2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
3IN2A 3SBPA 4W1TA 1ZDQA 1WS8A 1PNCA 4DP8X 3PCYA 2WO3B 2J55A 3X1FA 2HX9A 4BDVB 2P80A 1M9WA 1GSKA 2R7EA 1ASQA 1JZJA 2OJ1A 4NAJA 2Y69B 2QPDB 2QPEB 3FS9A 1E65A 3NSFA 1PF3A 4A66A 2CAKA 1OCCB 3WKQA 3OMNB 3CDZB 4K9JA 1ZIBA 1JXDA 3NP3A 1J9QA 5FC9A 1AS8A 2XUWA 1NINA 3PPSA 2PLTA 2IAAC 2N0MA 3ASNB 1SDDB 2ZONA 3PAUA 4HIPA 1SF3A 1GYCA 3H4HA 2BZ7A 1L9PA 4A68A 2XV3A 1BXVA 1ET5A 3JTBA 2UXTA 3T9WA 2HZHA 3GDCA 1NTDA 1T5KA 3NP4A 5B1JA 1SJMA 1HAWA 2YQBA 4FAAB 3CVDA 3TASA 4F2EA 5F7BA 1BYPA 3T6ZA 1CYWA 2DV6A 5I6NA 1TEGA 4YSQA 1GS7A 2I85A 2ZXWB 3FYEB 1WA1X 1FFTB 3V9EA 3CG8A 2ZOOA 4GP5B 4AKQA 3X1NA 1AQ8A 2QT6A 3AG3B 4F2FA 3GYRA 1CC3A 3OM3B 2XU9A 1A4BA 2BP8A 1BYOA 4KNSA 5AZUA 1OCZB 1M57B 1L9OA 1J9RA 4JKNA 3UACA 2XVBA 1FA4A 3FQ2A 1BXAA 4KNUA 1FWXA 1V10A 5PAZA 2DWSA 3WIAA 2CCWA 2FJSA 5I5MA 4PCYA 3NSYA 2VW7A 4EF3A 4E9VA 4TXVB 2AZAA 3HEIB 2VN3A 1SDDA 2UX7A 2UXFA 3AW5A 3DIVA 4YSDA 1A4AA 1WS7A 3IN0A 1NPJA 1AZCA 1QNIA 3L45A 5B1JC 5TK2A 4HCFA 2GI0A 1XB6A 4UANA 4E9WA 4YSRA 2AFNA 4DP5X 4GP8B 1PLCA 2J56A 1ET8A 3IBOA 1PLAA 4BWTA 4E9QA 1J5DA 3ZIYA 4QKTA 3G5WA 2IWKA 3WKPA 2DWTA 2DYRB 2XLLA 2YAEA 1J5CA 1A4CA 3BVDB 2FQDA 1BQKA 3ABGA 3JT2A 2CBPA 2BO0A 5B1KA 3FU8A 1SFHA 1URIA 3WG7B 1NIAA 3FPYA 3WNIA 2PP9A 3ABLB 4Q8BA 4GP4B 1QHQA 2VSKB 1N68A 2FT7A 3NSDA 3X2QB 1ILSA 2NRDA 4WTQA 1KDJA 2VSMB 1EZLA 3ZBMA 1GS8A 1IBYA 2YAFA 1OF0A 1DZ0A 1V55B 3U25A 1SF5A 3S3CB 4YSOA 4G70B 2JKWA 3CDZA 2EIKB 1J9TA 2GHZA 4DP4X 2PP7A 1JZIA 2J57A 3QJRB 1IUZA 1DYZA 4KO5A 2VM3A 5I6MA 1MZYA 2IDFA 1GY2A 2XV0A 2XV2A 3FT0A 2AANA 2GBAA 1JVOA 2R7EB 1X9RA 4W9ZA 2FT8A 1W6LA 3X1GA 4YVNA 1MG3C 2PP8A 2IH9A 1NPNA 2PPEA 3UAEA 4DPCX 2P80D 3FQYA 3MBWB 3UGEA 1CURA 1XB8A 1EHKB 3QJSB 3NJHA 2GC4C 4PAZA 4AX3A 1JXFA 1JZEA 1JZFA 3FYIB 3CVCA 2BZCA 3MX0B 3UABA 2OCCB 4WKXA 4A67A 1KBVA 2QDWA 3HB3B 3X1EA 4UAHA 5I6KA 4YVUA 1IKOP 5F7AA 2VW4A 4ENZA 2IDSA 1IC0A 2I7OA 2GSMB 2PPCA 5B7FA 1OCRB 3NJGA 3FSAA 3PLYA 4AZUA 2LLNA 1VLXA 2FWLB 3NJIA 3QJVB 2X87A 3RYMA 3DKHA 3NJMA 1L9RA 4BK5C 4HHWA 5LDUA 1JVLA 3DTUB 4AKPA 1JOIA 3NJFA 2JFCA 1JERA 2X88A 3FU7B 4HZ1A 4YSUA 1WA0X 4BDVA 1AS7A 2BHFA 2HX8A 1NZRA 1E67A 4DP2X 1AAJA 4E9RA 1A8ZA 2IH8A 1GY1A 1ETJA 1F56A 1WA2X 2H47C 3NYKA 4DPBX 1SHXA 1GR7A 2IWFA 3EHBB 1MDAA 1AZNA 7PAZA 3WNJA 4G7RB 1IBZA 3S3DB 1PCSA 1ASOA 4QLWA 2WO2B 1SNRA 5AKRA 3V9CA 1PZAA 5D4HA 1RCYA 4N8UA 1PZCA 4UF7C 5I5JA 4CSPA 1W6WA 4AKOA 3OMAB 2JXMA 2HX7A 1OE2A 3PAZA 2B08A 4A2HA 4YSTA 3FSVA 3T6WA 2UX6A 1AOZA 2H5UA 3S8FB 2UXGA 3TU6A 3T6VA 4E9TA 1E30A 1JZHA 3EH5B 4YSCA 1AACA 1GS6X 5AFAA 3QPKA 4G7QB 4JHVA 1L9QA 3ABMB 2PCYA 2PCFA 3TBBA 1AZRA 1MG2C 1PZBA 2VW6A 1HFUA 2BWIA 1AG0A 3C75A 4DP0X 3SBRA 2XYBA 1ILUA 5I6PA 1AR1B 2PPDA 3CVBA 1NIEA 3GXUB 3QJUB 4HAKA 3BQVA 4DP1X 1J9SA 3TA4D 1AG6A 2GC7C 2XX0A 1WAEA 1OCOB 3AZUA 2Q5BA 4NB7A 1CUOA 1NWOA 2TSAA 2RACA 3QJQB 2XWZA 3OQRA 1GW0A 4DP9X 4ZK8A 4A2DA 4M4RB 2BP0A 3H4FA 1AANA 5B1AB 3FU9A 2YAPA 1HAUA 1YLBB 1B3IA 4X4KA 1AZUA 4L0PB 1KYAA 2YXVA 5I5IA 3EH4B 9PCYA 3FQ1A 2W8CA 3N55A 2CJ3A 1BQRA 1ZPUA 3OMIB 1NIFA 2OV0A 1E5ZA 1KCBA 1ZIAA 1AZBA 1TKWA 2GIMA 3D12B 2PPFA 3NT0A 3SQRA 4RH4A 3AY2A 2EINB 4CSZA 1AS6A 2YAHA 1A3ZA 1E5YA 1I53A 1XMEB 3UAAA 8PAZA 2DY2A 2Y1AA 2FNWA 4BXSV 3NJJA 2BP8B 4G71B 3FPXA 1MZZA 4KOBA 2CUAA 6PAZA 2BW4A 3S3BB 3IE9A 4YL4A 3NSCA 2YAMA 3H56A 4N4YB 2FQFA 3TBCA 2MTAA 4JHUA 4F7KA 2UXVA 3QJTB 1KDIA 2XXGA 3UADA 2MRYA 1ZDSA 1ZV2A 2YARA 1BAWA 1ADWA 1TU2A 4M3HA 2AZUA 3FSWA 3T6XA 3KW7A 2VMJA 5I6LA 1NICA 2WSDA 2CALA 1PAZA 2HXAA 6PCYA 4KO6A 2VM4A 1OV8A 7PCYA 3SBQA 2A3TA 3CZUB 1NDTA 2FT6A 1ET7A 1RKRA 2IDQA 5B7MA 4YSEA 3ZDWA 2HLEB 3PAVA 4Q89A 3S8GB 1AIZA 2YXWA 4YSAA 4A2GA 1QLEB 4AI7A 3AG1B 1PNDA 1X9UA 4NERA 4DPAX 2YAOA 4GXFA 1TEFA 2FTAA 1CYXA 4P5SA 3NJKA 2HRHA 3KW8A 5E9NA 2Q9OA 4BWUA 4FA7B 3QQXA 4MFHA 3T71A 3ABKB 5PCYA 4E9SA 1OE3A 4BWWA 1RZQA 5D4JA 1V54B 4YSSA 2HRGA 2QDVA 2FQGA 1XB3A 3IEAA 1KCWA 2DYSB 1A65A 3EH3B 1BXUA 1RZPA 3ERXA 3FSZA 2B3IA 3PXLA 2J5WA 4E9YA 2EILB 4KOCA 4DP6X 5B7EA 1NIDA 1OOWA 2IDTA 1BEXA 4KNTA 5I6OA 5IY5B 2IWEA 3ASOB 2EIJB 3FU7A 3EF4A 4YSPA 2BP0B 2H3XC 2ZWNA 1N70A 1PMYA 4KO7A 2GB2A 5B1BB 4E9XA 4G72B 4HCIA 5EHFA 1R1CA 1PLBA 3NJNA 3X1BA 1SHWA 1JXGA 4HHGA 2TSBA 2FQEA 5TK4A 1KGYE 2BWDA 3ZX1A 4HALA 2I7SA 2XX1A 2YAQA 1SFDA 4A2EA 1OE1A 2IDUA 3AG4B 3OD3A 1NIBA 2BW5A 5D4IA 4KO9A 4BXVA 4A2FA 4HCGA 2AVFA 2EIMB 1UATA 3AG2B 1JZGA 3WI9A 1BQ5A 1NWPA 4GY4A 1M56B 2E86A 3NJLA 5I28A 3N2JA 1ID2A 1KBWA 1L9SA 1PY0A 4GYBA 5ANHA 4DP7X 1L9TA 2XXFA 1ASPA 4P5RA 5A7EA 5I26A 2PPAA 4G7SB 5B3SB 1KV7A 1W8EA 2W88A
chains in the Genus database with same CATH superfamily
