2IDFA

P. aeruginosa azurin n42c/m64e double mutant, bmme-linked dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron transfer in a crosslinked protein dimer mediated by a hydrogen-bonded network across the dimer interface
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idfA00
3IN2A 4KNTA 1NTDA 1BXAA 4DP0X 3FS9A 1L9QA 4WTQA 3T6WA 1XB6A 4A66A 1RCYA 1J5CA 1AZUA 4EF3A 3ZIYA 3X1EA 1GSKA 1NWPA 3IBOA 4F2FA 2UXFA 3FSVA 3CVCA 1SFDA 1GW0A 2B08A 1WA0X 4YSTA 4E9TA 4YSSA 2XX1A 1SDDA 3T6ZA 3T9WA 4FAAB 2BHFA 4GP5B 1PLCA 1MG2C 3QPKA 2X87A 5TK2A 2DY2A 2PP9A 2IWEA 4YSRA 1JZIA 1AOZA 5B3SB 1KV7A 3WI9A 1AAJA 1KCBA 1ETJA 3UABA 2AANA 1V55B 3QJSB 1ZDQA 4F7KA 2NRDA 3FYEB 4KO9A 2J57A 3EF4A 3TA4D 4W1TA 3NJNA 3MBWB 3FU7B 2W8CA 4A68A 1DYZA 1ID2A 1SNRA 5B1KA 2BWDA 2YXVA 3DIVA 3U25A 4GXFA 7PCYA 1SHWA 2FT6A 3DKHA 2IDQA 1JZHA 6PCYA 4JKNA 3WNIA 1IBZA 2FNWA 5I6NA 4DP6X 2ZWNA 3OMAB 2UX6A 2XYBA 4GY4A 4KOCA 2B3IA 5B1JA 2YAMA 3WKQA 3CVDA 4HCIA 2TSAA 1XB3A 4G72B 1KYAA 1L9PA 4E9QA 1ET7A 5B7MA 3WNJA 2PPEA 1MZZA 3NJGA 2FQDA 4UAHA 4E9YA 4E9RA 4TXVB 4F2EA 2HZHA 3CVBA 2X88A 3FQYA 2GC7C 2A3TA 1ADWA 1NPJA 3H4FA 4YVNA 1OCZB 2OJ1A 2H47C 3PAVA 1MDAA 3RYMA 2BWIA 3CDZB 3FPYA 3KW7A 2JKWA 2XXGA 3HEIB 5I5JA 1E65A 2WSDA 1AANA 3T71A 4ENZA 3BQVA 2HRGA 4N8UA 2J55A 2TSBA 4JHUA 1E30A 3S3CB 4JHVA 5F7AA 3NJHA 2MRYA 2OCCB 3NSYA 4DP4X 7PAZA 2GSMB 2XV3A 1RKRA 5A7EA 1AS7A 3UADA 2BZ7A 2PP8A 1PZCA 1CC3A 2HX7A 1X9UA 4UANA 2XXFA 4KOBA 1AZRA 1A4AA 4G7SB 3MX0B 2XWZA 2CUAA 1V54B 1A4CA 4CSZA 4A2EA 2FJSA 3AY2A 2R7EB 3NT0A 4BXVA 2GB2A 2H5UA 1RZPA 1PF3A 1GS7A 1KDJA 3QQXA 1AACA 4N4YB 4UF7C 2PPFA 4ZK8A 2VN3A 2VSKB 2P80D 3V9EA 1XB8A 3X1NA 1W8EA 3FPXA 2BP8B 2PPDA 3FU8A 3EH4B 3FSZA 3H4HA 5I28A 3PAUA 3NYKA 3NJKA 4HIPA 4K9JA 1E5YA 9PCYA 1GS6X 5I6LA 3NJMA 1TU2A 1BQRA 1PY0A 1PLBA 1J9TA 5E9NA 1HAUA 2ZONA 3ERXA 2FQGA 1SF5A 2YQBA 5I6OA 1ZIBA 2IDFA 1WA2X 4DP1X 4NB7A 1KGYE 1EHKB 3TBCA 1OE1A 4QKTA 1JERA 4L0PB 2FQFA 3N2JA 4KO7A 1AG6A 3QJTB 1EZLA 1KCWA 3FQ2A 3SBPA 1SF3A 2CALA 3SQRA 3NJIA 3NSCA 6PAZA 1M57B 2GIMA 1QLEB 1SJMA 2HX8A 1E5ZA 3TASA 1ASQA 3X2QB 1FWXA 3DTUB 3GDCA 2QPDB 4DPCX 1A3ZA 1L9RA 2JXMA 2PP7A 3GYRA 3V9CA 4A2DA 2XV0A 5D4JA 1HFUA 5FC9A 1GY2A 2W88A 4G71B 4AKQA 1L9TA 2XVBA 4HCGA 2YXWA 5ANHA 1RZQA 1NIDA 2FT7A 2IH9A 5I6KA 5D4HA 3EH5B 5AKRA 3ZX1A 3QJVB 1NICA 2IAAC 1ZIAA 2DYSB 2PCYA 3NSFA 3FSAA 3X1BA 2EIMB 4CSPA 2GBAA 4BWUA 4Q89A 4PCYA 1I53A 4WKXA 3NP4A 4Q8BA 4A2FA 4DPAX 5F7BA 4YSCA 3NP3A 1JZGA 2IWKA 2MTAA 3WG7B 1MG3C 2VM4A 4M4RB 2H3XC 5I5IA 3OD3A 4YSEA 4GP8B 1AZBA 1OCRB 5LDUA 1IUZA 1TKWA 1UATA 2J5WA 4DP8X 2YAHA 3PLYA 5AZUA 4BK5C 1M9WA 4YSQA 2BW5A 3ABKB 4P5RA 2DWTA 1IBYA 1PZBA 1SHXA 2HX9A 1AQ8A 2PPAA 1URIA 3JT2A 2DV6A 2FTAA 5AFAA 1AZCA 1AZNA 1AS6A 3TU6A 1BXUA 2GI0A 3D12B 2HRHA 2I7OA 3ASNB 4NAJA 2AZUA 3CZUB 1GR7A 1OE3A 1BYOA 2AZAA 2UX7A 3SBRA 1ASOA 4GYBA 1L9OA 1N68A 1AG0A 2OV0A 1A4BA 1NINA 1SDDB 4KO6A 2YAEA 2VW4A 3NSDA 4W9ZA 3QJQB 3ZBMA 3KW8A 3ASOB 3G5WA 4YVUA 5D4IA 3ABMB 3OMIB 4FA7B 2BO0A 4DPBX 1WA1X 2CAKA 1ET8A 3UAEA 2WO3B 4YSUA 1F56A 2YAQA 4AKPA 2LLNA 1NDTA 4PAZA 1FA4A 4KNSA 1JXGA 1NIAA 2QDVA 1JZEA 2I85A 2IDTA 1FFTB 1NWOA 1V10A 2IDUA 1PAZA 2I7SA 3CDZA 1PZAA 3CG8A 4DP9X 2IWFA 3H56A 3S8FB 4M3HA 4AKOA 1AS8A 4GP4B 1JVLA 1ZV2A 4BWTA 3X1GA 4BDVA 4MFHA 3PXLA 3QJUB 2DYRB 1DZ0A 1M56B 3QJRB 4E9WA 1BQKA 1R1CA 1ZDSA 2FWLB 3EH3B 8PAZA 4YSOA 5PCYA 1N70A 1KDIA 3ABGA 4KO5A 1W6LA 3EHBB 3NJJA 4X4KA 2YAFA 1GS8A 2BZCA 2QDWA 4A2GA 1BEXA 2BP0A 3AG1B 5B1AB 2R7EA 1QHQA 1MZYA 1NIBA 3IN0A 2N0MA 2VSMB 2PPCA 2VM3A 3BVDB 2FQEA 3NJFA 3FQ1A 2XU9A 2YARA 3OQRA 3UACA 1JXDA 2BW4A 1PNCA 3FSWA 1PMYA 1NIFA 5PAZA 3WIAA 2BP8A 1J9SA 3FT0A 3C75A 2WO2B 4YSDA 1X9RA 2HLEB 2P80A 1TEFA 2JFCA 2XV2A 2CBPA 3AG4B 4AI7A 2IDSA 1BAWA 2ZOOA 1IKOP 2EIJB 1J9RA 1OOWA 3NJLA 1ZPUA 1CYXA 1GYCA 5I5MA 4YL4A 2YAOA 3OMNB 2VMJA 2EINB 3AZUA 3PPSA 4YSAA 3IE9A 1JXFA 2UXVA 3S3DB 4P5SA 3T6XA 3S8GB 2UXGA 5IY5B 4DP5X 3OM3B 1T5KA 3N55A 4HAKA 3PAZA 4HCFA 2PCFA 4G7RB 4HHWA 1ILSA 4HHGA 1W6WA 1IC0A 4G70B 4AX3A 2EIKB 2VW7A 2Y1AA 4YSPA 2E86A 2PLTA 3TBBA 5B1JC 1HAWA 2HXAA 4DP2X 4RH4A 1OE2A 1YLBB 1KBVA 3FU9A 4E9VA 3PCYA 2CCWA 4DP7X 2FT8A 1JZFA 1JZJA 3UAAA 1WS7A 3ABLB 2AVFA 5I26A 4E9SA 4HZ1A 3UGEA 1J9QA 1ILUA 3FU7A 3HB3B 5TK4A 1GY1A 4G7QB 1BYPA 1OV8A 2XUWA 3AG3B 4BDVB 1WAEA 4BWWA 1ET5A 1ASPA 1OCOB 2IH8A 2UXTA 1J5DA 1VLXA 2EILB 1OF0A 1L9SA 3SBQA 3WKPA 1CYWA 4E9XA 3AG2B 4QLWA 1KBWA 1SFHA 4A67A 2VW6A 4AZUA 1XMEB 3IEAA 5I6PA 2Q9OA 2CJ3A 1JOIA 2BP0B 3S3BB 3X1FA 1NZRA 3FYIB 3GXUB 1JVOA 1A65A 2QPEB 1PLAA 2XX0A 4HALA 4KNUA 2Y69B 3T6VA 5B1BB 5EHFA 4BXSV 1CUOA 5I6MA 1TEGA 5B7FA 1BQ5A 3AW5A 1PNDA 5B7EA 2Q5BA 2RACA 1NPNA 2GHZA 2QT6A 1E67A 3ZDWA 2XLLA 4NERA 1B3IA 2AFNA 2DWSA 2ZXWB 1WS8A 3JTBA 4A2HA 1NIEA 1QNIA 2YAPA 3L45A 1AIZA 1BXVA 1OCCB 1CURA 1PCSA 2J56A 1A8ZA 2GC4C 1AR1B
chains in the Genus database with same CATH superfamily
