2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
4HAKA 1AZBA 4L0PB 2IDFA 2PPFA 3FSWA 1RCYA 4QLWA 3AG1B 3OMAB 3X2QB 1AOZA 1WA1X 3DKHA 4HIPA 4YSPA 3MBWB 4DP5X 2XXFA 1PZBA 4YVUA 3NT0A 3S3DB 1IBYA 3ABMB 2VSKB 4Q89A 5PCYA 4M3HA 3AG2B 1A4AA 3T6WA 1YLBB 1KGYE 1JXGA 3KW7A 2OCCB 4YSUA 4KNTA 3CVDA 4BXSV 2XX1A 4BXVA 1JZEA 2FWLB 2BO0A 3FSAA 4MFHA 4N8UA 1IUZA 1N68A 3FSZA 3L45A 4GXFA 3V9EA 4E9VA 5B1BB 3EH5B 1J9QA 1WS8A 4YSQA 2XV0A 3IBOA 2ZONA 5I5JA 4DP2X 2I85A 1SNRA 4E9XA 3CDZA 2J57A 5B7EA 2QPDB 2EIMB 1PLAA 1J9TA 3CZUB 4HHGA 1FA4A 4E9WA 3PAZA 3NJMA 1OE3A 1QHQA 4P5SA 3QPKA 4DPAX 1ZIBA 2YAFA 4DP8X 4YSSA 5B1JA 3TASA 4JKNA 1A4BA 3EHBB 3ASOB 5TK2A 3V9CA 1BQKA 4KO5A 4X4KA 2JKWA 1ZDQA 2R7EA 3D12B 2J56A 3CDZB 1MZYA 1L9QA 3ZX1A 3OMIB 1B3IA 2BHFA 1MZZA 2PPDA 4KOBA 2YQBA 2GC4C 4A67A 4JHUA 2PP7A 4HZ1A 4P5RA 4PAZA 2W88A 4K9JA 5AFAA 1BQRA 1L9OA 2XV3A 3X1BA 2NRDA 2FNWA 1ASPA 2ZWNA 4GY4A 4YSDA 4G71B 3GYRA 1BXAA 3PAUA 2XWZA 2P80A 1DYZA 2YAPA 3FPYA 4CSZA 2I7SA 1AZCA 1NWOA 1KCWA 2QDVA 3NJIA 4YSEA 3WKPA 1UATA 1PMYA 2BWDA 1CURA 4FA7B 5D4IA 5I26A 4DP6X 4YSCA 4BDVB 2HRGA 1KBVA 2UXFA 4KO9A 3X1FA 1TEGA 1OCZB 4RH4A 1A8ZA 1CC3A 2IAAC 3WNIA 5I6KA 1JERA 4YSTA 1PZAA 2FJSA 1J9RA 2Q9OA 2FT7A 3RYMA 4GP4B 2DWTA 3TBBA 2BZCA 1ET8A 5I6LA 2HRHA 3UAAA 2R7EB 1E30A 1JVOA 2X88A 4ENZA 2GHZA 2XX0A 3QJUB 3ZBMA 3AY2A 4WKXA 2PPCA 1SF3A 3PCYA 1JZHA 1CYXA 2PCFA 4G7RB 5IY5B 2FQGA 3SBRA 4WTQA 2UXGA 3FQ1A 1RZPA 3X1EA 2B3IA 2P80D 1SHWA 3CVBA 1SDDA 2GIMA 2JFCA 3QJVB 1NPNA 4A2GA 2XUWA 1SFHA 2ZXWB 1X9RA 1T5KA 4DPCX 3ERXA 1NZRA 4BWUA 1WS7A 5B7MA 1A4CA 4G72B 4A68A 1AS8A 2YXWA 1WAEA 3FPXA 2B08A 4HCGA 2HX9A 1ID2A 2JXMA 1FFTB 2VM4A 2UX6A 2XLLA 4TXVB 4DP4X 1HAWA 2AVFA 4Q8BA 2DYSB 1TEFA 2IDQA 3H56A 2EIKB 3ABLB 1J5CA 2WSDA 1OE2A 1NINA 1TKWA 5I6MA 3G5WA 1HAUA 2AZAA 2VMJA 5B1JC 3WNJA 1E5ZA 1E67A 3TBCA 3DIVA 1X9UA 1JOIA 2FT6A 2YAEA 4F2EA 1ZPUA 2GC7C 3N55A 2AANA 1AG0A 5I6NA 2XU9A 2BZ7A 1PCSA 2J5WA 3OM3B 2GSMB 4DP9X 2WO2B 4UF7C 1MDAA 1RZQA 2EIJB 3FU8A 5AKRA 3OQRA 1EZLA 1ADWA 3ZIYA 3HEIB 4UANA 2GBAA 3FYIB 4E9TA 1AQ8A 2BW4A 3PXLA 2J55A 3U25A 2UXTA 2XYBA 3S8FB 1AZNA 3QJTB 4HCFA 2DY2A 5PAZA 1SF5A 3N2JA 1A3ZA 1HFUA 1ILSA 1E5YA 1GS8A 1BAWA 3NJJA 5D4JA 3IE9A 1BYPA 1WA2X 1GY2A 3UGEA 2DWSA 4KNUA 4KOCA 3SQRA 1E65A 1URIA 3T6ZA 1XB3A 1QNIA 2A3TA 2IH9A 1L9PA 1JXFA 1M56B 5F7BA 1KYAA 2HX7A 2IDUA 3T6VA 5F7AA 2VW7A 3ABKB 3PAVA 2MRYA 1KCBA 1GSKA 3JTBA 1PLBA 4A2DA 1BXUA 2MTAA 4ZK8A 1PZCA 1AZRA 3FT0A 1KDJA 4PCYA 3TU6A 3H4HA 1ET7A 1EHKB 1WA0X 2BWIA 2YAMA 1NTDA 1AACA 4G7SB 3FU7B 1V10A 1L9TA 3QJSB 3NSYA 1GY1A 2YAOA 3S8GB 3UACA 1GS6X 3PLYA 1GW0A 1ZDSA 4AI7A 1SFDA 1AIZA 3OD3A 2CUAA 4A2EA 4BK5C 4DP0X 1GR7A 2XV2A 4HHWA 1W6WA 2YAHA 1BYOA 1OCRB 3UADA 2H5UA 3FU9A 4E9QA 1IKOP 1PNCA 3T71A 5B3SB 4BDVA 1ZIAA 2QDWA 1CUOA 2X87A 3TA4D 3DTUB 3AW5A 4DP7X 3WIAA 2FTAA 2UX7A 2PCYA 2PPEA 1QLEB 3T6XA 4UAHA 1L9RA 2WO3B 1RKRA 2VN3A 2VW6A 3HB3B 3NJNA 4KO7A 1JXDA 3FSVA 1NIDA 2UXVA 3NSCA 1PAZA 1N70A 1GYCA 4CSPA 2FT8A 1JZGA 5LDUA 2IDSA 5D4HA 1PLCA 3WKQA 1OF0A 2CCWA 2IWEA 2TSAA 3NSFA 2EINB 4AKOA 1NPJA 1OV8A 4DP1X 1KBWA 2VM3A 1JZJA 4FAAB 1OOWA 1KDIA 2CJ3A 2HX8A 1NIEA 5ANHA 2IWKA 4KO6A 3NSDA 1OE1A 3BQVA 5B1KA 3AZUA 2XVBA 2OJ1A 1L9SA 3EH4B 4NERA 3AG4B 3CVCA 3X1NA 6PCYA 4AKQA 1TU2A 1GS7A 2GB2A 9PCYA 6PAZA 1ZV2A 1AS7A 1ET5A 4YSOA 5E9NA 1AR1B 2CALA 4N4YB 4AX3A 4E9SA 4NB7A 2Y1AA 2IWFA 1W8EA 1ILUA 1NDTA 1V55B 1XB8A 1BEXA 1XMEB 2W8CA 3GDCA 3UAEA 4BWTA 5I28A 4JHVA 1M57B 3ZDWA 1AAJA 1VLXA 2IDTA 4YSAA 2FQFA 3ASNB 4E9RA 1SJMA 1SHXA 2CAKA 2YARA 4DPBX 1JVLA 3NJHA 2XXGA 5I5IA 2DYRB 2AZUA 4G7QB 1A65A 4NAJA 3EF4A 4EF3A 4G70B 4YL4A 4AZUA 2FQEA 5A7EA 1J9SA 2YAQA 5I6OA 1NIFA 2AFNA 4GP5B 3SBPA 3KW8A 3NJFA 2BP0A 3NYKA 2IH8A 3MX0B 3FQYA 3IN0A 1PF3A 2BP8B 4A2HA 8PAZA 4HALA 2N0MA 4QKTA 5EHFA 5FC9A 5B7FA 4KNSA 3BVDB 1BQ5A 2E86A 2HLEB 3FYEB 7PAZA 4W9ZA 3T9WA 5B1AB 1PNDA 1AZUA 1IBZA 5I6PA 2HZHA 4M4RB 5I5MA 1MG2C 3OMNB 1AG6A 1BXVA 3NJKA 2PLTA 1NWPA 4F7KA 4GYBA 3PPSA 1ASOA 1KV7A 1PY0A 1I53A 2GI0A 1F56A 3NP3A 1NIAA 3H4FA 3C75A 2FQDA 2H3XC 3ABGA 2Q5BA 1ETJA 2I7OA 5TK4A 3FS9A 3NJLA 1OCCB 3IEAA 3NP4A 4YVNA 3WI9A 2OV0A 4F2FA 3WG7B 2BW5A 2LLNA 3FQ2A 3S3CB 2H47C 1JZFA 3UABA 7PCYA 3NJGA 3SBQA 1NICA 3CG8A 2QT6A 4HCIA 3X1GA 1FWXA 2DV6A 1MG3C 1CYWA 4W1TA 2HXAA 1NIBA 3JT2A 4AKPA 3EH3B 3QJQB 1DZ0A 2PP9A 1R1CA 4E9YA 1J5DA 3QQXA 1IC0A 2Y69B 1OCOB 3FU7A 2VSMB 4GP8B 1AS6A 3S3BB 2PPAA 4A66A 4YSRA 1AANA 2BP8A 1XB6A 1JZIA 2EILB 3QJRB 4BWWA 1W6LA 2ZOOA 2CBPA 3AG3B 2RACA 2PP8A 2BP0B 2TSBA 1V54B 2YXVA 3GXUB 2VW4A 3IN2A 5AZUA 4A2FA 2QPEB 1M9WA 1SDDB 1ASQA
chains in the Genus database with same CATH superfamily
