5LNEA

E. coli f9 pilus adhesin fmlh bound to the thomsen-friedenreich (tf) antigen
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
152
Chain Sequence
b'FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPVGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Fml fimbrial adhesin FmlD
molecule tags Cell adhesion
source organism Escherichia coli
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
total genus 33
structure length 152
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lneA00
5LNEA 4J3OG 4AVHA 4AV5A 4ATTA 4J3OH 4AVKA 1UWFA 2JTYA 2VCOA 4X5QA 5FS5A 1KIUB 1PDKB 5FWRA 3BWUF 4AUUA 1TR7A 5FLUA 2UY6B 3JWNG 4XODA 2XG5B 3JWNH 4XOAA 4CSSA 1KLFB 2JMRA 4XOEA 4XO8A 5IQMA 5CGBA 3ME0B 4AUJA 4AV0A 4XOCA 3RFZA 1N0LB 5JQIB 5ABZA 3BFWA 4AVIA 4XOBA 5AAPA 3BFQG 1QUNB 5F2FA 3MCYA 4AV4A 4AVJA 3ZPDA 2UY7B 4X50A 2WMPB 4X5PA 4CA4A 3ZL1A 4CSTA 5FX3A 1ZE3H 5AALA 4BUQA 5LNGA 3JWNE 4AUYA 4LOVA 5AB1A 5IQOA 4X5RA 3ZL2A 1N12A 4J3OF 2XG4B 5IQNA 3SQBB 2W07B 2J2ZB 4XO9A 5F3FA
chains in the Genus database with same CATH superfamily
2ADGB 4PB0L 4QMEA 1M1XB 4F27A 3JUYA 1WD8A 5F7BA 3CPLA 1FFPB 1D2PA 1OGTA 2X6AA 4PRIA 4IMLB 5EU6E 5LGHH 5CZVL 3L95A 1JVOA 1OSZA 2QDVA 2VE6B 4EN3D 3I74A 1T1XA 1NCCL 4QRUB 4B7LA 5AVSB 3LZRA 2UV3A 1UEMA 3K6SA 3F01A 4PCKA 3V95A 1ZV5A 4OIAA 4Y1TA 1FZOA 3D09A 2E56A 4NC2B 4NKOA 1JMZA 2WVVB 3KLLA 5TDPB 4NQDB 4HFWB 3DBXB 2WPGA 1IGTB 1MVUB 4NSKA 1MJ7L 5FV2A 4Q56A 2WZAA 4JDEB 2QKIC 1E6JL 5F88A 2WKOF 4NUQA 3MRCB 2FR4B 3ZTNL 3MA9H 3D34A 2DWSA 2H6PA 3H9ZA 2I32A 1WA2X 3NAAH 2CPUA 1JZEA 3QCUH 3O2DH 4GAYB 1XZ0A 5LBSH 3MRNA 3ZRFC 1OT1A 1W0VA 2Y25A 4CMMA 4BQBA 1S5IH 1N3NA 1DBAH 4KZDL 3TNNA 1MY7A 5ETUB 5HJGA 3L4WA 1MCDA 3WFBH 2ZWNA 1E5BA 2LLNA 5D7EA 5B4MC 2IG2H 1CLOH 3FF8A 2PPEA 5HJ3A 3CSFA 4Q97A 5C0JA 3T6ZA 4V1DA 4C56D 5CIPA 1FRGH 3CFKA 4U0RC 3RGVD 1JRHL 3H56A 4Y8DC 2YQ2A 4NNXA 5KVMC 4WTQA 2DMGA 2HPTA 5G4MA 4UTBH 1WBYA 3QIUC 1Y1UA 4YL9A 1GGIH 1ID5I 1IILE 2XZCL 4AV4A 2AXHA 3DXAE 3GNMH 3GXMA 3KLKA 3P4NB 4IRSD 4Y5YA 5EWIH 1L5GA 2QL1A 1HXMB 1WDAA 3HRZC 4Z7IA 3JTTB 3O0RL 4KXBA 3T3PF 4X6BB 3SSGA 5FW8A 1YECH 3QJFA 3SQRA 1NCNA 4XHJD 4G7SB 3O3BA 2WQRA 1JDAA 2LLLA 3I6LE 4R4BB 3ARGC 3WLBB 2J4WL 4I18C 1U6AL 1SLVA 2OW6A 4P23A 3VM5A 1ZDSA 2GKIA 5DUML 4OZ4B 1FNEB 3PY9A 4O2CA 3NIGE 1KN4H 1G4MA 4KQ3H 3WD5L 1ZK9A 3SCMA 5DTFA 5DS8B 1WSST 4Y5VC 2GY5A 1FGVH 3HOGA 4G8GA 4Z7WF 3IWVA 2A3TA 1YJDL 1QHQA 5ESVA 2NXYD 1KGIA 3LOWA 3C60A 3WIIH 2LAAA 1SJHB 1Y07A 1IBZA 2HFTA 2WQSA 5AB1A 3RDTC 4ZMQA 1R19A 3KAAA 4N22A 1J8HD 3G5XB 3MBEC 2CHNA 3FF7A 5DFTA 4PN6A 4PJIE 1V05A 4C4BA 1GZHC 3HB3B 4JGNA 2VAAB 3MUUA 5DRZA 1BA9A 2VIRB 4BIKA 1WIOA 1AHWC 1YUKB 3ZKQD 4F91B 4NC1E 2YGPA 5EZIH 3DX4A 3NJLA 4PJ8D 1O6VA 2P42B 2ZCLL 3ESVF 2MOQA 2VKWA 1TTUA 4BFJA 4JM0A 4X6EA 4MCYB 2OSYA 4XVUD 4B96A 1OAQH 3C08H 4XMTA 1XF1A 2OQJB 3NK4A 4EQ3A 3DTUB 4D7PA 1AE6H 4XCYB 3BUQA 4KK8D 1XEDA 3TCLB 1KTLB 3HG1E 2DQDH 5D4JA 5F6IC 1T03L 2BHFA 2PYEE 2WXKA 1U42A 3MRPA 4DTGL 1TO5A 2DQFA 4RRPM 3SE9L 3K2IA 3RB5A 2JJVA 3TO4D 3PS6A 4PY8J 1XGPA 2F53E 4D9LL 1U3HD 4BWUA 4G1EB 3AACA 1EK3A 4Q6KA 4Y9EA 2A4CA 1IBGH 3QR2A 3LZFL 3U9UB 2XICA 3LNFA 1FNSL 4MWFA 5JZ7D 2XPZA 3OJDB 2VXVL 3BP6B 1NUGA 3ETSA 2NX5D 1RJLB 2MOVA 2FIRT 5I6MA 3NFNB 5F7NC 2FATH 1DQLL 4L1DA 4YQXL 5K1NA 5DURD 2GFBB 1KN2L 3P9LA 3HNSL 3VE0A 3WS3B 2CXKA 2I9LA 3FT0A 2WGNB 1ACZA 1EVUA 3ZGHA 4IGBC 3G04B 3V5KA 3F7VB 4M6MH 3FT1A 2WWMD 3MOAH 2Q86B 3ULVH 4JG0H 3KPQA 4FXKA 5FA4B 5KEZA 3DX3A 2HKAA 5DJ0B 2BSSA 2VXQA 2YJQA 3VAEA 1GS6X 3EFDH 4HPYL 4UQCA 4AIZA 3INOA 1DQDH 3VQMA 1HXYA 2NR6C 5CXPA 4MMXB 1KLUB 4FLQA 4AT6B 2F5BL 4FQ1L 4OGYH 1KIUB 2VSCA 5E6ZA 2BZCA 4OJDH 5K9OA 3V6ZB 2Q0ZX 3CSYA 5DZVA 2GJ6B 4RMBA 5D1ZB 3MJ9H 2IQ9H 4PRHD 5SX5K 3UTSB 4Y2DC 1QBLH 4JR9H 3KDPB 2YD6A 3RPBA 4JHVA 5HYFA 1ZMYA 2HKHH 3CSBA 5J13C 3US0A 4FMFA 3ZYZA 5EC1A 2PW1A 4CC0A 3KYMB 9CGTA 1IAKB 4MMZC 4R96B 3UO1H 5HJDA 4DEWA 3WN5A 5ID0B 5LNDA 1SDAB 2Z93A 2C1PB 4YPJA 4YPGB 1LNUA 1E9OA 3FSOA 1CDYA 4A2GA 1BZ7A 4FC3E 5I0ZA 2PW1B 4FCAA 4XGZB 3TA3C 3P9MA 4I0CC 4P23D 5K93A 4EIBA 2GTQA 1DVQA 5BO1L 1HYSC 4A37A 2DICA 1UM6L 1BXXA 4X8JB 3LTVA 1BOGA 3VFVB 3M46A 3HMXL 2MWCA 1GC1H 5IBLD 1CF8H 2JIXA 2ZSWA 4PJFF 1Q9LA 1CGTA 3SGKC 3SKJL 3GJFK 4F8TA 4MSWA 3GSRB 5IMOB 1CFNB 4Z0XA 3UEZA 1IC7L 3QH3B 4LK4A 1HZHL 4ZNEE 4ZXBA 1AQMA 5L0QB 2LU7A 2BRRH 1JG9A 2X0VA 1MVFA 3II1A 1SBBA 3FUHA 2CLZB 4A38A 3V6OA 1PNCA 4PB9H 1Y6MR 5FW6A 1WBXB 3UBHA 4HV8A 4NDMB 4JHZA 3QORD 1N4XL 3FBKA 3P0GB 2WTRA 1JF1A 2BNRA 2G5UA 5AL0A 1A66A 3ZMRA 4AL8H 3C5ZD 2HLEB 2QADC 5HDWA 4Z3TA 1GIGH 4WW1A 3T6XA 3S8FB 2GAZB 1K3ZA 1D6VL 4U1KA 4UT9A 2OSXA 3FQ2A 2ESVE 1BIIB 3FBQA 3PJSA 1MFMA 3TJEH 3IRCA 4EXPX 2AJUL 3TBCA 2PCPA 3QPQD 3L1OH 5L4JA 2ZIDA 2J25A 4FKHA 1KYOJ 3GKWH 4JQXA 5GGUB 3VACA 3ATDA 1KULA 5IUSA 5EN2B 2MTPA 4YDLB 2Z34A 1XQ4A 3GIZH 2EXTA 2VR9A 3D85B 2VLKD 4XR8C 5B39B 4M7LL 2ZOLB 4N26A 1HAUA 5C9JA 5KYNA 1CFSB 3DVNB 4Z7WE 3NCMA 3D0LA 4OLXL 3QFJD 4YSDA 1SOXA 2DB8A 2E7BA 5EO0B 2LGNA 4ZW6A 1TIUA 1UD8A 2XOTA 4GKSA 3WNOA 1HHGB 2V8MA 4Q58C 5J4MA 2NMSA 2GJJA 