA 3FCSA 4L0PB 1T83A 2HA1A 4LSVL 2ZAIA 4PJDF 2ICEB 1EXUB 5IESH 5M7QA 1S5HA 1JXKA 2QDWA 4MQTB 3S35X 1FFPA 4U4IA 1G9MH 1PD6A 1FYTA 1U95B 1WFIA 1SZNA 3P11L 3TIEA 1CFQB 1E4XH 2ZKMX 4PJBF 4YBQD 1O9WA 3HZ3A 2OZ4L 2P8LB 3ULSB 3KW7A 2HTLD 2ICWJ 2VLLB 3NAAL 5K1NA 4J2QA 2NUPA 3JTBA 4PRNA 3WYRA 2B0SH 2YBRA 1XMWA 3BSZL 4KNSA 2Y7QA 1AY1H 2RQ8A 3EGXA 3AJ7A 1BYNA 1B6UA 5HJBA 1JGVH 4JDVA 3HZMB 2FX8L 4S10A 3DX9A 3NEOA 3FFDB 4HJTA 2N7AA 1A6AB 4UV7H 3LS5H 3QE5A 4EQ2A 3K6SA 2B1OA 1RULH 4U05A 1J05B 1T89A 3O2WL 4M61A 1AS8A 4GT0A 1A7RH 2C8NA 2YWZA 5IBUG 2DQUL 4NZTH 1WEJH 4GI8A 4PJXF 1TNMA 4LK4A 4MNQB 4G9FA 4TQEH 4NOFA 5HGGS 3S5YA 2P48B 2X4SB 3MJ9L 1AHKA 3V4UL 3NABH 5JO5A 1FG9C 2C7UB 2X4RB 2YPLA 5MI0C 2VZTA 5E2WH 1EFXB 1BF2A 3KPSA 3WV0A 5IEKB 4PJ9C 5GS1C 4XXCA 1JNLL 3US0A 4WW2B 3ASNB 1C08A 3QG7H 5DVOA 5D1QA 5DMKB 4L9LC 4V2CB 1NGQL 3PJSA 1LO4L 4MBRA 4RFNB 2EYRA 1IAOB 4LSUH 3WNOA 4F7CB 4DAGH 5C0AA 4MBOA 5KSVB 4CKQA 4M5SA 3F3HA 1SMOA 5D2LA 5FWQA 5DI8A 4B6ZA 5D1XE 1HH9B 4HIXH 2AV1A 1KXQE 4JAMA 4ODVL 2BY1A 4TSCH 5D7EA 4YPGB 3GI9L 3TA3B 1SVCP 1A9BB 1PZBA 4P2QA 4N4YB 5IB2B 3P3TA 1URZA 3L4WA 1A6PA 3T0EE 4AGMA 1IM9B 2DH2A 3ARXA 3S3JA 2JKIS 4PB0L 4P04A 4ZT1A 2FH6A 3W0WB 2V7HB 3D0VA 3RRQA 4I85A 4ELKA 1KN4H 2HRLA 3FT0A 4EUPB 4LMQI 5CSZB 3U0PA 2ZCHH 3N42F 3ZUNC 1XZ0B 1R34A 5FUZL 3P3UA 3D6GA 3EYSL 3NCMA 4LCCC 3W81A 4QDGA 4NC1C 1VACA 3ISYA 4NNYB 2Z92A 5JHAA 1C5BH 4PJ8B 4AEIH 4N8CH 2ADJB 3QNYB 3W39A 3HRZA 4I9XA 3D51A 3O6KL 1G7IB 1A3LH 1NEZG 4N8UA 4JZJA 4PD4K 5I5MA 3HC0A 2B8OT 3VXRE 4HLJA 1CYGA 1RZ8B 3S98A 1EQWA 2IBZX 1AZVA 2YZ8A 4KROB 1Q0XH 1JP5A 2VUOA 3F7QA 1KLGB 3T5WA 1B4RA 1JTTA 1D7DA 2EXWC 2ERJC 