5JPMA 3LPOA 1BZ7B 4E41B 3T0EC 1ZDQA 4PY7B 4M8QB 4N6RA 3BWZA 3UDWA 4N1EA 5D6CA 1S9VB 3TBTA 5D5MA 1FNLA 4PW9A 1QFOA 3QPQD 1WG3A 4I7ZC 4OLUH 3L08A 2W81C 2WZAA 4I9XA 4DIXA 3DTXB 3TEYA 3E1ZA 1U8CA 3OSKA 3N06B 4W6WB 3KL0A 4ZX6A 3O6KL 4MNGA 3ARRA 2X70B 4J3SA 4JR9L 4PYGA 2QADB 4IRZL 1NINA 4YBHA 1DTUA 2IFFL 4UT6A 2VLLB 1U8KA 2N0MA 3FTZA 3KPNA 2ZUXA 4DKFH 2IF7A 4XOEA 3IDNA 2X10A 2X4RB 3SJVB 3NCBB 4HIPA 5E94A 3A4DA 1L9PA 2NY6D 4J8RB 4AL8C 1KIRB 3EFFA 3T0WA 4UM8A 4TV3A 3LV3B 3UZQB 1K2DB 2R2HB 1CTNA 1NTDA 2VB5A 4S0TD 4JY6B 4TNWF 2IPKA 4OCLC 3E9UA 2X9XA 5HHXH 1SQMA 3SQBB 4P23C 2HH0L 5AW7B 2Z93B 2PUQT 4UT9H 4XO5A 1KWKA 4L4TA 5JW5A 2NDGA 4DKAA 5E4EB 5DC2A 4PYHA 1OF2A 3VH8G 3KGUA 5CKGA 3ZZ1A 5JW4N 1XGYH 1IC7H 2FJUB 3OM3B 4GAFB 4P4RA 2DQCL 4QTIH 3CFJB 3EYUL 4Z7NF 3VI3E 3CX5J 5H2BB 4MX7B 3T3MF 3C5JA 4UM9B 4DF9A 3FCBA 4NQCB 4AUJA 4YUEL 1MCSA 4ZAKA 3VMNA 3RZWA 3F7PC 1EEYB 3RIFF 4O9HL 1FSKC 5I73C 1DZBA 3QCUH 3MRKA 4F2MB 5JW4Q 3EYVB 2ZXQA 12E8H 4U6VH 5F7WC 3TJEL 3A4EA 4D8PB 3AU1B 1EZSA 4BSVB 2AJVH 2J1WA 2OAAA 3GSNA 5I15H 2D3LA 4ZUWA 4PGDA 4WW2F 4OFYD 5DC9B 3VWKB 1FNSH 2YKLH 3GS7A 4QHUA 3F00A 3I6SA 1M7XA 1IEBB 1KELH 4N8VG 5DUMH 3VG9B 5LHDA 1G4MA 3D87B 4NQEE 1DJXA 3CHSA 4XPAH 4DH2A 4E9WA 1FGNL 1SPDA 3US0A 3THML 2WPGA 3QXVA 2MNJB 2QQLL 4LCUB 2A7BA 5BS0A 2J88L 2VH5L 3QAZC 1ZLUH 2OCFD 4B9ZA 1REIA 3WJJC 1WIPA 1XGRA 1CDCA 3O9WB 4OJYA 3K71A 1P4IL 2DLFH 3UGUA 1D6EA 3RGVB 4FEIA 4JM2B 3SY0A 3DX7A 5AWNL 1HINL 2PO6A 5IREA 4JO4H 3VD9A 4PBWD 4XP5H 5J56B 4U1LB 1PSKL 4HGWB 4F9PC 3J07A 2VL5A 4XP9H 3BAEH 1URIA 4OTXL 4JY4B 2V17H 1IGML 1DEEA 3GMNA 3V6FB 3DXAE 5E0FA 1E9QB 4JZJA 4YDIH 3GXIA 2BP5M 4HUUB 4IHBA 1A3LH 1KLGA 3VRJB 1KFAH 3C8HA 4NCDA 4UM9D 3P3TA 3ILQD 1NL0H 1YNTB 1JCVA 4RMRA 1TMQA 3CH1B 1AVAA 3D0LB 1J9TA 1H8OA 1KBGH 4Y1TA 2OMXA 2A83A 4F7TB 4PJBF 3WY4A 3AXHA 5KVMC 3VCLA 2MCAA 4JN2B 1J8HD 5CEXB 3QNFA 3MLUL 2YBRA 3PQYE 4GS7B 4KQ4L 5M95B 3BESR 3RA7L 1J05A 4GAAA 5IMOB 3K6OA 1NPNA 5CD5D 1JNNH 3OXRA 4Y5YB 2VO5A 5E8DL 3HE6B 1KNOB 4HS6A 1HEJC 1TJHL 7TAAA 5KSBA 5DS8A 1U3HA 2BZCA 2AK4B 1PG7W 2X42A 3HB3B 1WWAX 4G83A 2X2HA 4ISVA 2K0RA 4XCFH 5D1ZC 3S0PA 4MAUL 4ENZA 1IC0A 2I7OA 2F61A 1G6RL 2GSMB 1A7RL 4WWOA 2QGCA 2BPBA 4JQVA 4G3YH 5GGVY 4X5PA 1AKJB 1LDPH 3U46B 4AZUA 3NJIA 2FWLB 1PIFA 3I74A 5EU6B 4KTEL 1XR8A 2PWEA 3AC0A 1J11A 1GZQB 4C56E 3C12A 4MVBD 1XBRA 4FQIH 1G9NH 4JN2A 5DA0B 5GGTL 4KZDH 4I0CC 5LDUA 1NDGA 1E9PA 5BMFH 4WI6A 1F58L 5FX3A 1TVBB 1FIGH 2G75B 1AS7A 1J12A 1YEKH 2HJLB 3PHQA 5I0YA 3F7VA 5I18H 1S46A 1FL3B 1M7IB 3ZDZE 1JGDA 3IETA 3L4UA 4OCSL 3TBSB 4M43H 1HT6A 4F92B 4YX2H 3TO4A 4FLQA 4XHJD 4NKMA 2NDFA 1QACA 1AZNA 2F7PA 4Y2DB 2VE6B 5DHEA 2GJ6A 3GSRB 2CD0A 3L54A 3V7MA 3ZE1B 4L9DA 4Z1PA 4P2CG 5T3ZL 3HHSA 2QVTA 3T4AB 3SGKC 2O5NA 1OP4A 3VXRA 2ZE0A 4N85A 2V8MA 4M61B 4EZJA 5IW6B 5JZ7C 4YR6A 3AB0C 4H2CA 2K78A 3QBTB 4JFHD 4B9GA 4NHCL 2PTVA 2EXYC 3WFCL 3QYCA 2D7MA 2IAMA 3UX9B 1XIWD 2NY2D 3QUXC 1E4XI 3T6WA 2VLME 1WITA 2CMRH 5JPMC 2H5UA 3B9KB 3I9GL 4FABH 3FB5A 1CIDA 3KWVA 5C0AB 2GJRA 1E30A 3DROA 3HE7A 5DSCA 1I8MB 2EDQA 1OT4A 2DJMA 1QVOB 2KPNA 2BNUB 3AMKA 5A43C 3ABMB 1EHAA 2OJEA 3V6OC 1AGDA 5AVSB 4YXLL 3BGAA 1TJGL 3SDCC 4A7GF 5I66B 4TULL 1MVYA 1E6OH 4ZNCD 2WCPA 4KITB 1X5IA 1XF4B 4HVBA 4U1IA 1FJ1A 2XBZA 3KPRB 3MXWL 5LBGA 5H37H 3T4AA 3WTSA 3ARDC 3G5YB 5FK9B 1B90A 3O2VL 5KSAD 4G1EB 4F9PA 1XCXA 5D7JA 3CGTA 3O9WC 3OLEA 3O4LE 3QUMB 5LLIC 4OZIA 1ZVNA 2CJUL 2GEEA 3CNKA 1XL6A 4GAYB 4PIRF 1Q9WA 3FN3A 2TSAA 4URTB 1VFMA 4AEIL 4TUKL 4ZS7H 4ABUA 4G8FA 2HFFB 5ANME 2Z1PA 5DWPA 1ZJAA 1RURL 3H1ZA 4XH2A 4OJEH 1QSEA 3A6CH 4F7CB 3U9PH 3E6FB 3KYMA 2ZWSA 4M6ML 2XA3A 4D9RD 5IHUH 3GSUB 2G9KA 3QEUB 3SE3C 4ZFOA 5IESH 1FDLL 4ALAH 2DQUL 1YYLL 3BIKA 2ZAIA 3LIZA 5L6YH 3BCFA 1RPKA 2V0AA 3MXWH 5I66A 4PJ8D 3O45B 1OT2A 2MNUA 4W9LC 1DLHB 3IWVA 5GQBA 2VXTL 4NZ8A 3UMNA 3MRLA 1GCFA 1MW2A 3JWDL 4PFEA 2DQEH 4JMXA 4N28A 2B0SL 3TVMC 2WXKA 3HUJB 1E5YA 4RMQA 5DQJA 4TPRL 3KJ6L 3QFDA 1Q0EA 1AGCB 3AREB 3FTYA 2PW1A 4UBDC 3R4RA 4F37F 4KOBA 2CUAA 2NXZD 1WV7T 3V4PH 1OANA 4OZIE 1I8KA 4OZGB 3NSCA 1ZHLB 1MNNA 4Y8AA 2AF2A 2DL2A 2AJSL 4JANA 3VXUA 4FTVE 2C1OA 3CZNA 4NO5A 3WTTA 4F7KA 1XR9A 3LEVH 2W9LA 1KB5B 1NC2D 4FTVB 3CE1A 4OVVA 1BYNA 2CH8A 2EEBA 3KYNA 1TU2A 3A6OA 5JDJA 4PP1C 1WBXB 5I6LA 1DBMH 4UT6L 2OMTB 3QG6B 4IEFB 2YD2A 4K5NA 4OFDA 2A3TA 2VDKL 1GA2A 1RZKH 4Z6AT 5FM5O 2A77H 1DJHA 3OMZA 3QI9A 1TXKA 1Q90A 2B20A 1DFBL 3DIFA 1A9VA 3FCSA 1UCBL 1MRDL 1OB1B 3LZPA 3OL2A 3AG1B 3GZQA 4DPAX 3DSNA 1G7MA 1A5FL 1TCRB 2FTAA 4Q52A 3L7EA 2ZICA 2GABA 5TD4A 1BFOB 1BGXL 5CP3A 5FA3A 2ZOLA 3U6XS 4KNQA 4LL1A 4XNXH 1KN2H 5PCYA 4K0OA 4CNIB 2H9GA 3MQIA 2YWZA 3CBJB 3KPSA 3O6ML 5DEGA 4ODSH 1C7TA 1YMMA 5HDQL 5ID0A 1BXUA 1BBDH 1FZMA 4O2CB 5IBLC 4F93B 2MCPL 3JWDC 2AGJH 2DW5A 3PXLA 2EILB 5F0PB 4M02A 1QA9B 2YPLA 3QHFH 3M07A 3P4OB 1KIPA 1N3NA 4NQXA 3P4NB 5IBUG 3COOA 3CCHB 3MNVB 3KNBB 3ASOB 2QHLA 3WXWH 3EF4A 2CLZB 3FUNA 1YAIA 2CCVA 1N6VA 2H3XC 2HKFH 1U95A 3L3HA 2RMNA 3AU1A 4F7CA 4BA0A 3OB8A 2FD6L 2VDOL 5DFTA 3WEXB 1FGVH 5TDOB 4HP5A 2J1ZA 4EBQL 2C9UA 3N40F 3HNTH 3D0AA 3NGBC 3IDUA 2AV7B 4QYAA 2OFQA 1YMME 3MREA 5T3XE 2C7FA 3NIDF 1CD9B 1NOFA 5GZOC 4L5FE 3JWOC 4QRFA 4KO9A 2ORBH 4EBQH 1F4YL 1NKGA 1CGYA 3DX6A 2NXYC 4GNKB 3APFA 4XVSH 3VYOA 1ORSB 2FJGA 2FB4H 4U7MA 3HS9A 4QXTA 4XCEB 4DQAA 2XXFA 4EQ3A 4X4YA 4W6YB 4PB9L 4AV5A 4P5TC 4JR9H 3U4EA 3GUTA 3DDFA 2CK0H 3FCUB 