5LNEA

E. coli f9 pilus adhesin fmlh bound to the thomsen-friedenreich (tf) antigen
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
152
Chain Sequence
FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPVGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative Fml fimbrial adhesin FmlD
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 152
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lneA00
4AV4A 4XOCA 5LNGA 4CSSA 5AALA 2VCOA 3ME0B 4CSTA 4ATTA 1PDKB 2UY7B 2JTYA 5F2FA 4XO9A 2XG4B 4LOVA 4X50A 5IQNA 3JWNH 4BUQA 1KLFB 4J3OF 3JWNG 1KIUB 5FLUA 4AVJA 4X5PA 4XO8A 5JQIB 4AUYA 5AAPA 5AB1A 4J3OH 4J3OG 1ZE3H 4AUUA 5FX3A 3ZPDA 5LNEA 3ZL1A 4X5RA 1QUNB 4AVIA 3RFZA 1N12A 1UWFA 4XOBA 5IQMA 3BFWA 5ABZA 4CA4A 4XODA 2UY6B 4X5QA 3BWUF 4AV0A 4XOAA 4AV5A 3JWNE 5FS5A 4AVKA 4AVHA 1TR7A 5CGBA 1N0LB 2JMRA 4AUJA 5FWRA 3ZL2A 2WMPB 5IQOA 2W07B 3BFQG 2XG5B 3SQBB 5F3FA 3MCYA 2J2ZB 4XOEA
chains in the Genus database with same CATH superfamily
1PG7X 1SHXA 1PBYA 2RBLA 2V2WA 3O2WL 3UACA 1N67A 4BKLB 2BM3A 4JQIL 1RZJH 5T8IA 3MRFB 3RFZC 1RU9L 3M88A 1H15A 4F57L 3HR5B 3ULVH 1HKLL 3OBAA 4Z3HA 2OYMA 4MNHB 2NZ9C 1PDKB 3QJQB 4FLQA 5HDWA 4NN5C 4LRNL 5A2CA 1R3IL 1G84A 5I9QB 3RHWK 1ZHKA 2PN5A 2V9RA 5AW5B 1E4JA 4OTXH 5ICZB 1DDTA 1YUHB 3M8OH 1XT5A 4GP8B 1MREL 4ZTOL 5DFWH 4XHQA 1ZE3C 4QRPB 1E4WL 1J0ZA 2ZOKB 1QACA 2WN3A 1TZIB 5EOQH 1R24B 1WBYA 5D5ME 1G7PA 1ACZA 5EOTA 1CG9A 3GI9H 4AXWB 1QFWI 1QBBA 2DH3A 2YD2A 5GRVL 3QDHA 3SKMB 4PJCB 1T1YB 5INDB 3BDXA 1ZGLA 4HC1H 3WIIL 3LRGA 2I27N 1D5XB 3RDTD 2DWXA 1IAIL 1H3GA 5ANME 3VWJD 4BXVA 1JP5A 3OZLA 2KMWA 1FV1A 4TULH 4KC3B 1RZ8B 2XKNB 4MA8H 5T3ZE 2MCG1 3T3MB 4JM2C 2WZPD 4R7NA 4WV1B 4Z9KB 4ODWA 1BZDA 4HUVA 4LLVB 3C2AL 1MRCL 4AYFB 2DEYX 4PV8A 3IRCA 4CA4A 1AD0A 3P0GB 4JANA 1WC7B 4N0CC 4JFFB 4L29A 1FNAA 1KTDB 4NRYA 1TIUA 4JN2A 4PCTA 5FOBA 4YE4L 4EE2A 3O45B 1DVXA 2WQRA 4UF7C 4JM4L 5HDBB 4KKAC 3AXLA 1FH2A 4FNTA 2MHAA 3AG4B 2R15A 2OR7A 3ZDZF 2Y3NA 1SYVB 1VENA 2ZNXA 3HMXH 3GI8H 5EEUA 4GXFA 4UQAA 4XCNA 1C5BH 1UEMA 1XZ0A 1MCWM 4AOFA 1N10A 4ZXBD 2BNUA 2X2JA 2FJFB 2BX5A 4DCQB 1PFOA 2ZXQA 2BNRE 4U4BA 1EAQA 2WNKA 2LVEA 2Z92A 4RA3A 2G5BA 3QUMA 3LQAH 3ZDZE 1DE4B 1UB5A 3CXFA 4MB3A 4NKIH 5B4MC 2C26A 2IFFL 3IVKB 1X9QA 4WI3A 3SGDH 3KWWB 2HJLA 2XETA 3EBGA 4YZFF 3M7FB 3RYMA 2KZ1B 2QZQA 3RGBA 2DWEB 2YA0A 1T7XA 3ZYOA 3U2JA 1U8QA 2HTLC 2ZJSH 1FIGH 3ARPA 1KJ2L 3MMEA 4KI5C 4PJIB 3TZVB 3ZIMA 5EU7E 4L0YA 1CBVL 3CC5B 3PS6A 5FUCE 3LN4B 4L9LB 3ZVVA 1EFXD 3U9UA 1CT8B 3PWPA 5D1QC 2FIRT 2QQQA 5EC2B 4YDNA 3PWNA 4H20H 4Y4HC 5CSZB 5D1XE 3L95A 3RY4A 4J6IA 2XA8H 4PTUB 2NSMA 4A39A 1XCXA 3C5ZA 3DX8A 3DJRA 4OGAC 4ZMNA 1A6AA 3F62A 2XVGA 1E3FA 1KCSL 2QPSA 1UXLA 4W70A 1A7PH 3UADA 2XZQL 4I9XA 4WNSA 5IF0A 2N7AA 1A21A 3QG6B 5D2LA 3L1FA 4IRSB 4Q4EA 2OMZA 4TXVB 1B6DA 4NWUL 1JZ7A 2DQEH 3NJIA 3D4GA 4LSUL 2C7UA 1VGKB 5KSUB 4OV5A 4PJ8A 3F12A 1MRFH 5JHDD 1NICA 4NQDA 4CVZA 5DHMC 3LDBC 3UAFA 3TTSA 3OMAB 1F4XL 1ET7A 3ZZ1A 1FJ1A 1WZAA 4JRWA 1SMDA 2EINB 3ABZA 4S1SL 4ZMLA 4MQXC 1DQKA 4KUCF 4LBAA 4HUNB 5D2NB 1DYZA 3G6JA 3LEYL 4KK8D 5IOPB 1XF2B 5AYQA 2H7WA 3OWEA 3CAFA 2YBRA 2HG5A 2F8OA 1XGRB 4OI9A 5DI8B 4FQCL 4D94A 1D6EA 1BBJB 4NLAA 2H41A 1YY9C 3OMNB 2VSDA 2W94A 3AUWB 3BQUB 2IF7A 2FJHB 4LHUG 3PNRB 2DI9A 2IPKB 3TBTA 2JB6B 1SYSB 4MD0A 3SN6N 3TIDA 4DP7X 1GCFA 2HSIA 3T3PB 3ZE0E 2VW4A 1P6AB 4LHQB 5L2KB 2X44D 3MRHA 2M83A 3K4AA 3VXTB 3W39A 2EDMA 4UV7L 4G3YH 4XNQA 2WCGA 1QO3A 2BIIA 5C0RL 1GGYA 3JWOH 4HS8H 3ARDA 1M56B 4TSCL 1AGCA 5BRZD 2Z93B 4GSRA 1MHHA 1TZAA 3CFEB 1VEPA 3NSYA 4JB9H 4PS4H 3RI5F 2I5YH 3U9WA 4KDTC 5F89B 2KKQA 1ZSHA 2XN9E 3WO3B 2R1XB 3DUSA 4A2FA 5DT1L 1RPUA 4MSWB 4CC0A 1MEXL 4YL4A 3CHRA 3UTSD 3GMPA 1Z2KA 5DEGA 1MZYA 2B5IB 3K6IA 3QZWB 2YMTA 5G4NA 1LQSR 1U91B 2WXMA 1RZGB 5B3JF 1FVCA 1GVIA 3QEHB 4HK3N 5JA8B 1S6NA 1OSEA 4CU8A 4PJAA 1GRWA 2BSRB 1BQSA 4LEBA 3LZFH 1OTUD 1LL1A 5DQDL 3C2SA 1QNZH 4BFBD 5DJ0B 3PHOA 3E6FB 4NEHB 1QLEH 1SBBA 3FSVA 4NI6A 4X50A 4QOKA 1EDQA 3ESVF 5IK3B 4EUPA 7PAZA 2IQ9H 2FL5A 4O2EB 2Z31D 5D1ZD 5GZND 1UT1A 4YGVB 5CCHE 2IBZX 2H8PA 2BNQD 2YD3A 1E40A 3P4NA 3SPHA 3F83A 1JYNA 5J3HD 1F58H 2J8UE 2DYPD 4IKLA 2Z65C 2EO9A 1T5WA 4FQXB 5IBLD 5GRXG 2WINA 4FQIL 5JXAH 2X89D 1QLRB 5T1KD 3DO7B 2FO1A 1DN2A 2UWEB 1K2DA 2JK5B 3LD8B 5T3XL 3ZSTA 1XD1A 2WTRA 4BE5A 1G6RA 4WO0A 4M61B 4XOBA 3SOBL 2CMRL 3K4ZA 3DECA 1P84J 1YMMD 1ZDQA 4M6MH 1NFKA 1E27B 3CSPA 3D1MC 2B9AA 1U9KA 3RL2B 1EK3A 3JQOB 5DS8B 2OMVB 5J6HB 2CIKA 2ZUWA 3NIDB 3T2OA 2Y9RT 2ZUTA 1A9EB 3VH8B 2WLIB 4AW4A 2RQ8A 1UVQA 5E2UL 5JDSA 5DUML 4XXCA 1HH6A 4M43L 1WV7T 4X6FA 1O7DC 5EPMB 4WSGA 3FSOA 3SZ6A 3OKOB 3ALXA 4X4YB 1B0GA 5F44A 3P4OB 2XXFA 2A1WL 2NR6C 2WUBH 3B6SB 4LLUB 3SPGA 2FD6L 2R56L 2EDJA 1I4FA 1FI8C 2J6EA 2X2YA 2YEVB 5EU6A 2C8NA 3R18A 3NSFA 2JQZA 5DCCA 5H94A 3ZZSA 4ELMB 4OFYA 5BUPA 1WFTA 5JDJA 1INDL 4LKXA 3U0WH 2CJSA 2X4PA 1I9JL 4CC4A 2OYKA 1A3LL 2EECA 4P5TA 1JPFA 2V37A 5F1NA 3HZYB 4B95C 1PF3A 4YXLL 2V5MA 5H2BA 4EN3B 1KCUL 1SM3L 1PSKL 5KSBB 2J4WL 4HDIB 4N0YL 1JNJA 3H2QA 5DEZA 3VGFA 3C60A 3TCTA 5AG8A 5GRJL 