4AV0A

Structure of the fimh lectin domain in the trigonal space group, in complex with a methoxy phenyl propynyl alpha-d-mannoside at 2.1 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av0A00
2VCOA 3ZL2A 5CGBA 4X5PA 5AB1A 5IQOA 2UY7B 4CSTA 3ZL1A 3ME0B 2WMPB 5AALA 2XG4B 4AVKA 4AVJA 4AUYA 5ABZA 4AV4A 4AUJA 4CSSA 1ZE3H 4J3OH 2XG5B 3RFZA 1KLFB 2J2ZB 3BFQG 4XOCA 4J3OG 4J3OF 2JTYA 5LNEA 3BFWA 1TR7A 4AV0A 3JWNE 5FWRA 3BWUF 2UY6B 4AVHA 4XODA 4BUQA 5FLUA 3MCYA 5F3FA 4XOAA 4XO8A 5FS5A 4AUUA 4CA4A 4XOBA 2W07B 4AV5A 3JWNH 1PDKB 3ZPDA 5FX3A 3SQBB 3JWNG 4AVIA 1N12A 1QUNB 1UWFA 4X5RA 5JQIB 5IQMA 5AAPA 4XOEA 4ATTA 5IQNA 4XO9A 5F2FA 4X50A 1N0LB 2JMRA 5LNGA 4X5QA 4LOVA 1KIUB
chains in the Genus database with same CATH superfamily
1TG8A 3NJNA 4G9FD 4KI5D 3RUGA 4YHKH 1S7UB 3L5IA 3NPSC 2OMUA 43CAB 1DFXA 4NHCH 1MCFA 4KNSA 5C1MB 3P2BA 3FU7A 5F7EL 5IW6B 4HUVB 3MRIA 4PJIF 2FX7L 4EI5A 4D0BA 4I3RL 1YNTB 3PRZA 3VXSB 4FZEH 2CHZA 4PGEB 3Q2VA 3TT3H 4JB9H 2J2ZA 1FE8L 2O5YH 5E8OA 2YEZB 5J12C 4PJFA 2VDNB 4LNRA 2EIBA 5I8EB 4KI5F 3VFMB 1QNZL 2BS9A 3PDOA 5IQ9A 3QO1B 3EYOB 4L05A 1QFWI 1FIGL 1ZK9A 3H56A 2JI1A 2EP6A 3IFPA 2CBTA 4JKNA 3VXRD 5KSAC 5DMJB 1KY6A 2PCFA 3DTUB 2ZKXA 3HC4L 4F93B 5FHBH 4F20A 2X4PA 2MCPL 3ARUA 1WFUA 1WP6A 4KY1H 4O2EB 4HEPA 4JKKA 5ISZD 4GQQA 3EO9L 1T04A 1YEHH 4CSPA 1UJ3B 1XIWA 2VDMH 3VB8A 3BP4A 3OKYA 4K7PX 4TXVB 4CW1A 1T4KB 1NH6A 4YVUA 3SPCA 1CLYL 3JTTA 1OL0A 1YMMD 3NCWA 3WEBA 4ZMTA 3WU1A 3CFBB 5JW3L 1U3ZA 2VQ1A 4FNUA 1NDTA 2BFVL 3AXIA 1OOAA 5JOPD 3KLHD 1NBQA 3I6SA 4HJJL 4RMVA 3SYCA 1UXMA 4GIAA 1AY1H 3OKLA 4O5LH 3ZN6A 5B4MD 5I6NA 2X1QA 2GI7A 4ENEC 4I1PA 4XMPL 2P49B 3W5NA 3P77A 5HHNB 4YS4A 4LMQE 4G6ML 5ANMA 3HUJF 4TRPH 4Y2DB 5KVMC 1OAXH 4PB9L 3P0VL 1SYVA 3QEGH 1I8LA 2N4IA 2VMEA 