4NRYB 2YGPA 4WUUB 3UTTE 3RGVB 5LGHH 4ZAKA 3DARA 3I50H 3F7RA 1PLCA 5DRNA 1YJDH 4FAAB 5KSAD 5GRXG 2HP4A 2CO6A 4OUUA 4LFHG 3DKHA 3Q6FA 5HGDB 4FNRA 5BOJA 5F7DA 1B2YA 1I9RL 2DH3A 2J4WH 4FJYA 4TNEA 1P5UA 2E5EA 5I71B 5GIRA 3RIAF 3ES6A 3M1CA 1VB9A 1FGVH 1SBBA 4JR9L 1BQRA 4YR6B 4YSUA 4L8SA 5I8KH 5DK3A 3G9AB 2MHAA 5TDOA 3FFCE 1EBPA 1MHHB 1OZUA 3LEXA 4YX2H 4PJ5A 4UWQB 2FHBA 3TASA 2YRLA 4L3CB 4M03A 4N3UA 3RY6C 4KVPA 4JDZA 3T6VA 3RDJA 4YDKH 4P46B 1E3FA 5FLUA 1RFDH 2EUWA 4IS6A 4K9JA 2HX7A 1YN6A 2F6AA 1E9OB 3OF6D 4Z7WA 3BH8B 2I5YH 5LAXA 4FFZH 1MVFA 2DWYA 3EHBD 1MDTA 5T3XL 2HVKB 3SJVD 1KCLA 1BZEA 3HFFA 5DHYB 1BZQK 3ARZA 1KMGA 3OHXB 2HXAA 2I60L 4KKZA 1XD1A 1Z32X 4BRJA 2AZAA 3IFOB 3SGDI 2H32H 4ESKA 1EAQA 4I1PA 5CILL 4G6ML 3MOQA 4NHUB 4Y16A 1F6AA 2DQDL 2XOTA 3T8VA 4ZXBB 3BWAA 4PJ7E 3B5GA 2DWTA 4H20H 4IMLB 2G75B 2EXYD 4XMLL 1ILUA 4J3OD 2LAGB 4LPYA 4FTVB 3SDDA 4U6VL 1LL1A 3RJQB 2MQ0A 2WIMA 1YEIL 1FPTL 4NYLA 1FCCA 3UC0H 2DOCA 2NQDA 4AEHL 1A3QA 5DEFB 4G80B 4RBPK 4CAGA 2AGJH 5MEOA 3CFCH 2H32B 2K78A 2CKBA 2I9TA 1KB9J 3SPCA 4IBLT 5HDBB 1IC1A 2AQSA 2GQHA 4KAQH 4QOKE 1WIUA 3KXFE 4GG6E 1BFSA 2BNRD 2F68X 1EERB 3APDA 4KO9A 4LF3A 5F21B 3UTSD 3VTAA 4UOJA 1JS4A 3LPFA 2QR0B 4OZGB 3U7YH 4AV0A 4BDVB 5KS9F 3GUTA 1TTAA 1P5UC 4L2YA 2VITB 2NUTB 3O3BB 3UP6A 4G9DB 1Q38A 1E28A 2JJVA 3P4MA 3REVB 4NM8H 5C0CE 3RWGB 5K9QG 2ADGA 5EORH 4ODXA 4D0DA 5IG7A 4I4WA 1QD0A 3CH8A 5EO0B 3CCHA 1IJ9A 1CDUA 1N2RA 1Q9LB 4FGMA 1K4CA 5I1KL 2VDKH 1I3GH 4HGWA 2XG5A 3WTVA 4G8IA 2N0KA 1TQTA 2Q2EB 3QZOA 5JHLL 5D7IF 3QO0A 3RJDA 1NC2A 2E7LA 3SPVA 3Q8FA 4KK6C 1U91A 2WLMA 3TJPA 3EFOA 4IGBA 1QFWI 3QIUC 1PX3A 1WWCA 2CBOA 4QTHA 5LCVL 