5LNEA

E. coli f9 pilus adhesin fmlh bound to the thomsen-friedenreich (tf) antigen
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
152
Chain Sequence
FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPVGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Fml fimbrial adhesin FmlD
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 33
structure length 152
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lneA00
4XOCA 3BFQG 5FLUA 4XOEA 4AV0A 1TR7A 2JMRA 5ABZA 4X50A 1N12A 5FX3A 1KIUB 4X5QA 4CSTA 4AV4A 4AVKA 4XO9A 3ZL2A 3JWNG 1UWFA 5IQNA 1ZE3H 4XOAA 3SQBB 5FWRA 1KLFB 1PDKB 2J2ZB 2XG5B 3ME0B 3BFWA 5AB1A 3JWNH 2UY6B 4LOVA 5JQIB 5F2FA 1N0LB 4J3OF 5AAPA 4AUJA 5IQOA 2W07B 4AVHA 4XOBA 5CGBA 2UY7B 4X5PA 3RFZA 2JTYA 3JWNE 3ZPDA 2WMPB 4AVJA 3MCYA 2XG4B 4X5RA 1QUNB 5LNGA 4AVIA 4J3OG 4ATTA 4BUQA 4CA4A 5AALA 2VCOA 3ZL1A 5LNEA 4AUUA 5F3FA 4XO8A 4AV5A 4J3OH 4CSSA 4AUYA 3BWUF 4XODA 5IQMA 5FS5A
chains in the Genus database with same CATH superfamily
3BT2H 1O9VA 2X10A 3FF7A 4MA7L 2BJML 3CG8A 1KACB 1RIUL 2VXUH 4G9FB 4MCYB 1EHKB 1LO4H 2J25A 3VXSA 4UM8B 1U36A 3OWEA 2W0FB 4Z7QE 4OI8A 3MV8A 4LNRB 1WH0A 3NZ8B 1RLWA 1G7IB 1QHOA 2Y5QA 4W9ZA 4UOW0 1WD8A 4TF4A 3GS0A 2BCKA 4KROB 2QQNH 3U0PB 3EXJA 5AW7B 2IANA 3WIFA 3ZO0A 4V2BA 3KDPB 4XMXA 2VSDA 4WAFA 3UC0H 1IQDB 4L8SC 1JGUL 1OP3K 5CP7A 3RU8L 4NO5B 4P9HH 3LEYH 2OBGA 4V2CB 2G9HA 2VZ3A 3RA7L 1MJJA 1WWCA 4DKEL 2W8CA 4J3WA 4LEEA 3QUML 4QHMA 1V54B 3OKMB 5KBDA 3CVCA 5KN5A 2YGOA 4O02L 2AQ1A 1I75A 1TMQA 4LL1A 3K0WA 2JXMB 2NY5C 4UUJA 4Z7WA 3BN9C 2VQ1B 4YUEH 2BINA 3LS5H 4URTB 1J1XH 3KD4A 1ZPLA 2VUKA 3FQXA 4PP1C 4JN1L 2G60L 1H8OA 1YY8A 5CZRA 5F96L 4LCCA 4GSRA 4N2OA 4N2IA 1XXFC 3QO1B 3BVUA 4IBYA 5GJTL 3GSXB 1Z3GL 5E4EC 3P0YH 1B3JA 2X4UB 2E5EA 2IDQA 3MO1B 1GPOH 3MR9B 3ARVA 3ZTEA 2GSGA 1NWOA 4XPBL 3OAZH 5CP3H 2V5RA 1EHXA 2XZZA 4FQXA 1T5WB 4J8RA 1TETL 4QNPE 4WI3A 5IQLA 1Y1UA 4PWFA 1JDCA 4BFIB 3QEUB 4UAHA 4X4MA 2MSPA 3P3YA 2YUZA 1KBKA 5DFAA 3EAKA 3R4RA 4BYHA 5EF2A 4HULB 2KQMA 5LNEA 4P46B 4N9GA 1N19A 3T0EA 4YZFE 1RUPH 1A6TA 2FEEL 3O3DA 4ZPTA 1BPLB 3B3IA 3JTBA 3DJRA 2AEQH 4QMEA 4MWFA 2IXQA 2FECL 5KBMA 2NY7H 3ZZSA 4V11A 1WZMA 3CIAA 5JHMA 4LSQL 2G30A 3EJRA 3GMRB 2K9UA 2WANA 3CC5B 4D8OA 4NRXB 3QFDB 4QXTA 5D72L 5KVMC 5KVDL 5C0IA 3ATDA 3V52L 4MAUL 5IBLD 3BKJL 4XVSH 2X9YA 4HKBB 3C5JB 4JQIH 4QXWA 3C60A 1MVUB 2ZWYA 5JORA 2K1MA 3L1OH 2W9LA 3MRMB 5D7HA 3T3MB 4JGJA 2E56A 6PCYA 5IFJA 15C8L 4TQPA 4FNUA 4NX0A 1DVTA 2FATH 4MQTB 1TVHA 5HD8C 1ONQA 5KSAB 4Z7VE 3NUKA 3ARQA 1JI2A 3VI3A 4RWYL 2FH6A 4JREC 5F7NC 1NM4A 5T3XD 4RAVA 3QNXA 3LSOB 2BZCA 2KQNA 1D6VL 3S35L 3WGVB 2X5PA 2XN9A 4JVPA 3HPJB 2B1HH 5BQ7B 3FT2A 3MC0A 3KYMB 2RCSH 2ZCHH 4KVNL 4QEGA 3WXWH 1R5WA 4I7ZC 4JHVA 2YD2A 1D7DA 2BSSB 4RMUA 4WV1C 4A2DA 1AZUA 2MNUA 5D7SL 2F53D 3OG6B 4PGCA 3GMLA 4QHLB 4K9EH 2CR3A 3FB8A 3FOLA 2LHAA 1JZFA 4PJGB 5IVXF 2JJSC 1EEQA 4GQ9H 3F7QA 3EUDA 4G7VL 1UUSA 1Q0XH 5IQOA 4Z3TA 1U8LB 2F7PA 3SDCD 2YPLD 1JWSA 3QDME 4DKAA 1MEXL 3FH5A 4U7KA 3WE6A 3WTXA 3MLYH 5MP6L 2E9JA 3WNPA 1IQWL 3B56A 1AGBB 2BSCA 2AK1H 2PLTA 2W65A 5A6IA 2AC0A 5F1OB 4YFEA 5A6LA 3DDGA 3N9GH 2HLFC 4JFZL 4WNQB 5GGRB 3RWJB 3VTTA 4FN0A 1CPUA 5IB5B 1PVHA 5IOPA 4ZQKB 1MZZA 3QEHA 3DHJA 3ARSA 1NJ9B 5JLZA 4JFFE 5C0CA 1E2WA 1U6AH 2NQDA 5D7KD 4UT9A 3TN0B 3VE0B 4QRRA 5IKCA 2FX9L 1FYTE 4LCYA 1XCQB 3SGEI 4Y2NA 4H0LC 4R7VA 5CSGA 1UB6B 4YDKH 2R1YA 5F7EL 4ZO6A 1S8DB 4I87A 5EUOE 3FQRA 3NDZE 4IKIA 4YHNB 4M61A 2LABA 3DMMD 1NCWL 3QQ3B 5HHVL 1V10A 4N0UE 5D4QA 2NUTB 4OGXH 4EIZC 2SEBA 3ARGB 4HOXA 2BP5M 3TCLB 3ARDB 4FFTA 2ICEB 2IPTL 2GBVA 4M3KB 3S4SA 4LF3A 1WBYA 1I3GH 3T0WA 3HVDA 2G2PA 2F19H 3WKMH 3QPKA 5IEKA 5DD6B 4NQCE 3IDNA 4QI3A 1KCBA 2WSPA 2CRMA 3VGBA 5MEQA 4ZPVA 4MB5A 4AM0Q 3V0DA 1U58A 2BOCA 4IU2A 4K07A 3BGFB 3ZLQC 3L5XL 1T4WA 4IHOA 1VADA 4Q2ZB 4TVPH 1ZEAH 4G8GB 1I9JL 4APXA 4GKNA 4JK0D 1WHPA 2P49B 1WAAA 4LL9A 4CSPA 3CPLA 3OLDA 5A1AA 1XL6A 4KBPA 3TVMA 2AQNA 2NY1C 3BSZA 4QGYA 4F7MA 4FNTA 4Z3IA 4FNLH 1WAPA 1P4UA 1SOKA 3GMMB 4F15B 5L8KB 4QPEA 2X41A 5IGXL 1FZKB 2VUOA 3WIIL 2VXQA 4P9HC 3U0TA 1MPAH 1A3RL 5C0DA 5A16A 3JUZA 3S3BB 3VSQA 1FF5A 2EIZB 4GJTB 3S37H 2GSMB 2WWKO 1YEJH 3QQDB 2VDRH 1JF1B 4X9GA 5GZOD 3UTTE 3MHZA 3BIKA 1JRHH 4XGZA 1T20B 3CFCH 4FQQA 3AREA 2DQJH 4OZHE 4LVHC 4MZ3A 4MD4B 5JUEL 4X4YB 1R3LA 3ILPB 3UMTA 3WEMA 4ODSH 2P24B 3VNYA 4Y0GA 3CVIL 3OGCB 2BSTB 3IMUA 2ATPB 4BBWA 1FBIH 5I0ZA 5IWLC 5JNYB 1RZKH 2AW2A 1W6WA 4ISVA 4Y9BA 5F7YC 5HSFA 1F02I 3RWIA 1INDL 1MCSA 4Q6IA 3TCXA 3R7QA 3O2VH 5CUSH 1KCUL 1N6QL 2ENYA 2VN5A 2CLZB 3L3OA 2L7QA 1TCRB 1ECZA 2GY5A 4S1RH 2CHXA 3QIUD 4GRLC 2XC8A 5IM7A 2DEWX 3DK2A 5EF1A 4NZDA 2DI7A 5ETUB 3S36L 1FIEA 1MZYA 5DJ6A 2ZXGA 3IBEA 1IT9H 2F1BA 3SCMD 1II4E 1OAJA 3O4LD 3OJDA 2AV1B 1OW0C 4J3OG 3JBG7 1J8HA 5L6YL 1D5XA 1Z0MA 4IRJD 2FWLB 5I74C 4MCZB 3HJ0A 2K9FB 1SMDA 4IK7A 5KS9A 3LV3A 1RL1A 4QHPA 2CNYA 3QWOB 3L4TA 1NMAL 4OI9A 3W37A 4YSQA 4NM4H 2CBOA 1KXQE 3RZCA 3MNVB 2V2XB 1MCHA 3B9KD 4LFHG 2GJPA 3V8CA 4NNPH 2Z31B 2HCZX 3VMPA 3I3EA 1XF1A 3BSGA 1IFGA 2OK0H 4LASH 4P57A 4PIBA 