2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
2X88A 3NJLA 3QQXA 1PZCA 4KOBA 4YL4A 3BVDB 1ASOA 1CC3A 3AG4B 4HCFA 1J5CA 3EF4A 2HX9A 2GC7C 2P80A 3GYRA 4G7RB 3QJUB 2FNWA 5B3SB 2GSMB 5B1JC 5B1JA 3FSWA 2I7OA 3FT0A 5I6KA 4HALA 1R1CA 4G71B 4PAZA 4BWUA 5AKRA 5AZUA 1NIEA 4YSOA 3PLYA 3H56A 3WNJA 2H3XC 3WI9A 4KNTA 3MBWB 1CYXA 3ASNB 1BEXA 1E30A 4GP5B 1GY1A 1NINA 3FYEB 1AIZA 4YSCA 2YXVA 1OCOB 3ABKB 4KO6A 4NERA 5IY5B 3KW8A 1CUOA 4HHWA 2XYBA 1IC0A 1JZEA 3CDZB 5EHFA 4G70B 3EH3B 3FU8A 4AX3A 1PF3A 2EINB 2YAOA 3SBQA 1AG6A 2BP0A 1X9RA 4KNSA 3X1FA 4BWTA 3NP4A 5I6OA 2QT6A 3QJSB 5B7FA 4L0PB 1BXAA 1MG3C 2R7EB 4JHVA 1SDDB 4AI7A 1IKOP 2XV3A 2DYRB 3FPXA 1M57B 1JXFA 4A2EA 2YAPA 1KBVA 2HX8A 2Y1AA 3EH5B 3EHBB 2IDSA 2J55A 5FC9A 2QDWA 1A3ZA 1JZGA 1OE1A 2YAFA 2IWKA 4QLWA 4MFHA 5B7EA 1KCWA 1UATA 3DKHA 4FAAB 4WTQA 3NSCA 4E9RA 2DWSA 2PPEA 2Y69B 1JXDA 2JXMA 2AFNA 5AFAA 3NJNA 1PMYA 2OJ1A 3T6XA 3PXLA 3OD3A 1NIDA 3CVBA 1ZIAA 1E65A 3AY2A 5I5JA 4F2FA 1AZCA 3OMAB 3KW7A 2X87A 3X1EA 1AQ8A 1M9WA 2OCCB 1PY0A 2VW7A 4ENZA 3QJVB 1J9RA 1ETJA 1SFHA 2MRYA 1FWXA 1GYCA 2B08A 3T6WA 4A67A 1FA4A 1ET7A 3TBCA 3FYIB 3NSFA 2TSAA 4AKQA 1ZV2A 2ZXWB 4N4YB 2HX7A 3ABMB 2IH8A 2P80D 1PLCA 1QHQA 2J56A 4HCGA 4E9VA 2PPFA 3QPKA 2QDVA 4YSSA 4W1TA 3FSVA 1YLBB 2CALA 2JKWA 1L9SA 4YSRA 4YSAA 5I26A 2FQGA 3ZIYA 1JERA 3FU9A 3V9EA 2XV2A 2PP9A 1JZFA 5I6PA 1PNDA 3NJMA 2BWIA 1A65A 1GR7A 4DP1X 2UX7A 3N2JA 4G7SB 1ASPA 1L9PA 1BQKA 4P5SA 1GS7A 4TXVB 3SBPA 3T9WA 5D4IA 3NJKA 2DYSB 3JT2A 5B1AB 1AZBA 4JHUA 1A4CA 2PP7A 1J9TA 3L45A 2AZAA 5D4JA 4DPCX 2AANA 2J5WA 4DPAX 2BP8A 2IDTA 4AKOA 1BQ5A 4RH4A 2VSMB 1TEGA 3AG2B 3G5WA 1MG2C 1WS7A 2IDFA 2TSBA 3H4FA 3X1GA 2XXGA 4JKNA 1SHWA 4DP0X 3S8FB 2H5UA 3V9CA 4DP7X 3AG1B 2VM4A 1AZRA 3JTBA 4DP6X 1E5YA 1SNRA 1NPNA 3NJHA 1AANA 1AR1B 2BO0A 2HZHA 1N70A 3OMIB 1AZNA 3S3BB 1J5DA 1NIFA 2CAKA 4HIPA 1ASQA 3TU6A 2FJSA 3FSZA 2VSKB 1OE2A 2VN3A 3CG8A 4ZK8A 2XLLA 2PCYA 4YVNA 1L9OA 1KCBA 1RKRA 2B3IA 2BP0B 4AZUA 1J9QA 1ILUA 1AS8A 1HAWA 4M4RB 3ABLB 1NWPA 1JVOA 3CDZA 3DIVA 4G7QB 4GXFA 4GY4A 1HAUA 3NT0A 1NWOA 2NRDA 3X2QB 2FQDA 4YSEA 1L9RA 1CYWA 3NJIA 2A3TA 3SBRA 3ZX1A 1J9SA 1MDAA 3ZBMA 5TK4A 2YQBA 1SF3A 2IWFA 3WG7B 1TU2A 2BW4A 4A2GA 3U25A 2QPEB 2I85A 2JFCA 2QPDB 1NICA 3IBOA 1SDDA 2YAQA 5I28A 3NJFA 3CVCA 1JZJA 3OQRA 5ANHA 3FPYA 4KO9A 3T71A 3UADA 3WIAA 5E9NA 4GP4B 3QJRB 3X1BA 1JZIA 3ERXA 4YSUA 4FA7B 1NIAA 3OM3B 3WKQA 1E67A 4KNUA 1XB8A 2BZCA 4K9JA 2CBPA 1XB3A 1SF5A 1GSKA 1BQRA 1RCYA 3WKPA 2XUWA 1HFUA 3UAEA 3ABGA 3AW5A 2FT7A 2GB2A 5I6MA 1QNIA 3FS9A 2CCWA 3NYKA 5B1KA 2FQEA 2UXTA 2XX1A 3PAVA 4AKPA 1PNCA 2XWZA 1KBWA 2Q9OA 2I7SA 2YAEA 1ILSA 2XV0A 4UAHA 1ID2A 3IE9A 3FU7A 2XX0A 4Q89A 1WA2X 2DY2A 4BWWA 4E9WA 5PCYA 1NPJA 1KV7A 4A68A 1SJMA 4EF3A 5I6LA 3S3CB 3N55A 1GY2A 2GHZA 4UANA 2IDUA 2FTAA 2HRGA 1ZIBA 1MZZA 3QJQB 2J57A 2IDQA 4E9TA 2GIMA 9PCYA 4BDVA 3TA4D 6PAZA 2MTAA 3CVDA 4E9YA 1JVLA 1ZDQA 4DP2X 2CJ3A 3NJGA 4CSZA 1GS6X 1AOZA 2GC4C 1BXVA 1AZUA 1OOWA 3FSAA 4CSPA 6PCYA 2ZWNA 3IEAA 1AAJA 1W6LA 2BHFA 1RZPA 1BAWA 3ASOB 1ZDSA 1BXUA 1I53A 3FQYA 2PLTA 4F2EA 1SFDA 1DZ0A 1BYPA 4HAKA 1IUZA 1NZRA 1PLBA 2BWDA 3UACA 1NIBA 1KYAA 1WAEA 3S3DB 1F56A 2E86A 2ZONA 3TBBA 2BP8B 2YXWA 2PPDA 2Q5BA 3NSDA 3TASA 5A7EA 4P5RA 3S8GB 1IBYA 1A4BA 1XB6A 1ADWA 1DYZA 4E9XA 5LDUA 1A4AA 1ZPUA 2HXAA 4DPBX 3CZUB 1WA1X 4QKTA 2EILB 2XXFA 1FFTB 4DP8X 3HB3B 1V54B 1TEFA 2W8CA 3IN2A 1KDIA 4DP9X 4UF7C 2IH9A 2IAAC 3FQ2A 3AZUA 4A66A 3PAZA 1OV8A 4NAJA 2GI0A 1AG0A 4YVUA 3T6ZA 1TKWA 1A8ZA 5I5IA 7PAZA 3HEIB 3NP3A 5I5MA 4NB7A 1W8EA 3PCYA 7PCYA 1OCCB 1E5ZA 2W88A 3DTUB 3X1NA 3NJJA 2EIMB 3GDCA 2PP8A 1AS6A 2XVBA 3UGEA 2WO2B 4KOCA 3BQVA 1JXGA 3OMNB 1WS8A 2R7EA 3RYMA 1PAZA 5I6NA 3H4HA 2FT6A 4HZ1A 3FQ1A 4A2DA 1OCRB 2LLNA 2VMJA 4DP4X 1B3IA 4GP8B 1BYOA 1KDJA 1V55B 1NTDA 1V10A 2YAMA 4A2FA 2VW4A 1GS8A 2VM3A 1OF0A 2DWTA 1RZQA 3UABA 4HCIA 1JZHA 2PPCA 1T5KA 2BW5A 1SHXA 2RACA 4X4KA 2ZOOA 1W6WA 1ET8A 3T6VA 1ET5A 2CUAA 4YSTA 1X9UA 5PAZA 4BXVA 4WKXA 4N8UA 2AVFA 1CURA 1GW0A 2EIKB 2H47C 4W9ZA 3WNIA 4E9SA 4YSDA 2GBAA 3PPSA 1L9TA 2FWLB 4M3HA 1PLAA 3AG3B 3UAAA 1N68A 2EIJB 2UXVA 3FU7B 3SQRA 1PZBA 3GXUB 4KO5A 1JOIA 1EHKB 2HLEB 4HHGA 4G72B 2IWEA 2WSDA 4Q8BA 1AACA 4BXSV 3EH4B 4PCYA 1QLEB 1WA0X 4BK5C 2PCFA 1OE3A 1EZLA 2WO3B 1URIA 1PZAA 2AZUA 5D4HA 2VW6A 1XMEB 3D12B 1L9QA 1MZYA 4BDVB 4A2HA 1M56B 3PAUA 3MX0B 1NDTA 5TK2A 4GYBA 1IBZA 3IN0A 5B7MA 1PCSA 2UX6A 3QJTB 8PAZA 2DV6A 1VLXA 2FT8A 2UXFA 2XU9A 2BZ7A 2YARA 4KO7A 3NSYA 2N0MA 1KGYE 3ZDWA 2OV0A 5F7AA 5B1BB 2UXGA 4E9QA 2PPAA 4F7KA 1AS7A 2HRHA 2YAHA 4YSQA 3C75A 5F7BA 4DP5X 2FQFA 1OCZB 4YSPA
chains in the Genus database with same CATH superfamily