1CXKA 1J1PH 5DRZB 2IDSA 1JGUH 2AJUH 3DGGB 4CN4A 3TBCA 4GO6B 4NQTA 3T2OA 2IANB 3TEXA 4X6BA 5TDPB 1Y1UA 3NK4A 2IQ9L 1U8LB 1HHIA 3HOGA 1HXYA 4JO2H 4JE4B 4ZW5A 2VDKB 4WJ5A 4OCYL 2Z9TA 1UXWB 2NNAB 2RBLA 4UQAA 1FQ9C 1R4XA 5TPWH 3L3GB 4RAVB 5C2BL 1MLBB 5HYJE 1QTPA 2BOBB 2VW4A 3QAZC 2WNXA 3IJHA 4PJGE 1H8NA 1NCGA 4Y4FC 2P5WA 2Z0BA 3E6FA 3I3DA 4OZHE 7TAAA 3GSRA 2ZKHL 4PGCB 1HK6A 3GXDA 4JFHE 3N44F 4X7DC 3NIFF 3BZ4B 4BWTA 1W2KT 3ASOB 1JV2A 3GHEH 1ZXKA 4JCWA 5T1DL 3SN6N 1U3HB 1KN2L 1DSFH 5DHXB 3ULVD 3H42L 3R7RA 2GB2A 5EDXA 5D4IA 3IVKA 5EEYA 1KTDB 5E9DD 3VDAA 5J11B 5GGQH 4KPHL 1O75A 5DURD 4JM2C 1NCWH 5AW1B 5C0DB 1K72A 1PYWB 3ZKQD 3TV8A 1EA9C 4YHKH 3QEGH 2K3HA 1AOHA 1Z9NA 4B9ZA 4JK0D 1I9IL 1MPAL 2XWCA 3W56A 3C75A 4LSQH 4Z7NE 1FZJA 5BZDB 3B9EA 5HDQL 3I02A 4GBXD 2IGLA 2XTJE 2H9GB 3GBML 3F85A 4EI6A 4FXKA 2ALWA 5FOJA 5HPMB 3NSXA 1IC5L 2VLJE 4GIPD 2OZ4A 1NBZA 4YC2B 1F1GA 2QLYA 4ZSOE 5EU6A 3SDXA 3SGJA 2ODIA 5CLTA 2P8PA 3OKLB 1FNGB 2EVHA 3FPYA 4PJAE 3HS9A 3MFGB 3SKMA 2WLHA 4QJ3B 5DK2A 3EYOA 3NJXA 2E9BA 3BSZA 3HZYB 5DD1L 5IK3A 1XSOA 5CBAB 4K3GA 5J3HD 1CFTB 5SWSB 3S96B 2DLFL 1L3NA 3OKNA 1AQKH 5KBNC 2B1AH 1BAGA 4CBPA 5I66B 5C6TL 3ORJA 2FQEA 3GGWA 3MNWB 4MX7B 1JVOA 1WBXB 2QPDB 3ZYIA 5F0PB 1M6OB 1JCKA 2AQ3A 43CAA 1OLLA 4HG4J 4NRZA 2MQCA 3QJHB 3BIKB 3SOBH 4OAWB 3V6ZA 1PGRB 3MJ9A 2GJPA 3RX5A 1WWBX 1S7WB 5FYLE 3ILQC 5K59F 2WSDA 35C8H 2DKUA 2K7PA 4JZNB 4NBXB 4EF3A 1LE5B 3QG6B 2OMBA 4HLZH 4X42A 3KBFA 1AIFA 2PP9A 2EH8H 4NKIL 3OKDB 2OMWA 1Q0YH 4GEIA 4M1GL 4L37B 1M2OA 5EPMA 5LLIC 3GSXA 3EO0B 1W15A 1QNIA 2DQFA 2L3BA 3SDCA 8CGTA 5HHOB 1KBGH 4H0IA 3RYMA 2HUHA 1TJMA 2GTZB 1QKZL 1P7QB 2IAMC 4A66A 1NCBL 