2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
3TU6A 1W6WA 1MG2C 2XX1A 4YSTA 3OMIB 2BO0A 1JOIA 2E86A 1M9WA 3EH4B 3FSWA 4YSEA 2H47C 3PAZA 1ZV2A 1B3IA 1BXAA 4BXSV 3ZX1A 1ILUA 1E5YA 1KDJA 4G71B 2MRYA 3WI9A 4RH4A 2GC7C 4L0PB 3CG8A 2TSAA 1AS6A 3DTUB 3NJKA 1KGYE 2QDVA 3NSDA 4GP8B 3X1GA 2VN3A 4A2DA 2IWKA 3QJQB 2W8CA 3NP4A 1ETJA 1L9PA 5LDUA 5I5JA 1OE1A 7PAZA 4E9RA 3MX0B 3WKQA 1ASOA 2FT7A 1ADWA 2VSMB 4HIPA 1XB8A 1NIBA 2YARA 4FA7B 2I7SA 4JHUA 2IWEA 4DP7X 2BP0A 1BXVA 1E67A 1GY1A 3QPKA 3QJVB 1AG6A 2EILB 3FU8A 3T71A 1XMEB 4HHWA 4F2EA 3NSCA 1PY0A 4YSQA 5I6MA 2DY2A 2MTAA 1PLBA 5I5IA 2DYRB 1NPJA 2PCFA 3NJMA 3S3BB 1EZLA 2R7EA 1WAEA 2WSDA 1AS8A 4YSCA 1OE2A 5AFAA 2YAOA 2EIKB 1L9SA 3ASOB 3CVCA 5B1JC 1BQ5A 2YXVA 1PLCA 3X1NA 3V9CA 4E9XA 3WNIA 1VLXA 1PMYA 2ZOOA 3SBRA 3SQRA 2EINB 3X2QB 2VW6A 2HX9A 1GS8A 2JKWA 1JZJA 3IE9A 2UX7A 4N4YB 4YSOA 3T6VA 3U25A 4E9QA 1ASQA 2Y69B 2TSBA 2VM3A 4DP4X 3GYRA 2P80D 1OCCB 3IEAA 3NJHA 4QKTA 4YVNA 3QJRB 3NJFA 2FQFA 4ENZA 5PCYA 1NIDA 3EH3B 3BQVA 3OM3B 4A2GA 3WG7B 1NZRA 4A66A 1JVLA 3ABMB 4BK5C 1AIZA 4AZUA 1AANA 1PZAA 5E9NA 2AFNA 2PPFA 2ZWNA 3BVDB 4Q89A 2DWSA 3FU7B 1ASPA 1PF3A 1KV7A 1A3ZA 1ZIBA 2BW4A 1QHQA 2AANA 1QNIA 2B08A 1AZRA 2BZCA 3FSZA 1CYWA 4NB7A 1TEGA 1SNRA 2YXWA 4AX3A 2AZUA 1ZDSA 3WNJA 1AACA 3FQ2A 1WA2X 4BXVA 1J9RA 3OMAB 1AR1B 2B3IA 2J57A 2JFCA 3CDZB 5D4HA 2PCYA 3H4HA 3X1BA 1V10A 2PP7A 4DP2X 5B3SB 4Q8BA 5AZUA 2X87A 1GS6X 2Q5BA 3UABA 2XWZA 4A67A 1X9UA 3V9EA 3FS9A 3T6WA 1AZBA 1PZCA 3FPYA 3SBPA 1SDDA 2VSKB 3IN2A 1KCWA 4AKOA 1HAUA 1IKOP 4F7KA 5EHFA 5I6OA 4KNSA 4YSPA 2ZXWB 4P5SA 4G7RB 4WTQA 1MDAA 4NAJA 3AZUA 1EHKB 1CUOA 2CBPA 3S3CB 1JXDA 2XXFA 4YSRA 3TBCA 1AZCA 3NYKA 1E65A 1N70A 1KYAA 4TXVB 4FAAB 3NJIA 1RKRA 5B1JA 1A4BA 2BP8A 2GBAA 5I6NA 2IDQA 1WS7A 2PP8A 2YQBA 3IBOA 3X1EA 2HRGA 2P80A 3AG3B 4A2HA 1WA0X 4MFHA 1WS8A 4PCYA 2A3TA 2CUAA 1BQRA 1GR7A 2QPDB 8PAZA 2UXTA 2RACA 1W8EA 2UXVA 1GSKA 4AKQA 2WO2B 2XV0A 5AKRA 1NPNA 2BWDA 3RYMA 1ZIAA 3AG4B 1A4AA 5A7EA 2J56A 3JTBA 5B1BB 1PAZA 3FSVA 6PCYA 4KNTA 2J55A 2GIMA 3PPSA 3CVDA 3EF4A 2GHZA 3EHBB 2CALA 5D4JA 2FQGA 3D12B 3MBWB 1R1CA 5D4IA 5F7BA 2EIJB 2BWIA 4DP6X 5I28A 1NDTA 1TKWA 2YAFA 3T9WA 4BWWA 1J9SA 1FFTB 1NWOA 2I7OA 2JXMA 1M57B 1L9OA 4QLWA 2AZAA 2LLNA 1W6LA 2OCCB 3T6ZA 4KOBA 3TBBA 4A2FA 3TA4D 4HCFA 1J9QA 1NIAA 1JXGA 3FQ1A 3L45A 4GP4B 1HFUA 2YAEA 4W9ZA 4X4KA 1JZFA 1SHXA 1ZPUA 2IDUA 1J9TA 3AW5A 3QJUB 2NRDA 4HZ1A 3ZDWA 4YSUA 5I6KA 3NT0A 1JERA 2BW5A 1IBZA 1E30A 1L9TA 2IH8A 3TASA 2IDSA 1KCBA 2X88A 3S8GB 2BP8B 4HCGA 1WA1X 1J5CA 3X1FA 1V54B 4HALA 1NICA 2W88A 5F7AA 1CURA 2GSMB 3QJTB 1A65A 2XLLA 3NJGA 3ZBMA 3ERXA 1JZIA 1AOZA 1SF3A 2BP0B 4CSZA 1JVOA 3G5WA 4YSSA 3FQYA 1HAWA 1OE3A 3DKHA 4W1TA 4A2EA 1BXUA 2DYSB 3N55A 1CC3A 2XXGA 5B1AB 4P5RA 1F56A 3HB3B 1SFHA 1AAJA 5TK2A 3KW8A 1YLBB 2IDTA 4G70B 1TEFA 3S8FB 3SBQA 3UADA 4WKXA 2HZHA 3FU9A 1L9QA 3H56A 2R7EB 3EH5B 2N0MA 3OD3A 4HCIA 3DIVA 4N8UA 9PCYA 4DPCX 4HAKA 1L9RA 4AI7A 3AG1B 4KO5A 1PLAA 2GI0A 3PAVA 1IC0A 4G72B 5B7MA 4CSPA 4DP9X 1XB3A 2I85A 3T6XA 2VW7A 1RCYA 4KO7A 4NERA 1MZZA 4G7SB 1X9RA 4UAHA 1N68A 1OF0A 4YL4A 2WO3B 1AZNA 2H3XC 3CZUB 2XV2A 3H4FA 3CVBA 3ASNB 1NTDA 2OV0A 4UANA 2PP9A 2VW4A 2XYBA 3IN0A 7PCYA 3WKPA 5ANHA 1JZEA 3KW7A 3UACA 2PPCA 3UAEA 1A8ZA 1BYOA 2FQEA 2Q9OA 2QPEB 4UF7C 4E9SA 2EIMB 1BYPA 1M56B 4E9VA 4KNUA 1NIFA 3N2JA 3NJLA 1KBWA 3C75A 4A68A 2IAAC 1IUZA 2DV6A 2DWTA 2UXFA 1SFDA 2OJ1A 4JKNA 1I53A 1IBYA 1PNDA 4JHVA 1JXFA 2UXGA 3AG2B 1MG3C 1ZDQA 2PPAA 3AY2A 3QQXA 3NSFA 1SF5A 1AZUA 1ET5A 2YAPA 4G7QB 1OOWA 4DP8X 4ZK8A 1ID2A 2XVBA 1NWPA 2FWLB 4DP1X 2HX8A 3FYEB 2YAHA 3NJNA 3FU7A 1URIA 4DP5X 3NJJA 1FA4A 3S3DB 4GP5B 1SDDB 2XV3A 5I6LA 1ILSA 1GS7A 2FT8A 4PAZA 5I5MA 1RZPA 1PNCA 3PCYA 2IDFA 1ET7A 1FWXA 1QLEB 2HXAA 1JZGA 2XUWA 5FC9A 3CDZA 1CYXA 4YVUA 4F2FA 3ABKB 1SJMA 2HX7A 1AG0A 1GY2A 2GC4C 1ET8A 1OCZB 4M3HA 3HEIB 3JT2A 1T5KA 3FT0A 2XX0A 4BDVA 3FSAA 4K9JA 4E9TA 1BQKA 1UATA 4E9YA 2XU9A 3UAAA 1KDIA 2BHFA 1NINA 4DP0X 3ABGA 5I6PA 1PCSA 1MZYA 4GYBA 3OQRA 2GB2A 2FTAA 4KO6A 1A4CA 2J5WA 3PLYA 2CAKA 2VMJA 4M4RB 4BWUA 2VM4A 1BAWA 3FYIB 3PXLA 1XB6A 4KO9A 1E5ZA 3QJSB 4AKPA 2CCWA 1OV8A 1SHWA 5PAZA 4GY4A 1RZQA 2ZONA 3NSYA 2FJSA 1NIEA 2PPEA 2FT6A 2YAMA 2HRHA 2QT6A 1AS7A 3ABLB 5TK4A 4YSAA 4HHGA 4EF3A 6PAZA 4BWTA 1GYCA 2IH9A 5B1KA 2Y1AA 3PAUA 3UGEA 1DZ0A 2YAQA 2CJ3A 1BEXA 2PLTA 5I26A 1TU2A 4KOCA 2PPDA 1JZHA 3WIAA 4GXFA 4DPBX 2AVFA 4YSDA 2UX6A 1J5DA 3NP3A 5B7FA 3GXUB 4E9WA 1DYZA 4DPAX 3GDCA 1AQ8A 5IY5B 3ZIYA 3FPXA 2IWFA 2FNWA 2HLEB 1PZBA 5B7EA 3OMNB 2BZ7A 2QDWA 2H5UA 1KBVA 2FQDA 1OCOB 1V55B 1OCRB 1GW0A 4BDVB
chains in the Genus database with same CATH superfamily