4GAGL 2BSSB 3ZL2A 5CZXD 1K2DA 1JF5A 2R2HA 3C5ZC 3MYZA 3VGEA 3TF7C 3I6GA 4DP8X 3WL9B 4GFXA 3DMMD 5AB1A 2NOYA 5GJSL 3X12B 1DQML 2R7EA 3C2AH 1ASQA 5C0BA 3BT0A 4G6MH 3WFBL 1LLAA 5F97E 3L4ZA 3C5ZA 5EC2A 1XF4A 4NN5C 4W9CC 4R96A 1B4RA 1IEAA 1XH0A 2XIBA 3IJ7A 3V0VB 4JFEA 2CIIB 4M6OL 3BP7A 4IHOB 4LQFH 4HAFA 3IFPB 1UACL 3OMNB 1ID5I 1GOGA 5I9QC 3S37L 1MQKH 4I2XB 3MX0A 3HVDA 3M86A 1N26A 2CHXA 2FX9H 4S2SA 3VYNA 1XGUA 1INDL 2AXFB 1MRCH 3DX3A 4LEOA 3REWB 3ZN6A 1JTOA 2WUCL 2X0UA 3EGSB 3N44F 4FZ8L 2A6KA 1SEQH 3D3VB 4IMKC 4QHKI 1T0NA 2CZNA 2AI0H 3B5GA 1JGEB 4LRNH 1F4YH 1J0KA 5CSBA 4YHNA 3RRQA 5LXVA 3QG7H 1BVKA 2W59A 3KPLA 4K3HA 4HZAA 2ZXGA 4PGDB 4X5XB 2YPVH 3FH7A 2P7TB 2RCSL 4O9HH 5T8IA 3P2TA 1ZTXE 3UGXA 1G7IB 4JHWH 4Y9GA 5KYYB 4LXFA 1TEYA 4XVJH 5FKAB 3LKSA 1GYUA 2K70A 4AE1A 1PFOA 2CHNA 1MCWW 3KLHD 4OI8A 4ODBD 1JK8B 3HC4H 2NNAB 4QRTA 1N5AB 3NCYP 2R1XA 4JO5A 1TQTA 4KK8C 3TJPA 4L2YA 2J3SA 3ARFA 3CLWA 5F1KC 2WLMA 4KPHH 2QELA 3DX9A 3SKJH 2JV6A 4JRFA 3WTVA 5HYSB 1J9RA 2C1PB 2IALA 2N56A 3F7VB 3P4OA 3QARA 4LCIH 5DFVC 2I60H 3WELA 1CQYA 4F7EA 1Y0LA 4KNUA 5DI8B 5JORA 3TT1H 2ED7A 1HKLL 1KPRA 3STZA 3LPFA 2UVEA 3N9GH 2QTVA 1IEHA 4M6AA 2L4OA 3WL9A 5CBAA 3LH2L 1A7BA 3M45A 1B4LA 3CVIH 2DJSA 5TTRA 1OIOA 4N5EC 4D7PA 4J3OD 1MCHA 4KK6D 1WZAA 3DETD 3H85A 4P2QB 1WZLA 3D18A 3FO1A 3TEXA 5C9KA 3ULVF 1NANH 1UWGL 1WS7A 3IN0A 1S5HA 3RL1B 4AITA 1M3JA 3FO2B 1IAII 1IC5H 3RAJL 4GH7B 3RWJA 1UT1A 1MJJB 2KBGA 4KTDH 2FECI 3U7AA 4Z3FA 3D69A 3GJFH 4GKOA 1S9KC 1XD1A 2F19L 4WW1B 5AD0B 3QI9B 3D2UA 4PV1C 1IBBA 1L0QA 3V95A 2YUVA 5E8PB 1K5NB 3EJQA 3IU4L 1A6PA 3ARTA 3CFMA 1U30A 1J5CA 5F96H 4ZQKA 5GHWL 1FLRH 1RK1A 1GKEA 3AJ7A 3TS8A 2WBKA 5D7KD 1D7CA 5DZAA 1FO0H 3FQNB 5AG9A 4J2QA 4YHOL 3WXVL 1OSPH 1CCZA 3D48R 1INEH 3MRDB 4Q8BA 4LO9A 3K4AA 1N68A 1ACXA 4NRZB 5FWRA 2W0PA 3AU0A 1KGCE 3OB0K 1JWMA 3BHBA 4HUXA 5KANG 2X4TA 2YAFA 4L5FL 2CR6A 3BGMB 3HG4A 4YHMH 2XZZA 2AQSA 3BD4A 3CLEL 3HS0C 5DZLA 3TCLB 3RGVD 1SHMA 2UY7A 4I2XE 4LBAA 2CPCA 5C0RH 1KXTA 4C56A 2R39A 4LPVA 3O6FB 1VERA 3H3PH 1J8RA 1RIVL 3WO4C 3MO1B 2Y3NA 1PG7X 2P5PA 2WLKA 1X9RA 3C6LD 3FUHA 3HN3A 4CBPA 2DB8A 3RWEA 1I7ZB 2A74A 2JSFA 5CN2A 4PRAA 5IBUB 3T4YB 1Z9OA 3VXOB 1ZSDA 5AVVB 5CWSB 4MSWA 1FLRL 2GJ6E 4MD4B 5CP7A 1ZD6A 2J21A 4MNGB 2PYEA 1FO0L 2R1XB 3VFUB 4A67A 2IOMA 3L1EA 3RURA 1UVQA 1IKOP 1I31A 2Z4QB 4JM2C 5C0IB 1O6TA 4P4KA 1LO4H 2DKUA 3NA9H 2J88H 3UBHA 1TZIA 1E9QA 2VR6A 3LH8A 4D9QE 5JHDA 4LIQE 4CMMA 3U4BH 2ITDB 4FYQA 4L2LA 4W93A 4ETYA 5IMLB 4D9LL 4EIGB 1Y18B 1FRGH 4YFLF 4TYUA 2KZKA 4GO6B 5K1NA 2PCXA 2P42B 4ACPA 1IJ9A 2EC9U 4H25A 1TMCB 3L17A 3CN4A 5FEBA 5C0AA 1JSYA 2F5BH 1XEUA 3U4BL 1VEPA 4QKXB 1F1DA 4HW6A 5ISZA 1MH5A 4Y4FD 1LEIA 3P0VH 2ZT9C 5AVRB 4ILDA 2GTWB 3B2XA 3EHBB 4RMSA 3BGMA 4JDVB 1MDAA 2J72A 4KKZA 5IBTL 2PW2B 4ODUB 2FWOB 2WIMA 2WQAA 2D7TH 2J8UB 3TIDA 4FKKA 3WE6B 3MBED 4WTZA 1RCYA 2VDRH 4MA1B 4F80A 5ITBH 4CSPA 3MJGX 1AKJD 3ZR6A 1MW1A 4AKOA 4AYFA 2X4SA 4LNRB 1P1ZB 2K6WA 1OE2A 2E4TA 2BSED 3PAZA 1ZT4B 2WXGA 4ZQKB 3LV3A 2E7CA 5AW9B 5H94A 4YSTA 1ZLVH 3NCEB 5E8PA 5DJ2B 4MMXA 4B95C 1XF5B 3TU6A 4ZFGL 3ARFD 2ADGA 2BSRA 2VDNL 3HC3H 2B3RA 4GRWE 3T1FB 1HHIA 3VFGH 4AIXA 2NCMA 4GPVA 1JRHI 1XGPA 3VI3A 4APQD 4MD4A 4JHVA 4N25A 2VKXA 4JHAH 1OM3H 5EZIH 2EO7A 4BFFA 1R3JA 1SXAA 1TG8A 2C3VB 4TSAL 3Q9QA 2H3KA 4JRXE 2EVFA 1S7RB 4BZ2A 4JHZA 2YLHA 4FLHA 3QQ3B 4IRSA 4PD4J 3RIFK 1YUHB 4XN4A 3E9TA 4X0NA 2EEXA 1AFVH 2VJ8A 1BVNT 1YYLH 2WJ7A 2F0CA 3MRRB 1CZ8H 1OVZA 1JUFA 3C6EA 2PABA 4XMUA 2WWKT 1DQTA 4IJ3C 4R0LA 3JV4A 4YXHH 1KXVA 1OCOB 2XA8H 3DV6B 3WCYA 4AJYV 2Y6SD 3QIWB 4OB5L 1F8TL 1KTCA 1N2RA 2XWZA 4N8VB 3MA9L 1SYVB 3L7FA 5T1KB 3VI3F 3VXSD 1WICA 5C0AD 3WO3B 1TVDA 3T08A 4GRMA 4RNRB 5EU3B 4DGVH 1SLUA 2VH5H 3DJZA 4QCIB 2OYPA 2NY4C 4XX5A 5EOCL 1HYSD 5EBWB 3O3BA 3F12A 4LGRB 1EO5A 4QPEA 2PPFA 1BG9A 4KVNL 4N0UE 1EH9A 1B4JL 4X6DF 5EUOB 1MFUA 4K94H 4K7FA 1YUHA 2A9CA 5IMKB 4Z3EA 3OGOE 5HYJB 4GRLB 5IQNA 3UZEC 1YECL 1I3RA 3RX8A 4WEBL 1YO4A 4GW5B 1EJ8A 3OWEA 1RUML 5DRNB 3ECQA 4YC2B 1N0LB 2AQ2A 3S3BB 3NEXA 1EJFA 3I9GH 4FG4A 1ZLWK 3SGJA 1KGXA 4N3TA 1SZNA 1MLBA 3DVFA 2K4WA 4OD2A 4R83A 4Y2OA 3ME0A 5CJQH 4JFEB 4GAYA 1YJDH 1Z9MA 2FL5A 5CR8A 1RZGA 4IDJL 1NMAL 5TQ2H 5IVZB 2WXFA 3FQTA 2WY3B 2N4IA 1MCDA 1I9JL 3MRHA 4BA8A 4Z8FL 2YPLE 5MHSE 4Z3HA 3LJ3A 4UCFA 4G6FD 3BGFB 3ZMEA 4E5XB 4IK6A 4ORGA 4KQ3H 3T3PF 3CZUB 3CU1A 4TOYH 2IDQA 4D0BB 3KL5A 5C9JA 1Z9SA 1WBYB 4EOWH 4C4UA 3QEHA 3ETBJ 4Y5XA 4PJBA 5J11B 4PJCF 1XSIA 4XGZB 2F74B 1W80A 2JKRM 2V7NA 2KQNA 1QD0A 4ORZC 1TJIL 2E75C 1FL5A 4JRYE 2BNUA 3MV9A 2A9AA 2C9SA 4PTUA 5KSBB 3BKMH 3L3OC 1OXYA 4RZCB 1OM9A 1AI1L 1ZV5A 4K9EL 3DBSA 4Z7WF 1KYOJ 2PW1B 4AOFA 5T3XD 4AQEA 2JH2A 3QZBA 3ARBB 3IGFA 4OLZH 2MPAL 2IAND 1OE3A 5AYUL 2XPGA 4BWWA 4HPHA 1F02I 2HRGA 2V4LA 3L2NA 1VFAB 2AV7A 1KWGA 4AWJC 2IO5A 1UQSB 4YLQT 3QSKB 4PREB 2FEDC 3FBQA 2P24A 3MUJA 2B3IA 2P43B 4XCEA 2YEVB 4DP6X 1RAMA 2BFGA 2PR4L 1EBPA 5D7SL 1I9JH 2NY7H 2HFFA 3BKYL 4AEHL 1R3IL 2HN7A 3CFJA 1I4FB 3QEGL 4FNLH 3VI4F 1CB4A 4YSPA 2WOBA 2VJXA 