2GG1A 4CJ1A 4XC1H 4KTYA 4BFIB 5CZXC 2GEQA 4P4KD 5DT1H 2VDLB 1GGIH 4OZHB 5CIPH 2IO5A 1D7BA 2FR4A 3DMMD 5ENWA 3L3IB 5D7LD 1WIOA 3FFOA 3O8XD 4KGLA 2EYRA 2XN9B 1EERB 1L3WA 1T4WA 2DQDL 4FFZA 4P2QB 2X4QB 2AEQL 1ITBB 3R06A 4LQFL 4Y1TA 5EHFA 4U4BA 3BN3B 4ZT1A 5IMOA 4QOKE 4JUTA 5DD0L 1EJFA 5IBLD 5IJDC 1TTAA 3APFA 3B9KB 4MS8D 1AGBA 1LNUB 3BAEL 5K59E 4GAJL 2VDKL 4X5QA 4LBEB 5HDOA 4AQZA 1QTSA 2PR4H 4CU8A 1G7HB 4BHUI 3HG1B 4UQAA 2EUXA 4EMZA 4ENZA 3QIWB 4NZ8A 2XTSA 4JFYA 5B8CA 4PMEA 3QFJD 4IBWA 4JHWL 3CXDH 1RUKH 3MOAL 1KFAH 3F7YB 5E1IA 1ZGLB 3AAZB 2GSIA 3I6LE 4GBXA 4PHZA 3FSAA 1QKZL 2XBTA 5I2IB 4LLQB 1QA9A 4XN4A 2ESVA 3T3PB 4H1LH 4P2AA 4WK0B 1S9WA 3UBXI 4XBGA 3ZUCA 3L3KB 3ARDB 3WBDA 4BFFA 2XYBA 2DBLH 5BS0B 3WFZA 1XHHA 5CEZH 3QO0A 3VD7A 2NYZA 2WVVB 4AVKA 3W39A 3KMDA 3KJ4B 1S7WB 5BV7C 4YDKL 5HI5C 2JXMB 3GIZL 4DVRH 3AT8A 1LYQA 5M94B 3I75B 4DTGL 4PRDB 3L5XH 4DFIA 3T4AA 3QQ9C 5KSBB 3WN5A 3WKYA 3H3KA 3MPCA 2EQDA 4HPOH 5FXCH 3L3DA 1GZHA 3VGHA 2EE6A 1D5MA 4HJEA 3ETBF 1DBBH 3BT2L 4XWGH 1JNLL 4JJHA 4C56B 3TWCH 4JRYA 4L9LC 2DV6A 1GS7A 1IGTA 1J5HA 2OYMA 3LHPL 2AJUL 1QP1A 4N25A 5J1AA 1AGFB 3VFVA 2H3NA 5F7LB 4LSSH 5FLVA 5TQ0H 5I74C 5B1JC 4FG4A 1DQVA 4N90D 2CKNA 4Q74A 4NN6C 3V95A 5FLUA 3D87B 1EA9C 1XSIA 1VKXA 2F7PA 5TDNB 4LHQB 2BINA 1IKFH 1CE1H 1JGDB 4KZ0A 3CPUA 3MRBA 4O02B 1A14H 1AD9A 3SGKA 4LCWB 2VR4A 4TV3A 1S7RA 2GIXA 2P8LB 4Z0BL 2VAJA 2I24N 4WEBL 2OZ4A 3RWGA 3BKYH 4BFNA 5DJ6B 2N56A 1TLMA 2WOBA 2VXVH 4ZJ9A 2XN9E 3SGDH 3JTSA 3QEUB 4K0OA 5DVMA 4P2QE 1GYCA 1G7QB 3Q1SH 5IT2H 5E1AB 5FAAA 3G5VA 3Q8AA 2Q3XA 4GIPD 4NHUB 4U1HA 3BZFB 5IJVA 3FL7A 3V0WH 4HWEL 4G6KH 5LHDA 3FUKA 3U2SB 1R3IH 2YKLH 1A1OB 1U3NA 4X42A 4EUPH 3G04A 2W0FA 3V5DA 1MPAH 5F6HJ 5SWZB 3RA7H 2NYYD 1DFBH 3HG1E 3HS0C 3LJ3A 1SXSA 2P28B 3L9BA 