5KSBF 2X88A 4B3EA 3ZUNC 4K3GA 4RGMB 1NGWB 2N3JA 4MASA 3OWEA 3ARFD 1MQKH 2WTPA 3AG4B 4CUCA 3HG2A 3EF4A 4LKCA 4HJTA 2BCKB 4MCYB 3GSNL 4QRPB 3QPXH 2AJYH 4LCCC 5I76B 4NKDB 5F1IA 3D06A 2ID5A 2G3ZA 3CH8A 4UCFA 1S7XB 1RJYA 3MLWL 1AJ7H 5T3ZD 1JN6A 2EC9T 5E95B 5D5MB 2YUXA 3O9WC 3IJEB 5B21A 2RALA 2C9VA 4HMEA 4ZMYA 4OIBA 5K9OB 3BAKA 3VFTA 5I1IH 3CHPA 1RSYA 5JA8B 4PJ5E 4N28A 2EE6A 1YJDH 3IDUA 4NPJA 4Z0BH 1CYXA 1FZJB 2C3GA 4PJAF 1T0NA 4H0GA 2IBGA 3L4TA 4XAKE 3UGUA 1T0OA 3WY4A 4PP1C 5D7JB 4JAMB 3LZFL 2YKLL 3CXFA 3QDGE 4XOAA 1BOYA 7TAAA 2YRBA 2VO5A 4ZUSA 4M61A 2NY6B 3NIGE 2H6PA 4KDWA 4QPEA 5BRZB 1OWRM 5AYQA 1H19A 4WEUD 2ZCHL 3QFJE 3VWJB 4K3JH 4PJ9A 2LR4A 2OM5A 4AT6A 4ES8A 4Z0XA 1Z5LB 2Q8AH 4R4BB 5FV2A 5CCHE 2H3NB 4U1SB 1YG9A 5FLUA 1BPVA 5JPNA 2NMSA 3BSHA 2ADIA 1A5FH 3KPSA 5EUOA 5TDNA 1ZLUH 3IDIA 3SKOB 3AS3A 3UTOA 4WTWA 1RFDH 1VFUA 5AB9A 2WBKA 2XTSA 3ABZA 1L3WA 1NUDA 4PR5A 2Y2TA 1S7TB 4F5CA 5D2NB 4YE4L 4D0DA 4YGVB 5D9SB 2HVJA 2Z9TA 4M1CD 2A6KB 1JFHA 3H2PA 2QDWA 2W0FA 1EAPB 2X3BA 2HRLA 3U30C 4WUUD 2ROYA 4QLWA 3FTXA 2EDQA 2F53D 1UT2A 4PIBA 5CZXD 2Y4SA 3HHMA 3DX6A 4NZRL 4E9RA 2QQKH 4XX5A 3HS0B 1U42A 5ILTL 3LD8B 1L7TL 2IFFH 1XL4A 3RVTC 4EUPA 5DYOB 2OMWA 1HOCA 3C08L 3ZE1F 5HGHB 3PREA 3MROB 3WEMA 3FB7B 3GIVB 3D0AA 4XCFH 5JHLH 4TTDC 1YVLA 4WNQA 4L9LC 3FQTB 4UUJB 3GJFH 4K9EL 1PG7L 1UASA 3NAAL 4LVHB 2D73A 1KJVA 3LV3A 4GRLC 1NUFA 2Y3NA 1EO7A 1UGNA 3AXHA 4YEEA 2BINA 2IXQA 1YEEH 2B08A 4DN4H 3TBCA 4APXA 4FLSA 4B9IA 1QNZL 1IGTA 4H8HA 3U82B 1ADQH 1KZQA 3MBXH 3NA4A 4UV7L 2YPVL 3QXUA 1XXDC 4YXKH 5GZOD 3MV7A 4Q4IA 1N5AB 3FO9A 5EFIB 3HNSL 4NCDA 3MUY1 5AAMA 4ANUA 5J11B 3H42H 1L0YA 1RSFA 4FQIL 1XGUA 1YPZE 3LNDA 3LQZA 1S5HA 2JCCA 1PZ2A 4TLKA 1KTBA 3FT3B 5CMAB 2OL3L 3ET9F 4Z18A 1EANA 3VD4A 4XNYL 4H4NA 3NGBB 5EU4A 4MXWL 3GHEL 1EQWA 5KYUA 1A65A 3C5JB 2UX7A 1S2EA 4G7SB 1AR1D 1HZHL 2EEAA 5BOJA 2G0LA 4GLRI 1INQA 1D7BA 3WTYA 3EDJA 4XBGA 4AQ1A 1OAZH 2VJ0A 4BZ1H 3QHFH 3U7WL 4PVBA 4A7QA 4JFQB 2IMMA 5DVMA 4EZMA 3KYOA 5BRQA 4EBQH 1UZ8B 5C0CB 3R8QA 4OZGA 1XXFC 3RVXD 1S3KH 4M56A 2F54D 5D4JA 3VFRA 3AU1B 1KIQB 3TH4T 3N3EA 3N6YA 5D93C 3G04A 3G6JA 4WI6A 5CUSH 2X4PB 3RJDA 4YFLI 3ZRSA 2AXFB 1SJVA 1XR9B 4NQVB 1N26A 5AOIA 3MLSL 3WMQA 1K8DA 2EKSA 1CZ8L 1S7UA 4L4VA 3RKPA 2LABA 3EYSH 1X5IA 4WFHD 2HT2C 1J5IA 2Y3AA 3K6SA 3PF2A 2P5WE 1SNRA 2H26B 3Q2LA 5D1QE 3UPRA 4N2FA 2V17L 2CWRA 4RNRB 4XP9H 1EAOA 4PGEA 2FX8H 4XMUA 5ESVA 2XI9A 3ZL4L 4F2ME 1BFSA 3CLFH 4IBWA 4ZFGL 4LDOB 1RUAL 5D1QC 4GRMB 2CDGA 3SJVB 2ETWA 2I60L 5LKNA 1DBML 2AK1H 3T0ED 1BX2B 2JIXB 2SEBB 1ORQB 3LKRB 2XTJD 3IMRA 1C1EH 4YX2L 5CEXB 2ZAHA 3RVVD 5FYLH 3VYOA 3B6SA 2ZE0A 3GEFA 1AP2B 1OSZB 1CN4A 3ZHFA 3STLA 1PEWA 3ECVA 2QGCA 3FCSA 3EJUA 1HESA 3KPMB 4HJSA 5GS2D 2YOCA 3TIDB 1NEPA 4IEFB 1OT4A 3U7AA 3ZX1A 4XHJD 1NGPH 3ESPA 1TNMA 5SWSD 2N01B 1LWRA 2E7MA 4A2GA 3QDMA 1WBXA 5DD3H 5DFVD 4G43B 5A2FA 4N2HA 3M17A 3IFOA 5KW9L 3NEEA 4YHKH 4MX7A 1FCGA 4F15B 3K0YA 4J3OC 2ENPA 3ZGIA 5HVFB 3WDJA 3FH5A 2FB4H 3QZOA 2DQTH 3UTZA 1UFGA 2IGTA 1BXXA 2W65A 4FJ6A 4DAGL 1WT5A 2OJEB 1ZSDA 1LEKB 4OLWH 5KVEH 2VISB 12E8L 4Y16A 3NEOA 1X7SA 4C47A 4JG1L 2G2PA 1E3XA 1HVXA 3EJRA 4XB7A 2MOQA 1PNCA 4KWUA 3EZ8A 3L4ZA 1YMMA 3B7UX 2JKLA 4XN8A 4K8RD 4N8VA 1HHJB 1F6LL 1WFIA 1BEYL 1WA2X 4X7SL 3UTTA 5JDSB 4TYUA 1HL4A 3GMQB 4JO8A 4B41A 2K3HA 3CFCL 4EF3A 1ES0B 4P2QB 4R2GB 3FFOA 4XMWA 1GY2A 5ESQB 5EF1A 2WWOA 1TZ8A 2V0AA 2FWOA 4W6WB 2YPKA 5I66A 3FN0L 3FO2B 2VSDA 1I3GH 3ETBJ 9PCYA 4AVHA 2CKBA 3ZE2F 4AL8H 4JFXB 3O9WD 1OCWH 4FFYH 1JK8B 4HUCA 3MJ8B 3EDKA 3KL0A 3LKNB 4IKKA 5HI3D 5H35A 1OOWA 3KVQA 1K4CB 4X4YA 3AVEA 1EFQA 3U79A 4MNGB 1OANA 3CX2A 2ATKA 4PD4J 4PJ5D 2B7DT 3UO1L 3NFSH 3TT1H 3GHBH 1BAWA 1J88A 5HGBB 3WY3A 5FF6A 2J2ZB 5DVKA 3QXDA 1PKQB 3KCPB 3TA3A 1JNJA 4GW4B 3QDGD 2UUDK 1EFXA 1YNLH 4YIQB 1HK6A 3GZKA 3PHOB 4FQQA 4PJFA 1TPXC 5BXFB 1WCBB 2NSMA 1L0QA 4E36A 1EZUA 4FQ1H 1SMAA 4BK4A 1RAMA 1GTNA 3QFJD 4J5VA 3NSDA 2PCPA 3S8GB 2VDRH 4PWEA 4BHUA 2K4WA 4G83A 1ADWA 4MA3A 1HNFA 2Z7UA 2PXYB 1G5GA 3S6CA 1M2VA 3E9TA 1RPUA 4AVJA 1DVFC 4QKTA 2E7HA 3ULUE 4EIZC 1QI3A 5D5MF 4BGLA 1KLGA 1AQMA 2JMRA 3ZIMA 3DC0A 1SM3L 2P5WB 3MBWA 4BGDA 1DJHA 3ULUC 3MRFB 4PRAA 1IKNA 4G8IA 3I6GA 4F2MB 3EFFA 4PJXF 1U92B 3IJYB 4GSDH 3T2QA 1V27A 5I5MA 4PJ8C 3B2DC 4HS8H 1HH9A 3RVTD 1HDMB 4PRBB 2BNQA 3VMNA 3B9KC 3EGXA 3D7PA 4ZUVA 4B96A 4JQVA 4P23C 3ULSB 2EIMB 3FFCD 4HKBA 4NJAL 1NEUA 4XCYA 5IB2B 5IVXA 3DDFA 4ALAH 3OC5A 4TNGA 3A21A 4XH2A 2XVBA 2FLMA 4X99A 4PYHA 4UIKL 1FG9C 1A6AA 2YEQA 5AW3B 5IW3A 4B0MM 5KZCD 3ORJA 4TNVK 4TNWK 5SX4H 4OF3A 1KG0A 1LO2L 4RFEB 3WNMA 4OJCA 1T0PB 4LNRA 4LSQL 2QQLH 1R5IA 1MW1A 4G42B 5I8CA 3HAEH 4GMTL 3MOAL 1ET8A 3I85A 2EDKA 3PL6D 2DTML 1QSFA 3AAZA 4OCYL 5TQ0H 1JZ7A 5JPMA 1QATA 1CURA 3RQ3A 3FDWA 1UA3A 3VDCA 3C5SB 2Z31D 2UY7B 5DK2A 1JMXA 1MXGA 2IQ9L 4PBWD 4XMKL 2FJHA 4LLQB 1L5GB 1KGCD 2JJSC 4ODSH 4S10A 5HHXL 3HR6A 1EBAA 4FF9A 2NCMA 3BH8B 1J8HD 4YHPB 5ANME 3O4LB 4K5OA 1HQ4B 2F5AL 5I1JL 1KELH 3QI9C 4I18A 1BQUA 4RGOL 1KCVH 4MRCA 1OF2A 4B0MB 3RL2B 3VRJB 4Z7AA 1M56B 5B7MA 3T65B 2UX6A 4NNPL 1NC2D 1HKLH 2HT2D 5BQ7A 1JF6A 3U0PA 1E9QB 5I1HL 3FU0A 4FADA 3FB8A 3IK2A 3OAYH 3DURB 4PWFA 3WN5B 1ACYL 5LAXB 4JFEA 2N0MA 2O1AA 2WTRB 5A7BA 2KI6A 4LCYB 3BZ5A 2VJXA 5HHOA 1T7WA 4BQ8A 3BP7B 2VR6A 2K0RA 1RIUH 3PJLA 3UBXB 4GG6E 3PWNA 3CFKB 2LV4A 3LN5B 1E5AA 4D9QE 1E90A 2JJVA 3IDYB 1FC2D 4BUQA 1TPXB 3V52L 1AGCA 3W57A 