5HGDA 1NGPH 5GS3A 5EIIG 3MYZA 3FDWA 2H6PA 4YFEA 5D7HA 1HILA 4GG6F 2JJUA 5D71H 1U42A 1NCCH 2GK0B 4XE0A 3L1OH 1J87A 1NC2D 2X4OB 1NZRA 3HG1D 4PG2C 3VNZA 4L4VE 3SYAA 1DQVA 4LVHB 2FLMA 1KYOK 3SGKA 4QHLA 2HMIC 2F8XC 4JZJC 2YARA 3BIAX 1YJDC 2EZ0D 2Q20A 3BEVB 3O3EA 3QPKA 2CR0A 3Q3GA 2WMPA 1A4BA 3JYCA 3TX4A 4UAOC 4BUHA 3ZHLA 1SJMA 4QTIL 1X5ZA 3QHFL 2IANB 2QTEA 3GS4A 3LXUX 3LH9A 4HW6A 4FP8L 3TFKC 3LRSA 1CGSL 2DYSB 2JB5H 4J3OD 4PREB 4RDQF 1BVOA 4RA0C 1S7SA 1AE6L 1NSNL 3L5WB 4KTYA 2IH3B 3E1F1 4AQ1C 2EDFA 4ZFZA 2VR8A 1CLOL 1OCOB 2E6PA 4JZOB 1G0DA 4K23H 4ZDHB 3QWOA 4AG4H 4Z0BL 4PRBA 5ES4B 1JG9A 2XWJA 1NM4A 3ARZA 5BZXA 4UU9A 1DLHB 1G9NC 2WIIB 1FNGB 2ZYHA 3HE7D 1H0DB 1DBBH 4ALAH 2A74A 2RCSH 1WTLA 1ZT1A 4RH4A 1I8MA 1OTTC 4YDLC 4FKKA 2BHUA 3OZ9L 1T20A 3QUYD 3KLHC 1TLMA 2EDQA 2P24A 3HPJA 5KYYB 2XY1A 3OHXB 2KC0A 2UYLA 3F8UB 3ARRA 4IKNA 5DVLA 4BA8A 1IM3D 4PUBH 1GZQB 4K73A 2WBJC 4R9HA 1QUNA 3GSNH 2VXSL 5EHFA 1GYCA 2Q8BH 3MOAH 1HN1A 2IO5A 3FUJA 3BPLC 4JN1L 4K2UL 7TAAA 1XSOA 1S5IL 4H25A 2QKIB 4L3EA 2X4UA 2AZAA 2LW3A 4ZPTB 5JHBA 2G4GA 3BP4A 2H3NA 1KT2A 4U0QB 1HZHH 5CNHA 2AABH 2Z91B 1DQJB 3AWEA 5FYKU 1FGNH 1KN4L 4PJEE 1J7VR 1R5WB 5KVFL 4R4FH 2GSGA 4ZMZA 3QUGA 1IAOA 2CCWA 3L2NA 3FU7A 3WE6A 4ENED 2XX0A 4NCDA 4OD2B 3QUHA 5SV4A 4ZOEA 3LMJL 3D52A 4H2AA 1UXSA 4B0MB 4Y5YC 3LY6A 4HIHB 5GGSY 3ILPA 3AREA 1A1MB 1OGPA 3FRUB 1EHKB 3JTSA 4OZHA 3EO0A 4UILL 4YHZH 1WBXB 4M1GH 5DYOB 3LKSB 2WWKO 4PRID 4ZFFB 4QD2E 4GNKB 3FO0L 1FIEA 1E2VA 3S3PA 4UTAA 1S7UB 1U8KA 4WUUD 1BQ5A 3KYKH 4PGZA 1I3GL 5FUOH 3W1ZA 4OBRA 2B0SH 1H3PH 3IDJA 1Y6MR 4LFHG 2F53D 3KPRB 3O0RL 3PL6B 3VXRB 1S7TB 2QFRA 1ZLUH 3ULUE 2BIHA 3HS8A 3G5ZA 5LXVA 3PNWB 1Q38A 4GB9A 3MRDA 5DFTA 5EZLA 4XTRD 3U9PH 4CMHC 1F8TH 1CD0A 1K5WA 4WW2C 1RZFH 2X12A 1IQWL 3NG5A 3A22A 3BHBA 2PW2B 3CC1A 2FYYA 3FU5A 4XVSL 3KWUA 5M7QA 1OAXH 1B4JH 3HNVH 3DV4A 4JAMB 5DJXB 3JXAA 5LO7A 4GBXB 5HHVL 4A6YB 4Q0XL 5TF1H 5F7EL 3QBTB 3LIZA 4B7LA 4W81A 2APVA 1FHNA 3APMA 1QRNB 4K7FA 2AAVA 1JPSH 5I18L 1XH3B 4XMXA 4DW2L 1M05B 4BWTA 3U7YL 3UAJA 2XQYA 3RUGA 4LPYA 4MA1B 1NDMA 1WCQA 4RLDA 5IWLC 4S1RH 3HC0B 3RVTD 3WN5C 2N3JA 1EHAA 1Q1JL 2AMGA 1HL8A 3MXWL 4Y88A 2WP3T 4F7MA 1OD9A 1TJHL 5J1AA 1EO5A 1BLNB 4KXZI 4LSVL 2YPLD 3UO8B 1GMEA 4JZNB 2WO3B 1DBAL 2J43A 3IJSA 3DNKA 5LNDA 3WNJA 1GGCH 4BZ1L 5ABZA 3RDTC 4IBWA 3V6OA 3VWJC 1UKSA 3WXWL 2Q86B 3ZTEA 1J1XL 4ORZC 4Y19B 5AKVA 3IFPB 5KW9H 1V54B 3QJFB 4DP0X 1CI5A 4L23A 1KCKA 1OVZA 3COOA 1A65A 4B7IA 2WLHA 5EA0H 3WV0A 1VFUA 2Z35B 2A73A 4PGBA 4PJ5D 4HK0A 3FQNB 3W9EB 4WU5A 3ZE1E 3BPCB 1XH0A 1MI5A 1QASA 5HGHB 3MLWL 2RGSA 4JFZL 3GJFB 3AU1B 4PJHE 2P8PA 4IDLA 4RMRA 4O51A 1BQKA 1NGZA 2OR8A 2DF3A 3HNTH 4PTTA 5F70A 3E8UH 1GR7A 4XXWC 1WSST 4BSJA 4PWHA 7FABL 4PJCF 2WTOA 4G7QB 4E9WA 4F3FA 2YZ1A 1QSVA 4Z7NB 3D39A 3I6KA 4ZMWA 5KVDH 1QHOA 1KCVH 2X9YA 2YS4A 4L37B 4ZXBC 3MRCB 3MRBA 1CI3M 1RJLB 4QJ4B 3CZFB 3BRGC 3SJVB 4C4KO 4MJ6A 2OQJA 3UC0H 4ZFGH 2W0FB 4MD4B 3PRZA 3SIKA 2VR7A 4OZFA 1KG0A 4YSSA 3MRJA 2PYFB 3G7TA 3T3MF 4BFIB 1Q0YH 4ABQA 2VE6A 2ZOWA 4Z7VA 4RBPK 3WMSA 1R3JB 1QFPA 1XTMA 5BQDA 4F8TA 2LR4A 3WFDL 1RPKA 3EH5B 3KPPB 5EBWA 2IXQA 1NFAA 4NQSB 1NGWB 5A16B 4YQXH 1P4LA 2YPKB 3U1QA 1OCWH 2EIZB 1A14L 2FQDA 5HDBF 2P5WE 2NY3B 2ROXA 4QMEA 3ZL4L 2DYRB 3VM5A 1BXVA 1WWBX 1NGXB 2WQSA 3MV7A 3A5VA 3DJ9A 2XQBH 5L7XL 3QDGA 1L6PA 3GBNL 1JHLL 1LD9A 1ZHBB 2VLKA 5I1AB 4I2XB 2ZPKL 1KFGA 2F08A 4JFXB 2DWDB 2X7LB 2APXA 3QJTB 3SE4A 5JIHA 5F6HJ 5FB8B 4BUGA 3CDZA 5AVTB 2NDFA 1BZ9A 3LN5A 3L1GA 4HLZG 4MZRA 1PD6A 4NAJA 4ESKA 2PXYB 5IMMB 1TVHA 4J4PA 3X2QB 1N8ZB 3TASA 3NCYP 4GAGL 3TO2A 4YLBA 3OWRA 3D7PA 3D18A 3EYSL 3UX9B 1C5DB 3CLFL 3NSJA 3TIEB 4HOMA 2XIDA 2IQAA 1R5IA 3RIAK 2WM0A 2D9CA 1CE1L 4JO1L 4FQLL 2F7RA 4X8JB 1HCYA 1RD6A 1O5PA 1EO8L 1TJMA 1URIA 3HEIB 3UIYA 1AIZA 4B5ZA 5E00A 5EULV 1QX1A 1NA8A 4Q6IA 3B2UD 3G04B 1HCZA 4AX3A 2D7TH 3HG4A 4EXKA 1X5XA 3OJ2C 3ZUNC 3JV6B 5J8OA 1EZSA 2F68X 3IJHB 3D6GA 3HHRB 5IJCC 4KK8C 4LLDB 4LT7A 3FQXB 2HKHL 3F3HA 1R46A 3B3IA 4PSPA 5SWSD 3DROA 2WQAA 3M7OA 4G9DA 4K3EL 1ZLVH 3VXME 1MREH 4HC1A 3RWCA 1J5CA 4AQOA 1YNKH 4MMXA 1FAIL 2E8ZA 5ID1A 4LQFL 2PYEB 1EAPB 2OLDA 2UXFA 3U4EA 4TVUA 4APQA 2Y2YA 5EWIL 5EU5A 2OXHA 5KG9B 1PY0A 4KO6A 2EP6A 4ANWA 2W07B 4ZQTA 1R34A 1UJTA 3ZE2E 5ICUA 4WQOA 2C1OB 1EEYA 1GW6A 1MCPH 3D33A 3MUHL 1SLUA 5KZCD 1JV5A 1UATA 3Q9PA 2HP4A 2H2SD 3EGDA 1KB3A 4NUGH 4M62H 4PGDA 1SHWA 2O30A 3B2XA 2FHBA 2X6VA 5JUEL 1HWGB 5FK9B 4YIQA 3WEXA 2GBAA 2RALA 4TUJB 5MI0C 3VQ1C 3LSOB 3IKCB 4YK4C 3HMXA 3O41B 4ZUUB 2WB7A 3CX2A 2J6WA 3BVXA 1YEIH 3C2AH 3T4YA 1KPRB 4GEIA 1BVLB 4JO4L 4HEME 2R0ZH 1XR9A 4LLYA 4QO1B 3EJUA 2XXGA 3NIGF 3BPNB 1XL4A 4R96A 5DA4A 5IBTH 2WWOA 4HFUH 4LSDA 4F7CB 4HPOL 3UH8A 3VQMA 1ZS8A 3K1KC 4F7TA 1UG9A 5EZIL 1OTUC 1W91A 2D3NA 3DVNB 5CBAB 4KQ4L 2B7DT 1CZ8L 4TSAL 1IT9H 5FWQA 2XN2A 4JPQA 4EN2A 4UUJA 4M8VA 5LN4A 1QRKA 1PYWA 2GUOA 5E1GA 4M6NL 4L1TA 4N2KA 5T3ZH 5FHBL 2IFFH 2Z31C 1IJNA 5D1ZC 5GZNC 3BCFA 1LO3L 3QXWA 1AI1L 1WRFA 3LZRA 5C0AE 3UJTH 5HSFA 5J3HC 4IBUA 3AS2A 2FWLB 3UTZA 4WY7H 5D7LE 1HDMA 1I82A 5IBLC 3WKMH 4DEPC 