3TS8A 1IM3A 4QXVA 5K59F 3KCPA 5K9JL 4IMKC 2LV4A 1D9KA 3GBNL 3GSWB 4DQAA 3DBXA 2E8ZA 2OL3L 4PRID 5I8OL 1E50A 1F3JA 3MRIA 3P11L 3K7UA 4GSUA 4PRDA 1OE3A 4U7MA 4AIOA 2CO1A 5DHYB 2F74A 3ZW3A 3AQZA 4FG0A 5AVTB 2YD0A 2XVKA 2NX5A 3KL3A 3NSDA 3ELAT 4GT0A 3ZU8A 4HKXB 2F7OA 3RTQB 3L4VA 3UBXB 1KGXA 4HZAA 3LIZH 2Q8AH 2LU3A 1PZSA 4L0ZA 2UY6B 1YQ2A 2NLJB 1X5JA 1KC5L 5E2UH 3WJJC 4O9HL 1XIWB 4CNIB 5D7HA 3O8XC 3NTCH 5DJZA 1N0LB 5A2LH 1HXMA 4UM9D 2AJVH 4LOFA 3NT0A 3GZQA 2CO4A 3A67H 4PRDB 3BIKB 2FYYB 5AVZB 1NTDA 3KJ6L 4MAYC 3FB8A 5T33L 2ZAIA 4OLEA 4PHZA 5D7IF 1LP9F 3GMOA 4MLSA 3K74B 2JF1A 2VXTH 4PJIB 3TWCL 4TVPD 4JE0A 2HKFH 1FHNA 1OQOA 2NY5C 1CL7L 3NACH 4H8WL 3QRGL 2CU9A 4NHUA 1EJFA 2XN1A 2VR4A 3AREC 4CADB 2Z6FA 4LRIC 5I16A 2VJ8A 1I1AD 4AXWA 4JY4B 1AAJA 2C9QA 1C5CH 3LEXA 3S8GB 3LHPL 4F15C 5HJBA 2QQKH 1AZBA 1DJGA 2WMPA 3SBWC 4OLUH 5IF0B 3ETBF 2J73A 3HW7A 3NIGB 1SXZA 3N9GL 5DD0L 1U2CA 5L2JA 4GRLB 4XZUB 2Y4SA 1PZCA 5DK2B 1SHSA 1XDTT 5FK9B 1ORSB 2B59B 3U9PL 2YWZA 2XVBA 4J4PA 4FI8A 3L7EA 4X7TB 1IGFH 3QNFA 2GHZA 3CLFL 4ZMWA 3C5XA 1L0PA 4QHLB 2VAJA 3VYPA 4BGDA 3IDNB 4AK2A 4A2DA 5DQDH 4YS4A 5C71A 2NSMA 1WWBX 2FDBP 3ZPDA 3L08A 1ET7A 3G6JA 4OQTA 3S36H 4UV4H 3RX7A 4C59B 2QDWA 3QE5A 4DNLA 5BW7A 3P73A 3BPNC 4U1GB 4LKXB 2I7OA 2QKIA 1CFBA 1CYGA 3EJYD 4FQJL 4FYTA 3QO0B 1ORSA 4I3GA 2Z0UA 3QQ3B 1M1XA 5KBLA 4WKXA 2KQNA 2R7EB 3QISA 3KNBA 1S7TA 4TQPA 2DKUA 4B95C 1IX2A 3O6FD 4NUJB 1O9VA 1CFQB 3QQ3A 1Z9NA 4FCHA 4NKOB 2EDLA 4HS3B 4KO5A 1IT9H 1JFQL 1TDQA 4U7SA 4RMVA 4M48H 1QABA 2APWA 3RIAK 1I53A 5FFGA 2WBJC 4FNLL 3MRGA 1OTUD 3ILQD 1T3FB 2EE2A 3MGOA 2Z31C 4Q6IA 1XGYH 4PVMA 1UD2A 3C6EA 3EHBC 4JRXD 3X1BA 5LG6A 3CFMA 5BOZG 4JN2B 5EOQH 1NMAL 2R8SH 1MJ8H 3IJSA 1ZT4B 1KB9K 4PJHF 3PGDA 1RMFL 5C8JB 3GPSA 3HRPA 2JKJA 4XPAH 1LEGB 3K8KA 4H0LC 3MYJB 1W0WB 5D1XE 5B21A 2YXFA 1OW0A 3NZ8B 3Q3GA 1P6WA 4K7PL 2ED8A 2PR9A 4HS6B 3B9KD 1S78D 4K73A 4LASH 3WTWA 2CRIA 4HKXA 5IMKA 5I1IL 3Q2VA 4DOHB 3HNTH 2GTWA 1LP9A 4NO3B 1A02N 1L0QA 2D8KA 2HG5B 3VWJC 3AG4B 4Y2OB 4PTTB 4AM0B 1P9MA 1KWGA 3ILDA 4LQ1A 2EDHA 1MCPL 2I5YH 4FD0A 1YMME 2D7NA 4IBQA 3ESUF 5IVXA 5T8IA 4MJJA 4EIUA 2FBJH 3DJRA 2AJZB 1MPAH 2JH2A 2LOEA 2BVOA 1R47A 2ZXEB 3EGDA 5E7BA 5GRVL 1LMIA 1BYPA 1QFHA 4R7DA 3E6HB 2EZ0D 1XCQB 5GSRB 4PLNC 1LDSA 3ZIMA 6TAAA 4PCTA 1CT8A 1SDDA 3PQYA 3IDJA 1EEYA 4OQ1A 3TBTB 5EO9A 3M8OL 4J5VA 1TVHA 5D1XB 1U8NA 2OTUB 2VZ3A 4L8SA 4IJ3B 4JG1H 4RAUB 3VO0A 5FO8A 1OOAA 4HUMB 2GW5A 1A9EB 4BZ1L 2YD8A 3IBEA 1P1ZA 5MI0C 3I50H 3DUSB 4RX4D 2HFGL 4F9LA 3FUNA 5KSAA 3D87B 1LWJA 2YD7A 1HZKA 1U8OB 2H6UA 2A77L 1DHKA 1ND0A 2OMWB 3IDUA 4J3OC 1UOWA 4LOUC 4WWKC 5BS0D 5KYYA 2Z7ZA 3C09B 3ZE2B 3VFPA 1E4WL 3KWXA 3RDTD 4W9DC 3T1FA 2MMXA 4YXKL 2HN7B 5J57B 1AR1C 1CN4A 2OA9A 3L4XA 1PJWA 4E41B 2DQHH 1WS8A 1NL0L 2DQ6A 5IQ9B 4A2EA 2XI9A 1MHEB 2FJUB 3UBXI 1OTSC 4DAGL 1ZDQA 2B77A 2BO0A 7PAZA 1RU9H 5CHNB 2H32B 4FG6D 2BSTA 4TUUA 3HE7A 2AQ1A 1AGEB 3V5HB 1HDMB 5C08A 3VYOA 4JFTA 1A4CA 3UH8A 1VPOL 1W6WA 1KPRB 2QJDA 2VW7A 1NCOA 2ZKWA 4E9WA 3B83A 4IQHA 2IADA 2NX5E 3L13A 3MRLA 5DQ9A 2CGZA 2J21A 1JGLL 1JWUA 1MF2H 3H3KA 3RVXD 1TZIA 5F0PB 5TPWH 1TNNA 3BUDA 3V9CA 3P77A 3K3QA 2F58L 3GKZA 4YSRA 1G7QB 1U8CA 1I9RL 2IV9A 4LSQH 4M5ZL 4ZTPH 4HGWA 3CX5K 3JWOL 3BEVA 3K0YA 2VUOA 4XP4H 1FFNB 2C4FU 2N0KA 5EBMA 1BGXH 4OFIA 1QR1B 4KZEL 4FFWD 1H6TA 3EYOA 4XPBH 3WUWB 1QQDA 1V7MH 1X5LA 3FT4A 2XSKA 5DRWB 1CIUA 2WXIA 4MA8L 3T3PB 4H7VA 1GHFH 2RACA 4NGHH 3WBDA 2W38A 4Z7VA 1QSFA 2YC1A 5GSVA 3GXIA 5MHSD 4JANA 2B4CL 4LHQB 4MKTA 1URIA 5E9AA 2A6JB 2B9BA 3P4LA 3R19A 4HBQA 2FTAA 3N2JA 4B60A 4OZHB 5IJKA 1YMHA 1U9KA 2XBTA 3QEQD 3CN2A 3D85D 1MW2A 4NQEE 3RPKA 2XV0A 1XGZA 2GCYB 3EGXA 4F58L 2EIDA 1MRDL 1O7VA 1T6VN 2D0FA 3GO1L 5JMOC 2WKGA 5H2BA 4V1DE 4A04A 4KFMA 5E8OA 4OCSH 1PYWA 1AZUA 3NA9L 2ZX6A 2OAAA 3RAJH 2ATKB 2QPFA 2YQBA 1MCWM 4RSYA 5DRXA 4WHTA 4DOHE 3OKNB 3VFRA 1ZA6B 2KHAA 3KPPB 5K39A 2V9QA 3DO7A 4OZIB 5TGBA 4JY4A 2MNJB 4IRSB 5DC2A 4HFUL 2ZXQA 5F7AA 4LP5A 2VL5A 4U3HA 2HPOA 1MIEH 4TOYH 3AT8A 1S9WA 2PO6B 5DZOA 4OD1L 1TQBC 5FA3A 2ZG3A 2YD4A 4BSWA 5IJVA 3A4FA 3T4YA 4IOIA 1E4KA 3FHEA 2WP3O 1E8XA 4XH2A 3LNEA 3MNZA 3IGFA 2FT7A 4EI6A 4YPGA 3BIAX 3HZYB 2EVHA 1KJMA 3IFPB 1YSOA 1VGKB 4IDJH 2KLRA 2Y22A 4Q6YA 3BSZH 1B4TA 2GIXA 3NJFA 1RHFA 2UZXA 1PZDA 4KK5C 3DVGB 3B9KB 4ETYA 2AHIA 5D1ZI 4U6HA 4RAVA 1NPNA 3O3AB 1ZTXL 5SWSD 2P5EB 5I75B 4UIKH 3L5JA 2HFEB 2AJXL 4A7GA 1YPZF 2AGJL 4HJSA 2XX1A 1HNYA 4LEXL 4MJ5A 5BUAA 3WL9B 4FJYA 4Y4HA 3IBOA 4HXBL 1XCTA 3MLWL 5LGYA 3SQBA 3ZL1A 3ZSTA 1HU8A 3NP4A 3FSZA 3VVWA 3CXHJ 4GQQA 3TJHD 2X2YA 4L1HA 1P7QD 1P7KA 3DETC 4JY6B 3HHMA 4FNTA 4PY7B 4WV1B 3O2VH 4HEPG 4I3RH 1M7XA 3TH3T 2X38A 3ZUCA 2WVSA 2I27N 4ONFH 3C8KA 3E3QC 4LNRA 2NQDA 3L3OC 3MV8B 2JJTC 4H88L 2D3NA 4L4VE 4DN4L 4YHIA 1H6EA 2HX7A 3IAGC 4ILDA 4JRXA 4X0NA 1VFMA 4OLZL 2DS4A 2AJ3A 2UVFA 3MJ8A 1R24B 3SOTA 1F3JB 1EGJL 2GYSA 3LN4B 5AKRA 2WV3A 4IHOB 3U1QA 1AS8A 2X3AA 4P5SA 4HVBA 1KJ2B 2OLDA 3TH4T 3ZSSA 2BNRD 4GAFB 3M1BA 5D7SH 3WMPA 1WC7A 1IUZA 1AQDA 2R83A 3DX7B 5CJOL 2IOOA 4ZMNA 4IHOA 3ATBA 4AGPA 3WJLA 4ZTOL 1PS3A 3DX0A 