2NYKA 4AH2A 5DMGC 4NN6B 1F00I 3IETB 5JDSA 3IBEA 3MJWA 2ENSA 2ZWNA 3QEQA 2VXSH 4BZ1L 4L48A 3UTTA 2SEBB 5F70A 3CHQA 5IVXA 2UYLB 5EU5A 4Q9BA 1YZZA 1KIQB 1U21A 4LZKA 1TKWB 5INDA 2WKOA 1X7QA 4AQEB 3G5YA 4YHKL 4LP8A 4PG2A 3X1BA 1X7SA 1I3GH 4HIEA 5IVZA 1JHKH 2QQNL 5C0CD 4HK3N 3FOMA 4XMKL 3GSQA 3EO1B 5KVEH 1ZTXL 1C8QA 4GSDL 1Z9SB 5I9QB 1XSKA 1LE5A 3RTQB 3KJ6H 5FM4A 3GSOA 5FUZL 5I19H 4MJIE 5KYUA 5K9JH 1TTBA 3BN9C 3PWLB 4GBXB 1L9TA 5L6YL 3FB5B 3S37H 1KCVH 3L9EA 1FZMB 3N6YA 1FPTL 2ICWI 3WIIH 5I8KH 3GB7A 3QUKA 4NQVA 4ZS6D 4ZUSB 3MRFA 2IAMC 3QO0A 3CZFB 3V0AC 2Y7MA 1KULA 3IDIA 4EN3A 5KYYA 4LGPB 4AEIH 3ZRCC 5F8QC 3VXNA 4K23L 2KPWA 2PXYD 5E6YA 2QMJA 5TFSH 1D2PA 1G9MH 2KT6A 4WWPA 2X4NA 4ZOAA 3FUKA 5CIPH 4X6CA 1CE1L 4ODSL 1X6LA 2ZYHA 4ZAKB 2WQ8A 3NSFA 2YO3A 3QDMA 5HDQH 4AC2A 1DDHB 3B9VA 1NFKA 5FW6A 3Q5TA 4R7DB 2E9BA 2R23B 2V5MA 3DIFB 3LQAL 4PP2A 4UV7L 1D7BA 2HLAA 3MRBA 4K9JA 1HZLA 1AY1H 2GBVA 1QSEE 2NUPA 2VERA 2GBTA 1P4UA 3DURA 3LMJL 1KXHA 3PPSA 1C8PA 5GGQL 4BRJA 2CM6A 3PL6D 1BF2A 1HK6A 3MOAH 4Y5XB 1UOWA 2W07B 1DCLA 2HUEA 3RVTC 4NNPH 1GYCA 2ZG1A 2IQAA 2F08A 4O2EA 4N87A 4ZI8A 4JM2D 5B1JA 4A04A 5ALCL 5EU6A 1X7QB 5EU3A 3NJVA 3DA0A 2PMZA 5EOQL 3AXIA 5IMOA 2A9DA 3OKEB 4WU7B 3T6ZA 5DJCB 3NDYE 4JDZB 4JM4L 1TEGA 4NJ9L 2OZNA 1GS7A 5ILTH 2NXYB 4NUGL 1FFTB 3DO3A 2DM4A 2XQYG 1A9EB 1YEEL 3EOBB 2BNQE 5AVUB 4JFSA 2WINA 4Z7NB 3V6BR 1G1CA 5DMIL 4YGVA 4GSRA 5DD0H 4JDTH 4F3FB 1O75A 2WXRA 4PG9B 3VG9C 1W72A 2BY1A 2H7WA 4QR7A 3UXFA 1UM4L 3UACA 4NDMA 4M3JA 4N1CA 3UTTD 5J06A 4MB1A 5MENE 4X0KB 3O0LA 5LGJA 1K5WA 4YLCA 1BVLB 1NCHA 2VW7A 3RGVC 4NHUA 4AG4L 4EI5B 3VD0A 2YD7A 5EU6E 3KYNB 4L1TA 4LPWA 3MODH 1G1KA 1V7MH 2VN3A 4KDTC 3CHRA 5ETUA 4P3CH 5SWQB 1QLFB 3DX1A 1EGJA 4V2CB 5DRWB 1AZCA 4DGUA 3QZLA 3E6HA 3QCVH 4I5BA 1T1ZA 5DJDA 3ECWA 3NFPA 2P7TA 5F3BA 4HJJL 3EDEA 3KNBA 2RR3A 4AY0A 3VFPB 1C5DA 4LQFL 3LOWA 4HX1A 1KBBA 3HR5A 5CJOL 3ZKQD 1A5FH 5C08D 5BUPA 1S7WB 1QI5A 1WFUA 1JPST 4J6RL 1WE5A 3L6FB 4NSKA 4LASL 5GGRY 5LCVL 4PGJA 2Q6WA 4G8GE 3QZMA 1OAKL 3OKLA 3G5WA 3WKPA 4PBXA 5DQJB 3IDJB 1S9XB 4XVOA 3T8XB 2QKIC 4X9YA 3RJOA 1RP8A 3NEEA 5D71H 3KBPA 3I9AA 1CK0H 3CDCA 5BQ7B 3EDKA 4MMZB 4OFQA 5TDPA 4G2AA 4N0YL 4MB4A 5DK0A 5D2NC 4OFKA 3W2DH 3AM8C 5FOBB 4IRSB 4JFFB 5LN4A 1QFWL 1LMIA 1DHKA 1UVQB 4ABWA 5CGYC 1QLEH 4GQQA 4KK6C 1UEMA 1IBYA 3HC4L 1DDHA 2DTMH 1OF0A 3TT3L 4G8FB 3BI9X 4Q6IB 3SOBH 4YSOA 1BQHG 5KSVB 1NBCA 4PGEA 1CYGA 1H3PL 1SOQA 1HSBB 5I1EH 5E9DB 4HD5A 5ALCH 5BZDB 2J8UF 3ETSA 3GHEH 5DEFA 1R0AL 2B4CL 4YK4B 2WXOA 1KTRL 2OKMA 3ZTNH 1DJYA 2FWSA 3CLEH 2ATAA 4TRPH 5DVNA 1TZHB 3MROB 2OP4H 1TQCB 3ZGIA 2ALWA 4RAVB 3GBNL 4QCIA 1Z32X 3MKGA 2YOAA 3W2DL 1U58A 3KDPB 1JZFA 3QJXA 2VO8A 5EO9B 3VFNA 4QRQB 3UTQA 1CU4H 1PKQB 3AREC 4E0RB 1USZA 2NTFB 2VABA 3MNMA 3F12B 4RDQG 5I0VA 3A0OA 1B4TA 2J6EL 3ZQXA 3S88H 4K3GA 4YVUA 1CGVA 2OZ4A 3KYOB 2IEPA 3KLLA 3EOBA 3I02B 4H8WH 4PJHE 3CC5A 3OXRB 1CDJA 1OTSC 2DBLH 3MFFB 2NLJA 2JCWA 1KEMH 3DKHA 3KMDA 4WW2A 2KYIA 2IIJA 1S7UB 3R4DA 4Q2ZB 1CI5A 1S2EA 1THAA 3DIDA 4O5LH 3DYPA 3BVNA 3FU7B 3QPXH 4HZ1A 2FLRT 2D7QA 2IG2H 4MNGE 2DBLL 2ZCHL 5I6XB 5BRZD 1UOKA 1XGPB 4Z95L 3VI3B 1CBVH 1MELA 1XD0A 4OGYH 4ZODA 2BIQA 3P9MA 5CFAA 9CGTA 1RVFH 3RBGA 5GS1A 4LLYB 3H9HB 5D6DC 32C2B 1FYTB 4HC1L 5IUCA 1C08A 4N3UA 4PGEB 3X11A 4OZGF 4KRPB 5D1QB 4X80H 1TDQA 1IQWH 1PZAA 5FB8B 3SN6N 3SDCB 3N41F 1EHNA 2OR9H 1RUKL 4L8BB 1RIUH 2PWGA 4HWBA 4BQ8A 2NY5H 2PKDA 2D4FA 2DWYA 4WW2B 4XN1A 1ZTMA 4XVTL 5IB4A 2UX6A 3CPLB 3S8FB 2ITFA 1GZHC 2P5WA 2UXGA 3HE7D 4UT9L 4LSSH 3LQZB 2W91A 4JL1A 2X1PA 3RL2A 3WLBA 1S9WA 4A7SA 1JZHA 3ZUNC 5EO0A 3BGFC 4D2NA 4J3VA 3IGKA 3OG4B 3W0WE 4G6JH 1UA7A 4OM1L 3RJQB 3TCXA 4R8WL 4DEWA 4YHZH 5B21A 5EU4B 2EIDA 2VWEE 2ZCHH 2X9WA 4NENA 4BELD 1XZ0B 3NZHH 2XYBA 4HJ0C 1MJUL 4HIIB 3SPVA 2HMID 1I1AA 1FG9C 3ZY7A 1UZ6F 3X11B 4X6EA 4EIUA 5EOTA 3EO9L 3LS5H 3GFUA 2FSDA 3S98A 3QUZB 4PJAB 3F01A 3SKUD 5BPPA 3T3PB 3UYPA 5ICZB 3FAWA 3D0LA 1KIQA 1I85C 3LZRA 2Y72A 3QJQB 1QYGL 3BAKA 1DBJL 2I24N 3PWJA 4BM7A 4QHLB 4X8JA 5KSAA 3MJ7B 5EDXA 5IBLD 2IANA 3LN4A 1T80A 1MI5A 3QHZH 2QQLH 2G60H 9PCYA 4NN7B 5CN1A 1G7LB 2LVEA 3B7UX 4N8CH 3MNWA 4LBEA 3T1FA 1IGIH 5J89A 4XNMA 1MNUL 3BP5A 3I02A 4ZO8A 3V4VH 4AENA 1EO8L 2X6CA 1IKFH 1A7OL 2CU9A 2XG4B 1TJMA 3IFOB 4FS0A 3GTVA 1Q9WB 4HJTA 4WV1B 1EMTL 3PDOB 4M4PA 4R8WH 2BCKB 3DXAA 4R90L 4O02H 4N2KA 4WU5B 3UMTA 1FL5B 2VL4A 4XBPB 4Y4HD 5D6DA 4J4PA 5I1JL 2EIZA 4FQPA 1JPEA 4UINH 5B3NA 3LD8C 3BPNB 4FXLA 2JLPA 1RJZB 2E9GA 3T8XA 4OV5B 1UEYA 5LGYA 3NUKA 4K94C 2EKJA 5CEZD 4JFVA 5CF3A 2EICA 4XPHH 4D94A 2DWXA 4N4YB 2JCCB 4YO0B 1YEFL 4MNHB 3F7QA 5DUBB 3SDDB 5I1JH 3HC3L 3VFGL 4U1NA 1KPUA 2K7QA 3P02A 3ZE2E 5CLTA 1BZ9A 4UQBA 4LARH 3I9IA 3MR9A 1C7SA 3I85A 4YNYB 1UWEL 3PWVA 4PRPE 2XXGA 4ZUWB 5GISL 4PW4A 2AXGB 1PCXA 3GSNH 4FNSA 2AZUA 3FSWA 3CQFA 1DUYB 4NYLB 1ZANL 3K2UL 1PAZA 2D7TL 2HVJB 5I1CL 3TZVB 4L3EE 3GXFA 1KGJA 3HHSB 1VGKB 4KV5F 4YPGB 4EUPA 3K0WA 5I17B 3FN0L 3BKJL 2FT6A 2VZSA 2OK0H 1MFCH 1E7UA 3N0PB 4YOKA 4P5MB 3TEWA 4TNEA 4Z0XB 1P84J 