4NNXB 4YZWA 4L5FH 2X4SB 4G7VL 5EO1A 2J7LA 2NW2B 1TEYA 1TLKA 4JW3A 2PWFA 5ENWB 2FGZA 3AADB 1GGIH 1KPUB 4PJGB 1P7QB 3AXLA 1TJIL 1F6FB 2UVFA 6FABL 3FB8A 3EGXB 1ERNA 4QJ5B 1O6SB 4Y1AA 4LOFA 1AGFB 4QHNB 1D7CA 3BPNB 1AKJB 3UTZA 4A2DA 3IMTA 1UZGA 3RWEA 3MLXH 1XT5A 3VGFA 3RU8L 1FNEB 3CZNA 1VPOH 4PP1C 3VU2A 4RFNC 2VIRA 4HD9A 7PAZA 2D3VA 3DSFL 1PIFA 5KBPA 5IJBC 1TZAA 4XXCC 4ZTPH 4ZMPA 1KSRA 4GIOA 3PWJB 3TGXA 1TQTA 1Z9SB 1NIBA 2AXHA 1X5LA 4LQ1A 43C9A 3CFMA 4ZMTA 2QPUA 5BQ7A 1JZ7A 3BAKA 2HVJA 3B2XA 4PRIB 2R51A 1QFPA 2VQUA 2WBJC 2ZCLH 1ZLSH 3T08A 4W9LC 5E8DL 5HPMB 1NCHA 4UQIM 3HN3A 4HHWA 4FTVD 1QPKA 3DBSA 1MWAL 5DJCB 4N0YL 1TQWA 3L3OC 1QLRA 4OQTH 4L8SA 1E4KA 2MTAA 3MUJA 4GG8A 2F54E 3NK3A 3PQYD 3ZDXB 4ZS6C 1UWYA 5BS0A 4KMLB 3OWRA 2N1KA 2PNDA 3L3IB 4PJ5B 1IIIA 3O6LL 4KY1L 2GITB 3GI9L 1TR7A 5DHVA 1QRNE 2WSDA 4UYPA 4WFED 2YAOA 1MQ8A 5TGBA 1U2HA 1CMOA 5DMYA 1Q9KB 1JNNL 3RILA 3GJFB 1XV8A 3L3DB 3GXFA 3LVTA 1T80A 4GPVA 4XNQB 3SPVA 2JMRA 4IK7A 2H3NB 1RSFA 4EXPX 3B7RL 1X7SA 2DTMH 1UZ6F 4OM0L 5B39G 2HFGL 4FQHB 1AMXA 4GUPA 4PJCF 2D7QA 2G9HA 3NG5A 5CP3A 3SY0A 3CIAA 4RSVA 1HI6B 2TSBA 3H9HA 5IUCA 1RJZA 1T2XA 1CZ8L 1S7VA 1I8MA 5CM1A 3MTRA 5A3IC 4E68A 2XPYA 3F12A 2BP5M 4EO5A 4KVCH 3R06A 3OM3B 4U1LA 3V5DB 4BBWA 4ANWA 3WEOA 1R24B 2FR4B 2X4RA 4LDCA 2OSYA 4AG4H 1R5IA 3ABMB 2OLDA 1HXYB 3QARA 1QWUA 2EXWD 4DQOH 3L4ZA 4AYGA 2AFNA 4ORGB 2EXYD 4E36A 4OGAD 5D7LB 2PPFA 2ZWNA 3N40P 3RNQB 3LKNA 3OKEA 1XGPA 4HETA 1TZ8A 4N26A 3I75A 4JREB 5ID1A 4AVKA 5ALBL 2XBDA 4Z7NF 1MHPL 1RZKC 5FOBB 2EC8A 2SEBA 1CN4A 3O6FB 5A40E 2Y4SA 4Y9FA 3WAJA 1ZTMA 4ZQTA 2Q8AL 1KB9K 2B3IA 3BPLB 1UT9A 1VRSA 1JV5A 4R0LA 1DVSA 4KUCF 5JHDB 4LSUL 4ADIA 4PVMA 2CBOA 3QIWA 3NGBB 5FKPA 4Y4KD 3ZTCC 4DFIA 3BSGA 4U1IB 4H2CA 1OP9A 5FYLE 2PO6C 3BO8A 4R2GD 2GW5A 5FYLL 3QWOA 3D85D 4HKBA 1UURA 1A7PL 2YXFA 4UAOC 1EAPA 4WKZB 3O6KL 1JN6B 4K0OA 2FJGB 4PS4L 1E3ZA 3BCFA 4R7NA 3KBEA 4JQVA 4ZS7H 1DTUA 1DUZB 1NEPA 4NO5B 3TYGH 5JHMA 2W9EH 1OAUH 1G9MC 4KNSA 5DMGD 4QHLA 1W15A 2NSQA 1QFWH 2XXMB 1UWXH 3U4BH 2VITA 1OW0C 3C6SA 1MPAL 5GZOA 5I1AB 1RQ5A 1GMIA 1S3RA 1BD2D 1JHKL 2WV3A 2P7TB 1TENA 2FECL 3VFMB 2R0LH 5E9DA 1J10A 1AD0B 3CDYA 5BUGA 2VTFA 3D48R 3RGBA 3NACL 5I15L 1H6EA 4ONGH 3NAAH 5F88A 3MGTB 2W91A 3NEXA 3OR6A 5K1VA 3NZHL 2XN1A 4ISVA 3D50A 4L18A 1HC1A 3TO4A 3B5GA 1SY6A 5D7HA 2Q1EA 3B9KC 5ETUA 1AQHA 3K6SA 1JPTH 1BREA 3KYMA 5B8CC 4CDHA 1FFNA 5B38A 4NNPH 3DDGA 1TU2B 4MNQA 5E24E 3P54A 2WO2B 2Q3XA 3SGEH 4IRSB 3IJHA 3MLTA 4R4NC 2A5UA 3NQKA 5C07E 2C3GA 2DWDA 3HVDA 2J56A 2IPUK 3LKOA 3ZDZB 4CA4A 2EC9U 3ARBC 3EOAB 5J6HA 1ETZA 3FTSA 3OKKA 4KI5C 2ZXCA 2Y24A 3CVDA 1T5WB 4IJTA 4OIIL 5I6XC 4H40A 1DUYA 4YXKL 3WNMA 1KLGA 2OXHB 2XJKA 4O02A 4UM8A 3E2HC 4AGOA 2VDLL 3LXCA 2I9LA 1XGTA 3L4TA 3QWRA 4JO1H 3MNMA 4L1LA 1KN4H 5L88L 5EZOH 3MBED 4NENA 1TPXC 3I02B 4U1JB 4I85A 5JR1L 5FEBA 4PJHF 4LEOA 3T6ZA 3OZ9L 1JZ6A 1RIVH 1B4LA 1K3ZA 2IPKA 4Z7VB 2XZQL 3RWHA 4CNIA 3L45A 5I1EH 5F6IB 2BCKA 3BN3B 2FJFB 1FH2A 1MFBL 5GXBB 3P2TA 4NUGH 3F05A 1UJTA 4UUJA 2NRDA 5C0RL 3LS4L 1IBZA 4N9OB 4NNXA 2X4SA 3BD5A 3OKLB 4KKBD 4UBDD 3V4VL 3S8GB 2NW2A 2ADFL 4HALA 2HMIC 3D07A 1NICA 5ENWA 1KPUA 1ACYH 4PJGA 1E8WA 1P7QA 4PPTA 4QLRA 3EGXA 4JM2C 1O6SA 1CI3M 3D52A 5IBLC 5ICZB 4ZSOE 3B2UD 1AGFA 2ZCHH 4HULB 2BP0B 1I1AD 2O5YL 4QHNA 4AM0Q 2VABB 1AKJA 2V9UA 3NABH 3LIZL 4IJ3B 1BXUA 5CZVH 3ELQA 1WGVA 3OR7B 3NMEA 4LDLB 2JKIS 3QUXD 4UM9B 2YGNA 1UCBH 1AI1L 5JPNC 1AQKH 4LRNH 1SGKA 2GJZA 3PWJA 3FZUD 3RVUD 1M7DB 1Z9SA 1UXWB 4P5TC 2B1OA 3S0PA 4PRIA 1VEOA 1CICB 4W68A 1XTMA 2DI7A 1TKWB 2WXFA 5DS2A 3PWVB 5HPMA 2V8LA 2JCCE 4KK8C 4DP9X 4KVNL 5DJCA 3EADA 4KO7A 5E8PB 1BQHG 5EIIA 5AAMA 1T2QL 4GBXB 5DXWA 1MWAB 2WQVA 5C0CE 5JZ7C 4A39A 2HJKB 1CFSB 2H3XC 3IAPA 1MRFH 2IH1B 1WVZA 3L3IA 5CLWA 4L05A 2LT9A 4HJIA 1SXSA 4MJ2A 2F54B 2GITA 4XBMA 1T6BX 2FD6H 7PCYA 1CDIA 4AYFB 4PJBF 3KW7A 5IJKC 3RNKA 1BBJB 2WQXA 3C5ZD 3GJFA 3L3DA 4DKDC 1YEGL 4XNQA 5C70A 4X5XB 1QRNB 1Z5HA 1MWOA 2H3NA 4B60A 3D39A 1G0DA 1U3NA 3PUCA 3UTOA 4FQHA 4QYOB 5E56A 1F3RB 1GGUA 4KKNA 4TSCL 1O75A 4UIKH 4YNYB 3SE3A 3D33A 3GJFK 2ZX9A 5BO1H 1HI6A 4AEIH 3Q1SL 5FM4A 5EU6D 1UWXK 4UZUA 2PXYC 4PJHE 1QACA 3ZVVA 1YEEH 4NHUB 1HKLL 4K3JH 2F15A 2YK1H 3FCTB 3M46A 2PYFB 2DM2A 4N0FB 4QAWA 3SPGA 1JXFA 2UXGA 2D03H 4GRLC 5FUOH 2XXCB 3CZEA 3QI9B 3QQXA 4PIRF 1R24A 3MKKA 3V5DA 3DLQR 2FR4A 2CKBH 5FUCC 2W60B 4UMGA 1HXYA 4KTEL 2YSTA 4ZMWA 1U95B 4ZQKA 4ORGA 5D7LA 1MEXL 2H1PH 3NDZE 4I1PA 3B83A 3RNQA 5IMLB 3LEXB 1XF5A 2ZZUT 1YVLA 5FOBA 3K6IA 4MA7L 2P1YA 4X9BA 4YHMH 3O6FA 2VMDA 3U46B 3UJJL 2HXAA 2PCPB 2V9RA 2XUWA 3TXAA 3GRWL 3VYOA 4KKQA 1F42A 2AJXL 5DUJA 4B5EA 2OX5B 4H88H 3JT2A 5DVKA 1Z2KA 3EUDA 1MWAH 3KVPA 1BXXA 4N0YH 4P9MH 2QVIA 2CCLA 1WAAF 3V0VB 3L4VA 3CTTA 4WKZA 1JN6A 4E9YA 2DIBA 2FJGA 5L4IA 4N24A 2YEVB 1PFCA 1DLFL 1EEZB 1MLCB 4NO5A 1OQXA 5IJCC 4X9IA 2ZAIA 1WC7B 3RIKA 2F0CA 3S5ZA 2GB2A 2BC4B 3AVEA 1ED3B 1ZSHA 4M9OA 2UV3A 2LU4A 3DYMA 2VMJA 4AGLA 4TNFA 3EYQD 2P7TA 1J12A 2HFGH 3OSVA 1CE6B 3JTSB 3PV7A 4FEIA 1SHWA 2EXYC 4ZOEA 3VFMA 1HIML 2DF3A 2PPEA 2AQTA 2DWEB 4NM4L 4MB4A 3WFCL 4U33A 4MVBC 5LAPA 3GHEH 3MGTA 5JOPD 2J20A 3CUPB 1NOFA 3QYMA 5IHLB 4JCWA 1G9HA 3RL1B 1QG3A 5C71A 2DEYX 3LQZB 2PLTA 5DD5L 5BZDA 2KQMA 2WMPB 2DWXA 4EIGB 1TU2A 3CFNA 3OAWA 4Y9EA 1JZHA 4RFEB 5EU3B 2YZ1A 2EAEA 4IRSA 1FBIH 3TVMD 4L8DB 3UZQB 2WXLA 3V7AE 3WDJA 2QVKA 2IWFA 1T5WA 3ETBJ 25C8L 5HYFA 5C07B 