3MXWH 1BAGA 1I1AB 1QHQA 3ZDXB 1A6AB 4NGHL 5IB1B 4NP4H 2IQ9H 1U3HA 5CEZE 4PJBB 1U3NA 1CLZL 4XOCA 3FN9A 3S48A 5I30H 3U1SH 2QADB 4KZEL 2J8UB 5EEZA 3GKWH 2FK9A 4XN5A 4LMQI 4FLHA 4EVNB 4KK6C 2H3NA 3KBPA 4RGMB 1NMBL 1TR7A 4FHKA 2MWCA 3KLAA 5D2NB 4R96A 3S5YA 5HGHB 3IM1A 2ENSA 2WXKA 2FT6A 4XPFL 1GSMA 3N04A 1TNMA 1K4DA 4JFXB 4PV8B 2Q7AA 4KROD 4WDIA 1DJHA 1DVFB 1LO2H 1WDAA 5HI5C 2OW6A 2PO6B 3EDJA 5AVUB 1CDHA 2EDWA 2WO2B 5FHBH 5EH1A 1KTBA 1TG8A 2O6EA 1IMHC 1MIEL 2K7QA 1OT1A 4MMXA 4RGNC 5DJ0A 1K5WA 3ARBA 1OGSA 3CN3A 2BSRB 3SEPA 1AS6A 5DO8A 1JF5A 3HEIB 4YHZL 1QFUL 3C09C 5EBWA 1BSIA 3VWKC 4XC3L 5B39B 2BIOA 4UI2A 5DEFB 3QPXH 1P84J 2FLBT 4UOJA 2FSDA 3H0TA 4UM9D 3MUGB 1KB5H 1KXTB 3ZKXC 5C0RH 4G1EB 5T5NF 4Y16C 3N50A 3GNMH 4U3HA 4XMZA 5K59F 3L4UA 4H25A 1MHEA 1YPZA 2FRGP 5DJ8B 5GGVL 3RHWK 3QXUA 5DJ2A 2B1AL 3RVTC 2FJHA 4OBSA 4C83A 1NCTA 1PSKL 3IBOA 3M6DA 1CFQA 1QABA 4MJIA 4HQQH 3L9BA 4XP6H 3SOTA 1NFAA 4UF7C 4XWGH 3GK8H 4WEUD 4RQQA 4N8CL 3FB7B 3BEVA 4LPUA 4ONHB 2OX5A 3BPNC 4JKLA 4M6AA 1S3RA 4M5SA 3RY6C 1A14L 1YEKL 2B14A 4GMSL 4KOBA 1AR2A 5HGBB 1IAIL 5AYUH 1I7RA 4P4RB 1L9SA 2NZ1A 1RPUA 1DN0B 1T5KA 3C08L 3DWTA 3JYBA 3PQYD 3SDDB 3NFSL 3SPVB 3NABH 5HY9B 1HHGB 4PWHA 3N43F 3MAWA 5DK0A 4JDEA 5AD0B 4PY7A 1Q0YL 4QTIL 4MXWL 3NK4A 4F9LC 3P9MA 5B3NA 1D9KC 1WFJA 2BVEA 5I71C 1P7QA 5E99L 1NUDA 1ZA6B 3POHA 3BUYA 1OGTB 4PJ5E 1FGVH 3C5SA 1EV2E 1JPGA 1EO8H 3Q43A 4P46D 3KMDA 1QEWB 1H3VA 5D9SA 3SKOB 3MBEA 2VR5A 1MREL 3KPQB 4WU5A 4AK2A 4EZJA 1EA9C 2DLHA 1ZHBA 5EU6E 2CLVA 4GO8A 1XZ0A 4J6RL 1NCAH 4WEEA 3RGVC 1KFGA 4PRPE 1GH7A 5IQMA 4W9HC 5B1JA 3DXAA 1CDGA 4ZX3A 1FV1A 1J0HA 3FKUS 3MLZH 5C0EB 4OZIF 1ZT4A 2H2PC 1OSPL 4IOFD 4YIQA 5I1GL 4U1JA 1JGLL 1T66C 1NLBH 4K3DL 4DWHA 3QG7H 1HYSD 1HH9A 1U8NB 1IBHA 3WHE0 3II2A 4IDJH 4QOKB 5IJVA 5L88H 4F8LA 32C2A 3GMPB 2HFTA 2MNWA 4XZ4A 3TNMA 1E5YA 3ATBA 4JY5H 1EZLA 5KWYC 3ZGIA 5GSRB 4L2LA 2G3NA 1CDIA 3Q6FB 5J7CC 1DQKA 2E7BA 4HCGA 4TSBL 3U4KA 5ID1B 3O81A 1G1CA 3J07A 1P7HL 4E41E 4BRJA 1FNEA 4PTUA 5A43C 3X1FA 1KELH 3AC0A 4FHJA 2UY6A 5LBSL 3TIDA 4GYBA 5C0BE 1J9QA 2ZP0T 3F7YB 1IAII 3SDAB 4OF7A 3OZLA 5SWZE 3IKKA 1J1OH 5ESAB 4BWUA 4TPRL 5JZ7C 1ZE3H 4B9CA 3NN8A 4U1IB 5JR1L 1YN7B 2J8HA 4YDIH 4B97A 4HJIA 1A3LH 1OGAE 2ZG1A 4PS4L 5FUZH 1KB9J 4KH2A 1A1NB 4L2YA 3MRRA 5TPWH 1KENH 4XPGH 1FNSH 3KPMA 4AEHH 3I50H 4K7PH 5CN2A 4IRSB 2F08A 3EGXA 2E7DA 1X4YA 4RBPK 5FUOL 5KYUA 4FADA 2WCPA 5ESVB 1WBZA 1SF3A 4YNYB 1O7DE 4PY8I 4K94H 4ZAKB 3VXRB 3BDYH 2RQ8A 3D3VE 3VRIA 3NTCH 3HLKA 2ZWSA 3ZJAA 4WI0A 5LGJB 4LSSL 1JZ8A 3FUNA 4KRPB 3IT8D 2ZP8A 2ORBH 4PGBB 1RZKC 4BJLA 2YUVA 1EHLL 4PRHE 2NLJB 2C3GA 1YN6B 3FT4B 5CWSB 1WHOA 3LZFH 3DGGA 3VJ6A 5L7XH 1JV5B 3VFSA 1AXTH 2WSKA 3KL5A 3OWRA 5DI8B 4XP5H 3MMEA 3HI5L 5E56A 4A2LA 2FT7A 1AQMA 4PTTA 3CDGA 5L0QC 5LNGA 2DYPB 2KERA 3APDA 4XTRC 4KJPC 3L6FA 2R83A 2A9CA 5JIDA 2BNQA 2N56A 5BV7H 1LE9B 2PW1B 4M8RA 5CCHE 2BFGA 2APSA 1U8IB 3RAJL 3R1GH 1QOKA 3SGJC 1T7YA 3JQOB 4HLZG 4U1KA 5LVEA 3CFIC 2HTLD 4NLAA 2QDWA 5KSVA 1BVKA 3FDWA 5C7XH 2RB8A 3SQOL 1B9ZA 1NANI 3BRGC 5CJOL 2WXHA 4R84A 5DT1H 4LPCA 1WFNA 1FWXA 2WNXA 5ANME 3ARGD 2V17L 1XDTT 3QIWC 4X8CA 1KCVH 2VABB 4HXAL 4AY0A 3QA3B 4LPVA 1GJIA 2NW3A 1YAIA 2GFBB 4P05A 3AY4C 2VDLL 2OI9B 2ZXQA 4GAGL 4JKKA 4L8BA 4OZFG 1H15B 4QY8A 1E28A 1SNRA 2AXFA 4ZXBB 1UUNA 1ZOXA 2J43A 5I23A 3O2DH 3QXTA 1COBA 3AUWB 4OTXL 1ZDSA 4ECNA 1CYXA 1PLAA 4PI0A 3P77A 3STLB 2Q1EA 4ILDA 4AGOA 4U1SA 4X4XB 3MRPB 3P4MB 5EORH 1SXSA 1UCBH 4NZTH 5DTFB 1S7WA 2G4GA 2ZUXA 4D9LH 5I1LB 4MQ7B 2BSDA 4IBQA 1QP1A 1WT5C 1ACCA 4NWTH 1UM5H 2EVJA 1CICC 2OV0A 4MAYB 3AXIA 3AQXA 3FSVA 1HAWA 4NJAL 1YYMH 4NQED 4UAOB 4PJIF 1IBZA 3VX1A 3D06A 4FXKC 1NBVH 3KAAA 3FUEA 3C5ZB 5TQ0L 1QHPA 3GMQB 2ATAA 4BKLB 1Y0LA 1MCDA 5F6IB 4WFGE 1MY5A 4U33A 1J8RA 1XF3A 3RVXC 2YA1A 4PJIB 1BAWA 2MKLC 4UTAA 3WNMA 1YECH 2V3FA 4PJ9A 1FI8C 1GGBH 1HSBA 2H2SC 4FE9A 1G9EA 3U2SB 2D0HA 2DQHL 4OGZA 1JCVA 4UB0H 1X5IA 5H8DA 1O7VA 3A22A 3HPLB 4HPYL 3EDFA 1KY7A 2PUQT 3J2PA 3FH7A 2EEBA 4LSPL 4MB3A 4GP4B 4EI0A 4NN5B 2LE9A 2X6UA 1ZS8A 3LN4A 2WBKA 1NICA 2D7TL 4Z0BH 2YEZA 4K3EL 3UGXA 3FCTA 1EEYB 5JOPD 1IAMA 4FFWC 4G11A 4LCWA 5I1IL 3FMGL 3EOTL 5E51A 4LIQL 4LSVH 2HPTA 5HHOE 1J0YA 1TNNA 5BRZA 4HEME 4NQXA 4PR5A 4Y7MA 3UG5A 4EDXA 3G08B 3LQAH 1FCGA 2KLSA 2XTJB 4GG6F 3ZL1A 1LWHA 4YWGL 1T21A 1AOHA 2X6CA 1ZXKA 2NXZC 5HYSB 3DX8B 3OSVA 2GSIB 2RH0A 3FOMB 1WC7B 5DZNA 3V6OA 3K1DA 4AI7A 3BE1L 2SODB 4L3CB 2UWEF 1USQA 4KPHH 4XNXH 5LDUA 4HFUH 2Z31D 3WS6A 4YQXL 4GAJH 3EO9H 4PG2C 5FGBC 1N59B 2I60H 4MS8D 1I1AD 5T1DH 4K23H 4WCYH 3KCWA 1FORH 2MOQA 2X3BA 3H54A 4P2YA 4NPYA 5DURB 4W9EC 2EO1A 5FM5M 3WJJA 2X9ZA 3VO0A 1KTLB 5GPRA 4JFQA 3Q5TA 1B4LA 2WQVA 1OHZA 3LPPA 4OCSL 4X0NA 2OL3L 1I7UB 4Z7OF 1SF5A 2F1EA 4WWKC 3U79A 2ZUQC 5I1JL 1BDYA 2CA3A 1WRFA 1BBJB 2ED6A 3O45A 5C0JA 5J1SC 5F7WC 5I24A 4L9DA 3OAUL 4FQLH 3MODL 1DVFD 2CIKB 2JJTC 1H3PH 1E27B 2PP7A 2PO6D 4ZDHB 2BIPA 5I2IA 5EU7E 4PB0L 3F65A 1T1YA 4FULA 3KPTA 1UWXK 4KKCC 3I75B 2ZF8A 3R0NA 4P3CL 4XN9A 3DYPA 3ZR5A 3GSUA 2DAVA 4NSKA 1TZGH 2D3LA 1ZE3C 5HDBE 3QRGH 4L4JA 1AE6H 