1Y6NR 3ZYJA 4NPKA 3S3BB 3I50H 5DJAA 4N8PA 5HYSA 4XX1G 5GIRA 1P9MA 5C0JA 3EOTH 3PJSA 4A67A 2AJVL 3D0VB 4PRAA 2JI3A 1P4BL 4JY4B 4MNGB 5KANI 3H53A 4I4WB 4YNYA 5FYKE 1D9KD 2VXQL 1O7SA 4JGUA 1I7TA 4UM9B 4NLHA 3L9RB 2CJTA 4WWKB 3KMDA 1INEH 1RMFL 4M00A 2EAEA 4TKWA 2Q6WB 5C8JA 5I66B 2AQ2A 4XNDA 3HUJB 5AOJA 1R3LA 4IIZA 3O6KL 4E68A 3ZDYF 2AXJA 2YMXL 1NOFA 3M45A 3OXRA 4MNQD 4X8GA 5IG7A 3CN0A 2R0WL 1BM3L 2JKRM 3I74A 3PV7A 5ECJE 1SY6H 1T22B 4ODUB 4X83A 4P5SA 3Q8AA 1QD0A 1RZIA 5EOCL 1AOZA 3LS4L 5AENA 2ZYIA 5FFOA 2V8MA 3B5GA 4XVJL 1VACB 4XCCL 2ARJA 3I9GL 4JLRB 3O4LB 5KSVB 5FKPA 3QC5X 3ZDYE 1O7DE 2OI9B 1KELH 5FYKL 4S1SH 3T77B 1FNEB 3RY5A 4QRPD 1V10A 4F15C 5E2WL 2CSPA 2IDCA 1YNLL 5E6IA 2DJMA 1CTOA 1I7ZA 1DBMH 5K1VA 3V0VB 1IZKA 2ZD0A 3C08L 2EUWA 4ZO7A 2QFPA 4FFTA 1RP8A 4JQVC 1JZEA 2R2BB 1N18A 5DD6B 3O3DA 4IIQA 3V5HB 4NPYB 2WY3B 3UTPE 5TQ2H 4F2EA 3SGDI 4R7LA 4BJLA 2BVOB 3FAWA 4CSZA 5E8OB 2XWTB 1HHJA 1A6ZA 4K4KA 1UD5A 1XFPA 3S98A 5T5FL 2YN3A 4NHCH 4Y4KB 4PJFA 2H0FA 4G9FB 4YXKH 2A9MH 1JS4A 2VZ3A 5LXGH 5C6WH 2B15A 4PYGA 3NFSL 1HCFX 2X70A 3P3TA 2BLFA 2NMSA 2ICWA 4GSDH 4QY8A 5DTFA 1I8KB 1KIUB 5IW6B 2X6UA 4HUXA 2EZ0C 2VDPH 4PRHD 3QO1A 2WXGA 3VO0A 1S9WA 3T8MA 2H6OA 2O5ZL 1H9VA 5EBMB 5FX3A 4JO8A 3S7GA 1DEEB 1NIBA 4JFWA 5C70A 4QT5A 4J3OC 4MJJA 2NW2B 3OJMB 5KSBF 2MNUA 1KN2L 3VFRB 4YO0A 1TQVA 4JMXA 1NLDH 3LS5H 1XF4A 4H8WH 2FH8A 1J9CT 4YDKL 3HE7C 3F7PC 1UWEL 4NENA 1NAMH 4YN3A 1X5LA 1AHWB 1O75A 2FECL 3FS9A 4NFDA 3UBXA 3QUYC 4DFIA 1O6SA 2ADIA 4U1HB 2W95A 1BD2D 3ARBB 2OMTA 1MCOH 3PP3H 1QSFA 4PRNA 2HLAB 4LLWB 2NQCA 3AB0C 4E36A 4AEIH 1N4XL 1IQDB 3QDJA 3DTDA 1ND0A 1KIPB 1R17A 2EDYA 4Z7UA 1DFBH 5ITFA 1DZBA 2JSFA 2B39A 5CGTA 5TE6H 1X5AA 3Q5YA 3SDYH 4DZBA 3QORB 3A0OA 4V2CB 1LWHA 1RJZA 5CMAA 3KYNA 5EO1A 1VEMA 1GKEA 2BVQB 2F74B 1X5YA 3GIZH 5ITBH 4KZEH 2QLVB 4HXBH 5EF2A 4ENEC 3TBWA 2WV3A 2LFGA 2X4SB 2NTSP 4Z95H 2CO7A 3CFDB 2XJKA 1DVQA 3F7YB 5C0BB 4FYSA 2IAAC 4TUOA 4KITB 1YPZB 3BWAB 2J5WA 2VLJE 3DXAA 5DD0H 3MV01 1XIWB 4HKZA 5IIEA 3OLEA 2YGPA 4TL5A 1E7VA 3T0EB 4H13C 2DQ6A 1JZHA 4IRSD 1JPGB 5INCA 5DMIL 1FZMB 5ILTL 2XQYG 1O6TA 2A6DA 3SE3C 3HC3L 3HB3D 5EOCJ 1NBVH 4YHNA 3QPXL 3ILQD 3CBJB 4XO5A 4U6HB 2QQKL 2ICWI 3BO8B 1HWWA 4M43H 3TA3B 1UUNA 3I2CH 3MRRA 1YEEL 5IB3B 4TRPL 1FNLA 2FX8H 1TCRA 4FKHA 1J86A 3L3OA 5KOVC 3A23A 4F58H 2K9UA 2ESVA 1K8DB 3JWNH 3C6SA 1T7WA 2QPEB 1ZSDA 3A47A 2YZ8A 4X4XB 1OKEA 5BS0E 4XTRC 2JTDA 1L6ZA 3GXMA 3LPFA 2FEEL 5CILH 1TNMA 4Z0XA 2GW5A 4LU5H 5SX4I 5HHME 1AGDB 1N3NB 1J8KA 1I9JH 4L8DB 4UYPA 3EYOA 2FLRT 1T1WA 3BFOA 1E4KA 4HLJA 3UAAA 3BQUD 2R69L 3CDCA 5CJXA 1RJCA 3MRQB 2DWYA 2CM6A 4N0YH 1XGUB 2WLZA 1EVTC 3UG3A 4HOXA 2I26N 4NP9A 1FH5L 1JF6A 2CJUL 3FO2A 3RVTC 4YHKH 1E4XL 2ZXWB 3KH4A 4IOSD 1NIFA 4OF6A 3RURA 3QARA 4YSCA 3EJZD 5DK2B 1UKQA 3PAVA 4U6YA 4UB0H 3T1FB 4ORGA 2VIRA 3PJLA 3NIFB 3L3KB 1Q94B 3E9TA 4BH7A 4OZFG 4G7RB 1S9VA 5B8CA 2Q76A 2ZP0T 5DD1L 2ZSWA 1ET5A 2IVFC 4ODSL 2ATKA 2YGVA 2A2QT 2PWFA 1ZTXL 2H9GB 3C6EA 4KPHH 4M7LH 4PJGA 2NDGA 4U1GC 3LNGA 5ESVA 5GGVY 3S8WA 4K5OA 2Y2WA 1AQMA 3LX9A 1G7HB 4M29A 2BMKA 2F19L 2X6BA 5E1IA 4YDMA 4N2NA 5AAWC 1CLYL 4LHUB 1ZGLP 1AE6H 1WEJH 2CO3A 2D3LA 4EDXA 2X3AA 4XT1C 2W1NA 4JKKA 2VM3A 3U7WL 4TQEH 2LLLA 1CLOH 3GSNA 5DGRA 3V9CA 2H2PD 2NUPB 4WTQA 2WSDA 4OY9A 2GEQA 3OSKA 1RKRA 4IS6A 3IMBA 3SDDB 5GGVH 1XGTA 2ED9A 2EICA 3FQRB 2F54B 2OL3L 4NZJA 1DCEA 1G7MB 3LNEA 1EJOH 1FZJA 5LVEA 1TTUA 3H55A 1CL7I 4KO7A 3KM1A 2BIQA 3MREB 1OW0A 3V0EA 4BQCA 2PABA 3ARFB 2VXSH 3PDOB 5K59E 4BQ8A 4RGMB 4R2GB 3VACA 2DD8L 1GXEA 1S5IH 4FC3E 5EU4B 4FQXD 2XZCL 5JO5A 5IVNA 2HTKD 2VR5A 3IMSA 4WFHD 5HYJD 2NX5D 3SSGA 1HHHB 3DBXB 3B5HA 1CFVH 2VDRB 1H5BC 3BMVA 4DHLA 3BLPX 2V7HB 1DUZB 1OAYL 2CRYA 3CN4A 4XAWL 3PCYA 4Y4FB 3CXDH 5AZUA 2CLRA 3K4DA 4ZD3H 3VMOA 5AW4B 2VMEA 4JDZA 4X5XA 3LMJH 4QUOA 4TQPA 2NY0D 1JGVL 4HHAA 4XNZB 5DMGD 5L2JB 3IT8D 1HCVA 4UOW0 2HVKB 2WVTA 3RNQB 1MCNA 3D3VA 4KHXL 1FPTL 1V7NH 2GT9B 4Z7NF 3C5XA 5KANG 3TH2T 4MD5B 3CFJB 5EZPA 1W0WA 3O3BB 4PD4K 1TQTA 4S11A 1RUPL 2WZAA 4QHNA 4WHTA 4P48A 5BV7B 1U8CB 2FK9A 4ACTA 1BWWA 4TOYH 1H8SA 1N59B 2YD1A 1DQLH 4WEBL 1I3GH 4ZODA 2G9KA 2HN7A 5D7JD 1JD7A 4G43A 5C07E 1EHXA 5CZXD 5I24A 3T2NH 2I9TB 2QR0B 1S7RA 4JFOB 5CD3A 5DS1A 3TF7C 3UG5A 2ZIDA 2UZYA 3DK0A 3T6WA 2Q7YA 4GP5B 3FQWA 5I74B 5CBEA 3X3GL 1JDAA 3ZKSD 3WUWG 4U3CA 2FUQA 3HN3A 1NLBL 1QNIA 5H35B 3ZBMA 4KGLA 4O9HH 4AJYV 4EN3D 4XVSH 3B2UC 3O3AA 1RPQA 4HAGA 2GSIB 1KF9B 4JRXA 5JHDE 43C9A 3U36B 4GRMA 3G5YB 3N1GC 1NINA 3ALPA 1NCJA 1VLXA 2BWQA 4LPCA 1IM9B 3OQRA 3FCBA 5HHNB 5DEFA 2VAAB 2AKRA 2EVFA 2ZX9A 4MCZA 1FO0B 2ZYSA 5GS1C 3VGHA 2W9LA 2V3EA 1EGJL 3STBA 4B41A 1Q1JH 3TNMA 4MLIA 3ULUH 3LAFA 3AWGA 3OF6A 4LSVH 4G8FB 3S36H 3ZKQD 2PO6A 2GHZA 1KB5H 4DGIL 1LO0L 2KI6A 4DGYH 3H9SA 5LAPA 4AIEA 1CDUA 2H2SC 2VCOA 1E65A 1JXGA 3NAAL 4GW1B 4GQZA 4MKMA 1KBGH 2Y23A 3VFOA 1TSRA 2OCJA 1PX4A 3HCVA 4Q89A 3B2PA 4HZLA 3VDCA 5I73C 4G1EA 3IDYB 1OWWA 2D03H 4PJXA 5EIIB 5F7HA 3TN0A 2GJZA 3KLQA 3JTTB 4X80H 1HQ4B 3S6CA 1TVDA 4DVBB 3NOIA 3PUCA 5HYSG 4V1DA 4JY6A 4FI8A 5BRZE 4AEHL 3PGFL 