5D6DC 5HHQA 4XN2A 3MLXH 4P2CG 1I8IB 4FCAA 3L1FA 4RA3A 4FG6D 1YAIA 4O2EB 3TJEL 3WXWL 3V55A 3N91A 4YDLB 3OZLA 4FQCL 2F8XC 1DFBH 3K5RA 1BWMA 4NQDD 4U7SA 3ETBJ 3N43B 4Z7VE 2GW5A 5CP3A 3WN5A 3QFGA 4FABH 5F0JB 4U6HA 1I8LC 2Q3ZA 3I2CH 1JHLH 1KGYE 1NUGA 1RZJH 4WW1A 4F37F 2BOLA 1VDGA 4JFEE 2D0HA 1JK9A 2BC4B 1DDTA 2UVEA 3KL0A 4DGVH 5LXGL 3CIAA 5TJWK 3BSHA 3MRFA 1JHKH 3EDFA 1MCDA 1IJNA 4BHUI 1LTXA 1QLRB 3C2AL 3UAFA 2ZZUT 1MH5B 3AXIA 1YDPA 4B9CA 5E8EA 4NCC2 1IU1A 2WZPA 4LVHC 2Q87A 2EIDA 4DTGH 2VW6A 5H2BB 1IGMH 5J6GB 4S1DD 2ATKB 3BP5B 2KUTA 5F1KC 1I85A 4M00A 5IGXL 1J5HA 4F8OA 5EEXA 3OSKA 2R23A 2V3DA 3C6LD 1AVAA 3S2CA 3G6AA 1N4XL 3IS0X 1QSFA 1KJ2L 1R17A 5CP7B 4OKVA 3DMMD 4X5WA 4E5XB 5AFAA 5DHVB 3H4HA 2DLEA 1G7LB 5G4OA 1PPIA 3M17B 1N7MH 4GAJL 4ONHA 4WJG3 3WE1A 4OB5L 4ATWA 2QVMA 1AD0A 1NCIA 3HB3D 4Y19E 4Y4HB 1SYVB 2FHCA 3MRNB 3UYOD 4HKJB 1MWAB 2WYZA 3VD5A 5KWYC 1R5WB 3UO8B 3VI3B 2CDEB 4PR5B 2BVQA 1I3RB 4JG1L 4POZD 4TNGA 3ZTJG 3BFQG 4PG2A 3BUYB 4JQIA 4Q9RL 4DP1X 2E59A 4GQPH 3L9YA 5B7EA 5IQ7H 1IX2A 1YRKA 4M93B 3IJ8A 4UB0H 2HFFB 3COOA 1NOAA 4JRXE 2HLAA 3MGTA 4F15C 5EOQL 5I30H 3P73B 2GY7B 1B2WL 4ALAL 3QIBB 3EKCA 4L4VE 5DD3L 1I1YA 5DC2A 4EI0A 1OGAE 3G6JF 1DO5A 2R2EB 4ZFZA 1MCOH 1OB0A 4FN0A 5E8PB 1T2QH 1AR1B 2NW2A 4UT7L 5BRZD 4HWUA 4XTRD 2QPEB 2QSTA 3WUZA 2CZNA 2H0FA 2WINA 4MCYA 4YHNB 2E4TA 1S46A 3TYFB 3GEFA 1ZLVK 5K39B 2ZXAA 3HHSA 5B22A 5J9PB 1MF2H 2EIKB 2GSGA 3S5ZA 3H9YA 5MENA 4KY1L 5ESQB 1NDMA 3KHQA 4FXGB 3ZXAC 3PWPD 5D7LE 4PS4H 5IQMA 2FZ3A 5D1ZB 2YD8A 2MOGA 4JN2B 5J13B 2F8VA 1IZJA 1SMDA 3QXUA 2GUOB 3MCKB 3HAEB 4HPOL 3FZUD 4HWBL 3NIDB 4NAQA 1QWUA 2Q6WA 1CYXA 1SHWA 2BW5A 1FZOA 