4WSKA 2BIHA 3H7BA 3IDXH 1KIPB 3PDGA 5FGRA 2BMKB 5HHNB 5LNDA 1DFBL 3IDUA 4N8VG 4NCC1 4X4KA 4GRMA 2KMWA 4R7LA 5F3BB 2JK5B 3QDGE 1GZPA 1E8ZA 4XPAH 5EDXA 2V2TA 4Q74A 3SGKA 3W0WA 5L4IA 2VW7A 4NQDA 5MI0C 4MZRA 4XHJC 4ONFH 3FHAA 4EN3C 3S8GB 3T77B 4CN6A 2WQ8A 1VIWA 1PG7L 4MBRA 4G1MB 1NPJA 3QUXD 1MNNA 1KN4H 1TJMA 1IC7L 2UY7B 3LNFA 4L4TA 5GGTH 4DGIL 1VAHA 2PYEB 1ZLSH 4TUOB 3FQUB 3BGAA 3DRQA 3FU0A 3HZKA 4PJDF 5HJDA 4F7KA 3LRLA 5LQBL 2R59A 5AAWC 1KCSH 6TAAA 1WS8A 5JPNC 2CM6A 4XNMA 3L13A 3FSAA 3VXPA 4LPWA 3V4PH 3LH2H 3LX9A 3MA7A 3BAEL 5EBGA 1PY0A 2P7TB 4NZ8A 3HG3A 2D03H 2CXKA 3IDGB 3GMOB 1C8QA 3PWPB 5EO0A 4UTBH 3UJJL 3PUCA 4HS3A 2R9HC 4P49A 1T04B 1J05A 4RMQA 2VKWA 4AXWB 3IYLW 5BV7C 4R2GB 1GVIA 3S2CA 1EEZA 4Z6AT 4OJFL 5KVFE 1CTNA 3MNZA 5A2AA 5HYFA 4BUHA 2VDOL 4PRIA 3P4OB 4B5ZA 3BWUF 4FMKA 1KNOA 4GI9A 4GG8A 4RDBA 4LAQH 1H8NA 2WQUA 3JTSB 3M8OL 4F3FA 3QAZB 1DVYA 4V33A 1E8YA 2BIQA 2DW5A 2ESVE 3FRPA 2PCFA 4CUCA 3ULVF 5EEUA 1A7PH 3ABLB 2CKBL 3WTTA 3LN5A 1X7TA 2ZD0A 1RZGB 4EN2A 5K9JH 1HKLH 5IB4B 1CMOA 4WGWB 4LAJH 4QOKD 1PGRB 3DVNA 1TJXA 1F58L 4LSUH 4OCRL 4ODHH 3UMNA 1HCYA 3IJYB 2EEDA 4KRNA 2XVBA 2YOCA 2JELH 3Q8FA 4YHIA 5FCSH 2VQTA 4PJ8B 3P9LB 1XF4B 4NUJA 1I3UA 1W72H 3NCMA 1RJZA 5I18L 4AQ8C 4Q89A 5LDSA 1KYDA 1OB0A 2I07B 5DK2A 4KI5F 5C0AB 3VI4A 2WIMA 3HAEG 5BZDA 2OMVA 2H6PB 3O41B 1G7LB 4MSWA 4FYQA 3SDAD 1YUHA 2X4NA 3TYGL 4BK4A 2E6JA 1PLGH 1DE4A 1JHLH 1TJIL 3N1FC 3ZHFA 2J72A 1E9PA 2DQCL 4YSSA 4AT6B 4QHNB 3QK0A 4HGWB 1JZJA 4BKSC 1AKJD 2IPUG 1ZV2A 3H9SB 4YX2H 1E4KA 4A7GA 2VQ4A 3VXQB 1CE1L 5D1XE 5L2KA 1G1YA 2E27H 3EUUA 4MTMA 1K4CB 4YSPA 1RZ7L 1PKQE 3QISA 1M57B 1PLBA 1SLUA 2DIAA 5DZVA 1UJ3A 1ZDQA 3I6GB 4AZUA 4F7EA 5E70A 3GXIA 5AYQA 4ZAKD 3VXRD 1QI3A 3DURB 1M3IA 1NBZB 5T3XL 3T4AC 5D6DA 3HI6L 1IVLA 4E9SA 3GTNA 1ASOA 4ZW5A 1D5MA 4X5WA 4AJYV 3KPPA 4KRPD 3SJVB 6CGTA 4OV5A 4HT1H 3Q1SH 1MXGA 1VENA 3T4YA 3V4UH 3HG1B 4NXSA 4IMLA 4IBZA 1FG2B 4IKKA 2NZ9D 5HYQA 4M7KL 4P2RA 1AVAA 4DW2L 1R3IL 1L0PA 1SEBA 5GS0L 2OP4H 2MOVA 1H0DA 1I4FA 3MROB 2CK0H 2JKJA 3VXNB 5E9AA 4JDZA 3VDBA 5EEYA 3NFPA 3O3BB 2H26A 4JDVA 3LQAC 4MAZA 4OCMC 2ZAGA 4S1SH 5JOFA 1EO7A 4A7TA 2J1WA 2P5EE 4LRIC 1OCWH 4ZW7A 4IK6A 4KKLC 4CMHC 4D9RE 5DMKB 4ZOCA 4MJ5B 1HQ4A 3D39E 2KZKA 1E8XA 1I1FA 3KL0A 43CAB 3E9TA 2AKRB 1XT5A 3DX6B 5E6ZA 2KHAA 2G2RB 2R4RH 4BGLA 1OCOB 4FLRA 1FNGB 4M43H 3U0WL 5EZLA 2XUWA 1T1WA 2EYSA 2XCMC 1CFSB 2FNWA 4Z95H 3VA2C 4D3CL 4LHUG 4JFOB 4HS8L 3SE8H 4M1GH 4QRFA 3TBSB 1B0WA 2AAVA 2XWJA 3UAFA 5FLUA 2DMBA 3AQDA 4K0OA 2X88A 4ZXBD 2X53A 4BHUI 4HJJH 3BP7B 4NCDA 4KRLB 5C0GA 1FYTA 3I74A 2X89A 4I0KA 1IUZA 3PJNA 3GJFK 3FSZA 5ID0A 3TPUA 4AMWA 2VR7A 4GW4B 3X14B 1MHHB 2CPUA 1IEBB 4OD2A 3L4CA 4N2EA 3SY0A 1UH4A 2JB5H 2QSTA 4XXDA 1KTCA 3CH1B 1U8OA 5EUOA 4CSTA 3CNKA 3F84A 4MRBA 1VJSA 4PW4A 1KGXA 5TK2A 4QKXB 4MAYD 4ELKB 2IH1B 4NDMB 1I3VA 5E6UB 1ADQA 1ITCA 2ZCLH 4F7PA 4PBWD 3CFBA 3ASWA 3L8QA 4UZGA 4P2OA 1ZJAA 4LGRB 4O9HL 3QCVL 1SYVA 3VFGL 1F3JB 4LSTL 2WBWB 5JIMA 1FRGL 5IVZA 1IKNA 1F4AA 2E3VA 4OQ1A 2GJ6B 4MJJA 3ZL4L 5F0PB 3C5ZD 2HLAA 1LP9E 3L9EA 4KC3B 3LNHA 2QSQA 4JPIB 3P3SA 1IC5L 5IK3A 5ILTL 3MLWL 3WE1A 5IZ7A 1NAMH 1CC3A 1QUNA 4L5FH 4NNYB 5DR5L 2DI9A 4IOSD 5ESQB 3KS0J 3GHBL 2GPZA 3HE7A 3HZVB 2AJZB 3PGFL 4PG9B 5GGSB 1A4KA 2WINB 5BPPA 2Q6WA 3WNNA 2JSFA 4TN9A 2PXYA 4AVHA 2DKMA 3QQNA 4HU8A 3VD2A 1JPSL 1W0YT 4G8FB 4MNQB 4M6ML 3NJHA 4Y4FC 3ZHDA 2YGVA 4YDLB 5BXFB 4D0BA 3ULSA 1CFVH 2FJFB 2XA8H 3L3DB 4TSAH 3S8FB 2DTML 4A7QA 1B4JH 3A4FA 3DPBA 5KSBE 4NRZA 4Q9QL 3IFPB 1UQSB 2XX1A 3VXUB 2RJMA 1H8LA 3CZEA 3B2DC 3FT0A 1LDPL 4HK0A 1IM9A 1A6WH 3E2HC 5F3HB 2XTJD 2W94A 5T5FH 3OQRA 4IIQB 1JZ7A 1WICA 1A6VH 1XSIA 3ZE2F 4CU7A 2D2CC 3CU1A 3OR6A 3PP3H 4Z9KB 2YFNA 2VC2H 5BVPH 1DQLH 3S96A 5LUMA 1PZ2A 4HWEL 2WUCL 4M7LH 1N2RA 4WW2C 1OKEA 4U6YA 1M3JA 1HS6A 1PFCA 5I1CL 4WUUA 4DTGL 3X1NA 1I8MA 2Q8BH 2VLRB 5IY5B 5DURD 2GTQA 2Y3NA 3PNWB 1GIGL 1E6OL 3B7YA 5I8KH 2DWSA 3WN6A 1X7QA 3MXVH 4KKNA 3BT2L 4JMXA 4WTXA 3OTTA 1KCRH 2BS9A 3D2TA 4MFHA 3QNYA 4FFYL 3C6LB 4JFEE 4M4RB 4AKQA 2AV7B 3GXUB 3K2UH 3JTTA 1LO4L 2WBJC 4MLIA 4LXFA 4KHXH 3ATAA 1IILE 5TDPA 3QPQC 4NUQA 2A83A 4WHDA 1GGIL 4HWNA 4X50A 1RAMA 2A6JA 4WKXA 4L9LC 2IMMA 2LW3A 1AS8A 3BOVA 4J4PA 3PDDA 4JZJB 3A3YB 2H7WA 5I75C 1QFPA 2J12B 2QQNL 2WO3B 3ARFA 1ETA1 5C09A 2KUTA 3NCFB 4RMTA 4FQ2H 5JHDD 2P47B 1XMEB 3QUYA 3VXME 3UC0L 3V6BR 3E1F1 3LNGA 2BW5A 4IBUA 1NFIB 3C6EA 4P9HL 3V7AG 1EWHA 4MA3A 3LEYL 4W93A 2EXWC 1KJ3L 4R4BB 4I4WA 1UZ6F 2ZX5A 3FK3A 1XBDA 1ZK9A 4I9WD 2Z34A 1BEYL 4MMYB 3GZOA 4S0SD 2UX6A 5EOQH 3B2MA 3FO2B 2OJZH 1N5YL 1NGYA 3WMSA 4YUEL 3LS5L 2O6CA 2BVOB 5TE6L 1N0LB 3GMNB 3BVXA 5HJBA 2W88A 4UQ9A 2AQSA 3HRZA 1HL5A 2OMUB 5CLXA 2D7OA 2PYFB 1D7FA 3HKFA 3G5YB 5DHYB 3P0YL 4JO4H 1NMCC 3QZWB 4B0MM 3X3GL 1GPOL 3LEVL 1SFHA 2R2EB 2ARJA 1UA6H 3UGUA 1M2VB 4TNEA 1X6NA 4Y2DA 5F97E 4HUXB 3IAQA 1KZYA 1C08A 1CFTA 4LZKA 3VFRA 4A2HA 3PWPD 2WC7A 2RTTA 4NAJA 4H1LG 4YSTA 4P5KB 3RFRA 4DP8X 1KJVA 4BEIA 1DZBA 5CHNB 4PVNA 1THAA 3LKNA 2N7BA 4HBCH 5J13C 1JZ4A 4R2GD 1Y1DA 4JDTH 2QDVA 4HS6B 4P5MA 3EJUA 3IN0A 1RUPL 