1VFAA 3BVDB 4XVJH 5FGRA 4NHUA 4HOWA 1N3NB 3EIFA 2H0FA 2HX9A 3PY9A 2DL9A 3UTQA 3KBFA 1S9XB 3GPSA 5BUAA 4HCRH 3OXSA 4NC2B 2CIKA 5FYKH 4G8AC 4K2UL 1DQML 3STZA 4XB8A 2VUYA 4M5TA 2CGZA 2DLTA 4ZS6C 3FFDB 1A2YA 1I3RA 4J3OD 4KKRA 2Z65C 2ESVD 1HHIB 3LOWA 5GSRB 5E2WL 4Z7WB 2OBGA 3DRTB 3PJNA 4M7JH 5E08L 3N1MC 2JVUA 4X5WB 4LARL 4WGKA 4KMTL 4MQ7A 2AJVL 2BOCB 2NTSP 4AENA 5IMOB 3VCLA 4M43L 4PJ8B 4TULH 3TZVC 3BGFC 2R69H 5E5RB 4F7PB 4ZPVB 4M3JA 4N2GA 4JFDB 1BLIA 4N3UA 2Q7YA 4P4KA 1D3CA 4WW2A 5DJAA 3RDJA 3DO7B 3T0DA 1BG1A 2AHIA 3D25B 4P23B 4JHWH 1H5BB 2EDEA 4BWTA 3NRQA 2GY7B 3SY0B 1YJDC 3BD4A 4I0KA 2I69A 2D7TH 4N2NA 3MC0A 1DO6A 3AT8A 2DS4A 2HH0L 2F18A 4MDJB 3BE1L 4AI7A 3MLZH 3V4PA 5JHDE 3QCUH 1LK2B 3D0VB 3CFTA 4L2YA 4ABWA 1G7PA 1M57B 2OMNA 4NM4H 4W4OC 3JWOL 3X12A 3RE0A 3V0WL 4XCNB 3J27A 2YAPA 1KBVA 4LSUL 2ZXBA 3F5WB 4NBXB 5T3XL 3N1QC 4IOSD 1P7HL 4NLAA 1BG9A 4GIAA 2FDBP 2JV6A 4K3DH 2EAEA 3CXHK 4G9FE 1H15B 4FG6D 2Y7QB 1U8IA 2FATH 5I1CH 1AKJA 2X53A 3NSCA 4MQTB 2VR4A 3ILPB 3BGMA 4Y89A 3ROLB 1S46A 3VI4B 4G6JL 4I4WA 5C07E 4X8XA 4L3EB 3JZYA 3GLZA 3T6XA 1M2OA 3RWGB 3EOTH 4JY5H 2CDEB 1LO0H 4KQ3L 3LZQA 5HI4C 2V9QA 4YLQT 5KBMA 4GO8A 3ULVF 5ICZA 4BK5A 1T22B 4HKZA 3UGXA 2OCCB 3D2TA 3GM0A 4YBHA 3KBEA 4JQIH 4Y1AB 1RZ7H 1FIEA 4ZODA 1M7DA 4PRPB 1XIWB 2OMZA 3KPTA 4TOYH 4DO6A 5E8DH 4RWYL 1ZRUA 4OZ4A 4PJHB 1OT2A 2IH8A 4PLJC 5EU3A 5M94B 3B9AA 1WAPA 3Q6FB 4BHUI 4YFDB 4CVWA 3NN8A 4APQB 2B4CL 2XG5A 2DD8H 4Z7QF 2CBMA 1IBHA 1NOFA 4BQ6A 1S7QB 4DIXA 4LASL 5LJYH 2J1XA 1QW8A 1IC5L 2UZXB 3F12A 4U1KA 1D9KD 2G75A 2Y06H 3SOTA 1HE8A 1DQJB 2GW5A 5EDSA 4ZBJA 3ULUD 5LGYA 4J3XA 1QRND 4GKSA 5DK3A 3IDGA 1U93A 5HYJA 1ICTA 3OKNA 2KQNA 3MMEB 4Q9RH 5IR1A 3H0TA 1FBIH 1FAIH 4N0YH 1JSYA 4C56A 2NX5A 4K0OA 1CR9H 4G8GD 3KMDA 3B9KD 1A4CA 5B8CB 5JORB 3RUGA 1HI6A 1KY7A 2CJSA 3ZW3A 1LWHA 3QO1B 4W68A 3REVB 5KVGH 3KPPB 4L4TA 2X42A 4UTAL 3N85H 4Z3FA 2HG0A 4X6CE 2OZ4A 1T5WA 2ZCLL 5IW1A 1MJ7H 4E0RA 5F3BB 5T33L 2QVKA 4YXLL 1Q4NX 3X1GA 2CO1A 2IPUG 4U6VL 2V37A 3WLBB 4EZLA 2VTFA 3PGDA 4LDLB 1BZ9A 5EO1A 5GGVH 4NQUA 2O72A 2VXVH 1TQWA 3T1FA 1LJMA 3FF8A 4GXVH 1PIGA 3U6RB 5BS0B 4NQQA 2HKFH 5IT2L 3HB3C 4PUBH 2ITCB 4TVPL 5BMFH 5K9QI 5DZAA 1ZVYA 5B39G 3IJSB 1KYUA 4GW5B 1IQWL 3GSVA 3TZVB 1YHPA 3FSZA 4UNTA 1G9NL 2WIIA 1BAFL 3BLBA 4UQCA 3QUZC 4OJFL 3CG8A 4HZAA 2I5YL 5EOCL 4AIZB 4J3OG 4NO5A 4W9CC 3QG6B 4Q7DA 4H20L 2P24B 2XTLA 3JQOB 4F9LC 1ZLUK 2BP3A 3ZZQA 4JRYB 4UQ2B 4N3TA 2Q3XA 3F8UB 2NRDA 4NC1C 3BHBB 3DGGB 1L9RA 4ZUUA 1F58L 2AEPH 2FGWH 4QYOB 4HK0A 2RH0A 5HHPA 1J48A 4GT0A 1JPST 4DCQB 4PRDA 1U8HA 1QWHA 4QRRA 4PWGA 5JHDB 1BVLB 1YO4A 3PABB 3IRCA 4LHJB 1T1XB 4P57B 1ONQB 2VSCA 4DVBB 2IGFL 2R2EA 4GIOA 1UWGH 3NZ8B 2MNJB 2BVUA 1Q94A 4PW9A 2EDWA 2IH1A 4ABUA 3ENEA 1W8NA 2NOYA 3F00A 3BAIA 1BGXH 4PGJA 4JO3H 3P0GB 1XB3A 2ZUQB 3ESOA 3ZHNA 2GB2A 5HHNA 1JHKL 2BWQA 3MV11 2ZSVB 1YYMH 1FE8H 5IMLA 5LLIC 4OB5H 1ACXA 4EAEA 3VXMB 4XBMA 4N24A 5IEHB 5E2VH 5A16B 2A4ZA 2YPLA 5DA4A 3E7JA 3MR9A 4TNWF 5IJKA 4ZAKB 3GSOA 3VUAA 1MHCA 4D9QD 3EKCA 5I74C 3RDTC 3PWJB 1FGVH 4GBXA 2GHZA 5DJ2B 2Y07L 2WQWA 4F3FB 2EP6A 1JE6A 1TSHA 4NUJA 2G30A 2XPZA 5KANG 4KGLA 3DX9A 4RSVA 2WXKA 4IRJB 3H9ZA 4IU3A 3FCGA 3V0GA 2VL4A 1X7QA 2DQDL 1QTPA 2X2YA 1DQLL 4HZLB 4NNXB 5EOTB 3CC5B 3CVDA 3T3ME 4F58H 5HHMB 1EJFA 3GJFB 2I07A 4IJ3C 1TQTA 2BVOB 2ZWLT 3FSAA 3ARGA 1OB1A 6PCYA 1I7ZB 3EJZD 2DYPD 3CU1A 3CSYA 1P2CB 3E38A 3HZMA 4M7LL 4R7DB 4DTGH 4B95C 1JGUH 5IHLB 1SFDA 3QQ3B 1WDAA 2AV7B 2RFXA 3Q2CA 4I87A 4M8VA 3RNKA 4WF7A 1A7PH 2Z93A 5EZIH 4P46C 2QSCL 3F58L 1PLBA 2BWDA 2VM9A 1DLHA 1THCA 4IRZH 2ITDB 2CR0A 4PV9A 1AQKH 2XKSA 3S35L 1IT9H 2YHGA 2GJ6A 4M00A 2EYSB 4LPYA 4OLVL 5IQ7H 5J12B 3NACH 4X7TB 5F0JB 4BELD 1INDL 4NNYA 1AHWA 1URZA 3C5XA 3FQNB 3L3DA 5DT1L 4FTVE 3VO0A 3C60B 3LPOA 2PO6A 3QQ4A 4HETA 3BZFA 3S5LB 3W81A 3S9DB 3UAJA 2P7TA 4KMLB 4DPBX 2VXUH 5I1EH 1OHZA 3QEUB 2XXFA 3L4XA 2WQVA 2YLKA 1WC7B 5DHVH 3ARBB 3HB3B 5K9KB 2I26N 5T1KA 3E6FA 4RZCB 1QFUH 5E4EB 5CLWA 1MF2L 3BT2H 4XPTH 4A66A 5DC9B 1ZLVH 4XWOC 3MXVH 4XP4L 5E8EB 1TQCB 5DDHA 1NCWH 4MHHI 3HZ3A 4Z7WF 3WTVA 4LSSL 1UWXH 3FU6A 1CLYH 3B9EA 4QNPE 2VQ1A 1PQZB 3V8OA 1JNHA 5HI4D 3V10A 4HU8A 4ISVB 5D96C 5J4MA 2BRRH 3WD5L 1Q9OA 3N40P 5LB1A 1USZA 1RJZA 5EUOE 3KPSE 4PJ9C 5EBWB 3L5HA 4XAWH 4U3CA 3OMNB 1WS8A 4U6YA 4OLEA 4KRNA 3O6LL 1NCTA 3VFWB 3KR3L 3D33A 1MW2A 3E6HB 5JPNC 4XBPB 4NKMA 2B8OT 2QHRH 1NBZB 3G6DH 5JIHA 3IDNA 4UTBL 2VQ4A 5CJ8A 2OP4L 2A6DA 1NDGB 3VQ1C 4OCWL 4ZDHA 1FZKA 1F4AA 3PV6B 4BIKA 4NUMA 3LSOB 2FHFA 1I8MB 1CFBA 3HZYA 4J28A 1ZA3B 3IFLH 1OAUH 4G5AA 5J7CC 4HAGA 2OQJA 2Y6SD 4QDGA 2O6EA 5ESAA 2AVFA 2CRMA 3EJJX 3IS1X 1CD1B 3DGCR 4DKAA 5FO8A 1W2KT 2CLVA 1OGTA 2RD0A 4PI0A 4BKSC 3BUQA 3B5GA 3CFDB 4LQFH 3TCXA 2VOTA 3PU7A 4UT6H 3VI4F 4ADIA 4Y7OC 1I9RH 1JOIA 1S7WB 3SPCA 1KIRB 4GAJH 4E2OA 3S96B 3RDTB 1WA0X 2MTPA 2WQUA 2XV6B 1RH8A 4N2MA 5D4HA 2ED9A 1RZJH 3R4RA 2OXGB 2R23B 2DEWX 4B7LA 2VLJD 2XWTA 3MV7E 2CK0L 3MX0B 3D2UD 1IBZA 2E8YA 2GJPA 1MY5A 2YC1A 4FABL 4HIJA 4XMLL 1YECH 2JCCE 4KK9C 1XSKA 