3SPVB 5IMMB 5FIEA 4GUCA 3MLYL 2R0ZH 4D3CL 2IH1B 2WUBL 1FV1B 3V0JA 1BZ9B 5KSAC 1L9NA 1D3CA 2NSQA 1MWOA 1AHKA 3TLRA 2P47B 2GBVA 4QTHB 3EH1A 3QIBA 2WSKA 5TH2A 4HCRH 3RWDB 4N86A 4H40A 3BESR 3MNWB 1SQ2N 1U8PA 3SHSA 3HNVH 1KEGH 4CU7A 1QPKA 1LJMA 5EU5A 3FC8A 4JY5H 1S7UA 3WJMA 2ED9A 4R0LC 4EVNA 4TNGA 4G5AA 2DF3A 4XVSL 3E8VA 3IJEA 4JM4L 4POYA 1J8SA 1OCOB 3CHRA 3TNNB 1MI5D 4TPRH 4NENA 3DKHA 1A14H 1S7UB 5DMKB 3QZBA 2DWDB 3LMJL 3RIAF 1NBYA 2ATKA 4MKMA 4X4MA 1BFVL 2AS5M 5TE7H 2N01B 4HKJB 4ZTEA 1FFTB 1S7SB 2TRYA 3EJTA 3AJ7A 1K8DA 3D1MC 4UNIA 3L7FA 5FYLH 3O11B 1H9DA 1IQWH 2EP6A 2YA1A 3F3HA 4FFZH 3THML 1WBYB 5T3XL 2K6YA 1NIEA 4GKNA 3DBSA 5AOMA 3F05A 3TNMB 2Q9OA 1IL1A 4A6YB 5BV7L 2NNAA 4WFFD 2IQAA 4BK5C 4R2GB 5DD1L 2QZ5A 1YN7A 2WAHA 3GMQB 5B1JC 3ZDZE 1NCAH 4X9YA 3BGAA 3L8QA 1A9BB 5HDQL 4XPTH 5GRWA 1A4KA 4JDTH 3UO8B 3MMEB 3NRQA 2KH2B 2BLFA 4N0YL 4PJCA 4AVHA 2AQNA 3LKPB 3V2AR 1IGCH 1A7RH 1MCHA 2LAGB 1WUNT 3KW8A 3J27A 5DD3H 5DFAA 4OV5B 4NKMA 2Z31A 3WFZA 5FO7A 5E08L 3I9PA 3OKKB 4XPGL 2GI7A 3ZDYB 1A6TA 4ZQKA 2ICEA 1RZPA 5FUZL 4TTGA 3HS9A 4LSVL 1ZSHA 4PJ5D 1E4XH 4DO6A 3BEWB 1KYOK 2VL4A 3QUZB 2VLRA 3VXPB 2A38A 3PREA 2BNQE 4PJBF 4QHLA 2P49B 2D03H 4DP8X 4G8EB 1MHCA 3UJIL 4JQVC 5DJCA 5F8RC 5MI0B 1YY9D 4NNPL 4HK3N 3AITA 2MHAA 4JDZB 5PCYA 4ZRGA 4HWBA 2IGFL 4ZPTA 2CJ3A 2O26U 2OJZH 4OM1L 4UAHA 1LILA 3CJJA 3OG6B 3HR6A 3VFGL 4MXWL 3G7TA 5G5DB 4YIQA 1GKOA 2MTAA 3BOVA 2VLLB 4M4RB 1COBA 2IFFL 3KPQB 3QJZA 5C0FA 1IGYB 3NEXA 1Q72L 4P2OC 1BQLL 3D0LB 1IV8A 4NLAA 1NLDH 5DRWA 5HHOB 2RTTA 1DBKH 5F6HJ 1QOKA 2BIHA 5D6DC 4ORGB 3LIZA 4TNVK 4F1SA 5AENA 2XTSA 4HDIA 1EZSA 1XR8B 3UBFA 1X5KA 2OPCA 4UNUA 1V8HA 2P4AB 2Q8BL 5I1GL 5JW4N 4IBYA 2BY3A 1BEYL 3RWHA 4FQCH 4RGND 2ZSVB 4LLWB 1GVIA 2AAAA 2QHRH 4GRWB 3PCYA 4QGYA 4QHPA 2QQNH 4G42B 4AMWA 4K71C 4WTZA 2NCMA 1DQJA 2LABA 4GXVH 4X5PA 3SDYH 4GO9A 32C2B 3H3PL 12E8L 1J8HA 3F62A 4LVEA 5F7FA 5JTWA 4D8PB 4S1DD 3I6SA 4CJ0A 5MENE 1QQDB 3QHZH 3DO7B 4RFOL 4M6NH 2XDHA 4HS6A 4PJXB 1CGYA 3BXNA 4DUXA 4KVNH 5EORL 4KRPB 4PUBL 1U95B 1VHPA 1DFBH 2DYPD 4MQ7B 1MDAA 4MNGB 3W81A 4P4RB 5CD5C 1NAKH 1E4KC 1R3KB 5DC0A 1Q9LB 2QVKA 4H13C 3B6SA 3CFUA 3T77A 3WEMA 2X6BA 2RFXB 1GH7A 2JIXD 3AG2B 2XHNA 4NZRH 5I0WA 3QK0A 4OH2A 3MLTA 2D31A 43C9A 1AGFA 4WUUD 1OAZL 3HMWL 1KCVH 3KXFB 3X12B 2DL2A 5BO0D 4LVHB 4JJOA 2XG5B 3J8F7 3LQZB 1HOEA 1Z6JT 5ANMA 3ESNA 4PJHE 4LP4A 1L6XA 4M7KL 1HVXA 2KZKA 2EO1A 4LCYB 3R1GL 1BV8A 4GRWE 5D7KD 4B9IA 3GXPA 5TE4L 3TURA 3VD2A 2OXHA 5C0RH 1AS7A 1EAOA 4KUZL 1CTMA 2XPGA 5EUOA 5BRZE 1BOGB 1AI1L 4HK0A 1CLZL 1YEJH 3RL2A 1S7RA 2FO8A 2QQLH 4WJ5A 5KYYB 1T83A 1XGRA 3EGSB 1I8LC 1FNGB 3P9MB 1F4YH 5FDWA 4U1KB 4JUSA 4U4BA 5F21B 3LKNA 2W0PA 3VI3E 1ZLEA 1NDGB 2PCFA 3EYSH 3IMRA 2ALWA 5D7JC 4NUPA 4EOWL 5J6HA 2X4RB 4PI2A 5AAWC 2HT3C 3VXUE 4WHDA 1A65A 2HJKA 3ECUA 4JFZH 4EUPA 1MELA 1I1RA 4Y2DA 2ICWB 1SEQL 4OI9A 2EIEA 3I3DA 3QQXA 5CCJA 2PYEB 1OP5H 5CLYA 1SN5A 4LCUB 2V9TA 6PCYA 3D0AA 1HDMA 1QI4A 4QCIB 3RX9A 3CCHB 4F8LA 3BP5B 3VRLF 5HVHB 3I9AA 3P30L 3MREA 2BCKA 4BKLA 3F7VA 4XNBA 2PCXA 3TEYA 2EADA 1JPSL 1KPUB 4ONGH 5CHNA 4APQC 2W07A 4JFOB 4WKZB 4ZQTA 4P07A 1PG7W 2CDGA 1XGUB 1PEZA 1OQXA 1TUPA 3K8MA 4DK5A 3MBEA 5KS9F 5F9DC 3P0YL 3CDZB 5I74B 5DMGD 1W0VB 3G5VA 2C3GA 1XF5A 5SWSB 5AALA 3DOSA 1UEYA 1KUMA 3BP7B 1KT2A 2PPAA 3WIFA 2X28A 4UV7H 2H3XC 1DVFC 3TYGL 4E42B 1F56A 1B2YA 2FSEB 1I85C 2JKXA 4FQXB 3VXSD 2EVFA 2ZKXA 3DJTA 1QAWA 3OG4B 4IRJD 5GS0D 4BQCA 2BJMH 1AO7A 2CBQA 1GPOH 3NUKA 4P23C 3OWRA 1H3VA 1MVUA 5EC1B 1G84A 4HMDA 1YEKH 5HSFA 4HX1A 1QUPA 3QXTA 4CN6A 4OCMC 1NGPH 3FB8B 4K8RD 4MCMA 4DEPB 1UWGH 5D2NA 3Q13A 1IAIH 4XN7A 2AXFB 1T04B 3W9DB 3LH9A 1N70A 3M1BB 4JPIA 3TPKA 3B2PA 4L29B 3ETTA 3G6DH 5GHWL 3AB0B 5IMLB 3R7QA 4UINH 5KVEE 5I1HH 2AZUA 2ZCHH 2BRQA 1C7SA 2VMCA 5JQ6H 3WNNA 2YD2A 3OKEA 5EZJA 2OK0L 2YPLE 4PJ8A 3CUPB 1ILUA 3DK2A 4N68A 4G6JH 4Q9QL 5BPPA 4ZW3A 2X6VA 2JB5L 3F58L 4S1RH 4YZFE 2OX5A 3MNZB 1EA9C 2HTKC 5DUJA 3W0WB 1RZFH 5EC2A 1Z32X 5TQ2H 4AL8C 4LNVA 1SJHA 4G6FB 4XP5L 5ISZB 3DVFA 1QRNB 4L8CB 3ZL2A 5KANG 1ECYA 3NIDF 3HBZA 3L3GA 3MZGB 1XXDC 3WKML 2OMXB 2CKBA 2JJTA 3QDMA 3QXAB 4FERA 1CE6B 4ODXB 4OJFL 5TJWK 1FVCA 2DJSA 4OV6F 5DJDB 3UJTH 1I8IA 3SIKA 1CR9L 1UWEL 1MEXH 4I1NB 3HC0B 1LDPL 1NFKA 2XTJB 5D7JD 4TVSa 5JDSB 2VDQL 5E4OA 4XRCB 1H8OA 3BJLA 5HVGB 4UQAA 4UILL 5C0BA 4I3SH 3WNLA 1CURA 4Z7QF 4K7FB 4UM8A 1O7DE 4P57B 3OXSA 4HUXB 4CBZA 1HWWA 1YC7A 4HULB 4WGWB 5F9OH 2VN3A 2ZUSA 1UKTA 1T0OA 1ET8A 2SEBB 3KWWA 4AENA 2CJUH 1VFBB 1MCIA 3V6OC 2VERN 1PG7H 2C26A 1DANT 2NT1A 3DRTB 2LFGA 3JYBA 2QPDB 3CXDH 5I66A 1R5VA 3VD9A 4P5TC 4X8XA 4P9MH 4I9WD 4XWOC 5K59E 3P4OA 1YPZE 2X9XA 3VG0H 2XRAH 5DHDA 5C09D 3KYKL 4LRIA 5DEJA 3B9VA 4O2FB 3QXUA 5D2NE 1GKEA 4JM2D 3HUJF 5FYJU 2ZCZA 4YSPA 4G8IB 4Y2NA 5BUGA 4YHIB 3FH5A 5PAZA 1A2YA 3KR3H 4PS4H 3CMGA 3D18A 1KCRH 4G1MB 1BLNA 3UTQA 2AEOA 3QQ4B 4HJJL 5E8DL 4LKXA 3EJJX 3EG9B 5CM1A 2WQ8A 3RA7L 1UZGA 1XBDA 1XSJA 5FEBA 2EDFA 2WVVA 4GT7A 5GGVH 5TDPA 3CHXA 3NP3A 1HC1A 1MG3C 4XMVA 4L8DA 1MWAA 1QP1A 1IGIL 3PXHA 5JIPA 2CHXA 4HWZB 1A3RH 1JDDA 4P46D 2AKRB 5JHAA 