1X5KA 4D0CB 2FR4A 5FYJD 1EDYA 3L4XA 5IJDC 3GSNL 3MRBA 4K71C 5KYNA 2FBOJ 3SBWC 4CKQA 4ES9A 3HG5A 1AR1B 2JFCA 3HN8A 2NY7L 1HEZB 1CXIA 1KBPA 5CLZA 5J9PA 1YNKH 3PXJA 4MDJA 3F64A 5KEZA 1I9RL 4E9XA 3ARTA 5BO0D 3K3QA 2C8NA 3DGDA 3HHRB 2ATKB 1A6ZA 4I0PB 3AT9A 3UPRA 1G6VK 3KLDA 3TBYA 4FA7B 2PCXA 3GO1L 3K6NA 4XVSL 3L7EB 1Z9SA 1JZ6A 4JFDA 2QKIC 4LL4A 3CZLA 1HKFA 2IAMB 2YLHA 3MGTB 5C2BH 2YPVA 3P02A 4PJ8D 1X5AA 3ULVD 1BX2A 1XGUA 4OF3A 1CDUA 3O2WL 1S7XB 2P5WE 2GUYA 1O5DT 2NTFA 5TDNB 4D7BA 3N42B 5C0AD 5SX5H 2Z4QB 3JWDC 4XPHH 4L8SA 4C56B 1ZTXE 3OAYH 5AVTB 2DQIH 3DX9B 3L4YA 1RLBA 1M71A 5C07B 3GLAA 1AY1H 2P5PA 4UINL 1UOLA 2AQQA 2B1HL 2GCYA 2FEDC 5HJ3A 4KI5D 5IROD 1Y6MR 2ZCHL 3H9SD 3HS0B 4ZW8A 1YEFH 3WXWL 1OE2A 4UQ2A 5SWQB 3L95B 1KC5H 3DVGA 4FFZA 5ISZE 1INQB 4MQXC 1AO7E 1FFTB 1ED3A 1U8QA 3EDDA 4K9EL 4KFZC 4BHUA 4Z7QB 1B90A 5F6HI 3IGAA 5AG8A 1WAEA 3AT0A 5HHQB 3BZEA 4GQ9L 4AQ8A 2WQXA 2AXJA 5HDLA 1PZSA 4L4VD 2BWQA 3SKUD 4E41A 3OZ9H 5DEGB 4J2XA 1J0ZA 3MYJB 4X99A 1MWAB 2RIKA 3X12A 2ITDB 5GRJL 3OF6D 3LKRA 5ENWB 3S8WA 3IRCA 3MLYL 4Q58C 4Y19E 5D6CB 3HG1D 3MBWB 1BVLA 1FSKC 1G7HA 1OF2B 1QI4A 1JNLH 2PW2B 4KKPA 1GXEA 3KM1A 2CO4A 2NW2A 3WEXA 1QI5A 4ESKA 4YL4A 3VG9C 3N9GL 1BZDA 3IDYB 2O6FA 2WXNA 3HNTL 3MQIA 4UQ3B 1YVLA 3N44F 4JPKL 1NCGA 1DL7H 1FZOA 1UKQA 5I28A 3QJQB 5LXGH 1U6AL 2E76C 5K69A 2FHBA 4Z23A 1BF8A 1JERA 4YFLI 4ETQB 4XX1G 1KT2B 3L3GB 2AJSH 3IKCB 4FQHA 4QT5A 1L0XA 2HJFA 3D2UA 4L3EB 3D3VA 1HIMH 2F6AA 5IBLC 4YDKL 4AQOA 1NDMB 1K8IA 5E08L 5J12B 1JPFA 3U4BH 5D1QE 1GJUA 2Y1YA 3WELA 3GRWL 4W6YB 4MYWB 4KV5E 4RFNC 4YHKH 1F0LA 3DA0A 4OW6A 4BFBD 4MX7A 3W9EA 4DN3H 1T6WA 2CR0A 2N0KA 4OLZH 5K1NA 2F19L 3WKML 4AZ8B 5J6GB 3K71B 3C6SB 3DVFA 2ZXBA 4HKXB 1J87A 3E6FB 3G7TA 3KL3A 4RCAA 4XN1A 4PV9B 4JFPA 5DC4B 3I6SA 4TVPL 2QHRH 2R2HB 1ZEAL 4PGDA 5KVGE 5KAQF 5DA4A 3FONA 5DRWB 3CUPB 4X6DA 1RU9H 2X4RB 1Y18A 1M7UA 2CO6B 3TJEH 3L16A 4PB9L 5TH2A 2NY6C 4P2CG 2Q76A 1GSKA 5E00B 2QSVA 4HEPG 4E9TA 4RGOL 3RIKA 4UOZA 1NOFA 4FNLL 5ANMA 4AH2A 2WXPA 4ENED 4G42B 2UUDK 5JQ6H 4HH9A 2ZOTA 1MN4A 3CFJB 3RNQB 1MPAL 3SO5A 3SDCC 1QFWI 3N2JA 4KJQD 2GJ6D 3S37L 3JZ7A 1YEJL 1XF5B 2VDRL 2JJSA 1DJZA 2NY0C 2IH8A 3WFHB 4ATWA 3CFCL 4AQEB 3QXDB 3EH2A 5C1MB 3ETBF 1L6PA 1KFAH 1IJNA 1GY2A 4JKWA 5ECJE 2ZUWA 4ODSL 1HHHA 3K6DA 1S5HA 3MN8A 5AVVB 3QJUB 4Z7VB 3SZ6A 4KJWD 1K8DB 2PCYA 3KBEA 3CSBA 1V27A 4MNQD 1FBIL 5D7IF 1BXAA 3V5HB 1CE6B 3LY6A 2R56L 3H1ZA 1MJ7L 1P5VB 1DQQA 2CO7A 3HHSA 1FO0H 2WMPB 1FVCA 2YAMA 3O2VL 5CUSL 5KYYB 1MFAH 1T0PB 3QH3B 4EUPH 4S1RL 2VDQH 3TTYA 2FYYB 3DK0A 3DMMC 4LP4A 5DVLA 1WCBB 4Z3HA 5I17A 1MELA 1IT9L 3UBFA 4HIPA 4BQ6A 1JUFB 3C8KA 4FNQA 1OCCB 4ANXA 5CKAA 1F6AB 4N87A 5AALA 2B39A 2HPOA 3N41F 1UM4L 1HXKA 2WWMD 3DSFH 2CDEA 3IDJA 1X5MA 5D7LE 4I3SH 4Y4HB 4B50A 2EIEA 3HE6B 3PABA 5HYJE 3S5ZA 2V3EA 5D2LF 3ZUNC 2I7SA 3HFFA 1BQHG 3WOVA 4GIPD 2HLEB 4NM4L 1NFDE 3QDMB 4YO0A 2R69L 4BH7A 3QS3A 4GMTH 3CFKB 2ZOUA 3N41B 1NKOA 4J1UB 1BPVA 2C4XA 3ESUF 5DVPA 3KYOA 5I1HH 1B4RA 4EI6A 2OK0L 4XCEB 1TVBB 2VLRD 4GO9A 2VB5A 3MXWL 4TS6A 3UTSE 1XCTB 5IMLA 4NP4L 1IGFL 2A0LD 5ADOH 3O6FC 5HHOA 1RZQA 1LGVA 5I30L 5FLVA 3U1SL 1NPNA 3C6LD 4MQSB 1JRHI 3CU7A 1EO5A 1PMYA 1TYJA 3GKWL 4JFFB 4R4NC 4LDOB 3HR6A 1ZGLB 3LKPA 1T0NB 1F45A 2HWZH 2HKAA 5FKAA 1XB8A 3BIBX 1DVXA 1BG9A 4PSRA 1FN4A 3ALPA 1EZVX 5F7MC 4Z7NE 5FA3B 5J8OA 2Y7OA 1DDHA 3KYNB 2Z8VC 3VXOB 2ZT9C 3ARWA 5EIIA 2EYRB 4N0UB 3MJGX 2FQDA 4Y5YC 5GZND 1DCLA 1AYOA 1HE7A 5FHBL 1DP0A 1W6LA 3RUGF 2VR3A 3TLRA 4NKIH 3T0BA 2EEFA 2WIIA 1U8JA 3BKCH 3O6KH 4ORGB 1URIA 1B0RA 3LXCA 1A6PA 1JD9A 1WITA 3L5HA 3LKSB 4JR9H 4N0YH 4R4FL 2Z8SA 4AIEA 1U8PB 3FQYA 1KBBA 3LZNA 4Y9GA 4NQCB 3CMOH 2XSKA 3QPXL 1QLFB 4HEPA 4TRPH 5EOCJ 3BZ5A 3KLKA 3ZYIA 4PP2A 1JZ3A 3MRFA 5I6KA 1KB5L 3MACH 3IJEB 3AVEA 4I1NB 1NGXA 3ESMA 5F88A 2X4SB 1IC1A 2ZKHL 3MRHB 3FO9B 2DQTH 4ABVA 3QIUC 3DV6A 3WCYA 5F2FA 35C8H 1WISA 4UDTA 1BOGB 3CHQA 5IWLA 4FLOA 4HQQL 4DH2A 1KJ2L 4XWGL 3GK8L 4IRJC 2WXMA 2AJ3B 2H1LM 4KQ0A 2EDBA 1S7SA 3HI1B 4ZFOL 4GRLA 2G75A 4JM2F 3F7LA 5CP3A 2J6EH 2AEPH 3LIUA 5AYUL 5BO1H 1J5DA 3LZLA 3LS4H 3KE0A 1XGQB 5FA4B 3QUZC 2HMID 4TUJB 3NP3A 1HZHH 1MVFA 3WUWA 3UTTB 3FO0L 4IGBB 2PNDA 2UUDH 1LQSR 1ZVYA 3MZTA 1DANT 2OMBA 4OZHB 4DP4X 3OC5A 2FBJH 1G6RL 5J1AA 4AC2A 1WFOA 1FGVL 1ET7A 1EO8L 1FVDB 3GS4A 5DS8B 4ZSOA 3PNRB 4LIQE 5CSZB 1NSNH 1QW8A 4NQSB 3S97C 5FGSA 3RZWA 1FL6A 4P5TA 3SB3A 5AQ0A 3VXTB 1RI8A 5E8OA 3NPZB 1CTOA 3TBTA 3DLQR 1NCAL 1RK1B 1DBBL 3PIQB 4KROC 4ELMF 1EJOH 1YSOA 3BWSA 3LB6D 4X7DC 4PJCA 3QAQA 4H8VA 3MGOA 5SWSB 4I0PD 1S5IH 5AW6B 3QG7L 1S7RB 3NCEB 4JQIA 3NFNA 4AOFA 4KFMA 3T3PF 3IXAA 2IAMD 4HUMB 4POYA 1SLXA 1J86A 2Y1AA 4JY5L 2H0EA 1L9NA 2XYBA 4KZ0A 2ICWJ 1WD9A 5FV1L 2H32A 2CDGA 1PZDA 3ZXAC 1RFDH 3MGAA 3ZRFC 4O5LH 1CU4H 1FLTX 2FGZA 2NSMA 2XG5A 3TOPA 4DKFH 4AIZB 2QQKH 1T4KB 1NOAA 2IG2H 4WIQA 4C56D 1BQLH 3I3DA 4TNVK 4AVKA 5J57B 3MV7B 1TLMA 4FG6D 5CS7A 5MEOB 7CGTA 5AKVA 3NAAL 1WIOA 5BZZA 1A7QL 4N2CA 4CJ0A 4I8DA 4LBEA 1J1OL 1B4TA 5HP5A 2BVQA 5LBVA 1VGEH 4HV8B 3EZ8A 2EAEA 4X6FA 4YDIL 2I5YH 1E43A 3EH3B 1A3LL 4FDWA 