3QZWG 1I3RB 4F7CA 3FS9A 5CEZL 2P7TB 4ZX4A 2H7WA 2WYHA 5ID0B 3C60C 4H88H 3BCFA 4U05A 4HJ1A 2LV4A 3JWNG 1NFDF 3QRGH 3APMA 1JZ2A 1KN4L 4LCYA 4MCNA 2DL9A 3QUMA 1H5BC 1SUJA 4B53A 1DVYA 1IAIM 3LHPH 5BO0D 1ETZB 4MZIA 3LS4L 5BZWA 5DJCA 1ONQB 4FAAB 2FX8L 1TPXB 5F0MB 1MG2C 3AY4A 3GXFA 5H2BB 2AEPL 3GKWH 1USZA 5E8OA 2A9MH 2J1XA 2LLLA 3AWFA 25C8H 2EICA 3M1BB 3B7RL 3WFEL 1VEOA 2VQTA 4OCNC 4AGNA 1VKXB 3EGXB 4MWFA 1Y18A 3I50H 1YPZB 4HLZH 4NZRL 2XWDA 3TO4B 1KEML 3GZQA 4BZ2L 4YLQT 4ODUB 2Z1KA 1VFAA 4E41A 1ZT4B 5ITFB 5I18H 4KO9A 1KT2A 1N0LA 2VC2B 2ORBH 3GI8L 4EDWH 1XCQB 4PRIB 2MCPL 1BX2A 3WJJA 2CM5A 1T66D 1N3NB 2VDNL 3N9GL 4EXPX 3EW3B 1U33A 2ENSA 3ARUA 4MB5A 1O0VA 4I0PA 3BP5A 2IDQA 2PF6A 2UYLA 3FUKA 5TDOA 1IBGH 2YEZB 4NQEA 2HLFC 2NX5D 4PRPA 3ARXA 3BZ5A 1YY8B 1NLBL 5F7YC 4IU2A 1M05B 4HMEA 3UTPE 1N5YH 3V0VA 3HRPA 2IV8A 1BD2B 5JHDD 3WKQA 3CVDA 5JXED 3GHEL 3QIWA 4RFNB 3VW3L 5GZND 2HFGL 3DIFB 3X12B 2CBTA 1MEXH 3SYOA 5E2VL 4Y9GA 4XP6H 5ID1A 1DJWA 3RAJL 5I8OH 3GB7B 1WZAA 1KIUB 3RBSA 5I17A 2B4CH 3BPOB 1G1YA 2ZOLA 3ML9A 4J6RL 4JL2A 4F2EA 1INDL 1YPZE 4UT6L 2X88A 5D5MB 4LLDA 2XIBA 2WCPA 3O3DA 4KWUA 3WEXB 3MRPB 2IFFH 3D18A 3P2BA 4TTDD 5C9JB 4LP4A 2CNYA 4JO4L 3D0VB 4FFVC 4CBZA 3MRBA 2VGLM 4FHBD 4GNKB 5EA0L 4PRIE 3QQDA 4U1JB 4KY1H 4Z18A 8CGTA 3RFZA 4Q6KA 1MREL 4KJYB 1S9WB 4LLWA 1WDAA 2GBUA 4KROB 2W65A 3AREA 2OK0L 4JHVA 5C8JA 2B1OA 2MRYA 2DWEB 3L08A 1DVSA 3OLGA 3FO9A 4DP4X 5B3NA 1JNJA 5A7EA 1F6FB 3S2CA 4UYQA 1IX2A 2FK9A 1OPOA 4HF5L 4P46A 5D1QB 5DC2A 4P8QA 4AC4A 1G6RL 1BD2E 4IYKA 3L5HA 4AY0A 5LDSA 4XPAL 4FZ8H 4JM2F 4NSKA 1A4CA 2QPSA 5A6MA 4N0YL 2JH2A 1P4BL 1GHFL 2E8ZA 3AY2A 3PGDB 3DPBA 2Y0SA 3OLEA 5DHVB 2BSCA 1DQJA 4NKDA 4PN6A 1AIFB 1GC1C 2NCMA 3EOAA 2IPTL 2ZWLT 3DBSA 2P45B 3K8LA 1QUNA 1RD6A 4L3EA 4NO5A 5CWSB 1NBQA 5FFOA 2VN3A 3KVDD 2F7QA 3NUKA 3QWNA 2I5YH 4RLDA 4WEMB 2R56L 2ZNXA 2YMOA 1I8AA 3O9WB 3DROA 3MA7B 2DRUA 4JFPA 1HSAA 3HAEH 5L4IA 4APQB 4UV7L 3VQMA 4RNRA 2J1ZA 4KMQA 1MCEA 5DRNA 5HDRA 4UQEA 5E9NA 2PWEA 1NAKL 5FK9A 1HSBB 2JB6B 4JUTA 1T2QH 5LCVL 2EE2A 1T1WA 3H2QA 3T1FB 3L7FB 5D1QE 1MFNA 4HULB 3IJSA 4NKIL 1AKPA 5FFGA 2EUXA 3S37X 2Y06L 5E2WH 1J5HA 1CPUA 2V37A 3VGEA 1EFXA 1RJYA 5D7IF 4HLJA 2FQFA 2NY7H 2P44B 1Y6MR 4OZFB 1RJLB 1U4FA 2JCCA 2EVGA 5C08D 2ZJSH 5KBPA 2EIZB 1YNKH 3RB7A 4CGUB 1FZMB 2W60A 1RHHA 5H35B 3OB0H 2HX8A 3C9NB 5JLZA 1EXUA 3P4OA 2QADC 1FNAA 2NW2A 2I60L 2VYRE 2X6MA 3TGXA 1ND0A 2C9XA 3TA3D 3MUZ1 1R3IH 5DHYB 3SJVB 3MGTA 3A4AA 5K1JA 3IU4L 2EDXA 4KXZI 2EIEA 3MNZA 4HJTA 4K5OA 4O9HL 1FVEB 4Z78A 2ZUYA 3VFNB 5GS0D 1CMOA 1BSIA 4OLVL 2A77L 2YXWA 4H8WH 2X4RA 1LD9B 4K9EL 3T3MF 2W80C 2QKIB 7TAAA 4P3DA 5SX4I 3M1OA 3FT2B 2WQ8A 3GKZA 1JK9A 4L4VA 1V7NL 5E6IB 3E9TA 3LSOA 2CR0A 3D25A 2XN9B 3GPSA 4ELMF 3QQ3B 1ADQL 4NBXB 4MXQD 3GNML 4KXBA 1XAKA 1I1AB 1MVUB 2Z8RA 3LRHA 4PB9L 1IQDA 1XF3A 5KZCD 4FULA 2HP4A 2O5ZH 4M4RB 2EEAA 2JJTA 2PW2A 3QZWB 2ZP0T 3FHQA 2D2OA 2ARJQ 3UX9B 5LDUA 4IOIB 3SJVE 1DJSA 4PREA 4DP8X 1X5LA 2I25N 5BQ7A 2X4UA 1YNTB 3D50A 1I7ZB 1OB1A 3NPZB 1FC2D 2BW5A 1X5GA 2VLRA 2UY6B 1AYRA 4W9EC 4D2NA 4HFUL 3BPLB 4ZYKA 3M46A 5K39B 1NCWL 3RTLA 4JVUA 2MOQA 1KTLB 3SYQA 3GMMB 4TNVF 4UQ2A 1UOVA 3GXMA 1UWEL 1RK7A 3GSNB 5CSZB 1BXUA 4U6YA 4EBQL 5FYJH 3RWGB 4L5FL 3O6FA 3OF6D 3CZUB 1IEBA 2A9CA 5BRZA 2AZAA 2UX7A 5DQJB 4B9CA 2DQCL 2AJYL 2IH1A 2L04A 1VHPA 3DUUA 4KO6A 1S7QA 4XCFL 3Q9QA 1YSOA 4X5XA 2HT3C 4YHPA 1MCJA 4OLUL 3U1SL 3VFOA 4UZSA 1I9IL 3ASOB 1CVRA 5TDPA 4Y2OB 4KNQA 3GJFH 1A6VL 4RFEB 3OXRB 4J3OF 5TJWK 3V4UH 5J1SC 2RFXB 3GSWB 2GBVA 2HT2D 5E2JA 5HGDA 5HI4D 2XWEA 2DJUA 3IDXH 2H6OA 3JWNE 4ONGH 1R3LB 3PRZA 4J3WA 3CFJA 4MQ7A 2IQAB 2ESVD 3NCJH 4NUGL 1MN4A 4FQCL 4JFEE 4OF3A 4ONHA 4AVHA 4QXUL 1YN6B 4KHXL 4GBXC 3B2UD 2XVKA 1FZJA 4HCRL 1J12A 3BQUC 3HC3L 3I9GH 4KDVA 4KITB 1TFHA 2ZX8A 3NQKA 4Q9RL 4KRMB 2YD2A 3GSVA 3WD5L 4WWKB 2R29A 4RA3A 4JDZB 5D55A 2PWGA 4MXVF 3Q1SH 2XZQL 2NUPA 2G75B 4Z3JA 4L37B 2DMCA 5DEJA 4MJHA 2NNRA 2D3LA 2B14A 2VQ1A 2AXHA 1TF4A 4ZX5A 4M1DH 5JDSA 1ZA3A 4M4PA 4OJCA 1P7QB 1TVDA 4X8JB 2Z6FA 3HTLX 5DWPA 5JDJA 3KPMB 3ZLQC 2MCAA 1DBML 4NQDB 4NENB 3BLBA 1BPVA 2J21A 2WTPA 4WU5B 4GW1A 4PJAA 2IGLA 1KJ2A 1IZKA 1W91A 2CSPA 2ZXGA 3DDGA 4RMRA 3S3JA 4YSDA 2AV1B 2P80A 1JHLL 2UUDH 3B2VL 3P9MA 3V6ZA 3NA9H 3BZEB 3PUCA 5KJRH 3GIZH 4PWIA 4JM4L 5C7XH 5HI3C 5ABDE 1NCOA 3QIBA 3F00A 3T2NH 5DJXB 3K3QA 1WZLA 1PAMA 3CHPA 4ACTA 4WV1C 3FONA 4ZMPA 1ZJBA 1JXFA 3Q6GL 4HZLA 5L0QC 2X3CA 5E6RB 1QSEE 3MCLH 3WGUB 1RY7B 1IV8A 3FAXA 4OCYH 1IFHL 1IBDA 1S7XB 3WN5A 5EF1A 4PJEF 4V33A 1O9WA 5GSVB 5EWIH 3BLPX 3MCG1 4JFDB 1PDKA 1PSKH 3AACA 4JKPL 3ULUE 2VLME 1TG8A 1NBYB 3KLSA 1IM3B 4A7VA 1H3PH 4KX9A 1UB5A 2IBBA 2YEVB 4I4WB 3BDBA 4NQDE 1E3ZA 3VG0H 5DMKB 1F3DJ 3QQ4B 4MSWB 3RGVA 4ALAH 4XC3H 3GSRB 3MV11 5FYJD 3NCCB 4J39A 2FRGP 4HJUA 4FNUA 3MRKA 4DP7X 4HWEH 5KAQF 1P5UB 3ALWA 4YAQA 5I0VA 3UG5A 3ABLB 4BHUA 4DJMA 1E7UA 3L3GB 5FUCE 1V27A 4JFFD 2OCJA 5JIHA 1Q9LB 3W9EA 3LV3A 3MACL 5L6YH 4NM4L 1F4AA 4G7QB 4NN5B 1A0QH 2GJZA 5C0CA 4CC4A 3KCWA 3QUKA 4H25B 5FKAB 5C0BA 5EU5B 5CU5A 3Q2LA 3VMOA 3LVTA 4EKXA 4EIBA 5CKAA 1O7DE 1CLVA 4KHTL 3U9WA 2PWHA 1OF0A 5IB4B 1UZGA 4HS6B 3HZMB 3AG2B 4JFDE 4PJIA 4QLWA 3NIDF 3VH8G 3ULVH 5T8IA 2Y6SC 1A6AA 1SLXA 