3HAEB 2IH3B 2OXHA 5B7EA 3GK8H 2BZ7A 3JVFC 3K1DA 3OMNB 1WEJL 2FH6A 3N85H 1KBGL 1BVOA 3S3JA 1GW0A 2NY5L 4LEXH 3S34H 1KJ3L 2VDLB 4U7SA 2Z7ZA 3SGKA 3N0AA 2MQCA 4PJ8D 4U1JA 3I02A 3CN4A 4ZW6A 4DFHA 2FX8L 5HTSA 4J23A 5AAPA 1KTKE 1ZV2A 3A24A 3QIBB 4XCYB 4JDZB 4HD5A 4EI0A 3HG5A 3CVIL 2YWYA 2FJFA 2VXSL 3BPCB 3EJYD 4GI9A 5AVWB 1DBKH 1A7PH 2NPLX 3RVVC 3LTVA 3WI9A 1EWHA 3T04D 2DL2A 5DS1A 1R5VB 4XBEH 1DSFL 1MJJB 4WTZG 5TH2B 4M62L 5HI3D 5GRJL 1YNLH 5I17B 1OVZA 1B4TA 1PFOA 1ETJA 4Y89A 3V4VB 1VESA 4F58H 1K2DB 1UFUA 4F7EB 3HKFA 2CHNA 1B3JA 3ILQD 4LCYA 1WAAE 2WLLB 3FHAA 3AUVA 4K7PH 1XB8A 1UH3A 5E5UB 5ICZA 2A38A 4F9PC 2WXRA 5KJRL 2DPKA 2NYYD 3EJTA 2BP0A 3NACH 1BXVA 5KW9L 2ZF8A 2VABA 2D7PA 2V5YA 1AG6A 2EILB 4ZSOB 3QPXL 3JWDH 4X7DC 1IGCL 2ZJSL 4FFZL 3QR1A 1D5ZB 3OR7A 3T71A 3NZHH 4TTDC 3ZT7A 4UM9A 3I6KB 3QUZA 3AREB 3O3EB 2HT3C 3N1MC 3WNLA 1Z9MA 5JNYB 1ZVNA 3T1FB 1Q0XH 3X11A 1N64H 2Y07L 5D1QD 1KFAH 3VRLF 4Q58C 5KSBF 1UXWA 2XN9D 4NKOA 3WIFB 3MRHB 1CICA 1QASA 1U8LB 3P0VL 4JZNB 3RKDD 1HL4A 1SDAB 3PWVA 5AFAA 3TV8A 3WFEH 4UT7L 4UOW1 3VXUD 4GMSH 1CDCA 1H0DA 2E74C 3AU0A 1GC1H 3C60B 2GFBB 3O8XD 3PE9A 1U2CA 4RAVB 5E8PA 5FECB 2L3BA 1NC2D 1YA5A 3L16A 4N2MA 1E9OB 2WZAA 2JCCB 3P73B 4GBXA 1MWAA 2CHZA 1FC1A 2HJKA 1DHKA 1CFSA 2IH1A 1IBFA 1WCBB 3FO9B 4ZUSB 1H6UA 5C0CB 2F54A 4U3SA 5JR1H 1WGOA 5IR1B 4B9FA 2AGJL 3QJRB 4HUNB 4GT0A 4AYFA 3ULSB 5KSAB 3FQWB 3GC3A 2XZQH 1BBJA 1W0WB 4G9FE 2ED8A 4X5XA 1QRNA 5J56B 1NAKL 5I74C 1TZHB 4MJJA 4CC4C 4QYOA 1KCSH 4YXHH 4YNYA 5BVPH 4FQXA 2MNWA 2CG9X 3DV6B 4XP6L 2FLMA 5CZXC 3W38A 4FLRA 4NHUA 5F9OH 1ZIBA 3FCTA 4XT1C 2PYFA 4N0FA 1ZTXE 2NT1A 4Y5XB 2FVNA 1AR2A 4LL9A 1SNRA 4PJHB 4KTGA 3WJJC 1ZTXL 3QI9A 2CK0H 2AZUA 1AACA 3QUGA 2UY6B 2W60A 2R8SL 4DTGL 3ETBF 3OLDA 1U95A 2Q0ZX 2Y7OA 2LU5A 3C8DA 5A16B 3UO1L 3LZNA 3WGUB 5IMLA 2IOOA 3LEXA 1WD9A 2K70A 4FQJH 4NWUL 3HR5B 4KV5F 1MJ7H 2P5ED 1MCOL 2ICES 4HLZH 3BVNB 4JFHD 1JPST 4P2AA 4AKOA 4C4BA 3MGAA 3U46A 4Y16C 2PCPA 4HWUA 3NH7L 1U58B 4WTWA 1FSKC 3GNML 4K3GA 3N42B 2OX5A 2ZXWB 3L5WB 1IB5A 2KERA 4KVNH 3VM7A 2F7QA 3V0VA 1KYAA 4LK4A 4Q6IB 2B16A 2YN5A 5E2WL 4BZ2L 5J1AA 2WQRA 3NSJA 1KN2H 2A74B 1EEZA 1MLCA 1T83A 3CDGB 5KVDH 2ODIA 4HS8H 2VT0A 1WC7A 3B7TA 2NXYD 1DJXA 2BC4A 3QE5A 1EXUB 1ED3A 4LOUD 1XXDC 5E4EC 2EUVA 1MKFA 3OV6A 1WS8A 2NR6C 3PL6B 1GGBL 3ZOAA 3US0A 1BQRA 3VTTA 2IFFL 1FHNA 3AC0A 4JPIB 1CE6A 3JTSA 4NNYB 2ZICA 2Z7UA 3EOYG 3LV3B 4Z7WE 3EDFA 4POZD 1NBVL 2DWEA 2JNZA 1Y6MR 3FQXA 5C0FB 6PCYA 1KXQE 3CUPA 2YD7A 3L5HA 2DQEH 2J71A 2Y7QB 4EE2A 4HUMB 3MACH 1PVHA 3VFPB 2FQGA 3MBWB 4ZXBA 4NUPA 1FNLA 4J6RL 3KWUA 3LQZA 4QOKD 2WMPA 3ZSTA 3P2BA 4NPJA 3LRHA 4RFEA 3WTWA 2PR9A 3GS7A 5EU3A 1L9OA 4QLWA 1MEXH 2IMNA 2NY6D 4L8DA 3UZQA 2Y2WA 4PJCA 3FUDA 1MAML 3A23A 3WNNA 2R69L 3EYSL 3WEBA 3RZCA 2HKHL 5C07A 3HAEA 2IH3A 3MC0A 2X4OB 5EA0L 3QJZA 5AOJA 5I66B 4DEUA 1ZT7A 5EZLB 2VR5A 4MS8C 4TNWF 3SZKC 3ZT6A 4N25A 1L9TA 4U6HB 1GJUA 4N8PA 1I7ZB 1CF8L 4IBSA 4XODA 4CU8A 2RMNA 1E4XL 4AJYV 3QIBA 1QBLL 2HLFC 2WUCL 3N1FC 4XCYA 2W88A 4JDZA 3Q06A 3MLYL 4QTFA 1W9XA 1ES0B 1USZA 1DDHB 3QNXB 3BPCA 5FA3B 4FFTA 4DW2H 2F8IA 2C9AA 3L4XA 4K3EL 4Y5VC 2WOBA 2X28A 2BIHA 1R5VA 4AV0A 3K8LA 3GXNA 3ULUH 1HXMB 1HILB 1MJJA 2R83A 2VXTH 3F7YB 5TH2A 1CLZH 5LHDA 5A1AA 2KYIA 3PAYA 3SD2A 1BFOB 5BOJA 5I17A 4JFFD 2XBTA 3V4VA 4HIHB 2XXGA 3UERA 3GWJA 5F7FA 1K2DA 4F7EA 1SVZA 5BZXA 2MCAA 1WFNA 1MDTA 5IROD 2HRPL 2WLLA 1YLBB 4DSYA 2EICA 2HCZX 4K73A 3IGUA 4F9LC 2Y6SC 5EH1A 1HIMH 5EDSA 1GC1C 4JDTL 4JHZA 3HRZB 2N0MA 1OSPL 1I8KA 3V6FB 3VD2A 2XTJD 4G8IB 1M71B 5CO1A 4ZSOA 3SGJC 4DKFL 4CSPA 1WT5C 2I26N 1D5ZA 3HMWL 2R27A 2G5RA 3LIZA 4XC1L 5ISZD 2DMKA 3I6KA 2OTWA 3AREA 1IC4H 2CZNA 3FQ4A 3O3EA 5DSCB 5JNYA 4HBCL 4LFHG 5IF0B 4PRDB 3T1FA 1SMDA 2VISB 3X12B 5K33A 3KJ6L 3H4FA 1NGPL 3WIFA 1L5GA 3QFJD 3MRHA 1KTLB 1S8DB 4Z3TA 1U8LA 2M2DA 4JZNA 4JBSA 2YQGA 3FCSB 4L1BA 5EZIL 3P69A 1FV1A 3LDBB 2MIZA 4HKXB 5IHZB 5JHLH 2O5ZL 4G3YL 3C60A 1MCJA 4X8CA 2GFBA 1ZA6B 4GUCA 2F7OA 4RAVA 5FECA 2EO9A 2EIMB 1E9OA 2JCCA 3P73A 1CK0L 3SPJA 3QC5X 4FFYL 2QVMA 4G6KL 4P05A 4OVUA 1NDGB 4XGZB 1H3PL 3V5HB 3E3QE 3IPBA 4YC2C 5HI3C 2KZKA 1RK7A 3FO9A 4OTXL 4ZUSA 1REIA 5GS1C 5C0CA 4JCMA 5IFJB 3K1KC 2IAAC 4K3DL 3DURB 2N0KA 2OJ1A 3NIGE 4IM8A 3ULSA 5KSAA 1P7KB 3FQWA 2W94A 3H6JA 1W0WA 1ACCA 1NDMB 1OALA 3FUIA 1AGBB 2CXGA 5HHOE 5JIQA 2P8MB 2CIKB 1L0PA 3ES6B 4Y7OC 1YNKH 1TZHA 2OMWB 4G9FB 5FS5A 4G7QB 2NYYC 3CBRA 5GGTL 1O6TA 3MRQB 1R46A 3GSQB 2J1KA 5CBEB 2VAAB 3SKNB 5ADPL 3U6XA 3DV6A 1OXYA 4KROB 2VDPH 4Z0BH 3WFZA 1TQUA 5EIQA 2Q2LA 4LLQA 4TYUA 3HS0B 4Y5XA 4M5ZH 5BMFL 4PJHA 3RWJB 2YD1A 4F8PA 2EDNA 1QYGL 2EO1A 2UY6A 1D9KB 3EJRA 4TN9A 3PGDB 2HTKC 2VJ0A 4LASL 1T03H 3QXWA 2VDMH 3BAIA 3BRDA 2V7NB 1AG0A 2GC4C 5CJ5A 2ZJSH 4FFZH 4F8OA 5C7ZA 1NEZG 3HR5A 4NKIH 2GBVA 4JPKH 2JV6A 1IT9H 5DEGB 4OJYA 4WUUE 3BVNA 7FABH 1WWWX 2Y07H 4Z78B 3ZTJH 2E9IA 5HHMD 5HDQL 1U58A 1SLUA 3P3RA 3GRWA 4JQIL 2K3TA 4KH2A 1NCBH 3L5WA 4M8RA 1BECA 3ARFB 3KHOA 3BT2L 3U0TB 1FYTA 2ZQKA 4ZOAA 5C09E 2WQWA 1AYRA 1LILA 4WV1B 