3GLDA 1JGDA 4NKOA 4ZD3H 2HYMA 3K8MA 4N2KA 4Y16A 1Q1JH 3UH8A 4CN1A 4NZUH 2XV6B 4XPGL 4JO2H 4AEHL 3I50L 5E8PB 4G6ML 5LJYH 4JW3A 1Z1WA 1M1SA 2YAHA 2BRRH 4LU5H 3FTVA 4JM0A 2V37A 2WW8A 2I32A 4K94L 1Z9MA 3BDYL 5ABAA 5EULV 4FG4A 1QWNA 1EUTA 3VRLF 3VQ1C 1JP5A 3D0AA 3SYOA 1ID5I 2XNAA 3GSOA 3H42L 5E7BA 2CJTA 4P46C 1ZVSB 2EO7A 4M5ZL 3MVSA 4KMTH 4KDWA 3UBGA 3LZFL 1JXJA 5T33L 3OMAB 5L7XL 2XIDA 1AXTL 1RV6X 2VITA 4TULH 3D52A 5T3ZH 4XP5L 4YSAA 4F9LA 1D9KA 2YKLH 4YHMH 1G4RA 4CNIB 3O6MH 5E2VH 4UNUA 1I3RB 3APFA 4I18B 1TZHA 1T0MB 3QUGA 3HB3B 3G5VA 2EDMA 2W9EH 5L2JA 3TO4B 4JANA 1NEZB 5BV7L 3EYQD 4IOFC 5HI4D 4GFXA 7FABH 3FT3B 4A6YL 5FO9B 3R1GL 3UYPA 4L3ED 2YQGA 1T2XA 2FWUA 1QVOB 4DP9X 2FZ3B 4E5XG 5C7XL 3IS1X 3L5JA 1VFBA 4LB8A 1V3KA 5DT1L 4EI5B 1NBCA 3GZKA 3OB0K 5AFAA 2HAZA 2JIXB 2VZOA 4Y88A 5F9WB 5C08B 1LILA 4TOYH 4DHLA 1X5HA 5AOJA 2Q20A 1KCVL 2HFGH 5DCCA 5DQJB 5KSAC 3W5NA 2W60A 3D0VB 3ECBB 3CXHJ 4U3CA 4L8CA 4XC1H 3G6AB 3OXSA 3S34L 2MQ0A 3LIZA 2OMNA 4HJ0D 1MRCH 5C70A 4PJ5B 2EIBA 2B9BA 3GM0A 2D0GA 5DMYA 1JWUA 4R8WH 3EYFA 3VX0A 3VYNA 2P5EA 3U9PL 4NO2A 5EORL 4NZTL 4D9LL 3PRZA 1T2QL 1I1CA 5IHUH 2VJ8A 4K5LA 5EU6B 3NIDE 1TZ8A 4JRYE 1FC1A 1NDGA 3IFNH 4JRFA 4K7PY 5BS0A 2C1PA 3ULAB 5CJXC 4D0DB 3G04B 4E68A 4I3RH 1E9OB 4FOMA 1AXSA 2X4TB 2XIBA 4Y2OB 3SY6A 4XOAA 1YYML 4HALA 4KXZH 3O9WB 5GQBA 3BRDA 2EXYD 3V6ZB 5TF1H 2KS0A 4J3SA 3BC9A 1A65A 1SDDB 2ROYA 3KPSE 4NC1E 2DJUA 3CFQA 1S9WA 2QGBA 2XG4A 1JTOA 2ZYHA 4L37A 5FYKD 1MDAA 1W80A 2VW4A 2DEXX 1MCEA 3U6RA 3TNNB 3VVVA 5KW9L 1UT2A 1XIWB 1YECL 2ZUSA 3I6LD 2C7FA 5E6SB 1F11A 2NQ3A 3CSPA 1GGBL 1R34A 2DDQH 1G94A 1M1XA 4DGYH 3ABGA 4EZMA 4JFSA 4UB0L 2WB7A 5C0BB 4N1EA 1TU2B 3TN0C 4K7FA 4ZTEA 5L4MA 1CVSC 4HIHA 1YJDC 4O2FA 1RY7B 2HN7B 1ZPUA 4OVVA 4TVUA 4ZUUA 3MV8B 4U0QB 3NMEA 1QLEB 4Z0BL 3SDYL 4L48A 2HTLC 2O6DA 4YL9A 3NSCA 3WIHH 3NGBB 2BCKB 5AW3B 4UQEA 5T3XE 1NAKH 1BVNP 3BO8A 4LSVL 5K93A 2HJKB 4G7QB 1JE6A 4H13C 2MTAA 3BVWA 3ARDC 2XPGA 5J6SA 2ICEC 1LP9A 4YSEA 4KUZH 4X7SH 3SD2A 3V95A 2QV4A 3U6XA 4Z7WF 4Y4HD 2G0KA 2UXVA 1G9ML 2F53E 5F9JB 5JXEA 2VR6A 1ZLVH 1PQZA 3QDMD 5FYLH 2ADJB 2BWIA 5FWQA 4P9MH 5AWNL 3IJHB 4KPHL 4WLCA 3MOBH 4PRHB 1UT1A 4HFUL 1Z3RA 3NCYS 3QIWA 4XNXL 4GAJL 3GZQA 3EO9L 5CBEA 4LQFL 4W9LC 4PVLA 3ZKMD 1QSZA 1TTBA 2B59A 1JZEA 1S9VA 2YPLE 4K23L 1DVSA 1FORL 4JAMB 3FFCB 4XNBA 2CHNA 3AY4A 5TE7H 3UZEC 5KSBA 1T1XA 3WMPA 4Q9RH 5F7FA 1SOSA 4V1DA 4F15C 5CEYB 4JFFD 1Z0NA 2M1KA 4CVZA 3EOAB 4MDRA 3SYAA 3H9HA 1AGDB 3K8LA 5I0WA 5IB3A 5EN2A 5LWYH 2XRAH 1RHHB 2OJEA 1ZANH 1PDKA 2VN3A 3TA3A 1WT5A 1FHGA 4NKMB 5D7KE 1EGJA 1HT6A 1H3PL 3VG0H 3QI9C 1XGTA 4R7DB 3U30B 5FO7A 1RZ8B 4X6CE 4XO9A 4OFYA 1A1MA 5K5YA 2WP3T 3S5LA 1TEGA 3QFJD 3WHXA 4N9GB 4FXKA 3OKKA 1T1ZA 2PMZA 1R19A 1TZGL 2YA0A 3OB0H 4UIKH 4NQCD 1AD9A 3P0VH 3PDOA 3QRGL 2BERA 2ZONA 5F0LB 3RJQB 3V0VA 3WNLA 1SXAA 4JFEA 4DEWA 3IDXL 4PJXA 1H5BA 4Z3FA 4C57C 5EU4B 3BFOA 4IRZA 1DJYA 1IGIH 2L8AA 4HK3J 4XPAL 2E7LC 1P7BA 5I1EL 1VHPA 2JTDA 1MCCA 2NSQA 3QULA 2QT6A 1UYWH 2AEIT 3MSPA 5FK9B 1KEGH 1F1GA 4JGNA 4P23B 3KHQA 1BIIB 3CK0H 3QJXA 1MI5B 1LEIA 3MUJA 1IBGL 3VI3F 1C5BH 3CN0A 1EJFA 2CUMA 3N1PC 5GGTL 2ZX8A 3EYOB 1DLFH 3GBLA 1ZLSL 3BH9A 1UEYA 3FFDA 4AYID 1DZ0A 1LHZA 2CDFA 4FC3E 3D85A 2BP8A 4FKKA 2FL5A 2ZG3A 1FFRA 1CLOH 1XHHA 2BX5A 1Q9KB 3CVHB 1XZWA 4IGBD 3JUYA 2I24N 5E6IB 4Q14A 4KXAA 5GJSH 1WCQA 4QRQA 1WGVA 5I8CA 4X80H 4JM2D 5GIRB 1SJEB 1NBQA 2BNRB 5F9DC 5ITFA 3MCLH 1VESA 2H9GB 2QADC 1R1CA 5DXWA 2DH3A 1HX0A 3T09A 4F92B 2C3VA 4Y7OC 4K2UH 4G43A 4RGMC 1LQBC 5FGBA 5JTWA 1L9QA 2CG9X 3FU5A 1P2CA 5D2NC 1SOQA 3PWLA 4LKXB 4LOFA 2CO2A 4DOHB 4LDLB 4LAQL 2PO6C 3TC9A 2WLJA 1SXBA 3IJ7A 3K0YA 3EJSA 3NDYE 2WTPA 3WS3B 5AKRA 5IQ7L 4XVUC 1MCJA 5SWSD 3QJHB 1HKLL 2VZUA 2VSMB 2QR0A 4YSOA 4YXKH 1UXSA 4IBSA 3WD5H 3DO7B 1WJ3A 3F00A 2F8OA 3STBA 2DQGL 1S7VA 3WN5A 4Q52A 2R1WA 4H20H 3O4LE 4XX1E 5AENA 1P84K 2TRYA 2JJTA 3KEDA 3D4CA 5FYJL 1W72L 4Z3JA 4OCXL 3BI9X 4HDIA 2NPLX 1K5NA 4WJG3 4YBQD 5DUML 3T0DA 3CZJA 3MV7D 3SQRA 4YH6A 5JDSA 4HW6A 3VTMA 4XNUH 4C4UA 1JK8A 1Q1PA 1WVZA 1UKTA 1TEFA 1YEHH 4HX1B 3V0GA 3FQTB 3A4EA 4XNZB 4R90H 3C9NA 1NIBA 2JQZA 4HIXH 2PF6A 3HG4A 3NRQA 1MHPH 4FG0A 4YX2L 4IEFA 3ULVL 3OX8A 1M7IB 5TDOA 2J1YA 3ZT5A 2LU3A 5T1KB 5H37A 3VCLB 3R8QA 3HKZA 3SDDC 3WAJA 3ZDWA 5SX4H 2EDJA 4KTDH 1Q9WB 3HMWH 4XRCB 3NQIA 4UT9H 5HVHB 1CG9B 1SHWA 4F9PC 1WAAF 3SKJH 2ICWB 1PYWB 2X3AA 4B60A 3T0AA 3DJZA 3CZFB 4LGPB 1BQ5A 3ALXA 5C6PB 2GT9B 3KJ6H 4C58B 3M17B 1XR9B 3VD4A 4HT1L 4G6KH 3Q1SL 5JPNA 1I1YB 1FL5B 4EBQH 4JG1H 3K6SB 1XF2B 2NUPA 1IAOA 4U49A 5E2UH 1DYZA 3HOGA 4M5YL 2A6IA 3HC2A 2OMTB 1Z7JA 5E8NA 2IADB 1R4XA 1B9KA 4P4KB 3IDMA 5K9KA 3K4AA 1VFOA 2ZJSH 3QDGB 4OLUH 4YPGA 3T1FB 3HB3D 2IH3B 2K6YA 2ADFH 4UV4H 2NDGA 3EJZD 3IU4H 3TO4D 5A2FA 4DCQA 2VO8A 5D1ZB 3GJEB 3F2LA 3MTXA 1WBXA 3CX2A 3SE9L 3VMOA 4XP1L 1OD9A 5AVYB 1KBGH 1KPUB 4EI5D 2R4RL 2NNAB 1XTMA 3Q48A 2ZOWA 2JIXD 4PRNA 1BOYA 5C08D 5IW1A 1XGPA 4Y19A 4J5VA 4M43L 1PZBA 4N5ED 1OAYL 2QFRA 3BSZH 1RSYA 3KNBA 1MCOH 5LG1A 1G84A 4Z95L 5EU5A 2H1PH 1YDPB 1NH6A 1OSEA 3L7FA 4M1GL 3SDAC 2VXQH 