3GHPA 3HJEA 4IJ3B 2Y2WA 2YARA 1CFNB 4PJHF 5AW6B 1TTUA 3CZGA 4EDXB 5SX5K 5LQBL 4J27A 1QRKA 5BJTA 4X5XA 5CCJA 5DLML 5GGRA 3EGDB 3L8QA 1VESA 1O75A 2DW5A 4IHBA 5F7AA 4KNQA 1V7NL 4RAHA 2Q2LA 3FB5A 5SWQB 1MJUL 3QH3A 3L1OH 3QS2A 5TE6H 1W9XA 3LHPH 4Y2DA 5DSCA 1TT6A 3L3HA 3X14B 1TJHL 2WNXA 4Y5YC 5E2TL 4IBVA 1BFOB 4N87A 5IKCB 1QBAA 2D0FA 2LE9A 3MTRA 4M62H 3V5DB 2ZNWA 4OZGE 4N5EC 4FQHA 1G1OA 2XVLA 4CVUA 3QAQA 2XWEA 5GGQH 4LPCA 4PFEA 2VDKB 1OOAA 2P80A 4QRUA 4QHLA 5HDOA 1F3DJ 4OCNC 3KZ8A 3G6JE 2G9KA 3WIFB 5B1JC 5L0QC 1FVDA 4XBEL 4L4VE 1I4FB 1OSEA 4C83A 4FXLA 4EDWH 1GZHA 5EF2A 4IBZA 4ZO8A 2YGPA 2DKUA 2A9ML 2GBUA 4Q6YA 5LXVA 1MRDL 5DD6A 3TBVA 1ZY9A 2ZKYA 3WI9A 2Q2EB 2VR9A 4NAQA 3BAXA 2X4SA 4JKLA 1ZAGA 3MN8A 3V9FA 4NQDB 3GK8H 4JM2B 4ONHA 5ACLA 1DBAL 1F90L 4N2KA 5B38B 4Z3GA 2VDRB 2COQA 3RWFB 1OCOB 2R56L 2Q86A 2JK5A 4ZPTA 3F2LA 3ML8A 2WLHA 5C2BL 1ESOA 2DM4A 2YSTA 2FJGA 3IF1B 1P6AB 4LVEA 4UYPA 5D96B 2WUBH 5C0BD 2BOLA 2C34A 4B9ZA 2A6IA 3CWGA 2RQEA 4AGPA 3TFBA 1NGQL 5I8KL 3BPCA 4ODBD 5TE7L 3N43B 2R7EB 3BP5B 2UZPA 3NSJA 4WEEA 4JL1A 2VLRE 2Q76A 5I16A 2XPYA 1Y6MR 3WFDL 2EO9A 3H55A 1IC7H 2D7MA 3UO8B 1IMHC 1UHVA 1CFTB 1R17A 3VGBA 5IBLD 3SGKC 1OARH 4Y4FA 1MFAH 3VFGH 4K7PH 5IEKB 4U1IB 5DRNA 2E8ZA 3CHXA 1JZDC 3IRZA 4DO5A 4KAQH 3W82A 3X3FL 3NCYS 1CXFA 3IDMA 2L8AA 3B4NA 1ML0A 2V7HA 4HJUA 2G4EA 4L48A 4ZNEA 1TZGH 5CN3A 3L3KA 1LDPL 1OY3B 3D48R 3GSXB 1LEIB 3JV0A 4JJHA 2YN3A 4OZHB 4HX1A 2PPEA 1VENA 2Y69B 3N9GL 4FZEH 1WK0A 5D7LA 2R4RH 3Q9QA 4NWTL 3MACL 4P46D 1YMME 1JFQH 1E9PA 1RPKA 2VJ8A 1RXLA 3QUXD 4L37A 1E65A 1LO4L 3AM8C 5I5JA 3HAEB 1XCQA 4XI5C 4HK3N 4WWKB 3AJ7A 3UTTE 3QEHA 1AQ8A 3EOAB 5FOBA 4HBCH 4H88H 2VW7A 1WH0A 4Q97A 1S7SA 3IMWA 4ODVH 1OHQA 3QJVB 3FUHA 1EGJH 5E56A 1BQHB 5ICXB 2BNRB 1P4UA 3ESMA 4ZZFA 2Z92B 4G3YL 3FNKA 3IJ8A 4G6KL 3I50H 3FQUB 1WZKA 4L29B 3KLAA 4XPFL 2ZXWB 5DQ9B 5GS1B 1XF1A 1HILB 1UB6B 3VFSB 4DFIA 3OAYK 3IFNH 3FSVA 3QNYA 4KUCD 3US0A 4JCLA 4YSAA 3GMNB 3WY1A 1ID5I 4X6FB 4KJQC 3WXVL 2AK4A 3MGTA 3OKDA 1RUKL 5T8IA 3OR6B 2PP9A 3OHXC 1CXHA 1VERA 4U3SB 4OV5B 2H8PA 4KH9A 3W56A 5KUKA 2RCSH 1NDMA 4XWOD 5JQIB 4UIMA 3FRUB 2BC4B 3NDYE 1IFGA 1WAAF 4MS8C 5TH2A 1A6UH 2J8UA 4OM1L 3TH3T 4G82A 4ODTH 5CSZA 3L5XH 1IZJA 3MREB 4NKOB 4FFTA 4WFFD 4YDJA 5D4IA 2G5BA 4J1UB 2GK0B 4PJFE 2R1XA 4RRPA 3V8CA 1F6AB 1MRFL 4R0LC 4CMHC 3PP4L 2X4TA 4FTDA 3O41A 1JYXA 5HJDA 5DUPH 2BP8A 4M1GL 4PS7A 4PJ9D 2ALAA 3P9LA 1LM8V 4Y5VA 3OJVC 1MRCH 3Q2WA 1HQRA 1NAML 3BSZH 3G5WA 1WS7A 5IK3A 1QO3A 3IXTA 4NRZA 5CZRA 3WJLA 4Q6IA 3RWCB 5JIPA 1D2OA 2FJFA 3KPSD 1LO3L 1P1ZB 3WBDA 3KBHE 3P0YH 3T0VA 3RAJH 5MENB 1S7VB 4ZMVA 4PGZA 1R3JB 4B9PA 1JGVH 2O5YH 3DHPA 3L4WA 2ARWA 1I7RB 1G7HA 4JN2B 1H3PL 1ZHKB 4GMSL 3PHSA 1M3IA 4XNXL 1B4RA 4HIHB 1N70A 2EH7H 4P9HH 3OAUH 1C12B 3ARFB 2NY1C 3L48A 1J5DA 4W9GC 1KPRA 4Q2ZA 4ZMLA 3TN0C 5IOPA 4L23A 2X4OA 1D6VL 3DI3B 3KM1A 4DO4A 2YJLA 1KTKE 4NFBA 3GSUB 4Z3JA 1LMIA 1RKRA 1RIVH 2R29L 2K45A 4WJG3 4BKLA 3GSNH 2WQAA 1G6VK 2HMIC 2EDRA 5IVXE 1JVOA 2ICEB 5GIRB 2CO3A 3MLWH 3L7FB 5IG7B 4QCIA 1NWOA 3ZPDA 1I1FA 3WFZA 3AXLA 4JG5A 1UKQA 2NUPB 2C1PA 2ORBL 35C8L 4YHML 1DQQB 4RA0C 4YXHL 3I9IA 5MEOB 2WNKA 4ZT1A 2ZSWA 1IBGL 1DEDA 2HJFB 3LZFH 3ATEA 2YKLH 5ANHA 3MV7D 1KB3A 3RB5A 1D7DA 3APCA 4TLSA 4ZNCD 1QSFE 2YQGA 3WKQA 4C4KT 5AWNL 1NANH 4KNUA 1HC1A 1XB8A 1SVCP 3O3EB 2WLIB 2FO1A 1SYVB 2ZCHH 3UAEA 2J6EA 4JHAL 4WV1A 3ARSA 3RRQA 2CCWA 5JPMC 1KCKA 3PAVA 3U4KA 4A38A 1ZVSB 1P4LB 2DH2A 2NLJA 1PKOA 3HFML 3HVNA 1NEZA 2NQDA 2UYLB 2XJLA 4FFWD 1N18A 1UA6L 5EBMA 3KPRA 2DI9A 4JN1H 7FABL 4YE4H 3N55A 1T7YA 5IQ9A 3RIAK 2CGRH 5IM7B 4KKAC 3TVMD 4TQ8A 1XZ0B 2ZOTA 4P4RA 3ZKQD 4NRYB 4PJ7A 1DDHB 4I18C 1AXSA 5CBAB 2H3KA 3JTSA 5DMIH 1KTRL 1XHHA 4OFDA 1PG7X 6PAZA 3X13A 2KS0A 1T5XB 2J1YA 1T83C 5IQMA 1CDGA 2IOOA 2XN9A 4L4VD 1OK8A 1YN6A 4NZRH 3F7VA 4QLRA 1AOZA 1BXVA 2WXJA 4JFEE 5ILTH 5IF0A 5I1LA 1L7TH 1RK0B 2R0LL 4PTUA 3QJOA 5HHOE 5HGDA 3DNKA 5AENA 1SYSA 3S37H 3LZOA 3Q6GL 2EE9A 3PHQA 2ZOLA 5I8EB 2MCPL 4X4XA 4K9EH 3DUSA 1PG7H 3NAAH 3ZHLA 3UZQA 1U8LB 1NZRA 1WF5A 3UACA 1XGTB 5BUGA 2V8MA 5E1HB 4ATWA 1RZFL 4XODA 5J6HB 2B16A 3SDXE 4R0LB 4AV5A 3ESUF 1E5UI 5GGSA 1QNZH 4K55A 2ADFL 3LQAC 3MRDB 3UBFA 4UV7H 1OQOA 5HJBA 4NDMA 1A7OL 1X5AA 4P5RA 2K6WA 5JW4Q 3QYNA 3AMKA 3IAPA 4H40A 3HI6L 4NQEE 1A4AA 3NPZB 3GBDA 5FX3A 3DXAA 1JGLL 1KCRL 4U1GC 2A4EA 1U8PA 4P5MA 5LCVL 2EXYC 2OL3H 3CK0L 4ZS7L 4XNYH 4MXWH 3GHEH 3K81A 3QDMD 4TLUA 4PJDB 5DMJB 4M9PA 1OAYL 1IEBA 1XVSA 3BUBA 2H7WA 5ES4B 4AC4A 1DL7H 2NY1B 2G60L 3QB7C 3II2A 4RMRA 1GMEA 1IEAB 2DLEA 2I27N 2ZG2A 3HE6A 4OI8A 3U7WH 1BREA 4BBWA 1S9YB 4H8WL 4PRIA 2X6VA 1MREH 4JM2F 1VFBB 3CXDL 2V2XB 1NKGA 3VXOB 1JWUB 1Z3GL 3FT2B 3Q3GA 5AYUL 5K33A 2FR4B 5EF3A 3GRWA 5DRZA 4NQCA 3NIDF 4Y16D 2ADYA 1HYSC 3AY4A 3DX8B 1D5BB 5DZPA 2ZG3A 1EHNA 4P4KC 4WW2C 4EVNB 3FU5A 1RPQA 4PYGA 4LKXB 1YMMD 2LAGB 3MLSH 4Q52A 3ROOB 1R3HB 1W91A 1W72A 1TQVA 3UTTD 1FLRL 3MLRL 2FO4B 4MD0A 4TVPD 4AIEA 3N43F 4Z7NB 2V17H 1KDJA 2YAMA 2NYYC 4Q9QL 3T0EB 3TO4C 2BVQB 1Q90A 1UJ3C 2F1AA 4EUPG 