2XLLA 3X11B 1EJOH 3OJDA 4PEEA 3IMSA 1JNNH 4N0UB 5E56A 1SBSH 1RIUH 1GCFA 3PWUA 5EIQA 2CIIA 1U8LB 5I6NA 3II3A 1OTTC 3K5SA 2YN5A 2EE6A 5T1KA 4P4KA 2L04A 1ADQH 4CILA 1H0DB 1JV5B 1LMKA 2X41A 2YAFA 3RWDA 3BPCA 3S97C 1R3IH 1FIGH 3W5MA 2QKSA 1PL3A 3PHOB 1BF8A 2Z8WC 2W94A 5IJCC 3MV11 3T0EA 1JNJA 1OW0C 3PAYA 3MGTB 1JMXA 1VZIA 2XZQH 5C0JB 4Y5XB 2NZIA 3WHXA 4DKDC 3FOMA 1J8HB 4PJ7E 5DYOA 4HCRA 5T1DH 1ZS8B 4KGJA 2VC2B 2VQTA 1Y7VA 4PMEA 4HBCL 3BHBB 3GUFA 5K9OB 1RFDL 1G1OA 1KYAA 5JPMA 3BWSA 4UQ9A 4W9HC 3Q2WA 3AU1A 1ERNA 3DGGA 3EOBB 3F7LA 3N06B 4FQ2L 4HWBH 3CFTA 1YEWA 5F9JA 4RFNB 3MV9B 1WAAE 4JRLA 4Z3FA 4XN2A 5T3ZL 5AG8A 4S0SD 5I8KL 3EHBB 4GINA 3MCG1 1WBXA 2ZOKA 1ZLVK 4XNZC 3Q43A 2C1PA 3APMA 1XGPB 4HCGA 5BZWA 3SBRA 5DDHA 4LOVA 1VGEH 2PO6C 5EUKB 4JAMA 1KACB 4YHOL 1YNKH 3C5JA 1EHAA 2P48B 2DQFB 4JG5A 1GJIA 3G5YB 4G9FD 4HXAL 4AQOA 5D9SB 4JDVA 4JFEB 4BFFA 3T0VA 2VDKB 4P5TD 3H0TB 1A8JH 5IVOA 4PREB 4U1MA 2EXSA 3BLKA 2OTUA 4L8SB 3QUYA 4LLDB 3QW9A 1OPOA 3NFNA 1NCDH 4UQ3A 2JIXB 3VGFA 2RGSA 4O5LL 2NY4C 1OAXL 3VWJA 1CFMA 4DP4X 1WO2A 1WTGT 2A83B 4KPHL 1FZJA 1JS4A 5E2VH 4AQ1B 1T89C 1F90L 4WRLA 1I3GL 3MROA 5AZEL 1J1XL 3PP3H 1S78C 4JAMB 5I5MA 4ZQKB 3ZYIA 4HDIB 3PU7A 3QC5X 1QACA 3GHEL 5ALBH 3RL1A 5B8CA 4XB8A 4YUEL 3BKJL 1JHKH 5F7EL 2XFGB 1QWNA 2IDTA 2VXQH 4HV8B 4PJHA 4LL1A 3MKKA 3T3ME 2OSWA 4QYOB 1FE8L 2MJWA 1UXLA 1ZLUK 3DDGA 3GSXB 2VLLA 2FEEL 3EW3B 2ZX9A 4B3EA 1F8TH 1SPDA 2BP5M 3T2QA 4F2EA 4ODTH 3KLHD 4U1NB 4JB9L 1V10A 4Z95L 1MHHA 2KLTA 2WIMA 2XTJC 1KJ3L 4RFEA 1DQKA 4J3OF 2WLKA 4QXTB 2W07B 4HG4K 3GS7A 3W2DH 3GDBA 4DGVH 4HIXL 5DJ2A 2CGRH 3U82B 1JXGA 2OMYA 4I0KA 4Z5RA 3WXVH 4HISA 4F33A 4IIQC 2WYZA 3ARSA 1YYCA 2DWEB 5I1EL 2WZPD 5FHBL 3U4AA 4O02A 4C54A 1IAKA 2WC7A 1QSFB 2EXYD 4QRPD 4S11A 3ZVVA 1PU0A 4KX8A 4FFYA 4QJ3B 4ALAL 3AGWA 1T2JA 4BCZA 3T0DA 3DXAA 4ABQA 2ENYA 5GJTL 3RNKA 1EFXB 1OAYL 4HJEA 1JZJA 2VDKH 3EJPA 3LKOA 2QMKA 4PJBA 1ZIBA 1R5IB 3VXOB 4ZO8A 3QNYB 1CXLA 2OJ1A 5E51A 3HB3C 3EFOB 2K4WA 2WXOA 4FQXD 1FWXA 2P5WE 2XUWA 2NXYB 4LSRH 5HI4D 2F53A 3CSPA 4M4PA 4MQTB 2CUAA 1GZQB 5FYJL 4DP7X 3I6KB 4I5BB 3OB8A 4M62H 3V4PH 1UYWH 5JORA 4R96A 1D5IL 2YUWA 3BD4A 4NZFA 1A6WL 1KXTB 4RQQB 3W0WE 3DUUB 5IFAL 3FUKA 3EJCA 1HK6A 3T8XA 4K94H 1A6UL 2DKMA 3QAQA 4NBZB 1G9NC 1PY9A 2IJ0C 3C8HA 3OPZH 5C08B 2NTFA 4X98A 1I8MA 1RP8A 4G5ZH 1QATA 5HHQB 4UYQA 3V4PB 5IP4A 1MLCA 1F4AA 2DW5A 3RJQB 1XB3A 3CZLA 4ODWA 3V0IA 1B4JL 3QJHB 2D7TH 3SOBL 5C0AE 3OKMB 2MPAH 5HD8C 5D1QD 2Z4TA 5AVQB 1T1XB 5GISH 3SKOB 4S0HA 4WGKA 2B5IC 1XGTA 2G5RA 2CKBB 2LTQC 4QNPE 3IETB 3KVPA 1G9ML 5BMFH 5C0GB 4XVTH 1K3IA 4K23H 4DQOH 4J6IA 2J88L 4TM9A 4AENB 3WENA 1JGDA 1HYRC 1NIBA 4QY8B 1S3RA 3OWEA 3TPUA 4AEIH 4GIAA 2GC7C 2EDRA 5FF6B 1P5UA 4DZBA 1JYXA 4G8IA 4MD0B 4JJHA 1H9VA 3WUZA 2OS7A 4K3GA 3GMNB 3CFCL 1CF1A 1LE5A 4ZFOL 4ZUVB 2FQDA 3TYFA 3QDME 3QCTH 2V7HB 2Y1AA 4UDTB 1Z2KA 3RDJA 5AVVB 3OZ9H 4FTVA 3DYPA 4LLUB 3AREB 2X4OB 2Z3FA 3K6NA 4ZFZA 5CJQH 2F08A 3CPLB 5TK2A 4D9QE 4R26L 4XNDA 4I18A 1NSNL 2YSTA 3PUUA 1EAPB 3ZTDC 2P5WA 4I77H 4XPFH 1QPXA 4WWKA 5B7EA 1NEZB 4Q0XH 1L9QA 5EIIB 1TETH 2X4OA 5HY9A 2IAMD 4CVXA 1CVRA 2XKUA 4U1SB 5EN2A 1AFVL 1U8KA 2QMJA 3BFOA 1Q9OB 1LD9A 5CFHA 4LLWA 3AQXA 4PRBB 1FL5A 4YC2B 1SDYA 4N2GA 4KZ0A 5KOMC 4DN3L 2B1AH 2GVYA 3RUGE 4GLRH 3KCPB 3JV0A 5HPMB 1GAFL 2WLMA 3RTQC 3WMSA 2YKLL 1CBVH 3EDKA 2OR9L 1Q9OA 1BZQK 4YVNA 3WKYA 1NIFA 3NSXA 4G72B 3NJXA 1EEQA 4KH9A 2R56L 4R5XA 1BQKA 3JYCA 2IH8A 4JANB 4CVXB 3QRLA 3LS5H 3MRMB 2R4RH 2E86A 2DMCA 1S7SA 2KUTA 3HAEG 2O5ZL 3D25A 4HAGA 4JM2B 5HYSB 4KOCA 3I2CL 5HGHA 2AQRA 3SPJA 2R2EB 4DWHA 5C0CD 1IC4H 3QJFB 3BPOC 1MCFA 5IKCA 2BHZA 2BW5A 4FJZA 1U8HA 4PP1D 4Y5XA 1I1AB 2ZKHH 2RIKA 3RRQA 4KTGA 5E6UB 1HQRB 3C60C 4ZFQA 1BHGA 3RBGA 4PU2A 1UH2A 1HFUA 2XN9D 3O2WL 5JW3L 2Y07H 4BFIB 2FNBA 1TJIH 3V10A 2JTDA 3OKYA 1QFUL 1CLCA 5A40E 4LF3B 4XP6L 4NQVA 4P3WA 1SMAA 2OMBA 5CILH 1I9EA 3QPXH 2BC4B 2YARA 5DO2C 1J05B 3GXNA 2F6AA 4MAUH 3JTTA 5CLWA 4BH8B 2XIDA 2VL5B 4I5BA 2ZKYA 4NKQB 2Z31B 3MCLH 4KQ4L 5IHZA 5I6XC 1V3JA 3SEPA 1G9NL 1KBGL 4Z7QB 1RL1A 3N1MC 1G1YA 4Y89A 2BSRA 2WXPA 1FC2D 5C0EB 3D69B 5DEZA 3NK3A 4P2YA 5AQ0A 4LDLB 4BHUI 1GOFA 1AXIB 4JN1L 3QORC 1NGQH 2R7EA 1ZSDA 4G7VL 2A1WL 4ZPVB 5E8EB 3PL6D 3CZUB 3AU0A 1EUUA 1NJ9A 3H2PA 2XN0A 4X80H 2IDQA 4Y16D 3BGMB 3VA6A 3S3DB 5FC9A 4N2CA 1A3LL 2CK0L 4HSAC 1U92A 5AW3B 4U6YA 4MMYB 5JDSA 4YSOA 4O2FA 5FWRA 4ZD3H 4X2UA 1S7QB 1C7TA 4LPCA 3QARA 1NOAA 1QFWL 1INEL 2CCLA 5IQMA 2PPFA 1Z9SB 3VRIA 2FR4A 4Q2ZB 3E8UL 3IDIA 4OAWA 4YGVA 2HT2D 1OGSA 3MRJB 4K5NA 3S37H 3WNMA 1BM7A 1QBAA 3UG4A 4Y1AA 2Z92A 7FABL 5KBKA 5DC9B 5FYLE 4NFBA 3DX6B 4F20A 3LN5B 4GW1B 4A2FA 3WO4C 4JMNA 3HFFA 4FQLH 4ZX3A 1JGUH 3AG3B 2ATPB 2E4TA 3LS4L 3QDJD 4RSVA 3UZQB 4KAQL 3L4UA 1MCRA 1WICA 3KLAB 4JO3H 5I30L 4TVPL 1X7SA 1EV2E 1BZDA 3D4GA 3QG6A 4UQDA 1T0PB 2UYLA 5GGSA 1FZOB 1ONQB 3FFCE 1DBJL 4MS8D 4YLCA 1EPFA 5J1TC 4X7SL 3DV6B 3OGCB 2BERA 4A2LA 3BWZA 1TYJA 1OV8A 4QO1A 3IMBA 1MAMH 2V7NB 5EZOH 4KRNA 1NUDA 3O4LA 1SFDA 1W6LA 5D55A 1E7VA 2MQCA 4ADGA 4X9GA 4PJAF 5L4FA 1FZMA 4I9XA 2A9DA 3IPFA 4MA7H 4ODHH 