4FJZA 4AV0A 5I6PA 3WENA 3PQYE 4PJ5D 3O2DA 2IWKA 2QKSA 5DJXB 5FIEA 3RURA 3O3EB 1KB9K 2XDHA 4JQXC 2QVKA 5KS9F 5DMGC 4XWOD 4U05A 3S6CA 1MKFA 4ZOAA 3UAJD 2GUOB 2VDPB 2JB5L 1N3NB 3HJEA 3IMRA 3V4VB 1MCBA 2R29H 3T2NH 4IRSC 3W82A 1BWMA 5KJRH 2X7LB 4HUUB 1PFOA 4X7FC 3V0HA 4U6HB 3LRSA 3PWNA 2DBLH 2ESVB 3MRDA 4ZAKC 8FABA 2DQFB 4JHAH 1HH6B 3BXNA 1ZAGA 1LD9B 3QR2A 2OYKA 1MFEH 3RZCB 1ET8A 3M1BA 1D7CA 3IPEA 1B6UA 3CZGA 1YMMD 4JKNA 1HI6B 4XMKL 3BVNB 1Y6NR 5BZWB 2NZ9C 2E75C 5JQIB 2OR8A 4OZ4A 4FZ8H 1NAML 1XIWD 3FTSA 3T4AA 4MS6A 4U1HA 3VGFA 1UWEL 4XPTL 2FWOA 2WTRB 4ZX6A 5IHBA 2WNGA 3GIVA 3HS9A 5C0BD 3ZK0A 3VXSD 5JW5B 1RP9A 1AGEB 4WI6A 3MJ9H 5DZJA 2B9AA 5SWZD 4X83A 3T0EC 2QL1A 4FMVA 3BPOB 3MV8D 2PWEA 1CFVL 2XA8L 4HJTA 4TSAL 2UXGA 3TU6A 1J12A 4HWZB 3MA9L 4DEUA 3LJ3A 4JY6A 3QQ4A 2VM3A 3P2BA 1AACA 1G0XA 1S2EA 3TYFB 1IGJA 5I5MA 2AF2A 2QLYA 3B8SA 1NKGA 4NWUH 5D1XB 3VDCA 4FHBD 2VXVH 4KMQA 1DQMH 3H4HA 2WGNB 1PKQB 4Q6YA 5GHWH 5ICXA 5T5FL 4LRIA 1XFPA 3VH8A 2JJVA 3QUMB 3P73B 3RFZB 1A6VL 1TUPA 4XMTA 2OI9C 3AQYA 5BNXD 1MCIA 2Z91A 2O1AA 2VC2L 4O02B 1MW2A 4X6EB 2R39A 4M7LL 1WZ1H 1EK3A 1BM7A 3BDBA 4PY8J 1ZWIA 4WJ5B 3CX5J 2A38A 1BGXH 1OAXH 1AD0A 2Q8BL 2HVKA 2VAJA 4J8QA 5FW6A 5T1LA 3FFCD 2APFA 3KLLA 3A67H 5IVXE 5T1MA 3MXVL 1PBYA 4YS4A 2OMYB 1IX2A 4X5XA 3ABKB 3E6HB 4OJCA 2FIKA 4XOEA 4KAQH 3K2UL 3K4ZA 3F12B 2P80D 4XCCL 1HQRA 4PH8A 3TFKD 3Q2NA 4KHXL 4UAOC 2ED7A 4W9DC 1SBSH 5PCYA 2A1WH 4FQXD 5CGTA 2J44A 3D39B 1I9IL 4X8JA 3VD1A 3C5ZC 1HHKB 4OI7A 3BZDA 4X8GA 2AZUA 4LLYB 1KY6A 4U3SA 1G7QA 3B2XA 3EYSH 4CJ1A 1D5ZB 2HJLB 3D69A 2DMGA 1MHCB 3DETC 4WHCA 5JQHC 1N26A 2QBWA 5FM8A 1BECA 3UTSA 2R0WH 4HCRH 3W3BA 4YHPA 4NO0A 1U8MB 1Y7VA 3NA9L 4JM4H 3MLTA 3L5WA 4M7JH 2PPFA 1T5XA 5E5RB 3K4DA 3ESPA 1PZ5B 2IOOA 5F1IA 2H41A 2X2UA 1MJ8H 5EOQL 2OJZL 3TJHD 1HC1A 4JO1H 3LXBA 4ONOA 5LCVH 4TQEH 4OFQA 1MCPH 4JJ5A 4QO1B 4XBGA 2UZXA 4ZFQA 3EH5B 4YEFA 3FN3A 3BWAB 3I3BA 4Y4FA 4R9HA 2VMJA 2EZ0D 3O0RH 1ZA3A 1BVNT 1UT9A 1MI5D 3ECUA 2XTJC 2WSDA 4LSRH 5TE4L 1CD8A 2O5YL 1RIHH 4H8PA 3C60D 4WFHD 5HHXL 2OZNA 3KW8A 4H8HA 2JF1A 3II1A 3QC6X 4CAGA 2CHDA 2VDMH 3EO1B 4LVNB 1OTSC 5DUJA 3V4PA 2WLLB 2X6AA 1JL8A 3MI6A 2CJSA 2EDXA 4HUKB 5E6ID 3MRNB 1WF5A 3FBKA 4NQEE 1RSFA 4UTBA 1XWVA 3ZDYB 2YUWA 3GI8H 4O2CA 3UXFA 1AZBA 2BNRD 1F3DJ 1EEUA 4HBCL 4MNGA 2X87A 4FQ1H 4YR6A 1EERB 2Q3ZA 2B16A 4JDTL 3VA6A 1KF9B 1VGKA 4WW2A 5DHVB 2GB2A 2NYZA 3ZTJH 2APVA 1HILB 1T6BX 3VU2A 1HYRC 4PV1C 4PLJD 3MV9A 3HCVA 3ASNB 1DTUA 1YNKL 4AG4H 3PHSA 3TVMC 4G80B 3BHBB 2IBZX 1TQUA 5LB1A 3A6BH 5ICYB 1CVRA 1U93A 1BZ9A 5F7UA 5HBBA 2WBJA 5IF0B 1PTZA 5JOPE 4L0ZA 3HZYA 1DR9A 2DIEA 3KH4A 3RI5F 3SZKC 1IZJA 4ERSL 2B0SH 2J88L 3VJ6B 4PS8A 1T2JA 3P1VA 2Y4SA 4L9LA 3RTQB 4F7TA 5D8JH 4L1SA 3T2PA 4LLUB 1ETZB 3BPCA 5LO7A 3OKOA 1JS4A 3CJJA 4FERA 4ZNEE 2YSTA 4XPHL 4NUGH 3QUKA 4GKZB 3M88A 1E5ZA 4B7LA 5JXAH 1I82A 4AL8L 4EIGB 3MJ7B 4LLVB 3MRLA 2RBLA 3LHPH 3STZA 1VDGA 2FBRA 3RX9A 1HJBC 4Q6IC 3QWRA 3VWJB 3QUHA 5HPMB 1YEFL 4NT6B 4N1HB 2PABA 1EFXB 2VQUA 1KC5L 3PAUA 1NGZA 3V10A 2VE6B 5T1KD 1QMUA 2UV3A 5DD5H 2YSSA 2X70A 1S7QA 3EYVB 2A4CA 4Y4KC 3P30H 3K2MC 1BJ1J 4JO8A 3FCSA 4QHKI 4WY7H 5ELIA 5JO5A 1AQ8A 3L4WA 1F4WH 3HC3H 1KYFA 3S3DB 2GW5A 3CN2A 4ZOBA 4GAAA 5C0ND 3RLSA 3VXMB 4HIQA 1URZA 3ZUCA 1XB6A 3B2UD 4WGVB 1S3KL 3SGDH 5KYXB 2Z93B 2AXGB 5IEHB 1JNLL 1R5IA 1QBBA 2DY2A 4YBHA 4S2SA 4KXDA 4G9DA 4OKVB 4DPRA 4AQ1B 4WSGA 3FO1A 1X9UA 4R3SB 4LEXH 1DANU 1IKOP 2TSBA 4P4KD 4PMEA 3UJTH 3UTZA 2AK4A 4B95C 3RDTB 2NX5A 3TBVA 3CZKA 1EZUA 3QDGD 1JXFA 5MENB 3QAZC 1QSVA 1DL7L 1I31A 5LXGL 3RPBA 4RDQF 2A74B 3JYCA 5D1ZD 1SGKA 1V7NH 4O51A 1XGZA 4F7CB 2AJSL 4PJAA 1C16A 4EXPX 1AGCA 1WK0A 4ALAH 1AQDA 1X9RA 4HIEB 3KHOA 3U4BL 2LU4A 1OANA 4PJ8C 4PRDA 2DQEL 1SMAA 3FQWB 2DJMA 2LTQB 2ZCZA 3D34A 5G5DA 2JV6A 4Z7UA 4RRPA 1O6TA 3NEOA 4JKPH 2AP2A 4GEJA 4YHKL 1R33A 2P43B 5K59E 2Z64C 1X5ZA 3W9DB 3RYMA 2NNCA 4MMXC 5BJTA 1G7MB 3FHEA 3HUJA 1XQ4A 5D5MA 4HC1L 4LCUA 4OLZL 4E0RA 4X9IA 2QKIA 2EDEA 1C5DB 1ASQA 5DJAB 1MRDH 5FB8B 2YR3A 1AIFB 4GSDL 4XB8A 4E9YA 1R0AL 3PHOB 5CZXD 3WTVA 4MJ4A 4PVBA 3EYUH 3DUUA 2G2NA 2V7HB 5IROC 2QHRL 4ZMQA 3BCDA 1FG9C 4YDVB 2I9TB 5C8JB 5GRUH 4UTAH 2WWOA 1OTTD 1X5JA 3TJEL 1UXLA 1J8HD 4W9GC 4WO0A 1ASPA 2MCAA 2Y06H 5E8DL 3QJFB 4ZO9A 1SYSA 1JFQH 3F7VA 2XFXB 5IV2A 2F9BT 5DRZA 5AOZA 5JQ6L 1P4LA 1BFOA 3SIKA 1P5UB 1VZGA 5E2JA 3RZCD 5AVZB 3MJ8A 1GCYA 4TL5A 1TQWA 3II3A 5CF3A 4K8RH 4IOIA 1NIFA 4A55A 2KH2B 3L81A 4LARH 5DUPH 2YK1L 1K72A 4NN6B 1I1RA 2HG5B 3RJDA 1SXNA 1E2VA 1TZAA 1NAMA 2CRZA 5FF6A 5FUCC 4JEGB 4U1NA 1K2DB 4BE5A 1J5OL 4QOKE 1KFAL 3CZSA 2P5WB 2ZOLA 1Z5LA 3V0WL 3VFOB 4DP6X 1QBAA 2ZSWB 4NFBA 4XVJH 3RVWD 2VAAA 4OAWB 4I5BB 4PJFA 1N10A 3VSVA 2JCCA 1NCUA 3C8DA 1WUZA 4OZIE 3L3IA 4NQQA 2BOBB 2DF3A 2XZQH 4Q0XL 4ZFZA 2H6UA 3B6SB 3CDZB 4YMPA 4IIZA 2JLPA 4MDIA 4RZCA 5FFLA 4PJEA 4KX8A 4PLKD 3IGLA 2P8LB 3MBEC 4J3VA 1RJLA 4ODWA 4WI4A 3U9UA 3WJMA 3MCYA 4O58L 1FO0L 2ADYA 5KG9A 1FZJB 2JJWA 5I8OL 2VDQL 2HG0A 3BUBA 2BP3A 4GSUA 4OZFB 4QRUA 3V4LA 1HU8A 2GAZB 5FYKL 1O7SA 3BZFB 3BH8A 3BUPA 5AZ2H 5ISZB 1AO7B 2R2CA 