5L2JA 1RUAH 2RACA 4RFNB 5H4ZA 5E5LA 3HHSB 4UQDA 5D55A 3D4CA 2I60H 4KJQD 2JXMB 3WGVB 4UM9A 1KXQA 1OD7A 2AITA 4JZNA 3T0BA 1DHKA 4LSPL 4YX2H 1JV5A 1AZZC 1Z66A 4W9ZA 2G0KA 4TVUA 1Z9SA 2GBAA 2VC2L 3HBGA 3PPSA 1MUJB 2WZ0A 4Z7VB 3U2IA 3MRLB 1PAMA 3VXTA 3AREA 1MFVA 5DHDA 2JLLA 1WWBX 5CHNB 1MNUH 1K2DB 3FU7B 4PU2A 2L4OA 2AW2A 5GPRA 4N68A 3P3YA 1ZV9A 3KPNB 5BO1L 1N5YL 3TA3D 1EHKB 4HHGA 3AITA 4L8SC 1IAII 3RL1A 1EFXD 1EZSA 1AACA 1TJMA 4Y9CA 4AM0A 1P7QA 1NCOA 4BK5C 5KW9H 1KSRA 4YAQB 2WTOA 4ZQTA 3VXRD 3G9VA 4F33B 5I82A 4BCYA 3LRKA 4H2AA 1AE6L 1MJJA 5G5DB 1QFWH 1A3QA 1N64L 4BM7A 3JZ7A 4X5QA 5I2IA 5ACZA 1Y0LB 1SRDA 3HR5A 2VUKA 4MB3A 5IQNA 4AXWA 1MCKA 4GQZA 4JG1H 3K72A 5AUMB 1JNLL 5I1KL 8CGTA 1AYRA 1MIEL 2HLAB 5GJSL 4QHNB 4GPVA 1ROCA 2FSEB 3U4EB 1RZJC 3G5ZB 3GNML 5HYJE 5KYYA 4LMQE 5FO7A 4PTTA 1BEYH 4X7SH 1G7IB 2DLIA 2DQGL 1UM6H 4TTGA 4L8DB 2FQFA 3MFFB 3PJSA 4OTXL 4C56E 3ZDZE 2F61A 3SKNA 3RUGE 3W5NA 2HFTA 3C6LB 4J6RL 3FB6A 4FI8A 2D7OA 4L4TE 5F7EL 3VVWA 4PHZA 2VAJA 2HMID 3IETB 1DN0B 2RJMA 3FN0H 4XCEA 4HCFA 3SDXB 2BNQD 4EMZA 5ABZA 5T5NG 4YR6B 4UQ3A 1ED3A 3ILDA 4HGWA 5HDLA 3QJUB 3VXQA 5I1GL 4MJIE 1VDGA 2A7BA 1H8SA 4PJGB 3X17A 4ZFOA 2D7QA 3U9WA 1A6TA 4TUOA 1XH3A 3PGFH 2EVJA 1FVCA 4N2AA 1B0GA 4WNJA 3EFDL 3UO1H 1BZ7A 1KN4L 1ZLVK 1GSMA 1TVHA 3VFUA 4B9KC 3CFJA 4FFVD 3COOA 4P8QA 3IGAA 3GGWB 1OTUC 1AIZA 3HZKB 2O5XL 4XRCB 3SB3A 3L2LA 1UWXK 1QSFD 3LH2L 4HHWA 1JZEA 3CDZB 2C9XA 3BQUC 5FW8A 3IU3A 2CHDA 1REIA 4KKLC 1PSKL 3ES6B 2JKJA 1ETZA 5CJXC 1NQBA 3ZKSD 4AYMC 4X6DA 5DHVB 2XT1B 3HJ0A 4AITA 5JNYA 4PV8A 1XD1A 4ZTPL 2J5LB 5BUPA 1YRKA 2A9DA 3HBZA 3MDJA 4LVNB 4G6ML 2P28B 3D8MA 1W16A 3GS0A 3BX7C 4KKAD 4QRRE 4XNBA 4AK2A 1I8AA 2YSSB 3D39A 5CFAA 5J57B 3TO4B 4U1LB 1MIML 2HX8A 3WENA 4BEIA 1UJ3B 1IAIL 2YMTA 3VI3B 4MD5A 3T3PB 4G5ZL 5CEYB 3WL9B 3WS3B 4H26A 1U58A 3LRHA 1C7TA 4N8VG 3KXFE 3D0LB 4G1MA 2PW2A 4L4JA 3RY6A 3V2AR 4XMPL 1UKSA 2O93L 1UATA 3DKHA 5LDSA 1I8UA 3RIFK 1OM9A 4JFED 2UWEB 3TBWB 3H7BA 1U95B 2AFNA 4NJAH 5AFAA 1WFJA 3OJ2C 5D1ZI 4HWBA 5EUKB 5GRWA 3MYZA 5HHOD 3AY2A 2AXGA 4X6BB 1N12A 4UIKH 3SE9H 1BBDL 4L8SB 2WQXA 4JDVB 1N8ZB 1T20A 3CBKB 4EOWL 1R75A 2PCFB 4QR7A 4U4IA 1SFHA 4E41E 4AMKL 1BVKB 1P84J 2MRYA 2CMRL 4HJ1A 2QL1A 3ZRFC 1AXIB 1F5WA 3RGHA 5H94B 4GMTH 1UUNA 1FZMA 2QADD 1S5IL 4C59B 3MOAH 1WBYA 3GT6A 3RWIB 3D85D 2OW7A 2JWYA 3MV8E 5LWYL 2QDVA 1WZ1H 4OCYH 1S78C 3JV4B 3SODB 3BKML 3LPGA 2CDFA 3ZMNA 3S3JA 4X80L 3RTQA 1XGRA 2C1OB 4KUZH 3TNNB 3A6BH 1O5DT 4J39A 1QLFA 1RHHB 5DS1A 1EO8L 2IQ9H 4XPBL 3SDCB 3TPUA 1KB9J 1EIBA 4XMKH 1HIML 4U1JA 2BWIA 3BRGC 3HI1A 1UVQA 3ETSA 4DP1X 2IJ0C 1YY8B 5MEQA 4UOQA 3TIEB 1FVEA 1PDKB 2CZNA 1KLFB 3EJYC 4L1BA 4YBQC 5CCGE 5HDWA 3SKJL 5HYSB 1XCWA 5IGXL 1UUSA 2IPUK 2JJWA 3R1GH 2IBZY 1LWJA 2DYSB 2ZUVA 5I1JH 3M1OA 2V3EA 2PKDA 3MODL 4LLWA 2PP7A 5CD5D 4RGOH 1S7RB 5DD1H 2GJ6E 4YNYB 4PP2B 3RIAF 3L3JA 3ZDZB 4UINL 2VDPL 1JGEA 4X2UA 2WN3A 1LQSR 3GB7B 5DA0B 3POCA 5T1LB 5ITFA 4A7VA 1UWEL 4JKKA 3P3RA 2VLKA 6CGTA 4LF3B 5E94A 5KVFL 2OTUA 2WJ5A 3K80A 3L95A 4JKNA 5H37A 5I1HH 2J6EL 4M48L 1I7TA 3QAZC 1AHWC 1PTZA 3AXIA 1J86A 1ACYH 1P6FA 2OMVB 3QFGA 2PO6C 1D5IL 1K5WA 2GSGA 2G2RB 1E5YA 3P11H 4IU2A 5D7IA 5GRJL 1G1YA 1HH6B 1NC4B 3MCKA 1TQBC 4J12A 2DF3A 4JM4H 3ZTJG 4AQ8A 2EUZA 2EDFA 1YUHB 3KWWB 2Y36L 4PJDF 2ODIA 4RDQG 4JANA 3Q8EA 3V52H 3DVIA 2D3LA 3BQUB 3S97C 1JV2B 3INOA 1E5BA 2ZXQA 5ADPH 3MGAA 3BI9X 2AEOA 3WUZA 1AKJD 4EZJA 2B3IA 3LS5L 1ILUA 2WBJA 1HAWA 3CDFA 4XTRD 1O7DE 5KS9E 3ABLB 5EN3A 1ODAA 4PVNA 1I8IB 3SN6N 4LLYB 3MVSA 2FQDA 5HGGS 3LVTA 1CYWA 4LEOB 2A3TA 3OZLA 4K2UH 1DQMH 2ESVB 3C6SB 1A1MB 3GEWB 3NRFA 3VGFA 1O7DC 3ZT7A 3OGOE 1NM9A 3IMTA 3ZBMA 2VDMH 5LGJB 3AS0A 4BA8A 3F65A 4CC0A 3GSWA 5FK9B 4PS8A 5K1NA 3ZYZA 1AO7A 4EN2A 2EIEA 5E2WH 3NJFA 1JPGB 3KGTA 4LARH 1T4KA 4KMTH 4P5TA 2KMWA 1D5ZB 2AJVH 5D6CA 2NXZC 2XNAA 2KDGA 1BMWA 1E67A 4TNFA 1U8QB 2WD0A 3LNHA 4MA7L 3W0WE 1MHPL 2RIKA 1VZIA 3GMPB 3KXFB 1JPSH 3WS6A 1DBJL 3ABGA 5E51A 1JWMB 3FH8A 3H3KA 1QG3A 1MCWW 3NYKA 4MLSA 4MSWA 4AQEA 2HH0H 4LBEA 1LDSA 2J4WL 4HXAH 2O61A 3BE1H 3EYQC 3KPOA 5CZKA 1E4KA 1DE4A 5HYJD 1QA9A 1QZ1A 3D3VA 3IWVA 2XX0A 1QSEA 1INEL 1B0RB 4JEGB 2Y24A 2GBTA 3JWOH 4Z7VF 3V0WH 1KGJA 1UCBL 3C87A 1ZXKA 4C56D 2NX5D 3AQDA 3EO9L 5IHZB 4XNQA 3G5YA 3F7YA 4L4TD 5AOMA 4KJYA 1E43A 5T3XH 3WJMA 2A6JB 4E41B 4NP4H 4XCCL 3DETC 3QJHA 3UP6A 4Y4KC 4WI8A 3BUDA 1QUPA 4YK4C 5JW5A 1IM9B 3NJGA 3AQXA 1OPOA 3MV8B 4ICWA 1GS6X 5LG1A 3T77A 2WY3B 3FHAA 2HT3C 1F1DA 3INUL 4QRBA 4AQAA 3DI2B 3MGOA 4M8QB 3ESVF 2G9HA 2X4NB 3L9RB 3TCLA 1GGUA 1OTUD 4KQ3H 2WLLA 3ZKND 2XQYA 3F6IA 4AW7A 3QUML 2Y72A 4G1EB 1MWAL 3W39A 3NZHL 3V0HA 4AYFB 4BQCA 3KEDA 4WO4C 1TQUA 3T8MA 3BEWA 3GXFA 3GUTB 2QV4A 1EXUB 1QAWA 5D7SL 3VH8B 4M6MH 1HL8A 1KT2B 1T66C 4RWYH 4Y4HC 4CC4A 4ELMB 3F84A 4YDVB 2F1EA 1BWWA 3OTTA 2BY2A 1D9KB 3HLAB 2XFXB 2B4CH 4ZMNA 1AGDB 3QAZB 1G4RA 4LASH 4LCWE 3BEVB 4L2LA 1IC5H 1QRNB 3VDAA 4BQBA 2IPTH 4K9EC 4ABQA 4X7DC 4FHBD 2YBGA 1IARB 2YEZB 3LYRA 3VGGA 3D52A 4IIQA 1P5VA 3QZBA 4OLUL 1A9BB 4QRRD 4J3TA 