1T5XA 1HWHB 4C56E 1FG2B 1ZJBA 4I3RL 3H9ZA 3TH4T 2NY5H 1EUUA 4PTUA 1U8KA 3WMSA 4X6FB 3UPCA 2EUWA 5FLVA 2HJLA 4X99A 3OF6D 4OZGB 5DD1L 5EO9B 5IM7B 2EVGA 2VCOA 5KBNC 3U4AA 4BK4A 5E8DL 4KY2A 4M3HA 4OZIF 2F08A 3T6WA 1YLBB 3GTNA 1S7UA 5EC1A 3CVDA 3PJLA 4UT9A 4BXVA 2DTML 1SBSH 2FWLB 4KKLC 1X5JA 3GKZA 2VDQL 1N68A 3L45A 4KDTA 4A2MA 3TCLB 4N0CD 3MRKA 4AIEA 1JHKH 1CICD 5BRZD 3F62A 3EH5B 3L3DA 4ZSOA 1YJDC 3QHZH 1QMUA 4PJBE 4Y8DC 1CGUA 3FAWA 3H9YA 1R9FA 3MREB 1K4CA 1OGAB 2AQ3A 3DVNB 5DFAA 4LVNB 3LH9A 3L2LA 4EN3B 2ENSA 2VZ3A 2WKOF 4AGPA 1QOKA 2CUMA 4L5FL 4MNHB 2X6CA 4A7QA 1TVBA 3FTGA 1XWVA 4QRPB 3BAYA 5CJXA 1ZANH 2VLKB 4XHJD 5IBUG 1HZHH 4KKLD 4N28A 3QQ9C 4K4KA 2IPKB 2X10A 4AV5A 1UA3A 3RWJA 1ZVNA 2CDEB 2VDMB 2YPLD 4GRLD 3UX9B 4MA3A 4WDIA 2BHFA 1IFGA 4EUPB 1HIML 3HNTL 3LRHA 4N0FB 5AAWA 4IRSA 4BD4A 1GIGH 2W88A 1RZ7L 2R4SH 3NN8B 4ZUSB 1BX2B 1RZIB 1DSWA 1IBGH 3ZYOA 1WFIA 1RULL 3OR6B 3OG6B 3OKDB 1XGTB 3BI9X 4FF9A 2QQLH 1EJFA 2D2OA 1IC4L 4AZ8A 2VC2B 1KG0B 1UXLA 3N04A 2XKUA 4P0DA 5E9DB 4B9PA 1J0ZA 3FB6A 3NJIA 3QEQE 1FPTH 5EN2B 1PU0A 1JGDA 3N41F 1V7MH 2Y7NA 1F8TH 1MOEA 4N22A 3AC0A 1NFDF 3VX0A 3UP6A 4HK3J 1Q94A 2DQHH 4RWYH 3BVNB 4ESKA 5A6LA 5CWSA 5DHVB 2HRGA 4MB4A 4QHKI 1UHVA 1JP5A 2F19L 4HS6B 3NIGF 4QKXB 4NM4H 3WFCL 5EF1A 3WNIA 4ZMPA 4PLKD 4I1PA 4KUZH 3GDBA 5E4IA 3RIFK 2BNRD 4FG6C 4HISA 3MNVA 3GSVB 1UOVA 2XIIA 1JERA 2BVOA 5AW6B 4QMEA 2D7QA 3BZ5A 3HS0A 2GK0A 3GKWH 4MXWL 5EU3A 2FLRT 1O6VA 1RULH 2FX7H 4G1EA 3KPRE 5I6LA 4XMZA 3QE5A 2CCLA 3L3KA 1BSIA 2CIKB 4FTVB 5GZND 1M7DB 1IEBA 3EJCA 1LNUA 4IRSD 5I18L 3QORC 1WC7A 4GQ9L 2Y6SC 5HHOE 1SF3A 3B9KC 3N9GH 3AUVA 4XRCB 3RVXD 3ARBC 3CDCA 4FA6A 1H3TA 2DPKA 4QRQA 2UXGA 5G4NA 3W1ZA 2V8MA 1EMTH 2VDNL 3VVVA 1HTYA 2UWEA 3O6FD 5F3BB 4K3GA 1ZVHA 4OBRA 1BQLH 2JFCA 3QJVB 4A2GA 3T4AB 3TFKC 1U2CA 4YAQB 4Z3FA 1KN2H 1FGNL 4FKEA 3HI1B 6FABH 5IBLC 2PTTA 4W4NA 5EORH 1B2YA 1MHPL 1E9QA 3I6KA 1U6AL 4G72B 1AQDB 1YPZA 3WO3B 3FRUA 4M7JL 3W82A 3HFMH 3MV7A 2AQNA 4N0UE 3TYFA 3ZDYB 3CFBB 3B9KD 4XH2B 3RGVB 3D8MA 4OGQC 2D0HA 5GS2D 4KKQA 5I1HH 5F1IA 2QSQA 1N8ZA 1RZKL 4DP4X 1Y6MR 2FYYB 3FB5B 4HGWB 4Q8BA 3V4VA 2IDQA 4Y5XB 3OGOE 3QR2A 2QVFB 3ARYA 2WSDA 4GRMB 4U31A 4FOMA 5C6WH 3BFWA 2J88L 2PABA 1QSFD 2LU5A 1EAOA 1S7RB 1UYWH 4PJ8C 4PRIB 4A7UA 4CMMA 5CCGE 1K4CB 2VN5A 1Q72H 1U8MA 1ZT1A 4RISH 4W9HC 2N7AA 5DZ9A 2XWXA 5DJAB 3MXWL 3U79A 1BXXA 1OAKL 2GJZA 2J20A 2FATH 2AANA 5FR3A 2D3JA 1R34A 2XU9A 5IBTH 2KT6A 5F7LB 1SXNA 2ZXBA 2W9DH 3FRPB 3GJEB 3NGBB 1HXMB 3M8OH 1MCJA 2GSMB 4IKJA 5D2LA 1U8LB 2ZOKA 3T0AA 2EIJB 3UJIH 1N7ML 2OJZL 1T2JA 4M02A 5ENWB 4ENED 4IIQC 3IMSA 4YQXL 5I8EB 3VXQA 1OB1B 1VACB 5CGTA 4XN1A 4YO0B 1MVUA 4IDLA 3U25A 3WHE0 3MBWA 3B6SA 5PAZA 4G6AC 2K8QA 2H1XA 1H15B 3OHXC 1HCFX 1G1CA 5J57B 3TVMA 2GUOB 4NKDA 1GS8A 1BAWA 3PV6A 3IDJA 1MQ8A 2BVYA 3IE9A 5E5LA 2G9HA 3K72B 1DHKA 2Z91A 4LPTA 2KPWA 1URIA 3ILQD 1XB3A 1G6VK 1N0LA 3EOAA 3QIUD 1RZKC 3ECUA 3K8LA 4KX9A 3ZIMA 1OAZL 2OYPA 1A7QH 3T6VA 1IILE 5F7AA 1EHLL 4N2EA 1JD7A 1SN5A 2JKNA 4ETQB 1A6WL 2ZKMX 2ZUWA 2ROYA 3BP7A 1MJ8L 2BH0A 4F33A 3UYRH 2EIZA 2BC4A 2B14A 1A9BB 1PZCA 1V3LA 2DQEH 1CGVA 1FH5H 3RZCC 4Z7NB 4Q74A 4UTAH 4PCYA 3V6ZB 4ZAKA 2BLFA 2YK1H 4FFTA 3DRTB 3SE4A 3H2QA 3MN8A 1VCBC 5FYLL 4AJ0A 1C5DB 3U9PL 1SN0A 1KY6A 1IIKA 3GHPA 3K0WA 1G1OA 3N06B 3QQ3A 2H9GB 2OJEA 2GEEA 3U4KA 4F57L 5E2TH 1AD9A 3V0IA 4G9DB 3KPSE 4NNPH 1TJGL 3FUJA 1N6QH 1JGUH 2BDNH 1WZ1H 2V2WB 5FXCH 1FG9C 4TUUA 3ZY7A 3AU0A 3CZGA 2ZIDA 2IV8A 3CDGB 1T2XA 3KL0A 1BW8A 3P30L 3PRZA 5KUMA 4H40A 3Q06A 3U1SL 4YHIB 5EN2A 3OSKA 5CO1A 1VF5C 4ZFGH 1YN7B 2W80C 2JIXA 2X4NB 5EIIG 3U36B 1VAHA 2NXZC 1MFAL 1ZS2A 1HHHB 4F7TA 4M4RA 3T71A 3RTQD 4K7PX 1RZJL 2WYIA 1MREH 4GKZB 5M7QA 3NFPA 2QDWA 4OJEH 1TKWB 5FO8A 3L95A 4QHNB 4YL9A 3EYFA 5DD5H 3JV4B 3ESNA 3BN9D 3WNPA 1CLOL 1W0WB 2D03L 4A6YB 3H3BC 1UXMA 5H8DA 4PJCB 4EUPA 2WKOA 2XHNA 2CLVB 5D7LA 5C09D 5C2BH 4YPJA 1X5AA 2VQTA 1FQ9C 4R90L 1WPCA 5T5FH 5LBSL 4X5WB 4XNAA 5D2LE 2A9AA 4LLWB 4OCXL 5EUOE 1T03H 2ZKYA 2DWDB 4Y2DA 3WS3B 1FN4B 5IQLA 3G5YB 3MV9D 1HL8A 3UTSB 3SDDB 1N70A 3DROA 3MOAH 3ZT6A 5LXVA 2VUYA 1MI5E 1N4XH 1XSOA 1UENA 3O2VL 4H44C 5CUSL 4QWWC 2IDSA 5IMOB 2B4CH 3PS6A 2VDPH 1SRDA 3IAQA 4AW4A 4MA7H 4GT0A 3GGWA 3UAJC 4AEEA 2BINA 4QUOA 5ISZA 1BLNA 4FXGC 5ANHA 4WI4A 3EYOA 4H1LG 3IRPX 3BQVA 4E0RB 5IV2B 3IU4L 3O4LA 1JNJA 4ZPTB 1CVRA 4N2DA 4XGZB 4JGNA 3ULUH 1DVZA 1ET5A 4X7FC 5E9NA 5FYJL 1Q0YL 2DTSA 4I9WE 3NA4A 4UIMA 4HMEA 3WLBB 5HHNA 1RJYA 3F5WB 2VLJB 4HJGA 2MMXA 1L5GA 2VXSH 4MYPA 4D9LH 4FJZA 3NSXA 4QNPF 3VGDA 2OTWB 4JHVA 3RWJB 3WIHH 4GSDL 4K5OA 4LLYB 4QWWD 2FQFA 3MKKA 2PYEA 4JHBA 2A73B 1SJMA 2ICWI 4G11A 2COQA 2N0KA 4XNDA 1A0QH 4P04A 3V4VB 4MXVE 1UZ6E 2PR4H 4Z3HA 2QKIA 2VDPL 4B27A 4X7SH 3CHXA 2JLLA 1EGJA 4KX7A 4GAFB 5J11B 4QO1B 3OPZL 5DC9B 4FMVA 5AW2B 3M86A 2RHEA 1KJMA 1CIUA 2MTPA 5FK9A 5J6SA 4CRPA 4L48A 4QYAA 5BOPA 3KW8A 3D6GA 2EUXA 5DHEA 1HJCA 1ZSHA 3CFQA 2YXFA 4J28A 2YGNA 4LXFA 4HQQH 4LLVA 4OI9A 4EI5D 2N0MA 5E2VH 1G7LA 3BVDB 3T2NL 1LEGA 3FYEB 1OSEA 2R23A 1U3YA 1TQTA 3P11L 2X4QB 3RURA 1JJUA 4G6KL 2R4RL 32C2B 3GBEA 1YECH 3L4CA 1TQBC 2J6EA 4I87A 3NJKA 4N9GB 4BQ9A 3KPRD 4UDUB 1HNYA 2GI0A 3K6OA 4JCWA 4NUGH 3TA3C 3NP3A 1KXTB 4JM2F 3DO3A 3DYMA 3FQNA 1OQOA 5IIEB 5FPIA 2H3XC 3SDAC 3WMQA 3PWVB 2WVTA 3LZQA 3QEUA 4PB9H 3DK0A 2PXYB 2A5UA 2ZCLH 2BW5A 2PN5A 4LASH 5GS0L 2W91A 2WXKA 3VYOA 5I76B 3VXMD 5DMYA 4ZYKA 1WC7B 