3KBHE 5HHME 4K9EL 2BSCA 4PRPE 3VW3L 2ATKA 4JPIB 2E47A 4WW2B 4UT9A 4L4JA 1J48A 2C26A 3CFUA 3N6YA 5GRJH 5IFAL 5E7BA 4JLRB 2YMXH 1AJ7L 2A73A 2VLRB 1V7ML 1MJUL 3T3PE 4AX3A 3C5ZD 4Q9RL 2M26A 2HTKC 2NSMA 4JKLA 3MV01 1KCRL 4PRNB 1U8CA 5CEYB 1MG3C 4KAQH 1PEWA 4ECNA 2ZXAA 2AABH 5C71A 1IGFL 1ETZA 2XTJB 2P24B 5GZOD 5H2BA 1BCIA 1FYTA 1ZT7B 3B43A 1JZGA 4YZWA 4WI2A 3SB3A 4ZQKA 5KSBE 4ELMB 4QKTA 4QR7A 3RWJB 5KYYB 2D03L 2ICWA 1PJWA 2P44B 4JFSA 3X14B 4YLQT 1XGRA 4KKBD 7FABH 2Y6SD 3GC3A 3KPMB 1S7QA 3DLQR 3UTSD 3UYPA 3G9VA 3GSVB 1GC1L 3EBIA 3NK4A 2WZAA 2ZCLH 3RIKA 1ZD6A 4G42A 4N28A 1GZPA 3MJ6A 3WDIA 1K72A 1SVZA 4I4WB 5K9OB 3TYFB 5ADOH 3MXWL 1HINH 2G2NA 3RHWK 3BFQG 3EFOA 5F1NB 3I85A 4JO4H 3T6VA 4XCCL 5ETUB 5J3HD 2QQLL 1Z5LB 2NPLX 4JVWA 3LS5L 3VGEA 4LCWE 1EXUB 1DTUA 3ARPA 4GXFA 3ORJA 4M1DH 4PJDB 3MGTB 5GJTL 1TJHH 4OSUH 3QDGD 2C3VB 1ZANH 3DMMC 5DC2A 5HGHA 4KZDH 3HVNA 2Z91B 5JHDA 5KVDH 4XNXL 3O8XC 4XOAA 5D2LB 5LCVL 4AKOA 1LK2A 5EDSA 2QR0B 1BQSA 3MUHL 5DWPA 3KWWB 4E5XB 5L2JB 2V2WA 4IRSA 3TF7C 3Q1EA 1N26A 2HLFD 3LY6A 5D1ZI 3TBVB 4YSEA 5J13B 3EYFB 3SDCA 4XGZB 4JRXD 4LLAA 2F74A 4CKVX 5SWZE 4DUWA 3QUKA 3NOIA 1TQUA 1RZFH 1IAOB 4UQ9A 1J8HD 4R9HA 2OX5B 4BH8B 4Y5YA 3I2CL 1HSAA 2GK0B 2L7EA 3BPOB 3DETD 4F8OA 1DVYA 4LIQL 4G8FB 5I15H 2FX8L 1D6EA 3IF1B 2XXGA 5FHAL 2NXYD 2VLRE 3IDMA 3KD4A 3DO3A 5FYLL 5T3XH 4NZUL 1MHEA 4A2GA 3SKMA 5L6YL 5EEZA 4S0HA 1TQBC 2D0FA 3WLWD 1UJ3C 1X5LA 3B9EA 1FNLA 4X9YA 3WY4A 1NFDF 1P4UA 4HUCA 4X4XB 2XTJE 5DRXB 2DLIA 3W81A 4LLYB 1IFRA 1MHCA 1QPXA 5T5NF 4HUXB 2X05A 3MO1B 1K8DB 1H9DA 4V2CB 3Q8CA 1ZEAL 4AOFA 4ELME 1M05B 3RY4A 2PP8A 1NBVH 2IOIA 3UJTH 2XPGA 4EJ1C 4GMTH 1LO0H 3CZNA 4FJYA 1WE5A 4WQOA 3TGXA 1DBML 3RRQA 4D94A 3T4YB 2KZ1B 4OM0H 4R8WH 4J5VA 2XHNA 4ZMLA 1TJIL 4Y2DC 3D7PA 