2N1KA 4HJJH 2X6AA 3UZQA 2P46B 4LLQB 2OL3B 3QPXH 3CFEA 5FAAA 3O11B 3V0WH 4FTVA 2V7HA 1OZTG 3FN9A 5DMGC 4KQ3H 5BMFL 4V11A 4ZAKA 5EF2A 3HG2A 3GXTA 1AD9A 2GW5A 3EJQA 1IBFA 3LH2L 3EOBB 4F20A 4MA1C 2VISB 3TF7C 3TT3L 4ALAC 5I19L 2RACA 1QVOB 5F6HJ 4K3JH 3B4NA 4AENA 1YEEL 4RWYL 2PCXA 3VD7A 1KN4H 1A7RL 2FIKB 2H2PC 2NY6B 1CGVA 1CURA 5HYQA 3AITA 1FDLH 2BSSA 4HIQA 4PVLA 2ZNWA 3V6OC 3CSTA 4KNTA 3CMOL 1M4KA 4H4NA 4HETA 4M5ZL 4CU8A 3DX1A 4YK4B 2VZ1A 4LCWB 3BAYA 2E7LA 4UTBL 5TQ0L 4XNDA 2AEPH 5DHXB 2VMEA 3WFEH 1PIGA 4JE0A 1T89C 3BN3B 4G9FA 3VXRA 4EUPG 1A7QH 1WCQA 3ATDA 4RMTA 4NZRH 3ULVC 3JV6A 1KEMH 4MGXA 3RDTD 4Q4IA 3UTZA 4BZ2H 5IGXH 2B08A 4E9TA 1U8PA 3DRQB 3T9WA 1HHHA 1KGIA 2A74A 1SYSA 2BHFA 3GI8H 4DK6A 5EORL 3TEZA 3SDDA 3ZZLA 1T20B 1VFBA 5I1KL 5BS0E 3DSNB 3EUUA 3UEZA 2VITB 5LG1A 1J10A 4K5MA 1XD0A 1AOZA 2L0DA 3BAEL 4UNTA 3QDME 5FO2A 2DLFH 4LKXB 4PJ9C 3WI9A 4WWPA 3T0EA 3PL6B 4CW1A 1R75A 1KNOB 2F53B 3QEHA 2OLDA 2IOOA 4QYOA 2OMZA 4WI8A 1NLBH 3UO1L 1X5XA 4LOVA 4A39A 2V2TA 4LIQL 4C54A 4RFOL 3C5ZA 2W92A 3EYOA 1GGYA 3VW3H 3GHEH 3IDYC 3ATEA 3KBPA 3OAYH 4DKAA 4LCWE 3DO3A 2UVEA 5IVNA 2BIQA 4L8CA 5DEGB 3RAJH 4F1ZA 7PCYA 3DX3A 3CE1A 1CE1L 5DVKA 4J6RH 1KELH 5ALCL 1GOFA 1UOKA 4UT6H 3X13B 2AQ3A 4ZQKA 2ADIB 5M94B 2JKTM 1OSZB 3IETA 1GJIA 2YAMA 4JG1L 4JO4H 5DJZB 5C0AE 1B9ZA 1NGQH 5DDHB 1HHKA 4N9GA 3W82A 1QSZA 1OK8A 4LVOB 4P4KB 4YX2L 3VXNB 2OX5B 3VUAA 1MREH 1MCRA 1WWAX 4JFQB 3RWEB 4BM7A 5I6XB 2OK0H 3VQ1C 2HJKA 1A1MB 3IXTB 4P2YA 2L8AA 3KYMB 3HE7D 1RV6X 5SWZA 3K4AA 3UZEA 4JJ5A 5KYWB 4DH2A 3K46A 3NFSL 3A23A 2VAAA 4I1RA 1RQ5A 1B0RA 3V6FB 4HF5H 5GS2H 2ADYA 4NYLB 3BQVA 3B9EA 1J8HB 3JXAA 4JHAH 4XPAH 4JZNB 1KTJA 5AL0A 4YHLL 1K3ZA 2YBRB 1P4BH 4I18A 1GIGL 4W9LC 1NDMB 3MPCA 5F88A 2IPTH 5MEQB 2UZIL 4JPIA 4ANVA 2IAMC 4GQRA 3L17A 3UP1A 2AK4D 3LRKA 4LVNB 1IQWL 3DOSB 4L8SB 3LEVL 3IFPA 5EPMA 5CSGA 2K1MA 3C6SB 4X9HA 2M1KA 3UTSA 4XP4L 3D4ZA 2EDYA 3B2DC 5EMYA 4MJ5B 4P2RD 5IVZB 4EN3D 4D9RD 3LKRB 1ZGLP 4P2OB 1BVLA 1PF3A 5JO5B 4JK0D 4OGYL 1RURL 4UV7H 3BH8B 3T77A 3HRZC 4TLKA 2NDGA 3BIKB 1MW2A 3S4SA 4BCYA 1NAKH 1W8EA 3VGBA 4JY6A 2ZUSA 5DEFB 5LCVH 5CGYD 4A1RA 3L2LA 4QRQA 2DZEA 4NKIH 3PAUA 1J8HE 3QK0A 3TVMB 4DCQA 4K07A 2Y06H 1DQMH 4WJ5A 3UG4A 1IC5L 4Y4KB 3X14B 1FNLA 1Q72L 4BKLA 2J8HA 5HSFA 3LZFH 4ODWB 4BH8B 5IEHB 5AVWB 5HHNB 2FGZA 3S35X 1PD0A 3TCLA 3FAWA 5IQ9A 3HB3C 4OSUL 5I6OA 3H8NA 1G7HA 1BFSA 1X7SA 3IGUA 35C8H 4XNZC 3SYPA 4Z76A 2QSCH 3U4EA 2CQVA 1NGWB 2I60H 3LEXA 2NLJB 4HOWA 4XNAA 3ARDD 4PTTB 4LSSL 2CDFB 1H15B 1JGEB 2ICWA 2LQRA 5GGUB 3IU4H 5DK3A 1TLMA 5F44A 4TUUA 1K2DA 4O9HH 1N19A 4MCZA 3BIAX 4JGMA 3IT8D 4OLVH 2V7NB 2RMNA 4HHAB 1N0XH 4K9EH 5EOTB 1BQLL 3GDCA 3NCYS 3UBFA 2Q7AA 1G1KA 1FO0A 3OKKA 4OZHE 1V7NH 3VH8B 4I1PA 4NP4L 2VR3A 3S36L 2G60L 3NH7L 4AKQA 1ED3B 4WI9A 4CVZB 5I0DA 1ML0A 2VDRB 4PB9H 2JCCF 2DDQL 4MAYC 4F27A 4YFEA 3FCGA 3RZCD 2DMKA 1NBCA 3ARTA 4LMQI 4HK3N 4UQ9A 3P0GB 2WJ5A 3EXLA 4Y16B 5D9SB 4QCIA 2UWEB 5I1JL 5GGSB 4HC1H 2I26N 1BW8A 5E51A 5JYLA 4F5CE 4Z5RA 4G8EB 1UA7A 5ESAA 4B9FA 4CN4A 1AXSB 3QJHA 3QJFB 4JFOA 3VFMA 2H1PL 3AGWA 3MRNA 4GG8A 3OHXC 5EIIG 5KVDE 1T6BX 4KV5E 4Z7QE 5E5UB 1Z66A 4N0FB 1OCRB 1NC2B 2J88H 1NCWH 4OQTL 1S9KC 4XVJL 1ZS2A 4XMKL 2DH2A 2YUZA 2VL4A 3SKNB 4A6YL 4EI6A 4HUVB 1UWEH 1YDPB 5T1LB 5F0PB 3ZHKA 4EUPB 1F4HA 3DX9B 4DETA 3ABKB 1CLZL 3MV7D 2CG9X 2IADB 2DQCH 2PPAA 4Y5VC 1KYDA 4JO1L 4PLJD 4WEBL 3SGEH 5D6DA 3MBWA 4XCFH 1A6PA 4GLRH 5CLWA 3T6QC 1OAQL 4OLUH 4NCC1 3BRFA 1I9IH 3CCHA 2X9YA 1LO5A 2XQYA 4MMXC 3EO0A 4QOKB 1ZCRA 4B97A 4O2CA 2F8XC 5TD4A 4J2XA 2HPOA 2B1HL 3FF7A 3GLEA 1CK0L 2VLJE 1E9OA 5CD3A 4FXKB 5EU3B 3VDCA 3QJQB 4NUGH 1XHHA 3BN9C 4FQXD 3KW8A 2R59A 5DZAA 3G5WA 4FQCH 1BWMA 3HE6B 4PY7A 4Z95H 6FABL 4X2UA 3APNA 2FZ3A 4FQ1L 4L3CB 1D7FA 4KHXH 2C8NA 4QXUH 4F8NA 5IVXB 1YEHL 4P5TC 1TQWA 4Z77A 1R3KB 2FECI 4AM0B 4HPOH 2ALAA 2XJLA 2H8PB 3LOWA 4ZFOB 3T0WA 4ECNA 2AJUL 4Q9RH 5D1XD 5I5RA 3II3A 5IFJB 2IWFA 4AKOA 4LASL 2BHUA 5FA4B 1JFQL 3FQUA 1ZLUH 2AV7A 3ARFA 3FQTB 2XZQH 1K8IB 5LHDA 1S4IA 1JGVL 1MLBB 1JWUB 4FYTA 3MV9D 4FF9A 3MUY1 4PB0H 4PJGA 4ZO8A 4W6WB 4XVTH 4HKBB 1OANA 5E5RB 5DD5H 4OD2A 1EUUA 3TH2T 5E0FA 1YMMD 4QOKE 3GC3A 5HPMB 4L3AA 3QNXA 4C4KT 4B0MM 2DPKA 1AD0B 2F08A 1DBMH 1WO2A 2BCKA 5DGQA 4LEXL 3DO7B 1BEXA 2BP0A 3LQZB 1O75A 2EE9A 4U6XB 2Q7NA 2JJUA 5BJTA 2KI6A 4TNVK 4U3SB 5IVXE 3B2VH 4PHZA 5EZLA 4NO0A 5EO9A 4NWTL 3K8KA 4LF3A 2WXFA 2YRLA 2HA1A 3OQRA 4JM4H 2JK5B 3ZRSA 5KSBB 2Z91B 4MA3A 2BW4A 3HAEA 3ARBD 5D7JC 1CDBA 1PMYA 1MI5A 4AIOA 3Q6GH 1YN7A 4NQXB 3REWB 3MO1B 4PGEB 3GUTB 4DZBA 4QGYA 1G5AA 4JPWL 5E1GA 1IFHH 4L1TA 3PIQA 3ZTJH 5AG8A 5MI0B 4L4JA 1QO3A 4DVRH 4JKPH 5CLTA 1HXYB 3LNHA 1BJMA 2CXGA 3WIFA 1OXYA 4YSAA 2AABL 4Y1AE 4LNVA 1XH2A 4WKZA 2B9BA 3MRRB 4KK8D 4TVSa 2LU7A 2CM6A 4AGMA 1OGAE 1OARL 5DVNA 1MLCB 3PAZA 5HGGS 4ONOA 4LLMB 4OTXL 4AV4A 2DM2A 5ETUA 3NCEB 3PS6A 3GUFA 3KGRA 3CSBA 2JI1A 5EFIB 1ES0A 5JNYA 2HTLD 4HIXH 4RISH 1OP3K 4AJ0A 1A9BA 4NM4H 4X8CA 5FLUA 2Z93A 5FA3B 2X40A 1LEKA 1VERA 5EBWB 2RHEA 4GXUN 4KHTH 5LBSH 3BD5A 5IMMB 1I1FB 2GUYA 3ZT6A 