4Q6IA 1E5ZA 1CD9B 4LP5A 4ETQB 2NDGA 4GY4A 3D2TA 5PAZA 2A74A 2DH3A 3CDGA 1RUKL 4XVSL 3ABLB 5IG7B 3ME0B 3SQOH 2BVTA 4TVPD 4M5SA 2QVFB 1JFQL 2R23B 3PIQB 3PL6A 1W0YT 3ZRCC 1P1ZB 2WXJA 5I26A 3ATBA 5CN2A 4JPIA 1EMTH 1GTNA 4NNYA 3LV3A 1JUFB 1HCYA 2PPDA 3MLWL 1NGQL 4Y2DB 4K7FB 2JXMB 1YN7A 2A4CA 3S88H 4X98A 4XP6H 4Z7WB 2YS4A 5C0FA 1II4E 1XIWB 4L4VE 4M7LT 1AQ8A 4QRPD 3G08B 3NFSL 3VGGA 4HWZB 2Y7QA 1KXHA 3LRGA 2EUZA 4GAYB 3L5XL 3KLKA 3MV9D 3VFPA 5E1QA 4NPYB 4PJBA 5E9AA 4OB5L 1PLGL 1V55B 2R8SH 2H0FA 1DSYA 1UB5B 5DUBB 1M2VB 4LPUA 3JQOB 4ZMLA 3OLGA 4IBWA 4EDWL 5A2JH 3ARDD 3ULUC 4G6FB 3VRJB 4WWID 1MCOH 1E43A 3G9AB 3MLUL 3GINA 2X4OA 1P7BA 5AALA 2OMVA 4Z77B 5I66A 2OTUB 3V10A 2FX9H 3PWUA 3GSVB 3NH7H 4PR5B 4AQ1B 5AZ2L 1U8MB 3GNMH 2QHRH 1BQSA 3DO4A 4N6RB 1I7ZA 4LHUD 1UWGH 1DN2A 5HI4D 2ZUWA 4LOUC 2MKWA 4G7YL 4IMKA 4OY9A 4OR1A 3FH7A 3GXDA 2F7IA 1LEGB 2XZAL 4TRPH 1ES0A 1SHMA 1DDHA 4QHUB 3QNXA 4OLWL 4HGMA 3TIDB 3CXDL 2J8OA 5DLMH 1TQCC 1WFOA 4BZ2H 1MUJB 5I1KL 2VUYA 5FR3A 5I1HH 2I7SA 1HXMA 1HILA 1L7IH 2WZ0A 1HHGB 3WIIH 5DTFB 1VFOA 2YEQA 5DJ0B 1PQZB 2IV8A 5FM8A 1BFOA 1I3RB 4JM4H 2EDFA 5I73C 2XT1B 5T3ZD 4HIHA 4F2EA 5MEND 1ZLVK 4EQ3A 2M83A 1W8OA 2IJ0C 2VUOA 3VQMA 3HC4H 2R1YB 4PTTB 5F71A 4X9FA 1ZK5A 1OAQL 2VO8A 3BZEB 1XH2A 2QTEA 3UP1A 5IT2H 5IESL 2FB4H 2XFXB 1WAAA 2GK0B 4GUQA 3V6FA 2ITFA 1KENL 2EDHA 4G8IA 1M71A 4CRPA 4U0RB 4ZMXA 4MAYB 2P47B 2VDOH 1KTCA 2Y7SA 4XOBA 2FSDA 4E9XA 1RP8A 1INEL 3QORC 4FFZA 5D7JB 1PMYA 2ZOOA 4O00A 5DSCA 3BRFA 2NY4D 3TJPA 5IF0A 4PRDA 3U7AA 1X5HA 4MQ7B 3X12A 4N4YB 3MA7B 1TNMA 3T6VA 3U25A 3RX7A 4BFGA 3TT3L 1S8DA 5C0BD 4APQC 4QKTA 5BV7H 3D34A 3FCSA 3PYCA 4Q9BA 3SBWA 4M1CD 4ONHA 4K5OA 4HKXA 4OM1L 5IHZA 2R69H 4O4YL 2WYIA 4LNVA 1IKFH 1ZA6A 4NXKA 1GOHA 1SN5A 3S4SG 1AC0A 2WGNB 1M2OA 1RZ8A 3T2OA 2AABH 1NDGA 4XGZA 3VFGL 4U31A 3MOQA 3V5HA 3IRZA 4R96B 3C5XA 1WH0A 3D25B 4FTVE 1IGIH 2PF6A 3QCUL 5IFJA 5JA9A 5L0QC 3DURA 4KJQC 4LVEA 4HIIA 1E4XH 1ZOXA 2WANA 3B8YA 3FU7B 3PQYE 3QZWG 5TE6L 1MELA 3U30B 5JHBA 2WUCH 3SCMB 1P7KA 2I69A 5DUML 4Z8FL 1NDMA 2JJTC 1AZRA 3APCA 1AHMA 4XN1A 4JL2A 1VGKA 1AGBA 3NIGB 2VJ8A 3WJMB 2CIKA 2P8MA 3ES6A 3VAEA 3FQ2A 1ZSDB 5LBSL 4WFEE 4ACPA 4ZMZA 5LVEA 2WB7A 2OMWA 3DK0A 3KR3L 1CWVA 4FMVA 3EAKA 4G9FA 4I3RH 1MH5B 3MRQA 1LQSR 3G7TA 3GSQA 2BOBB 4V1DD 5CBEA 4ALAH 5HHOB 2VAAA 3IMWA 3SKNA 3TWCL 3QRGL 4DVRL 3VACA 1THCA 4FXKB 4I18B 5L4JA 1J0YA 3KS0J 1F5WA 3BDBA 3HS0A 3MSPA 2YGQA 5DC0A 3RWJA 2YA2A 1U2YA 5LWYL 4FYRA 5TQ0H 3G3LA 4KJYB 1D9KA 4YHOH 1OGAD 1EO5A 1WBXA 2FNBA 3D6GA 3PGDA 1E4HA 4OZFG 4WFGD 5ILTL 1XCTB 2LGNA 4XB3A 4BQCA 1P4UA 4XE0A 2DJMA 1CGXA 3K6DA 1P2CB 3PWPD 2V7NA 4YSPA 4DKFH 2FO8A 4B53A 2AQ3A 1IGYB 3S35L 3HJ0A 3HMWH 1EHKB 3LXAA 4N2BA 1HZLA 4XC1H 1S7XB 2XXFA 1M7IB 1IM9D 5DEGA 1QFUH 2FUTA 4TXVB 4GG6F 4Z78A 5CEXB 2D3LA 4NZRH 1P4BL 3OTTA 2WXMA 1NGPH 4FN0A 3RGVA 1I85C 4WUUB 3RGHA 4KMQA 4Z0XB 4P23C 5EZIH 2EJ1A 1QAWA 3ARFA 3JVGC 5L9DL 4K7PX 2O5ZH 4WFFD 1XGYL 1QFWI 4PLOB 4NZUL 4PRHD 4Y8DC 3U0TA 1CLOH 1CK0H 1FI8C 4WV1A 2LW3A 3HZYB 4BFJA 3I6SA 3M8OH 2R39A 4AKQA 5C09B 2DQMA 4BZ2A 4LCWE 2F18A 1ECYA 2Q76B 5IG7A 5HYIA 1UM5H 4XBGB 3UPCA 2H26B 3BOVA 1PAZA 3FSVA 4L8BB 2DQGH 3L81A 1J05B 2R23A 4AMXA 1UXSB 1SLWA 5T3XD 2EVHA 1MW2A 4MXWH 4M6MH 2E9JA 3QUML 3TF4A 3T77B 4JRXD 3F8UB 5GGTH 2E7CA 4O51B 5AKTA 2P52A 1NWOA 4Y2DA 1A7BA 2JXMA 2OCFD 4K7FA 3BZ5A 1QQDB 1RJLA 1BD2E 1CTNA 1QZNA 3SGEI 1V27A 2LLNA 4Z7WA 3EBHA 3HJEA 4ATWA 1WBYB 1XIWA 2XWDA 1I8AA 3L1GA 3G08A 4RX4A 1FNAA 1UB6B 5IB5B 1LD9B 3J7HA 4HWZA 3VXQB 4GAYA 2PABA 4HF5H 4XP5L 3TPKA 1KXQA 4O2EB 3A6BL 3VD0A 3L1OL 3LPOA 4ICWA 5B39B 1UB5A 4HXAL 5DUBA 1M2VA 4JN1H 3F84A 1JTTA 4PJ6A 1WA1X 1DJWA 3WIHL 3A67L 3IDNB 3HE7B 1UXLA 2VZ3A 2ARJA 3BXNB 2E6PA 3EOTL 3NFPB 5D70L 5F7AA 3DX7B 3VRJA 4K71B 3QJTB 4QT5A 2R69A 2H2PC 4GXVL 4Z77A 4M6OL 5E7BA 5C3LD 2OTUA 2QQLH 4GSDL 4PR5A 3GSVA 3ERXA 4AQ1A 1HCZA 4NC2B 2HKFL 3NCJH 1U8MA 4CSZA 3P4OB 4N6RA 3EFOA 4W1TA 4A2EA 1PX8A 3WY3A 2DYSB 2LU3A 3MYZA 3ZSSA 4P5RA 1LEGA 5SX4H 2FEDC 2K6ZA 2BFGA 3TIDA 3MN8A 2AXFB 5F96L 4GQQA 3SOBL 4GG6E 1BVNT 4HOZA 4JHBA 1CFMA 1BQLL 1MUJA 2XWJA 4G5AA 2EEXA 3ZYOA 3LQMA 4U0QB 5DD1H 2KDYA 1HHGA 5DTFA 5DJ0A 1CDBA 1PQZA 2OMUB 2WBJA 4LU5L 2QL1A 4RQQB 1I3RA 5CJQH 3IJEB 3QDMD 2ZX7A 1LE5A 1TFHA 5TFSL 3AS3A 4MDJB 5IEKB 5BV7C 2FIKA 2R1YA 4PTUB 5L7XH 4PTTA 3PP4H 3AAZB 3CLFH 2WM0A 3BZEA 2C3VB 2O30A 3CVBA 2XFXA 2GK0A 3ASNB 4OLYL 3ARDC 3VNYA 3ECVA 1QBMH 4FMKA 5BOPA 2ZPKL 3WKPA 5LQBH 1JZEA 3VH8G 5F0PB 1FNHA 3BAWA 4PFEA 5JLZB 3FTGB 1A8JH 2Z1KA 3CFKB 3KPNB 5D7JA 2BOCB 2ZXDA 1J88A 2BMKA 4MQ7A 1T21B 4OB5H 4U3HA 4KHXH 5HI4C 4JZOB 4WI7A 5E4IA 3KH4A 1TF4A 4G1MB 1UM4L 2UXFA 3K8MA 5CJBA 3L9EA 3KL3A 1I53A 3VXPB 4ALAC 4CVXB 5DO8A 1IBDA 2AI0H 2CO4A 3PABB 2NY0D 2IG2L 1AZUA 4LVHC 3JWNG 4Z95L 5AZ2H 3D25A 4DP8X 4FFYA 1WUZA 2MFNA 4LRIC 3GTTA 3LH9A 3FU7A 4FTVB 1QPPA 4DP5X 3SCMA 2MEJB 3UTSA 3AMKA 4D3CH 2XZAH 4OJFL 3AMLA 2PTUA 4KZEL 3PQYB 5E5RB 4IS6B 3WJMA 1ZSDA 4ANUA 4OFKA 1MH5A 1NQBA 5HHOA 2BOBA 3ABKB 4JFTA 5GGTA 4Z76B 1CI5A 