5LVEA 4XTRD 1XGQA 3PWJA 5F1IA 2YPLB 3S37L 2UZIL 4ZTEA 2WMPB 4J3OD 1J8SA 2FGWL 1NSNH 1OAUH 2LU4A 4Z3TA 5KBLA 1SJEA 2MTAA 4DN4H 2P3YA 2JLLA 2FQFA 3CX5K 1P4IL 2OMWA 4TUJA 1ZSDA 2EJ1A 3C60A 4OGAD 4PRBA 4D9RD 5IJCC 1KDIA 4LOFA 1THAA 5KS9E 5MERA 2Z93B 5D7KD 2QDWA 1A7NH 3N44B 2DPKA 1KLFB 5KS9F 3ESNA 5ICYB 4CN1A 4J3OF 4HJIA 1BMZA 2BP8A 3B9KC 2AKRA 2YQGA 3QUYD 1QFWL 3VSQA 3KBFA 4QAWA 1J12A 1CG9A 5D2LE 2OR9H 5EUKB 1AACA 4M7LH 1AGDA 3IDXH 5JLZB 1QR1A 3A67H 4MJIB 4M1GL 1T5WA 3L4TA 2BOBA 4IEFA 3MNZB 4KJPC 2FHBA 2WWNA 3IMRA 1BFSA 1UCBL 5H35B 1B0RA 2N1KA 1P2CA 2MPAL 4UT6H 1LE5A 4F2MB 2CGZA 4P23A 5E8EB 1S5IH 1OM3H 3FO1A 1WQVT 2VXQL 1MXDA 2HAZA 2X4NB 4HUKB 3US0A 2H2SC 3LN5A 5EO0A 1YJDC 2NYYC 3P40A 3TEWA 3ARDC 4P3WA 1NIFA 3OC8A 2BZ7A 3MV9A 4IDLA 5L9DL 4WI8A 1I1AA 2WQWA 4YVNA 3OF6D 1WEJL 3VXQB 4RGNB 4NQDD 3MV7B 5CU5A 5DD1H 2VYRE 3QJZA 3KLLA 3F6LA 4YSOA 1KCSH 1U8PA 4PBVC 1HX0A 2Z64C 2FBRA 3PY9A 3ILQC 1IM9D 5C0EB 3L5HA 4CNIA 3U7AA 1MCDA 5DQDL 3D0LA 3S35H 1HFUA 4GOSA 3WGVB 5INDA 4JY4B 4AYSA 5IWLA 2CO1A 5T3ZE 1CPUA 4JFZL 1ZGLP 1GGCH 5GGVH 4UMSA 4ZFFA 1CDIA 3GPSA 5FOBA 2F58L 2JV6A 4BV1A 1IIKA 2IH1B 5IUCA 5ITBH 2X44D 3CVDA 1KGJA 5ADPH 4HKJB 2E27H 2GK2A 1EUTA 3HHSB 1KYFA 5I82A 2NR6A 2X7LA 2GUYA 4GP8B 3GSRB 3LV3A 3D69B 2Z0UA 1UZ8A 2YPLE 1A7PL 2HVBA 3DX1A 3OMIB 2ZAIA 4L48A 3D08A 4HYTB 4P2OC 5C09A 1KGUA 3EGDB 2YFOA 5E1HB 3BN9C 1FCGA 1OGAD 2RACA 2VLJD 3OKEB 3DOSB 3GMQA 4G9DA 4LLVA 1V5JA 3GXPA 1N10A 2NY0B 1KB9K 3G5XA 1CXIA 4NQCD 4S11A 2A0LC 2GAZB 4HAFA 4K9JA 3K3QA 4NQTA 2ZG2A 3H9SD 3RVUD 1KY7A 4HEME 1NAMA 1OF0A 1R5IB 4K5NA 4OUUA 1OK0A 3QJFA 5L7XH 1YYMH 4PI2A 1S9YA 3ME0A 1BGXH 2RR3A 4MJ4A 4GUPA 5JDJA 3MGOA 2H6UA 3V4VH 2P5WB 4PUBH 4HFUL 4KO5A 5AW8B 32C2A 3GBEA 1DQKA 2Y25A 3LHAA 4H1LB 4JM2A 3FT3B 3FZUD 