1USQA 3MLSL 4OH2A 4F15B 1HSBA 2EDHA 1XGUB 5CBEA 3T4AC 2Y2YA 2AJUH 3WDJA 2P5PA 4RFNC 2AERT 1UVQB 3MBXL 1U8LA 2ZOKB 3SKJH 2OR8A 3CH1A 3N43F 4YDKL 1FH5L 4M62L 5TQ0H 1YDPA 2P7TA 4YGVA 1OK0A 5HPOA 4MAYA 5L6YL 1IC0A 1MW1A 2OI9C 1NGZB 3J27A 2VSMB 4AGLA 4KJPC 2M83A 2XZAH 3CGTA 5AVYB 1C5DA 2NXYD 3VG0H 4ZMVA 1W6LA 4HUNB 3CZNA 2B1HL 3CVIH 4UAOB 3HC0A 2E6JA 3TYFB 1I9RL 3QO0B 2IMNA 4K55A 1KGXA 1P5UA 2WWOA 3MCLL 5ECGA 2YPVL 3KYKL 2PPFA 5GS3A 5KVFL 4LBEA 2Q76A 3BWAA 4JY4B 1YYML 1AOZA 3DKHA 4HGWA 4CGUB 1EZUA 4NN6B 3ZVVA 3RPKA 5CJ8A 4LKCB 1HK6A 1M2VA 3D39B 5F6IB 1J86A 5HHQB 4X4MA 3JTSB 5DFWH 3CXHK 1FFNA 3HRPA 4LSSL 3U7YH 4DK5A 5K59F 3EYOB 2VC2H 4E0RA 2GAZB 1JD9A 2FX9L 4ZDHA 4YSUA 3O6ML 4KTDH 2J1KA 2H1PH 2WO4A 3BLBA 3BZ4B 5IVXE 1KXVC 1UH3A 4X9IA 4PN6A 2AKRB 3AU1B 3IKCA 4PU2A 3BGAA 5B1CA 2XXCB 5EU6D 3HMXA 1KNOB 2V2WA 3CDFA 2HT3C 1U3HC 4TQHA 4PV9B 2XNAB 5JW5B 4JW3A 4TF4A 3SBWA 4XWOC 1OE3A 2VDRH 1EJOL 4O2CB 4WHCA 4X6EA 5KN5A 1ITBB 2W60A 1AJ7H 4W9EC 3M7FB 3MLXL 5IMOA 3S35H 3V9CA 4PGBB 4JGJA 2DQMA 2C3HA 4X4KA 5CNHA 3FW6A 1TO5A 4FLRA 2JJSA 3BVTA 1AZVA 3LB6C 4L8SC 1C7TA 1KCUH 1RFDH 3D87B 1FZMB 2WWNA 3F3HA 4GKZA 2JKJA 4JRXB 5CJOL 3NZSA 1F4WH 2R1WA 3E6FA 3R0NA 3S36X 3QULB 1EX0A 3NK3A 4WFFE 1MI5D 4HK3N 3HG1D 5AFAA 3BVVA 1S9WB 5GJTL 2ESVB 3QDGE 4GG8A 4P99A 4KY1L 1SUJA 5D7LB 2VR3A 5TE6L 1G7JA 1PYWB 1PZDA 4IRZH 3SQBB 1HYSD 3MBEC 1KTLB 2OL3A 3FMGH 2R23B 3AROA 4GY4A 5JQIB 2IBBA 2VXSL 4KH9A 4D9LL 4MCMA 2FX8L 4F5CA 3OXRA 1JYVA 4P06A 4ZW6A 3FCSB 4NIYE 1RSFA 1QBBA 3TVMC 4XH2A 3RGVA 3C5ZC 4BCYA 4PSRA 4LHQB 1MHEB 4YEFA 4AH2B 2KL6A 4AIXA 4DGIH 2I07B 2CO6A 5GSRA 5DD0L 1WAPA 3D25A 3O9WD 4D9RD 4BDVB 2DM4A 3LDBC 4IBTA 4WO0A 4AYBA 1SOSA 1TJHL 4RGOH 3NEOA 4LMQE 1NGXB 3BUIA 4IOIB 4PQXA 4ZUVA 3BD5A 3IDJB 3BPOC 1QKZL 5D1QD 1Q4NX 3G04A 3ZDXE 2YFOA 1EAQA 2J1YA 3DJZA 5I8CB 3RA7H 4F58L 1YEEL 1Z1WA 3KH3A 4JN1L 3KWWB 1WSST 4OCSL 2Y07H 4XPGL 4FQIL 5IEHB 4WUKH 5HYEA 5I6XB 4J3VA 1MHCA 4OCXH 1KGUA 2AMUA 4ONHB 5L9DL 2XPYA 3MRNA 4E2OA 2ENPA 1ZLUH 3W2DL 2ZSVB 3MLRL 2BC4B 1PY4A 3FONB 3O11A 1KCRL 3N43B 3O9WC 4P46D 2QGCA 4HOWA 4JZJA 3TF4A 4GUCA 5K69A 4ZFZA 1CD0A 2NPLX 2X41A 1RAMA 4LMQI 3DXAA 2FQGA 1RUKL 1MFAH 2Z1PA 5D7HA 1RZPA 4TUOB 4W6WB 5I15H 1IC5H 2APFA 2HLFC 4PJ9D 4MJ4A 2VSCA 5IFJB 3RP1A 1E50A 4MS8D 1FZKA 2WWKO 3L3OA 3PV6B 4BFNA 3IDGA 3HN5A 3QB7C 1NQBA 1CBVH 1U8CB 2F53A 5CSBA 4ZODA 3H7BA 2XOTA 4TULL 2D7TL 1WAEA 4M5YL 1TVHA 1PPIA 3A4EA 2UUDH 3BUYA 3EHBD 2HKAA 3W56A 2F7QA 1WAAE 1XEDA 5ABAA 2A6KB 3WENA 5ABDE 3EFDL 3NABL 5D1QA 1FFOB 2GYSA 2NX5A 4LQFH 2BY3A 2AEPH 4AMKL 5K9OA 4PRAB 3N42F 1TEFA 1XR8B 3CIAA 3D2UD 1OP9A 2P5WD 4L4JA 4Z0BH 4Z7QB 1BBDL 3JV4A 5HYQB 4J4PA 3RZCD 3TOPA 4FE9A 1G7QB 5GZNA 4A6YA 1S78D 1TCRB 2AXFA 4XZUA 5I6MA 3F7RA 4RWYL 2X4SB 1BJ8A 1WT5C 3M88A 3J8F7 5IK3A 1YEGH 4K7PL 3FQNB 3MGOB 2BP5M 5IIEA 4Y4KD 4C4UA 2ED7A 1UJTA 1NCAH 1YEHL 3KS0H 2KPNA 3CBKB 3GB7A 3QYMA 4BKSC 1I8IB 4FQXD 3B3BA 3NGBC 2C5DC 3CDGA 5F7NC 2GTQA 1RSYA 2LU3A 5I23A 3QFDA 5L2JB 1FNLA 3EFDH 4PMEA 2APWA 1AHKA 3LOWA 4LFHG 2Q20A 1DQKA 3MV7D 1B0WA 3EBGA 2XYBA 3S8FB 1LD9B 4JPWL 4JPKH 3BWSA 3SGEI 3VXUB 4IU2A 1OW0A 1J8KA 1IGYB 3LQAL 3NJJA 1REIA 2XT1B 1HQRA 4YBLB 1O9ZA 2NY7H 5JHDB 1IE4A 1PG7W 4WWKC 3UGEA 1NGQL 4WO4D 5DO8A 4RSVA 2YEZB 3MNMA 3MRRB 5IHWA 3KEHA 3CV5A 4HJSA 1DBJH 4KXAA 5JW4R 3MLVL 1EXUA 9CGTA 3LZOA 5IB3B 4M6OL 1FUNA 4LLYA 4ZNEA 3PAVA 4LK4A 2MQGA 1KCBA 2DI8A 5SX4I 1DP0A 4CDHA 1WQVT 4N1HB 3S5YA 5IQ9B 3JTSA 3NRPA 3QPQC 5DCCA 5C92A 4R97C 2K4WA 2MFNA 1T66C 3M17B 3GHEH 3GJFK 1SUHA 2I9LA 2ZOTA 1EZVY 4IK6A 4P4KD 1YEEH 2IPUK 3WTSA 3EZ8A 3UZEC 5A2FA 3X14B 3GC3A 3IDUA 4M8VA 3PLYA 3TM6A 3SDAD 2BS71 1TR7A 2F5BH 3WLBA 5E7FA 4FFZL 4X8XA 3RFZB 4URTB 4A2EA 4WTXA 3MBEA 1B0IA 4OLZH 4DOHE 2NT1A 4DP0X 4L29B 2EIBA 3AAZA 1E8ZA 4WCYH 3TYGL 2HFGL 2VDNH 2Y7MA 2BNQB 1BFVH 3DV4A 2VJXA 4L9LC 4PJAA 2ZCHH 2DWEB 5ESVA 3CFMA 3ZRCC 1OARH 4HIXL 4OFYD 2J21A 2X87A 4P5KB 2WD0A 5IEKB 1P4BH 3DRQB 4GW5B 1RMFH 2VAJA 5KEZA 3BDYH 3QHTC 3FFCE 2PCYA 4XMPL 4X5RA 1TZOA 3RA7L 5FGCB 4YC2B 2FBJL 2UV3A 4MJIB 2BRRH 5AW7B 4PW9A 1NCCH 4WUKL 2WO3B 4JFOA 3PQYB 3A22A 3QWOA 2FX7L 4ZW8A 4P3WA 4HKZA 2YEVB 5TQ2H 1NGQH 2ZUUA 4M7KL 5AB1A 2IPKA 5L4JA 3N1PC 5BV7B 3BSZA 2VXUH 3FF7A 4XBGA 4Z0BL 1E9OB 3HMXH 2QQNL 2OZ4A 3V6FB 3KR3H 4MX7B 5GZOC 5AWNH 2EINB 1BFVL 3WEMA 4Y2OA 3WLWC 2K3HA 2B16A 3GBML 4IIQB 5J9PB 4NM8L 2XG5B 4G6JH 4FQJL 4XNXL 2YUZA 4ODXA 2ERJB 3KWXA 4Y4HA 3C09C 1KMGA 1A4KB 4QXTB 4WHTB 4JFEA 1GYVA 4TSCL 2MCAA 4UBDD 3OKNB 1ZV5A 2JKTM 3WNKA 3R19A 4FG2A 3QDJB 3QHFL 1JYNA 3VFVA 4OQTA 1TLKA 3TZVA 1SY6L 1JHLH 5AG8A 2CRZA 4U4IA 2AJ3A 2JTYA 1XMEB 4ELME 2XZQH 1RJZB 4PUBL 4JEGB 1M57B 2DS4A 2EO7A 3N1QC 5A2BA 2GSGA 2CZNA 3P9LA 2F7PA 2CAKA 3L5XH 1A6TA 4YDJA 4NP9A 1V5JA 4M1CD 2LAAA 1UZ8A 4L1SA 2WYHA 2YQ3A 1CGXA 4MAYB 1CE1H 4NBXB 3MNVB 5E8OB 3B43A 4DTGH 4MQXD 2NR6A 3UTSE 3TH3T 2FSDA 4LEXH 3B2MA 2QQKL 5EEYA 1HT6A 5CF3A 3CFJB 3K2UL 4L3EE 5DMJB 1OEZW 5JIDA 4AQ8A 3OZLA 5I1AB 5AALA 4APXA 1XO8A 2VLKE 3VD5A 4YE4H 1BCIA 1BZEA 3WSQH 