4P2RA 3S8GB 3D2UD 4HBCH 3RWCB 2YKKA 1MLCA 1JVKA 5D9SB 5C0DA 5IMKA 2ZOWA 2X4OA 3LAFA 5GJTH 4WK2B 3RFZC 5HDLA 5C0JA 1QR4A 2JIXD 1ZCRA 3GMQB 5ICYB 2W9EL 5G4OA 4WZ9A 2YA1A 5FHBL 2VMDA 4RZKA 4RWYH 4UTCA 3DX8A 3HZMB 3D30A 4WWKC 4Z7WE 1R9FA 5EU7C 4HF5H 5B3JF 3UTSB 4GRWF 5C0CB 1M2VB 2YBGA 3QAQA 3ZMNA 2YPVA 2NY6B 4HWZA 3DMMB 1JGVL 4XXDA 4J6IA 3TJEH 2FR4B 2ETWA 4EOWL 1OSZB 1Y1DA 4ZSOB 5K59F 3AS2A 5D93C 1T5WA 2J5WA 4JHBA 2ZKWA 1A6TB 3U4AA 4LSTL 2X05A 1U92B 5GRUH 3T65B 4CA4A 1NIDA 5J12B 3DO7A 1I7RB 1KYDA 1M7DB 3UIYA 4QJ4B 1BEXA 1LHZA 1FAIH 1A7PH 1FNEA 3MOQA 4HJSA 2QBWA 5ACMA 5L8KB 1XHHA 1R24A 4JB9H 1KMGA 3GBEA 2C3GA 1N4XL 3O4OB 3FT1A 4PI2A 4UOW0 1AQMA 5B1BB 1D6VL 2G2RB 4E9XA 2F8VA 1RHHB 2QV2A 3DHJA 2CR3A 3AITA 1PLBA 3QUZD 3HRZC 3QDMB 4U1HA 4H88L 5EBLA 4IJTA 2JMRA 3V4VA 2B9AA 2X4NB 3FB6A 3BP5B 1WEJL 1S5IH 4IGBD 4F20A 4ZFFA 1XGTB 1WP6A 4XZUA 1DQQB 3SE9L 5DUPH 2CPUA 1GC1L 5HHOA 3C60B 1HXMB 3WTXA 4QHMA 1AD9A 2JQAA 1NFDB 1J1PL 2JI2A 4FQ1H 5F7UA 1V7NH 1IILE 5I0DA 3BZEB 1QMUA 3BH4A 4QRPA 2IMMA 5LAXA 4XMLL 1N12A 2PPAA 2R29A 1K8DB 3DGGB 4B9PA 1JYXA 3D9AL 3LTVA 1CFBA 1OTTC 1A8JH 3TESA 2OPCA 1N18A 3NAAH 2PO6D 3O2WH 2Q3ZA 3GK8L 1KC5H 2DIJA 1M9SA 2ZWKA 1S78C 3FQTB 3HJEA 1XR9B 2HFGL 2YGVA 2WBWB 1KB5H 1VACA 2V3DA 4HMCA 2NY5C 2R83A 4O51B 5AW2B 2ZF8A 2CHWA 4XBGA 1A4JA 5I0WA 3T2NL 5ESAA 2QPEB 3S5LB 3KM2A 5T1LA 2MQ0A 4RRPM 3THMH 4YDLB 3UOAB 1QVOA 1ERNA 3QXUA 1ZT1A 1RFDH 3GS4A 4UQ9A 1MF2L 4JPQA 2D3VA 5GGTA 3S48A 3F58L 2PW2A 2V9QA 3ZDYB 1IO4C 5F3FA 2HVKA 3CFQA 2A99A 4NPYB 2IV8A 2XUWA 5JA8B 4XMLH 4E41D 4Z76B 1QBLH 3O9WA 5JYLA 2VQTA 3QXDB 2A6JB 2LHAA 4QRSB 5CEZL 2ARJA 4OF6A 1KTJA 3PWJB 3UAJD 3DLQR 4D8PA 4DEUA 4CJ0A 1T5KA 4OGQC 1EZVX 3C9NA 5AUMA 4N9GB 3TBVB 5IB1B 3O3BB 4XNAA 4QHUB 3BAWA 2XFXA 2EE9A 1QFWM 4UTBA 4ZG1A 5ABDE 3FYEB 3FTUA 3SBWA 4K7PH 1KLFB 2Y07H 4GP5B 4JFOA 5SX5H 3LRHA 2QT6A 3LKRB 4WI0A 2OL3B 2YSSB 3IWUA 4HS3B 5D8JL 2B77A 5EN2A 2OMUB 1XGQA 4MD5B 4M00A 1CDIA 1A4BA 4IBYA 2B1HL 1NLBL 1L5GA 2F7QA 4K7PL 1U8MB 1H6FA 5I76B 4OLYL 2DEYX 3BKCH 4QY8B 1T0PB 1BXAA 2NUTB 2QQQA 5ITFB 3KLKA 4LCWD 3MLZH 4HBQA 2VDLH 4LLVA 5FLVA 3T1WA 3SE8L 2QEJA 4M48L 1ED3A 4LLMA 1LO2H 1K4CA 1YEWA 5D7LA 1CVSC 2PTUA 2NYYC 1XGZA 2GW5A 1QBAA 4OCRL 1FG2A 4ZTOH 5BZWB 1DEDA 2AQPA 1G7PA 1KN2L 2X4QB 2VQ1B 3GSRA 2IQAB 5DF0A 3TO4C 5EF1A 1U3HB 4L3AA 1N64L 2ILLA 2ZOKB 1OD9A 5GRYA 4MA7L 1D5XB 4UANA 1U42A 3IDMA 2LFEA 2WZ5A 2AFNA 3LQAH 4MNQD 4GP8B 4ZUVB 3W1ZA 4BFJA 3HBQA 2YSSA 4HS3A 3WFZA 3VWJD 4NKIH 4LSQL 4Y7OC 5HGHA 1R3JB 2C3VA 4I77L 1J5DA 1U8KB 1DQMH 4M61A 4Y19A 2C9AA 1HN1A 5IW6A 4QKTA 5MEND 4OY9A 4AQZA 2CXGA 1OP5H 2A9NL 3ECBB 4JG5A 3W9DA 1TQUA 4MWFB 4WEEA 5SWZB 4JJHA 3IAPA 3EJPA 1M6OA 1G7JB 3P77A 3S3JA 4DJMA 3LNIA 2R2BB 4UNTA 1D9KD 4AQ1B 4IBUA 3HBPA 4BQ9A 4LEXH 5AW1B 4KHXH 1HNYA 2VITA 2Y7QA 2HT2C 4L37B 4HIJA 1FNHA 5ALBH 3N1GC 4H1LH 5D6CB 1UKQA 2BS8A 1AO7B 2MJWA 3E7JA 2ZUVA 5C08B 3NIGB 25C8H 4BSWA 3AABA 4WIQA 4GBXA 5DURD 3U25A 5L8JB 3F7KA 3WS3B 3FF7A 4EI0A 3J2PA 1U8QB 1RK0A 4PJHA 3SQOL 4FADA 2BVQA 1IT9H 4XN2A 1A6TA 4HV8B 2DQDH 2CBQA 3JYBA 1LK2B 4P5KA 3QJRB 2X6VA 2BDNL 1A2YB 2H3NB 3EO0A 2TRHA 3VFRB 3RFZA 3MCLL 1M1SA 4GQ9H 5LO7A 4HGMA 5F3BB 4K3EL 2PN5A 2QL1A 3BEVA 3EYQC 3WAJA 2LT9A 4YHKH 2CMRL 4Y88A 3MV7A 5E08H 4JFUA 3UGEA 2YPKA 3T0AA 1MFBH 3V0EA 1C16B 3QORB 3US1A 1AZVA 2GCYA 4KHXL 5D2NA 1CICA 3WXWL 4M6OH 2FIRT 1QEWA 2AQRA 4PBVC 4NI3A 4TN9A 4G1MA 3UPAA 4KKRA 3F05A 1RZIA 3CVHL 3RJDA 5D93B 4Z7OB 4OIAA 2E3VA 4JQXA 1N5AA 2GIXA 4MNQA 2CO1A 4JREC 2Z91B 4BFRA 4LEEA 2R0LH 2E4FA 1TR7A 2AJ3A 1RD6A 1B0WA 2E6JA 2BSRB 2WWMC 4UQ3A 5D7JC 3RPIA 4N5UA 3U79A 3FT2A 2E74C 4FQJH 5FCUH 3LS4H 3IFNL 1K4DB 1LP9F 5IEKA 2Q0ZX 2VTFA 4NQCA 1DVFB 3VFTA 2BWQA 3BEVB 1IC5L 4AKPA 1YNKL 3FAXA 1JERA 1NCAH 3L5XH 5KYXB 2WMPB 3LQZA 1NFDF 1P9MA 3RL2B 3ZSSA 5FCUL 1VZGA 1TITA 4DP2X 1JDDA 3B5HA 3MCG1 4KDTA 1FN4B 5FGBC 1V7ML 5A40E 4MJID 1ADQA 1EO7A 5C0CE 1QRND 2Y2WA 1N67A 5HVGB 3AQZA 4PGCA 3CFNA 4BFOA 4OF7A 1E5BA 3UCQA 5JPNB 4N8PA 3RY6C 1NGWA 2R0KL 3EYOA 4LVNC 2A1WH 3RVWD 3V52L 1CDBA 1U41A 4W4OC 1Z9NA 2ZKXA 2Z0BA 1JNHA 1YC8A 1J5OL 3FQRB 4H25B 3FUFA 1LEKB 3RUGA 2XVLA 5E03A 3SYQA 5C07B 3D0VB 5HPMA 3QYNA 3A4FA 5KBDA 2BNQA 4ZW7A 3QI9D 3VO0A 4FERA 4FEMA 2WLZA 5DJ8B 5L88L 1F1GA 4PLKD 3QQ9C 5DVMA 3IMVA 5KYNA 4TS6A 1IFGA 5IKCA 3UBFA 2COVD 4Y2DD 4PRID 2Y7QB 4L37A 5GZNA 1WBZB 2IWGA 2R2CA 2RCSH 4IGBC 1L9QA 2YMTA 1S7UA 5I23A 1I1AC 4XB8A 2R2BA 4G6KL 5D5MF 2PXYB 3VU1A 2WCSA 5C0GA 1OAUL 1YA5A 2BWIA 3TN0A 2DPKA 2B1OA 4FKEA 2WQSA 4RMTA 2GUYA 2LU3A 5BZZA 4H8VA 5ADOL 1CF1A 1NIEA 3OJDB 1S3RA 4L0YA 4KV5E 5DRXB 2AMGA 3GXPA 4MX7A 1PD6A 3TA4D 2YQ2A 2CO4A 2BK8A 4XO4A 2OMYB 1KEML 4V1DB 1NDGB 5CU9A 4OT1L 2NYYD 2O6FA 1R24B 1ZXQA 3OKOB 3VGGA 2E6PA 4PS7A 3DX9B 5HD8D 2CRYA 4FFTA 2CDFB 1T04A 3T04D 3TA3B 5A7BA 2XZAL 4U1NB 1SY6A 5KYUB 1YEJH 1B3IA 4F7EB 1HYSC 4R4FL 5F6HJ 3GF8A 3QEQB 3DHUA 1L6ZA 4WWKD 2JI3A 2VNCA 4N20A 1EAJA 1LP9E 2GIMA 4A39A 1CLZH 4MYPA 4CSZA 1ZOXA 1MWAH 5H35A 5LJYH 2Z31D 1AS6A 3ELQA 2OTWA 5HJDA 4JFQB 