4J8QA 3VFUA 2O5NA 1F45A 1C8QA 1MJJB 3TS8A 2NY3B 3WXWL 5CBAA 2EIZA 4P46C 1HEZA 4KRMB 2HLFC 4GAFB 1Z6JT 2B3IA 5CD5C 1NTDA 5CJXC 4NQED 1GIGL 4QHLB 5EOTA 3L9EA 4X6BB 4PV8A 4P9HL 4NPYA 2EDMA 4PJ9B 2C3XA 1ZLSL 2E75C 3N1QC 3HR5B 1SJHA 4QXGL 1DSYA 1HOCB 2ENJA 1JVOA 3PDDA 3U1PA 1G6RH 4LLUA 4WO4B 2XTJC 4XVOA 4XO4A 4Z23A 3DPBA 3GO1L 2E76C 3ZKND 3SBWC 2DQHL 3GNMH 2C9PA 2YXWA 4ILDA 1TZOA 3CGTA 5HDBF 1NC4D 1ZT1B 2VXUL 3WLWC 1KB5H 1KACB 1RJYA 4P5TB 1E9PB 2JELL 5DRNA 3VDBA 2EUVA 4AV5A 1X6LA 1YEIH 1RK0A 2ITDB 4HH9A 4DGYL 3C9NB 4BK8A 3WXVH 4M62L 5INCA 1J5OH 1MLBB 4LVNB 4HWBA 2F15A 1NIDA 3RWDB 1DJWA 1Z9LA 3ARGD 3OQRA 1QFWM 4YUEH 2E7LC 4Z8FH 4DQAA 1BBDH 4WHTB 3SZ6A 4WNSA 4Y9GA 2XN2A 2RALA 5F9OH 3ENEA 3MKKA 1PYWA 3VE0A 4AG4L 4GQ9H 4CVZB 5J6GB 4OCSH 2QVMA 4XVUC 4R6UA 5DUBA 3F7LA 5I26A 4XTRC 4XAWL 2YMOA 2WQSA 3SYAA 4J3OC 4G83A 1DQJB 4APQB 1JNJA 4GLRI 2YMTA 4ZO9A 4K94H 4UQ2B 5DTFA 2RQEA 5DJAB 1JJUA 2I5YL 1DN0B 4E5XG 4E41B 4N5EC 4WI0B 3CFIC 1P1ZB 2JKTM 1UKSA 4OGAC 4R7NB 1RY7B 1JN6B 2NY4D 1GJUA 1NEPA 1U4EA 3CWGA 4JZJB 3OR7B 4FG6D 1U2HA 4DQOH 3IWUA 4G1EA 3KHQA 2QJDA 3FU5A 4M7LT 3UTTE 2YJLA 5KVGH 4L18A 4A2EA 2P5WE 3VG0H 2OP4H 4DKEH 3QUYC 3ZLQC 3N9GH 1E30A 1WJ3A 1QRNB 2F53B 2X4OA 4F7MA 3E6FA 3SY6A 1MRFH 4W9IC 2W59A 2VNCA 1AQKL 4ZW5A 2F7QA 5CEZE 2C5DC 2RIKA 1INEH 4RRPA 5E6IA 4AVJA 3BPCA 5HYSA 2Q76B 3HRZC 1JD7A 5FUZH 2F08A 4Q6IB 2JB5H 2GSGA 1SHSA 1PZUB 3BGAA 1KIRA 1N6VA 2UUDH 3DI3B 1G7JB 4QRRB 2IQAA 3WIIH 3QJUB 5ALBH 4U0QB 1E6OL 1HYSC 2ZUTA 4ZMQA 5T1JA 1KCUL 2D7QA 1NPNA 2AJXL 3GSOB 3G6DL 3HEIB 3H7LA 4MCYB 2NY2D 5DR5L 4BEIA 3D0VA 3P0YH 3N5AA 3E6HB 2F5BL 4FQHA 4L3CA 1CE6B 2HFTA 5L0QB 2BMKB 5F9JB 1E2VA 4FQLH 3ZOAA 3CNKA 1WWCA 3MRHB 4XHJD 4F8PA 3QIUA 5CFAA 3MRJB 3DX6A 1IILE 3KWTA 3MXVL 3PGDA 5DJ2A 