2D8KA 4XAWH 4XNXL 4F7TB 3MJ6A 1WLHA 3FT0A 3MRNB 1FH5H 2A9ML 4H8VA 3WENA 3GS0A 2PO6A 3UTPD 1BVNP 3SQBA 5EU6E 4G42B 1O0VA 2CA4A 2P45B 3DK2A 4KJYA 3C08H 4IBZA 4TNWK 1XCTA 1R4XA 2JTYA 2OP4H 5E2UH 1KENH 3V4PH 3DUUA 3D51A 1P2CA 2QQNH 1R33A 5AZEL 3FRPG 4XN9A 4ZTOL 1VZGA 1D2PA 5E0FA 1JHTB 2ZX8A 5CWSB 1MFMA 1OW0A 5I1DB 4UV4H 4YL9A 1M7IA 5EOTB 3TA3C 5IV2A 3ZN6A 1FAIH 1IC7L 4TUJB 1IAIL 5K93A 1TTGA 3DX1A 5D1XD 5DO2D 5CEXA 1RPUA 5EEUA 1FFOA 1RFDL 3EBIA 1NIEA 1A4KB 1NCAL 4CJ1A 1C7TA 2CMRL 1Y0LB 2QT6A 4HJTA 4E41D 1AJ7H 5DYOB 4FL4C 4JQIA 4PI2A 3TBSB 4I18C 1U8HB 5FGBC 1A1NB 1UTDA 1DZ0A 3H55A 2WUBH 3VUAA 3HZYA 4U1HB 3VG0H 4NUMA 1F90L 5C09A 1KYFA 1BWMA 2W0PA 4WNQB 4WF7A 1LWHA 4Y4KB 4PU2A 4XBGA 3FT4B 1V5JA 2H26A 4UU9A 2A4EA 2BM3A 5TE6H 4HSCX 3TJHC 1WZ1H 1HTYA 3H3KA 4HQQL 4L8BA 3SDAC 1F00I 4R2GB 3Q2VA 2YIHA 1J05A 4LCWB 1FO0B 1HH9B 3L17A 1VIWA 1UXSA 3CLEL 5IGXL 1FZOB 1ACZA 3B37A 2I9TB 2BJMH 2EDLA 2FQDA 4KK6C 1BQHB 4NQDD 3T77A 4XN2A 1GAFH 2OMZB 2WN2A 4O51A 2W9DL 3QUMB 1RZGB 3CH8A 4YSTA 1RHFA 2YWZA 4NP4L 3EO0B 1PZDA 4DVRH 3DX6B 5IP4A 1WIPA 3E6FA 1HX0A 1TJGH 1T1YB 1WBYA 2G4GA 3WGVB 1BXAA 1BD2B 2UUDK 2V33A 3HNVL 3GZOA 1LD9A 4PJDF 5IB5A 3VXQA 2EEBA 3RG1C 2MRYA 4BQ9A 4L4VA 3C8KA 3HFML 4O2EA 1DBBH 3CG8A 4ZYKB 4PJ7E 5B39A 5LCVH 4GP8B 2ZF9A 4ODTL 2F19H 4I2XE 2WYTA 1JCKA 2R0KL 2WXNA 3NP4A 3IDNA 4RDQG 5FLUA 1CXKA 3HE7A 3NFPA 3BXNA 5I5JA 1MIEH 2P26A 1JGVL 5DUPH 2B5IB 1PKQE 1HYSD 4N2DA 1R3JB 1PS3A 4LGPB 4NAQA 3GMOB 5C92A 2QMKA 1X7QB 5DMJB 1GZHA 3BP4B 2A83B 4PLNC 1GY1A 2VZTA 3P4OA 4M1GH 1A0QL 4N8VG 5I71B 5IFHL 4B27A 1CO1A 5ESAB 2Z8VC 1U8CB 2PR4L 2G5BA 2QFRA 1I7UA 1DVFB 4O9HH 3MRFB 4AY0A 4BKSC 3PXHA 3MBEB 1IC5L 4P5TA 1VHPA 4J8RB 4RIRB 4GG6B 4PJ9B 3RVTC 2OMUA 1FO0H 4RQQA 3UBXG 1T0MB 2P44B 1S9XB 4LBEB 2EDJA 3IJEA 3E0GA 4G83A 3HUJE 3ARGD 3NRPA 1XGZA 3WNIA 4PD4J 1RLBA 1U8NB 5IEKA 4PTUA 5G4OA 4NC0B 3AAZA 4LEEA 1J87A 1MJ8L 2C3VA 2QTVA 4YBQC 3C12A 3FQNB 2Y69B 3OC8A 2C1PB 4K23H 1D7FA 3VCLB 4PV1C 1CFTB 5FV2A 2A6KB 5CEYB 3KZ8A 3GBNL 2FLBT 2L8AA 1LL1A 5JLZA 1A25A 3U48A 3FTGA 3CFKA 3KPNA 4UILH 3RWDB 2BOCA 4KKCC 1FC2D 5AW1B 3HPJB 1NAML 1T21A 4S1SL 3PNWA 4BK5C 4YBHA 2VCOA 5CEZH 1C8QA 5HJBA 3VGAB 1CGTA 1I1AB 1GGYA 1N67A 4BYHA 3KWXA 4JZOA 4MSWB 4AYBA 3BH4A 4G1MA 4ABQA 3U7WH 3MLPA 2V6HA 1EUUA 3EFDL 5D1QE 5F7DA 3QUXB 3MJ7B 1HJBC 4CL7A 3VXPA 1JGLL 2W5PA 1EJ8A 4QXTB 4PJDE 4HU8A 4K07A 4CVXA 2A0LC 1QLEL 1V7NL 2AEQH 1CPUA 2IALB 3PABA 4JE0A 5AOIA 3WO4C 1RHHB 4ELME 2K8MA 4JFZH 1S4IA 2ICWJ 3VXUE 4J3OG 3OMAB 1T0PB 2CNYA 4LSPH 3X1BA 4KWUA 4LLUB 3MLVL 4ODSL 4U3CA 1DANT 3R7QA 4N8CH 4I1NB 3P02A 3CSBA 1IGML 3PDOB 4FTVA 3UABA 4YO0A 2C5DC 2D73A 4HJGB 4XN7A 4JDVB 4YDLB 4RETB 2ENJA 2KI6A 2X2HA 2DAVA 3KBPA 2LR4A 3PQYA 4IS6A 1OLLA 4KTDH 2VN4A 3SOBH 4KRLB 1FUNA 1A2YB 3D87B 3C9NB 1PZ2A 1FGNH 4XVOA 4Q9QL 4L9LB 4JVWA 2AQNA 3CHSA 5LBSA 3QZBA 1X5IA 4JO4H 4KUZH 5D8JL 2BH0A 4Z76A 1U8KA 5FA4B 1BPVA 2VWEC 1A7OL 4F7TA 3C5ZB 1MDAA 4OD2B 5K9JL 2XIIA 3MRNA 5F9AC 4G80B 3LKRB 1U6AL 3RY6C 4Q0XH 2YKKA 3Q01A 4KXZH 4MA8H 4G42A 4OF6A 3CHPA 2N4IA 1E4WL 4U1SB 1Y07A 5BZWB 2EEAA 4OGYL 5EU6B 2J1WA 2WQAA 2WP3O 4XMPH 5T8IA 3AT9A 1OTSC 4JFUA 3WS3B 1B9ZA 5GS3A 5HVGB 1JHTA 1CTMA 1EO7A 5CWSA 1KC5H 3BKCH 5ALCH 1OM9A 5I1DA 2PWHA 1HEZB 5EOTA 2IPTH 4XNDA 4TUJA 3QP3A 4UQ9A 2WTRA 2YGVA 1AXTH 1A4KA 2P5EE 1SXNA 4AMKH 1CXFA 4XP4L 1Y0LA 4WSJA 4Y9BA 3M7FB 3LPGA 5T1LD 1GYWA 4JFHE 4ZOBA 3QNZB 5H37G 4RGND 1JF1B 4LPWA 2GHZA 3MAWA 4XOAA 3TBSA 1T66C 1U8HA 3AB0C 3F01A 4ZZKA 2BRQA 1A1NA 1CF1A 4OT1L 2IG2H 4Y4HD 2VDRB 1DJYA 1JPSH 3MRBA 4LVNC 1RIHH 4LESA 4EOWH 5KZCB 4LL4A 1P53A 3R19A 1CQKA 2LVEA 2I60L 2AF2A 2ZIDA 3MA9H 1ZT4B 4WNQA 1FYHB 1MCCA 3FBKA 4Y4KA 3FT4A 5C2BL 3GS4A 3EO1B 2YO3A 2X6MA 3RA7L 4Q9RL 3CFJB 4NQED 1IVTA 1OD9A 3MUY1 4AUJA 4LCWA 1SRDA 1HH9A 3JV0A 3JWOL 4F7CB 4J2XA 1FZOA 2I9TA 4Y4FC 4QGTA 2R0WL 1BQHA 2V2XB 5GPRA 3ULVH 2Z31C 1U4EA 3EH2A 3T0VA 4KK9D 2OMZA 2CKNA 2FATL 4IMLB 3QUMA 1RZGA 4TULH 2IH8A 3P40A 3MJWA 3U4KA 3QFDB 1FRGL 2CO7A 3SPHA 3DX6A 4OI7A 3BSZL 3ESNA 5AYUH 4KQ4L 4P99A 3QEHB 4TLUA 1BD2A 4JHWH 1WZMA 1KGXA 4JQXC 2ID5A 2C34A 4G6ML 4BE6A 4ZYKA 1JNJA 2X89D 2FJHB 4K2UH 5AVTB 5J5EA 2R56L 3UG4A 5I1IL 2ATKB 2YD3A 3KS0H 2P8PB 3CMOH 2CIIB 1SXZA 3UEQA 2EIZA 4LSTL 3C2AL 2ICEC 4PJ7B 4UZGA 4UQ2B 2IBGA 4ODUB 4WNJA 4XNYH 3WIHA 3VWKC 5B3JF 2NX5D 4I2XB 3LXBA 3MO1A 2ADJB 3TLRA 1R3JA 5D55A 1NC4B 3TVMB 1X5YA 1X7QA 4M3KB 4Y2OB 5ESVB 1NCAH 3WYRA 1PKQB 3JYCA 1JL8A 4JPVL 3T4AC 3BP4A 2A83A 2CMRH 5F7UA 4UTAL 1R9FA 3G5XB 2AEWA 4G72B 5FYJH 3R18A 1J8HD 1XB3A 1YEIL 1ZD6A 2R29L 4PUBH 5ESAA 2AERT 1U8CA 3CFDB 4L4TD 5KOMC 3B9VA 4LSQH 3CHXA 2VDRH 3NCMA 5JYLA 2D31B 2NUTB 3K5SA 4OSUH 2WO3B 1EERB 3PNRB 2R0ZH 2EABA 1DVFA 3KEDA 1F90H 3MBEA 4HYTB 4PJ8B 4PB9H 1JS4A 4LL1A 3TJEH 5ITBH 1NTDA 2EE2A 1JGEB 4J8RA 4RIRA 4GG6A 3OBAA 3WEMA 3FN9A 4PJ9A 5JMRA 5A2CA 1T0MA 1YY9D 5FCUL 1E8XA 1S9XA 4LBEA 3KLSA 4HU2A 1FFPB 2FQEA 4ORZC 3GBDA 3IDYC 3W2DH 4JFQB 5DMIH 4OKDA 5IGXH 1U8NA 2Z93B 4HIXL 1MCHA 2D2CC 3UAJC 3Q43A 5D7IF 3HUJB 4L23A 