1RJCA 3ZU8A 2QGCA 1TPXB 3OJ2C 3RX8A 4AM0A 4B9JA 3DSFL 5CINH 4I3SL 1M7DB 2FJGA 3GBMH 5DJYB 2HT2C 2Z1PA 4TV3A 2WCGA 4N0FA 4MB1A 4QYOB 3AG3B 2F7OA 4GMTL 1CFNA 4JRXA 4Z78B 3AABA 3H9ZA 3VXRE 4N2MA 1CGXA 4NM8H 1QSFA 1UWGH 1A1OA 2M8XA 5C3IA 2WOBA 4GW5B 3IVKA 1YLBB 1YQVH 1LNUA 1AP2B 1M9WA 4CMMB 5F9OL 3OR7A 3QBTB 1RIVH 1IL1A 3G6DL 1BD2A 5I1DA 3UO1H 4JCMA 4KXBA 4FXGB 4AYFB 3NYKA 3LMJH 1GKOA 1UH2A 2VXTH 4PHXA 4OM1H 3CD4A 2HWZL 2PP8A 2UYLA 4DVBA 2XQYG 2R51A 2XY1A 4NYLB 1KIUB 2C9UA 3D39D 4KJQC 4OD3H 4BQBA 1OHQA 2IFFH 2Y07H 5A2CA 3I2CH 4P2QA 2IJ0C 4G6AD 5D1QB 3S37X 3QO0A 4S1DD 1CLVA 2R7EB 2QZQA 3B37A 5F21B 3UEZA 2X4PA 1P7QD 3WL9A 4XB7A 5KOMC 3L5IA 4BSVB 2AVGA 3OXRA 2CJ3A 3BKCL 2VR8A 3O6KL 4BSWA 2C1OA 3SDCA 2YPLA 4N0YL 5M95B 4XAWH 3ZMRA 4Z7IA 4KJWC 1H3UA 1KLGA 3TWYA 1E6JH 4J3OD 5IIEB 3QHTC 3CMOL 1WA2X 5JDJA 4TRPL 1KLUB 3EJCA 2XT1B 4ZTOH 4FI6A 2DPKA 1WZLA 5CFAA 4NXKA 5LAXA 4DP5X 4F8PA 3IGUA 1RQ5A 1YNLL 2DQTL 3RWFB 2V7NB 3KPRE 1F90L 35C8L 3DSNA 1PD1A 4M8QA 4LFHD 1LMIA 2XOTA 5L4JA 4RNRA 4LNVA 3RB7A 2OAAA 2ICCA 3L1GA 2DWEB 3GJFA 3VI4F 4JVUA 2QLVB 4BFJA 3EO0B 1F8TH 2WWMC 4A66A 4K15A 1TVDA 4DN4H 4R0LB 1UGKA 4ODVL 4ZOEA 2VWEE 2YRBA 3D0LA 2Q7YA 3WY1A 5J3HC 2WGXA 2J6EL 4ZO7A 3DMMA 5BO1L 3I02A 3L3KB 2JKRM 3LS4L 5IBTH 3ML9A 3EFDH 3KWWA 5DLLA 3CN1A 1HZHL 4UOQA 3QFGA 1CBVH 4A7GF 1J5CA 4HHAA 4JE0A 3N85H 4IM8A 4ZUWB 4GKLA 2FBJL 3U4EA 5EC2A 2Y7SA 2WN2A 1FCCA 4KNSA 3L17A 5M94B 3LHAA 1NIEA 3FU7B 3I85A 4I2XA 5AOMA 3ULUF 3MCKA 2W0LA 1IEAB 3C6LC 1NSNL 3B9DA 1MFCL 4LGSB 4IW4C 2ZNXA 4PJIE 2EDDA 3GSRA 4TNWK 3OC8A 3VGGA 4ALAC 3LQZB 2J55A 4NP9A 4XODA 5B21A 3QIBB 2YMTA 3FQ4A 4UQCA 1CLCA 2R15A 2HT4C 4MXQC 4JZJC 1DQJA 3O6FA 5IW6A 3DROB 4GXUM 2VLME 3IMTA 5GISH 1EJOL 5GZNC 1JZ2A 1DUYB 3U36A 1TIUA 2X1PA 2XWZA 4F2ME 4N8VB 2K4WA 1S5IL 5DVNA 1SY6A 4BFOA 4XBMA 2X3CA 5E95B 1CN4A 3ZTNH 5D7LB 4FI7A 3OKNA 2WY3B 1A7OL 1G7PB 2EDTA 2YMXL 1MQKH 5EO1A 3RTQD 3U7AA 5HYJB 5HYQB 2Y7QA 1S7UB 1NFDB 2BC4A 3D9AH 4XAKE 4O5LL 4Y5YA 2XTJE 3ULUH 3KM2A 2NYYD 5CIPB 4WU7A 5FDWB 3WFCH 4BZ1L 3G6JF 1G0DA 2H0FA 4JFHD 3U4AA 5GGRY 2BNQD 4GRWF 1KBWA 1ZT7A 3QQ9C 4XCNA 4G3YH 1FVEB 3RP1A 5IQNA 4ODUB 3UO8B 5KVEE 2HX7A 2BO0A 4Z0XA 1VGEL 3NEEA 3THML 4GG6E 3WLWC 2YFOA 2DWDA 3TT1L 5EDSA 2I5YL 4OCYH 1WZAA 4GNKB 2F8VA 2GITA 5KAQG 4IMKA 2HFFB 3G6JB 1EFXD 4NUPA 5BCAA 4I1PA 1Q1JL 2OQJA 3T65B 4NZUL 3QIUA 4JO2L 2J71A 4NJ9L 3PV6A 4ZUSA 3JWNH 4OKDA 2UWEE 1ES0A 4U1LB 1JBJA 4PRAA 4EQ3A 2VKXA 2HMIC 2BRRL 4LU5L 1DSWA 2B4CH 1AZNA 3FNKA 1XH3B 2VDLB 2XETA 4EUPG 1CO1A 4IRJA 2V4LA 4OLEA 4DZ8B 3PY9A 2YPKB 1JGEB 2VMDA 5GRYA 4FNPA 3U2IA 4Z8FL 1U30A 2XWXA 4UQDA 1YO4A 3X1BA 2ADGA 3UJIL 2LLLA 5EUKA 2W0PA 4KMTL 3B9KA 3QUZA 1ANUA 4OZGF 2MPVA 4Z7OE 3VD3A 5JHDE 2NY2B 2JWYA 3L1FA 3E1ZA 5T3ZL 1D6EA 3AG4B 2QGEA 5AW0B 2Y5TB 1E5BA 1AR1C 3VYOA 1F6LL 3RDTD 4K3GA 3IPBA 3O6ML 5E2VL 4XH2B 5MEND 4OZGB 1YY9D 3LZRA 4I9WE 2VL5B 4MHHG 1R9FA 4G9FA 4MCYA 4UM8A 2DM3A 3WGUB 3UBXG 2AHIA 2W0FA 3HAEB 4BWTA 3Q2WA 4LNRA 3NZ8A 1G7IA 2HLAB 5DC0A 4M8UA 1IVTA 2PTUA 5GS2D 4ZFFB 1A66A 3LZPA 2B2XH 2VH5H 4QTFA 4I85A 3U0PA 2L3BA 4PJ9D 5IOKA 3QRFM 2WTOA 3UX9B 4BUGA 2HFGL 2GY7B 1IQDA 1ADQH 4O00A 2VISB 5F1NB 3RKDD 4K5OA 4NO5A 3OMIB 2VMEA 2FO1A 1QFHA 1G1OA 4BCYA 4HAGA 1JHKH 3FYIB 5A7EA 1FQ9C 4D2NA 3MNMA 4KXCA 3OKMA 1LK2B 2JB6B 4LCWD 4R8WL 3ABZA 8PAZA 3K91A 3HS0C 2VZTA 1RH8A 4PJDE 2O30A 5BRZD 2JXMA 1NC2B 2VQ1A 1FFOB 1FDLH 1HE8A 5JW4Q 1PIGA 1UFGA 3H6AA 4OFIA 4KTGA 4WHTB 2IALB 3AG1B 3IFNL 4PPTA 4K7PX 2CZNA 5HPOA 4I3RL 3KVQA 3QO1A 3QG6B 3UTQB 5FYJE 1BFSA 4FTVB 2WAQA 2VR4A 2Y1VA 3GSXA 4M7ZB 4OGQC 3QDHA 4W4OC 4B9FA 4KTEH 1I7ZB 2X4UA 3S96B 2XXCB 3PFUA 3MO1A 5TF1L 3ATEA 3TIEB 3RWEB 3MR9A 2KYIA 4U31A 3MOAH 1A3QA 4WUUB 1T5WA 3UACA 1AQKH 3A0OA 1JNJA 2BS71 4QJ4B 5DVKA 2NY4B 3GSQB 4BFIA 2P5WD 3QEUA 1WA0X 5CLWA 3E3QE 3AT8A 1I85C 4DGYL 1E7VA 2R0ZH 4GSXA 25C8L 3REWB 3RWHB 1KXVC 1E8WA 3NRFA 3OHMB 3KXFB 2OL3B 4M29A 4P46A 3ULVE 1HSAB 3ARPA 4YXHH 3UTPD 4P59H 3IWVA 1GHFL 3EYQC 4OFDA 4QUOA 5HI4C 4BDVB 1KPVB 4IBTA 2WLIB 4LHUB 3DBXB 4GUPB 3AW5A 5EWIH 4HYTB 5C0AE 3GB7A 4EUPA 2KZ1B 2EUZA 1KPRB 3LEXB 4PAZA 1UFUA 2XVKA 2Y6TE 3WIHL 5J12C 3LPGA 1JZDC 1I7TB 2AMGA 2AXHA 4OUOA 2IBGA 4JPVH 3NESA 3RGHA 4A04A 1AO7D 3GMRA 1IFHL 3TV8A 1N0XL 2VRQA 3CC5A 3MV01 4KI5E 4NRXA 3QDJE 3QFDA 2EADA 4X7SL 2VDNL 3GBEA 3F01A 4HKBA 2BVPB 3MLVH 4R7XA 4UZSA 1IB5A 3C5JA 1IV8A 1MVUA 4HJ0C 3MRMA 1SHMA 1PJWA 2AABH 2K3TA 5F6HJ 5FYLL 5KYWB 1TJHH 5IVNA 4L4VE 2NT1A 3RILA 4RSYA 2WLNA 1IBDA 3NACH 5CJ8A 5DD1L 1IGCH 5KSUB 5KSAA 4KXZI 3W0WD 4NQDD 4PD4K 4LOUD 5TE7L 3K72B 4JO5A 4WHYG 3LSOA 5B38G 1J9TA 3MNDA 3HG1E 3TH2T 3FB5B 4R7NB 4CBPA 3HPJA 5BQ7A 5CEZH 3FU9A 3KYMA 1NBYB 3TF4A 4DESA 2C9VA 3DTXB 3GKZA 2WZPA 4EOWH 2BSSA 5HJGA 5LWYL 3NP4A 4UNIA 3S2AA 3WSQL 1UXWA 2XRAL 2DMHA 3E8UL 2D3VA 1ZANL 4QHLA 3UZQB 4TLSA 5D1QD 4PJGA 1CD1B 1NOLA 2X0WA 4HUWB 5CJXA 4AX3A 2DM7A 3OB8A 4AENA 2O93L 4OCNC 1SVCP 4BSJA 1U8LA 1MXDA 4JNXA 3QZMA 4CRPA 4EZLA 2VDOB 4UIKL 1E4XL 3V8OA 1B88A 3P0VL 2YARA 2F7QA 4E9LA 1NUGA 1AGBA 2CAKA 3C12A 4W9KC 5GGRA 4WNQA 3RWJA 