1U8NB 2YXVA 5DLLA 1DVFA 2ZOWA 4MMZB 5F6HI 2EVIA 3S8GB 4FC3E 4XCNA 2DLFL 3LXAA 4RFEB 1NBYA 2C34A 4JHUA 5CXPA 1FAKT 1HWWA 1WG3A 5JYMA 3MJWA 3GSXA 4PGCB 5I8KH 1FZKA 1CT8A 1C8PA 4NQQA 1J9RA 3U7WH 2AQQA 4NQUA 3UMTA 3LPFA 1ZLWH 4MAYD 1PNCA 1JXGA 1CFVL 4AI7A 3Q6GH 3QDMB 4E41E 2WQXA 4AEEA 3ML9A 1KFGA 4WGKA 5E9AA 1V54B 3LMJH 5JHLH 3WTVA 2WVUA 5F2FA 4PS4L 4WEEA 3NFNB 4MA3B 1XF5A 4H20L 4GEIA 3FOLB 4XB7A 3H55A 5I1IL 4XMLH 5HHVH 5LNGA 4MQ7A 1OWWA 1JERA 3MREB 4PD4K 3RTQD 3MJ9L 4PVMA 3P54A 4LSUL 1QRNE 3DVFA 1NGZB 4I85A 4TN9A 3VWJA 5I8CA 5EF1A 1J86A 4IMKC 3ZRFC 3FZUC 3PFUA 3KPNA 1NMBL 4QYOB 5B3NA 3QCUH 4XP9H 2JJTC 1G6VK 3LH2L 1LWJA 3MLWL 4MDJA 2ADIA 3UH8A 2XY1A 2EICA 3VJ6A 1MF2L 2OJ1A 3IT8D 3CFDB 4XZ4A 1FVCA 4GKSA 4QRRE 3CVHL 1BECA 3X11A 1B2WH 4AT6A 3EO0B 4OJEH 2MNUA 1C16A 1AKJA 2NW3A 3ZE0B 5AVVB 4N9GB 3NSFA 2NY7H 2VERA 4YFEA 2F8OA 3S88L 1KNOB 3EADA 4MWFB 1FPTL 1OAQL 1MLCA 3VCLA 1F8TH 1N70A 3STLB 3B7SA 3H9ZA 3QRBA 3C6LB 3T2PA 1WFOA 1T1ZA 4U3SA 4PJBF 5HD8C 3AY2A 4QRSB 4BSWB 1M9SA 1F2XK 2HVJA 3EJZD 4ACPA 3L7EB 1AR1D 3VFSA 3HMXA 1KBWA 2AK4E 3BDBA 1M3IA 4G8GB 1NIBA 6FABL 2Z7UA 5I8OL 1OM9A 3LH8A 2EDFA 2DJSA 3RFZB 1BLNB 1FH5L 3ARGC 4WFFD 5BOPA 2XX0A 1WCBB 2IG2L 4N2CA 4LCYA 4PRIE 1JFQL 1CFNB 2QKIC 3MNWA 4XMZA 5KVDE 4LF3B 3KVDD 2CKBH 4LSRL 4UTCA 3BZEB 4U0RB 3LCYA 4XH2B 1KJ2A 1EO5A 3PWNA 5HJ3A 2IADB 2NTFB 2CNYA 4NKIL 4JFOA 4WWPA 2V5TA 3DECA 3HNVL 3QDME 4GXVL 4JFPA 5HHPA 5T5FL 3O41B 5GJSL 1S7VA 2AAAA 5C0RL 4KTDH 4XO3A 4HZAA 3PP4L 4FMKA 3QR0A 4OLZH 2FBOJ 3HR6A 4NUGH 1FNAA 3AG2B 1I1FB 3QWQB 3Q9QA 4FG6C 4ZZKA 1JGEB 4PJ7F 4JO1L 3O6KL 1CZ8L 1RHFA 1SN0A 3ESOA 3GXFA 4PJ9C 4ZAKC 5K33A 3VMPA 3DYPA 3LZLA 2NQDA 2CK0H 1EHAA 3AS3A 3IGFA 4KKQA 3QJSB 1BFVL 2KYIA 1SMDA 3DGDA 4I1RA 1U92B 3RAJH 2L0DA 5D4JA 5EZIH 