1EVTC 3ARUA 3NFSL 1PSKH 1KJVB 2XETA 3CSPA 4PJDA 5DEZA 6PCYA 3LSOA 1RHHB 4G3YL 1GZQA 3HC2A 3DROA 4AIEA 2A6KA 4P5TB 1HINH 1HOCB 3MUUA 5F8RC 5SV4A 3WJLC 3WIIH 3NJFA 2F19L 4E9TA 5GSRA 4PJBA 2FJFA 4XBGB 4MQXC 5ELIA 3HUJE 3U36B 2WMPB 1AMXA 2C5DC 1NBQA 3A6OA 3K74B 5DHDA 4BIKA 1YPZE 1XGRB 4P59H 3B6SB 2JJTA 4KDWA 2HLFD 1O6SB 4WFGE 5DUML 4PJHB 3D3VB 4LLQB 1KG0A 4PI2A 3UH8A 4CVWA 4PRBB 1WH0A 2UZYA 4Z8FL 1WITA 2APXA 4L29B 1BOGA 3L3HB 3O11A 1DCEA 1PBYA 4WW2F 4PP2B 3WY1A 3WTUA 4ONOA 4PRPA 3VXUA 1XEDA 1GRWA 3L16A 4JY5L 5DJ6B 4GB9A 4X6FA 3T4YA 3HRPA 5JHLA 4JPVH 2IXQB 3P0VL 2K4WA 3VI4E 4XN5A 1GC1C 2FLRT 2MNUA 2ZYHA 4FHKA 1TSRA 3IDIB 4PJXA 3CZKA 3WDJA 3QUYB 2HJLB 4JFDB 2XA8L 1GOFA 2ESVD 3ET9F 3HMXH 3B7SA 1ZVSB 4UT6A 5ANME 3STBA 5IW1B 3AROA 1N0XH 4BKTC 4TUKL 4NKOB 2ARJA 1AI1H 2BOCA 1S9WA 3EGDB 1MOEA 2Y7SA 3WL9B 2WLZA 3EJUA 1TJHH 4DKFL 5G5DA 3WNJA 5AZEH 4PJ5D 2Z35B 3DX8B 3SCMA 3BSGA 3ZE1B 5DVMA 5IREA 4HBCL 4OSUL 3RWCA 4TSBL 2AAAA 2QTEA 4N6RB 1E8WA 3QO1B 3AS0A 1BBJA 2ZD0A 4HKXA 4HT1H 4YSDA 1KFAL 1JNNL 1Z5YD 1X9RA 2IG2H 3ZTEA 1NGZA 2VN7A 1IGTA 2P80D 3US1A 1O7VA 1BZ9B 1EH9A 3MLTB 5DSCA 4DK3A 3IE9A 1PD0A 2IPKB 4U6XB 1W16A 4X5PA 3X12B 4XCEB 4HFWA 3ZKMC 4WV1C 1Z9SB 1YMME 4GO9A 2NSMA 5IB4B 2V7NB 4I2XE 2WCGA 2VJ8A 4AM0B 4RDBA 3UROR 3G5WA 1LHZA 3ZZSA 4KQ0A 4HIEA 3DSNA 5TF1H 1HHKB 3O2VL 4XNZB 2GTWB 1MG2C 4TPRH 3FF8A 4LAQH 4TVPE 3MC0A 2MMXA 3IFPA 3KAAA 1HYSC 4HUUA 3THMH 2AC0A 1YMHA 4YSRA 1HT6A 4M3HA 4PB9H 4PLNC 3MUHL 3IXAB 4ZTOL 3BGFB 3RWHB 3HG5A 3UYPA 1CGTA 4GFTB 2WTOA 4R7LA 2ZWNA 4Y1SA 1LO2H 4YJZL 1TPXC 1QG3A 3DURB 4IBYA 4PTTB 3S3BB 3BKJH 1DSYA 3BX7C 4ZFOA 2RFXA 3KBPA 4HD9A 3TEUA 1QUNA 4Z6AT 