5LBVA 5FO7B 2FE0A 3C6LA 2PCFA 4X7TA 3VRLE 4BGDA 3RA7H 4RMTA 1FFNB 3KJ6L 1OALA 4L4TA 3DPBA 1CICA 1R3KB 5E8PB 1ZE3H 4HJ0D 3SDAB 4B0MM 1PZBA 4H7VA 5FA4B 4E41D 3Q7JA 5C0CB 8CGTA 5LGJA 4OM0L 3UTSE 5IVOA 1FBIH 4LSTH 1OF2B 1NCGA 3EH2A 5I0XA 3JT0A 3LKQA 5E6RB 5DVOA 5M95B 5F6IB 2Y1ZA 1RL1A 3L5HA 3MO1A 3O81A 1J12A 2I60L 2MH4A 3JV5A 2MOQA 1LEIB 2G3MA 1CLZL 1B88A 1FLTX 4XBGB 5BRPA 3OB8A 4R6UA 5IHUL 1HKFA 1G9HA 2OM5A 1SQ2N 3FO9B 1J1OL 1FVDB 2CCLA 2CKBL 3P9LB 2Q8AL 2VDOH 3QIUB 4TVPD 1DJZA 3NCXA 2AJZA 3G08A 2IPUK 4PJ7A 3SE9L 2BNQE 3VI4F 5L7XH 1K4DA 5T1LA 5BO1L 1YYLL 1D9KC 2FSEA 2R1YA 3QHTC 5CN1A 4JR9L 2EDXA 3PPSA 2OSLA 1WITA 4QYOB 2NT1A 3WNIA 3V0GA 1X5JA 2A4CA 1YECL 1LGVA 3W37A 4JQIA 2GK2A 2YD9A 2QHRH 3KPRD 2V2WB 4JKNA 1NAKH 4WZ9A 4UDUA 3U4AA 5TTRA 5I71B 3P0YL 4N1CA 2BS71 3VI4E 1WGVA 3RDJA 5LWYL 5CLWA 1ZVSA 1IAMA 1H15B 4MAYA 3ZR6A 1YMME 1Z0NA 3RGVA 4ZMOA 3MNZA 2D0FA 1C9SA 2YAOA 2P80D 3O6MH 4M3JA 1I3VA 2VM9A 4TN9A 2DKMA 2GIMA 2HJKA 3NSXA 3FH8A 1EPFA 1ZHKB 2B77A 2WHVA 1K3ZA 2CK2A 4JO1H 2XFXA 3QCVH 1VDGA 4F8QA 2YQBA 1EO8H 3MRMA 5C92A 1XL6A 3GTNA 1KBWA 4D8PA 2E6JA 1QRND 4BZ2L 1WBYB 3UTTD 1G7PB 3F6IA 1U4FA 5EOTB 3EYQD 3V7AE 1CG9B 1WGOA 4FLOA 1S7QA 2YK1L 3DKHA 2P8MA 1Z9OA 2G9HA 2C34A 3VCLA 3D48R 4L3FA 4Z23A 1FAIH 1I7UA 3SDXF 5ECGA 4CRPA 1ZGLB 3HUJF 4KQ3L 3VXSE 2WQ8A 1AGEA 2OJZL 1UZGA 3FQTA 1Q9OA 4Y5VB 1JPST 4X42A 5AAMC 3UBXG 4DUWA 3MI6A 4GI8A 4KV5F 4QRRD 3SPJA 1BDYA 3TWCH 1RQ5A 2B8OT 1FV1B 4KJYA 3ZGIA 3DYOA 4ZRGA 3ZGHA 4AY0A 2QMJA 1JPTH 4R7NB 2WLNA 4ODWB 5D5MA 4UZGA 3TA4D 4HUVB 4R3SA 1WZ1L 2HT4D 4OH2A 1AS6A 3F7QA 1AD0B 4JANB 3ZN6A 1P7HL 1R3HA 2AJUH 2KZWA 2YKKA 3OPZH 4L29B 4NRYB 2AC0A 1AY1H 4JN2B 5FOBB 3C09B 3DURA 3HG1E 3HN5A 4R0LC 3TOPA 5C0FB 2HRGA 1XH1A 2EJ1A 3AXLB 4LASH 2MHAB 3I75A 3RAJL 3FULA 3A24A 1KEGH 4TMPA 4PY8I 2JCCE 4L5FL 1JHTA 4N90D 5DK3A 4AIXA 5ANMA 1XZ0B 4NNPL 1TJIH 2BNUB 1B4TA 4QRAA 5D70H 2BPBA 4GKLA 4RX4D 4J3VA 1SPDA 2Z92B 1V3JA 2G5BB 4XPFH 3SJVD 4AENA 1AXSA 4LDOB 1UB5B 3WNPA 4G6JL 2HJLB 4OFPA 4RMSA 5E2VH 3VXPA 5CCKH 3PFUA 4TSAH 3P4LA 4W6YB 4KTGA 1VFMA 1IGIL 1H19A 1U8QB 1ZLWK 3MMEB 1H3TA 4UT6L 4LCYA 2GG1A 3WCYA 3VSVA 3U79A 1JZIA 3QRFM 3ZKMD 2R59A 5IEKA 3IPFA 1LO3H 2RR3A 4XE5B 3U9UB 1PPIA 3CG8A 3PWPB 1OEZW 1WHOA 2H3KA 2BNRA 2IGFL 2YOCA 3PWNB 4JPKL 1UJ3A 5C6TL 2BVTA 2ZCZA 3B2DC 3L95B 4NCC1 3C5ZB 3DX8B 3O3UN 3K0WA 1A6AB 4HBQA 1Z6JT 4FABH 1BFVL 3D09A 2XVBA 4M7KH 3WIHL 2XTJB 4JHWL 3ULSA 1MFCL 5IF0B 3ARWA 2PXYD 4XN4A 5D2LB 5DEJA 1IAII 2VXQH 5D7IE 1QHQA 4GXUM 2OMZB 3V0WL 3QQ4A 2O5NA 3I9PA 2VXTH 1UEYA 3CXHK 2C7UB 1SFHA 2OTUA 4IRSC 1U3JA 4LVNC 4NBYB 4PJ8B 3ORJA 3F12B 1ZLVK 4OV5B 3HS9A 4NQDB 5JW3H 1RMFH 4CVZB 2B2XH 3HB3C 4LARH 1J9TA 3ILQC 2DQTL 5HJGA 3O6KH 2MFNA 5IP4A 1BWMA 5JQIB 1FJ1B 4NP4H 4PRIE 1OXYA 4OFVA 1WE5A 2CR3A 5D1XA 2WXPA 4WUUE 2DL2A 2CRIA 1AQKH 4LEOA 3G6JB 3QCUH 5DWUH 2V33A 4TNWF 4R97B 3NCWA 2XVKA 4DGWC 2YBRB 5D4HA 1Y07A 2HG5B 3DO4A 4FJ6A 4FHJA 2F53E 5DC4B 2EVIA 1YPZF 1D6EB 1JF1A 3DTUB 4NC2B 4KTDL 4BGLA 1JXFA 5E2WH 1GGTA 3TIDB 3TBTB 4R8WL 4MD0B 3BQUC 1OSPL 4BV1A 2EE3A 3QCTH 3MRHB 4JFQA 3P0VL 3N42F 3W39B 1L9PA 3BP7A 3ES6A 5AVQB 4XNQB 1QO3B 4Y7OC 4FERA 3DOSA 3MRLA 3GLZA 3MUY1 3DX1A 3RX7A 1BEXA 4Y5XA 3ARDB 4XNMB 1AGCB 4AQZA 3EJZC 4PCKA 4F27A 4K8RH 1MHHB 1KYDA 2OP4L 1S4IA 2XBDA 4GSQA 5DQJA 5GZOD 4XPTH 2L7UA 3DUSB 2XKUA 3ZIYA 1SLWA 2ITDA 1IGTA 3U1SL 3S97C 1OGSA 3MLTA 3GMPB 2YPLE 5DEGB 1GZPA 1SDAB 1M71A 2IGTA 4MJ2A 3BDBA 3CN2A 4FFZL 2B5IC 1FVCB 1MIEL 1MELA 1E90A 4XOEA 4PJAB 5MERA 4WW1A 2ORBL 3A4AA 1YEKL 4KNQA 1BIIA 4NQVA 4OCSH 4PRPD 5DMJB 3DJSA 2H2PC 3MDJA 2Q87A 1FVEA 3PHOB 3ARGA 3TGXA 1MFBL 3MJ6A 4ZPVB 4BFRA 4M8UA 4QOKB 5DD3H 2RH0A 2XN9A 3MBXL 5DC2A 4EUPB 2ARJQ 1KACB 1EAJA 3L2MA 4RGOL 3PDDA 3GMQA 2FL5B 3NIFF 5GPRA 4PJ5E 2IWFA 2H8PB 3P4NB 5CUSH 3Q6GH 1T5WB 1J5OH 3WDJA 2CO1A 1WO2A 5BXFA 4JRYD 4HPYL 1GAFL 2WINB 3ZU8A 4FQXC 2VDNB 3BKJL 2HTKC 3CFNA 3TEUA 1YJDH 1K2DB 4ZNCD 1RZKH 5AVWB 2WTRB 3U2IA 1SNRA 4KRPB 4N2AA 3RWFA 4MCYA 1G6RB 1SJEA 3CVHH 2QELA 4N3TA 2X05A 3D5OF 3I6SA 1UQSA 2VR3A 1N6QH 4UM9D 2NY0C 2AQNA 4JHAL 3CIQA 2CIKB 2MWCA 5DMGC 2BC4A 4JY5L 4YBQD 3FBQA 3LB6D 2J8UA 4J27A 2FATL 4PW3A 5AW6B 4HWBH 4XZUA 1UVQB 3ETSA 4E2OA 5JDSB 1HH6B 1L0YA 2O5XH 3E7JA 1QLFA 2CGZA 1IKNA 1G9NH 1AS8A 1JYWA 3MNVA 1A8JH 5HYIA 1B0GB 2BS9A 4LSSL 4Y16D 1QFHA 1AGBA 1YO4A 2Y69B 1I4FB 3QE5A 4UT9L 5D7JC 4F7KA 5I6LA 4KJQD 5EU6B 5I1LA 5H94B 5CZXC 4LKXB 4I8DA 3N41F 2X4PB 1PQZA 3B7UX 3U48A 3O4LD 3K81A 1VFBA 4P5TB 1JPFB 2C3GA 5F1NB 1T7YA 2GHWB 3EJCA 4IGBD 2K0RA 4RMVA 5TK4A 3VQ2C 3VMPA 2BCKA 2Y06L 5FCSH 5A7BA 4EN3C 4I1NB 2AQPA 4LQ1A 2H0JA 3C60B 5PAZA 1JDCA 5HGDB 4Z8FL 3QRGL 2GITA 2H6PB 3KBEA 1HILB 1RZ7H 2WXFA 2Z6FA 3BAKA 4F1SA 3V52H 5KVEE 1O0VA 3MBWA 3T0DA 1UFUA 3N9GH 4AIZA 4AMXA 4B3EA 4U6VL 1U8NA 3TURA 4OZIE 1MRDL 5E4OA 4G9FD 3WKPA 1XAKA 2AAAA 1WAAE 4JPIA 4QHLB 5CLZA 1G6VK 3WEAA 3O3EB 4X8XA 4Z6AT 5ADOH 3Q3GB 5JPNA 2NY1B 3ENEA 3BPOB 1WF5A 2AK4D 3UZVA 4MXVF 1IRAY 1D6VL 3MHZA 1KJVA 4P2OD 4M7ZB 3MUZ1 1GZHC 5BZDA 4XVUD 3LRSB 4TSBL 1QFOA 1PZ3A 3PP3K 2X6MA 1PKOA 