4TQHA 3VYOA 2ED8A 2EXWC 3ARRA 3GTTA 1KIQA 3IKCA 3BP4B 1E4WL 5FYJU 1OEZW 5E9DD 4RAVA 1SBBA 4BFEA 2D9QB 1I7TB 3ZHNA 3L81A 1FN4A 4FXGC 1XGTB 1ZKAA 5A16A 4PJHA 2IH8A 2OR7A 3NEXA 3K80A 5BMFH 3KS0J 1WHOA 2LTQC 4P23C 5ITBH 4KQ4L 4QTFA 2MIZA 4Y1TA 3LH2H 3WKPA 4V2BA 5A2JH 1BECA 1B6DA 1MCSA 3M8OL 4XH2B 2J1YA 2I9TB 3RPKA 3TT3H 4YO0B 4RMSA 4LLVA 1AGFB 1UEYA 5I19H 3L3HB 4FXTA 5CJOL 4G3YL 3PJSA 4UQ3A 2A1WL 2EXSA 1NZRA 1YEEH 5DMIL 3I6LE 3BJLA 1TVHA 4HALA 4XB3A 5KSAB 2PXYC 4TUJA 4XWGL 1A7RH 3ABZA 5LN4A 2VE6B 4GQPH 1SBSL 3QXAB 4AIZA 3CMOH 1UWFA 2CH8A 5B7EA 3TZVA 4UINH 3CBJB 3SO5A 4K94L 3CFKA 3Q13A 4UTBH 5TQ0H 3L4YA 2OULB 4HEPA 4PJIF 2VJXA 1O7SA 5EUOE 3B37A 4BA8A 1I7UB 3QI9B 1IAOB 2YMTA 3PPEA 4MD0B 4EIGB 1O7VA 5J13C 5EIIB 1XZ0B 5K9KA 2HVJB 2WBJA 4RMWA 1G7QB 1VACA 5CN3A 1OAUL 1AGDA 3BUPA 3WFHB 2D3NA 1G0DA 3CZFA 3NRPA 3RVTD 4ODVL 1P7KB 4ZXBB 1KTRL 2NSXA 3UTPD 4A66A 1FYTE 2F1EA 4JY4B 2D73A 2CLRA 4JGJA 5I1KH 4PJCB 5LBGA 3M17A 5J12C 1JVKA 3DECA 2VR7A 5EOCL 3BAEH 2NPLX 3SDAB 4A7UA 5IVOA 4D0BB 3KBEA 1BPLB 1UURA 4UV4L 1NGXA 1KXHA 2XX1A 2Q3ZA 3QDJA 3UO1H 4GP5B 4LIQH 1CDGA 4PBWD 4RFOH 5CJXC 2OZNA 1N4XH 4XB8A 5D2LB 3WFZA 4EI0A 4ZMOA 1OALA 1OK0A 1JZIA 4CKVX 2EKJA 1BIIB 5HDBE 3OWEA 4PRID 3LKSB 4CADA 1WT5C 2ADJB 2PNDA 1R9FA 5ALCH 2F58L 2R69A 5T1DL 2WKLA 5EC1B 1BLNA 2DBLL 4QTHA 4JG1H 3A22A 3NK3A 5IQLA 4ZNEA 1NEZA 2X2YA 1S7SA 3U30C 1S7VA 4YX2H 1MRCH 2N1TE 3CVHA 3DJTA 4PJCE 3LEYL 2WWOA 1BD2D 5F1OB 5C0FB 3LTVA 4OCSL 3FRPG 4FG6D 4PW9A 3TBWA 2KLRA 1L0QA 4DEPB 3HFFA 3W9DA 2ICEB 4NO2B 4S2SB 4EIZC 5E94B 1XB3A 1XCWA 2Q20A 4WI6A 3NFSH 3MYJB 3V4PB 2CZNA 3RWCA 3LIZL 1O6SA 3KLLA 3KNBB 1CE6B 3VXPA 3BW9A 3QCTH 4OUUA 4YHLH 2HJLB 4M3KB 2HZHA 4ETQA 2FBJL 3L1GA 1C5BL 3PGCB 3VCLB 3ZW3A 1V7ML 2UZIH 4KROD 3CBKB 3PV7A 4PJ8A 5HGAA 4PTUA 4HWBL 4P07A 1TQSA 3F12A 1LXMA 3DVNB 3O2DL 3QNYB 3VE0A 1E30A 2AEQL 1AGCA 2C4FU 5J3HC 3J8F7 3PHQA 2ZUTA 1IGJB 2VZOA 3NSYA 5CZVL 1RKRA 4OGYH 2ATPB 1RURH 4IBQA 3ZL4L 2NYZA 4E0RA 5EZOL 5BVJA 1U3HB 3FB8A 3IB4A 2XPYA 4E5XG 3CFQA 2OMXB 4N26A 2YK1L 3WDIA 3N1PC 2HVKB 4UMSA 1U8OB 2FJSA 4DUXA 1EK3A 1SJHB 1XQ4A 3LJ3A 2YPVH 2ZWKA 5DJ6A 2IOMA 5IJVB 4H5SB 4Y4FB 4QRRA 1DFXA 1FL3A 1IIIA 3G04A 1UT9A 3PHAA 3LH9A 3OJDA 4X4XB 2JKIS 4DKEL 4DOHB 4F9PA 4UQBA 3V0IA 1IC5H 2VL5B 4GAGL 5LN8A 3SY0B 1G9NL 1FIEA 3ROOB 3O9WD 1MFBH 5DD0L 1AQHA 3P0VL 3R06B 3R4DA 1A22B 5L4FA 4Z7OF 4APQD 3RKDD 2L7JA 3V6OA 2IF7A 3QIUB 5AAWA 5ES4B 1C1EL 3QPQC 2P5WB 2Q7YA 1UT2A 1J8SA 3PWJA 2EDDA 4DNLA 1RFDH 2A38A 1JWMB 4WCYL 4ZPVB 4D3CH 3SDXB 1JI1A 3TBVA 3NIGB 1RIVL 1QSFA 1AKJB 3VGGA 4P5MB 1S7UA 2Y5QA 5DC0A 4AEIL 1ODUA 4TUKL 1IM9D 3P3TA 1PVHA 1E28A 2P8LB 3U36A 5FKPB 4DOHE 3QJTB 4GRLB 4QRUA 2Y2TA 5AOZA 5J5EA 3AWEA 5JW4M 1RSYA 3ZYJA 4PJ9A 3IDNA 4X6EA 4NP4H 2Q8AL 1UJTA 3FFCE 3NH7H 3PXHA 1QA9A 5H4YA 1GGBH 2BY0A 3QORB 1NGYA 2YRPA 1F6AB 3DRTA 3U79A 2YD4A 4X80L 2GITA 2X3AA 3SJVD 2DDQH 2QHRH 2ZCKL 3C5SA 3PV6A 4L23A 2P5WE 1P4LB 5DJYA 4DFIA 2A73A 1F3JB 2Z7WA 2OW6A 3NAAL 4MD4A 1J8KA 4XZUB 5AKSA 3P3SA 4HS3B 4KKAC 3VFUA 5HGBA 5JORA 2X4NB 1CDUA 3K1DA 1NGZA 3BSZL 1OD7A 1UGNA 2JWYA 1SHSA 2ERJC 2C9UA 3EH5B 1BVKB 4BK4A 5I1IL 2AS5M 4XPTL 3K2IA 2FL5B 2AERT 4LGPB 3WUWA 3LQMA 1S3RA 2VXVH 1I1AD 4BZ2A 1R24B 1T6WA 3BOVA 3NN8A 4H26A 4N1CA 3QXWA 2BSED 2CDEB 2OMTA 5BRQA 4PCYA 1A7NL 4OQTH 4XVJH 3UDWA 4XMKH 1TTCA 4IOSD 1VZIA 2JIXD 2VMCA 3VFVB 1JZGA 1H3UA 4BJLA 3IXAB 1JYWA 3JV5A 2NY1B 2C4XA 3KYNB 2IWGA 1CLZH 4LPVA 3E2HB 3KCPB 4JVPA 5IJDC 2ZPKH 4JO1H 4I87A 1NFDB 4WEBH 1I8MA 3IF1A 4XMTA 3HLKA 3PQYB 5IF0B 3OLDA 1JBJA 4B95C 3L8QA 3U7YH 1OAQH 5B8CB 2RTTA 3ZJAA 1WCBA 5H37A 3UAFA 1YZZA 4PV9A 4CL7A 1NC4A 4C47A 4JFED 2F54B 3BZFA 1N9PA 4UBDD 1EEZA 2IAMA 1KN2H 5E9AA 1N64L 3ZTNL 1WIUA 2Z92A 3SGDI 1MJJA 4CDHA 1CK0H 1SRDA 4NFDA 4UT6A 3JT2A 3SDCB 3MLYL 3OKDB 4Q2ZA 3IMTA 3HCVA 2DLTA 2GK0B 1QWHA 3B56A 3FQWB 4X7TA 4S1DD 2Y72A 3HRZA 1T66C 3DOHA 1IGCL 3FRUA 1JD9A 1KXTB 2B5IC 4QRTA 1Q9OB 1R33A 4GUPA 2OSLA 3KDPB 3ZK0A 4R0LC 2GYSA 3Q0HA 4ZUSB 3T3PF 4MNQB 4UILL 4J3OG 2AJUH 4PV8A 5GZOD 1NLDL 1UD8A 4NJAL 2GQHA 4BKTC 1GYAA 2WVUA 3HPLB 3NZUA 4LASH 1TEYA 4YVUA 1NFDE 3PP4L 2YWYA 5EZIH 4EQ3A 3PQYE 1U3JA 3MAWA 2NQCA 4ODTL 1JGVH 4IK7A 5BV7B 3C08L 3DXAA 5HYEA 2A6IA 2X89D 4TPRL 5D2NC 1IB5A 2ID5A 4X0KA 1PKQA 5GZNC 3H6AA 5ISZE 2F54E 4JZOB 2QDVA 4F9LA 3FRPB 5FW7A 4NC1C 1ZEAL 4Q0XH 5CJ8A 2WTOA 3MNVA 3EYVA 1JGIA 2XTJB 2DLGA 2ZX5A 3OMZA 2O6PA 4JLRA 4AQ1B 1AVAA 1X7QA 2W0PA 4LEXH 5ABAA 5K5YA 5AL8A 4YZFF 1GPOH 3EKCA 4TTDC 1DJGA 2AAVA 2TRYA 3TNMB 2BNQE 5GGRB 2I32A 4B5EA 3FJTA 4N28A 2DYRB 1S7WA 4YBQD 1U8KB 5FYKL 1QSED 1Q90A 3RNKB 3V0GA 1CGXA 3CUPB 3LN4B 4MLSA 1U2YA 2XKNB 4NUJA 1XIWB 2YPLB 3NJJA 4GIPD 3MX0A 3ULUD 4MNQE 5DSCB 3MJ8A 3KPRE 4Z0BH 4YIQA 3SE9L 2VLMD 4N2FA 2EYSA 4EDXA 1NIBA 2ZXEB 4X6FB 1AXIB 4JPWH 5LCVA 3BVDB 1MCWW 4NQDD 5GGTL 5IMLA 4AC2A 4PJGF 5DJ0B 4D0CA 4D94A 2DMBA 3B3IA 5DT1L 2AABH 4MAYA 1LEGB 2XTJE 4OGAD 4E5XB 2YPKA 2EO9A 1UYWL 2HMID 4NRYA 1M71B 4JFTA 1K5NA 1WBYA 2ED6A 3E1F1 4Q9QL 4YHYC 3MRCA 1P53A 4D8PA 1SJXA 1GYCA 4OTXH 4FG4A 4TN9A 5G5DA 