3VDBA 3MGTA 4KXDA 3QUMA 5FUOL 1QO3B 5A6IA 1W9XA 1VERA 3WUWG 2A9ML 2HLEB 4P3DB 5F96H 2DRUA 5C0DB 2WXIA 2X7LA 5FX3A 4LKCA 2V9UA 2BNRA 5I6PA 3ARBB 2XYCA 3DGCR 4JBSA 3CZEA 2EO1A 2VDQH 3QORB 3SDDC 4JREB 4YHKH 4H20L 1AY1H 1OIOA 5DYOB 5IG7B 2ORBH 4JKKA 3C2AL 2CMRL 3I6GA 4FABL 3GPEA 2ATKA 1IGJA 4UIKH 2WZ6A 4BZ1A 2X4SA 4LOVA 4N5EC 2V17L 3WO4C 5BQDA 3GHBH 5DXWA 2Q87A 4A7SA 3JVFC 2VLKA 4PS8A 1E7VA 2EDMA 4QGYA 1IARB 3WG7B 5D7IA 2DMGA 3U0PB 3CSFA 4E42B 2ZWKA 4OCLC 4PGDB 3VI4F 1J1PH 1HH9B 4F58H 1RVFL 5TDNB 1K9TA 5FF6B 1N9PA 1U3ZA 4PS4L 1ETB1 5LGJB 1J0JA 2ZKWA 1WFNA 4I0PA 4CGTA 3LS4L 2H8PB 3EW3B 3T2PA 2E7LC 1DZ0A 1HE8A 4FS0A 1I3VA 1MCEA 3FO2B 2H6OA 3L3DB 4ZSOB 3ATFA 4FNTA 1QSED 3ECWA 5ICXA 2BNUA 3WDIA 2ZKHL 1DO5A 5DJAA 1DDHB 1YQVL 2H32A 2O61A 1NUDA 3H2PA 1TZGL 4UOW0 3UL4A 3DUSB 3UTTD 2PP8A 2HUHA 2DMKA 2TSBA 3GXUB 2J1XA 1T03L 4U6HB 2VTFA 3CXHJ 1T22B 2DMBA 3KPRA 2IDFA 4ADGA 5LCVH 5LUMA 4U1NA 4FEMA 3D1MC 5CJBA 5F1SA 1DQMH 4OZGA 1I9JL 2ID5A 4Y4KB 5EO0A 3X2QB 2VITB 3FULA 1QATA 1HESA 4ZFZB 5JIQA 4JRYB 5EOTB 1XF3B 4Z7NF 2WNXA 2D8KA 4DAGL 4WWID 1S7QA 3NK4A 3VFUB 1RZJH 4AIZA 1YYLL 5MI0B 3WJMB 4E41A 4WJG3 5AUMB 4G6KH 1JZEA 1TEYA 2E4FA 3O4OC 4QJ3B 1KLGB 4KK8C 4FTDA 3M17A 5JR1H 3WFBH 4KRLB 4TPRH 2Y07L 1WS8A 1MY5A 3GIZL 3EOYG 2C4XA 4HUCA 4R3SB 3GSQB 2B1HH 3CVIL 3US1A 3T04D 4C83A 3QA3A 4RBPK 1CDBA 2M8XA 4Z5RB 5L7XL 1NA8A 3MRJA 4NKOA 1NC4B 3QPKA 3DGGA 3V52L 1XF1A 1WBXB 2ZX9A 4WFGD 1OGPA 5ETUB 1CWVA 1KEMH 4PRDB 5F7MC 2CBOA 2ZF9A 4KMQA 4C8XA 5GGRA 3MI6A 3V6ZA 3GIVA 3MLTA 4NN7B 4UINH 4KZDH 1U8NA 4HEPG 2CWRA 12E8L 2AXFB 4XZUB 3CDZB 1IGYA 1MZYA 4Y2LA 1BZ9B 3ZK0A 1MLBB 3IDIB 5D1XA 3U46A 3ZX1A 2HVJA 2JQZA 3ARGA 2XICA 2BVOB 4AK2A 1M71A 2G4GA 1EANA 4XMXA 5AYTA 4NIKB 2ARWA 1W0YT 4KQ4H 4N0YL 1ACYL 1BOGA 1C16A 4WFHD 3AQZA 4ODUA 3X1BA 3AXHA 2IFFH 1LE5B 3TPUB 5E24E 5T1LB 1E27B 4JFOB 4YR6B 1DVTA 2IOIA 3P1VA 1RZGA 1GZHC 4GRMA 4H8HA 5DHYA 5IW6A 4E5XA 1ZA3B 4FLQA 1P7QA 1NUGA 1OXYA 2Y6SD 1FFOA 1DQDH 2L04A 4RAUA 4C47A 1U8MB 4B0MM 2G60L 4IRJC 3F65A 3CMOH 4GG6E 1M3IA 3I50H 5JIMA 4CC4C 2Q3AA 2WWMC 2GG1A 2ZNWA 3M1OA 3UC2A 4TVPE 2B2XH 2XTJC 3VI3B 2X9XA 2BNQD 2P5ED 3QNZB 4Y4KC 4ZX6A 3EGSB 4GAGL 2VAAA 2FATL 1FL5A 4YHOH 1J48A 2WLHA 4ZMLA 5HHOB 4UNVA 1R5IA 1ZT7B 3DROB 3K8MA 3GB7B 1KTJA 1SYSA 2O6DA 1VACA 1IZJA 3GSUA 1ECZA 1W0VB 4C56A 1KCVH 2FCBA 5C86A 5CILL 4NNYB 3EBAA 4HT1H 1OW0C 4OZGE 3FQXB 5DUPH 5AG9A 2X6AA 5D7SH 1CYXA 3L8QA 3PGFH 1UGNA 3HZYB 1DQDL 1S7UB 2VDOH 1XGZA 4JREC 4N2MA 3MJ9L 5D6CA 2J71A 4AE0A 4N26A 4MVBD 5FWRA 3MJ8A 3S4SG 3X3FH 1M9SA 4R26H 2C34A 2CJUH 4B50A 5IVNA 3CVBA 4U6VL 1RH8A 1WGVA 2GFBB 2ZSWA 4H4NA 3QWOB 2IALA 1WUNT 2YPVH 3KYKH 4PJHE 3LN9A 1EJ6A 4RX4A 5ESAA 2H3NA 2VDPB 4KVNH 2E56A 4J6RH 4FKHA 3IU3B 2XACC 3HC4H 4JZOA 3LRMA 1Z2KA 2WUBL 2BMKA 5F1IB 1E5BA 4OM0H 1YY8B 5IHLB 2X7LB 3ZTEA 1FYHB 5DF0A 5ESVB 1PX3A 3F12B 4FQLH 2AV7B 3F6LA 1TTBA 3MLUH 2XWBA 3C6LC 4Z9KB 4X7DC 2DD8L 1KLGA 1JF1A 4JFEE 2QQNH 3A47A 4JFEB 4XP4H 5DYOA 2QZ5A 1O9VA 1QSFA 4UYPA 4AE1A 5LDSA 3C6SA 1J5IA 4XCCH 5B1JC 4MJIE 2D7NA 4GRWB 5CGYD 1E9PA 5MEPB 5E99L 5BVPH 4ETQA 1Q38A 5KVEE 3NZHL 4JY5H 2KYIA 4UMGA 4J8QA 4PJ8A 1HHIA 3IDXH 1MHPH 1M2OA 2VDOB 1S3KH 3NA9L 1AGBB 4UB0L 5I6NA 4F8QA 2X4QA 3ULUL 1A6TB 3MTRA 1UWYA 2F7OA 1PIGA 3VSUA 1RZQA 2WY3B 3NTCL 5F1NA 1TJIL 2OMWB 4AIZB 1HQ4B 4UANA 1I7ZA 4NZTL 1S2EA 2J8OA 3QUYB 2VMEA 3PIQB 2FR4B 1CE6B 3CBRA 4R83A 1QBML 2JELH 5JNYB 4NQSA 5IMMB 5FCUH 1HFUA 3WTWA 5E6RB 4XHJC 2XQYA 2ICWA 4RISL 3AMKA 3T6ZA 2ZXCA 3QDJE 2X6VA 3TA3D 3T1WA 1X5YA 3QZWA 1JXFA 4MCYB 1MJ7H 3QUXD 4I3SH 2OK0H 4PRID 4N2AA 1OTSC 3SGKC 3RVWD 3GSXA 1BVNP 4Y4KA 2VDKB 4W9LC 3OKEB 5B39G 5ACMA 1VGEH 2NZ1A 5C0JB 4NM8H 4C4BA 2JQAA 5IV2A 1IGFH 2HP4A 4O2FB 4J1UB 5FYKU 3S5ZA 1WFTA 4NN6C 5IESL 1V7NL 4WGWB 1KDJA 5I71C 1VHPA 4XNQA 3DSNB 3SJVA 3BGMB 2D9QB 1DBML 5DR5L 1KC5L 1UACH 2YAMA 4CN4A 3ZQWA 4UQBA 3QZLA 3U4EA 5JLZA 1JTTA 3MV11 3MAWA 4ANXA 3H55A 3FU7B 4V2BA 4PJFE 4E42A 3QXAA 2WMPA 2XRAH 3NSYA 1NCCL 2YAOA 3L3IB 3PABA 4WSKA 5IF0A 1W0VA 3EYSL 4WUUD 5DRXB 1FDLH 5AW9B 1J0IA 2XJLA 4K8RL 2G2NA 3CFBA 2B59A 3VQ1C 3CN3A 1F45A 4K94L 4JPVL 1A2YA 5IT2H 1ZA3A 3EADA 5JZ7D 4FI6A 4N8VA 2J1WA 2I24N 3JBG7 1UM4L 4KV5F 1UWEH 5E8DH 3GBMH 4W6YB 2YMXL 3PFUA 3QC6X 3RX7A 3LKRB 4LHJB 1R0AL 1YAIA 2Q7AA 4LGSB 3EH2A 1AGDB 3AW5A 5DD3H 5GJSH 5H2BA 5G55A 5IJKA 3DYOA 3ZL4L 4LSRH 3CSYA 3DVGB 4G43A 3SSGA 3ZKXC 3ZXAC 4YZWA 2C3GA 3HBQA 1Q9LB 1INDL 2VAAB 1JWSB 1KTKE 3B7RL 1FF5A 4PRPA 2CQVA 3GI9H 3UEQA 1KJVB 2VN3A 3O6FC 3BP5B 4DCQB 5FYLD 3P0VH 3ZSTA 4C54A 4CSPA 4NPYA 2O30A 1DJSA 4HSAC 5CD3A 4TVPD 3E1ZA 5TE4L 3CZSA 2WP3O 4HWUA 1BBDH 2OK0L 1YMHB 4G6FB 3QUYC 4NOFA 3UTQB 3OBAA 1MIML 3A4DA 4Z7WA 3IMBA 1E4WH 4F7CB 2IAMB 1KBWA 3OAYH 4HS3A 5E1GA 3VGGA 1G84A 3K46A 3KYNB 5IBLD 2EDRA 1BPVA 4GKNA 1CFSB 3OLEA 5F7EH 2JJSC 5KUKA 1O0VA 3O3DA 4X8JA 5EZLB 1UD8A 1KZYA 1Y18B 4BGLA 4IJ3C 4PJAF 4E9SA 4NQCB 4PIBA 2DLHA 3PWUB 3OZ9L 2GT9A 3TO2A 5GS1C 1V55B 1XB8A 2BMKB 4G80B 1XF3A 2F8IA 1F02I 2OMWA 2XI9A 1S5HA 1SPDA 2B5IC 4KDWA 