2DLFL 4LCUA 1S7SB 2BCMA 3FUDA 4NXSA 1CR9H 2HXAA 3QR2A 5IQNA 4ODSH 4CKVX 1PZAA 3FOMA 3K80A 3Q5OA 3N1QC 4RAUA 4ZFZB 2PR4H 2Y5TB 5GGTL 3HN8A 3QWOB 4IJ3B 1VGEL 4PRBB 3RKPA 4ZMVA 2XWJB 4MXVE 5KVEL 3DHJA 5A2FA 3T2LA 4L4VA 4UU9B 1JGLH 2XV3A 2ZP9A 3OKLA 2A74B 1ZT1B 1I8MB 2W0LA 4A68A 1MJ7L 4Z7OE 1T20B 2P24B 3HKFA 2I85A 3HPJB 3JUZA 2WKGA 1JAEA 4GG6A 1IC0A 2UYLB 1ZHNA 2YHGA 4UQEA 3L81A 4YAQA 4JFDD 2IOOA 3ARBD 2KLRA 4MQ7A 3OHXC 3RI5K 4BEIA 1QUNB 1CU4H 4HJ0C 2WUCH 1BAFL 4H25B 4L3EB 4LL1A 2DQDL 2X4UB 4CADA 3WL9A 1CGUA 3T0XA 3TT1H 3BP4B 2H3NB 2W9DL 1KT2B 1F97A 2QKIC 5I1CH 1KCRL 3KPOA 3FF8A 5FIEA 3GDBA 1EHLH 2JJSA 2MPAH 5C2BL 1MCIA 1XSJA 3HRZC 3QORD 3BP5A 3UDWC 4H8HA 3PGDA 1S78D 1TTCA 3WKNA 5IVXF 1IAOB 3VXNA 2AMUA 1NANH 4L8SA 3FU7B 3WE6B 1R5VA 3U6XA 1A0QL 1HNFA 2FGWH 3BJ91 1XSIA 3HE6D 3LNFA 3FT9A 1UXSB 4AVHA 4W9LC 5AWNH 2KPNA 1RVFH 3ILPB 3AREB 5D4IA 3JTSB 4OZHB 5C0BD 3EO0B 1G1CA 4P23D 5D7SH 4GY4A 3IAQA 1F6AA 4I3SH 2DKUA 4NO5A 3BSGA 3F05A 2QQNL 4X6DF 1U8KB 4PLKC 2FRGP 3TVMD 3WEMA 4RMUA 4LLQA 3L3GA 3BT0A 5F8RC 3B8YA 5CEXA 3ASWA 3IDJB 1T89A 4PJEA 3BOVA 2Q3ZA 1H8OA 4GO8A 2DQMA 5JPMC 4Q9QL 1OGAE 2WP3O 3UO1H 5SWQA 2B16A 3G5ZB 4WEBH 4XMUA 4I85A 1HS6A 3MRDB 5KSAA 5JYMA 2NT0A 5EZLB 5K9OA 3QAQA 2ZG2A 2AS5M 1IZJA 1IC5L 2IG2L 1G94A 3BHBB 3PGCA 4JFHD 2FYYB 3Q2WA 4B96A 4Z78A 3MJ9L 3DV4B 1IFHL 3AT0A 2X9ZA 1ZK9A 3QQXA 2DIBA 4PVNA 2H26A 1EXUA 1P2CA 4K7FB 4MNQE 1UWGH 4FX5A 1OAKL 4GSUA 5KVMC 1RJYA 4AZUA 1XXFC 2DJ4A 1FNFA 5E99H 3RUGB 1NDMB 3EYQC 3QULB 5IJBC 4BHUA 2J5LB 4BK4A 2Y22A 3M46A 4GPVA 4MA1C 3ZHFA 1HX0A 4ZO9A 4F7MB 1KB5A 5C7XL 5J1AB 1EJ6A 4JBSA 5E2TH 4G8EA 3IJSB 4XN8A 4M93B 1BFSA 2DBLL 2H6UA 3HJ0A 3VYOA 1KGUA 1Z3GL 3FUNA 1NBQA 4WHYH 3D50A 3ILEA 3RFZA 1GKOA 1KDJA 1JI2A 3PLYA 4FMFA 2CKNA 4PB0H 4L8CA 3VFUB 5DRWA 3F7KA 2DJUA 2NXYB 4JO2H 2HT4C 3EGSA 4QF1A 2A73B 4PPTA 3K74B 2CLVA 4HK0B 1Z66A 4QKTA 4ZW7A 3T04D 2QLYA 3M1CA 1MI5B 4Y2OA 1J10A 2J8HA 4AVKA 2P8PB 1JGEA 4O51B 5HGAB 1NGZB 4PTTB 5TD4A 3BW9A 4DQAA 3A6CL 1DLFH 3D9AH 4PRHE 5LGYA 4GKNA 3A6BH 4F3FB 3PWVA 1NCOA 3VG0L 1YEJH 5IMLA 5F6HI 5DMKA 3D39B 2JJVA 3I6KB 4UTCA 2F54D 3NZUA 3SKUD 4F5CE 2LOEA 2H1PH 3MRBB 3IEAA 3VSTA 3HS0A 3K3QA 4MJ6B 2OQJB 4FL4B 1MFMA 4YWGH 4OZFB 1I7RA 3ARFD 1MVYA 1KG0B 3DVGA 2I24N 3MRJB 5B21A 5I1IH 2BSEA 1R75A 3F7RA 4IBLT 1C1EL 1TT6A 1RCYA 2VE6B 3O2VL 4Z7VB 5MEPA 5FYJL 4A2DA 4PJHA 4PS3A 5EBWB 2IXQB 4FG4A 4JM2A 3U30C 2JKJA 35C8H 3CFQA 5J9PA 1P4LB 3L54A 5A2IH 4NZUL 1HYRC 4FQ1L 3VTAA 3ZKMC 5SWZD 3IAPA 1BD2E 1WBZA 2X4NA 1ESOA 4LAJH 3MV7B 3RVVD 5CP7A 4PHZA 3ZO0A 5CZVL 3QDGB 2F5BL 1LD9B 1LWRA 1UGNA 2BDNL 2VLKB 4UIKH 3RE0A 4NC0B 1UENA 2GSMB 3CSFA 3MLVH 2FJUB 5LBGA 2OR9L 1CQKA 5IHBA 4ISVA 3E6HA 3NFNA 1QYGH 3CDZB 1BZ9B 3LN5B 2A9BA 3SPCA 2JKWA 4QXGH 1X7QA 1TVHB 3A67L 1YYLH 2E7LC 2WNXA 2XA3A 3TO2B 1QPKA 2PXYC 5H4ZA 1W80A 1XDTT 5F7MC 4JJOA 5KJ4A 5DHYA 3D18B 3D85A 1SFDA 2JJTC 3OKNA 3QZOA 3LH2H 4AQ8C 1YECH 2P5WA 2IQAB 2OAAA 1R5IB 5T33L 5D8JL 3A6OA 1ICTA 3FCUB 4LSQH 3S88H 4HGWA 2O1AA 5JXED 3P0YH 4GAJL 3HFML 2R8SL 2GIYA 4M5YL 1BF2A 2YD6A 3VA2C 1F4WL 1A4JA 4J8QA 4W9CC 1LP9B 3DTXA 5E00B 3TPUA 3NJXA 4Q6IB 2IWGA 3QXAA 3WTXA 1BQLH 5JZ7D 3GTTA 1CD9B 4U1SA 5FYLD 4JHZA 2I25N 1P7KA 1PGRB 3WIAA 3IU4H 2Y07H 3B3IB 1JZ2A 4PIRF 3DROB 4I7ZC 4O02H 4G9DB 1L0QA 1YEHH 4Y9EA 5BW7C 4FYQA 3RWCB 4G6ML 3I9IA 5JMOC 3DGGA 4MMXB 5HI4D 2YR3A 4DO6A 3WNOA 2NLJA 3WXVL 5ID1B 3G6DH 1YDPB 2RB8A 5I76A 2HFGH 2Z8RA 3NZSA 2Y7SA 5GSRA 4DK5A 1DFXA 3K2KA 3U4EB 4APQB 5EU5B 2OXHB 3V10A 5DZPA 3BIKA 1GS7A 4KRMB 1TQBB 2P49B 5K9JH 4U7KA 2LU5A 2ZOLB 3I85A 3QEGH 3RWDA 2H32H 3NZHL 3EOBA 5KBMA 1EEYB 3WELA 2XDHA 5I8KL 4DQOH 4LAQH 1JV5B 3FTGA 5JIDA 3EGDB 4YHYC 1KDIA 3B1TA 3IWVA 2VR4A 4PGDB 4UT7L 5H37A 4JDTL 3F04A 1F5WA 3BE1H 2WLJA 4TLSA 3VXMA 4ZBJA 1U95A 4R90H 4YIQB 3WEXB 2VSCA 3G6JF 3T3PE 4R4BA 4H88L 1KXHA 4RSYA 4OV6F 4JVUA 3KS0J 3X12A 1KIQA 2V3FA 3T4YB 2FX7L 3NEOA 1XEDA 1IL1A 4BA0A 4I0CC 1AH1A 1XR9B 4LLYB 3X14A 1NJ9A 1ZXKA 5IQ7H 1E8WA 3HG2A 1MJUL 4R96B 1KC5H 1M6UA 2OZ4H 3KM2A 5I6PA 4DZ8A 5IM7A 3JBG7 5EB9A 2ZWZA 1REIA 4TUKL 4IU2A 2AEQL 1ZS8B 4F7TB 4H44C 5F97E 4TVSa 3UMTA 3SDAD 5L6YH 1SEQL 4OCMC 2XWDA 4UUJB 4G7VL 1NWPA 4IRJA 4AMKH 3NZ8A 1PYWB 2GUOB 5IHWA 1KSRA 5DURB 2EIKB 1NCWL 2BIOA 2VERN 3NMEA 4FA7B 2AJYH 4RFEA 1Q9LA 3JWNG 4XP1L 3WS6A 2MOGA 4HEMA 3S48A 1W0VA 1FF5A 1UOKA 5F1SA 3WJMA 3DMMD 1JZFA 5LB1A 3QZLA 5ETUA 3UTZB 4KDTA 1NQBA 5FGCB 1HDMB 1JRHL 3GKWH 2OW7A 3C5JA 5AOZA 4XMKL 2J20A 5DJAB 1JHKL 3S4SA 5HYSB 5GIRB 4E9TA 2VH5L 5C0JB 4NYLA 5B22A 3PJSB 3DI3B 4K9EC 4PRAB 2PETA 3PIQA 4PJAF 5FHAL 1JFQL 1EJFA 1TZHA 2G75A 2VXQA 4YNYB 4ETQA 4H2CA 1WUZA 5IQMA 4XRCA 4JQXC 4WAFA 5MP6H 3LNDA 4KY1L 4AL8H 5LBSH 1I7TB 2I7OA 1L5GA 2KQNA 3PE9A 1DJXA 4Q6YA 3L4WA 4NB7A 4HV8A 1DJHA 4TUUA 4W4NA 2BRRL 5HYJE 2J88L 4RFNB 2NX5E 1FYTD 5C0AA 4YBQC 5C8JB 2ITFA 3LB6C 2R9HD 3FU9A 3WD5L 1R3LB 2COQA 5KS9E 5D7LA 3L4UA 5AKRA 3V4UL 5BOZG 3OLIA 3OXRB 4W9ZA 5IG7B 3FT3A 2X4RA 4GQ9L 4MGXA 5AZEL 4WK2B 1RZIB 4Y16C 3VYNA 3CCHA 4FNLL 1RSYA 3H0TB 3X13A 4CUCA 1ZGLM 4P06A 3HI6H 4D9LL 4OIAA 5J12B 