2HKFL 3SGJC 1E6OL 1RK0B 4KRLB 4KTDL 4Y4HB 3VXUB 1SOSA 5CFHA 1P1VA 2YPLE 3OHXA 1MJUL 1UVQA 2VT0A 4XMXA 1CFQB 2Y7QB 5JUEL 3WS6A 2H6PB 1NGPL 3KL0A 2H32A 3VGFA 4ORGB 2GPZA 5JHMA 3PNWB 1IM3D 1T5KA 4N6QA 4FQ2L 4HHWA 4ZSOB 1VGKB 1FFRA 4F2MA 5DRXA 1DVQA 1DHKA 2X4SA 1QW9A 3U4AA 1FFQA 3F05A 4KXZH 4F8TA 3QARA 3LN5B 4IGBA 4I89A 4LAQH 4BQ6A 5IW1A 2XWTB 1FL5B 3D0LB 5LGJA 5D7IB 3IJ7A 1B4RA 5TGBA 3RRQA 3S6CA 3N50A 4BCZA 2CCWA 4HH9B 2F2HA 1S9YA 5IHUL 1R17A 1ADQA 1IEAB 1JZJA 2Z65C 4XNXH 5SX4H 3TIEB 1HE8A 1MHCB 4CJ0A 5I16B 1A6ZA 3ZHFA 2D8KA 4YE4L 3M8OH 2JKNA 1UXMA 3QUXB 4B9KC 1N8ZA 2E7MA 4MMXA 1GZQB 5D7SH 3H2WA 1OV8A 4G43B 5CJOH 3VXUE 3TA3C 4G3YH 4B50A 4GG6E 3FH8A 3QFGA 3ZRFC 2A1WH 4LDLB 5DMIH 4Z0XB 3R8QA 1J8RA 2DIAA 2DLIA 1KLUA 4XWGH 1DVFD 3I3DA 1E8ZA 1M2OA 1SBSH 2EDMA 3B7UX 5GS0C 3VFGL 2HWZL 1E3FA 2RCSH 3O2WL 5E4OA 1EVTC 5AUMA 1ZWIB 4P5TA 3T4YB 1BZ9B 5I6PA 2CXKA 2G5RA 5DK2A 2EO1A 3T3MB 1UC6A 5C07A 32C2A 4R7XA 2IFGA 1J05A 1NCJA 1JVOA 3COOA 3NQIA 5BS0D 3ZE0F 5D7IE 4XCYB 1J1XL 5EHFA 3QH3A 3QDMD 4LCCB 4BCXA 4MXQC 4ELMB 4NQSB 1XGPA 1V3MA 3F6IA 3WAJA 3X11A 1OAUH 2NY4B 5FGCB 1NPNA 2H4EA 4C4BA 4RQQA 3HG1B 3KBHE 4ODVH 2NY6D 4ODXB 1E67A 1SY6L 3ZDWA 2CHNA 4NHUB 4A2HA 5EOCH 5DU7A 1TTBA 1JI2A 4LCWD 2XFGB 4YGVB 2E7BA 5IMOA 5IQOA 1AR1B 5DLML 4UV4H 2P3YA 4HSCX 3MBXL 2OXHB 4NM8H 1TJMA 1P7HL 1JNNL 2AJXH 4ZUUA 3ZL2A 1KTDA 3T6WA 3INUL 1JRHI 5J89A 5CLYA 3KR3H 3O81A 3S37H 1FAIL 2XN1A 3P4NB 5C0AD 4D8OA 1OAKL 2VDMB 1QPKA 3QAZB 4IIQC 3SCMA 2VDOB 1KZQA 3KWUA 3FQNA 3STZB 4YSTA 1UT1A 1RZGA 1I31A 4ZO7A 3ZTEA 4K94C 1O9ZA 5T1DH 4HCRA 3E6FB 4Y5XB 3RVVC 5ILTL 3QULB 3ARQA 1IC7L 5CCJA 2DBLH 3A6BL 3PL6D 5DVMA 4XNQB 1BLIA 5FGCE 3FUDA 4PGCB 3HG1E 4FKKA 2FECL 3CZKA 3PWPB 5ADOH 3LEYH 3LD8C 3IDJA 2FYVA 3MNDA 4AW7A 4CMHB 4KKCD 4OCLC 5C09A 2RBLA 4OCSH 2D0FA 2P8MB 1CDIA 3MJ6A 4YWGH 2QTEA 3NJNA 1KPVB 4KI5C 3RIAF 1XR9B 5ACZA 2Y5TB 4AJWA 5HI4C 2HT2C 4A68A 3IDMB 1TNMA 5KVDH 5EU4B 1GW6A 3LIZH 3FW6A 6PCYA 1D9KC 4LSUL 3O3BA 3WNIA 3ALPA 3HG3A 3BZ4B 2AJ3B 3O3UN 3RNQB 3UPCA 2WTRB 4U7SA 3PWNA 1C5BH 5A1AA 2FO1A 2B3IA 4P4KD 3VD9A 1V7MH 1E90A 3B2UC 3VI3A 2R2EA 2TSAA 1YJDL 4Y19B 4R4BA 4E2OA 6TAAA 3V7AG 3ZGHA 1FFPB 3SDYH 1KLFB 4HWBH 2PPEA 4PPTA 4PP1D 1WFUA 5HHVL 3O2DH 2APTA 4Y2DD 3EBAA 5AG9A 2ZSWA 4KK5C 2A3TA 4L1HA 5J6SA 3PWPE 1OCZB 5CZVH 2WZPD 5FPIA 3AU0A 3ZHDA 5FLVA 1J8HD 4FXGA 3PWLB 5AOKA 5EZOH 4K8RD 2OTUB 2Q76B 2XXGA 1JZ8A 1E65A 3FH7A 2R23A 4LQFL 1DUZA 4NAMA 4P23A 2A9AA 4UT7L 5F9AC 1JN6B 1UA6L 1I4FB 2FWOB 2D4FA 5E2UH 2KZWA 5FO9A 3ZKMD 1FG2B 4DWHA 5IV2A 5A2BA 1UM4H 1LHZA 4DKEH 3R19A 1TJGL 1U58A 4NDMA 3UCRA 2VZVA 1RERA 4KUZH 3X3GL 1T0PB 4P2QA 1G9NH 1NCNA 3A4FA 4UANA 2YKLL 2R1WB 1OAZL 4NOFA 4P2OD 5KUMA 2PXYA 5AKVA 2VLLB 5F9OL 4EI5D 4L4TB 3V5KA 5IB2B 4M1GL 5I1HL 2MNUA 4CMMA 4NPKA 1ZHNB 2F6AA 43CAB 4G1EA 4WCYH 4MXVE 4N9OB 1RIVH 2J20A 4JZJC 1LDPL 2W0FB 1KF9B 4PJEB 3O8XB 4X5PA 4OLZH 2AP2A 1E42A 3EDDA 3OKLA 4FLRA 4WEUD 4Z3FA 5A2KH 4TUKH 1XWVA 5JPNA 3GXNA 1QLFA 1J9CT 4KPHL 1AXTL 2KZKA 3C6LB 4GXVL 5DHEA 5I2IA 2NQDA 3CXDL 3QUYB 4KKZA 1CFNB 5BUGA 2CUHA 5B38A 2FHCA 3GSOB 3K6IA 4FQIL 5EO0A 2Z31B 1SF5A 3P3YA 2YQBA 5E4EC 3HOGA 2Q8AH 3HVDA 4G6KL 3J27A 1XDTT 4K71C 1UZ8A 1WUZA 1EIBA 3GQFA 5F7UA 3US0A 1LK3L 2K3TA 4LHUA 3TBCA 1MH5B 5BZDA 4L4TE 5CJXA 4H8QA 3QT2A 4KVNH 2ZCKH 1CL7L 1QEXA 1TFPA 2PTTA 3ALXA 1AG6A 3EFOB 4NNPL 5C71A 1GKEA 1JZ4A 1HH9A 3NAAH 2WOYA 3HZKB 2CALA 5DC9B 1ZT7A 4PWGA 3K6OA 2ZCLL 2IG2L 2HAZA 5BRPA 4PJEE 1ACYL 3F2LA 4KAQL 3TASA 3KXFB 4UTBA 3NIDB 3BSZH 4PRHB 4U0RB 5FX3A 5I1IH 3ULVF 1JGDA 3V6BR 2ZXAA 4XPTH 5CN1A 3AC0A 2AQ2A 4GS7B 1HFUA 1XSOA 1XF5B 3OG4B 5AVUB 3CSFA 4Y16D 1NMAL 1JIBA 2P47B 2VWEC 4FTDA 1W0VA 4K7PX 5F6IB 2AQRA 3REVB 1UTDA 1HHGB 2W1NA 4K5NA 4R4ND 2WXPA 1A6WL 3GZKA 1XH3A 2QGCA 2XQBL 4L8BB 5A43C 2VC2L 3U9PL 2VLJD 1C12B 1ORSA 3AT0A 5DVOA 2J5LB 2A0LD 1JV2A 2C9PA 2F0CA 2PYEA 2W59A 3FTWA 3QR1A 5GISL 1GCFA 2H0PA 2R83A 1IARB 1NC2D 3KXFE 3NIDE 1N64H 3BVNB 1JGLH 3ZTNH 2HSIA 4HGMA 5T1LD 3BKCL 2OBGA 1QFWI 3OR6B 4OIBA 3RDTC 5FO7B 2J5WA 5IROD 4P04A 4EIUA 3PLYA 3CIAA 4HWZB 1C7SA 4N5ED 1M1SA 4RIRB 4NRZA 2X2HA 5F7FA 5JOFA 5T1JA 3N41F 2NXZB 4HEMA 4DT2A 4LSVH 2GUOA 2GSIA 3MLRL 4UILH 4F7PA 1NLDH 3RZWA 4NWUL 1E9QB 4NJAH 4FLSA 4QOKD 3SO3C 1MF2L 1RVFL 3Q44A 5F7DB 2WVVA 3D12B 4LCYB 4XZ4A 5CJQL 2Q0ZX 3C08H 2D3JA 2ROYA 1R3HA 4YR6A 1ASOA 4TPRH 4JFYA 1P6WA 1U93B 3VXQA 3K6SA 5BZWB 4YHOL 3HE6D 3BX7C 1ZEAH 3VACA 5TF0A 3D48R 4IRSA 4MJIE 5E8OB 4QRSA 1A6TB 1P7BA 3ABMB 1SM3H 4MWFB 1U8HB 1Y18B 3SZ6A 4MZ2A 2F68X 2WO3B 2YAQA 4I77L 4TUOA 1HILA 4WW2A 2UZXA 1E6JH 4UU9B 3Q8CA 1VFAB 1XT5A 4JQXA 1L3NA 5FYKH 3BVTA 2ICWJ 1KT2B 1N0LB 3N1QC 4JEGB 1BX2B 5F9WC 2JXMB 4H7VA 5I8EA 2W9DH 4M3HA 2VMFA 1XVSA 1BM3H 1EXGA 2NXYB 4GW4B 3E8UL 5TE6L 1XTLA 5LAXA 4YNYB 4R97B 3HE7C 4PWKA 3BP5B 1G0YR 4HWUA 4UZUA 1BJ1H 3FTGA 4JW3A 1OTUD 2UYLB 4Y1AD 5J6HB 4PVMA 1N18A 4PRPB 3IPEA 4IU2B 2YGPA 5I76A 1YYCA 3V0VB 3QS3A 1LO4H 1OGAD 2ITFA 1FPTH 1W6LA 2ENQA 4X4KA 3WFBL 4NKOA 4AQ8C 4FABL 1JDCA 1OSEA 4X98B 5ID1B 5EIQA 5DT1H 1TIUA 1A4KA 4PWEA 