1GZHC 1TQBB 4PJGF 3ARUA 1P4BH 2JKIS 4AG4L 4G8GB 5I17B 1DANU 4KVCH 2FL5B 1KJMA 2VO8A 3AZUA 4QO1B 2BVYA 4XZ4A 2ROXA 3ALPA 2F58H 1A8ZA 3LN4A 4F7TB 1KBGH 3NP3A 4JGMA 4NB7A 4UTAH 3LEVH 2P52A 3MA9L 3O11A 3VJ6B 4GAYA 2Z34A 2ICWB 4HIEB 1E28B 3FTGA 5AYTA 4RGNC 3MRIA 5JA9A 1OSPL 2ZCLH 4ZUTB 2WSKA 1TJXA 3DTUB 4YXLH 1IV8A 4JPWL 3SDAA 2WQ8A 2PP8A 1GGIH 4XO5A 2YPLD 5I6NA 5CN1A 3NPSC 2WK2A 3WV0A 2EDJA 1A6ZA 3FQ1A 1Z5HA 2LLNA 3QBTB 5L2KA 4GP8B 3NEXA 5E6IA 4GBXD 4N20A 2OTWA 1CICB 3GSNB 4TVPH 1BIIB 1RI8A 1LGVA 2H32A 2X1PA 4HCIA 3EHBC 4WRLA 3U9UB 1KLUB 3PQYA 4J8RA 3TBSA 1IQWH 1FGNL 1G9NH 2CUAA 1MFCH 3VI3F 4UM8B 1TSRA 3BUTA 4OJFH 5CINL 4RISL 5EOCH 2C3VA 2I5YH 3T3PF 4WKXA 4WWPA 2EIKB 4WHYH 3WNIA 1ZT1A 1ZLWH 4IOIA 4FE9A 4H20H 3NZUA 5D7LE 5EEZA 3ARGD 4Q6KA 3HN8A 2PTTB 4LLDA 2HPOA 3EJYD 3T8VA 4YBQD 2AQRA 3ZU8A 2X6UA 4J2XA 2CHWA 1I1AA 1I8KA 5GRVL 3MRGA 3JWDL 4KO5A 2UWEF 4PJEB 4HT1L 3A4DA 1D2PA 2LOEA 1QVOB 3MCLH 4MMZA 3QJFB 1YUKB 5IB5A 3ALWA 5L4FA 2V2WA 3ZDXB 3CPLA 2GJ6D 2B2XL 2IGFH 4JKWA 4XXDB 3F6LA 3NCJL 2XZCL 3BVNA 1R46A 1MZYA 2CLRB 3CVHH 4O2CB 4Y4KB 5DJXA 1NDTA 5CGMA 3LY6A 3IN0A 4N9OB 5JYLA 4KKNA 4HHAA 5MI0B 3WTWA 2PO6D 3C5ZA 3KH4A 1YPZF 1NFDB 1IAOB 3UAJD 4KJPC 2LU5A 1CK0L 2F0CA 4OM0L 4YHIB 2VNCA 1JHKH 1I75A 2WOYA 3I75A 1JD7A 1QLRB 3U6XA 1X3DA 5T1KD 1WV7T 2J8UE 5KSBA 1T89A 5H2BB 2VR8A 2HFEA 1BLNA 4RFOL 4DK6A 5CEZL 4DP5X 2EIZA 3WEOA 3LXUX 2BDNH 1PZCA 3I3BA 2CQVA 1ZJBA 2Y07H 3GSQA 3S34H 1TTGA 1IQDB 2Y5QA 4OGYL 5F7WC 3MO1B 1EO5A 3CGTA 2VH5L 1MI5A 2DQDH 1DQLH 3KPLB 2HG5B 3G3LA 43C9B 4NRXA 4NP9A 1HXMB 1JVKA 4I1RA 2NTFB 2MQ0A 2YK1L 4QTIL 5I6KA 4YHOL 1A3RL 1EV2E 1K6QL 1K8IA 3L9YA 4Y5VC 5ECJE 5ENWA 4HWBL 4BH7B 2GI7A 3WJLC 5LVEA 4FLRA 4LCWB 4Q6IC 1C5DA 4XVUC 2GTWA 5CILL 2VQTA 5L6YL 2R8SH 5FS5A 2DQCH 3IXAB 3CFBB 3ASNB 1MEXH 2FRGP 1YN7A 4M7LH 4JFOB 4FCHA 1XF4A 2SODB 2EO1A 4PJIE 5EIIB 5DFWH 3C8KA 4HUNB 3UIYA 2QSCH 3KJ4B 3LKPB 3V6ZA 1LXMA 3E8VA 1N0LA 2GIYA 3B56A 2V33A 3ZKXC 1ZA6A 2GKIA 1FRGL 1OK0A 4X9GA 4AIXA 3S35H 4IOFD 2OL3B 3AS2A 1XF2B 4D8PB 4RGNB 4AX3A 4OLVH 1VADA 2D3NA 2VMFA 2NW3B 1SLVA 3EYQD 1INDH 2X2JA 1JHTA 4L8BB 3X1FA 3HPJB 4FL4B 2CLZB 4U0QB 3UROR 3BZ4B 3DX7B 3E2HB 3T2OA 4BCZA 2DQUL 4L0PB 4RA3A 1TMCB 1O6SA 3SO5A 2F6AA 4TLTA 4HQQL 4N5UA 3BUPA 3FPXA 1A6VL 1SEBA 5INDA 3LN9A 4XP6H 1FAKT 4AOFA 5EIQA 5BNXD 1FLTX 3VVVA 3Q05A 2J44A 1KTDB 2A83B 3OR7A 5D2LA 5F21B 4ODXA 3EHBB 3SYPA 1LD9A 1MF2H 2O30A 2OJZL 3QHZL 2Y7OA 3O6FA 4N90E 4XP4H 1FO0L 4QTHA 2AEIT 3BWZA 4LSSH 5D4QA 1RZGA 3TH2T 3L3OC 1A1OB 1OZTG 4NLHA 3H2WA 4NQTA 4YDLB 4FKHA 3SZKC 5GSVA 1GZQA 3MJ9A 3WD5H 2A9NL 2JJUA 4Q56A 3PXLA 2B9AA 3QQDA 2QMJA 4WV1C 3FTUA 1NCIA 4CVZB 4WKZB 2HCZX 1B3JA 1NMAH 4Y2DD 2X4RB 25C8L 2R59A 3O6LH 4WI9A 3ILQD 2XDHA 3V0DA 2DH3A 3KR3H 2ZQKA 5CF3A 4ENZA 2APVA 2A73B 3KPRE 1LP9A 3PWLA 4IDJL 4J3SA 4OJDH 4U1MA 1G6RL 2X9ZA 4MMYA 3WFHB 2Y1YA 4TSBH 2VKXA 4UTBH 3KYKL 4DHLA 2OP4H 1HXYB 4Q4EA 3OAZK 3VE0B 4OCWH 1UG9A 4U0RC 1MN4A 1ZTXL 5I18L 4K07A 5E1AB 2OMTB 2P80D 2WCSA 4KY1L 1GJUA 2PPFA 4ZO9A 3QPKA 3MRHA 4FQLH 2JKWA 3LXCA 4YSRA 1HTYA 4NJ9L 3MNZB 1KPUB 2WO4A 5F97E 5FKPA 5FWQA 3PHAA 3EJQA 5C0JB 2GSIA 1N2RA 1F4XL 3A6CH 4IGBC 3KNBA 4IBSA 3IGKA 1OPGL 2DKMA 4PRHE 4FOMA 5L7XH 2XKNA 3QIUC 1DVXA 3UZVB 2D2OA 1RJLA 1AH1A 1ACCA 1FFOB 3NJVA 2XZZA 3E3QE 1EEYA 2AJXL 1F3JB 5DJZB 4BSJA 1HN1A 2KDYA 2W9EL 3F7RA 2QR0B 1EJ6A 3E3QC 3ZTCC 3V4VH 4HJ0D 4R7LA 2CK0H 3KS0J 3TT3L 4ORGB 1DUYB 5IW6B 2A99A 2IDTA 3B8YA 4ABVA 1J7VR 3IGFA 3AG2B 4FABH 1ETA1 4ELMF 1BMZA 3GJEB 1FJ1A 3LS4H 4AIOA 1HHHB 3QO0A 1GJIA 5LQBH 4KDVA 3LX9A 3P73A 5DYFA 5DLMH 4DP6X 8FABB 2PTVA 4QRFA 4WUKL 1FORL 1K85A 1V7NH 3L4CA 1MJUH 4Y4FD 5IJCC 2FIKB 4KKQA 1XGQB 5AVUB 1T4WA 2BVPA 3ZDYE 1MNNA 4JPIA 2D31A 3DMMD 1TJHH 5E2TH 4PRIE 4LQ1A 4PJIB 2F74B 1ASQA 3KLQA 1U91A 1OGAA 3FT4B 3WO4C 3DROA 3FQRB 1SY6L 3KL3A 3WHXB 2A74B 2ENSA 4XPGH 3O0RH 4NUGL 4NQCE 3ZT6A 5E8NA 4L3CB 3P0VH 3K6IA 4P3CL 5D7LD 1YMHA 5E00A 3DIVA 5B1CA 2DEXX 1VGKB 2R2HA 4XBEH 1KF9B 2NY5H 5KYXB 1G9HA 2G2NA 2OR9L 3AT9A 3HN5A 5D8JL 3AY4C 2A9MH 2VDLL 1DQTA 4A6YA 1Y1DA 2DPKA 5K93A 1HJBC 5E9DE 1QEWB 3H54A 3VDBA 2Q7AA 4TUJB 5EC1B 2BIMA 3VFOB 1FFNA 3IBOA 4QOKB 4U6HA 5BV7C 3I6KB 1DBAH 1F90H 2CA4A 2IO5A 5ERWB 6TAAA 4LSVL 4XO8A 3QJRB 3X1BA 2R56H 1JZIA 2GCYB 5J13C 2FJUB 4D0BA 1ULVA 3TEZA 1YYLL 3CQFA 3L3OB 3NFNB 5C2BH 3QNZB 2LHAA 3HG3A 1N59A 5J1TC 2AK4D 5BOPA 2E9BA 1IGML 2E4TA 3L3GB 4BCXA 3DBXA 3QUYA 2FT7A 3R7QA 4PWKA 1NGQH 4JDEA 4PJBB 4CAGA 5DUBA 5I8KH 4Z5RA 1ZLEA 2ATPB 1YY9C 4JZOB 2H1PL 1CE6A 1OP5H 2QEJA 3IMVA 3VWKC 4HIQA 3S3PA 5C0DA 4Q89A 4YPGA 3WFDH 1DUZA 5E7BA 5DRWA 4A68A 2BVEA 4EE2A 2H2SD 4KZCA 1TUPA 5CLYA 1DSYA 4F20A 2CM6A 4U0RB 4PJEF 4HLZH 5KOMC 1HHKB 2HVBA 5I0VA 1IFHH 1RJCA 2NDGA 3X3FH 1AGBA 5EB9A 4WU7B 1IU1A 1GOGA 2EDYA 3BXNA 4QRSA 1SN0A 3ZDXF 4UZGA 1LDPH 4GQRA 1FZOA 1FG2A 1IGCL 2P3YA 1E9OB 3EAKA 4BUHA 2V7NB 4EO5A 2HAZA 3CDGB 2OMBA 4I3RL 1ZT7B 3BP6B 3N9GH 4B50A 2HWZL 4IGBB 3MACH 3FCTA 1RK1B 1MVUB 2P5PA 4QY8A 2UY6A 4WHTB 3TCTA 3WFEH 1NFDF 3VW3H 1LO4H 