5EUOE 3HCVA 3WDHA 2EDQA 4OF7A 2EQDA 4HUVA 2YPKA 2RH0A 4FQQA 1AD0A 2DEXX 4IRJB 3S96B 5C0FB 1PSKH 3LXBA 4MNGA 2MFNA 4QXGL 1F11A 2X70B 2P24B 4XCFH 3V0DA 1UG9A 2GK0A 4QRRB 2K7QA 1JV2A 5EU3B 1MXGA 2K4AA 5BZDB 4OF3A 1JTOA 1QWHA 1LQSR 4A7UA 4B9ZA 5ICUA 4BD4A 2DQGH 3BKYH 3H4FA 4DH2A 3GSOA 2WBJB 3B7RL 3LDBB 4Y4KA 5IB5A 1HKLL 2YEZB 3QNXB 3FONA 4PG9B 4DSYA 4RX4A 1OOWA 4GYBA 3FCTB 5B38A 1CD0A 2VWEC 3DX2A 2HJFB 2Y7OA 3QIWA 4N9OB 4DCQB 1AMXA 3MNMA 1IEAB 3MSPA 4X99B 4ZDHA 5KSVB 1I9JH 4L1SA 3IFNL 1TQCC 4YHZL 1IFHH 1NMCC 2K8QA 1XF4B 2CAKA 2OYLA 3QPQC 2JK5A 2ZPKH 5HHMB 3OJMB 2R9HC 4ZSOB 3FU5A 2AMGA 4HF5H 3RIFK 3IU3A 3VXNB 1GZPA 2VC2L 4MJHA 4NJAH 3RFRA 5IV2B 1FZKB 1USQA 1LK2B 3T8XB 9PCYA 3OXRB 4XCCH 3CK0L 3PWLB 1BEXA 3IPBA 3H0TA 4AC2A 2NY2B 3MLVL 2AQ2A 4P49A 5DSCA 1RZKH 3H9SE 5A6MA 4AIXA 1OZUA 2ODIA 1RPKA 1SVBA 4FDWA 3CLWA 5AB0A 1F97A 4UUJB 1O9WA 1BX2B 3QI9A 1TCRB 5KBPA 4CA4A 2FEDD 1MCBA 3FTWA 2VSKB 2CMRL 3PXJA 3NJMA 2FNWA 3UAJD 2LU4A 3QDJA 2X0UA 5FF6A 3QZWB 2JELL 3EO9L 5F9JB 4M7LT 4U0RB 4GUOA 2AK4A 5GGRA 4LCVA 2DLGA 3MFFA 4NP4L 3OLDA 4WKZA 2FT8A 3QEHB 3PGCB 5DEFB 4JL2A 4XP9L 4ADIA 2G9HB 5IT2H 3O6FC 1E30A 2CNYA 1V3LA 2ADIB 1NGXB 1PLCA 3V9EA 4NN5B 1ZLSL 5L88H 4FQIL 2HLAB 4J12A 2X6UA 3GXTA 3ZGIA 4I4WB 2ZXGA 3FZUD 1FORL 4UT6A 2FGWL 3VJ6B 4Y4FD 5KZCB 3EYFB 5FHAH 3UTSE 5DVMA 2ADIA 3HI6L 3ARRA 1IIIA 5AZUA 4APQB 3WUWA 1CXIA 3MRCA 1HIMH 3HZKA 2H8PB 3D7PA 4QUOA 2EC9T 3QQ4A 3UZEA 1DYZA 2R29L 4HS3A 5JHDE 4I9WE 2V3EA 1LO0L 1CE1L 1QA9A 3EAKA 3P1VA 4G6AD 3RURA 1YN6B 1AZRA 3QHFH 1UXWA 3PQYE 1KNOA 4U33A 1NGYA 3AGVA 3O6ML 4JPKH 2A6JA 5KJRH 3HZ3A 2YLHA 4G3YL 2FLRT 4KDTA 3VB8A 5D8JH 3WFHA 3OKDA 4XMPH 4N1EA 2YQGA 5HYJB 4B41A 4CNIA 2ICEC 1HX0A 1PKQB 1ACYH 4FYSA 2XWBB 2X2UA 4R5VA 3HVDA 2ZOWA 4FXTA 1ZD6A 3D12B 1HXYB 4KKBD 2V3DA 5AOIA 3IJEB 1UA6L 1IGJA 1HEHC 3NEOA 4F2FA 2BX5A 3A24A 2FUTA 2Y7LA 2WZ6A 3IJ9A 3EUUA 5B1JA 4ELMF 3DVIA 3V0WH 1AZVA 1ETJA 1H3PH 1I9IH 2FK9A 4WU7A 1FL6B 2QZQA 4XBEH 2ENPA 3TP4A 2R59A 2V33A 2X6MA 1X5YA 5EC2B 5F7KC 4AZ8B 2EECA 3WTTA 4MASA 5I1LA 4HJ1A 4JFDD 5IWLA 2CNZA 2IAMB 3BISA 1O5PA 4HMEA 1OP4A 1TTBA 3C6LB 1XBRA 1IBYA 5HHVH 4JHWL 3FCUB 2VISA 4NPYB 4FHKA 4MNHB 4OFYD 1D5BA 5EOTA 3OKEB 1O7DC 2X4TB 3GHPA 2ZP9A 3QXAA 2VSMB 3HC4L 4QHNB 2YXMA 4XZ4A 4LL9A 5J1AB 1XB6A 1KDJA 1ED3A 3NJIA 5DWUL 4BDVB 3D8MA 1PLBA 3AWEA 3IDJB 5DHMC 1UWXH 1E0OB 2MRYA 4P9HL 5EN3A 5TK4A 5JW5B 1G6RB 1WUZA 1RKRA 4F7CB 1LO4L 1DSFH 4KUCF 4P04A 5ANHA 5E6IA 3ARQA 3VUAA 4A7GF 3VQ1C 3UAJC 4MYWB 1G1KA 1T66C 3Q1SL 2AK1L 1JGVH 2ZOOA 5DUBA 3RDTB 3VXRA 4MNGE 4PYGA 4KY1H 4P2RE 1DVFB 1WISA 3NZHH 4XAWH 5FLUA 3VSQA 3B1TA 4K7FA 2BHYA 4UM8B 5C6TL 3L5WA 2P9RA 1I3VA 3EH5B 4XNMB 3SE3C 5JHBA 2FT6A 1FNAA 4MNQD 3VG9C 1UATA 5ADOL 2A9AA 1J1OH 4HC1H 1YVLA 5AOKA 4KK9D 1T0NA 4F2MA 1OK8A 5CCKL 1X4XA 2WKOA 3CH1A 1T1YA 3AQYA 3MRBB 4FTVD 2VXUL 3CD4A 1CB4A 1G7JA 3FUJA 4AC4A 4ODXA 6PAZA 2YMXL 3I6GB 1N0XH 3RVXC 4QRFA 1WFMA 2ATPA 3EYUH 1J5OL 2AEQL 3BWAB 4M61A 4P2QD 4X9IA 4AJ0A 2IPUG 2H6PB 5GIRA 3PDOB 2BNUB 2XWJA 3CU7A 4ELDA 2E3VA 2BNRB 4NQSB 3MRHB 5EOCJ 3QFJA 2A4ZA 3CZJA 5AW0B 3RWIB 2K78A 3ZRCC 3U7YH 5J0BA 4L18A 2MKWA 1FYTD 2XXGA 2EXWD 3FSAA 3CVIH 2VLMD 4GKZA 5F96L 4Q9RH 2VR8A 5IEHA 4POZD 5HHOE 1ETA1 3ECQA 2QLYA 3CIAA 2ZOLA 4WUKH 3OX8A 2AEPL 1LO2L 1G43A 4HALA 5CD5D 3P4OB 2XWDA 3KLSA 5DI8B 2WYHA 4N0UE 3E9TA 4PCYA 3T2OA 5BRQA 2YBRB 5LGJA 5I18L 4W6WB 1DBMH 1TYEB 1YAZA 1P4LA 3AS2A 5C97A 4A7VA 5HXMA 1CGWA 2GUYA 2CDEA 1SMOA 1Z0NA 3QHTC 4FTVE 2R2HA 2XCMC 4DP5X 3L9RB 5MEOB 2J5WA 1D7FA 1KYDA 2B8OT 4X6CB 4XMKH 5E94A 4BWWA 4Z7UF 3ZT5A 1YPZA 3WGVB 3EH3B 1FH5H 4LEOA 1X4ZA 2LE9A 4M3JA 3OF6A 3WO4B 1RIHH 4M5YL 5EZJB 3FB7A 4P3DA 4O02B 2FJFA 3GSUA 5D7IE 1TR7A 3RTLA 3HJEA 1F86A 4ELMA 3EJSA 1AXTL 1QSEB 1QEWB 3CHOA 1I7RA 1JBJA 1KGCD 2Z7WA 4LEOB 3R8BB 4ZDHB 4AG4H 5KSVA 4EPSA 2P8LB 3S3SA 4DGWC 3FCTA 1G9HA 1KBBA 1EFXA 4N5EC 3FTSA 4PWGA 4LPTA 1BVLA 1TJXA 5AZ2L 1OCRB 4HK3J 1H6UA 2F19H 2PW2B 4F7EA 2EH8H 5DMYA 3DPDA 3EYQC 2X1QA 2WXNA 2IANA 4FG6C 4WI9A 5DJZB 4GRLA 4HCIA 4XZUA 4ZOAA 5GRVK 5HDLA 5ECGA 3DV4A 2RMNA 3V52H 4WI5A 5F7LB 3ZR5A 2F9BT 4BA8A 3UYRH 3PP4H 1J10A 1CMOA 1ES0B 2IO5A 3QUKA 5SWZD 3G5WA 4LQFH 4NUGL 1QTPA 3STLB 2IGTA 3IMUA 2D73A 3BKMH 3SE3A 4XO4A 1MFEL 1QWUA 1W72B 2QGBA 4UIMB 4Y19D 4DIXA 5J11C 1B3JA 3Q9PA 5E2TH 3R4DA 4XN5A 3S34L 4AYGA 1FGNL 3MGAA 1PZBA 3REVB 5JIQA 3WXWL 3TIEA 1QSZA 2QSVA 3MC0A 3UADA 2WBJD 1BD2E 4N1HB 3Q01A 4P2CG 2FJHA 4L5FL 4FFWC 5DJXA 5GXBB 4MDJB 4JQIL 1NAMB 5E99L 4BZYA 1UZ8B 4PJ9B 4YEFA 4XC3H 2BSED 3S7GA 1A4AA 1JVKA 2XZAH 5D7KE 2Z91B 1EEZB 4IOFC 4JEGB 3SODB 3V4UL 2MCPH 2C1OB 1K4CB 2RR3A 2X9ZA 2UZIL 4L8SC 1AC6A 1SYVA 5DJXB 3G6AA 4C55A 1G7QA 4JJ5A 4H8WC 1EJ6A 3IU4H 4D94A 3DIFA 3KVDD 4PLJD 1D7CA 4XCYA 5IHHA 3OMZA 1SJEA 4PQXA 2LVEA 1CXKA 3T6VA 4Y5VA 5DUPH 3D3VE 4FHJA 4QHMA 5FW7A 2Y1YA 1OVZA 1YRKA 1RUMH 1XR8A 4FOMA 2BP0B 3VXUB 4KDTC 5D9SA 2MKLC 1MAKA 3MLXH 2CCWA 2ZNXA 4UT7L 4AJVA 3GM0A 4BM7A 1YMMD 1C5DA 1U3HB 2DEWX 5L7XH 3FTZA 2ADYA 3KEHA 2YPKB 4FQQB 5IB1A 2M83A 3AY4A 4YHPB 1MRFH 2W92A 5HDBB 1WAAA 2MQ3A 3IJYB 1M4KA 