3E8UH 2HVBA 3V4LA 2HTLD 1CXHA 3PABA 3DPBA 1X5ZA 4ZMLA 3CZLA 3UBGA 1NEPA 5E6SB 5K69A 4JPWL 4L4VE 5C0DB 2YRBA 3APNA 3L7EB 1F6FB 4TLKA 5IKCB 3OKDA 4P2RD 2FD6H 2E8YA 4ZYKA 5LWYH 3H0TA 3CQQA 1CD0A 4CBZA 2Q7NA 2O93L 4BFEA 4PVLA 5HYIA 1ZLEA 4AQ8A 3RKDD 5GGUA 2AABL 4EZLA 1BAWA 4P46B 2Z93A 4R5XA 4GG6A 4OLWL 3PE9A 2FHCA 1ZHNA 5HI3C 2Z0UA 3QDJA 4DZ8A 4KO6A 2GTWA 4X5LA 3T0EE 7PCYA 2EXWC 2BXZA 5F9WC 4NPYA 3WSQH 1EFXD 3OG6B 3WJJA 4DO6A 1F2XK 4YE0A 4QI3A 3PAVA 4PWHA 2J8UA 4TLTA 3N1QC 3IT8D 4X8XA 1BP3B 1YYML 1YNTF 5AB0A 4AIZB 3FRUA 4MXQD 1H3XA 4WY7H 1SDAB 3MUHL 5TPWH 2VDOB 1UZ8A 4NQSA 1MCOL 5JHDE 4IRZH 2BY0A 4K2UH 2H32H 3BN3B 4FP8H 5EO1B 1FNSL 3O3AA 5DFVD 1YQVH 5FGBA 2NNAA 4CSSA 2Y7OA 4L3EB 1KCUH 5GGRB 5GJTL 1QO3B 3B5TA 1MAJA 1GHFH 4XMWA 3HLAA 3U0PB 4AMXA 3QUZA 3IGAA 3Q2NA 4PJAA 3QQ3A 3ERXA 4MCZB 2ZPKL 1U8HA 1AD9B 1OLLA 5KVDH 3MLRL 1AGFA 2ZXEB 3QULA 4MRBA 4N2NA 4QTFA 3EOAB 4G8EB 3VRIA 5BJTB 2VRAA 4LMQE 3V8CA 4X8JB 5F7MC 5L8LB 1MFEL 3TLRA 1L6PA 2G30A 4JRXB 2X6UA 4R4BA 1BOGB 1XGYL 1AE6H 1T0OA 2BP0B 3FRPG 3OR6B 3LEXB 4M5SA 5EPMB 3BSHA 3QZNA 3MA7A 1LILA 1N70A 2DH2A 1KCSH 3L9BA 1ULVA 1F11A 2C9RA 4O2FA 5E8NA 4M7ZB 4KKQA 3Q6FA 3CFDA 5K33A 1NEZA 2HPOA 2F53A 3L7FB 1EZUA 1AGDB 1SHWA 4HHGA 5AW5B 4LKCA 2Y23A 4LU5H 2RQ8A 4C58B 2XTSA 2V5RA 3EJSA 5K39A 1ETA1 3ARVA 2B5IC 4NQED 3P0YH 4GI9A 1OE1A 3OD3A 1NBZB 3WD5L 1E4KC 1AKPA 1CFVL 1GGBL 4KKNA 2GTZB 1E7VA 4FL4B 1D6EB 3RGVA 1DO6A 4MD0A 2B7DT 2HWZH 3F5WB 1KBWA 4GYBA 3PU7A 5FLUA 2Z7WA 5DD3H 2DI7A 5B39G 5EG6C 2YD3A 4AQ1A 4MS8C 3V79C 1T5XB 5E9DE 1XZWA 4XP9L 2FHFA 2ZYRA 5FGSA 1N0LA 2R56L 1UA3A 3HTLX 2F1BA 2J20A 3ALPA 4YQXL 4P5TD 3X1FA 2P80A 5J0BA 4P48A 3GBML 2QKSA 3CH1A 4NRYA 3J7HA 1D5IH 4ADGA 1MPAL 1BD2D 3CFCL 1H0DB 3E0GA 4ZX4A 2KZBA 4KTDL 4L1HA 4YXHL 3RL1A 4L8CA 1J1XL 4OZ4B 4AQOA 1QNZL 4XMXA 3W38A 4OCWL 1KPVA 2VSCA 1YEHL 4P2RB 2EDXA 1SHSA 4L8DA 1N59B 1WZMA 2D3NA 1EEYA 4XPAL 5DHYB 1JXDA 1YG9A 4OLZL 2EDMA 4K2UL 4Z7WA 1WTLA 4OCXH 3ATFA 1M53A 1GTNA 3DUUA 2DQHL 2QGEA 5IHWA 5ADPL 5CGTA 2D0FA 4XNBA 3QDGD 4N90E 4LCWB 1SF3A 4PRDB 4PRAB 4PJGA 1AMYA 1ZY9A 2AXWA 3Q44A 3B9EA 1TVBA 4ATWA 2F54D 1ED3B 4LLMB 1WUZA 5J6GB 5E1HB 2VDLL 3MGAA 1HAWA 1ZLSL 2ZIDA 2DLIA 4FFWD 1MHEB 1FVDA 1ZK5A 4P23B 3QJFB 3QEUA 5A2AA 3ZT7A 5D1XB 4AIOA 3HS8A 5IWLA 5C7XH 2K6ZA 4RMWA 4PHXA 3QZOA 5L2KD 3O81A 3VI4A 1AR1D 3TFKD 3AG3B 5D9SA 4E0RA 4HWUA 3ZTJH 3OX8A 3SJVE 3VWJB 5BJTA 4PSPA 5DJ0B 3HHMA 5I8CB 2IMNA 4PJ5D 2XTJE 4B9FA 2LE9A 3LZQA 4M1CD 4Z7WB 2FLBT 2MH4A 2WHVA 1A7PL 1EEUA 2XVBA 1BOGA 2WOYA 4LLQA 4J3OG 5J6HA 3FCSB 3ULUL 1V10A 2WYTA 2OL3H 3W11D 1X5KA 1F4AA 5FYLD 1ZVSB 2YD4A 1M71B 4YXKL 4PCYA 1UKTA 1X5HA 2LV4A 4EF3A 2MCG1 2OMWB 2CA4A 3L3HB 1CS6A 5ADPH 4PPTA 4Y1SA 3KLHC 2QKIB 2QVMA 5A3ID 4Q9CA 1BX2A 1WYJA 5CGYD 4WHCA 4ZXBC 3V4VL 4KVNH 2Q10A 2Y0SA 1P5VB 5G4NA 4RGMB 1N6UA 4QOKB 5K5YA 4PD4K 1A6AB 1K9TA 3SGEH 3SZKC 5I1HH 5LBSL 5HI3D 1U8IB 2ENPA 3WKYA 3M6DA 3S3PA 1DBAL 2DQTL 4K23H 3BWSA 4PJCA 3HVNA 2DRUA 4YWGL 5T1DH 3PGDB 2BSDA 3NPSC 5SX4H 4AXWB 3QC5X 1H3VA 3EBIA 1RQ5A 4JEGB 3V5KA 1RULL 4U49A 4E5XA 3BIBX 2Z8WC 2FQDA 5ETUB 3VGAB 3SYPA 3WENA 2YIHA 4ANWA 2Y7LA 3KGRA 3HI6H 3DVNB 3MLWH 1HCFX 4UNUA 3JUZA 1A21A 4K8RD 3JWNG 1BQHB 2CGYA 4AQAA 1MRFH 3WFHB 5CLWA 2WGNB 1M05B 1ILSA 1H8LA 1NMAH 2GI7A 1BSIA 3F65A 4OJFL 1QZ1A 1IBGL 2IPTL 4IOSD 4EPSA 4Z3TA 2ZUYA 3ILPA 3TPUB 3FRPA 4QHLA 5KSAB 1N8OE 3GRBA 5C0IA 4UIKL 4NXSA 3AXLB 2OQJA 1SOXA 3DGGA 4ZO9A 1WEJH 2VERN 1QQDA 1FNFA 1JZ2A 3FQXA 1ANUA 3G5XA 4HJUA 2L3BA 3DRTB 4PJEA 4UQ3B 4R4ND 2VUOA 1B0RA 2WK2A 2C9VA 5I6MA 5M7QA 4YPGA 3BDYH 2XV2A 5K1VA 2W9DH 3HMWL 4ZAKC 4X6EB 5ADOH 3FONA 1YJDC 4XP1H 1HESA 3LXAA 2AEQL 3BT2H 1Q0YL 5SWZD 3BPLC 3V6OE 5IOKA 4WHDA 2VDMB 4LEXL 3BPLB 4K94L 1WCQA 1MRFL 4XVUC 5EZLB 2WBJB 5HHOE 2VXSL 3T09A 1J7VR 1UXSA 4AEHH 1JNLH 2B59B 4Q4EA 2JJSC 4MJ4A 5EULV 4O2EB 4G80A 2ATPA 1EFQA 1IVTA 1BZ8A 4EXPX 4P23A 1OWRM 5MI0B 2JKJA 4PY8J 2CDGA 5DHVB 3ZKSD 5GGSB 4BQCA 5HTSA 1LQBC 2VW4A 5MP6H 3ARGD 4Z77A 3SKNA 4NKIL 3UPCA 3DMMA 4U1MA 4TLSA 2LLNA 5KVEE 1GGYA 3KD4A 1YY9D 4HG4J 3NIDB 2F15A 2NW3A 2H2SD 5EWIL 3FHQA 4ZX5A 1IBHA 1Z3RA 1CFTA 4NZRH 1HHIB 3MRIB 4E42B 2BHFA 4PLKC 4APXA 1WWCA 3UTTB 2KL6A 5FFLA 5IVXB 1RPQA 5EZJB 1JGLL 4UV4L 4P9MH 2QSVA 2OMTA 2OXHA 3QG6A 5DZNA 1WCBB 3SPCA 3GJEA 3MMEB 4N2CA 2OSLA 2NNRA 3ZL4H 1QW9A 3L5HA 1SYSB 1UM4H 2OQJB 3DUSA 3D4YA 2GCYB 3RVWC 1BDYA 2AJXH 3FOLA 2K3HA 3UJTH 4H1LA 3VMPA 5DD0L 5D7LB 3B2VL 2ZKHH 2XFGB 3DYMA 1KCRH 3TC9A 3V7AG 3HUJF 5LXGL 1HWGB 3BN9D 3MJ6A 2M8XA 3EYSH 5F7LB 2ZCLL 1I9IL 1BLIA 1BVKB 1A7NH 3PP4L 4DK5A 3DVNA 2L7EA 3MLTA 3SGEI 1CR9L 5C08E 4OF0A 4NJ9H 3L5JA 1U8PB 2E5EA 3BMVA 1BMZA 4RCAA 1UXMA 4NOFA 2CO7A 3FT3B 3O11B 4HZLA 2ICEA 3RX5A 2XQBH 4G11A 4A38A 3AS0A 5T3XL 3OHXC 2P8LB 4IRJC 4U3HA 3CSYB 1DLHA 4LHUD 1MCPH 1P6FA 4M7LL 4X5QA 2EIZB 2Q7AA 1QWNA 3RI5K 5JIDA 4C47A 3DWTA 4HK0B 4UB0L 5EA0L 4XBMA 3FO0L 3CLFH 1T20A 2WNXA 1EWHA 1QBLL 2J4WL 3GLDA 4H4NA 2WBXA 3DX6B 3HUJA 1CLZL 2P24B 3P3YA 1T03L 3BPOC 4KKAC 4HHAA 2VE6A 5LBVA 4I18B 5HPOA 