4LSUH 4P2AA 1WAAF 2ZYHA 4UZGA 3OGCB 2EIZB 4NO2B 3VI3F 2CO1A 4PRHE 2OXHA 2X44D 2FJHA 3AY4A 2EKSB 2J4WL 1KLFA 4WI8A 4TL5A 1SJVA 5H37G 4ZMYA 3WTUA 1ZANL 4G8EB 2VXQL 4URKA 1RIHH 3V4UL 3N40P 4GW1B 5E08H 5IFHH 2OSLB 4GMSH 4JFDB 1J8HD 3D52A 2YJLA 3O6FA 4XMWA 3HI6H 3LTVA 4ZUUB 3WNLA 5AVRB 2V5YA 1KGJA 3GSQA 1PD1A 1LDPH 4M61A 4TOYL 3EOTH 5CEYA 4BUGA 3NJFA 2EE6A 5ICZA 1T83C 1BZ8A 3LV3B 1NOFA 2CLZA 5JIKA 1U92B 2APSA 2H3NB 4NQEE 1WG3A 4QKTA 2ZSVA 2FD6H 1OVZA 1WV7T 4LCUB 2A74B 3UTOA 3FQRB 5IESH 1QUPA 3PGCA 3GBNL 4CNIA 1JK9B 1XH1A 3IAGC 2PCPB 2ARJA 5DUBB 2QEJA 4ZG1A 2DTMH 5I24A 4L8BA 1MG2C 1Q0EA 3ESUF 3RFZC 3NACL 4HS8H 4LF3B 3KLHD 3EO1A 3QUZA 5F2FA 3MKGA 5E1HB 4F7KA 3Q8FA 3SJVE 3EYFB 1YEJH 3ARZA 2AK1L 4GUPB 4KMTH 4F2MA 3CHQA 2XBDA 4I1RA 3B7UX 3ILQC 1QLFA 4FDWA 1FIEA 2UZYA 4FNUA 5GS1A 4PJDB 3IEAA 3PHOB 4OJFL 3PF2A 4HGKC 4AQEB 3AT0A 4N87A 4XP9H 4K07A 4JPQA 1IL1B 3VXMA 3WJJC 4MCYA 2WBJD 2ADGB 1IVTA 4JFWA 2NNAB 3OHMB 3CG8A 5B39A 1EHAA 3FQXA 2O4EA 3SO5A 3TL5A 2QT6A 4HHAA 3CH1B 3Q9QA 1FWXA 4GXVL 5MEND 2DIAA 1S7WA 3ZKNC 2EYRB 4GFXA 3O81A 1JGLH 4I18C 4MA1B 2AEPL 4AMKH 2OYLA 5A40E 4X7TA 1OCOB 1ACYH 3EHBC 3TIEA 2YA0A 5DRWA 3NCMA 2C9XA 3MUY1 4NQDD 3O9WB 2YKKA 4BFEA 3WEAA 2OA9A 4XO3A 2OXGA 2YXVA 3BPLB 3MUJA 1A6PA 1IGCH 5AZEH 1P1VA 4ZO7A 3WJLC 1AZBA 5KYYA 3IWUA 1RCYA 4K71B 2VYRE 3OMAB 5FHAH 3WFDL 2YPLE 1EFQA 4JJ5A 4MB5A 1K4DA 4LEOB 5ADOH 1YJDH 4LHUD 3VXSB 3J07A 4C4KT 4JRXA 3IAPA 2P8PA 2DDQL 3LCYA 2VLKD 1H3PL 2LT9A 1T1ZB 3DX2A 4S2SB 4K8RD 1OGTA 3RIAF 1VKXB 3NTCH 3EYUH 3NIDE 4GKNB 1U3NA 4HC1L 4MSWA 1Y7VA 1LD9A 3HC3H 1KYOK 2DLIA 3HZ3A 3LB6D 5CLTA 1GMIA 2OS7A 3V0AC 3S97C 4OB5L 1RUAL 5IEHA 4U3CA 4GXFA 4N0YH 1GTFA 4NQEA 1XH0A 5AOKA 3V5KA 2JMRA 4WHDA 3QWRD 2XNAA 4QCIA 5T1KB 3VRIB 2AQPA 4E9XA 1JV5A 4JY6B 5DFTA 2EVHA 3DUUB 2V3FA 4GAJL 4DPAX 5TF1H 2V9QA 2PW1B 5B1JA 4IOSA 4JKNA 3NA9H 3WKNA 5J0BA 1SOKA 1G9NH 5A16B 3VWJD 3B2UC 3LNEA 1LO0H 5I1EL 3KDPB 3RNKA 4L0ZA 3ARDB 1QA9A 1UQSA 5DFVD 3MBXH 4J4PC 3SKJL 1LK3L 4ODBD 1MVFA 2CRMA 2YSTA 3BIKA 1CL7L 5CLYA 1DQQB 4KU1A 1EEUA 4PP2B 4HUWB 3UAFA 2CR6A 2A9BA 5D1QC 4P5RA 2A9NL 4QOKB 3V4PH 4HMDA 4IU3A 2F1AA 4KXBA 2JELL 4HJEA 2V2TB 1MHHA 1SXAA 5GS2H 4BEIA 5KYWA 2ZWYA 2A6JB 3RWHB 4Z0XB 4K3DL 2OTUB 2F7IA 4CNIB 2XWZA 2Z35B 5CBEB 1ZSDA 5FGCE 4FL4C 2V9RA 4X5XA 2ZPKL 1KENH 5DT1H 2CGRH 3UEZA 1GXEA 1NLDL 4FCAA 4WUUB 5HY9B 2FWUA 1OGSA 5D7SL 1LEKA 3PIQA 4L3AA 4JR9L 4XPFH 4WGVB 2YPVA 4OFQA 5JORA 4K73A 1EXGA 3F7LA 4XX1E 3L3OB 4KO9A 5HI5C 1LEIB 2V17H 1IGIL 2LOEA 5EOCJ 1KBGL 4RH4A 4XVTL 4ATWA 3MBED 3EJZC 4JKMA 4HOZA 1T0NA 2J8UA 1IBFA 3DMMC 3D3VB 4FQ1H 3L2NA 3WGUB 3M07A 1T80A 2FEDC 4Z95H 2V2XB 3VWJA 4EQ2A 1LO2L 4IM8A 5T1DH 5JPMB 2XY2A 4RCAA 4NC1C 3O11B 2ZD0A 4HAGA 3HG1B 3BKML 5C0BD 3B9KB 1WT5A 4XWGH 3P3RA 1I8LA 4LCWD 2NNCA 4JFQB 5IW1B 3RVVC 2Y0SA 3MLUL 1B4JL 4ZS7H 4FJ6A 3SDXF 5I1LA 4L4VB 3AY2A 4EDWL 4WENB 4X4YB 3GLDA 5G2NA 3X11B 1JZ4A 2ICEA 4ODHH 4YDVB 1A4KA 1F2QA 1GZQB 1Y07A 2F8OA 3TEYA 3QDMD 2D7PA 3I3BA 3SPJA 5HI3C 4LSVL 5JPMC 1S46A 3B2PA 1IGIH 4DVRL 1TZIB 1DEEA 1SHWA 5C0FA 1QW8A 4AGNA 3WFEH 3VFSB 4PJ5D 3FFCA 2NY6B 4K9EC 5KVFH 5H37A 2L8AA 2ZCLL 4OZHE 4MS6A 3FB6B 1G6RB 1IC1A 5CEZD 3GWJA 1A4CA 5B8CC 3L5IA 1KPRB 2E76C 2KDGA 3IDYB 4YFDB 1IFHL 3L3OC 3IGLA 4P2QE 1OGTB 3SDAB 1EVTC 5CWSB 5DHVA 5AB9A 3VB8A 3WKMH 4QHUB 2HLFD 2GKIA 1HAWA 2XTJD 2P5WA 3RZCA 4L05A 2BCKB 2GJZB 1AGDA 4DSYA 4U6YA 2G2RA 1BIHA 1JN6A 1H5BC 2C3VB 4WY7H 4ALAL 5BV7L 1MCPH 2ICCA 1TJGH 1E40A 2OSXA 1FYTA 4ZTOH 2FB4L 3GXIA 3FBKA 5MEQA 4F8TA 4BZ2H 3AAZB 1HH6B 2KLSA 2YAEA 4XI5D 4JQVA 4DUVA 4IQHA 3A67H 1ZHNB 1E4XI 5D7JB 1QYGH 4Y1TA 1MVUB 3ME0A 5KSAA 3LN5A 4OZ4A 3LVEA 1L6XA 1FAIL 1F1GA 3I85A 1O7DC 5CEXB 4FQPA 1FNEA 4J3TA 2TRHA 1QR1B 1D6EB 1IMHC 4LARH 3N40F 4PBXA 5I1CH 2SEBB 1T7ZA 5I19H 1FNHA 4PJ5A 1BGXL 3ZPDA 5T3XD 2GBAA 5MERB 1NAML 1DBBL 1WICA 5FA4B 3ZO0A 4E9TA 3DX7A 4EN3C 2IGFH 4Z7OE 1NAMB 5I0YA 5D4QA 3BCFA 3LAFA 3QJTB 4X50A 2VXQH 4RBPH 3DBSA 4WI2A 5I30H 3ZE0E 4FABH 4J2XA 4ZBJA 2GSIB 2VZOA 4PJGF 1RPUA 1MELA 1FVCA 4CDGC 5I1JL 3V5KB 4DVRH 1KZQA 4NO3B 1E65A 5I17B 2DQIH 4OGXH 1SOXA 2H6UA 1OSPL 3NIGB 3CFEB 5HVHB 4R5VA 2F0CA 2XN9D 1ZTMA 5F7BA 4N3UA 4NO2A 4FG0A 4L8BB 4N2OA 3DECA 3LQAC 1UCBL 3HG2A 1WHPA 3EGDA 4JFTA 4P5KA 5GRVK 1KV3A 1VSCA 2MTAA 5EA0L 3RPBA 3S2CA 2AJZA 4EZLA 4PB0H 4PJEE 5DK3A 4ECNA 4LAQH 2E7LA 2R69H 3BDYL 2X09A 3LKOA 4JO4L 3QFJB 4M48H 1GH7A 1YEKH 4BELD 1WP6A 1OALA 2ZX7A 2FBJH 3WUZA 3IDGB 2VR4A 5DTFB 2E8ZA 2NY2C 4U1JA 1GY1A 4JFZL 3S8GB 3K6SA 1EEYA 3QIBC 5ISZE 4QHLA 2JCCF 3BFQG 1LO4L 4OTXL 1MLCA 2EKJA 3NFPB 4HUMB 1NUNB 3Q2NA 5LGYA 4HF5H 1KSRA 1P7KB 1VPOH 2CHDA 3HZMB 4MA1C 5DJCA 5I6XC 5CIPH 1NH6A 4WWPA 4JMNA 3BMVA 3REVA 4HAFA 2GK2A 5DYFA 5BUPA 2W9DL 4AY0A 4J8RA 4LARL 3KG5A 4R2GD 4HXAL 1ZGLB 3TA3A 4UQ3A 4PRIE 5C0FB 5E03A 1N7MH 4TL4A 4MQTB 4WNJA 4LEEA 4Y2DB 3WFEL 3WS3A 4L23A 1Q9KA 4JFPA 2L7QA 2WLKA 3O6LH 4JFDA 5FYKH 3KNBA 2PYEE 4P46C 1GSMA 5D8JH 1R5WA 4AG4H 2CUIA 4JDZA 4PWKA 4WJKB 5BUGA 1ZLUK 2VH5L 1QHOA 1YN7A 3K6DA 4IRJB 3V0VA 