1IGCL 4Z78B 2H45A 2AK1H 5EU7E 2RD0A 1LEIB 2FRGP 2Y5TB 2OMXA 3O3DA 5DS8A 2V7HA 4JHVA 1QTPA 3ZHKA 2XKNB 2O30A 1VEPA 3KDMB 3A6BH 3QZOA 1MJ7L 1OF2B 2CO6B 3AACA 4GI6A 1GS6X 1YMMA 4P5TC 5I17A 5KSVB 3ZE0E 3KEDA 5TJWK 5HJDA 4DK3A 3FTSA 3HJ0A 5GRVL 1NCBL 3D5OF 3RVTD 1WC7B 4NKMA 4F9PA 5C07A 4F2FA 3IPEA 5LNDA 4KDTA 2X9XA 1LDPH 4HSCX 4MX7A 2VDRL 3UBXG 4F80A 1PZDA 4GKZA 4DKTA 3HE7D 1EXHA 1DQLH 1UB5A 3F7VA 4KHXL 4S1QH 3VFPB 1TQTA 3MV8D 4OTXH 3CUPA 4L5FH 4XHJC 3TZVB 3M7FB 1KPUA 5CUSH 2VQTA 4MAUL 4OZ4B 5DJCA 4XNQB 2J8HA 3CN0A 4BQ8A 4G8GE 1G7PB 1XB8A 3DXAD 1JZ3A 3VO0A 1F4YH 1YDPB 2FT8A 3LXBA 3PWLB 4MNGA 4APQC 1S7XA 2DYPD 2IALB 1IB5A 1BOGB 2R1WA 2N59A 2P47B 4LFHD 3K6DA 3V4VB 3ZYZA 3I3DA 1KGXA 3EDFA 2AXFB 4LCIH 1CQYA 3HMWH 2NUPA 2LOEA 1U8MB 3KJ6L 5DFVD 2GBVA 4HALA 3RVVC 4YE4H 4PR5A 1X5GA 2ZKMX 1MAKA 3EJPA 2H9GA 4G82A 4O51A 3HI5H 2EDDA 5LAXB 4Z3FA 3HZYA 1A3RH 2OL3L 3N0AA 4MAYC 1JGVH 2DIJA 3MLYL 3Q9PA 2X4RB 3RIAK 4B53A 1SEBA 3ZGHA 2QPUA 5FUOL 1J1XH 1IC0A 2V2XA 2WKOA 4XX1G 1G6RB 3QDJA 4NZDA 1OSPH 1Q0EA 3Q3GB 4L0ZA 4Q6IC 4BKLA 1ZLEA 4DO4A 1UB6B 3B7UX 3GUTB 1NGQL 3QEHB 3MBEA 8PAZA 1XGPB 2WBJA 2OSXA 2ZX7A 1MUJB 4PLJC 3HNSH 1BSIA 5JQIB 1Z9OA 4M7KL 5T1LA 1ILUA 2R7EB 4CL7A 1I1YB 3C75A 3LKSA 4WV1C 3GDBA 2XFGB 1Y1DA 3NG5A 5F7EH 3JYCA 4NBYB 2EZ0D 2FX7H 3NRFA 5BW7C 3G5ZB 4I3RH 3QUZB 2OSLB 4KKAC 3FCBA 4MNHA 1IJNA 2WQVA 4LOVA 1KIUB 4IOSD 1I4FA 1FE8H 3QSKB 4ADGA 5EC2A 4K07A 2WYZA 4QNPF 1ZLUH 1BD2A 3UG5A 1QNZH 2CM5A 3BQUB 3ZDXB 4UIMA 4O2CB 3VRIB 4JMNA 3WEOA 5I6KA 1MCEA 1NANI 1ZV2A 3MOBL 5CBEB 4MSWB 3VYNA 3HC4H 3CD4A 4BWTA 3WKML 1C7TA 2MCPH 3HBGA 5CHNB 2WQ8A 4FFYL 2CJ3A 1PX8A 3K8MA 2NXZB 5FM8A 4GB9A 4MGXA 3EO9H 1FQ9C 3AB0B 4JHZA 5T1KB 5DJYA 2BDNL 2C3HA 3IN0A 4UQ3B 4GPVA 1NM4A 3D85A 4KY2A 3K91A 5TGBB 