3KWUA 2HTLC 3RWDB 3R06B 1I8LC 4Y4KA 1IGTB 1MUJB 4YBLC 2J44A 1F6AA 4Y89A 2JELL 1GSMA 3ARZA 1RURH 2ITEA 3BAYA 3N1FC 4AM0B 5ABZA 4AVIA 1OAJA 2D9QB 5GJSH 1DQKA 3IU4H 2R0ZL 2A9NH 4JFHE 4G1MB 3QUYA 2BXYA 1AZUA 3QUXA 3B7YA 3UBXB 1EBAA 1U93A 3EYQD 2CCLA 1I7TB 5LGHH 2R9HD 1ZSDB 4FQLL 2ZAHA 4JKWA 1BVLA 2Z92B 1I1YA 1MREH 1GGIL 3OMIB 4UU9A 1BFSA 2WLYA 5ESVB 5EEVA 4ANVA 3SDXF 4LL4A 3D12B 3SQRA 4H2AA 3QCVL 1N7MH 3V0VA 1MCIA 1BOYA 1D5BA 2XWJB 4P3CL 3ILQC 5K9OA 3CHOA 4KFMA 1IFRA 1E3ZA 1A3ZA 4M7LH 2OP4L 4X5WA 2X1QA 5EUOE 4AIZA 4QNPE 4KC3B 3O9WD 4CVZB 1IAOA 3HAEH 5I73B 3V5KB 3MV8E 2FYYB 5JHLA 3MV9B 4YL4A 4G5ZH 4PWIA 2BVYA 3CDGB 3T2LA 5FGCB 1BJMA 3BQUB 1A0QL 2F9BT 4NT6A 3VAEA 4HIJB 4NWTH 3TT3H 1R19A 3SOBL 2V2TA 3OJMB 4DUVA 3OC8A 4KKCC 1BPLB 1GAFH 2R69H 3GKWH 4P4KC 5HHQA 3KPOA 2DIEA 4FL4C 4C57C 1MY7A 2I5YL 2W0LA 3DUSB 3LQMA 2JJUA 1YMMB 3EFOB 4F7TA 1WCBA 3QQ9D 4OQTH 2D2CC 2HXAA 3MRRA 3V52H 3WNKA 4I0PA 3HS0B 4CADA 4MCNA 4P9HL 1ZMYA 3GSUA 1FYTA 3AVEA 4FXGB 5F96L 4HKBB 4DCQA 2LGNA 2VZ1A 4ODTL 4GKNA 4JPVL 3RVVC 2AEPL 3FHEA 4QTHA 4XODA 1DEEB 5AALA 2XQYK 1CLYH 1J8HE 3BUPA 1X9UA 3GJFK 3IU3A 3O6MH 3REVB 1WIUA 3NFSL 1A4KA 3TV3L 3E8VA 3T4YA 3L1GA 4HKXB 1MRCL 3A22A 5E9NA 3UJJH 3UEZA 4GRWB 3UO8B 3ABKB 1GZPB 3K74B 5FOBA 3VI4B 4H8WL 3NFSH 2YPLD 5MHSD 2FQGA 3H54A 2WAHA 5HDOA 4OLUL 5JO5A 3WKML 4AG4H 4H44C 1BJ8A 1ZS8B 2F5AL 2VLMD 3IGLA 2WC7A 4LSSL 1IZKA 1F2QA 2EDFA 4UDUA 3HCVA 3LXUX 5IY5B 4NFBA 3OSVA 4IMLA 2V2WB 4QO1B 1IM3D 1J8HA 2QKIA 1INQA 2WBJC 2CJTA 3DV6A 5I76A 3X3GL 1SMOA 1H3GA 1R5WA 1IC7L 5LNEA 3RUGF 4HOXA 5DMGD 3OKMA 5BCAA 5E6RB 5LWYL 3QDGE 4N90D 2NY6C 1OAQL 1U8CB 4I9WE 4XVSL 2EDEA 4YBQD 3TFBA 5JYMA 4QNPF 3OHXB 4XP4L 3SPGA 2FQEA 3U6RB 4JHWL 4Z23A 3IFLH 3F7LA 3R8QA 2CGZA 3ESPA 3HMXL 4DPRA 1ZA6A 1M6OB 4G5ZL 2ZWLT 5ACLA 4MJ5B 3NN8A 5DC0A 3DX4A 4HPOH 4DQOH 1BZEA 4NP9A 3VNZA 5TH2B 3LRKA 3LKPB 4PRPA 2G9HB 4IDLA 4LMQI 4JN1L 1PBYA 1XT5A 1ZLUK 1QFWH 4XH2B 5ENWB 1UYWL 4PJGE 4DEPB 2NT0A 5JOFB 3VVVA 2G60L 4NCC2 3CXFA 4IS6B 4X6CF 4QXUL 1MCEA 3SY0B 3T0ED 3FU5A 4HZLB 1T1YA 1XIWB 4QRUB 5T3ZE 1NCWH 4IW4C 3U82B 1MCWM 3IRCA 1FORL 5EBMA 3VD1A 3X14A 4QXWA 4WFGD 4MGXA 2VZOA 5FM5M 1HE7A 3P2DA 4MKTA 4F5CA 5EO0B 4A66A 4K73A 1OGAB 2M83A 2WTRA 5D2LF 1GYAA 3PDGA 4RIRB 3Q6FB 5F0MB 1SM3H 5C3TA 1UURA 3LKNB 5KUMA 4DK6A 4MBOA 1ZPLA 3HNSH 4WUUB 4R7VA 1P2CA 2L8AA 5B22A 4ORGB 3S5ZA 3U1SL 1FCCA 2EABA 1JFQH 3FKUS 2WZ6A 3KR3L 4RGND 5CCKH 1EDQA 4FQHB 1Y18A 2BZ7A 1BVZA 4MSWB 1BXVA 4XPGL 4IBSA 3CHXA 2BP3A 3TNNB 4E9LA 3BH8B 3CZSA 4Q7DA 2E27L 4S1QL 1SJMA 2OMWA 3EUDA 1FI8C 5KSBF 2X2JA 3ZE2B 4LOVA 5SWQA 4GUPA 3N0AA 3EYVA 3GXNA 4P4KB 1CYWA 1RUPH 3V9EA 2NW2A 2AJZA 5D2NB 1OPOA 4YIQB 4FA6A 2KH2B 3B3IA 3CG8A 4KROB 5E9AA 4QTIL 1KF9B 1TFPA 4CRPA 5L2KA 4JBSA 1PYWA 3UH8A 1RJYA 1WJ3A 3FU0A 1RUPL 4NQSB 4QMEA 4HIHB 3T2QA 5I0ZA 1NCGA 3QEHB 4HKJA 4Q2ZA 3IS1X 3FB7B 4ZTPH 4DO5A 4JY4A 4V1DD 1GPOH 4GMTH 2I9TB 4LSUL 4Q9RH 2H9GB 3RE0A 4AYSA 3ZDYE 3L4VA 3FFDA 4HC1H 3CFDB 3RWHB 2IBBA 3WIAA 3H6AA 2BCKA 3DXAB 4AYMC 1HHJB 2DWEA 1M7DA 2E27H 2AW2A 4S1QH 3VXSB 5JHMA 3FCTB 4QRUA 3DV4B 1JV5B 3W39B 3OKOA 3ZDXE 5L0QC 3UPRB 2JVUA 5EEZA 2IADA 3AWFA 1DCEA 1TT6A 3KXFB 4N2EA 4OJAA 1NC2B 4LSRL 4TSBL 3TNMB 4HIXL 2OMUA 4RWYL 4DKFL 1FRGL 2FH6A 3UTQB 5FIEA 3K81A 2XIDA 5B1JC 5TK2A 3ULVD 4WUUD 2H8PA 3BUQA 4XWOD 3NFNB 1J1XH 1IIKA 1B0RB 4EQ2A 1CLVA 3L3KA 4E68A 2EDTA 3FQXB 3G5XB 2J56A 4JM2F 3FU6A 1OAZH 1U3JA 2EDBA 1XF5A 3PHSA 3ZIYA 4X42A 5KVDE 1MFCL 3GSNB 4APQC 1FLTX 4R7XA 4CVWA 5EF2A 3GMPA 3BVDB 1NCJA 3DPBB 2YA2A 3EOTH 4KQ3L 5EIVA 5B1KA 1SFHA 4JQIL 4L0ZA 4AL8L 3WG7B 5HPMB 4HISA 3DV4A 3GC3A 5AOZA 3WMPA 1UJ3C 3X2QB 2GITB 5CIPA 5EU4A 1CI3M 1KDJA 1ND0A 2DQGH 4EN3C 1X5XA 1BQUA 4HEME 2BFVL 2KLSA 4EN3B 5FO8A 3FC8A 3D8MA 4JFYA 3NABH 2A6IA 4B0MB 2Z7ZA 3Q05A 1TZ8A 4ZFQA 4Z78B 1OTTD 2DKSA 4LLDA 2XN9E 1N3NB 3H3PL 3MLVL 3I84A 3FK3A 3VXPB 5DZPA 1DQLH 4BCZA 5DUPL 2D0HA 1OGAA 1YSOA 2WTRB 3W0WD 3HBGA 3M7OA 1QLRA 1OSEA 3HFFA 3PWPA 3NQIA 1HHGB 4OZFA 4TNVK 3BRFA 5AZ2L 1EFXA 1RUMH 2LTQB 2MOGA 3MLVH 3Q8EA 1JVOA 2R7EB 4WTZG 4Z9KB 1T5WB 4H0IA 1PZ5B 3NACH 5D1XE 1ONQA 5FAAA 4BH8A 2PP8A 1MNUH 2G5BA 4J8RA 1M42A 2EDKA 2EE6A 1NEZB 2DQEL 3GS0A 4TVSa 1A7OH 1N10A 4TUJB 1A66A 3BVVA 3SJVA 2GC4C 4UU9B 4WCYH 2BSBA 3TNNA 3G9VA 2R27A 2ZF9A 4U6HA 5ITBL 1AZZC 2IANB 4JCWA 5E00A 5ES4B 3DX8B 3HZMA 4LLYA 5HVFB 3O4LB 5HYQB 2QFPA 4Y16A 1IAMA 1MHCA 4LQ1A 1L7IL 4HDIB 2IGFH 1MFAH 3X1EA 3EXJA 1EV2E 4JVUA 4F57H 3T4AC 3S4SB 4DESA 2B2XH 2G0KA 5DRNA 4HJ0D 1GXEA 1X5AA 1ZT4A 4XRCB 5EORL 1I3RB 4JRYB 3WIHA 5EOTB 2X87A 4J4PC 3BOVA 3II2A 4PRIE 3QEQE 4P2OC 2AQ1A 2XY2A 2EDHA 4RRPG 5D1XA 4ZJ9A 2CO7B 1JOIA 3FT3A 3MUZ1 1Q72H 5C6WH 4HXAH 3RY4A 4U1KA 3C8KA 2X3AA 1QW8A 1U8PA 3HE7C 4K4KA 4RZCA 1E67A 2UZIL 4Y19E 3IKCB 1VB9A 2IH8A 2YGNA 4KTYA 4QXGL 2M1KA 3HG0A 3CSBA 1PVHA 3MR9B 4R4NC 4NENB 4YDKH 3ES6A 7PAZA 3HFML 1EAOA 4QXTB 4NQEB 3B7TA 1Q94A 3IKKA 1PQZB 4PRNA 1I85A 2BOLA 3DBXA 1Q0XL 5HDBB 4ACTA 1W6WA 2UV3A 5I1DB 3BVTA 1PX3A 3OMAB 4IDJH 4BZ1H 4JRYA 4XBPA 2C9XA 4GBXD 