1SEBB 3PP4H 2ARJQ 5E4AA 1TZGH 2MIZA 1NCDH 2VW6A 4PYGA 5DS8B 1XCTB 4MBOA 4TSBH 5F0LB 3A6CH 4XR8C 1BZQK 3NSCA 2DYPD 2R1XB 3BWZA 5CJ5A 3EDDA 1CICC 3SPHA 3UP1A 4NKQB 4PJ9C 4PS7A 1JRHL 2N01B 1F90H 4X7SL 4X7TB 4PEEA 3KLHC 3HE7A 1FVEA 3BEVB 3KGUA 3G5XA 4OZFB 4FFVC 2ZOLB 5EMYA 1M1XA 1RI8A 1R3HB 3MDJA 3QS2A 2FEEI 2P9RA 3CPLA 3I02A 4KUCD 4XP6L 2D03H 1NMBH 3BE1H 3GUFA 1CBJA 1GS7A 5EORL 2ODIA 3ZTCC 4Z7UE 2AVGA 3FCUB 3TZVD 2Q3ZA 2O93L 3AADB 3TFBA 1LM8V 4NNPL 3IJHB 4PG9B 4YHPB 4D8PA 3B2VL 4JM2B 1Z9MA 3VFTB 3JWDC 3HG1A 4D0BB 2XC8A 2IDTA 2PWFA 2VN4A 3EKCA 3VU2A 2O61B 5E5UB 4YNYB 2Y24A 4QF1B 5D7EA 1LK2A 1JPTH 1I3UA 2XSKA 3FTVA 5L8KB 2CRIA 4NAJA 5F3HB 2AI0L 2NR6D 1N18A 4U1NB 2WZ5A 3VA6A 2ZUVA 4KRNA 3TPKA 5IVZA 2GCYA 3JTTA 3GT6A 5IQMA 1R5IB 1ZT7A 2Z3FA 4Z0XA 5GHWL 3X14A 2WXMA 2AQ2A 3SBPA 1JNLL 4HX1A 4JO5A 3VFPB 4OIIL 3SGJC 4FEIA 4FADA 2QV2A 4PTTB 3LN5B 1X7QA 3BISA 4XXCA 5B7FA 4QXUH 4ZW3A 3TN0C 4JZNB 1NJ9A 2E86A 2Z6FA 1QACA 2NY6C 2MQ3A 5SWSD 3K2IA 2X2UA 1URLA 2QSTA 4IGBC 2KMWA 2W0LA 4D3CH 4DN4H 2VR6A 1BIIB 3CSBA 1U8IA 3RNKB 4FG6D 2IADA 5I5MA 5DT1L 1HKFA 1YUHA 4I0PC 3QXVA 1IGTA 3FQTA 4LSDA 1ASOA 3U6XA 4B95C 4DGYL 2C1PB 5JXEC 4DHLA 3MJ9A 1KTRL 3KYOB 5DRNB 3CXFA 3C75A 2IOOA 3SODB 1KTDB 2ZKXA 1JPEA 5IUCA 1G7IB 1PD0A 2NY7L 2N59A 2GTZA 4MNQA 1GOFA 4L37B 4M9OA 2WGNB 3X13B 4CKQA 4TTDD 4PRDA 5F7EL 5F9WB 3S3CB 5IJDC 1U8NB 5DJCB 1U30A 1QFPA 3RWEA 4IBVA 4R7NB 4WCYL 1NICA 1U33A 1UM4H 4KRPD 5KJRL 2NY6D 5DVPA 4DERA 5GRXG 1I7RB 3W9EA 5KVMC 1KIQB 3F7PC 5KOVC 1TUPA 1XSJA 1RXLA 4YHLH 2HXAA 3CFDB 3JT2A 5FV1L 2EC9U 3S4SA 1XGRB 4D9QD 4EZMA 1U8HB 2O6FA 4O02A 4X2UA 1GL4B 5IB5A 5ANMA 4HBCH 5CZRA 3KBHE 3QYCA 3NIFB 4ZFQA 2VDOL 3U0WH 1URZA 2W38A 3UZVB 1FFNB 1T21B 4FL4B 5D7IE 5DO2C 1W8OA 3HI6L 3D2UA 4EVNA 1Q9WB 5DD6A 3FF8A 3GNMH 4ORGB 4L0PB 2FRGP 5EO1B 5AQ0A 5EO0B 3BAWA 5DMGD 5IB1A 4QLWA 1UOLA 7CGTA 4R5TA 3HG4A 5I71B 1AGEB 4A37A 4JFQA 5IW1A 4N9GA 1IKNC 3ROOA 4DP5X 4QHMB 2XXFA 4C59B 1PZBA 5BXFB 4PJGE 4X4YA 3M46A 2Q8AL 4ODWB 4B41A 1QTSA 3KLQA 3KPSB 4NQVB 5F0PB 5JPNB 1P6WA 1MWAL 5I74C 3CLFH 4YQXH 3QUKB 4U6XB 2EUZA 4G3YH 4HWZA 3UJJH 5JTWA 1A8JH 2AJYH 2YMOA 5E1AA 5KVDE 3O8XC 5IHUH 4YDNA 1BBJA 1DE4B 3QJHA 3I6LE 2XQYK 3WXWH 2PTVA 3MLPA 1GYWA 4WRLA 4N0UA 5JDJA 3TO4A 1OAJA 4FMKA 5KANG 2WVSA 1D6EA 5IFAL 5BVJA 1Q72L 4B60A 1PLAA 3PREA 4TKWA 4CADB 5B38A 1O7DE 2F53E 1UT2A 4N86A 4H8WL 2AEWA 3SE8H 4YNYA 3BZ4A 1BVOA 4DP8X 3OAYK 5EF2A 1MAML 5JW4M 1VCAA 4L4TA 2IGLA 3RVVD 1VZHA 1A6AB 1E2VA 3MXVL 2HN7A 3APNA 3IE4A 2JKWA 3QIUC 4U1SB 3MV8A 1D3CA 3HA0A 4BQCA 3JTTB 2BOBA 4TYUA 3UGXA 5GHWH 3TNNA 5HHOA 1XF4A 1C16B 2M26A 2WXFA 3C2SA 3PABB 3W0WE 4MD0A 1X5GA 2R29L 5DZJA 1J12A 2X6MA 3WIHA 3B9EA 2Q76B 2XV3A 3BWAB 3NCCB 1AKJD 4JY4A 4LCCA 4M7JH 5C0GB 5HDBE 2IBGA 3OLDA 4ZOBA 4QRRD 5E23A 4GSQA 4OD2A 5K33A 2B9AA 3TWCL 1BXAA 3H85A 3L1FA 2K1MA 3S96A 1R3KA 5IOPA 5DZNA 1S7VA 3KGRA 5JDSA 3WN5A 3VWKB 4RWHA 3G9VA 4GQ9H 3VXTA 3CC5B 3S88H 2WB1A 4K2UH 1NDGA 3B3IB 4K7FA 1PDKB 3P2BA 2R0LH 1DUZB 4DP6X 4PTUB 3I75A 2EIEA 3SOTA 3HLAB 4NZDA 1RHFA 4HCRH 4OZFA 1CC3A 2LU4A 3BT2H 2ZOLA 3PHSA 4DPRA 3DMMB 2NY1B 5CU5A 4LLVB 3E8UH 5JHLA 2KZWA 5I6KA 3TCXA 5BZWA 1YEDA 4AH2A 3MHZA 2BSSB 1IU1A 1J9RA 1PZAA 2FJSA 4TUJA 2VR7A 2FT7A 1MEXL 5FM4A 1ZHNA 3QRGH 5HYFA 4JO8A 3RUGE 4Z1PA 2OMNA 1SDYA 4F7EB 1A7PL 4EDXA 3DOIA 4TSBL 2Y4SA 1LO4H 4OTXH 2EDNA 3EGDB 1JPFA 2DM3A 3P0VL 4U0RB 4AYID 1BX2A 3TA3B 5EUOB 2OX5B 4BK8A 4MA8H 5DJXB 2QVKA 5CGMA 43C9B 1D5RA 1DN0B 2OMXB 4UDUA 1S9KC 2V7NA 1VADA 2WAQA 3QULA 2F58L 1P84J 2PCFA 3MLYH 5ANMB 3UC0L 3D39D 1NCIA 3FJTA 3LH2L 4N25A 3ZLQC 1IKNA 2VDLB 2WQSA 3JZ7A 3T3PE 4G8GB 2ZAHA 4LDOB 4UCFA 1Q9WA 1G7IA 4KJWD 4AM0A 2B2XL 5DS8A 4Z7UA 4DPCX 2WN2A 3KM1A 4Y16C 1BF2A 1NZRA 1OGAD 4ISVB 3IU3A 4JLRA 1WS7A 3R8QA 3RWCA 4AVHA 2Q8BL 4PJ7B 3N91A 5EOCL 2DQ6A 2YXWA 5IR1B 3WE6B 3X3GL 3MRJB 2J44A 4NKOB 3K71B 1IQWL 4FNPA 4I48A 1HEZB 5LGHH 1XIWD 2EP6A 3K0YA 3OJ2C 3REWB 1HVXA 3FB7A 1C8PA 3CBJB 2Q7YB 4UQ3B 4Z7OB 4S11A 4KXZI 1T0MA 3NFSL 3CVHL 3UOAB 4OSUL 4YHNB 3LEYL 3G5WA 3QO0A 3QS3A 4R8WH 1ML0A 1P5UB 4MCZB 4PRPE 2NNRA 2VERA 1RK1A 3EFFB 1A14H 3WNJA 5BVJB 2BSRA 1E67A 2KZ1B 3IJHA 4PG9A 1A6ZB 1JOIA 2VMFA 1M4KA 2F2HA 3O2WH 4LCUA 3VSTA 1ZPUA 1OSZA 2WWKT 4PJIB 4YK4B 1AG0A 2WGXA 3UTPE 1E2ZA 2K45A 4KZDL 3QG6B 4IHOB 5J1AA 5JIPA 5ERWB 5C1MB 4GKLA 1MDAA 4N85A 5FGBA 2XVKA 1HDMB 1MCBA 4ONFL 4LSSH 1T3FB 3DX8A 5EEVA 1MNUH 3K1DA 5KBLA 3BO8A 1MRFH 4K9EH 3KCPB 3SYAA 3VW3H 5D5MA 5JUEH 1IIIA 5A2IH 2OQJB 1YA5A 5C2BL 3HJ0A 2ATAA 4O02B 3US0A 3HAEH 5IVXB 4LEBA 4KY1H 1PAMA 3WN5C 4Z7QF 2F53B 3TBYB 5C07B 1QFWM 3N2JA 4Y4FB 2XV6B 3GM8A 2XRAL 3GBLA 1CICB 5F3FA 3MV01 3BN3B 2Z8RA 2CJUL 3MFGB 3HW7A 3Q1SH 3KJ6H 1XGYH 1MCLA 1NCBL 2FGZA 3CC1A 5CP3H 2DLFL 3EXLA 1I1RA 4U3SB 4NYLB 3OB0K 5IB1B 4ZFGL 2F61A 3H9SB 1K5NA 2QZQA 1UM6L 3P9MB 1L3WA 1TETH 4PV8A 2MOVA 1D5MA 5F96L 5KBPA 4LGRB 1CGYA 3D4YA 2YC1B 4KK9C 4L9LB 4Y16B 3M45A 4AEIL 1QFUL 4JGMA 1EHKB 3E3QE 5EU3B 5CCHE 4N2NA 4MJJA 2K70A 4ZOCA 4OIAA 1NTDA 4C4KO 3IJEB 4Z7AA 4ZXBB 