5DXWA 3I3EA 1UYWH 5F3HA 1Q38A 1R34A 5I17B 1HU8A 2ZOLB 2IXQA 2W94A 3MUGA 4KK6D 1LO3H 2Y9RT 4LLDB 3O3DB 3FHAA 2YRZA 5CINL 3D18B 3V4LA 4E41E 3CHQA 2HKFH 3FSWA 2C4FT 3KYAA 4EN3C 1E6OH 2NZ9D 2BP8A 1KUMA 3QQDB 1QACA 4ABVA 1TKWB 5CP3H 5H94A 1KCKA 3FUHA 1BZDA 1MJUH 4KFMA 2WIMA 4LLWB 2W65B 3C2SA 5EU6B 5IW3A 5TTRA 3V7AE 2DS4A 1NGPH 2P9RA 4HISA 5JUEH 4XMPL 2ZKMX 5F70A 2EVHA 4M1CD 3NJLA 1PD1A 4LVEA 3D5OF 4NQEE 3D09A 4PRPE 1H0DA 4TVPE 1ZLVH 1ZE3C 1U36A 4P46B 4KI1A 4ZMAT 3IVKA 1NFAA 4BV1A 1A64A 1J0KA 4MDIA 4OFQA 1SVBA 3DPBB 3UJJL 3ZY7A 4X50A 1DQJB 3OKNB 4NKDB 3EOAB 4OJYA 5FHBL 3I6LD 1P6FA 4HHGA 1XO8A 2AHIA 4NO5B 1DVUA 1FCCA 4YE4H 1QUPA 2WWNA 5AW4B 4F57L 3KWWB 4Z7NF 5LXVA 3BGFB 4BFIA 3NPSB 2H9GA 1KC5L 1ZA6A 3ARDC 3E6HA 1NUDA 3FU9A 4LPUA 3DROB 1UKSA 2O5XL 3VYPA 2WLLA 4GQQA 4EZKA 4YEFA 2GTWB 3K4ZA 4RGNB 1DLFL 4MTMA 1DTUA 4I9WE 2X4TA 3AMLA 1CICD 3FU7A 4XXDB 3UAJD 3US9A 3VFGH 1V8HA 2HH0H 3O2WH 5FK9B 3CU7A 1T1WB 5EEWA 1DN2A 3W5MA 3IJSB 4YE0A 4OQTA 1DUYA 1FYTD 1E5CA 3AAZB 1I8KA 1RJYB 5CUSL 4A6YA 1J1XH 3R7RA 2ED9A 2V2XA 3TT1L 1TMQA 1RIHL 2OXGA 3ZN6A 5K9QI 2VKXA 4ADJA 3BI9X 4L3EE 1CZ8L 2W0LA 5KSAD 5E8NB 3FCTA 1KB5B 1SY6H 2O72A 2W60B 1MCOL 3FYIB 3CDGB 2Z1PA 3H9SA 5JLZB 4OZGA 1EXUB 3P4OB 3ET9F 2NW2B 3T5WA 3VXMA 1ND0B 2BVTA 3GSNL 4RGNE 5DLMH 1WF5A 5C6TL 3H1ZA 1ROWA 3MBXH 4WNSA 3MGTB 3L3DB 1JNNH 1LMKA 3QI9D 4DAGH 3INUH 4Y89A 3MBED 1VZGA 2AFNA 1FAIH 4XNYL 1PZ5B 4HLEA 1QNIA 2CO6B 1OAKH 1V05A 5I75B 2X4RB 1IGFH 5T5FH 2F19L 4V1DA 4G11A 4ZXBD 3S35H 1J5IA 3TN0D 3CZNA 1E4KC 1BXAA 4R4FL 3K2KA 4L4VB 3HG4A 4JANB 3TP4A 4J1UB 4NZUH 3ZZQA 3SDAD 3NCXA 3LSOB 2ADFL 3D25B 3KPNA 1UCBL 5HHMB 3BUYA 3IWVA 3ARWA 2JCCE 5CMAA 3EO1A 3D05A 3TBYA 4NQCB 1IQDB 2JQZA 3BJ91 3O0LA 3OB0K 4RDQG 3H3KA 5IWLC 2VXUL 2YD5A 2E9WA 2AW2A 3NABH 2PYFA 4JREB 2E46A 4FJZA 4GFXA 4POYA 4YSSA 1WFIA 2BIPA 5AW0B 2A83A 5KBDA 4L9LA 4FFYL 1BM7A 5BQ7B 2G2RB 1KV7A 2X4UB 3WTSA 5T5NF 2BRRH 4LSUH 1IRAY 3WLBA 1MELA 1SMDA 2VLRB 4FQXC 4AJVA 5BOZG 4P2CG 4EZMA 3IYLW 2J57A 4FQLL 4UOJA 4FA8A 1UJ3A 4ZYKB 4HOMA 1LNUB 4GW5A 2EDRA 1J5OH 3SEPA 3WTVA 4AT6B 4L4VE 3U25A 4WI0B 1MCWM 5DCCA 4ORZC 4UQ2B 4WENB 3NVQA 3W37A 1HQ4A 3PABA 5HHME 1TJIL 4U6YB 5D1XC 3O6FB 2GEQA 1IEBB 3MRJA 5HTSA 3DSFL 2IH1B 3PXJA 4PG2A 3DUUB 4ZPTA 3ULSA 4AMXA 3WY2A 4WVRA 4CN1A 2IGFL 4JRWA 1RZ8A 4XX1E 5E1AA 4DZ8A 4X5XB 1B2WL 5DTFA 3VFOB 1HI6A 1WE5A 3SSGA 1BWWA 3TONA 5TDPB 4E9QA 3FB6B 2H0EA 1ZS8B 1UZ6F 1MCCA 1VESA 2EUWA 4UT7H 1UA6H 3BT0A 5JOPE 3BWSA 1J1OH 1MHPH 4IHBA 1ADWA 2BVPB 2E0PA 4J8RB 1PPIA 4TSAL 3QR0A 4KRPB 2VLRE 3LS5L 3RYMA 5F6HI 1RJZB 5AW9B 2FB4L 3X3GH 4LRNH 2AMUA 1OZUA 1BBDL 1N8OE 2YKLH 1EHAA 2QPUA 2BOCA 4ONHB 2DEYX 1OAZH 1NFIA 1QBML 4MMZA 4OF5A 3O4LA 3TFBA 2BCMA 3VI3F 3T4AC 2J55A 4NT6B 3GSXB 5F9OH 5J13B 1FZJB 5ESVA 3A0OA 5JPMC 2N0KA 4NBYB 2CIKA 2QR0A 4M1GH 1YJDC 5G2NA 1JD7A 3K71A 4OFDA 5BRZE 2WZ0A 5FCUL 4AZ8B 3Q5YA 3UTTA 1CC3A 2OR9L 1JPST 3QQ9D 2YA0A 4Y4FD 1LDPH 3A67L 4YHML 2CUAA 3UGXA 1N6UA 2NUPB 4YDIH 4C56B 3AT8A 3GJFK 3RIAK 4A7TA 1D5RA 5FECA 3MRQA 4BRVA 2R2CA 3FFCD 1RZPA 3PWUB 5JDSB 1ZA3B 3QXVA 4GXVH 1AQKL 3EOTL 5CFAA 4N4YB 1U30A 1MFCH 3CXDH 4KK8C 3I2CL 1NOFA 2HN7B 2JI2A 3WE6A 5IOPA 2FJHA 3P9WB 3F01A 2ZOKA 1IAII 4M5SA 3QIUD 2AJVL 2BVOA 3VX1A 4FQIH 1SN5A 3QUHA 1UOLA 5D1ZC 2P5WD 2MNJB 3OC8A 5AVYB 2DN7A 1KJ2B 4HG4K 3BWAA 1E4HA 1KPUA 1UXSA 1VPOL 1HJCA 4G6KH 4QYAA 4HOZA 4NQUA 1VFOA 3NJKA 1OW0A 2OL3L 3GFUA 1FFNA 1NCBL 2ILLA 3P9MB 4M93B 4OU3A 5FOBA 9PCYA 1GS6X 2DQDL 4HJSA 3VDBA 1LK3H 4GEJA 2Q3AA 4LHQB 2HB0A 3SKMB 4Z3EA 3QIBB 3ERXA 4NNPH 3S4SG 2BY3A 4F15C 5C0JA 3ZE2F 3VWJD 3FONB 3U48A 2BH0A 1WD8A 4HZLB 4IIQA 3RPIA 3Q01A 4HG4J 3QISA 2CRMA 2ZCLH 3OB8A 2IG2H 3VNZA 4B3VA 2K8MA 1BZEA 1ACYH 3GMPA 3WN5B 4QHMA 2XIIA 2ZUVA 2XI9A 1PDKB 2GHWB 1CXKA 3IPBA 1BFOB 1ZTXL 1RUMH 1TQUA 3UMNA 3BD4A 4PP2A 3CSGA 3SBPA 1UB5B 2YOCA 2O6DA 4GO9A 4WF7A 2COVD 5JHLL 4TM9A 4HFWB 3RGVB 1X9LA 2UUDK 2VDQL 2XIDA 1NMAH 4ZMVA 3NK4A 1FE8H 1A6UL 1JJUA 1YEKH 4XRCA 4YAQB 2WBWB 4GUOA 4UUJA 1OM3L 1TZAA 4ANUA 3N1GC 1NOLA 2NW3A 3NG5A 2CLVA 3VG9B 3W9EB 1A6WH 2WKOA 1D9KA 3LV3B 3V0FA 1NMBH 2GJZB 2X7LA 4H2CA 5DS1A 3O3EA 5C0CB 3S2AA 4F93B 2VC2H 3NTCL 3U9PH 3D85A 4R8WH 5GISH 2R2HA 3GINA 3WSQL 1O9VA 3KDMA 4PJIB 1QLEL 1PQZA 2DTSA 3VVVA 1JRHL 2GBAA 3ISRA 4UOW1 3DX6A 1JE6A 3UZQB 3DBXA 3AUWB 4I13B 2NY1D 5TQ2L 3CFEB 4FQQA 3RL2A 1I7RB 1BGXL 5CZRA 4D7BA 5HHPA 5J1TC 3FU0A 4LE8A 4ZAKB 4GO6B 3RVTC 4NOBA 1DQQA 3KM2A 3RILA 4AG4H 4HXAL 2XQ0A 3PQYD 4BQ8A 1H8LA 1WFJA 2WBXA 2ZKHL 5GHWL 2DJSA 2IBGA 4UB0H 1ZXKA 5AWNL 1MFEL 2NY3D 4MJ2A 3LKQA 1PX4A 3V8OA 1TPXC 5ISZD 2F54D 1MCFA 2J1WA 5EF3A 1UHVA 1EV2E 1WZMA 3WLWC 1RVFH 3D4YA 4AWJC 2EKSB 4PMFA 5C0CE 3S88L 2WV3A 5C0BE 4K5LA 5C70A 1GZPA 3CSPA 3LIZA 5CJQH 4HLZG 3TO4C 2CKBB 5HYQB 2X70A 5T3ZL 2BSSB 5IB3A 4NNXA 3SDCD 4PJ5A 2BNQD 4I88A 4N8VG 1QMUA 4YHOH 4AJYV 4PJIE 2XDHA 5K9OA 4JQVC 4JG0L 2Z0UA 4G80A 5DFWH 1AZCA 4PJDA 3CPUA 1AS6A 2Q6WA 4MNQD 4FTVE 3KPRD 3JV6B 4I77H 4HWBA 3UTZB 3ATAA 2H26A 2WQWA 3SQBA 1U8PB 3O2DA 2BOLA 2A74B 3TS8A 1SYSB 3VA6A 3VTTA 4S11A 