3HRZA 1AS6A 2N7AA 3D5OF 3Q8FA 4K3EH 3JV5A 4MNQB 4R7VA 1X5XA 1UH3A 3O6LH 4OD3H 5KVGH 4RMSA 1JPTL 2E6QA 2OYMA 1U3NA 3S5ZA 3LRHA 4MS8C 1GGCH 5CGTA 5FKAB 3ARUA 4K94C 2B14A 2GSMB 2J8UA 3VSTA 1NIDA 4F8NA 1GGYA 2RB8A 2IPKB 4XN9A 1HJBC 4XMWA 3QXVA 1QTYT 2NY3D 2J2ZB 5E1AA 1KB5B 3K71A 4AQ8C 2KPWA 3L3DB 4L4VA 2BWIA 2YOAA 3N5AA 4GQRA 4NWTL 3T4AC 2CIKA 4O2EB 5JHLA 2C7UA 1BD2D 4XCNB 2F1BA 1BBJB 4LL4A 1BQ5A 2P5PA 3KXFD 3EFOA 1X6LA 2VR6A 3CBRA 5ANMB 1NCTA 4R2GC 4G43B 3ALXA 4TL5A 4DKFL 3MV01 1OTSD 4D0CA 3NCYS 3LZNA 1F45A 4N2HA 4P4KD 2G4EA 4AEFA 2AJYH 1L9SA 4GBXD 4GP5B 5F1IA 3K71B 3GSRA 1KGJA 1R5WB 1NBZA 1QLEB 5CKGA 1WZLA 2JFCA 5IBLC 3B8YA 1UACH 2Y5QA 3WHE0 3TVMB 2HRPH 3BUTA 3CVHL 4K71B 4JNXA 1A4JA 4U1JB 3UZVB 1IC5H 4ODUB 4BHUA 5CEYA 5E1QA 4LCCA 3U46A 2KDGA 1MW1A 1Z5HA 5D5MA 5A7EA 5AW1B 4OIIH 4Z0BH 5CLZA 5CP7B 3ZE2F 4ELKA 3IFLH 1TQWA 2DKSA 4RMQA 3SJVA 2EICA 5J11B 4GG6F 3K4AA 3NH7L 1IEBB 25C8H 3R0NA 2BHUA 5BJTB 1EDYA 3D69A 5BVPH 1RD6A 4LSPH 4ZO6A 1NBZB 5C0IA 1AGFB 4U1LA 3A6CH 3BIBX 1HINH 2BCKB 4Q14A 3B2MA 4BKLB 2VZOA 2R0LH 2ZSWB 3W11C 3ZX1A 5MP6L 1OGAE 3RU8L 2WK2A 2PYEA 4WEUD 3T1FB 5EBLB 1N59A 4HJ0D 4Q9CA 4ZFGH 4YDIL 1QKZH 3QIUB 1XF2A 4DK6A 4ZXBC 3MLZL 4AEHH 4ICWA 4L0PB 3TF7C 3GMNA 1AANA 2P26A 1A22B 5E0QA 3ULUC 2J6EA 5F3BB 5KS9A 2VE6A 3LKNB 4GW4B 4Y9FA 4AQEB 2HMID 2O61A 2C1OA 1J48A 2B3IA 4JFHE 4WWKB 2XQYG 2QGCA 4BQ8A 1HHHB 2AZAA 2R0KL 2R0WL 2YLKA 3ECBA 5LBSA 5C0GA 3S35H 1SOKA 3CFEA 1T4KA 1DQMH 2DQEL 4QRQA 4OVUA 3TC9A 4Z3GA 3GSNH 3ZY7A 3QQNA 4YK4C 1R0AL 3BW9B 2IWGA 1RZJL 2X4PB 1WFOA 2ALAA 3DSFL 1F6FB 3QNZA 4GUPA 1RURH 5L9DL 3DX8A 4KNQA 2W9DH 1TJHL 1LM8V 4XMXA 2IH3A 3SE8L 1C5BL 4DKEL 5ABDE 3KDMA 2C8NA 3GI8L 3BVNB 4BFEA 1PIGA 1HL9A 1PVHA 2W5PA 2VR7A 4MZRA 2NW3B 2ZAGA 5EF3A 2IF7A 4X5XB 1WV7T 1RZIB 1UJTA 1MFCL 2AV1A 3MX0B 5SWSA 3OB0H 4X6CF 3KPMB 43CAA 3WELA 3E3QE 4PGDA 3S36X 5T3XD 5ENWA 3AXLB 2W0FA 4N2KA 5TDNB 3ATEA 4UNVA 1SXAA 3Q3GB 2W88A 4IGBA 4OSUH 3KG5A 4WI2A 2YOCA 4LIQE 4QRRA 5IEKA 3DX9B 1FBIL 1TQBB 1MKFA 4W68A 4I18B 4G9DB 1UOVA 5CSZB 1ASOA 3KGSA 2DJ4A 4MAYD 1A7OL 1MFAL 1MREL 2WLNA 4N90D 5KYUA 3I75B 1MUJB 5KVGE 2JKNA 4WCYL 4HPHA 1XSKA 3ZDWA 1FLRH 3BMVA 3C5SA 2L7UA 3P3TA 1WQVT 3BUIA 5FA3B 4ENED 2EDWA 3DSNB 2NYYC 3C8DA 3ZE2E 1QRND 5E23A 2C7UB 3GBMH 1C16A 3DHJA 1KPVB 5ENWB 3U2IA 5H94A 4IW4C 4JFXB 4OCWL 1VFUA 3LEVH 4B50A 5GS0H 2O5XH 3BKCH 1DP0A 1GC1C 3WLWC 4DW2L 1ZLWH 5I17B 3BYTA 1RZGB 2L0DA 3CIQA 5CSBA 2R1YA 1A7PH 1A5FL 3T71A 3DUHA 1FL6A 2WLZA 3FTGA 3FL7A 5F1SA 1OM3L 1JZHA 2DTMH 2IGLA 4OF0A 3VFNA 5AAPA 4R97B 4QF1B 3L4YA 3M6DA 1JAEA 3OAWA 4ISVB 3EOTH 1QLFB 4QRTA 1ITCA 2VITB 2BSCA 3U30C 4XXWC 4ABUA 3LQZA 1NQBA 1AKJB 1HEZA 2OKMA 5IB3A 4P2OD 3WLBA 5L6YL 4OKVA 3O41B 2XWXA 3Q2LA 1XD0A 5C7XL 1B90A 1K85A 1U8JA 2WUCL 3IGAA 4JCWA 1FNFA 1ANUA 4HQQL 1NCWH 4MMYA 1Q1JL 2WO4A 5I15L 4HLZG 3LKRA 4JPVH 5BVJA 1K6QL 3VU2A 5C07B 4DETA 4ZYKA 4XNYL 1NDTA 1XGRB 5FK9A 1CFQA 1JI1A 1TG8A 5IOPA 5EBLA 3WFCL 4NSKB 2DQCL 2ID5A 2PF6A 2PR4L 3RIFF 3ME0A 5GGTL 4JFQB 5L2JB 1S7TB 2Y7MA 4KXDA 3L16A 1T2QH 1N64H 1NM9A 5FCUL 5J9PB 3TEXA 1QUNA 5DJ8A 4Y5XC 4ODBD 5HP5A 2ZUTA 1H3TA 1RK1A 1SM3H 1T4WA 3AT0A 1DJZA 5HGDA 4JE4B 1HKFA 4GSDL 2CXGA 5K1VA 2HRLA 1WZMA 4G71B 2N1TE 5FM8A 4Z3JA 5MERA 4E68A 2ERJC 4QKTA 5FO9A 3HAEA 1WEJL 4YWGH 4P46B 4W9GC 4NERA 4JFQA 3CFDB 4R90L 2ZSVA 5IW6B 4QWWC 4Z7AA 1DR9A 2AANA 4FXKB 4OB5L 5FA4A 3G5ZB 3U2SA 3DPBB 3ZQXA 4AVKA 5DHVB 2AFNA 5LWYL 4GS7B 3FO9A 4G1MA 4NFCA 4TNWK 5KSBB 4AYID 1KTKE 5CGBA 3BGFB 3UYPB 4FI7A 4AQ8A 2DWEA 2J6EH 2DLTA 3WMQA 4BXSV 1DBBH 4PJEA 1DE4B 2JCCF 5HY9B 3KCWA 3SPCA 1RJYB 3JWOC 3H42L 4U05A 5C0AD 1F02I 4M8VA 4F7EB 2B7DT 5DYOB 4LHUA 4JKMA 3P9LB 1XR9B 2GK2A 5D71L 3WAKA 1ASQA 1C12A 4YE4H 3KVQA 4K5LA 2JV6A 2BC4A 2OL3B 3U7WL 1U3HC 1BYOA 1IAII 3PJNA 3V0HA 1CGSL 1SDDB 3V0VA 3WY3A 3H7LA 4ZUSA 3H53A 4XOCA 4FFYL 4QLRA 2JK5B 3QULB 3VNZA 2BNQD 2HUHA 3ECWA 2WQWA 1I31A 1BXVA 2OI9C 3VMPA 3ARFD 2G60H 4NQEA 4MA1C 3ZTCC 3UC0H 4L9LB 3QFJE 3V0VB 4NM4H 4PLKD 5KSAB 5DHXB 2NUTA 4G70B 5GS1A 1PLGL 3T0AA 1AGDA 3OVUB 3HS0C 3QDHA 1L3WA 3L3JA 2XKSA 2F1AA 4M7ZC 1OLLA 2ZX5A 1BAFL 5LDUA 4LSSH 5ID1B 2BFVL 1PLAA 3A4EA 3RY6A 4DF9A 1LO5B 3IFPA 3ZTJH 4HLZH 3QA3B 5I76A 5CZXC 3KD4A 4MS6A 2E74C 4YDVA 5CUSL 5AOZA 2VLKB 4PJ7B 1JNHA 3SZ6A 1W72A 1HXKA 2N4IA 1B4RA 2P3YA 5AAWA 2W0LA 4O4YL 4Q4EA 1YEDA 2V2WA 4HGKC 4PRNB 2J1KA 4YLQT 5MEPA 2VDLB 5AVYB 4LKCB 2PN5A 5FB8B 2P8PA 1MJJA 1NFDB 2GSGA 5INDB 4PVNA 3BO8B 3STZB 1U8JB 2OJEB 3FQTB 4YFEA 1HOCB 4GBXB 2ZYSA 5F0LB 4BA0A 5FO7B 1JHTB 3RUGA 4E0RA 4XWOD 4IBZA 3QQDA 1NAMA 4LAQL 4G8FA 4PJBE 4GRMA 5EIIG 2RQ8A 1GY1A 4O02H 3B9AA 3MV8E 4UT9L 5LAXB 1BVNP 1KB5H 4MFHA 3UDWA 3N85H 5EO1B 3NJNA 2ESVA 2R4SH 2VDLH 1LLAA 4LCIH 2E27L 2BSBA 2UXFA 3CC5B 4FZEH 4NM8L 4G6KL 5AKTA 4AW4A 2CWRA 1WP6A 3HE7C 4CSSA 3FN3A 5TF1L 1FZMB 5DK0B 35C8L 1NCJA 3L3OB 3I6LD 2H0JA 2OYKA 1TQCB 2WTRB 2Z92B 3WTYA 4YJZL 3MRPB 5A2BA 3TT3H 4R97C 5EV7A 3RQ3A 3RWGB 4X5RA 1YEGL 3BZFA 4JREB 4MZIA 1U91A 3MRKB 3ULSB 5I8CB 1N6QH 4HOMA 2APTA 1BOYA 3VJ6A 2BPBA 5IBTL 2NY5H 4FXLA 3KLAA 2CHWA 5JXEA 2R2HB 