5HD8C 5GRZA 2QSVA 1YQVH 2N1KA 3L4WA 3FQWA 5AAPA 1FLTX 4GNKB 1RPQA 3K7UA 3UACA 3SDCA 3W5NA 3SPCA 1SFDA 2UZIL 1Q9OA 1T7VA 3OD3A 5CINL 3ZRSA 2AC0A 4FI7A 3IWVA 4ZXBC 5DWUH 5EU5A 1W6WA 2YAHA 1W72H 3GXTA 3K2MC 3WN5B 3HBGA 1RUPL 2WZPA 5DLML 1F3DH 1ZE3H 4RNRA 1RVFH 1DBAH 3V6OE 3AT9A 3HOGA 3HMWH 1EWHA 1UM5H 3LEVL 1SJEB 3SPVA 2X9ZA 2R56H 3ZE0F 1AQMA 5JUEL 1OAQH 4QOKE 5FYLH 3WIFB 3MOBH 2FO8A 1MXGA 5J3HD 1IB5A 3E3QC 4XCEA 4F57H 5E2WH 1NEZG 4WWKB 3P3YA 1RKRA 1HEZA 1HL5A 4PLJD 2YGOA 2YMTA 4ORZC 4Y4HB 4PGZA 3WMPA 1MCWW 5E8PA 4JHWH 1R3LB 5IJVB 3TVMB 4FFZH 5CINH 5KWYC 3NQKA 5KJ4A 3MV9A 2BERA 1TYRA 3DARA 1OAZH 1A0QL 3QR1A 3NBNA 4NQED 3CC5A 3ZQXA 1FI8C 1WCBB 1WWCA 3QWRA 4X9GA 4JANA 4PVNA 4QT5B 5INCA 5TFSL 3SDCD 4P2QA 2R0WL 2HX8A 3I6SA 3QIBD 4Y9FA 1AYOA 1HHHA 1I1AD 2BIPA 3AG4B 4UOW1 1RMFL 3ESPA 4P07A 3CVCA 3T4YB 3B2UD 2WIMA 2XFXB 3ZHLA 3HB3D 3CH8A 5EZJB 4JFFA 4ZNEE 1MFCL 4H7VA 5DMIL 4PWIA 1P5UC 1TJMA 2OJZH 4JO1L 3OKEA 1AD9B 1XAKA 1UD2A 5LWYL 4MYWB 4EE2A 5LCVA 4PREB 3TTYA 4AENB 4CMHC 1BD2A 2R4RH 2CKBH 3HZVB 2QGEA 2UYLB 3UH8A 2QGBA 4HIQA 5IREA 3GINA 1RK0B 4Z77B 3TV3L 4OZHF 3TBVB 1G1KA 2EDOA 4YLBA 5T3ZL 3S37X 3QUHA 4GSUA 5E00B 3T2OA 2QADD 3VH8A 1TTGA 4UV7H 1JVKA 2WZAA 4YDJB 4IKIA 1FHGA 5FOBA 4ISVA 5E94A 4PBDA 4X6CA 3C09B 3RWCB 1E28A 3TV8A 3ZDXB 4UILL 1CU4L 2NY1D 4MSWB 1SQ2N 1MJ8H 2R83A 1F6AA 4IIZA 4F9PC 3MR9B 5LAPA 1B2WH 4LL4A 1OAUL 4HH8A 2F15A 2X2HA 3LS4H 1LWRA 2W5PA 3REWA 4LP5A 4DFHA 1GZQA 2Y7LA 3ETBJ 5E6IC 2YPLA 3MJ6A 4GRLA 5GGTA 1UB5B 3VXOA 1XF4B 4ZXBA 4PBWD 4GYBA 1Z5YD 1OP3K 2VLRD 4JS7A 1F56A 3P4OB 3H42L 2CDFB 3G6DH 4K5LA 3V6OA 5KYYB 2XTJE 4OJAA 3DUUA 1UKSA 5F8RC 3IJYB 1IAIM 2JKRM 2I7OA 5E6IB 1RJCA 3R4RA 4PRPB 5EU4A 1JGEA 2E9WA 4NDMA 5CP7A 5D1QE 3VMNA 1LO5B 3FQ2A 2Q8BH 5HYJD 5FV2A 1KLUB 2NSQA 4G8IA 4NPYB 2D7TH 1QQDA 2HFGH 3X3GH 1YJDL 3T8XB 2A9MH 3X1GA 3CZLA 4N2BA 1ODUA 4GB9A 5HHXH 4XPAH 3Q5YA 5FYJE 4AKPA 4F8NA 2PP9A 2VRQA 3KVDD 4RIRB 5GSVB 1EERB 1EFXD 3CSTA 4IK7A 4GP8B 1RZ7H 2X0VA 2PW2A 3V4PL 3B7TA 2EDTA 5SWSA 3ZL1A 3IJEA 1XB6A 4OSUH 1O6SB 3SDDA 2EILB 3HG0A 2A73A 4DQOL 1A4JB 2NXZD 1CE1L 2XXMB 3GIZH 1RIVH 4RMQA 1V54B 1IM3A 1BMGA 1GGCL 1CD1B 2F5AL 4I0PB 3RVUC 1M9WA 3GXDA 1SM3H 1FNEB 3CN2A 1WFMA 4B9YA 3MNZA 3BAIA 5D70H 1R17A 4XAWL 3FSWA 1T7XA 3DYPA 1J5OL 5TE4H 2XWTB 3B9AA 3FK3A 1BQUA 5BJTB 4PRNB 2VLRA 1D7BA 3LHAA 4HKBB 4GMTH 3MBWB 3RRQA 3TYGH 2BJML 5JDSB 2D31A 1INQA 2QKIC 1UZ6F 2EC8A 3KYMB 2F74B 2WLNA 5E8NB 3ABMB 4QTIL 3PL6B 4CSTA 3US9A 1A4AA 4GW1A 3ARDC 1BREA 4HXBH 4TLTA 4XMKH 4JG9A 1GKEA 2BHUA 3EO9L 1SY6A 2BO0A 5KZCB 5FYKE 1UGKA 5IKCB 3QXDB 1M7IB 1A7NL 3TEXA 1L7IL 4PJ9A 2XFXA 1YDPB 3R7RA 1GAFH 2C9QA 4NI3A 2BVPB 4OJCA 1OSZB 2AK1H 1P1ZA 2K7PA 1JV5B 4EI5B 2X6BA 2WXGA 3IFNL 1KF9B 1UYWL 2GHWB 4MDJA 3VM5A 2QPDB 2H8PA 3U6XS 5I0VA 4LPUA 1HDMA 2R51A 2A74A 5IROD 3WS6C 4XMLH 1QHQA 1YPZF 1MSPA 2DQTH 1E3FA 4EJ1C 3N9GL 3PDGA 4BFIA 4CC0A 1NDMA 4NSKB 4OLUH 1VRSA 1ZOXA 1I9IH 3ASOB 1EIBA 2LGNA 1AR1C 1DN0A 1XQ4A 2OMXA 1PKOA 4RMWA 1J1OH 4DJMA 3AUWB 4P2RB 4WW2B 1CLZL 4L8CB 3QUXA 4BH7A 1HSBB 5HJDA 4TOYH 3VXSD 1GGBH 2QLVB 3ARED 3KPMA 3ABZA 3IKKA 4O4YH 1KC5H 3QEGL 5T33L 4ELKA 4FXGB 3HC2A 3GMPA 4KKBC 5EU6B 3WIFA 2ZYIA 4JPWH 1IQWH 3C6EA 5TPWL 1WFJA 32C2A 4K71C 3OAZK 3U7AA 4YOKA 4HWEH 2XKNA 3VXNB 4JVPA 5DZPA 3IFOA 4HEMA 4XTRD 4PUBH 1DYZA 2I7SA 2JNZA 1K8IB 3AT8A 3LSOA 1SMAA 1BDYA 5J12B 4J8RB 2P28B 3UG3A 2VRAA 2BWDA 3FN9A 5D5MB 1G5AA 4L2YA 2W0KA 2I69A 2VNCA 1CGTA 1CFTA 2UXFA 1HWGB 1F11A 2ALWA 2XETA 4Q4IA 2I9TA 1NGYB 3HVNA 4PGBA 1WFUA 3F7KA 2PWDA 3QA3B 1NCAL 3IJSB 5EU7C 4LKXA 3ZHKA 3HBZA 4J3XA 2QQKH 5FA3A 4XPBH 2MHAB 3QEQA 4WVRA 3S7GA 2R0KH 2VLMD 2NW3A 2EXWC 2E7DA 1JK8A 3RYMA 3E6FB 4A7TA 5F9DC 3FNKA 1A22B 4JFZH 1ET8A 5KS9B 2JKLA 1R3JB 4XTRC 5MP6H 4Z3JA 2R7EB 4QOKD 1HNGA 4AT6B 2F54D 4NZUH 1FNGB 2AKRA 2D3LA 1FBIH 3AU1A 3ETBF 4PV1C 2P46B 3CCHB 4R5XA 3WO4B 4OKDA 4NS0A 2XZCH 4BKTC 1E6OH 4S2SA 4XOAA 2A6IA 2HJFA 4RMVA 2PPCA 2WQUA 1NGPL 1PFCA 5AOLA 2ENYA 2H7WA 4P23B 1UXSA 4LDLB 1I8LC 3GI8L 3KZ8A 1U95B 3BLKA 4UQEA 1D2OA 3GJFB 3GSUB 5DK0A 1TJHH 4RGOL 4XXDA 5EDSA 3H54A 1YY8A 2J6EL 5FHBL 1TJXA 2WKGA 2X53A 3M1BA 3RWGA 4HOMA 2XUWA 2Z31D 3FU6A 3MVSA 1F3DJ 1JV2A 1EK3A 1CICA 3N50A 4KGJA 1DJIA 4I3GA 2HJKA 4BFFA 3NIFE 1Z5LB 1IT9L 5TDNA 1GIGL 1TSHA 1LMIA 4AUJA 4LU5L 1MJUH 2GITA 1T2QH 4WU5B 2YUXA 4PG2C 1GJUA 2VISB 3CUPB 4X8CA 3PL6A 1EVUA 5F89A 1VIWA 1FFTB 5I0ZA 4B9JA 1QRNE 2HVBA 3FTSA 4ZRGA 3BGFC 3N85H 1S9XA 3MLRH 4L3ED 4PVLA 4YDMA 5HI3D 3IKCB 3DX9B 1U93A 5KVFE 1XBDA 1NLBH 1BAGA 5ICYB 3SPVB 4PJ9B 3DO4A 1EGJH 1OE2A 2NUPA 1I7UB 3F00A 5H4YA 3U0WL 4U6TA 5EZIH 3THML 3CZKA 4O00A 2WSKA 5D7LD 4MQSB 5DUMH 1CD1A 3WFCH 4HF5L 3BKCL 4DVBB 4V1DA 5TGBB 4KDVA 4I1NB 2DQTL 4FC3E 3G6JF 4LOEA 3V8OA 1LO5A 2V5MA 4HYTB 1X7SA 3ILPB 4HZLA 5E2VL 1ZMYA 1KPVB 3ARWA 3G04B 5EU5B 1OO2A 2ZCHL 4FQIH 4TNFA 2Y7QB 5E2JA 4DP9X 2WO2B 3GBDA 4LIQH 3EBIA 2ICWB 3GEWB 1OL0A 2OZ4L 5MENA 5AKRA 1EZLA 2Z31A 4HV8B 1IEHA 2ERJC 5EC2A 4XO4A 2WYTA 3TC9A 5K9JH 2V5RA 3CN1A 4IRJA 5DDHA 4X98A 2ITDA 