5BUAA 3R7RA 1IGIL 2NZIA 4DO4A 4CL7A 5IB5A 1FZMB 1ZD6A 2CKBB 4ZQKA 3F04A 2XLLA 1NJ9A 5I6XB 1UYWL 3TN0A 3NIDB 4JRYB 2EE6A 3TBYB 2ZXDA 3CK0L 5AKTA 1XCQA 4X9YA 1C5BL 1M9SA 2JTYA 1UB6A 4QRSB 3HE6C 5G55A 1S8DA 3NH7L 1XGYH 4YHNA 3GXNA 1UA3A 4ANWA 3QXAA 4GI6A 3EJTA 3SKMB 4GKSB 1XSOA 4OGYH 4X98B 4KZDH 3ARGA 5IFAH 1RZJH 5BZXA 3KPSB 3QCTH 3TCLA 2P9RA 3ARDA 1KBVA 2ICEA 2F8IA 3RIFF 1YEGL 3NVQA 4M9OA 4NO3B 1PAZA 3Q3GB 2AJUH 3ZKMC 3EADA 2EIKB 2YHGA 1HNYA 1T7ZA 2Y22A 2GJ6E 5DD6A 2DQDH 1AHMA 4XMLL 2YKKA 4KJYB 1CB4A 1S9YB 4Q2ZA 2WB1A 4G8GA 4HA1A 5KOVC 1WIPA 4IBWA 4JBSA 1M2OA 3GTTA 4TM9A 3FFOA 3UZEA 4PJ6A 3O8XB 4RMRA 4RA3A 4LHJB 2ZWKA 3RBGA 1H3TA 2YRZA 3GMMA 2ZYSA 5DWUL 1CF8H 1FZKA 1I8LC 2CGZA 5DF0A 5EOCL 3VFWB 3L3JB 3CIQA 3L4ZA 2EICA 3TGXA 2MJWA 4RSVA 3WD5L 1T3FB 2E6PA 2EIZA 3VUAA 5ABZA 1L6ZA 1K3ZA 1I8KB 3QEQB 2F53B 2YWYA 4H20L 5A3IC 3QQDA 4P2RD 1JF1A 4NNXB 1T20A 3ZR6A 3KPOB 2ZSVB 1EXGA 2C9RA 3QNFA 4MD4A 4X4YA 2F18A 3ILPA 4GOSA 3CLFH 4DJMA 1FE8L 4JG5A 4YSRA 2P24A 4BK5C 1L9OA 1E67A 3CFEB 3NJIA 4XNUL 3OGCA 4ZTPL 2ATPA 1DLHB 1YEHL 4ZUTB 2PXYC 2FSEB 2VZVA 3B7UX 3VB9A 5JNYA 3IMVA 3OBAA 4QT5B 3SQBB 4QRPB 4R90L 1Q4NX 1DSFH 2VO5A 2B1OA 2W9DH 1AHWB 2R0KL 2CCVA 1JAEA 2IVFC 2NRDA 3ZE2E 2VLRE 1R5VB 1MHPL 4H1LB 1QQDB 2CLZA 4OQTA 1TCRA 1QLEH 4TYUA 3FZUD 2E7LA 5ETUA 2OXGB 5BMFL 2XBTA 1P0SE 2HT3C 3D30A 5J89A 1Y07A 2FX7H 2AV1A 4KTDL 2EH8H 3Q01A 3W9EB 3N5AA 1I9EA 4IGBC 4CVXB 1U92B 4N25A 3ISWA 4UT9L 4X6DF 4MCZA 3SHSA 4JE4B 2BZ7A 5ACZB 2R8SH 4ZNEA 5DC2A 4X6CB 1QG3A 5MHSE 4BA8A 3US0A 3QWOA 5DJDB 3KJ6L 3BESR 1JNHA 5I73B 4KQ4H 3MNVA 2ZOOA 4G6KL 2V2XA 3OJVC 4KZCA 4EBQL 4AGQA 3IFOA 4JG1L 4KQ3H 4X6DB 1PY9A 4NHCH 2DL9A 3WNIA 5IB1A 1A6AA 1MH5B 2C7UB 4P04A 4AKPA 3FCBA 1IM3B 2WKOA 1TYEB 4PJBA 4U7MA 2FX8H 4JZOB 4OLUL 4F58L 5FCUH 2J8UA 1U3YA 4P2OD 4AYEC 5DMJB 3IU4L 3G5ZB 5JMOC 2GI0A 3OKDB 3SDXB 4EVNA 4WV1B 3H2PA 1SMOA 2AMUA 3U1PA 5BUPA 2K70A 4HZAA 5D2NA 2PWFA 5HGHA 1U8HB 2Y2TA 3EGSB 4HZ1A 4X9FA 1BBDH 4XMVA 4OSUH 5EMYA 5B3SB 1UZ6E 5IHZA 4N6QA 3KWUA 4A7SA 2BRQA 5FM4A 4JFXA 4PV8A 2AS5M 4J28A 1DVFA 4GUCA 3DOHA 2PO6A 3GLZA 2R1XB 2OXHB 4ZI8A 2ZNWA 3HE7D 3BSZL 5IESH 4RIRB 3KPLB 1XL4A 2GEEA 2H1PL 5D70H 1FFNB 3B43A 3EBAA 2BSRA 2YIHA 5BQDA 3WAKA 1GC1C 2Z1KA 2VXQL 1VB9A 2VUYA 4P0DA 5E1AB 5SX4I 2A9BA 3P2DA 3WO4B 4DVRH 3LRKA 5B39A 2E4FA 5DEFA 1JPEA 4PUBL 5B4MD 4LOEA 4X5QA 3MUGA 5GRVK 1KXTA 3GINA 3ILQD 4G1EA 2B3RA 4KKBD 4CU6A 2H6OA 4Z77B 1HHIB 3HMXH 4A2EA 1NC2D 3H3PH 5DJ8A 3WXVH 3FCGA 1L5GB 4N0RA 1QWUA 1S78D 1U3JA 3EJQA 3M07A 5KJRL 3LRMA 2PPCA 5FDYA 1DUZB 3TASA 4ABWA 2CJUL 2DBLL 4HWBA 1T22B 3PABB 3ZHLA 3B9EA 4FTVD 4ONHA 4CDHA 5INDB 4RWHA 1MFEL 1N8OE 2BHUA 2DJSA 4N2AA 4YDJB 5HGBA 1O6SB 4P4RA 3BDXA 3H7LA 1DN0A 3SDDA 4DZBB 5B8CB 5BOZG 4WUUD 5IHWA 3SPVA 1HHGA 2AFNA 3O4LB 4PCSA 5AD0A 1JNNH 1YEEH 1GW6A 2NY4D 3CVHH 4KK5D 4NUMA 4EO5A 4FZ8L 4F9PA 4IJ3B 4WUKH 1LEGB 1XEDA 2DRUA 2B3IA 4QXGL 3CCHB 3ZE0F 1ZA6A 2V2WB 1OGTA 1FPTL 5CEXB 3B1TA 3FPYA 1JK9B 3KXFD 2XN0A 3HB3C 1QEWA 5DVMA 2P28B 5DHEA 1DBKH 2DYRB 2EE2A 3SKOA 3EJZC 4OCLC 4WEMB 2DZEA 1ILSA 1AIZA 4LHUD 4I9XA 2PTVA 3KPQA 4X7CC 1I8IB 3BP5B 3SPJA 4QAWA 3QZPA 2EP6A 3IJSB 1VCBC 2WV3A 3ARFD 5J0BA 5E9DB 4NWUL 5C0EA 4YGAB 5F9WC 4BIKA 2EDHA 3TWCH 1DQML 2WIIB 1BLIA 3GUTB 5B3JF 2Y2WA 2IGLA 4ZW6A 4XMWA 1U8NA 4GXVH 4QOKA 1BFVH 3K46A 1E4WL 2J7LA 3GMPA 3BZ4B 4KO6A 5EBMA 1A7NH 1H9DA 4B9PA 1A4BA 3MDJA 3EH1A 1U91B 2WP3O 4YPJA 3JWOL 5GSRA 2IDFA 2W92A 3MX0B 3Q6FA 2DM2A 4M5TA 5IB2B 3HNSH 5ID1A 1D7BA 2R0LL 2OYLA 3V5KB 3ZE1F 5J11B 1KDJA 1L9RA 3ELQA 1BGXL 1E5CA 2EC9T 4FS0A 1MG3C 2BY0A 4RA0C 3UAJC 1YEDB 4ZMOA 3F7YA 4UCFA 3SDAA 4KDVA 4HD5A 3WEAA 1ORSB 3O6LH 3EGDB 1CXLA 1WO2A 2RALA 5ESAA 3KZ8A 4U1IA 4KAQL 1YN7A 3NSYA 1V7ML 4I48B 4JQXA 2QQQA 3T8VA 1KJMB 4UM9B 1A1NA 1NCDL 1SBSL 2AJVH 3O9WC 2ZXCA 4ZS7L 5IT2H 2A1WL 2IIJA 4MJ2A 4RAHA 2XACC 1MAML 1XH1A 1JJUA 1OT2A 3M1OA 3MRJB 4Y2DD 4IRSA 4GLRI 5IUSA 4D8PB 5ESVA 2RACA 4OB5H 4YNYA 4YVNA 5FO8B 3EOYG 3EYSL 3EFFB 2IDTA 4L3EE 4ZAKA 1OGPA 1QLRB 3VXRA 2ZX6A 5E2WL 3UAEA 4OF6A 1HCZA 3IF1B 3VSUA 1FC2D 5LGJA 2ICES 5DUBB 2A9NH 2FCBA 4PGBA 2R0WL 5DFVD 2FHCA 3TBCA 2NLJA 2OTWB 1L7TL 2N4IA 1YN6A 3FT4A 3GSNB 4GBXB 3E0GA 2PCPB 4PJCF 5CWSA 4JM4L 2G9KA 5FM5O 3PQYB 2GC4C 5DFTA 1JV5A 4M7JL 3UOAB 1VFAB 1REIA 5DI8A 1GR7A 1Q9LB 1MRFH 5E94B 1BEXA 3BLPX 3NGBC 5JIKA 1BQHB 4JO1L 2DYPA 1IC4L 5DZLA 4EXKA 4TQEL 4YFLF 4N85A 2JLLA 1T6VN 5F0JB 4JRYD 1LE9A 2XY2A 1A0QL 2F7IA 4U1MB 2PW1A 3COOA 3BGMB 3O0RL 3QC5X 1TTUA 3NK3A 1U8IA 3HZ3A 4JFDD 1QO3B 3DHUA 4LSRL 3S4SG 1O7DC 1G9NL 2YGPA 2ZUUA 2IGFH 2D7QA 1JHTB 2KI6A 1DSYA 4Y1AE 3MNWB 5I0YA 1E30A 2N01B 1NCCH 2VDML 3ILDA 5FW8A 3KPSD 4A37A 2X1XR 1R24B 5IW3A 2VABA 1JDAA 2BVUA 3DVIA 4JFTA 3TV3L 3QA3A 4ZZKA 1DQVA 5T8IA 5CBAB 3LZQA 3K5SA 3MYZA 1LO5B 2BDNH 2GFBA 3VWKB 4PMFA 2Z7UA 1H15A 2GHZA 1GYCA 2CE6A 2GTWB 1CT8B 3AACA 5HGAB 3FTGB 4NPKA 4JFYB 2W95A 1QD0A 4E2OA 4ZXBA 1HOCB 4ENZA 5FYKE 2H32H 1A6UH 3WLBA 3TFKC 3PF2A 4Z3GA 1AZZC 3I6LE 3STLA 4E9VA 5KVFH 3GGWB 1TJGL 1MFBH 3P4MA 4X4XA 3VDAA 5DTFA 5I1LA 4PP1D 3U7WH 4YE4H 5DA0B