2QMKA 4KMTL 1FBIL 1HWWA 1GIGH 1PFCA 2B08A 2VR7A 4FNLL 3VQLA 1XO8A 3TBSA 2X38A 5HGHB 1WSST 3RWGA 3UG3A 1J0JA 4P49A 3UBXA 4AGNA 1KXVC 1S7QA 1KG0B 3TBWB 2GJ6B 4Y7MA 1O9VA 2W0FA 5AFAA 3K72B 3O41A 3SHSA 2C26A 4JFEE 4UQDA 3V9FA 1FZKA 1YECH 2Y22A 1BEYH 4TL4A 1TTGA 3FZUC 3ZSTA 1XF3A 4XBEH 4PJFB 5DT1H 4APXB 1DN2A 2L7JA 1DUYA 2A6DB 3L3GA 4OZHB 1H0DA 4C54A 2Y7NA 5EUOA 1XEDA 1ZS8A 2DQHH 5GGRA 3B1UA 4DP1X 3VD5A 3GO1H 2EDOA 1IGJB 2GQHA 2XX0A 4A7VA 2OI9C 4I9WD 5K39B 2Q5BA 5C0BD 3WHE1 1I7RA 3RNKB 2ED9A 4RFNB 5IVXE 3UTTE 2XBTA 2EP6A 4GIPD 2OJEB 5A6MA 4KKBD 1PY9A 5AG8A 3SKMB 3ULSB 3OZ9H 4BKLB 1XFPA 1N9PA 1K6QL 3I50H 2CJUH 3WFEL 4Q6KA 3A6BH 4X4KA 3NIDE 2F7RA 3QCTL 3TP4A 3HBZA 1Q1PA 1H6UA 2BOBB 1FCGA 2ADJA 2WKOF 3F64A 5DZOA 1WFMA 1BQRA 4WJG3 3HHRB 1ZIAA 1E2VA 2CK0L 2NNCA 4NRXB 4OR1A 2NTFA 4KJYA 4MMYB 2RB8A 2E9IA 3PFQA 1AR1C 2KHAA 3TFKC 3AY2A 2AQ3A 4JFOB 1OD7A 4LKCB 2XICA 4OKDA 3L3GB 4CADB 1L3WA 1TJGH 4XAKD 1K5NA 2W65A 5FUZH 3FNKA 1E6OL 1VAHA 4R26H 1BFOA 1MZZA 3PV6A 4EDXB 5HGAB 3KWTA 1T7ZA 4ONFL 3TBYB 5JXAH 1QSFE 5F6IC 2HSIA 4IKNA 2C3HA 4CAGA 1LWJA 5BXFA 2DBJA 4CU8A 2O72A 1CTMA 3MDJA 4OCNC 2VOTA 4Y1AD 4UMSA 4Y1AE 4R26L 1XCQA 3STLB 5IB5A 1FV1A 4NC0B 5E6IC 5GS0L 5DRZA 2OSWA 4YDJB 3UC0L 1CXEA 4GFTB 4MCZA 5KEZA 2CO6A 1DUZB 2EUZA 5DMIH 2OTWB 2FX7L 5TQ0H 1VKXB 4L8SA 3EJRA 2K8QA 1AD0A 1QHOA 3S37X 3A4AA 4PIBA 3T0VA 4B9IA 1NMCC 3MJ8B 2AJXL 1C1EH 2RJMA 5L9DH 1UM5H 4J3BA 3W81A 1BM7A 5IJVB 3KLAB 3MV9D 1UH3A 4WGKA 4P2QE 1UB6B 1JWUA 2EH8L 1UUNA 4PJEF 4ZTEA 2C1OB 2WVSA 4NO5B 3JYCA 1QBBA 1RIHH 4IHOA 5I1DA 3ECUA 4UBDD 2HN7B 4YSAA 4TF4A 4NO2A 1QLEB 1H15B 1KXQE 2NQCA 1MAMH 3V4UH 1NAMA 3WN5A 3K6SA 4XNXL 3V5DB 2DL9A 5E4AA 2DF3A 2FJHA 4BWUA 2RAMA 2FEEI 2UZXB 2FX9L 5I1GL 5MEQA 3K1DA 5D72L 4LPCA 3PHOA 5L4JA 2GJZB 4L3FA 3U2SB 4UZUA 3STBA 1Y1UA 3MNDA 3PJSA 3N44B 4OZFH 3NDZE 1I9EA 4AENB 1AHWB 2CGRL 3US9A 3PHAA 3KVQA 5TDOA 5AZEL 4ZMPA 1A6WL 1Q9LB 3KPMB 1R3LB 5IQ9B 4E9YA 1BVNP 4N2AA 1MWAB 1XTLA 5TF1L 2DJUA 2NQ3A 5D2LB 1TIUA 4Y2LA 1OTSD 3RTLA 1CDHA 2ZUTA 3P3SA 5CUSH 3D5OF 3TM6A 5I6OA 2OR7A 2VLJD 5CWSA 3QXDA 3ZHLA 3BVNB 3FU7A 2DMGA 1DE4B 2JJWA 5T5FL 1RIUL 4GUCA 1KCRL 4ZMVA 4IKIA 5I30L 3QUMA 3MTRA 4F2ME 1EHLH 4MAYA 1TCMA 3I2CH 4TNVF 4WVRA 3QORA 5JW3H 3OPZL 3ARED 3DNKA 2CDFA 1AXSB 2NY1B 4WQOA 4FQCH 4GI8A 3BUBA 7FABL 3S5LA 3MV8A 1KGYE 3PP3K 3U30C 4O4YH 5B1CA 1HU8A 4JO2H 3SGDH 5E2WH 5AW6B 3VXUD 4YFEA 1PLGL 1W72L 3C08H 3MYJA 1H3PH 4J3OF 4PJGB 3MLSL 5KG9A 2OL3A 1S9XA 5T1KA 2LU4A 4G8GA 1J86A 2NUPB 5E99L 1BQ5A 3GZKA 2VLLA 3MZTA 2ZSVB 5J13B 4DWHA 3QPXL 1ID2A 4GBXC 1HX0A 4H8HA 2E9WA 4FQQB 3Q3GA 4FZ8H 4NZFA 1N7ML 3S8WA 2XCMC 3ZDYF 3HG1B 3FQWB 4WENB 5C0FA 1WO2A 1BMWA 3O6KH 1JK8A 4L8SC 2A0LD 3PNWB 2PCPA 1JD7A 3GWJA 3HUJE 2ZYSA 2JCCF 3LYRA 5JMRA 2FYVA 4ODXB 2J55A 2QV4A 2R0ZH 3G04B 1YEJL 3EDDA 4XHJC 3QS2A 5IJKA 4HKZA 5FO7B 3MRDA 3IXAB 1KCLA 2EXWD 4Q6IA 5J6HB 4APQB 2ZOKA 1P7HL 1NSNH 2CAKA 1P7KB 4OFIA 2H2PD 2Y25A 2VLJB 2PXYA 3NMEA 2N0KA 2JIXB 3HAEB 3VA6A 3WKQA 4HJJH 3MSPA 4FFVD 5F7EL 1CFNB 2V2XA 5FYLE 2NLJB 3U36A 4RMUA 3BP4B 4QWWC 4TRPL 5K9KA 5GZNC 1YN7A 4NJAL 1SXSA 5I8EA 3QUHA 3Q3GB 1FC2D 2NY3B 4Q4IA 2FWUA 4F91B 3Q8CA 1SOSA 3N9GL 5T3XH 2QHRH 4IMKA 2F8OA 3GSOB 3WEAA 2H0FA 1RSYA 1P69B 4U31A 4XB7A 2YQBA 5D2NE 4LFHG 5DI8A 1KT2B 2NXZC 3CVDA 3QRGL 3TASA 3D7PA 3TNMA 2VABB 5F7BA 2Q3XA 3O3DA 3QE5A 5AOJA 2EKSA 4A7UA 2ZXWB 4N2OA 1KJ2L 3FT9A 3NFPB 2XWXA 1Z0MA 1BBJB 2ZG3A 2OR9L 2VZ3A 4DHLA 1HXMA 1ZLDA 4LCUA 3AT0A 4HOZA 1EHLL 1UFUA 3VQMA 3QDGA 4DUWA 2FBJH 4GRLD 1QEXA 4WV1C 1KB3A 5DU7A 4FLOA 2EYSA 2O30A 2WYZA 4OLVL 1FZOA 4RVBA 1DE4A 2K9FB 4NQQA 1NKOA 2CJSA 4NQCE 2VR8A 5FKAA 3Q43A 4R7DA 4P5TA 3RWDA 3MRPA 1VFAA 4GRWH 1DVFA 1B2YA 1Q9KA 4PJ5A 4ODWA 2CNZA 2G2PA 4FQ2H 2AI0L 1C16A 1NOAA 4POUB 2FZ3A 2OW6A 3AW5A 2DAVA 5ESQB 3GMRA 4Y9EA 4EN3D 3ES6B 2JJTC 3CDYA 2PETA 4I4WA 5E9DA 4WNQA 3QQ4A 4HIIA 4JFED 3SPVB 3ZO0A 4M7JH 4XGZA 1LK2A 3CUPA 3RVTD 2PTTB 1ZA3A 2FK9A 4MAUH 2R4RH 3RZCB 12E8L 1A7RH 3IRPX 4U6VL 3LVTA 1B9KA 1E8ZA 2P5WE 3MV7B 1JZ4A 1B0IA 3WSQL 1KXTB 2Q76A 4ZW8A 4C56B 3B43A 4OFPA 3SDDD 3FU8A 4M03A 5FO9A 3OKDB 5TE6H 1MHHB 3JQOB 2PP9A 3ABLB 5BOPA 4GP4B 1MVFA 2VSKB 3NSDA 3VXRD 3GUTB 4F33A 4K5PA 4A37A 3O8XB 2VDPH 1P7KA 3ALXA 3H3KA 1NGQH 3KPPA 4CN6A 4G70B 5C6TH 4UOZA 2JKWA 1T7YA 3W37A 2WSPA 2EIKB 1KPVB 1CPUA 5DGQA 3DTXA 2DS4A 2FX8H 3F7YA 4LKXA 3SE9H 3TX4A 2A9ML 1QKZL 2F7OA 2Q8BL 1IUZA 2QZ5A 4WO4A 3HS0A 4WSKA 4Z7OF 2XQ0A 2LU7A 1CICD 3JXAA 1OPGL 1IARB 3FT0A 5KYWB 4ELKB 2FUQA 2EEDA 3MLXH 2BCMA 5HI4C 5C09B 4PJ8B 2YHGA 3CU7A 3I6LE 1KGUA 4LHJB 1AE6L 2ADJB 2DQIL 3QJSB 5EIQA 3V0HA 1HNFA 4UILH 1FAIL 4LIQL 3UZQA 2HJKB 4NKOB 3TCLA 4OCWH 4E41E 2DWDB 3FT4B 2D0GA 3ARQA 1NC4B 3KYAA 1RZJH 1TQSA 4TSCH 4NM4L 3J27A 3BQUA 4NT6B 4NZTL 5HI5D 1PZ3A 3T8MA 4W9IC 3HR6A 5KSBE 1FORH 1ZT1B 4L4TB 4HWEL 1MHPH 4JO3L 4OB5H 3FUDA 4YX2L 4IBWA 3MA9H 2EO9A 3FSAA 4MJ6B 1E5AA 3LXCA 2VJ0A 4OT1H 2QSQA 4G9FD 2DM7A 1FZJB 5F2FA 2XWJA 3LS5L 2FGWL 1T1XA 2VR4A 5E5MA 1QOKA 1UJ3B 5DD3L 1NGXB 5EF3A 1J0IA 2YN3A