1QRND 1B4LA 3T2LA 2OYLA 3OKOB 5DC4B 3UG3A 1W0VB 4KY2A 6FABL 3NPZB 5IT2L 3V0WL 5E7BA 4JHUA 5KZCB 3ZIMA 4LOVA 4MNHA 4PRIB 5LKNA 4H44C 3MKKA 2NY5L 1S7XB 3GI8H 4HJIA 1U8CA 3SE4A 3ZHDA 3CFNA 3LQZA 1QBMH 5AVYB 2Z1PA 1MCBA 1ZDSA 3NSDA 3DECA 4G6JL 2CDFB 1RKRA 2ATPA 3U1SL 2R0LL 3QJZA 2RMNA 1YCSA 4IKKA 4N9GA 4N28A 4LEOB 4LASH 5E9NA 2EIMB 3DX0A 3FUJA 3MRJB 3IGLA 1MFNA 3WMSA 3SYOA 2HLEB 3MI6A 2VMDA 2XG4B 1NC2D 5HHVL 1DQJB 5KSBA 4MZIA 1R3IH 4R4NC 1L7IL 4YAQA 2A6JB 2AJZA 1HZLA 3ESUF 3TWCL 4B60A 1UOLA 5KYXB 3ULVL 3DPDA 3KYOB 3NZHH 2UYLB 1T66C 2X6UA 2XVLA 1CPUA 2IH3A 3PWUA 1XGYL 2WVVA 3ESNA 4KJPD 1WISA 1ERNA 2XPYA 3ARTA 2A9ML 5JPMA 3PCYA 3W11D 2XFXB 5I6PA 4EAEA 4IRZA 1L9QA 1X5ZA 1Y07A 2Y1ZA 5DJAA 5EN2A 1ZLUH 3VFOA 4AY0A 1TQWA 4K23L 1HYRC 1MW0A 5D7JB 5HDBF 5I1CL 2WXGA 5I1DA 2XXFA 3FO9A 1A14L 4HBQA 5AW2B 3CXHK 2XQYK 1NKOA 4M7LL 5D5MB 3H4FA 3WFEL 4DKDC 1S7TA 1JF1A 3L3OB 1NIFA 1JHTB 4X4ZA 1DQIA 1B3IA 1HQRB 4OZGF 3JUYA 4AQ8C 3IJYA 1OL0A 2ZXDA 1B4JL 3K2MC 4S11A 4XRCA 3H9HB 1XF4A 3J2PA 2X9ZA 2IH1A 4TL5A 3CDZB 5IESL 4WU7A 4UTBL 2NY4C 2OMNA 3PPSA 5BUPA 1OP3H 4MDRA 4F8QA 3DOIA 2BFVH 4JCLA 4EZMA 5IKCB 4UTAH 2KLRA 1OW0C 2PP7A 1WSST 1EX0A 3H53A 5D9SB 1EHNA 1EZVX 3B9KD 2X42A 5I5JA 1UZGA 2QSCH 4TLUA 3R4RA 4WWNA 5TH2B 4Y5XC 2OMVA 3D85B 3FMGH 3FC8A 4ZZKA 1XGZA 1URLA 5DC0A 2HJFB 5KS9A 2B0SL 3LN4B 1SGKA 1P6FA 1KJ2A 1AY1L 4CSTA 4N86A 3TN0C 5FCUH 3R06B 2HJKA 2FJGB 3EOBA 1JGVL 3S3DB 4ZFGH 3II1A 4X4MA 4RSVA 5IHZB 2GJZB 1DEDA 4UAHA 4KFZC 4UV7L 5AVXB 3QEUA 1M9SA 2EEBA 1BQUA 3K6NA 1RULL 2QJDA 2VUYA 4W9KC 5BXFB 2QKIC 4JO4H 4QHMB 4QLWA 1A7RL 4HUKB 3WIAA 1CUOA 3MV9E 7PAZA 1AO7D 4IBQA 5DEGA 4HOXA 3LS4H 