2QV2A 4IBQA 1UA6H 2ARJB 4KJQC 1HYSD 3NIDE 2NY4B 3KGUA 4NBZB 1OO2A 5FKPB 3TM6A 3TONA 3VWKA 5JW4N 2RD0A 3GXIA 3QIWD 4XBEH 1F13A 3TEWA 3ZT6A 1AFVH 1I1FA 1J18A 3B56A 1FFOA 2AQ1A 3UJJL 4IGBC 1ADQH 1ZA3A 5E6IB 1I7ZB 1W72H 5D9SA 2HH0H 4HKJA 3MKKA 4M7JH 1P7QD 1CFBA 2YWYA 4G8AC 4BSVA 3L7EB 3KBPA 3O3DB 1U93A 4HH8A 4I1RA 4IIQB 4M03A 2XZAH 4YEEA 3MCG1 4XOCA 3U83A 2Y36H 3S2CA 4OUOA 1F6FB 2CNZA 1PY9A 5GS0D 9PCYA 4LFHD 4HKXA 1HHJB 4KTDH 1A6ZB 2FT6A 5DO2D 4ZT1A 2HPOA 2QVKA 4H1LH 1IKFL 4PJFB 5DR5L 2AJSH 5TPWH 1ACXA 4U2YA 1RUMH 2B08A 3MJWA 4FYTA 3QNFA 4XP5L 2G2PA 2HG0A 1TMCB 2X70B 1GGBL 2ICWB 3QJZA 4QY8B 5DTFB 4Q9RH 1CFSA 4ZMTA 4HUXB 4PLNC 2NR6A 4ZI8A 1WAEA 3QO1B 4FNQA 4EI0A 3VRIA 4TQ8A 5IJDC 1S9WB 4ZOBA 4AEEA 4X6CF 1KNOA 1J48A 4P2OC 1QABA 3FFDA 2WLYA 4ZUWA 2OP4H 3BISA 3D2UA 4R7DA 4XVUC 4F2ME 4ODHH 3BVVA 4QT5B 4WGKA 5DZLA 1A5FH 1A6UL 1VZHA 2VSMB 5LGHL 1MCJA 4PWKA 3TESA 1DANU 2EILB 5B1JA 1QLEB 1I9EA 2YD4A 1HNGA 2Q0ZX 4OM1L 4YO0B 4HK3J 3HOGA 4G71B 2R39A 1XF4B 3I9AA 2WW8A 4X6CE 2DIAA 7CGTA 5C2UB 2E7CA 3HJEA 3WAKA 4D0DA 4Z7WB 1JDDA 1LDPH 4AGPA 4FFZH 1AVAA 2C4FU 4ACPA 3UBXB 2V3DA 3BKCL 1O6SB 2ADIB 3O6FD 3O9WD 5LGKA 3OZKA 3QDMA 2OMTB 3F85A 1U21A 3QFJD 4PRNB 4G42A 1NIAA 1QSFB 3VJ6A 3GMMA 2W0KA 3ARBC 2J3SA 4DKFL 3QDJB 2Z1KA 1ND0B 3VXUD 1BQRA 4JZJA 4NQTA 3UTQB 4NFCA 1GS8A 3ABGA 3F58L 3IMRA 4P5RA 4Z7UB 5ITFB 4X5LA 3T6ZA 5C0EA 3L4CA 3CHQA 4EI6A 4LSRH 4DZBB 1BZOA 2WB1A 4TPRH 3CVHA 2UZIL 3GLDA 1RJZB 5CMAB 4E9XA 3QORC 3KYNB 5EO1B 1S78C 3H7LA 1FFRA 2VW6A 4JDVA 4KROD 5EBGA 1WQVT 1YQ2A 1A66A 4HPYH 5FDYA 1GAFH 2CZNA 2DMCA 1T5KA 2DTSA 2XWEA 4GMSL 4NQED 4A2MA 4E41E 4AQ1A 1UYWH 1F45A 3DX6A 7PCYA 1Q4NX 2CO7B 3GK8H 3HE6C 4LO9A 5J13B 1E43A 3CFCL 4HWBA 1UASA 4TUOB 3VXOA 3X1EA 1JGIA 2V5YA 1MJJA 4KXDA 1JZDC 1ZOXA 4P23C 3STLA 4KOBA 3DXAB 1A7BA 2BJML 3S37L 5F0MB 5CD5D 4HKZB 5IIEB 4UQCA 4FFWD 1JSYA 4GMTH 3NJHA 2BO0A 1C12A 3HMWH 4JPSA 5INCB 1CD8A 3TVMC 3IJYA 2JQMA 2A6DB 4U7MA 4L0ZA 1XEUA 3CVCA 5IQ9A 4YHNB 4NQQA 4YHIA 3TT3H 1MFUA 3FT4A 3HHSA 3PABA 5F7KC 5EORL 4RMQA 4N28A 4HCFA 4N2MA 3MRRB 4JL1A 4P2QD 1E2WA 2E47A 4OJFH 3CMOL 4TVPE 5GRYA 4A2GA 1TCRB 2PMZA 3L3OB 2Y1AA 3MXVL 2EIBA 1MN4A 2QV4A 1HXYA 1N68A 2ESVB 2YXMA 4FZEH 5E1QA 3C6SB 3RX9A 1IGFL 1ZSDB 4MHHG 4NPJA 4MDJA 1BVKA 3AQXA 4CC1A 4M5ZH 1KIRA 1MIMH 3L9YA 4HGKC 1E9PA 5GRUH 4ZUSA 3NA9H 2AJXL 4Z0XB 1N19A 3OJVC 4F91B 2YUVA 4FS0A 2VR9A 4N87A 1KZYA 3QQDA 3EYOB 4G7YH 5DO8A 1T1WB 5K5YA 3UYOD 2CUIA 4OZ4A 4Y5YA 5GRZA 3NGBC 4CDGC 2FECI 2XG4A 2FO4A 3NSDA 1DQMH 2EKJA 2XTLA 2FHFA 2KERA 3CSGA 5E4EC 4Z8FH 3QRGH 5GXBB 3FO2B 4TVPL 4YUEL 4XMLH 4FRWA 5BS0A 3GUTA 1N12A 2W9EL 3CFTA 4FQJH 3ML9A 3PXLA 4U6YB 1B4LA 4ORGB 2VIRB 3PU7A 1VIWA 1QRNE 2JELH 4BH7B 1KLGA 3UTTE 1S9VB 5B8CB 2Q76B 4XODA 1QI4A 4B53A 5AG9A 2ZSWB 2WSPA 3K6FA 5CEZD 1JK9A 1HWHB 5C3TA 1V55B 2ATKB 4GH7B 1Y6KR 2LLNA 3C8HA 5GS2D 4ADJA 3W0WD 3BAEL 5ESVB 1BIHA 2EH8L 4PJGB 4WW2A 4F33A 1TETL 2BMKB 4TSBH 2A77H 3ISYA 3T9WA 4F8OA 4OUUA 5I1HH 4HJTA 4EDXB 3KLKA 4HA1A 4XWOD 4QRRE 1P5UA 1F3JA 3GSNB 4J28A 3RUGF 3Q48A 5A1AA 1OSYA 1VGEH 3TYFA 1HU8A 1K85A 4IS6B 5A3ID 4OJDH 1A4KA 1XGTB 2DQFA 1A6WL 2UVFA 3H4FA 3UYRL 4KHTL 1MJ7H 5IWLA 4KKLD 5IGXL 2BSSA 4HXAL 3WN5A 2MJWA 1FZJB 4FE9A 4P9ML 3LKPB 3ZUCA 1TQSA 4IOFD 1DVFD 4GW4A 3AS3A 1X6LA 3ARFC 2KT6A 4HX1A 2VRAA 5EU3A 1BAFH 1EXGA 3HI5H 5HVHC 5JO5B 1M53A 1PZSA 2FEEI 3RDTA 2Y25A 1KJMA 3KNBA 4KVNL 4N90E 1DDHA 2VQUA 1OZTG 4KMQA 1N0XL 1OLZA 2G30A 1VZGA 2WZPA 5TDPA 3DSFL 3EFFA 4GW5A 4KRPD 5DUPL 3SJVE 3P9WB 2CLRB 2HRLA 5IY5B 4AKOA 3VGEA 4X5XB 1NUGA 4JDZB 3B37A 3RTQD 3CN3A 4XCFL 3RVVC 1SXZA 1QBLH 4DGUA 1Z9LA 2NQ3A 3N85L 1MCBA 1T0NA 3D3VB 3DI2B 1E4XI 5DGQA 2W92A 4XXWA 4H0GA 1W0WB 2QVTA 3ZTNH 1RULH 1E6JH 4OJEH 2ZONA 3VG9C 1KEMH 4QHNB 3APNA 4ODTH 4WHTB 4WGWB 1GPOL 1OK8A 5J5EA 2K45A 5ALCH 4ZXBA 2ZAGA 3GMOA 4TYUA 2HN7B 1CFQA 4G43B 4JRFA 1PCXA 1RFDL 2GAZA 3L4TA 5T3XD 4N0UA 2NY7H 1NMCC 1ZLSH 3L4VA 5FW6A 4I2XE 5CD3B 1S7RB 2JI2A 1E42A 1RLWA 3RZWA 2Q7YB 3FQWB 5CBEB 5JXEC 4PV9A 4N2OA 3T4AA 4P5TD 5IVZA 1BZQK 1EO7A 5H37G 5I74C 1IARB 1KTKE 2CUMA 5K9QG 3ERXA 3EDJA 3LOWA 3U4BL 3UABA 4OLVL 3O3AB 2VN6A 5F7BA 2NCMA 2KZKA 5JZ7C 2CA3A 4LL4A 4JRXB 3P2TA 43C9B 3KDPB 2FNBA 1IBGH 3C60D 5DRNA 1EFXA 3T0BA 1RZPA 2DMGA 4GRMB 3CWGA 2MKWA 2A6IA 4YPGA 3TV3H 5GGQL 3FUFA 5HI4C 5C07A 5CU5A 1M4KA 5DEFB 4ILDA 2FT7A 2AKRB 1EGJA 3DDFA 3L9EA 4XMWA 1DQDH 3DSNA 2Y7QA 1AKPA 4MCZB 1I3RA 5HYFA 4FA6A 5ADPH 4OCXL 3TNMB 3UJIH 1AZZC 1QFWH 1Y18A 3TJPA 2B14A 2OBGA 2EYTA 4EQ2A 5B1BB 2PO6B 5LCVH 2YRBA 1G9EA 1QBML 3H9SB 3HNSH 2P9RA 1NBCA 1JJUA 2WPGA 1YEFL 1QR1A 3VFOB 2LTQB 4UM8A 3HCVB 4R5VA 1NDGA 4HZLB 4HJ1A 2WNWA 4AM0Q 2ZE0A 5IR1A 4OVVA 4G1EB 5CN3A 2J2ZA 3KPNA 3IJEA 4PJXB 3TN0B 4P59L 1PW3A 2GJZB 3KXFD 4MYPA 1UWXH 4B97A 4NUPA 2Q2EB 3S4SG 1YAIA 2VNCA 4V1DB 5FM5M 2ZSVA 4JY6B 2N01B 5MEND 1AXTL 1VHPA 2PCFB 3C6LB 4X7TB 4YXHL 3N2JA 3KS0H 2E9IA 3DPBB 1CICB 4ERSL 4XMPL 4DVRH 2VUYA 1IGMH 4Y9CA 5E5UB 1FLRL 1PG7W 4Q74A 3VI3F 3SDAC 4ZW6A 3Q44A 3OKEA 4FZ8L 4L3ED 1XCWA 4XO8A 1NCUA 4I18C 3WTWA 1CE6A 1IGYA 4JKLA 2XIIA 