4KNUA 4JFFE 4WGKA 5K1NA 4PRAB 2EQDA 4X99B 1KBWA 3FQNA 2ZUVA 4A68A 5LAXB 4OCMC 2C1PA 4RBPK 1SN0A 3T5WA 1XD0A 3VCLA 2LTQC 3I9AA 1HE8A 1BX2B 4S10A 4XPFL 2A6KA 2E4TA 5CEYA 3LB6C 4P46D 4JY5L 4KKLC 4GUOA 1HYSC 1NOLA 3AG2B 3BP6A 1ZDQA 3BW9B 3RWDA 2XTJE 2AV7B 4WNSA 2EYSA 2YAPA 2OYLA 3V52H 1ESOA 4H8UA 5HDOA 1HEHC 1I1AA 5F0JB 2OZ4L 3FO1B 4MSWA 1OEZW 5ISZE 1RUQL 3ARZA 5AW6B 2YAHA 4I88A 2UZIH 2DBLL 1T20B 3QUXA 3MJ7A 1JMXA 3ZQXA 2Z7YA 4PW4A 4QXTA 1XGQB 3QFJE 5GISH 1QFWM 3T2NL 2IALA 3KJ4C 5D1QB 3ZR6A 4NZTH 1RHHA 3ZRFC 1JBJA 1C08B 3QZMA 1FWXA 1QLEB 1A5FH 1CR9H 2VMEA 3P30H 4PJDB 3KXFE 5I1LB 4ELMB 4QD2E 5HDBF 4LLUA 4BD4A 1GIGL 1TXKA 1A0QH 3VXUB 3QYNA 2VKXA 1E5AA 3ARVA 4YHKH 1H9DA 1G1KA 1NMCB 3HEIB 3PDOA 1T5KA 3M17B 3O8XB 4HJGA 1NC2B 4JCLA 4GI6A 3N40F 4JDVA 1YEDB 2OAAA 4F1ZA 4UOZA 2BXYA 1HWHB 3G6JE 1HINH 5EN2B 4QTIH 3V5KB 1A2YA 4M7ZC 4XN8A 3C9NA 3F04A 3KEHA 5E08H 4L9LA 1YEJH 1DQML 4L9DA 3QHFH 5IHHA 4PM1A 2WAHA 5FA4A 1QKZH 4I4WB 3TNMB 4QPEA 3C5ZA 4KO6A 1CLCA 5D7EA 3D69B 3FQRB 1EQWA 1RLWA 1ZVYA 2CDEB 3AQYA 4N86A 5GRUL 3K2UL 2AV1B 3MRKB 4G80A 4AWJC 3LKRA 3LKSB 4H25B 1C5BL 1R47A 2OJZH 5CU9A 1TTCA 2R2HB 3ARXA 1C1EH 3DX9B 4IIQC 1MJ8H 4LAQH 4PG2C 4U1SA 2WLIB 5DWUH 5BZWA 1DBML 4PS3A 2J4WL 3BHBB 4XO4A 5EU6A 3RTQC 2HWZL 3LNGA 4YDNA 4WTZA 3WS3A 4LHJB 1UA3A 5T1DL 1MFCL 1CXLA 3GJEB 4X8XA 4EI5C 3GBEA 4YUEL 5TE7H 3RWCB 1JNLH 1YHPA 1HEZA 3AS1A 5MERB 4TNVF 1V3LA 2XACC 4FXTA 3BAJA 4WI9A 1U3JA 4R8WL 1QLFB 2JKRM 3CVHL 3TCLA 5CFHA 4PP2B 1SHSA 3QPQD 1JNHB 1T22B 5F7KC 2XQBL 3VD9A 2ZWKA 3G6DH 3ULVC 4DO5A 2QSTA 2X7LB 1D5MB 3QNZA 1JF1A 2J8UF 5HHME 2XKSA 2P5EB 3ZHFA 1A1OB 3OB0H 3ZKND 3Q05A 1BCIA 1QHPA 2QGCA 2ZUQC 1OD7A 3N6YA 4MMXC 3TCXA 2BK8A 1KBVA 4B9YA 2WNWA 2A2QT 1U3HC 1E8YA 4OCYH 1A47A 4QRBA 3BGMB 2HPTA 1M9WA 2NY3C 1N59B 4MHHG 3WAKA 5HYSG 1ZT4A 3FSWA 1F1GA 5E95B 3ZIMA 4QHPA 3AROA 3PAZA 3EO1A 3TWYA 3HZKB 3CFJA 4GLRH 3ZX1A 1Q1JH 4M48L 1KDJA 4F7CA 1IGJB 1BV8A 3RDTB 4RH4A 4GAGL 2V2XA 2APBA 4R4BB 4TVPE 1J0ZA 3DTUB 4OUUB 4IMLA 5INDB 3OAYK 4TVPL 1CE1L 3QFDA 2NXYB 4PV9B 3PF2A 2DQCH 4ODHH 1GGCH 4YFDB 3VWJD 4S1DD 2ZCZA 4JFSA 1A7RH 2UWEF 2Y3AA 4PLKC 4UQBA 2C4FU 1XZ0B 5I9QC 5CILH 2YFOA 4HC1L 4W9DC 4URKA 3QEHA 5J12B 5GRWA 4BFOA 3VFWB 1ASOA 3VG9C 1C8PA 1ZPLA 1BMWA 4FCAA 4OF3A 3T6QC 3RUGF 2FJHA 3K0WA 3OXSB 4QRPE 4OGYH 2ATKA 2IWEA 2P8PA 5BUPA 2CIIA 3EYFB 3MV9E 4IDJL 2V2TB 4JKPL 4PJ7A 2WWKT 4WK2B 4UQ2A 4YMPA 4ODUA 2A9NH 2F08A 4ZOCA 5BRQA 4YQXL 5I6MA 4Y4HC 1T89A 4I2XA 3UC2A 3IFNL 3WY4A 2CSPA 1TZIB 4A7GA 2ADJA 1UQSB 3N9GH 1ZCRA 2PCFA 4LARL 4LXFA 3NRFA 3VFVA 5JXAL 3TVMA 4Y2OA 1PKQA 5DJDB 4R83A 4FNTA 2ZUYA 3MRPB 2E5EA 4AM0B 1JYWA 3G5XA 1ACXA 2KS0A 4H8PA 1H8SA 1I9IH 1G4MA 3QXAB 3VA6A 3CVCA 2YXVA 2V9TA 1XGRB 4PWKA 3VD4A 2NQCA 4QRQB 3CFDA 3S3PA 1NEZB 1IV8A 4GSQA 2D31A 4HG4J 4Z1PA 5CF3A 3FUJA 3NDYE 4HLEA 2UX7A 3FHQA 2BERA 1MRDH 4PJ8A 2QADD 2DMCA 4XI5C 5B4MD 4QY8A 1JGEA 5FHAL 3GI8L 4MMYB 4UB0L 4WW1B 1P6WA 4R97C 2X1PA 3LXUX 2FQFA 4XWGL 1BDYA 4WW2C 4XP1H 1FFPA 5J06A 2NZ1A 1O7DE 4JFQA 4KC3B 3VXNA 2Z93A 1Q0YL 3EW3B 1UHVA 1YPZF 4EN3D 3D8MA 4FXGB 1A7QH 1JVLA 4OW6A 1LK3H 4OLZH 5MENE 5B38G 5T3ZE 1YNTB 4K9EH 4PRAA 4X99A 1EA9C 5T3ZL 5LAXA 4JFFB 2VRQA 3QO1A 3BPOB 4EIUA 1O6VA 3FKUS 3BW9A 2BSBA 4CJ0A 4ZFZB 3T3PF 4XVTH 2AJZB 5EBLB 3JZYA 1F6LL 2NTFB 3DUSB 3FONB 2PCYA 3AY4A 3MNZA 3MXWL 1NAMA 2XTJB 4DP2X 3N06B 2JI2A 4QTHB 3V6BR 3C2AH 3VD7A 2UWEE 4NN5B 4WHTB 1T20A 4YWGL 2O6PA 1E4XI 3B5TA 1OWRM 2QSCH 5ISZB 2W80C 3OZKA 2LFGA 1NCWH 1XGQA 2VSKB 3BYYA 2DOCA 1A6AB 1D3CA 1OGTB 5D1QA 1O9VA 2AK4D 5C0BE 3WOVA 4WO4D 1C08A 1LDPL 1G94A 1MIMH 4F7KA 4OFPA 3RUGE 2WYZA 4PJDA 2XN9A 3QFJB 2D7TL 5EOCH 5I1LA 4ELMA 1GVIA 1MN4A 1KCRL 4FG6D 3W0WD 1AYOA 1YY9C 1N7MH 4LLWB 1MLBB 4WJG3 4U1MB 5GJSL 3VXUA 3KXFB 1YEIH 5F6HJ 3RI5F 3M17A 3AZUA 3O8XA 1QA9B 4JHAH 4XPBL 2CBPA 1NC2A 4D0DB 3DMMB 4NYLB 1YEDA 4B7IA 1IC1A 2V7HB 4KFZC 2BLFA 5EN2A 4RISH 4N5UA 1RKRA 3V5KA 4QXUL 5AYTA 2FEJA 2HN7B 1A6UH 3E9TA 2X6BA 3SDDD 3G6JB 4YDZA 1A14L 1OHQA 3AG3B 3WCYA 2MCPL 1RZJH 1DVXA 1ONQB 4I4WA 2COQA 1QUPA 4OQ1A 3TNMA 3D69A 3FQRA 2CDEA 2UZYB 3O2VL 4RCAA 4MFHA 1OF2B 4V1DE 5FKAB 5HGHB 2AV1A 1FJ1B 4HIXH 2R2CA 3LKSA 4H25A 1B90A 1KZYA 2UXTA 2D7NA 5HXMA 2R2HA 1A4JA 1BM3H 3DX9A 4PQXA 3ZE2F 3FHEA 2WLIA 5E00B 2WCGA 1PU0A 4DZ8B 2AXWA 3BHBA 1MNUH 3AG4B 4ELDA 1A4AA 4ABVA 1TZGL 4FQIL 1S9YB 1CBVH 4TLKA 3ZTNH 2VERN 1OGAE 3GJEA 4WFGE 4QXGL 4A2LA 3GKZA 3RWCA 2EYTB 4H1LG 1MXGA 5D4IA 5EIIG 3PWPE 3C5JB 5I28A 3ILPB 3MUZ1 1QLFA 1TQBC 1NM4A 2OULB 2X4PB 3QJHB 4PP2A 2OZ4H 3CVHB 5GJTH 1JNHA 1T22A 1R3KB 4XPTH 3ZMRA 2X7LA 3CN2A 1D5MA 5DJZB 4HGKC 2P5EA 3OPZL 2Y36L 1A1OA 4PJEF 1I7RB 1TSRA 1JZFA 1SHXA 4JVUA 4BHUA 4S1QL 1J9TA 5HHMB 3ARPA 3BEWB 5IEHA 4IDLA 5B1CA 1UJ3B 2FYVA 4I89A 1DJZA 1LO2L 4H44C 4P4KD 3BWUF 4PRHE 2DQHL 1KCBA 3BGMA 1XH0A 1GIGH 3NIDF 3P11L 3QQ4B 1BYNA 4DN3H 4C55A 3CQFA 2VXVH 2XVLA 3TN0C 3HZKA 4LP8A 1P9MC 3GUTB 1JDDA 4L2LA 4R5VA 4OCWH 4NOBA 1D5BB 1DEDA 4OZGF 1IGJA 2AJUH 2GHWB 2VRAA 2R1XB 3WHE1 1CGSL 3A6CL 2FBJL 3JWNE 4Q56A 