2BSDA 4TQEL 5D7IA 3TS8A 4ZPVA 1G9NH 3QDGB 4ANUA 1M3JA 5I76B 3MLRH 3NABL 1VLXA 3VFGH 4NUJB 3SGKA 1KV3A 4BINA 4UQIM 4DEPC 4APQD 5GSVB 3EZ8A 2Z8RA 4TMPA 3G5XB 4JUTA 4Z3IA 3CFBA 3GSVB 4YBQC 3QG7L 1IBGH 3NQKA 1C9SA 4CN1A 2B20A 5INDB 3KPOA 2HTLC 5CWSA 1PKQE 4OD2A 4LSUL 2DWDB 2EVGA 3FU7B 5AVSB 4DAGL 2VLKA 5C09B 3BP6B 3HBQA 3R7QA 2EDOA 5C0BD 1LQSR 2Y1AA 3E9TA 1N67A 3QORB 1E9PB 5DZNA 1ZK5A 3RNKA 4HIXL 1KLFB 4BGDA 3D9AH 1U42A 4TSCL 1ECZA 4EO5A 3VFWA 1OSEA 3TBTB 4K94H 2XWJA 2CBTA 1KF9B 1QNZL 4TF4A 1JNJA 3O3DA 4WEEA 4F93B 3QQ4B 3C5SA 1IGIL 1KN4L 5DO2D 1DQQA 2ZUUA 4R0LC 3SKUD 1SXNA 4YZFF 1DN0B 2NX5A 1KXVA 4ODWA 5EBMA 2ARJQ 4GS7B 1C5BL 4AEIL 2MRYA 4A6YH 1XCQA 2P5EE 4N8CL 5KYYA 1UXSA 3N5AA 1XR9A 1PCSA 5KVDH 3MV01 3QDMB 1R46A 4NZUH 2JELH 3DUSB 4QRTA 3QZMA 2AK4E 3UYRH 5L8KB 5H8DA 3QI9D 1Q0XL 4JY4A 2DICA 4C56D 1FVDB 1J1XH 1JV5A 3NCEB 1OGTA 4NFDA 2CJ3A 2OMTB 1PG7W 5LGHL 5FV2A 3GTNA 3I50L 1YJDL 4MA1B 5C0FB 1NANH 1YA5A 3OR6A 4ALAC 1HEJC 3WN6A 4HX1A 4ES9A 3CZNA 4Z7OE 2WLLA 1B0GB 2X1QA 5A2LH 3RPIB 2J4WL 5FYJH 1RSYA 4UIMB 4OQ1A 3KPRE 1FGVL 1S7UA 3M1OA 3V4PB 2ARWA 2A9AA 1CXFA 2RD0A 3TF7C 4J3SA 4OKDA 1THAA 3KJ4B 5C70A 4HS3B 3UTOA 3F12B 1CICD 3BOVA 4KXZI 5AQ0A 3N43F 3TO4B 1QQDB 4GG8A 1RFDL 1OT1A 3OMIB 2OXHB 2XTLA 4KI5E 4TQIA 1QTYT 3PDDA 1QFUL 2I5YL 2NXYD 4IRSB 2CMRH 3TU6A 4FFZL 3PHOA 4YE0A 4ZMYA 1ZE3H 2O6DA 2ZG3A 1MUJB 3U0WH 3T3ME 1BBDH 1FNEB 2ZUSA 5EBWB 1P4IL 4UQ2B 5BS0B 3TFBA 2OP4H 1BF5A 1FYTE 1ZLSH 3V95A 3OHMB 2AEPH 4G1EB 5J12C 4DCQA 3RTQB 4H20L 2NNXA 1CG9A 2DQGH 2OMZA 4ZD3H 5I28A 5KSAC 2AXHA 2WC7A 4TOYH 1T0PB 4KZCA 1A5FH 2ICWB 3CNKA 3NFPB 4LO9A 3UC0L 3TTSA 1UADC 2J1WA 1BJ1J 4GJTB 