2VN5A 1RZIA 1T1WB 2R1YA 3ARDC 3UXFA 5EO0B 2OXHB 5CGYD 3B2UD 1ZTMA 5CR1A 2YQ3A 3QZWG 3LNFA 1IUZA 4GSXA 1PX8A 2W07A 4AE1A 5DZJA 1KYAA 3WXWL 1BJ1J 4X9YA 1A6PA 1OAXL 4G6KH 2OI9C 5IFAL 2E86A 4R3SB 1JN6B 4XPFH 3TL5A 5HP5A 2OSXA 3H1ZA 5CP3A 5FFLA 4NGHL 3IKCB 4MCYA 3L9BA 4QRPA 4AYDC 3W9EB 4XR8C 2HKHH 3P77A 5I76A 2C3HA 4NKDA 5LDUA 4K7FB 1S7XA 3WXVH 3RIKA 1RUKH 5D5MA 4ODUB 2IH3A 1HCVA 5A1AA 2C9QA 5C6WH 3IJEA 3JVFC 3MA7B 5EU6A 1JXJA 4MDRA 4JS7A 3FRPB 3G08B 1J1PH 2RMNA 5FGCB 1FZJA 3OJDB 4M1DL 3HC4L 2J3SA 5D7JA 5EG6C 4JAMA 3GXTA 4N90D 3MBEB 4IRSA 4YVUA 1S4IA 4WQOA 5KSVB 2GFBB 4AY0A 1MRFH 3PP4H 1WISA 2AQSA 4GQ9L 4K71B 1ZHNB 3MNDA 4CDHA 5IB3A 4X6DE 5BRZA 5IIEA 4M1GH 4XMZA 2OYKA 5C0FA 1NAMH 4JO2L 3VWJA 2CBTA 2X9YA 3P3TA 3MOBL 3GDCA 5FCUH 3MV9B 5CJQL 2MCAA 1Z3RA 2CUHA 5IP4A 2WO2B 4MLIA 4P05A 1TDQA 3CLEL 4R4BA 4YL9A 1YAZA 4U1SA 5C7ZA 2HVJB 2K7QA 4F7CB 3H4HA 2IAMD 4NFCA 2JB5L 3S4SB 2BPBA 3D39E 5CEZE 3SKOA 1SDYA 3KPRD 2PWGA 4XNAA 3HOGA 1H3PH 4GMSH 3L1EA 1G0XA 2W9DL 5KSUB 1S7TA 5F1KC 5D2NA 1OF0A 3PXHA 2PPCA 1T5KA 5D9SA 2Z7ZA 4HK3J 3C8DA 3G5XB 4R7NB 5DUML 5FO2A 5J13B 1CXLA 2A6KA 3ARXA 2OMXB 1D6VH 4YSTA 3B2VL 1EAPA 1SPDA 4AEFA 5KJ4A 2LTQC 3EYFA 2XN9D 3PG2A 3ZXAC 1U3JA 4FHKA 2R29H 4LFHD 3FHEA 4HPHA 3BSGA 5C0AE 4YSDA 4PCKA 3RY6C 3RGVA 4WNQB 2HTLC 3F62A 3HS0A 1BWMA 3Q8FA 4XGZB 4WI0A 5DYOA 4PBDA 5HGHA 3VACA 1RZKC 3MROA 3N5AA 3GIVA 2ORBH 1H8NA 35C8H 1R47A 4YHMH 2NY4B 3FQTA 4UUJA 4YXHH 3EH4B 3FO9B 4QAMB 1CG9B 1GH7A 1SOKA 1PZAA 3UEZA 1TCMA 2XZQH 4CN6A 2W91A 1XGUB 4LP4A 3NA9H 4JW3A 1JZ8A 1PFCA 1I7UB 4BH8B 3UP1A 4JB9L 3UEQA 5AWNH 2DQ6A 2E76C 1N5AA 1AFVH 3QJTB 2K9UA 5EFIA 1VLXA 3DX0A 3H8NA 3GBNL 2KL6A 4MNQA 4ONOA 2OA9A 4WGWB 1GPOL 3DXAD 4W4NA 1IIIA 5CNHA 3SHSA 1KYOJ 4RRPG 4JHAH 4ONGH 3ZL2A 3O6ML 3FT3A 1INQB 5GRXG 2JI2A 5CMAA 3RTQC 1UXLA 4YDKL 2WZPA 1H6UA 3ARDB 2XG4B 3KGRA 3DA0A 3GDBA 3ZY7A 3C5JA 3HFMH 3TVMB 1UA6H 3HE6D 4RX4A 4YSPA 2VKWA 4KOBA 4KU1A 5E2JA 3G04B 1YEWA 3MZGB 4S0SD 2XBDA 4JFQA 1SQMA 5AQ0A 1N6VA 1UZ8A 5C0CA 3AB0C 4S1RL 4DETA 5IB1B 3EW3B 4NQCD 2GC7C 3AU1A 1KGUA 1KIQA 4KVPA 2Z3FA 1QBBA 1J1XL 3K8KA 4JBSA 3L2MA 3K1KC 3RZCC 5B3SB 4FERA 5DMKB 5L88H 1PGRB 4HC1L 2X4PA 1RULL 4OVVA 3OF6A 4OSUL 3MJ9L 4NQVA 1XR9A 5ESVB 1GIGL 3KJ6L 5AKRA 3GIZL 3QCTL 5KWYC 1HL5A 2R0LH 3ARYA 1WQVT 4OGXL 3BAEL 2H26A 3Q6GH 4HPOL 4NXKA 2PETA 2AS5M 2C4FT 2MCPH 5E2UL 4RNRA 5FUZL 1SVZA 1TG8A 3GKWL 4AQ8C 3B6SB 1RZFH 2WAHA 4GRMA 1CUOA 3SO3C 3SJVA 4UM9D 1E4JA 3STLB 3P9MB 1BX2A 2JIXA 2WYHA 2FBJL 3K2MC 1ORQA 5J6GB 2UZIL 3GBML 4ZI8A 5CEXA 1A7OH 4Y2NA 4M6NL 3RLSA 4YFLF 4OBRA 1U3HC 1AP2A 1OSZA 3ARED 3QDMB 1AOHA 3QJSB 2RTTA 2WBJC 1BXAA 1JGLH 2D3VA 5LCVH 1FDLL 4ZS7H 3KPMA 1QASA 3TIDA 4IEFA 1ZVNA 4YDNA 1OAYH 2NY3C 1P7QD 2AI0H 3W2DL 5CKGA 1XSIA 5MP6L 2G60H 4G43A 2A4CA 3JYBA 4LL1A 2HUHA 2W65B 3HUJF 4PS4L 2BIPA 2XQBL 1ZLWK 1NEZG 2LTQB 4ZXBB 5AYUH 2L04A 1KENH 2IC2A 5JOPE 2OJEA 1LEKA 1J0HA 2VISA 4Y2OB 3I2CL 3SDYL 5I73C 3NJNA 4X7EC 5CD3A 5KSAC 2R2BB 3OD3A 1ZANH 3AMLA 2V5YA 3CXHJ 3D3VE 5J6SA 1WWAX 1MJ8L 2JJTA 2ZIDA 5DC0A 3RFZC 1QSEE 5GRYA 1FLRH 1SLWA 3PDOB 1HHJA 4EIUA 4PJBF 2EYRB 2HB0A 4LFHG 2ILLA 2X2IA 3B37A 1U8JB 5JDSA 3GMQA 3M6DA 2EZ0C 4CBPA 1ES0A 4P2QA 3T4YA 3T6WA 1A8JH 5LN8A 3JT0A 5GS0H 4UT9A 5ESQA 2TSAA 5E1GA 3MCYA 2WBWB 3FO2A 1UZ6E 2EADA 5AAPA 4JCMA 3F7KA 5FIEA 4LSPH 2XPGB 1JK8A 2ARJB 4P07A 4PWIA 4R4FL 1TTAA 3MJ8A 4HD9A 4KRPD 4O4YL 3GM8A 2VC2H 3LKNA 2QPSA 5ALCL 2VDQL 5EC2A 5DTFA 1MELA 4ZFFB 3QXDB 5G55A 5FUOL 1UH2A 4I9WE 5G2NA 5KVDL 5F44A 2IANB 1K4CA 1AI1H 4PN6A 4XC3L 1N10A 5FDYA 2CIIB 2EXWD 3N2JA 4CN4A 5T3ZL 3CVHB 3BVWA 5HGBA 1BQKA 1CTNA 5BO1H 3VXRB 5FFGA 2B15A 2J2ZA 2YD0A 4HXBL 4R84A 1GS7A 5F6HI 1LE5B 2DL2A 3SBPA 1PKQA 3KCPA 2RGSA 4GW4A 3NJXA 1U33A 4NBYB 3U1QA 1UKTA 4JLRA 3VTTA 5M7QA 4YIQA 3MXWL 3PHOA 5BXFA 1MAMH 1WCBA 1CI3M 2E9GA 3MLUL 3WIHA 2V9RA 4LLMB 1CQKA 4KK8D 3MJGX 3RZCB 1AE6H 4CC4C 2CXGA 1N64H 2JELH 4KUCF 2X0WA 3P30L 3NCCB 4XX1E 5JW4N 1BZEA 5F88B 4JREB 4MGXA 1UXWB 2B1AL 1F3RB 1MCIA 5I1KH 3D39D 3CD4A 3TX4A 5CEZD 1MIEH 1IJNA 3NJHA 1CWVA 3K4DA 3I6GB 3WN6A 3EFFB 4K23L 3GNMH 4WI4A 1HHGA 3KYNB 4IIQC 2DQGH 1SGKA 2P5WA 3Q1SH 3S3BB 4OTXH 2P8MB 4HS3B 3MRFA 5D1QA 1UD4A 2BNQB 5C08B 4YLCA 4ESKA 1OAQL 2FVNA 3S98A 4J6RH 1M7XA 5F7EH 3RX5A 2PABA 4F2MA 1Z9NA 4HKBB 4CU8A 1U92A 4P2OC 1QUNB 3IJYA 2EXTA 2Z4QB 4HUUB 5GGUB 1AS8A 2JKSA 1HDMA 4PRBA 5HXMA 1U3HB 2HN7B 3ELAT 4M4RB 4POZD 4PY8J 5B39B 1KG0B 5AOZA 4M5YH 3HKFA 5ETUB 1B9ZA 3OLEA 3ULSA 2WXNA 4WFEE 3H3PH 5IB2A 4N1HB 1NCDH 5EUOF 1FFRA 4A7GF 1MFEL 3BD3A 3SDAC 3KWXA 1A7RL 5F0MB 3EFDH 5FUCC 5L2KE 4P3DB 4R90H 15C8H 3AAZB 1IL1B 5ALBL 5FYJE 3SOBL 2O5XH 3PQYE 4K3HA 3VGAC 4G42A 3A4EA 1TITA 5E6IC 4MJ5B 4HEMA 5DK2B 1NGXB 3LH2H 1U6AL 2ZPKL 2WW8A 2NY5C 4WI2A 5F93C 3O2DH 4DQAA 2CBPA 1HFUA 4KHXL 3QQ9D 4KV5E 4ODHL 5FDWB 3HG5A 3RI5K 1NKOA 3C5SA 5KSAB 2YRLA 4ZTPH 4GUQA 2QQQA 4YC2C 3LZPA 1DJWA 3RFZB 1QQDB 1TF4A 4Q14A 4PCTA 1PJWA 5A6LA 4UAHA 1L5GA 4LLQA 4CC1A 5DF0A 5EDXA 5EA0L 3GXMA 3BH8A 4YHPA 3O4LA 1IAIH 1HQ4A 2ERJB 2X9WA 