3FYIB 3ZE1F 3WFHA 4PJ8B 3A3YB 4QY8A 4HCFA 2PW2B 2DY2A 3NH7H 4W6XB 1NCNA 3WS6A 4R0LB 1XBRA 3DK2A 1F18A 1C1EH 2R1XA 4WSGA 1IBGL 3ZO9A 4M3JA 3GRGA 3S36L 1F6AB 3D08A 2DWSA 1UVQA 2B3RA 3I74A 5EIIB 4UDTA 3QNYB 4AYFB 4UV4L 3ULVD 4HIHB 1KYAA 2VKWA 2IDUA 4AENA 1FAIH 5AENA 2YPLB 4GRLB 1JF1B 1FO0L 2HT2C 4YWGL 3S35L 2XDHA 1PLBA 3FH8A 3DBXA 4J7RA 4L4VA 1KIRB 3KPNA 1WZKA 4AZ8B 1QLEH 2C4FU 2ZCKL 3KYMA 5HYJB 4WW2A 4L8CA 2UWEF 3D33A 3LN4B 3TU6A 3WEXB 4IRZA 4K9EL 2AF2A 1JL8A 3QFJA 1W8NA 5HHME 1XXFC 2NLJA 2KKQA 1A2YB 4DK3A 4ZUTB 2NX5B 3U9WA 3HCVB 2E7CA 5FYJD 5ID1B 2WOBA 3LQAH 1NM4A 4J1UA 1LWJA 4DN3H 1DLFH 1ZLWH 3LKRA 2V33A 4KZCA 2C3XA 3L3JB 4P9HC 3F05A 2ZXQA 2K6YA 1DSFL 4G7YH 5D5ME 3NFNB 3FCTB 4OFDA 2BRQA 1FL6A 3KWVA 4ODVL 5AW5B 4RIRA 5JLZB 5D71L 3KS0J 5FUZL 4PREA 3KLLA 1EUTA 2IBZX 1I8IA 1FJ1A 4KK5D 2WAHA 4C57C 4WHYH 2JCCE 1PNCA 1NCWL 2XN9B 3GMMB 4NQCE 4R97B 5KVGE 3ARGD 4XVTH 3ELQA 5GGRY 3UROR 4Q6IB 4UQ9A 1ZT4B 1M7UA 2CKBB 4NQTA 4UMSA 2F6AA 2X4RB 2MEJB 4QXGL 3KXFB 5E4OA 3R0MA 4M5ZL 3PWPD 4ZS6D 3C5SB 5E0QA 1HH6A 4G5AA 5KN5B 4WV1B 4GAAA 3RWDA 3K6FA 1TSRA 1B2WL 5DMIH 3G5VA 4Y19A 3D4GA 3NVQA 1KCVL 5KS9A 2UXVA 3ATDA 1DVSA 4NUJB 2HT4D 3V52H 4NLAA 2DEXX 2G30A 4X8JB 5EZLA 4EI5C 2B5IB 3O3BA 5IWLC 1OM3H 1AHWC 5EULV 2FAUA 3RFZA 1R4XA 1FE8L 2HKFH 3ZKQD 1CK0L 5GGVY 2Y2WA 4FKKA 3OC8A 4XC3H 1LO0L 2FB4H 5I1EH 2CKNA 4PGJA 1MAJA 1L0XA 2YRLA 2OL3B 3TBWA 1LK3H 5INDA 3L4XA 1WF5A 3ZR5A 1A1OA 1IM3B 1LLAA 25C8L 1NFKA 2Z7WA 4G8FB 3ZDZE 3O6MH 4WO4B 3X1NA 1N3NA 2VXVH 4BYHA 4AQ8C 4U1IA 3W9DB 3IF1A 3O45A 3CFIC 4GXUN 3TCLA 5C6TH 4ELMF 2GIXA 1JNHA 3AQDA 5E9DD 3U6RA 3LEXB 1Q1PA 2BHZA 4IBQA 5C0IB 2IWFA 4UM8B 5C09E 1CFNB 1FCGA 3DI2B 5F9OH 1J9CT 3UAEA 2FWOA 1SHSA 3GTTA 5I16A 1JMZA 3ZT7A 2VZSA 4XE5B 3PJSB 5I5IA 1Y18A 4G7QB 4XPFL 5I30L 2X4OB 2Z1KA 2WLMA 2EDKA 2KH2B 1HYRC 5EO1A 1Z3GH 3RY6C 4UM9B 2IWGA 3RY5A 5FO2A 12E8H 2NY4B 1B0GB 2P49B 4JRYE 4WEBL 5D93C 5TF0A 1FIGL 3MODH 3MJWA 4OZFG 5DTFA 3TZVC 4RX4D 2XKNB 1ED3A 3VQ2C 3VXNA 2IG2H 3K6SB 1AHMA 1M3JA 1WBYA 3BEWB 4KJPD 2H9GA 4M00A 4Y1AE 3WL9B 1G4RA 3MX0A 3VRLF 4LVEA 3HIZA 1YMHA 5AW0B 1BMZA 4JL2A 2Y06L 2V37A 4A63A 5I1KH 2OAAA 4W9ZA 1FSKC 4K5NA 2Q2EB 2WWMD 3BZFA 2OULB 1SJXA 2MOQA 3ZTJG 1YEIH 2D31B 4OLYH 1QFUH 4R96B 4P5TA 5MENB 3QR0A 5IQOA 3V55A 1R19A 3LH8A 3LIZH 4FJYA 1EEZA 1JGDB 5EBMB 5J1TC 3ZKMC 4N0RA 2P47B 2YD6A 3PYCA 2E0PA 1NBCA 4FXGA 3P9LB 1R5WB 3CNKA 4CL7A 4BCXA 3H4FA 3O3AB 4NRXA 1FYTD 3S36H 3NJLA 4RAVB 4YVNA 4Y2OB 1BM7A 1Z9PA 5C09A 2Z93A 3A6BL 2ESVE 2OV0A 3QDGB 4HUVB 2CLVA 3L13A 5CM1A 2LLNA 2WTRA 5DGQA 2L3BA 4LF3A 3QDMA 1I9JH 1JTPA 3Q48A 4CVZA 2FECI 2IGTA 5HYQA 3U2JA 2B15A 2BOBB 3CVHB 3IS1X 3QFGA 4DKTA 1JHLL 5HDLA 2VZ1A 2W07B 2XWEA 2I32A 1CTOA 1NIBA 3N0AA 3PV7A 3HC3L 4MJIA 3LDBB 1KJ2B 3CMGA 2DQJH 4YS4A 1OF2B 4XP5L 3CZFB 3FU7A 2WW8A 4H20H 1AS6A 4NZJA 2UWEE 3KLDA 2F58H 1QSEA 2QSCH 4S1DC 1U92A 2WOYA 4WY7L 2FYVA 5EBLB 3CPLB 1LXMA 1TF4A 3C5JB 3MTXA 1QBLL 3L5JA 2GY5A 4YHMH 4NZRH 4I88A 4HAKA 3RUGB 1R3JA 3EDEA 5F7KC 4Y19E 5ERWA 1A25A 3CZJA 4U1KA 1BEYL 2VXUL 4F7PA 4BFJA 5JW3L 4YSPA 4C56D 2ZF8A 5ILTH 2HCZX 3MO1A 4QRRE 5L2KD 1EO7A 2PTUA 4FFZA 5JPNA 3G9AB 1IBYA 4R7XA 3KPNB 4KXZH 5IVOA 5KSAD 3GMMA 2C3WA 2C9SA 3LVTA 3UCRA 1JGLL 4JKWA 3NAAL 4DUXA 1NAMH 1K8DA 3SYPA 4YX2L 4TSCH 1M1SA 4G5ZH 1WRFA 1N3NB 4ENEC 4MFHA 4XVSH 3P3SA 4KKRA 2XA3A 4BBWA 3R18A 1OTTD 3Q1EA 2I5YH 3IGKA 4J3OF 5FA3B 3MACH 3CSPA 5C9JA 1PFOA 3WLWD 1QUNA 5E4EC 3EZJB 4OCYH 5IMLA 1CDJA 1JPST 5E9DE 15C8H 2V5TA 3D0VA 4KI1A 1D6VH 1S7TB 4DETA 5E0FA 1IGJB 5T5NG 4V2CB 3QIWD 1NC2A 2WINB 4BUHA 1KYUA 2D3NA 4Z7WB 2CNZA 4LVOB 2WXJA 4X98B 1ICTA 2I9LB 3Q44A 1MJJA 1A6WH 2YSSB 2E6PA 4B0MB 2VDLH 4FERA 2AJUL 5TDPB 1WO2A 1IX2A 1OP3H 2OXGB 4ONFH 3ULVE 3CAFA 1OQXA 2XVGA 2QKIB 2DF3A 3GHEL 3SKNA 4PAZA 2X4RA 4WW1A 4B7IA 3APMA 2JWYA 3L16A 3U7WL 2E9BA 3IJ7A 5ABZA 5F0MB 1AXTH 3V5HA 1MEXH 5I8EA 3VXQB 3INUL 2FZ3B 1ND0A 4B3VA 5BQ7A 2ZWNA 4KKPA 2CIIB 5IB4B 3D18B 4LSUL 2GITB 3STZB 1RZKH 3KJ6L 3DUSA 2DBLH 2GUOA 3ZOAA 1N0XH 2HWZL 2DJMA 4DWHA 3VI4E 1EGJL 5D4IA 3I2CL 5G4OA 2BSRB 3DGGB 4AVJA 1ACCA 5JOFB 1NFIB 1OARL 1A8ZA 4ZMTA 4I89A 3NRFA 3SDYH 3MXWH 3U4BH 1B90A 2GTWB 4FN0A 1HIMH 1UASA 3LHPL 4MD5B 3S37H 4F15C 3LZFL 1A7NH 3X11A 3IF1B 3PFQA 2Q7YA 3MV9B 3FO2A 3UTSD 1Y1UA 1YMMB 3QARA 1KXQE 3CFNA 1GGTA 3DBXB 4LAJH 1QA9B 5HYSB 5HGDB 2X88A 3L6FA 4EZJA 4QRUB 2J8HA 2PCFB 2ADJB 2XX0A 4LDEB 4L5FH 3ZBMA 4PY8I 1T89C 3U30C 3H9SD 1XCQB 5KVEL 2FH6A 3RJOA 4HBCL 3V4LA 3WTVA 4G7RB 1MIMH 1ZLDA 2J12B 3ES6B 3P9WB 3X1EA 2ITCB 2P8MA 1CQYA 2OCJA 3HJEA 3BKCH 3O2DA 4RDBA 1PZ5B 3UBGA 3SOBH 2VXQA 1ZVSB 2R59A 4G82A 1XGQA 2V7HA 5IR1A 1L0PA 4WI6A 3PWLA 4HGMA 4OZFH 2R0KL 4U6YB 5DHMC 1WBZB 4ZD3H 4Y16A 1RLBA 4YK4C 4GQPH 2JXMA 1KPUB 2R2EA 4HH9B 3V5DB 4BFRA 4TNWF 1KB5A 4U33A 2DWDA 1CZ8L 4M43L 3VXUE 4H8QA 2EYTB 1SJHB 4OFPA 3OJDB 1IC4H 1XF2B 5DRWB 2VDKL 2NY3D 5I76A 1XDTT 2FJGB 2DYSB 3IGAA 3FCGA 5DVKA 3H3PL 2TRYA 5FW7A 4ZYKB 2EIKB 1E6JH 3ABLB 1DJHA 2YZ1A 4RFEA 3Q2CA 1NEZB 2NLJB 1BAFH 1WTGT 4X4ME 5HGBB