4NC1E 4R4BA 3K4DA 1IBGL 4LP4A 4OUUA 1DQMH 2V5SA 4JANB 5INDA 2ZXGA 1OP5H 1J18A 4LLYB 3L13A 1XSOA 4PBDA 4PV9A 1QEWB 5T3XE 4HJSA 1G1OA 2HAZA 3DKHA 5T3XL 2DKUA 2XFGB 1KJ2L 2V4LA 5D7KD 2J1XA 1CC3A 4JRXE 4FJYA 2C9XA 5E6ID 3BSZA 3QEQD 5FFOA 3K2UH 3ZKSD 3NBNA 2JJWA 4PRPD 1OAZH 1ZE3H 3VFWA 3S8FB 1H5BB 5CBAB 1A21A 2A6JB 5D2NC 3U9UB 4YHIA 2DQIL 3FU9A 3OXSA 1RXLA 3H56A 3TS8A 1I9RL 4XP9H 1DQTA 5B3NA 3LD8B 2ICCA 3EYFA 3I9GL 3OF6D 1PLAA 3OKOB 5ITFB 2V2TA 4QRPB 1LEKB 3HZVA 3T4YB 3MV9B 5KVGH 3DECA 1IAKB 4HSQA 5SX4I 2B9AA 4QOKA 1UQSA 2SODB 4Y9CA 3RB7A 1OSEA 4DPRA 3ZE2E 4UANA 4BZYA 5DJDA 1KGUA 4OZFB 3STBA 1T1XB 2VDKB 3GMMB 1UYWL 3MRPA 4AM0A 2YRZA 1S9VB 3QXAA 4B9GA 4UTAA 3BZFB 1JK8B 1DANU 1XGRA 2XWTB 3FUEA 4JFXB 4K15A 4PJXF 3H2PA 4QRQA 2R29A 1NEZA 5GHWH 1BYPA 4FQPA 1KWKA 4J5VA 2IOIA 4PGBB 5ECGA 2JCWA 3M6DA 4Z7OE 3BKMH 2DICA 2X09A 5DVOA 2NNFA 3HG2A 1EPFA 3SO3B 5F7EH 2ERJC 4BE5A 4CN6A 2OI9B 3QA3B 2QBWA 3JV6B 3DXAD 4MMYA 5AVUB 4YDIH 4WW1A 3RBGA 5BPPA 3GSNL 5A6IA 4QRTB 5J1SC 2CGZA 3QEGL 1IBYA 4XO3A 3IFLH 1RK1B 6CGTA 3QBTB 3QNYB 5CAYB 2ATAA 3DBXB 3CMGA 4QEGA 1ZLSL 1KCKA 2AJYH 3AY2A 5HHXL 4AK1A 3NSFA 3WN5C 3T3MF 2WINB 4H4NA 4I8DA 1ET5A 5I1JH 1ORSB 4FXGA 5ACLA 2A4ZA 3DARA 1DQLL 3AS0A 4JG1L 3TF7C 3W5MA 3QDME 1U0QA 4RGMC 5CHNB 3MLRH 4JZJB 4OZHF 3NSXA 2HX8A 4I77H 3NIDE 5AWNL 1MREL 4JFFA 5MENB 2V5TA 3TEZA 1SVBA 3SE4A 3BWZA 5EEYA 2R4SH 1KELH 4PY8J 5AW2B 5IROA 1F0LA 2P43B 3E9UA 1TJHL 3VVWA 3DC0A 4BV1A 2BS71 4OZGE 4ZFZA 4DGYL 3TZVD 2AJZA 3GZKA 5EBLA 2V17L 2NTFA 4NHCL 1LK2B 3FONA 4DZBB 1RURL 4PD4K 4ZJ9A 4A37A 1RIUH 3G5ZB 4ODXB 1DQKA 4QTHA 1HN1A 4YBLC 2OZ4A 4HOXA 4WHTA 2CD0A 3I3EA 5JPNB 1URZA 3IMSA 5ISZA 2QHLA 3RFZB 2N59A 2NY4B 4IGBC 1RZJC 5DVNA 5AD0B 5CBAA 1A6AA 1OGTA 1WFIA 2UWEB 3Q6GL 5J3HC 3WSQL 1UATA 4XPGL 1Y1DA 4OCXL 3D08A 2VDKH 3QFJA 1G7MB 5C0BB 3S96B 3ZE1F 1OAXL 1Z9PA 3SKUD 3BUYB 2YN3A 3H53A 2WXKA 4LLWA 1MLBA 3RUGB 4U1MA 2O5XL 3KXFA 3QEUA 2J5WA 3NESA 2B4CH 1FL6B 1QBBA 1QA9A 3PP3K 5HVHC 4D0DA 4NYLA 1F4AA 2V7HA 4FX5A 3PXLA 2ICWA 4EDXB 2AEPL 1IGFH 1R3IL 1NM9A 1OARH 4NBZB 1JGDB 2HN7A 4HGWB 4GQ9L 1LWRA 4KZ0A 3G6JA 2DQUH 1U8PB 5HDRA 5IBTH 4MCYB 3FL7A 3WE6B 2GBUA 3LRMA 4EXKA 3FUFA 4M43L 4P2OD 1ONQA 1TNNA 4BSWB 1KCVH 2J3SA 3LSOA 1FVEB 4I0PC 4PJXE 1GRWA 5HGHA 4K4KA 1OF2A 5FKAA 2P48B 5CMAB 1FJ1A 4B9IA 4JG5A 1JFHA 1S3KH 3L6FA 4D9QD 2O1AA 4V1DB 1RSYA 3CFQA 3V0IA 4PH8A 5F2FA 2EECA 3WIAA 4BJLA 5E00A 1OM3L 2IO5A 4DZ8A 4YSDA 4XMXA 3T0BA 4AXWB 1M05B 3VX0A 3ZPDA 4DO4A 4ICXA 1S9YA 5I8KL 2OR8A 2P3YA 3BDYH 5IY5B 3FPXA 1HESA 1YC7A 3DI2B 1IIKA 1E3FA 4IKIA 2EYTA 1J1XH 4IOSD 3TEYA 4YEFA 2QDWA 2XCMC 1OGAB 3C5JA 3CC5B 2OL3L 2R9HC 3ILPA 3NPZB 2YD4A 3ALWA 4DK5A 4AMWA 3QK0A 2RQEA 2WWOA 5GZND 5HD8D 3ML8A 2KUTA 3PWPB 4JG0L 4OZHE 3CVHA 1R3KA 1MCFA 2H47C 3AWGA 4FI6A 1F97A 2FDBP 1IBBA 2IAMD 3AUWB 3NTCL 4IBQA 2J6WA 5D1XE 5I1GL 1IJ9A 5DJZA 4JGNA 1IM9B 1R75A 1I7RA 3VH8B 3H0TB 4Q4IA 4KDTC 4TQPA 1ZS2A 4N3UA 4HPOL 4E41E 1G84A 1TOXA 5JUEL 1UJ3A 3NJKA 2AP2A 4Y88A 1KCRH 3QQ4A 2NLJB 1CL7H 43CAB 2XA3A 2XG5B 4PRHB 3TESA 4HZLA 3VW3H 2CDFB 4FQ1H 4XR8C 4HCRL 3ZE0E 2PWDA 1CDYA 2WK2A 4FCHA 4WCYL 3GUTA 1BJ8A 1D5BA 3KYNB 5D2LF 4PRBA 2R1XA 1BFTA 3V8OA 1ADWA 1R5WA 4DK3A 2R2EB 3JT0A 3OC5A 1R17A 5D93B 4JANA 4JHUA 4D0CB 3ZE1E 1QEWA 1QSFD 2VLMD 4X6EB 2CXKA 5DD3L 1NKGA 5I30H 4NQDE 2RFXB 3RWFB 2WLHA 5EO0B 1KJ2B 1MFVA 3KPSD 3S36L 4HC1A 1KPRB 4WIQA 5EWIL 2HG0A 1RP9A 4JRXB 1H5BA 1ZXKA 3MBXH 2GG1A 4WI0B 5JIKA 1NLDL 2A6JA 3DHJA 3NJMA 3U9UA 4KZDL 2EH8L 3AQDA 4RNRB 1P84J 2ADGB 5DGQA 4IRJD 1I1CA 1TZGH 1ZA3B 3OKOA 5ITFA 3HC3H 4QRPA 2H1XA 3EZ8A 3NCYS 4QXGH 5D1ZC 1LEKA 4GKZB 3T4YA 1OPOA 1CDGA 2APTA 3D0VB 3MV9A 1VACB 5JXED 4OFIA 3UCRA 1IJNA 1YECL 1WE5A 3QB7C 5IVZB 4LIQE 2QMJA 3LZPA 4P4KC 4RGOL 5EULV 4LIQL 3HI6H 5EB9A 1TJMA 2ADIA 5D72L 1MJUH 4KJPD 4OZFA 4W81A 3U4AA 3WEXB 3ZE2B 1EZVY 1S9VA 4ENZA 3OPZH 3KYOB 5L2KD 3BZFA 3L54A 2XWTA 1HWWA 3FRPB 2BHZA 1NIDA 1S78C 4FGMA 4ZMAT 1OAYH 4PGBA 1QFHA 4TMPA 3N43B 3GKWH 2C1OB 2Y1ZA 3QA3A 4WWKB 3TEUA 3JV6A 3KCPB 4LHUA 4N22A 4WUKH 4Y7MA 4AT6B 4Q89A 3MRRB 4Z7OB 3BH9B 3U1SL 3WJLC 1VFAB 4QRTA 4JO3H 4JPSA 1RK1A 4YE4H 3F58L 3QNYA 2F5BH 1A6TB 3GSNB 3DBXA 4LLMB 3V4UL 2FHCA 2ZP0T 3HMXL 2WINA 4HWEL 1ORSA 3IJ7A 1JWMB 2ZNWA 4X8JB 3GIZH 4WSKA 3JWNH 3H4HA 4UTBH 2PP7A 4XVJH 4JZJA 5CHNA 4FXLA 2XKNB 5MENA 3QYCA 2GSGB 1S9KC 3QDMB 1MCWM 1NANH 2AQ1A 3FPYA 4KI1A 1N4XL 3NIDB 3UJIH 1GHFH 4H8WH 4J12A 5ANME 3HAEG 1HAUA 1IKOP 1E5UI 3KPOB 3QIUB 5D96B 1SBSL 2B4CC 3FTXA 1ETB1 1LK2A 2XZZA 4DZBA 4PLJD 2Q2EB 4OZGB 5DJ8B 2MOVA 5IMMB 3G5ZA 1CLYH 4ODXA 4L1TA 1U30A 5GGVL 1USQA 2BZDA 3GXTA 4P5SA 5BW7C 5DC9B 1C5DB 2TRHA 1INQB 2EEDA 2W95A 5JPNA 3U7YL 1DLHB 2DIJA 5CUSH 3RFZA 4PVLA 5AD0A 5I1CH 2UWEA 4FAAB 1N70A 3M07A 3HI5L 5EC2B 4M7JH 3KMDA 1F4XH 2IDQA 5D6DC 2BVQB 2YQBA 3IBOA 3FFDB 4AV4A 3GZQA 3DDFA 5ABAA 1G7MA 1N12A 1Z0MA 2DEWX 5C0BA 1ZEAL 3BUYA 4NX0A 4J4PD 4RLDA 3RUGA 3IPEA 5MHSD 4NIKB 3C09B 4NCC1 3D1MC 3GMPB 4GQZA 1PG7H 2ITCB 3BRGC 2OCJA 5DRXB 1FL6A 4JL1A 3BWSA 2KMWA 3DGGB 2NY0B 