4URTB 1MCEA 4JHVA 5F3HA 3LKQB 1P1ZA 2FBJH 1OHQA 3MO1B 3MLRH 4J3TA 4PRPE 5BRZA 3VI3E 3WEBA 3FQYA 3DMMC 5F6IC 1IC1A 3R7QA 4J3SA 2CKBA 4YHLL 1NTDA 3HBQA 3CK0L 2XY2A 1A9VA 4B9GA 3N50A 1YN7A 1TQUA 4G6AD 1N64H 5E51A 5BQ7A 3US0A 2AJZB 3G08B 4NZTL 4PJ7B 1SDYA 1Y1DA 5C0DA 3UTSA 3V2AR 1K4DB 1S3KH 5T1LB 4W9HC 4KTEL 2F5BH 2FSEB 2R1YB 5DDHA 3HR6A 1R1CA 4BFEA 4ODXA 3LPPA 2OSLB 4JO3L 5AYUH 3FQ2A 2XV0A 4JRYE 4RFOL 5FDWA 4WLCA 1WWWX 3ATDA 1I75A 1I1CA 4UDUB 1OOAA 3BWUC 3K6DA 1XTLA 4K0OA 1RP9A 2R9HC 5I71C 2VZ1A 1UCTA 1THCA 2ADFL 4JDEA 3OKDA 4MNGE 3J2PA 3HBGA 2G3ZA 4MAYB 4OFQA 1HEJC 3RGVB 3V6FA 3B8SA 1SOSA 1XXDC 2RHEA 3MNZB 4QTFA 2P8LA 4P2RD 4DP2X 2Z31A 5D1ZA 5D8JH 5GZNA 4O02A 5HYQA 2HJKB 2IFGA 3EF4A 5BUAA 2BNQA 4X7EC 5HHQA 5IEHA 2B3IA 3QQ3A 2DYPA 4FEMA 4AYBA 3MRMB 1HYSC 5G4MA 1FL3A 4IU3A 5BJTA 4AQAA 1MHPL 4D8PB 4AH2A 1J9RA 2X89A 3QIWC 2X5PA 5T1KA 2P47B 3QHZL 4NGHL 1PY4A 4Y7MA 3V8OA 1S7QB 3UAJD 4K3DH 2H32A 2L3BA 2P8MB 4CILA 3CVDA 2G9HB 4K9EL 1ZT7A 3VCLB 1IE4A 3VI4A 3OSVA 4P3CH 2X6CA 1F02I 1HE7A 1I7UB 1QATA 1ROCA 5GS0C 1AGEB 5DO2C 3FQTB 1Q9OB 2R7EA 3SO5A 3ME0A 4ANKA 4YSAA 5L8KB 3HPLA 3QH3A 4Y5VC 2DQHH 4KJYB 1UH3A 4ANXA 4QRUA 1JNLH 4HAKA 4LEXL 3QUMH 5I8KH 4N0FA 1F1AA 5D5MB 2X3BA 4XVTH 3GDCA 4R3SB 2D4DA 4JW3A 2NY2D 2KLTA 4OLYL 4V2BA 5C09E 3ISWA 3KPLA 3DURB 2OZ4A 4PGJA 2FWOA 2K7QA 3I75B 2GIXA 1MI5D 2PCYA 1BYNA 3VXSA 2OW6A 1RURH 2I7SA 2NTFA 3S5LA 1YYML 1JHTB 2XN1A 3P69A 2AK4E 5ANMB 3UZEC 3WHE1 5EEXA 1YQVH 5JHLL 2BIMA 4PJFF 2C9QA 3LV3A 4XP6H 4MWFA 4ZK8A 1UH2A 3FT0A 3SDXA 5D4QA 1UXWA 3FB7A 4YFDB 5TDNA 4AENB 1AXSB 4NT6A 4OCRL 3O9WC 3O6FC 4LLMA 4P07A 1FZKA 2K9FB 4OCYL 1CTNA 4JCLA 3VXPB 1NC2A 4ZYKA 4HULB 1D5MA 1MXGA 1HZKA 3F00A 2LE9A 3WFCH 2VO8A 2PTTA 1CFMA 3AT9A 5FUZL 4AUJA 1IEHA 2EC9U 4LCYB 1BVNT 5D55A 1NCAH 4ZFOA 2JCCA 5E7FA 2GTZA 3V7MA 5IEKB 3VGAB 5KEZA 1KV3A 1T4KA 2B20A 4EF3A 3ZZQA 4JFDE 1N26A 5LBSA 3BUIA 3MJ8A 3QJXA 5DHVH 2MRYA 2BNRB 4DP1X 1UJ3B 4KROC 3L45A 5CINH 4XMKH 3ARYA 3NJFA 2VLKD 2YQGA 4FLRA 4U3SA 3ZDZB 4OW6A 5C08D 2LU7A 1C8PA 3VFPA 1T7ZA 5FHAH 5IB5A 3ULSB 2J55A 4FXKC 1GIGH 5F9WC 4JPWL 5C0ND 1JF5A 3HE7A 2WOYA 3GBML 1HAUA 3NN8A 2DL9A 4PR5A 3TBBA 4J4PD 1HESA 4J3UA 5CD5C 3ULVD 2XPZA 2DEXX 4FFWC 5J1SC 5E08L 2OTUB 4ZTEA 2O5YL 1KXVA 1MAML 4AGOA 4Z7UF 2OSWA 4B9YA 1IM3A 1GOFA 3L2LA 5D93C 4OD1H 5C0BE 3DA0A 2X1PA 1VFAA 2ZWNA 1KB9K 4IDJL 3H3PH 2F58L 2BSCA 4R83A 1XMWA 1E5YA 1RIVL 2AQSA 1ADQA 4JEGB 1TZ8A 1W72A 2Y72A 5EF1A 3S0PA 3B7TA 4EDWH 2ZCHL 4LEOB 1BX2A 2VW7A 3BSHA 4D9LH 3BVDB 3FZUD 1A7RH 4POZD 4TF4A 2JIXD 5D7IA 2LV4A 2ZCLL 4K3JH 4R97C 4H1LA 1JF1B 1RUAH 1E28A 1A7OH 3AT8A 3AZUA 1MFEL 3WNMA 3UJJH 1MQKL 1Z9PA 3FSZA 5F7YC 4CW1A 1Q9WA 3WDHA 3GRWH 3VSUA 4APQD 3BUPA 4JFQB 4PRIA 2VDPB 2GY5A 3GT6A 4XNYL 4JFHE 5TE4L 3BP7B 3ES6B 5ICYA 4WUUA 3MTRA 4YDZA 1DHKA 6CGTA 1N2RB 2Y6TE 3DOSB 4F93B 3MRLB 4Y5XB 4DPBX 3WJLC 1O9VA 2QGBA 2E9WA 4HOWA 1ZVHA 4WKZB 2F53A 4W4OC 4W93A 4FCHA 4XP5H 3ATAA 2VDMH 2CE6A 2VMJA 1DBJH 1Q0XH 2WOBA 1MPAL 3FUMA 3LPGA 5DQJB 1OM3L 4QWWD 1SZNA 3L5JA 4I9WD 2FZ3A 3EYUL 3ZO9A 4R84A 4BKSC 4OAWA 4XWGL 3K0YA 2A3TA 2I32A 2KS0A 1F00I 2WVVA 1IGTB 2ITDB 3MYJA 2PP7A 4QNPF 1GYAA 2ETWA 4FFZA 3D8MA 3MLTB 1JPEA 4N2BA 1GZPB 1BSIA 4AYSA 4WNQA 2HAZA 1M71B 2A7BA 1OARL 4HIJA 4ONFL 2A83A 3NTCL 3H42L 2DM7A 5MERB 4PLJD 1HH9A 4XWOC 4WW1B 5LGHH 5TQ0H 3BSZL 3QSKB 1JVLA 3OQ3B 1BIIB 4NQVB 1IILE 3L8QA 3MCKA 4Z7QE 1FVEB 2X9WA 3ARGB 4OD3L 2EVJA 3FU3A 1KFAH 2L7QA 5A3IC 2XN9B 5F7UA 4N2HA 4XMVA 2APBA 4KKLC 4UINL 3GMQB 1CXKA 1XGYL 5D6CA 1PD0A 1UCBL 4IOFC 1DVFC 2YPLA 4FG2A 1VRSA 4O00A 3N44F 2DW5A 4ZX6A 2GJJA 5BXFB 1E8ZA 2F9BT 1CPUA 5KN5A 2QMKA 1CWVA 1MFAL 2F1AA 2F54E 1TPXB 5J89A 3NACL 2QBWA 3QRBA 4HT1L 5I0VA 3RWFB 3D30A 4MCYB 2XWZA 4HVBA 1SJEB 3UBGA 4NUJA 1HHKA 1BQUA 1WYJA 1MVFA 4KRPC 5AAWA 4O2CA 3S34H 3QWRD 2QPDB 4TTGA 4WO4D 3OM3B 3RTQC 1ZDSA 4OT1H 1UQSB 3ELQA 4PJDE 4YH6A 3VFTA 3VGDA 2BC4B 1ZANH 4L1HA 1E3ZA 2J8UB 4KUZH 2YGOA 4XZUB 3WO4B 2GEEA 1UHVA 3Q6FA 4WRLA 4CGTA 1QLFB 1WTGT 1PMYA 5T1DH 1IGCL 5SWZE 3MNVB 2YPVH 3FHAA 4WHYG 2X1WL 3V9FA 2G0KA 1AGBB 4IBSA 2HLFD 5FEBA 1I1YA 2YUXA 4I77L 5I1LB 5IUCA 3TNNA 2X4QB 1SBSL 1CDGA 1D7CA 2WVUA 1EVUA 4QDGA 2DDQL 1PQZB 4HS6A 1T21A 5DLMH 3S96A 1U36A 1VFBB 1DR9A 2XX1A 4TNFA 4M02A 2YKLL 3QXDA 1BXAA 5G5DA 1SF3A 2YXVA 5K33A 4P5TC 3WLWD 2BCKB 2K7PA 1H5BA 1HXKA 4KVCL 3A3YB 4NM8L 2JE8A 4FFVD 1HEHC 2JKLA 4EAEA 4N20A 3TEZA 3ZKND 2VDRL 2GITB 4OZGE 4X9YA 2FT8A 3C60C 4YBLC 3ET9F 3DX0A 4HHGA 3MBWB 4DKEH 3RHWF 1YY8A 2ADGA 2B1AH 2EUZA 2M8XA 2Y1VA 3P11L 4OSUH 4AIZB 1BAWA 1U8NB 4NNXA 3MV9A 5E9DD 4HG4K 4XNBA 1T0OA 4LLAA 5B7FA 1QTYT 4JPIB 3NABH 5CGMA 3MQIA 2O93L 3IDXL 5FYLE 1HJBC 3T8VA 1KPVA 3FC8A 3WFEL 5JPNB 3CBKB 4YUEH 3UZVB 3ZK0A 2B1HL 4TNWK 3WJJC 4B9CA 1BLIA 2W9EH 3JV0A 1I1AD 4HWUA 4PWGA 1KJVB 5BV7L 5LNGA 4KXZH 2BZ7A 3DYPA 3CVIH 4MAUH 4Q7DA 5CJOL 4GRLB 4KK5D 5BZDB 5HJ3A 4M7ZC 1ROWA 2F7IA 4LCUB 2EC8A 2QTVA 2DOCA 4IRZH 3FOMB 1XB3A 1XMEB 2Y5EA 3N40P 3POCA 1JGDA 4RAUB 4XN5A 3OAYK 2EH8H 4W9KC 4OZIA 1OWRM 1TJGH 4L4VB 2R51A 1KZQA 1WAAA 2ICEA 3ZTCC 1XX9C 