1A14L 5I0YA 3JBG7 3U0PB 5BQ7B 4G5ZH 2XKUA 2A0LC 4OLXL 5B22A 4PGCB 2VLKD 3RL2A 1Q72L 4XMPH 3T65A 3ZTDC 1KXTB 3UDWA 1S9WB 1E9QA 5EO9B 1BM7A 2FNBA 5I6XC 2OSYA 4ZMQA 3DURA 3H9SB 5LAXA 4G8FB 3TJPA 2XIDA 2GHWB 3LRGA 2WXHA 4OD3L 2WTRA 4TQPA 5KSBE 4LCYA 3NK3A 4OQTA 2AAVA 4YDIL 1T1ZB 1BBDH 2WCGA 3UBXA 4NHUB 1G1KA 3HMXA 2QADB 3LN5A 1T89C 3D85B 5C92A 2CMRH 2B5IC 3SCMD 3MAWA 2M83A 2F19L 2ZXDA 4LAJH 4HIIB 1PY4A 4CJ1A 1S5IH 1MI5E 3HE7C 1N3NA 3STZB 3LCYA 3FUMA 4PS3A 1U36A 1KXVA 2VR3A 4G9DB 4DEPB 3OKLB 3L5JA 2ZOUA 2HXAA 2ICCA 5DMGC 3BKCH 4YJZL 2P5EB 4CSSA 3S8WA 4PJAE 1FNGA 5IMKA 5EBLA 5E6SB 2V2TB 1TO5A 3PFUA 2OSLB 2EILB 3DVGA 2P9RA 3CX5K 4P0DA 3TTYA 3FFDA 1AO7D 5FYKU 3V4VB 1XT5A 4L18A 1HHIA 1KDIA 2FH6A 3A67L 5I0XA 3LNIA 3OKKB 1X5JA 5GSRA 2FUQA 5LHDA 1I85C 4P5TD 5F1NB 2DWEB 4QT5B 2R0KH 4F91B 3VU2A 1RIHL 4X5WA 1RY7B 3MODH 4LNVA 3RY4A 5C6TL 3VYPA 5TD4A 2BOCA 4P2OB 5IMOA 4R7VA 4PJ8A 4UINH 1PFOA 2WXMA 1BDYA 2VDPH 4F7PA 3L17A 4ZPVA 4X4ME 1J5OL 4QMEA 1IBDA 4S1DC 4PG9B 4H0IA 3LEXA 5JOPD 1UWEH 2XZAL 2K9FB 3DO7A 3EUDA 3D25A 1V7ML 1MCRA 5KVFH 4P23A 4XNZC 3SY0A 3SE4C 1N6QL 4M48H 2EDOA 3IMUA 4NO2B 5HJGA 3UMNA 4MDJA 4YO0B 5GRZA 1NM4A 3RYMA 1IBFA 1QSED 1D5IH 4K94L 3K6FA 3N41B 3OAWA 5GRJH 2V3FA 1S8DB 4NUQA 5D2LE 5DFAA 4Z76B 1NTDA 1V55B 4XCNA 2VYRE 4IW4C 4PEEA 5K1JA 4PB0H 3UABA 3MHZA 4OKDA 3F5WA 4NOFA 3PWPB 5KN5B 4DZ8B 2Y36H 1AKJB 1HWHB 3BGMB 3LH9A 1BM3H 2FZ3B 4ZOAA 4BXVA 5FEBA 1H15A 3LS5H 2Y7QA 3ZE1E 3VRIB 3IFPB 3R06B 4HKZB 3ILPA 2PR9A 1OP5K 1T2JA 4YC2B 2YZ1A 4P9ML 3ROLA 4I9WD 2AJZB 3ZVVA 2A38A 4L3EA 4KXZI 1QR1B 3RWGA 2OMZB 2CDEA 2JJSA 3GXUB 3VB9A 4FMVA 3ZN6A 2ZUTA 3SGEI 1T22A 4OZ4B 2NR6C 3MPCA 4BXSV 4Y1AA 1IM3B 3BMWA 3M8OL 1AR2A 3DRQB 3QI9A 4XN5A 4GKOA 4ZW6A 2FBRA 4PRPA 4PD4K 2K78A 2AZUA 2XG5B 1R3KA 4BFGA 1T7VA 1WJ3A 1JTTA 2YD8A 3TF4A 3ISWA 3QCVL 2Q10A 4U1KB 3OKEB 1N4XH 4V1DB 4PJHA 5I19H 3KLSA 3VFNB 5J1SC 4RQQB 3D18B 3DV6B 3Q6FA 4LLUB 4R97C 3TTSA 2XETA 4MA7H 5L8LB 1MHPH 4KO7A 1Y18A 5I6XB 1S7QA 3NSYA 1U93B 4EPSA 5E9NA 5IR1B 2UZXA 5C0GB 3S2CA 3OL2A 1LO5B 2MHAA 2J4WH 2QLVB 4H0LC 5TPWL 2NX5B 2UXGA 5DR5L 3W11C 1HI6B 5ADOH 2YAHA 1QHOA 2FH8A 3HRZB 4UB0L 5H37G 4ZFQA 2J12B 2LQRA 2E27H 3MMEA 4XB3A 4YLBA 3EO9H 5DGQA 5JIIA 4OIFA 4GG6A 2F9BT 4FS0A 1DBKL 2R51A 5B8CA 1P6WA 5JORA 2QFRA 1NLBH 3HE7B 2ZD0A 3REVA 4XCCH 3KPPA 5DD5L 5KG9A 1BZ9B 1EJOL 5EO1B 4QHKI 3QQNA 3T1FB 2UUDH 1SOXA 1YEKL 2DWDB 3Q1EA 1VA9A 1ZLSL 5E03A 1UOLA 2GSMB 2GK2A 4GUCA 3DOSB 2W60A 5A6IA 3N44B 2CBQA 3FMGL 2NQ3A 5CZVL 1R1CA 3WLBA 3INUH 2ZOWA 5FW7A 1KZYA 4CVXB 1M7IB 1VPOH 1NIEA 4PJAB 5L2KD 1O6VA 2AQPA 4Y19B 3NIFB 3QUMH 5E6ID 43CAB 3U6RA 5BS0A 1MWAH 1PCXA 4MVBC 1E4WL 3PQYD 3Q9PA 3IJ9A 2ITCA 2VZ1A 5DJ0B 4H5SB 1DJYA 1XH2A 2WZAA 3IJSA 4NERA 2CO2A 2FSDA 5IY5B 2QPUA 4E9LA 4GW5A 4DH2A 1IVLA 3TZVA 5HYQA 4OR1A 4A7UA 4M9OA 1WTGT 2YAOA 3OX8B 4XN2A 3SBQA 5IHUL 3MTXA 3QG6A 2IV8A 4M6AA 2ZWKA 5I6OA 1X4ZA 1LE9B 2P24A 1OIOA 3RX9A 4CA4A 4JRYA 4UQ2A 4D9RE 1MFDH 1I1AD 1TJGH 3IS0X 4RDQF 2EH8H 3BHBA 4JE0A 2E9IA 4OLUH 4XNUL 3B7SA 3FTZA 2R2EB 4QYOA 4JRFA 4W4OA 3GS4A 1QTSA 2A0LD 4AG4H 2IG2L 5JHDA 4EEEA 1P9MC 4KRLB 1T1XA 3KLHC 4GS7C 4HJGA 4P57A 1ONQA 5IROC 1UD3A 2Q20A 1NAMB 3PNWB 2R9HC 1DQVA 2NNCA 1NMCC 4E5XB 1FFPB 1XF3B 5GZNA 4JQXA 2YGQA 3C5ZD 3WIHL 3MA9H 4MFHA 2W59A 2XHNA 3UBGA 1KIPB 3FZUD 5E8PB 5K59F 4WTQA 2QMKA 1AHKA 4LU5L 2C3WA 2VQUA 4OD1L 1A1NA 3ZZSA 3E9UA 2XJKA 3T04D 5CS7A 3MR9B 3CFMA 3HPLB 1VKXB 4G9FA 3GSOB 2BERA 3O4OC 2XXMB 2EDNA 1UQSB 1DVUA 2ZSVA 3QUYC 4OUUB 4D94A 1FPTL 3KW7A 2Z8SA 3QVAA 1ANUA 4NO0B 3VXMA 5IEHA 2DM3A 4BZ2L 4JVPA 4JVUA 5A16A 4JFHE 4Y8AA 4MA8H 5C0EA 3ECQA 4GUOA 1CI5A 3DX9B 5KANI 4FZ8H 4LSRL 4IU3B 1PEZA 3UTSD 3ZE2E 4YFEA 3PWJA 4UV4L 4OF5A 3Q0HA 4FQCL 5DJ2A 2TAAA 3IJHB 2XQYG 4F3FA 4LSDA 2I07B 1FGNH 5AVRB 3KLDA 1MI5D 3UCRA 1F4YH 4IRJA 4R97B 1OB1B 3UG3A 1T1YB 2CALA 4HZLA 4RISH 1XFPA 5CINH 4NNXA 5EOTA 2N59A 1D5XB 1EDYA 3CC5A 5F7DB 4JRLA 5JHLA 3CSYB 4HUWB 3QEQE 3GJFA 3V9EA 3CVIL 2XV2A 3VB8A 4KITB 2BVOA 1PNDA 4YZWA 3VGHA 2NNFA 4KBPA 1I7ZA 4X98B 5GS0C 2APTA 1B6UA 4QEGA 1P2CA 2JF1A 1CS6A 3QQ3A 1IZKA 2AV7A 3HW7A 4KVNL 3QHTC 1Q9LB 4XX1G 4KKCC 3DIFB 2B2XH 2ITDA 5AG8A 4RAVB 3CUPB 3NCJH 3M7OA 4FYRA 2XZCH 1WGOA 2WVTA 4TL5A 5D6DC 4UQBA 2EYSA 4WY7L 1PX3A 3BT0A 3QISA 1M53A 4X7TA 3IDXL 4QRPE 4AKOA 3B1TA 1MG2C 2TSBA 3FQNA 4LOUD 3VSUA 3C60A 5HVHB 4JDTL 4DP0X 5D5ME 3S5LA 3EH2A 2QSTA 1CK0H 1DVYA 2DJ4A 4OM0H 1QMUA 2HLFD 3TYFA 4BZ1A 3JTBA 4F8TA 4AEIL 4POYA 4YWGH 4IM8A 3LPWA 1WC7A 2NXYB 3L5WB 2FLRT 3ARBA 2KYIA 3O6KH 4PJXE 5K9KA 2VAAB 1QKZH 4RFOH 1T04B 4RZCA 4ANWA 2O6CA 3US1A 3O6FD 3IPBA 5AZ2L 2CAKA 3WIIL 2HTKC 1E8ZA 3NCFB 2Z7WA 3UTPE 4M93C 5E8EA 2F1BA 4OIIL 5GGTH 4OGYH 4PJCB 5D7JC 3KGSA 4I2XB 3IGUA 2LT9A 3QUZA 5BRZE 1KCBA 5B3JF 1THAA 2VH5H 4OAWB 1QEXA 3OKOB 2NY6C 2BFVL 1XGYL 1PQZA 1V8HA 4F9LA 1SJEB 2XA8L 4AYBA 4ISVA 4OH2A 5E23A 2YK1H 5C8JB 4NZFA 4QTIH 4YSEA 4YHOH 4D9LH 4NKMB 1K6QH 2BLFA 4YHYB 3PYCA 5EBWA 1EVUA 1Z2KA 2CO6B 4PGDB 5CILH 3VXNA 1SF3A 2KHAA 5L6YH 3MLXH 1R3IL 1FZKB