5GRYA 3PY9A 4PCYA 1F4WH 4XRCB 3TT1H 2RACA 4EDXA 1W8EA 2UXVA 1O7SA 4KXZI 1JGDA 3BKJL 4HGWA 3I84A 1NPNA 4FKKA 3RAJL 2NZ9C 1U8PA 1BIIA 4MCYA 4WW2F 5AVVB 5HGDB 3WE6A 5AENA 1C9SA 4XNAA 3GIVB 3GSNH 1YJDH 3JTBA 4AQAB 4LCCC 4BSWA 5BVJB 4KNTA 2GIMA 4N8VB 1FVEA 4GH7B 2GI7A 1WZAA 2CALA 3IGFA 5CMAA 5HHXH 4NZJA 2XTSA 3FF7A 4G6AD 4UQCA 4AGPA 1BVKB 4DKEL 1CG9B 4DP6X 4PJXB 1DQLH 4ATTA 4V1DA 3GSUB 2HT2D 2ENQA 1WISA 1OCWH 2I7OA 4IRZH 2WLYA 4K8RD 3K7UA 4AXWA 4EBQL 3RTLA 1M05A 5DFVD 1MREH 2L7UA 4YHYC 2W65A 4UINL 1EX0A 1NIAA 2K9FB 4H20H 2X70B 1B88A 3P0GB 3QGVA 5DZNA 5EU5B 1OGAA 1HSBB 1XH3B 3CC5A 4KHTH 4NHCH 5AOMA 5KSUB 4KQ3H 3OLEA 2X4NB 3LHPL 1E30A 1VADB 2OL3B 3WN6A 4R26L 3PWPA 1HCFX 2KZ1B 1J5CA 3PPEA 3BKYL 2DJ4A 1MCNA 1SQ2N 2CRIA 4OZHB 1IM9A 1RU9L 3VH8A 3KDMB 3H0TA 4M8QB 2WBWB 5D1XB 3ZL4L 3IGLA 1SXBA 3NJGA 4PN6A 4FQQB 1UA6L 5EMYA 5TJWK 3P1VA 3H54A 4DF9A 4OCXH 4RGNE 3PWLB 2A6IA 1SF3A 4LGRB 3S3SA 1JVOA 3DHUA 3CBJB 4CMHB 1Q1PA 2FYYB 4M6NH 2Z6FA 3NIFF 4ZX5A 4E41B 2NLJA 3DYOA 3RJDA 4JN2B 4LE8A 43CAA 1ZVHA 3FU5A 1JK9B 2XG5A 2FEEI 4PRHA 5F7WC 5JQHC 1J1PL 1K6QL 2CDFA 1GYAA 1SFHA 4ZMNA 3ALXA 3KYNA 1OAKL 3E6HB 4DOHE 5JTWA 3AGVA 1I8IB 3DI3B 4PMFA 2R2EA 2E9WA 3ZE0B 2XWXA 4MA1C 4WEEA 4NQEE 4XC3H 4Z7QF 4A6YL 1QSED 5CD5D 4PGCB 5GS0D 4YAQB 1T5XB 3AG1B 5KVEE 1PPIA 3OPUA 1CFNB 1DCEA 2RFXA 3ZK0A 4EIBA 5KVEL 1FDLL 5IFAH 5C7XH 3WTYA 3ZE1B 1FLRH 1J11A 3RWFA 3S98A 5EO0A 1KJ2A 2ATPB 1F3DJ 2OW7A 3LZFH 4P2RE 2OMXB 5ERWB 1KPRA 4NQDB 3C6LD 3PHOB 4JGJA 1H8NA 4JRXA 1AGEB 3SO5A 5TPWL 1ZJBA 3FUHA 1IM3D 3HG4A 4LO9A 1OM3H 4KDVA 5GQBA 4RNRA 2ADGA 4F92B 3TPUB 3OWEA 4OJDH 1ZA3A 4HEPG 4B9JA 5I8KH 5FUZL 1TYRA 1YY8B 4GAJL 4PHXA 3IT8D 4DEPC 2Q9OA 4DKTA 3D0VA 1VACA 4UF7C 3V6OC 3L7FB 4HXBL 5A2FA 4PWFA 1AFVH 4S0HA 5IVZA 3HHRB 1AD9B 2JB5H 3CX2A 4GKSB 3WL9B 5LN4A 3ZZ1A 4B9ZA 2NX5E 3QXDB 3HRPA 3MROB 3IXAB 5AUMB 2AHIA 4X7TB 3MRDB 4JB9L 1J1OL 3WEXA 1XXFC 3WD5L 3KYOA 3BE1L 4PCKA 1I3UA 3FRPA 2G3MA 1ADQL 1LO0L 3NEOA 1ANUA 1W72L 2H6UA 4YXLH 5BS0E 2DQJL 15C8H 4N1CA 5FOJA 4DO6A 1J8HE 2QV4A 3ALPA 5I75C 5IKCB 4L4TE 2QPFA 3LS5L 4ERSL 1NWPA 3KCPA 4H8WC 4L3CB 3MRRA 3BH9A 1VFAA 4W70A 2O72A 5FWQA 2D2OA 2NXZD 3NJJA 5KYNA 2BOLA 1RAMA 1A6TA 3GSNA 3IDXL 3SGDH 1ZGLB 3QZOA 4LLMA 3LKPB 2IDFA 1OGPA 1KGIA 2N7SA 3F00A 3GO1H 2ZKMX 4J3OH 1JWMA 5FF6B 1RD6A 2FWSA 1KTJA 4JRLA 4PJEA 4X0KB 4X8JA 4IRJC 3OAZK 1MFAL 3FMGH 2PTTB 3HBGA 3W11D 4HG4K 5DD3H 3NIFE 5L2JA 1ET8A 4M3HA 3QDMA 4D9LH 1I8LA 3ARGB 3IYLW 3MUHL 3MOAL 2ZG2A 2O6DA 2VZOA 2JJSC 4K9JA 2JKLA 3ZQ9A 5DD0L 3SJVD 5CJXC 3V7AG 1AP2B 1MQKL 3KPOA 4KY2A 2OYKA 2Q86B 3RVXC 4G1EB 5HGAB 4Z7QE 3S37H 4YDKH 5IMKB 4AENB 5I23A 5K69A 3D05A 4OZGA 5DJ8A 3B1TA 5ANMB 5JO5B 5IMMA 5H8DA 1FAKT 1MFUA 2VDQL 3DJZA 2OPCA 1C5DA 3VSTA 3VXSD 1INQA 1DLHA 2XNAB 1TETL 3WKNA 2Z0UA 1E6JL 1YJDC 1WTLA 4ZMOA 5EC2A 2BVQA 2FJSA 3FFDA 3U9WA 1OK0A 4JFED 2X44D 1SMAA 4NKDB 4JR9L 5TK4A 1M53A 3QDAA 4OV6F 2EVJA 2BNUB 2WKLA 3GMPA 1U3YA 4PVBA 1DN0B 2ITCA 1MVYA 4N0CC 1NGYB 2Y1AA 2E8ZA 3DGGA 5DK2B 1F8TL 1AVAA 2LAAA 2B2XL 4XRCA 5DZJA 1O5DT 4B95C 2WLNA 4QJ3B 5DURD 2ZOKB 1F45A 1LXMA 3QIUC 1X5AA 2YLKA 1CGVA 1IFGA 3GBML 3AQXA 4RA3A 5M94B 3F85A 3GIVA 1DYZA 3KVDD 5H37H 4AQAA 5BVJA 5IHUL 1SYVB 5KAQG 2X4UA 3ZIYA 4N8VA 1JHLL 2HLEB 2NY1D 4ZUVB 3QXTA 1XFPA 4UDUA 1BVKA 1CG9A 4QO1B 3HHSB 4PJXA 5E9DE 1WZKA 2VN5A 4BDVB 3SPIA 1L3WA 4DGVH 4G82A 3GSUA 2K3HA 4P4RB 4RMUA 5FDYA 1KULA 2PYED 5EFIA 1KTDB 2G0LA 5HI5D 4XH2B 2OR9L 4XPHH 5FO9B 3TNNB 3U2SB 3QAZB 2X70A 4QNPF 1FNSH 1HOCB 5EC1B 3HE6C 3KPMB 5EU5A 3HCVB 1HSBA 1SBSH 1XH3A 2E6JA 2GC7C 3DX3A 3QWNA 4MNQE 5AYQA 5ADOL 5KSUA 4WHYH 2F58L 2X4NA 4YEEA 1VADA 2OL3A 3EGDB 2ZXQA 3EJUA 2X38A 1RY7B 4K55A 1N6QL 2CJTA 4H2AA 5GGVY 1K5WA 3ZKXB 4OZHA 1RZFL 4OLEA 3G04B 5FW7A 2K4AA 3KDMA 4GLRI 4M8QA 1XCQB 5D1XA 3PXJA 4XCEA 2VXUL 4FQQA 1TTUA 3KPLB 2ZOUA 4P3CL 4YX2H 2QR0B 2DQDL 3PWLA 4PP1D 1ZLWH 4DK6A 1GA2A 2ED9A 1Q9WB 4M5YL 4OUOA 2BWQA 1ZEAH 4HUUB 5T1LB 2A77L 1QR1B 4E41A 2FYYA 2Y5EA 3AQZA 3ISWA 2OMYB 3FU8A 4RGNB 4JN2A 3QNFA 1JK9A 2FO1A 3NSCA 4BSVB 4YSQA 2DY2A 2YQ2A 1YMMD 1IMHC 3VD1A 1E9QB 3E6HA 1PLBA 1I8IA 1CU4L 4HCRA 3O9WC 1R19A 3ETTA 3ZXAC 2HUEA 5DHYB 4PGCA 5F3HB 4DOHB 1L0XA 2GYSA 2GUYA 5EDXA 4A6YB 1MFDH 4AEFA 4TUKH 4YAQA 1T5XA 4YSCA 1AE6H 4NQEB 1CFNA 3L1FA 2LLGA 1PLCA 3OGCB 4M1DH 2IQAB 2ATPA 4J7RA 4X80H 2OMXA 5ERWA 3SQRA 4NQDA 3N44F 3F7QA 4DKEH 1AGEA 1MCBA 3AXLB 1B0GB 4P59H 1DDTA 4P2RB 1QFOA 4HKJB 3NJHA 4APXB 3JXAA 2BPBA 4GKNB 3TPUA 2FAUA 4FHJA 1YY8A 1D7DA 32C2B 4OCRH 1EVTC 3UTZB 5EU7E 3L7FA 4N85A 3Q7JA 4NAMA 4PWJA 1AD9A 1ITBB 5A3ID 2DLFL 3PRZA 5TQ2H 4FFVD 4ZW3A 1WQVT 5LBVA 3PS6A 1PZAA 4Q6KA 1EGJH 3LHPH 4YHZH 4R26H 4GKSA 5KOVC 3WL9A 3SDYL 3QXDA 3MROA 1SOQA 3IXAA 5AUMA 5BQ7B 4J3OC 4X7TA 3D9AH 3MRDA 1KLUB 1F4YL 4LZKA 2IAND 3LPPA 1PIGA 1RU9H 2NX5B 2YXWA 4AX3A 2BSED 1KPVB 1YEWA 4MLSA 1A9BB 3WNJA 5E8NB 2Z91B 1L7TH 1AGCB 1W72B 2J57A 3CZKA 2JFCA 5IKCA 1AR1B 5D4HA 2PWEA 3T09A 5BS0B 3RLSA 4G5ZL 1J8HB 4A7QA 3H9YA 4O2CB 2Q7AA 1HNFA 2BY3A 4L4TB 1KGCD 2ZKHH 1F4HA