2ZUQC 3OKLB 3QUXD 1HHIA 2HKFH 4K5PA 3T0VA 2UY7A 4I3RH 1QA9A 3BGMA 5L0QB 4GG6B 5FYLL 1ZHNB 3BC9A 3CVBA 4WVRA 2F6AA 4YAQB 4MQ7B 1YAZA 4XPBL 2H5UA 3E3QC 3EH4B 1QSFD 4UV4L 1D5IL 3MNDA 4WCYL 4FNSA 3VFGH 4NO0D 2BHYA 3QDJD 5TE7L 4OGZA 4CADB 3WL9B 3L5XL 1BCIA 2DQIL 4GEJA 3KPOB 4X5RA 1HC1A 2DQJL 3BP5B 4XNUL 3SBQA 1N6UA 3PGDB 1FO0L 2OV0A 1LHZA 3NYKA 1QMUA 4AC4A 3P3YA 2FQEA 2VYRE 3VXNB 4HCRH 4L8SB 3AACA 2EXYD 4QXTA 1R5VB 1CBJA 3GRGA 5C0GA 4KOCA 4G8GE 1KYFA 2IMNA 5HHXL 1OIOA 4M5TA 4PJXF 4K55A 1CQYA 3PREA 4YR6A 1MLCA 2FGZA 1IAKA 1QFUL 4FFYH 4WUKH 2GVYA 4JCWA 3QUZD 1GJIA 1EZVX 3PJNA 3HLAA 1F6AB 4NO5B 1PX8A 4FQHA 4G6AC 1U30A 4ZAKA 3ZSSA 1EJ8A 3TYGL 3MLYL 3RZCD 2R0KH 2WWMD 3BDYH 4FMVA 4N2GA 4BK5A 4M6OH 1B0RA 4LLQB 3KYOA 4NIKB 5CFAA 3L3GB 3O2DL 5EG6C 2NNFA 4PJEB 5CEXB 4R4ND 4JKWA 4A7GA 1PZ2A 2YN5A 3UPAA 2ZKXA 4P05A 3EJQA 1EANA 1G5AA 3BD4A 1H3UA 4KZDL 2VLRD 5CHNA 5JR1L 5GGRA 5SWQB 3LXBA 3HZKA 3PP4L 4RISL 3DX3A 5ACMA 2DJSA 5KSAB 3QISA 1G4RA 1YMHA 4PJBE 3VD7A 2VC2H 2CIIA 3GHBH 1L9OA 3MLSL 2ODHA 3JWDH 3PGCB 5IVXA 4Z78B 2VJXA 3DX7A 1FDLL 1UD3A 4FQQA 2D7OA 2XWRA 3KR3L 1FYTE 3BKYL 3N6YA 1NWOA 2DI7A 3V7AG 3CFUA 4A7UA 4P4KA 1I9IL 5ACZA 3FB6A 2H26B 3K2MC 3NK3A 1D2PA 1UZ6F 1EXUB 1P2CB 4YL9A 4DOHB 1N7MH 2CO4A 3DGCR 4P5KA 5B1AB 3TV8A 1LYQA 1RJYB 3SO3C 1ACYH 5F88A 1OGAA 3IB4A 3W38A 5GHWL 1PG7H 4X6DA 2AV1A 2VN5A 5AOLA 3S5LG 3UAJC 3IDNA 5E5LA 1D9KA 2WANA 5SX5K 1KB5B 2NZ1A 5IFAH 3PWUA 1E5UI 5F9OH 2Z64C 2C5DC 3VD4A 3TU6A 2AQ3A 4RGND 4G8EB 4UCFA 4XZ4A 5HHOD 4ZNEA 4K71C 3RX5A 1OV8A 2HFFA 3D69A 2BP0A 1X4ZA 1CD1A 3HKZA 3X3FL 2ZTBA 1T2QL 3MLZH 3RFZB 2CK0L 2G2NA 4KK6D 1EIBA 1UA3A 4F2FA 2FDBP 4L8CB 4MNQA 1GYWA 4FG6D 1WZKA 4U1IB 5DRWB 1PIFA 1MSPA 2EDNA 3CQFA 3W2DH 1CVSC 4NN5B 4MMYA 3EGSB 2NY2C 3PPEA 4PYHA 4QF1B 1IC7L 4QHMA 6PCYA 2QHLA 4ADGA 2R4SL 3EYVA 2CLVB 1CGWA 5DJYA 3HVDA 1K6QH 3O11A 4X7SH 4Y2OB 4F9PC 5AEAA 2XKSA 3TH3T 3BFWA 1FL6B 1MNUL 1JGEB 4QXUL 4N26A 5C9KA 3BW9B 1ED3A 2I07A 4LZKA 5KVGE 4I13B 1V7ML 4GKNB 3PWVB 5IMLB 2MCPH 5DMKB 2EKSA 2TRYA 1JN6A 1PIGA 15C8H 2BY0A 1XGQA 3HS0B 4WI5A 4UOQA 4Q14A 1E0OB 5FCUL 5I1JL 2D2CC 4G6KH 1JGUL 1GHFL 1I7RB 5INDA 4XMPH 1CYGA 4FL4C 5IB4A 3DVGB 2QSQA 3BZDA 5GS0L 3N0AA 4WTWA 1BGXL 5MEPB 5D5MF 3GWJA 1JVKA 1UD6A 3H6AA 4GAYA 4PJHB 4CN4A 2A9NL 4WEEA 4JM2B 3R0NA 2VDOB 4XPHH 4J8RA 4AYMC 3BFQG 5J9PB 4HCGA 1CLVA 5GJSH 1IBFA 4PRHA 2P1YA 4DP4X 1SJXA 2BVUA 4LLVA 1WBZB 2X4NB 5KYUB 5KVGL 3QFJE 4OBSA 3N1FC 4MDRA 4YHOL 1NGQH 4MXWH 4F5CA 5CP7B 4R0LA 4Z7AA 5I15H 1ORQA 1VPOL 3ARUA 1MXDA 3KYMA 2RFXA 3LKNA 3L5IA 1JWUA 3VXUE 1LO2H 2XSKA 5EEVA 3GHEL 1WFJA 4KO9A 1NBZA 3D3VD 2IH8A 2DQCL 4ISVB 4H1LG 3E6HB 4AGMA 3NFNB 4S10A 3W5NA 4UWQB 1IKOP 3SE4C 4ICWA 1ZEAL 2KYIA 2HLEB 2EUXA 1OGTA 1QW9A 1X7QB 3V4PH 4NX0A 4DO5A 1LE9A 4KTEH 1XCQA 3P2DA 5C0NC 3NCJL 3KL3A 5FV2A 3GSRA 4J4PC 1Z0MA 3S35L 3B9KA 3ULVC 4EBQL 4MB1A 3OKNB 3D85B 5DHYB 5FO8A 4NQEE 4ABVA 4BXSV 1BD2A 5I6XB 2WXQA 1S9YA 3LEVH 3QEQD 4HGWB 3APDA 2XCMC 2ED6A 4RCAA 1ZRUA 3GTVA 5EUOE 3VFNA 4ELKA 3RBGA 4HIPA 2CBPA 3IRPX 1A4JB 2P46B 4XC3L 3O8XD 4WK4B 2XTSA 3DTXB 4F9LC 2O61A 3RPIA 3TPUB 5AVXB 5D2LE 2E27L 3QXAB 1E30A 5I1GL 2HT3D 1W15A 4LMQI 4L2YA 4U1SB 1X44A 1P7KB 1FYHB 1LDSA 4JG1L 5EDSA 2EYSA 3FZUC 4POZC 5LHDA 2QADB 3L08A 3DGGB 4KMTL 2DQGL 2NLJB 1IFRA 4P2QE 5L9DL 3VB8A 2FH6A 2ERJC 3EDEA 5I76B 1R33A 4MMXC 4NGHH 5GSRB 2AXFB 5E6ZA 1J8RA 3RVUD 3BIKB 4O4YL 5I17A 3EFDL 4APQC 2YFOA 4JGMA 2QSVA 5BUGA 1MVUA 3RWDB 1UWXK 3FB8A 1TZGL 3K91A 3EOBB 1TQBC 3OXSA 5HY9A 1WICA 4S2SA 2A5UA 4HBCH 3FTGB 4IRSA 1AQ8A 1UTDA 2PO6D 3IRZA 4W9EC 1C5CL 2R29H 4UNIA 1XGPA 3H9SD 2VRQA 3D07A 1A4CA 5ENWA 4WWPA 3K8MA 3VXMB 1U95B 5BPPA 1M1XA 3KLDA 1JZ3A 3C8DA 3WTUA 3QYCA 4R4BB 5IFHL 4JREB 3MBED 4QWWC 2YQ2A 3X12B 4ANUA 1KIQB 1BAGA 4CAGA 2J72A 2R27A 1IL1B 2AQRA 4NJ9L 4PY8J 3BXNA 1L6XA 3L48A 1P4IL 4OF3A 1LK2A 1NJ9B 2OMWA 4RETB 3ZE2B 4AGLA 5A2JH 3VRJA 4XBMA 5AOKA 1CCZA 2B4CL 5F0JB 5IM7B 4R26H 4KWUA 1FN4A 4ZW8A 4IU2B 4PLJC 5D72H 3UROR 5JIPA 5CEZE 5I6KA 1CICD 3BAIA 2JXMA 2FJHA 5E8NA 2C9SA 4YSQA 3W0WE 4NZDA 4GRWE 1B90A 1ZIAA 3K6OA 4IRJB 1MCSA 2PPFA 2EEXA 3NZ8B 4I5BA 5HDQL 1WZLA 4OCRH 3TO4D 1D5ZA 2Y4SA 4RFEB 1GW0A 1Q9LB 3MTXA 5DHVA 3MUJA 3QZMA 5E70A 2HFTA 3WJMB 1W0VB 4ZOCA 3QXTA 1GSKA 4LPWA 1ULVA 4MVBD 4U1MA 3ZYIA 1X5HA 5ETUB 1KCBA 5DU7A 3LNIA 3M6DA 1KV7A 4K3GA 3ZE0F 2BZCA 3NJLA 3C5JB 2XQ0A 3RB7A 3S4SB 2IBZY 4NO3A 4XC1L 2E59A 4NYLB 3PG2A 2DIEA 3PIQB 5E5MA 5CEZL 1TZHB 2G75B 2BY2A 4ETQB 3SQOL 2TSBA 4X0KA 4XRCB 2ISDA 1SHSA 2V17L 5H35A 3X1NA 4CDHA 3NIGB 3OC8A 4ZSOE 3MLPA 1L5GB 4LCIH 4IOIA 4WO4C 3Q8BA 1UM6H 1CGXA 5C0AB 2EH7H 4OJAA 1OTSD 4YHML 1OAZH 3FUHA 4RFNC 3QYMA 2IWEA 2VMDA 1BPLB 5D7LB 1L7IH 3VTMA 4NFBA 3FT3B 3STZA 5E08H 1OM9A 2X4RB 1WHPA 4MAYD 2FX9L 1EX0A 1NMAL 3N43F 4U49A 2Z7YA 4G6FB 2ATPA 3CCHB 3X13B 2HLFC 5JQ6H 2Z9TA 2Z8SA 1BEYL 1HSBA 1U92A 1KYAA 3LHPH 3BUYA 5J12C 3SKNA 2F5AH 5LQBL 3VWKB 4DK6A 1T03L 1I1FB 3GRWA 4P9HL 5HYJA 1FFOB 2NX5A 2L0DA 1SEBA 1ZA3B 4J6RH 3WI9A 5D9SB 3WIFA 4HKJB 3WLWC 3MV8D 4BSVB 5KS9A 3DC0A 2VDNL 1U93B 3NA4A 4S1QL 4UMSA 4FFVC