3S7GA 4XPBL 3ZBMA 3EZJB 4A7SA 2IGTA 1VFBB 4RFNC 4PWFA 3OKEA 5TE6H 3RA7L 3SZKC 4NQVB 5E0QA 1FSKB 2YJLA 1GTFA 2XA3A 4CW1B 1G6VK 3BPOC 2XTJD 3NGBB 4QYOB 5F9DC 3U7AA 2DQUL 4JO5A 2D7MA 5ESQA 1BF5A 2V2TB 3CG8A 3A6CH 3JTTB 2G30A 2YN3A 3C5ZB 1AS8A 2EDKA 4XN2A 2XWJA 3EYOB 4N3UA 5T1MA 5E1IA 2BMKA 4XBEH 2P5EA 1QI4A 4FABH 3OX8B 3R7QA 4H40A 5GXBB 5L2JA 3WL9A 2APWA 4G8FB 5GRVL 4KROC 4C4KO 4G9FE 4MDJA 3SHSA 3Q7JA 3VXRE 4AEEA 1M1XA 1N6VA 1WGVA 1JHKL 4ZQKB 5CINH 2W38A 2VXTH 3OWRA 4WW2F 3ARVA 2VRAA 3MUUA 1AC0A 2APSA 4ADIA 3BUDA 4GKNA 1QQDA 3ULAB 5H8DA 3D2TA 5FV1L 1RMFL 4FNPA 4N9GB 1X5IA 1BBJA 4QLRA 5D1QC 4OFKA 5B1AB 4O02L 1F58L 3G5ZA 2BSRB 4ZO6A 5HVHB 1M2VA 4JM2D 1E9PA 2HJKB 1C5CL 1O5DT 1YY9C 3FCBA 4FOMA 2D7OA 4IRJD 4NKMA 4XMPH 4BZ1L 1F1AA 5SWZB 1QR4A 1LYQA 1S3KL 2VAAB 1B0RB 2E7HA 2ZYHA 4K3DL 2NNAA 4LLAA 3OAYK 2XFXA 5K1NA 3WTYA 4QPEA 1D7DA 2VR9A 4XMZA 4I18B 1T21B 1GCYA 1TQVA 3O9WC 3QS2A 2IDSA 4LDCA 3TURA 3VXUD 4N25A 1YC7A 3FO0L 4GMSL 3S3SA 4APQC 2C3XA 5CN2A 5FHBH 1F97A 2YAOA 3HAEG 3RKDC 4HJGA 4Z7OB 2VMJA 1C8QA 1UD5A 3PPSA 4YDZA 1BHGA 5T1KA 5DUJA 4L2LA 4OY9A 3LRSA 3VX0A 4F57H 3IFPB 1AE6H 1MFVA 1T2JA 5EPMB 3UTSB 4OJDH 3LVEA 3EYQD 3KH4A 1KC5H 2HCZX 1WEJL 2GJ6A 2XVLA 2O5XH 1DFBL 3UYRH 1BVLB 4XGZA 3RLSA 1P2CA 1DLFH 3LZLA 4HUXB 4MRCA 2G3MA 3BSZA 2YRBA 5DJ8A 5I1GH 4U1GB 2EVFA 2NX5B 5DD6A 2DWYA 4J2QA 1VRSA 5SWZE 2EIKB 3S4SB 5IG7A 1ZPLA 1YCSA 1GJWA 1JCKA 2ZAGA 3S48A 4JY6B 4EN2A 1FVCB 3L4WA 5GSRA 4DGUA 1FIGH 4QRQB 3BXNB 4WY7H 5C0DA 5FYLE 1CU4H 5DJAA 4ELKB 1OT2A 4WJ5B 5KYYA 4UYPA 1KXVA 3DOIA 4BKLB 1XGQA 4X7EC 3UGEA 3W2DL 1ILUA 2L7QA 2WQVA 3TT1H 2AXFA 1RIHH 2HKHL 1BYPA 4MB1A 1MNUL 1UGKA 3GS0A 2WINA 1QOKA 4IOFD 3TCLB 1PEZA 1G7HB 3QNFA 3GGWA 5KOMC 4O00A 2UXTA 1QX1A 1MCOH 3U4EB 3VRLF 3UTSE 1D7BA 2EILB 1HS6A 3B5GA 1LE5A 2F1AA 2QSQA 3LEXB 1T0MB 2ZYSA 4KDWA 2QKIC 4WFEE 1BQHG 3P0YL 4LCIL 1N6QH 2OJEB 3GSNH 3V4VL 4L2YA 5C6TH 4AZUA 5SV3A 2ICWB 3UEQA 2K7QA 2NX5E 5E6IC 5FYKU 4Q7DA 1LP9A 3EJPA 1JOIA 1H9VA 3ZKXB 1I1AC 4XNYH 3UG3A 2RB8A 5JW4R 2NY4D 4MVBD 3O0RH 5B1BB 3HG1D 4BXSV 1CUOA 3ZE1F 5B7FA 2ZAHA 3SGDH 2C7UA 4AXWB 4QHKJ 5C0IA 3I3BA 1QFWL 3NDYE 3L2NA 3OKKB 5I1AA 5HJGA 1GMIA 4Q9BA 4FD0A 2YC1B 1KGWA 2F7OA 3PHSA 5IUSA 2ADFH 3C87A 1UCBH 3POCA 1AR1D 2EIBA 5IIEB 1EDQA 2YAPA 3L45A 5E6SB 2WLIA 3EHBD 2VXUH 3JWNC 3G5YA 1PCSA 4LSDA 1EBPA 5KW9L 1TQTA 1ZOXA 4OIFA 1DL7L 4LPYA 3RP1A 4OZGF 3TEXA 4DERA 1DSFL 1EJOH 3JUYA 5SWQA 1GYVA 3BPLC 4HEPG 4ZFOL 3MRFA 4UBDC 1OL0A 1G7JB 1IAKB 3F58L 4ZW6A 4Z5RB 2JNZA 4LCVA 2FNBA 4FQPA 4FFYH 5ESAB 1SEBA 3QJHB 3BAWA 3VFMB 4AQOA 3KLDA 3MRIA 4LP8A 5L7XL 3MRNB 3F04A 4GG8B 3IMVA 3CVCA 3POHA 4N2NA 4YXHL 8FABB 4NRXA 1DDHB 2PN5A 1LL1A 1IC4L 2BSBA 4LSRL 1PLCA 5GIRA 4OJFL 4N8VB 1JHTB 3PWPD 5HVGB 4WWID 2H0JA 3ATFA 5C0GA 4L0ZA 1T4WA 3Q2WA 2DJ4A 3QVAA 2BIIA 3FT4A 1ETJA 1GL4B 1SJVA 4XNUL 5C08B 5DYFA 4J3OD 1ZXQA 3GSQA 3ARZA 2ZOWA 1D5ZA 4JAMA 4F7EA 3ISYA 3RTQA 3N44F 4MNGA 3KGUA 2CMRL 4MYWB 4Z3TA 3MBWB 5GGTA 2IGFH 4BFRA 1DYZA 1N26A 5GS1A 3QP3A 3T8MA 3CCHB 1KV3A 4HV8A 5IQ7L 2W0KA 1LO5B 2ZTBA 4FX5A 1F1GA 3FT3B 4Y9EA 2JLLA 4M7JL 2W9EL 4O2CB 4KJWC 1XR8A 3ZYZA 3FMGL 4WTXA 3PDDA 3WFCL 1KLGB 2Z4QA 1ECYA 4TSAH 2XTLA 1VB9A 3IFLH 2LAGB 5CR8A 5CD3B 3ZMEA 1NEZG 4M8RA 3OR7A 4WWKC 2AXJA 4YBQC 1UKTA 3FUEA 3O45A 2NR6D 3OSVA 5E8EA 4PY7B 4OBRA 1QBMH 2X4OA 5IBLD 4K7PL 1ACZA 1HTYA 1KCVL 5CP3A 2YSSA 3T3PE 1D3CA 2P4AB 5AVSB 2B7DT 2OJ1A 3NZSA 1MDAA 5KZCB 1QLRA 1W0WA 3FPYA 5FCUH 2OR9H 3MR9A 1YNLL 4FYSA 3FTUA 2VSDA 3IMRA 3BEVA 3ARFB 3MCKA 3A67H 2EDBA 4YHMH 4YLBA 5LB1A 1J0HA 3BDXA 1N12A 1BZ7A 2KH2B 4PJGB 4Y5YB 1A02N 1P5VA 4M6ML 4OD2B 1W9XA 4OGAC 4HUKB 5FUCC 3QNXB 1PZCA 1RUKL 1KBGL 1HEZB 3V95A 3K72A 4RCAA 2WXLA 4KOBA 1AZRA 5L8LB 4G7SB 4L4TD 4OJEH 2GAZB 4YZFE 2YO3A 1YAIA 3DUSA 1VPOH 1O7DC 4R2GD 5AW5B 2H5UA 2B2XH 5EZLB 5EO9B 3MV01 4IEFA 3MZGB 3QQXA 4LF3B 1ZGLB 2FYYA 3AFLA 4JFSA 2Y7MA 4MA3B 2HG5A 3HAEB 1I1YB 1XL4A 2BHZA 1MI5B 3X1NA 3QUMH 5KYUA 1ZLUK 3C6LD 2F8IA 1K6QL 1YN7B 3WS3B 3UOAB 4DZBB 3PHOA 2HLAA 1E4KA 4HIPA 1A1NA 2FX7H 3PIQB 4XOCA 4PJGE 4IKLA 2Z31D 5I6LA 2ODIA 3L95A 2HJFA 1P5UC 1QO3B 1J9TA 4YBHA 3GBMH 1M53A 2WWMD 1UB6B 3BVVA 4XOEA 3ARGA 5IWLA 4LO9A 1A1OA 2IDFA 4TYUA 4NN5C 3AQZA 2ESVB 4TLTA 4WKZB 5ICXB 3V10A 2X6VA 4X9IA 5JHLH 5J11B 4J3UA 4MX7A 5IR1A 4XBGA 4U1KA 2F7PA 5HDQL 1NBVL 2VDQH 1SY6A 4PH8A 4PJBA 4WSKA 1DSYA 4IRZL 1K9TA 1OIOA 5ETUB 1QPPA 3SKJL 4M8VA 4AV5A 3S5LA 3LQAL 2YUVA 3HBGA 1ES0B 5JNYB 1KCWA 2UY7A 3KXFD 2LE9A 1NCUA 1OB0A 1A9BB 2K6WA 3QCVL 1XTMA 3EGSB 5E23A 4FMKA 3TJPA 1LEKB 2LOEA 1MI5E 3PJLA 4CUCA 3L48A 4YFLI 3V55A 4RX4A 1B0IA 3FQRB 3VD0A 3MCYA 1S7TB 4PY8J 1E40A 1T5XA 3RWJA 3FT9A 1Z0MA 3V9CA 1KIQB 3IKCB 5C2BL 1BQHB 4AGQA 1QLEH 5A3IC 4GFTB 3NFPA 1JRHH 4JX0A 4PVNA 1WBZB 4RAVB 4C83A 5CIPA 1EEUA 3ZE0B 4B60A 4KTGA 1FN4B 5TQ2H 5CBAA 3AWGA 2MPAL 2I07A 1BGXH 1RZQA 4ZDHB 3ZU8A 3LNFA 1MIEL 4LSQL 4HUCA 1YEJL 2J44A 3I02B 2ZWYA 2V17L 3Q3GA 2NY6C 1KCLA 5DQDL 1YYLL 1OM9A 5IW6B 4XP9L 2PKDA 3U82B 2ZKHH 5GHWH 1EXHA 5GS3A 4LLVB 4BWUA 4XBMA 4YK4C 5AWNH 5CBEA 1QP1A 2EXTA 