2R2BA 2WXNA 2AGJL 4NC1E 3DXAA 3ZQ9A 3H2PA 1U2HA 1VFOA 4R7DB 4NCC1 2H8PA 5H35A 4L1BA 2VC2H 4MWFB 3DK0A 3GZPA 3SDAB 1FNSH 1NWPA 1OXYA 3GBEA 4U6YA 4ZNEE 3IDGA 4KAQL 2APWA 1UVQB 3L3KA 1EZLA 1MVUB 3VFTB 4FQQA 2GT9B 3L7EA 1BFOB 3CJJA 3DK2A 4LLVB 4ORGB 4NQXB 2ZPKH 1CIUA 4XXWA 4MCNA 3TBYB 3VI3F 1IC4L 1T04A 3PDGA 5T33H 3WTXA 1CDJA 3MO1B 5K1VA 3U7YL 4OF7A 3PXLA 3MGOA 3Q5TA 5FM8A 4X5XA 4DK6A 5CKGA 5CKAA 5MERB 1A1MB 3VWJD 1N64H 5KBPA 4F8LA 5I82A 3L4ZA 2VN3A 4WEUD 3WFCH 3KPSE 4NM8L 5EORL 1F5WA 4WVRA 1E6JL 1J0KA 4LSPH 1DJGA 1UT2A 5D1QE 5PAZA 5IROD 2CNZA 2G2NA 2EXYC 4J3OC 4EI5B 4L3AA 5CD5D 3UPRA 3P40A 2VDKL 1JPEA 1XT5A 2P1YA 4GSRA 1W8EA 3TIDB 1J0JA 3EFFB 5C0AE 3ECBB 2JB5H 1XCTA 1L9NA 1QW9A 2H3NB 5D2LE 5AAMA 2DL2A 5FOBB 3IMBA 3RIFK 2A1WH 3D2UB 3IXTA 4ODUB 4HOZA 3V4VB 4APXA 1JGUL 2AJUL 2GFBB 5SWZA 2Y24A 1ODUA 3TA4D 3VXUD 1NJ9B 1K8IA 4G7RB 2WLIB 4WO4D 3Q13A 1WJ3A 2F9BT 4JO2L 1W72H 1JXGA 2HCZX 5KANG 2NY6B 5MEPB 4Z95H 4I7ZC 2OL3B 5DJZA 5D2NA 5GGRY 3WS6A 5TPWL 1QHQA 1WFNA 2XBTA 3CK0H 4C4KT 1CFNB 1JTPA 5ENWA 3G6JA 3P9WB 4FA8A 4MA8H 4BZ1H 2EVFA 1HXMB 1VEPA 4J1UB 4DO4A 3L7FB 1HSAB 1HDMB 3C5ZD 3L1GA 1EXUA 2ZUQB 2GI7A 2WIIA 2P49B 2OTUB 3FU0A 1TQCB 2E7CA 3VGFA 1QMUA 3GHEL 1U95A 3AQYA 1NMCB 2ORBH 1DSFL 1NIBA 4Q89A 1DN2A 4LBAA 3H2WA 2DM3A 1TXKA 2P8LA 3ULSA 1UD6A 5F1NB 5GGQL 1NCWL 1CXLA 2VLLA 3ZYJA 3ZTNH 2N1TE 4PJHF 3WEXB 2FK9A 4YMPA 3QEGL 4NUMA 4XOEA 1UOWA 3A22A 4UTBA 4LSQL 3HZMA 1UH4A 2QHRH 3LNFA 3FFDA 1U8KB 3T0EB 1A6AA 1VGKB 5KVGE 2QFPA 1U8PA 1K4DB 2WLJA 3TJHD 4OLVL 3WHXB 5A3ID 4KTDH 4PN6A 5HYIA 1KIUA 1Z2KA 5CU9A 1P7KB 4MNQA 2QVFB 4AYSA 3GRBA 3CZGA 2VKWA 4U1SB 3SD2A 5MP6L 2X4SA 1XGQB 4JGNA