2ZTBA 3QUGA 3VFWA 5DMIL 4AYSA 2VLME 3O9WD 3DXAB 4LU5H 3N55A 2CR0A 2YD5A 3V6ZA 3S2AA 2DLEA 2AV7A 5CJBA 1OARH 1RUQH 4C57C 2Y1VA 4CW1A 4PRPB 5L2KB 1JPST 3PAZA 2FHCA 4N3UA 5IBUB 3UJJH 5LQBL 3DX9A 5CSZA 4WHTB 3MRDA 3O3DA 1BMGA 5KTEH 4JVWA 4W9FC 5I1LB 1PZAA 3ZL4L 5BRPA 1CICD 2FHFA 1D5MB 2VDPL 2WLYA 3KW7A 5GRYA 2NYZA 4Y8AA 4J7RA 4KKNA 4TSAL 3FMGL 4NBXB 2FQFA 1U3ZA 3QAZC 3RWEB 4LARL 1QNZH 1RIVH 3CGTA 4NENB 2ZXBA 1K5NA 1JZ7A 1TKWB 2XV2A 3HFMH 2AV7B 5EU6D 3QUZC 5L8LB 3O9WA 3WV0A 1KB5A 3OGOE 1M6OA 4TN9A 3ZDXB 1AQKH 2JJSC 2AJSH 1M3JA 1WYJA 2OP4H 5H37A 3UTSA 1VADA 4R4BA 5KVFL 2VRQA 3MU3A 2DMBA 4HIEB 4P5RA 3FU8A 4P48A 4L29A 3MRRB 1J7VR 1Z3GH 1N5YH 4HYTB 4QRAA 4ZMTA 4H2AA 1Q0XL 2MEJB 5IF0A 3QIWC 4JFFB 1T5XA 4O51A 4PGBB 4EI0A 3WCYA 3KMDA 4GG6B 4J3OH 1T1WB 5DA0B 3VFMA 5BZZA 3HTLX 4L3EB 3SQOL 1I1CA 4P4KC 5HGHB 1XGQB 2OR7A 2QR0B 3LHAA 4G59C 3S35X 5DD5H 3V4VL 3PHSA 1G7MB 1RVFH 3IGLA 5GPRA 3RVTD 1PD6A 3VMNA 4S1SL 3IPEA 3EUDA 3JV4A 3NRPA 5BCAA 1HHKB 4QLWA 4UANA 4ODUA 4PY7A 4XNXL 5IB4A 4U6VL 1BP3B 1HILB 4PJGB 5DVNA 5CBAA 2WLIA 5GZOA 3WO3B 4WU5B 3HKFA 4J1UA 1LL1A 1DSYA 3KGUA 1Q0YL 3BZEB 3RUGF 1IGMH 2HX9A 1Q8MA 1E8WA 2OMWA 1HTYA 2NY4D 1GOHA 4XODA 3QDGB 1JD7A 5D7IA 3WIHH 4E5XB 4RGNB 1DLHB 3HG0A 1KIQB 4HWEL 4JRXB 1DVZA 4YXLL 1BYNA 1OSZB 2Z4QB 3QI9C 5INDA 3CFEB 4JFSA 3FT2A 4ZUUA 4EE2A 3PE9A 3OBAA 4UT6L 3AM8A 4LNRB 2JKIS 4PJ8C 1ZHNA 4FZ8H 4XNUL 3W11D 1TENA 3FHQA 2XA8L 1NCUA 3EKCA 4DP6X 2UWEB 5GGRB 3EBHA 3DWTA 5EHFA 1QO3A 5M94B 4HT1L 1YCSA 4YMPA 4XNMA 5G2NA 1I8KA 2G9KA 1E8ZA 1T1ZB 2Q2EB 4IKIA 1FG9C 2JTYA 1FHGA 1QMUA 1NMBL 1HYSD 4J27A 1Z5LB 2JKLA 3IXTA 3O4OB 4UQEA 3CG8A 4U4IA 5CMAB 5J89A 3F8UB 4TQ8A 4G82A 2WXLA 5JQIB 4ES9A 4FI6A 4F37F 3SKMB 3T0XA 1T1ZA 3TESA 4JL1A 4QRQB 1MW3A 1TZHA 4B53A 2R23A 3ARBB 2I60H 3UYOD 4G7YL 4H5SA 4PBVC 1LK3H 2W81C 3MNDA 3OHXB 5IESH 5F6IB 1U8IA 5ABZA 5HGDB 1RJYA 4HD5A 5JUEH 4JFVA 4Y1AB 2OV0A 4P59H 5DRNB 4LDOB 1KEML 5D7LA 3NZ8A 2FSEA 5FYKE 4LCWD 2HVJB 2ZUVA 4YGAB 1NFIB 4WW2F 5JLZB 1KNOB 3CC1A 4P5MA 1NGWA 1H0DA 1JV5A 2DQUL 1WFNA 4M56A 1E6OH 2R1WA 4NBYB 4IJTA 4U31A 2N0MA 2PLTA 1DTUA 4KI5D 2PW2A 1LTXA 5FECA 4OGAC 3LH2L 2J8OA 2MIZA 4EEEA 3H6JA 4P2RA 4I0PD 4XNQB 3HI5H 1CK0L 5JMRA 2XN9B 4H1LB 1B9ZA 3MGOB 2FSDA 3PJLA 2R1WB 3S48A 1EVTC 2YAQA 4PGCA 1AZNA 5IJKC 5A1AA 5D1XC 4YOKA 4FQXC 3MRNB 5FYKL 2WINB 4OLYH 3DYMA 4Q52A 3FQUB 3MN8A 2FJFB 3GSUB 5EF2A 1ZCRA 2W80C 1VRSA 4E41D 4BINA 5ILTL 4L1BA 2GEQA 1NLBH 2C34A 1WWWX 5EU4B 1CXFA 1R5IA 1T7XA 1EZVX 5GGRY 5SX4H 3QWRA 2JCWA 3EOAB 4HIEA 1MCOL 3MRFB 2WBKA 4GMTL 1YEEL 5EBWA 4JO4L 3LQMA 4AX3A 2DY2A 1OT2A 3SYPA 2B59A 2V8LA 1RLWA 2EKSA 4GW5B 4FHBD 5GQBA 5JIHA 3A47A 3FOLA 1TFHA 3DA0A 4WFFE 3ISWA 5AW8B 4JM2C 3SYOA 1NCBH 3QGVA 1TEGA 1HI6A 3PGFH 1J8RA 4X50A 2EKSB 1K8IA 5IROA 4L4TE 1I8IB 1M53A 1A6VL 3QR1A 5CU9A 3ELQA 5IB3B 4FJ6A 4G6AC 3V0FA 1JCVA 3U0PB 1MJJB 1NFDA 2GSGB 2P8PB 4NKIH 3CQPA 1UM5H 3QS3A 5F6HI 3A23A 2W60A 3FU7B 2WXQA 1AJ7H 1J0YA 2DQJH 4D9RD 3T2NL 1YNLL 1PY0A 4MJIB 4RBPK 5FYLD 1TTRA 3B3IB 1V3MA 5AW2B 2F54D 2J1ZA 2ZG2A 3MXWH 2CHDA 2O5YH 1NPUA 4PG2A 3H9YA 3RLSA 3IGAB 4E9VA 2BY1A 4IKLA 4JO1L 4QGTA 2ZJSL 1P4IH 1MNUH 1X9RA 1OIOA 3D05A 5EEYA 2P80A 2UZPA 3BUYA 5IK3A 3U9UA 4NJ9L 3TA4D 4JFPA 3ARED 3RX5A 4GQ9L 5JR1L 1N10A 4BKTC 4TMPA 1AD9B 2VLJA 4KHXH 3QJVB 4XMZA 3RY4A 3ZRSA 1U3HA 1THAA 2WSPA 3OKKA 1XH1A 3EXJA 5GIRB 5F3HB 3FB6B 3HIZA 5I8EA 3RVUC 3DJSA 4FP8L 2APFA 4HIIA 1JNLH 4GRWH 2Y3AA 3RY6C 2BIPA 5GRUL 1YDPB 3ZUNC 1XTLA 2HWZH 4YHKH 5EO1A 2PWDA 5J7CC 3HB3D 4UTAA 5F3HA 2JJSA 3WKNA 4DVRL 1CG9A 4LFHD 4QT5B 4JW3A 2CIKB 1L7TH 4KX9A 1FF5A 4OFVA 5F1NA 1IKOP 1E2ZA 3MODL 4POUB 5AW4B 1VKXB 4C58B 2FX9H 3FFCD 3OGCA 3GMLB 4BFKA 1QVOB 2NY6C 4NQXB 4NO3A 5IHUH 3WY2A 3H54A 2FRGP 3ABMB 3KPNA 1OP3H 3QCVH 4L8BA 2HH0L 4CSZA 2B2XL 1Q94B 3TTYA 3Q05A 1KTJA 1F4XH 1R3LA 1O5DT 3V4LA 4AITA 3NCCB 4AMKL 5T1KD 3U1SL 1EMTH 3C60D 2EE3A 3IJYA 1KCUL 3A21A 4BZ2L 5FS5A 4M1GH 5HYSA 5T1MB 3RX8A 1RUKL 2CKBH 1DL7L 4KTEL 3NCJH 4U1HA 4BH7A 1TZGL 1RJZA 4KX7A 1UA3A 1KBVA 2VDNH 3CSGA 3HA0A 4PIBA 5CP3H 3RHWK 3WYRA 4GAJL 1QTSA 3LPWA 5TQ0H 3T3PE 3O4OC 5HGBA 5I28A 2P8LA 5I1KL 1AIZA 3CDCA 3P3YA 2PYFB 5TFSH 5IIEB 4XGZA 1M9WA 1NCCH 3HR5B 1E28B 1P4BH 3LSOA 1CU4H 1HCZA 4G80A 5ESQA 4OZGA 3MGTA 2DWDA 4L3EA 3BDBA 3SDXF 2AQ3A 4PLOB 5A16A 4KKCC 1XEUA 3FCSA 1XCWA 1MJ7H 1UM4L 3MRFA 4MSWB 2F5AL 1QFWI 3LPOA 3F2LA 1E67A 3TN0B 4Z77A 2W9EL 3LB6D 1SXBA 5J5EA 4RWYH 1LEKA 2WWKO 1GGBH 4EUPB 2DLFH 4KQ0A 2X6CA 3GGWA 1TO4A 2XV3A 3LKQA 2Q3XA 3OQ3B 1WJ3A 1M7DB 1AOHA 2Q7YA 3FT3A 2CA3A 5EPMA 1S5IL 2YMOA 1ZT1B 4PJEF 3SJVB 2PCPB 1U58A 3NIFE 1M2OA 2QSCH 4HIJB 3QVAA 2GJ6D 2IPTL 1BJMA 1YQVH 5GJSH 4GAGL 1KIRB 2WNXA 3PWNA 5DT1H 5JOFA 4F15B 1U92B 1RZ7H 2FX7L 1QSEE 3ARBC 3C87A 3O6FB 2NY1D 3WFEL 4YBQC 4NQSA 3VI3A 2QADB 2X7LA 4CMHB 4LSUL 3ZJAA 3HZKB 3TZVD 1A7NL 3MA7B 1PCSA 4L3ED 5EFIB 4RRPA 3M88A 2OMZA 4YHNA 2EIJB 4LLDA 1SLWA 4WY7L 2XZCH 4H8QA 2X44D 5J12B 1L6PA 1EANA 1XVSA 4ADJA 3QRBA 3QBTB 4AGLA 1UB5A 3L2NA 4WJKB 1PAMA 3VWKD 1FL3B 4JFWA 1J9SA 4FKEA 3OMAB 3X14A 3BRGC 3QR0A 4GFXA 3SO5A 2FBRA 3X3GL 