2I24N 3CFBA 3IRZA 3VSQA 2YBGA 2E74C 4WUKH 1D5BA 1O6VA 3SE4C 1HHIB 4UQ3B 3CC5B 5EC2A 5HGHA 1XSIA 2WKOF 4MJID 3BP6A 3CVIL 2P42B 4ICWA 4QF1A 3B6SA 4S1QH 5DFAA 3WUWG 1YEWA 2P24B 3WHE1 4LPWA 4R96A 5T3ZH 1S5IL 4AIZB 5AZEL 3TZVB 4OZHF 3GZPA 4OZ4B 1IGYB 3CFKB 5F0LB 4XHQA 2OJZH 4JG0H 5TE7L 2FX9H 3E3QC 2NXZD 5DHDA 4BK5C 1ZANL 3ZE0E 4I8DA 2VXSL 1QPXA 2XRAH 3V4PL 4PJHE 2F18A 2DWTA 3PL6C 1IBYA 5K9KB 2NT1A 2WBJB 5EEYA 1VACB 1TU2B 3MLZL 2F61A 1AGDB 3HBQA 4CNIA 5FUOL 3STLA 5CS7A 3CZFB 2R1XA 1WZ1L 1HZKA 4XPBH 4JRYA 2CLRB 4KKCC 4JFFB 4UNVA 2NYYD 3M17B 5KVEL 1T1ZA 3RA7H 3EFFA 2WK2A 3RVWC 1ANUA 3MROA 1U95A 1GR7A 2XOTA 3GJFB 3QDHA 4KKLD 1A4BA 1NGXB 4GKLA 1CFSA 4JKMA 5D1ZA 2YWZA 4PBXA 4ANKA 4GUQA 5L9DH 4AYFB 3Q6FB 3N04A 4TMPA 2ICES 2XG5A 3H9HA 4E41D 3WKML 1FQ9C 2EDNA 1FVDB 4LVOC 4P4KC 1WITA 4CADB 1FGNL 2B16A 4PJDF 2JE8A 3TOPA 1BAFL 5I6XC 2NXYD 4HZAA 1JZEA 4FP8L 4FE9A 2KYIA 1JHKH 4PP1C 3FCSA 4I0PD 2UZYA 1BLNB 5I66A 5D7LA 3EJYD 1M6OA 4HIIA 1KB9K 2Z0BA 4NQED 1NEZB 3G6DL 4PRPD 1S7SB 1RMFH 4TVPD 4WU7A 4O02H 3A6OA 2WXJA 3MODL 1UD6A 3QIWD 4K8RC 1ZDSA 1EH9A 3TBWB 1C5CH 4MJJA 2NSMA 2FEDD 2JLPA 3MGOB 3W9DB 4TNGA 4BZ1H 4DGIH 5BW7A 1KB9J 5J8OA 3QDJE 1S3KH 3RWCB 4LVNC 4XMLL 4K3DH 2XWRA 4L8SC 5E00A 2R7EA 4AQEB 3VXPB 1JYNA 3BW9B 1TUPA 4OUUB 5JA9A 3HKZA 3KEDA 2VSMB 4ETQB 4YQXH 1IBBA 2FQEA 3DUHA 3HZVA 1KWKA 5F7NC 3RQ3A 1XGRB 2R0KL 4FNTA 4UMGA 5E5LA 4P2OC 2AJZB 2P8PA 1X5YA 3BZDA 2QQLH 3FO0H 4XN8A 3UACA 4GMSH 4N3TA 1AY1L 3ARED 4LOUD 2D03L 3EF7A 4TNFA 5D93B 1ORQA 5HPOA 4I9WD 2HLEB 5EH1A 2EEDA 4ZNEE 1LDSA 1OHZA 2E3VA 2JFCA 2XV2A 4AGPA 1AGCB 1WEJH 3PHQB 4BRJA 2BLFA 1IGMH 4P46D 3TVMC 1FLRL 4LKCA 4X9FA 4YXLL 1LWRA 4N2IA 5F7HA 1QKZL 4Y4KC 5HYSA 4E0RB 2CK0L 3FB8B 5I1LB 5C0ND 2LU5A 4L29A 1BA9A 2GABA 4L0YA 4LBEB 5JMOC 1NQBA 1ZSDB 4L1BA 4AM0Q 2EAEA 5DJ6B 4DP5X 4L3ED 2DLHA 3BH4A 1FL3B 3G04B 2NYKA 5FM4A 4FCHA 5AQ0A 4G7RB 3WN6A 5FWRA 1PU0A 3OKOB 5BZXA 1ZVYA 4ODHH 4G6FD 3G5VA 2EC9U 1P9MC 3W2DH 1VKXA 2WUCL 1MNUH 4RGND 4KMLB 1CI3M 3TO4A 2G3ZA 1OPGL 4ODUA 4KXCA 4E9VA 3K5RA 1E5AA 1HXMB 4LEOB 1U8CA 5E5MB 3DGGB 1DQLL 3PWJB 4MAUH 3TBVB 1F8TH 1GC1L 2VR6A 3P0YH 1MAJA 1C5DB 3NA4A 1QSFB 1RSFA 4Z6AT 3V4VH 2OMNA 2X05A 3RPBA 1R6VA 3U2SA 2VJ0A 4PUBH 4XVSL 1JMZA 3TF4A 1EFXD 2WSPA 4WHYG 2MCMA 5AD0A 5IHZA 4X8XA 1ZT1B 2WD0A 1M05A 2EYRA 1K85A 1L9SA 2DI7A 3L1EA 2GJJA 2X1OA 4W4OA 1E28B 2CA3A 1LO0H 4E9XA 4QRRE 1S8DB 2QVTA 3U36B 1SFHA 3HMXL 3RURA 3BFOA 4QRUB 4Y16C 1QFWH 4NGHL 3GB7A 3RWFA 3WDJA 4X6EB 3WXWH 1WBXA 1QA9B 3I6KA 2AK4B 2IMNA 5D5MA 4R4NC 1QI5A 2GITB 3NEOA 4QXGL 3WJLA 4BSJA 1G7LA 1QFWM 3V6OE 1PYWA 3WU1A 5KW9H 1BQ5A 4P2RB 2A73B 5DJYB 1DL7H 4WTZG 1I3VA 4YH6A 2A0LC 1U6AL 4HXBL 4MD4B 4HJIA 4JO3H 1DSFH 3RWIB 3VD5A 1QSFE 3MJ9L 3TCXA 5B4MC 4FG2A 5KBLA 4NERA 3F58H 3TV8A 1RL1A 1KYUA 4QI3A 5JORB 4N2KA 1NGZB 3ULVE 4L4VD 4DTGL 5L7XH 4LLYA 1LP9F 2YJQA 1DEEB 3KD4A 5IROC 4XR8C 2XWXA 3WUWB 2WLKA 5D1QA 4LSRH 4RGOL 3NN8B 2R0ZL 4WTQA 4OJFH 4MDRA 1F5WA 1PTZA 2OMTB 5D6CB 1J5CA 3TV3L 3T65A 1Q1PA 1MWAL 2X10A 3IBOA 3N41B 2JKRM 3JV4A 4N2AA 2EUVA 2XICA 2UXFA 1BMGA 4XNUH 5EBGA 2B39A 1RPUA 4Z7WA 3DURB 2DQ6A 1G9EA 3BFWA 3JQOB 5LQBL 1CBJA 1ZLEA 4BGLA 3QPKA 4OD3L 5T5NG 1F86A 5MERA 1LO2H 5JOPD 1I8MB 3LDBB 3QHFL 2J8UA 4FXKC 5DR5L 1GOHA 4LXFA 2VLRD 1WAAA 3HI1B 3R0MA 1Z0NA 3QDGA 5IQ7H 2E7CA 3HE6C 5EUOF 3EBIA 4PV9B 3QEGH 1NC4B 3FUNA 2YQGA 3R18A 3BZFB 1EEZB 2O61A 3D2UA 3D4GA 4FKHA 4M5YL 4WW1A 2W9EH 1EEYA 3ARSA 3SKOB 5HHQA 2X2UA 3FMGH 3ILPA 4EJ1C 2AGJL 1GAFH 4DKFH 3WIIL 1I9RH 1MJJB 2JB6A 1OD9A 1RLBA 3JVGA 3UGUA 3TWCL 2E47A 3GMNB 2Z7YA 3O6FD 5IK3B 3N5AA 3QHZH 1U21A 3HCVB 4GXFA 4NP9A 4Q2ZB 1SHWA 4UM8A 5BRZD 1KBBA 4HIJB 1GGIL 3SGKC 4X7TB 4UZGA 2JELH 4K7PH 5KVGL 1VADB 4J8QA 3E7JA 1KCVH 3FRUB 3QNZA 2GSGA 2X1WL 4QRTB 3QEUB 3I84A 2GK2A 4GUPB 4OZFA 1I3GH 4J28A 1WIPA 4JO2L 3K0WA 1NL0L 4LQ1A 4PV8B 4UI2A 2DIEA 1OTUC 3RZCB 3QUZA 1G9MC 1WWCA 1FZMA 3MA9L 4AL8C 5H35A 1TNNA 3AB0B 2VR8A 4KRPD 1M6UA 3BUBA 3CVBA 3DXAB 4BFKA 2A6IB 2C3VA 3H53A 4X0KB 1HZLA 3FU6A 3HR6A 4CSTA 3LPFA 2VRQA 4P0DA 4Q6IA 1MFMA 3OSKA 5EOQL 1JAEA 2H47C 3MNVB 3EYVB 4UWQB 5C0RL 3ZDZE 1KBGH 4C8XA 5I5JA 4KK6C 5F1IA 4AV0A 2HRGA 4F3FB 1HN1A 1DZBA 3FT2A 4CVXA 2KMWA 1PW3A 2NZ9C 1OF2A 2XHNA 3HS9A 3WTWA 3P02A 5MI0C 1M42A 2OYPA 3ZTJG 5E6IA 5D72L 1G94A 2J8OA 3OGCB 4P3CL 2HX7A 2XXFA 1UACH 1U8QA 2XN9A 3MV7B 4Z9KB 3MX0B 4PWHA 1MDTA 3E0GA 3BDYL 4GRWH 4M1CC 2EYSB 4R7NB 1E2WA 2YLKA 3KL5A 4M4RA 2ETWA 4ZOBA 1G7PA 1SGKA 4AIXA 1RHFA 5ICZA 5IMLB 3DXAE 5EN3A 1EHXA 4UCFA 4U1HB 2CJSA 4G6JL 1PKQE 2V5SA 3KPPA 3K5SA 5FIEA 2XYCA 2IPUK 3VSTA 2VSKB 1XF2A 1ZLSL 2P80D 3FO2A 3F7PC 2YPKB 3HG0A 1I7ZA 1F4WL 2WLNA 4M43L 3OGOE 3SY6A 4NRYB 1AP2A 1R5IA 3MRDA 2ZICA 1OLZA 3QIBD 2UY6A 1K5NB 1WBYB 2PMZA 1X5HA 1X5ZA 4W6XB 2N7BA 3MRCB 4WK2B 5F7WC 1VIWA 3OKYA 1DJHA 3GMMA 4Z7VA 1NSNH 2QGBA 4WFFE 3LQAH 4LRIA 3UBXG 2A2QT 1HE7A 2FGWL 5CSZA 3GSNA 1UVQB 3QCVH 3AXLA 5D96B 2DICA 2ZG3A 2P43B 2YGNA 4F2MB 5B38G 3CSYA 2KQNA 4ETYA 3O41A 3RGVD 2PO6A 2X4SB 3LRMA 4Y2OA 3V5HA 3CFUA 4JFXB 1HK6A 1HCVA 3F85A 1S7RB 1XF4A