2J4WH 3CVHB 1U6AH 2X7LB 1G7HB 4L4VB 3K6IA 1N8OE 5DUMH 3RL1B 2NY4B 4L05A 5C92A 5KW9H 4KK5D 2A6DB 3WNKA 2FO4A 2KDYA 3QUMH 4P2OA 4BSVA 5CCGE 3BEVB 1SVZA 4NQUA 1FGVL 2DM2A 2H0PA 2VH5H 4XO9A 4M6OH 2HVJA 2PTUA 3K2UL 1OGAB 1L9RA 1AXSB 3O0LA 4XP1H 2DQIH 5CIPB 1SFHA 4P3DB 3AY4C 3ZKXB 4GG8B 5AB9A 1DQTA 1OPGH 4OCNC 4OFPA 4AE0A 2VN4A 2AC0A 4OZIE 1TVDA 1A7QL 1X5GA 5A2KH 3F7YA 5H94B 5B39A 4H4NA 1PG7X 1AO7E 1XR9A 2Q86A 3IM1A 2D2CC 2VDPB 3MQIA 2FWLB 2WXFA 2QVMA 3S8WA 1LE9B 5C2BL 3E2HC 4OD2B 2YAPA 1TITA 4PJEE 4AW7A 4QXUL 1E5YA 5JXAL 3QO1B 3QG7H 1F4WL 1AXSA 4QAMB 5E5MB 4ZI8A 2ODHA 4JFED 4DT2A 1YYLL 1TTCA 1NKOA 4PV9B 5IEKB 1YHPA 1L9MA 4UM9A 3B2XA 4A6YL 4OT1L 4F57H 4R8WH 3C9NB 1N7MH 4TLSA 3FUDA 3U1PA 5JIIA 3FW6A 4ODSL 4MA3A 3RJDA 2BDNL 3A5VA 4N9GB 4G8GB 3SDXA 4PWIA 4RDQG 4JGJA 1BFOA 1OL0A 4F37K 2VTFA 4CGTA 1K9TA 3QUZD 3RTQA 3CUPA 3VW3H 3C9NA 4IGBD 3PWPE 1A64A 1IBGL 3UBGA 3GBDA 3LZFH 4PP2B 1J86A 2DIBA 3SDCD 1FNSH 1BZEA 5B1BB 5ABAA 3U25A 3QWOA 1ZHBB 2VXVH 3DSNA 5LB1A 3MMEA 15C8L 1RZQA 1U33A 2P1YA 4L4JA 3N91A 2X09A 3IU3B 3QQ9D 5L4MA 4R0LB 2FATL 5ERWA 2FWUA 4RAHA 2H26A 3P9WB 5A2AA 4MCYA 4XO3A 2Z0BA 3AUVA 4DZBB 4N2MA 1JL8A 1AMYA 4IOIB 1FNEA 2YGOA 4O2CB 2AQSA 2KI6A 3T9WA 2VQ1B 5FUCC 3TZVC 3OAUL 3RVTC 2KYIA 1ZLDA 3OM3B 2EH7H 1HSAB 1JPGA 3LD8B 3FT3B 2PXYD 1KFAH 2M26A 3O6KL 4JFPB 3EFDL 5GS3A 4R4FH 3UTOA 1R5VB 5CINL 1F18A 3EH2A 3WEOA 3FZUC 5CCHE 3IDIB 4OAWB 4GJTB 1FDLH 4PTUB 5F1OB 4UMSA 1KPRA 4DP2X 5DD6A 3T6WA 3H9HA 2X9WA 1TJGH 4KMTH 4W70A 2E9BA 2XN2A 3V7AG 1NGXA 3KLDA 3MOBL 4RGOH 1IC0A 3FO0H 3FU7A 3N04A 5FAAA 5C07D 3FO9B 2XC8A 4D7BA 3ULUH 3OXSB 3D39B 3P77B 4L3AA 1RHHB 2HKHL 2ENQA 5HJ3B 4B9CA 4IKJA 4XAKD 2BP3A 1NGWB 4WVRA 1Q9KB 2E47A 4KRPD 3L5XH 3FO1B 4G7QB 5D70H 4Z7WB 2WP3T 1BZ9A 2IH9A 2Y06H 3VX1A 3CXFA 2RALA 4FQPA 4LBEB 3RE0A 3BQUC 4NHCH 1R6VA 4KDWA 3OHXA 3EJUA 1UM6H 2QEJA 3SJVD 1JPFB 3MLSL 1BVLB 4YX2L 4HUKB 4AUUA 2VM4A 1GC1L 3M1CA 1CF8L 3HPLA 4O58H 5B1KA 4UTCA 4E9LA 3BE1H 4MDIA 5KSUB 2ZWKA 3UGXA 3IB4A 4UZGA 2PABA 1OAUL 5LXGL 3BVDB 2RHEA 3CZGA 1ZJAA 3GB7A 4ONHA 1U3YA 4X7DC 3ESMA 4ZX6A 4OLVL 1BSIA 5KVDL 3S5YA 5JHLL 4HGMA 5GGQH 1N6VA 3PL6C 3MRMA 5DJAB 4IMKA 1S7VA 5E24E 5CEZL 2H2PD 4FABL 5DS2A 1ZV9A 1OCWL 3TBYB 5EIVA 1REIA 3ZQWA 4AMXA 4YO0B 4XB3A 5LBVA 4ZMAT 4K55A 4XVOA 1D5ZB 3C09C 3BX7C 5H4YA 3HC3L 1EQWA 3D0VA 4MYPA 2FB4L 1VEOA 3IDGA 5EU6B 2L8AA 3ZT6A 4L4VD 2N1KA 5FPIA 5JA9A 4EVNB 2WTPA 1TVBA 1LO5A 3L1OL 5T1LB 3GJFH 1JN6A 1TMQA 1KLFA 2L4OA 3FQUA 4MNHA 4WFEE 1D5ZA 1ZGLM 3FO2B 4FG4A 1E4XI 4ZAKC 1WIUA 5IG7B 4ERSH 1BBDL 1DCLA 2R1YB 3NBNA 1BECA 5IVXF 3Q8CA 5IHLB 2P5ED 4DO4A 5IFHL 1ND0B 4NPJA 1SLUA 2I07A 1SYVB 3H55A 3FTGB 5JDJA 1J05A 2H1LM 4L37A 2EUVA 4WU5A 1JJUA 1GGTA 2VLJD 3B2UC 2BS8A 3K6DA 4X7EC 3SKUD 2BXZA 4ZG1A 5MEND 2CBPA 4DKTA 5DS8A 1YMMA 1U8NB 3SYQA 5ITBL 1MG2C 3ZDZB 3GBNH 5SWSE 4EO5A 2OL3H 4UTBA 2H9GB 4H20H 4Z7VF 3KWUA 1GSMA 4J3OG 4NZDA 4PWEA 3QDGE 5GS1C 3DURA 2K3HA 2XKNA 1MAJA 3M17B 4HWUA 1D7DA 3CCHA 2BW4A 1BJ1H 4RAUA 1KCKA 1TTGA 1CXEA 3FN0L 1P5UB 4FRWA 4ZMVA 3C2AH 4M8UA 4H0GA 1IAMA 4Y2DB 2FZ3B 3BVUA 1UZ8A 4C4KT 3LIZL 1TPXC 3LKPA 3UP1A 4LRNL 4U3SB 4RLDA 4J39A 3C8KB 1C5DB 3D06A 3KH4A 4Q2ZA 2X5PA 1WZKA 3LRSB 4Z8FL 3A6BH 2WXRA 3UYPA 2QT6A 3NJJA 2AJVL 5DQJA 5K9KB 4HEPA 4QIRA 5DJ6B 1HWGB 3S3BB 1G7PB 5T33H 2IH3B 3HBGA 1JGEA 3DX1A 4AZUA 1JRHI 5F7HA 1Y0LB 5DMJB 5IK3B 4N1CA 2BIMA 2HKFL 3DOSB 1U8KB 1HH6B 3QRGH 1G7LA 3HPJB 3IDMB 5HHXH 3SGJC 1H5BB 1W2KT 5FO9B 3HZVA 5JHMA 2XWBA 3BSZA 5GSVB 1ML0A 2QGEA 5IFJB 2BSDA 1ZANH 4ICXA 4N8VA 4OCRH 3U0WH 1C5CL 1BD2B 1SY6H 3LHPH 1NICA 5EZLA 2NY7H 1X5IA 2QQKL 4DP0X 3GXFA 1JTPA 5AFAA 2QADD 3UTZA 3RI5F 4DGIL 1CYWA 2VDRL 3LQAH 4XOAA 3G6JE 1NWPA 4PJBB 3JWDH 4P2RB 5DFVD 4EDXB 3BSGA 1T66D 1UXWB 5CGYD 1IGJB 3OKOB 3MO1B 3U9PH 2DDQL 2A6DA 1IM9A 5JXED 4KVCL 5I8CA 4NIKB 1JUFB 3FCBA 3O9WB 3BPLC 5IR1B 1EHLL 1QEWA 3UG3A 2FD6L 3QIBD 3G08A 4P3CH 4KOBA 1HL5A 3INUL 4LXFA 1ZT7B 4IRSA 4PWJA 2H1XA 1RZ8A 4TQEH 5H37G 3REWA 3WGUB 4MZ3A 1G1CA 5G4NA 5C3IA 1T5XB 4O51B 1XF3A 2WVTA 4PGBA 4HZLB 2ZCKH 3GI9H 4RCAA 4AI7A 2AABH 3TN0A 1BG1A 3QJOA 3A4DA 4PJXE 4KMLB 1KDIA 1ZWIB 4FFVD 4A2HA 5HPOA 4XN1A 4XOBA 4AK1A 4MQSB 4PW3A 1UZ6E 5L4IA 1UCTA 3D30A 1RLBA 3LEYH 4HS8L 2RFXA 5JOPE 3PHAA 2CO3A 1I4FB 4R9HA 3TNMA 2VJXA 3IDXH 5CWSB 4C83B 4YSQA 3CZFB 1P6FA 3QDJB 3R4RA 4LSTH 4JLRA 1INDH 1R3KA 1JFQH 5IHWA 2EYRB 4J8RB 4J3XA 4M48L 2J8UF 2CG9X 2D0GA 1UGNA 2OMVB 2XQBL 4O00A 4XC1L 5LKNA 5DZPA 3MLRH 3S9DB 4QOKD 4ZODA 1J9TA 4XBGA 3Q5YA 1HSAA 1JPGB 5I23A 3BUPA 3TVMA 5LCVL 5I5RA 4QWWD 3HLAA 1A9EA 3FFDB 1KF9B 2XIIA 3B7YA 4WV1A 3TO2B 4JBSA 3VGGA 3I3EA 3OXRA 4ZW8A 1IBHA 2AK4D 3KWWB 1MXDA 2Y5TB 4J6RL 4F24A 1FYTA 1NMAH 4Z77B 2YPLD 4BK4A 3BP5A 2WAQA 4YVUA 2R8SL 4PRHE 2ICES 3L5IA 3RWCB 4F7PA 1LWRA 1Q9WA 1T2XA 1YEFH 1E4HA 4GO6B 3F6LA 4LLUA 4PLJC 1U8CB 1RUAH 4M7JL 4R0LA 2GPZA 3Q9QA 4KTDH 4F9PA 1M3IA 2WSDA 1IMHC 1E3ZA 2ATAA 1IE5A 1KB9J 4PJGF 2EVJA 3EZ8A 4K7PH 2LHAA 5J6HB 3RIKA 4EI5C 4KXAA 1FPTH 3RUGB 4E0RB 2ZYIA 5EIIA 1WLHA 1FNGA 4GSXA 2X2JA 4ZX5A 3HNTL 2MCMA 1DVYA 5T1LD 2AV1B 3MX0A 1RULL