1JS4A 3NEXA 2X4UA 2WIIA 1CLYH 1PKOA 1AHWA 1W72L 3A47A 1HHHA 2FQEA 4PJHB 4XOCA 2EE2A 4F24A 5JW3H 3SDDB 2F54D 1YAIA 3QNYB 5ERWB 2BFVH 2HT3C 3FRUA 5IQ7L 2CALA 5C6WH 4JFXA 1N3NA 4HD9A 4HJJH 4APXA 1H6TA 4IHOB 2ERJB 2QPEB 4MAZA 2CDEA 2LW3A 4IS6B 2Q8AL 3HHRB 5L8JB 3I84A 3JWNE 3L3GB 3UTPE 1C1EL 2R2HB 3QC5X 3QS3A 3V6ZB 3X3FL 3BUIA 4G6MH 1S3KL 4ZMOA 3EZ8A 4PB9H 3P0VH 2F1BA 5IEKA 5IY5B 3P02A 4I0PB 5BVJA 3C5ZA 1AHKA 3I50L 3FUNA 5KBKA 2XVKA 5DZNA 1GH7A 4OIFA 2K8QA 5K9KB 3ZK0A 5B38A 5I0VA 2EUWA 4GAGL 4JO8A 4Y5VB 3IJSA 1I8MB 2P9RA 2DQDH 3LOWA 5FGCB 2AEQH 4U1JB 5TQ2L 4LQFH 5IREA 3QNXB 2VW4A 4LHUG 2H6PB 3PABA 4X5LA 2PPDA 3RWIB 4FHJA 5DD0H 3TC9A 5IB5A 5DF0A 3D25A 3AG1B 4KDWA 3IJHA 2QQNL 1XR9A 4KZCA 4NQXA 1LWHA 2CGYA 2DQFA 3DPDA 3IWVA 3BAEH 5JW5B 4GAJH 2VDKH 4JW3A 5DZOA 4AIZB 5C0NC 2ICEA 4QEGA 1ACZA 2HJLB 1A3ZA 2KLRA 3H9HB 4P2RD 3OGOE 3UAJD 2BP0B 2VAAA 5DI8A 1FFPB 4JHWH 4MNQA 2AERT 3MOAH 5F21B 3IDGA 1OTUC 1V3LA 1ZAGA 4YE0A 1QKZH 1FZMA 5C86A 1BP3B 3RFZC 4R5VA 4JZNA 5DXWA 5HYEA 3CSFA 2CDGA 3MRIB 5C0JA 2JIXA 4HFWA 1AO7B 1TNNA 1DDHB 2P4AB 4X0KA 1HH6A 4PU2A 1BG1A 3IYLW 1DCLA 4ZW8A 3VD4A 3OWEA 2J4WL 3S34L 3GKWL 2XN0A 1A64A 2FJHA 3GIZH 2EIMB 3JV4B 3GEFA 3QDGA 2HN7A 1PKQB 4LNRB 1H6UA 3TNMB 4F8TA 4DTGH 2IAND 3IAPA 5KVGE 1R3LA 1U33A 5E5MB 4Z7WA 4U6YA 4HU2A 1UURA 2XWJB 3VI3A 4B95C 4JQVC 3BT2H 1JNLH 1URIA 2UZXA 3D3VD 3G6AB 5KOVC 1BVKA 2CA3A 4QXTB 1JPGA 2J5LC 4MD4B 1X5XA 4UM9A 4GG6F 3DX0A 1Q9KA 3P1VA 4FFZL 5DFVC 5IJBC 3FU6A 2HRHA 1T1XB 2ZXQA 4AC2A 3MFFB 3LHPH 2Z92B 2AJUH 1RHHA 5HHOE 3M17B 3DIFA 4Y2OB 2CBOA 4AIOA 4O58L 2PO6C 2H41A 5C0AD 3FUEA 4FQQB 4BZ1A 4CDHA 2FSEB 2XG5A 5C7ZA 3S97C 4Z6AT 1S7TB 3AMLA 3NN8A 3JTTB 2EIEA 4R96B 1X5IA 4HX1B 5D1XD 2FBJL 1R3KA 2VM9A 15C8L 2B20A 3VI4B 4RISL 2XU9A 3MJGX 5EBLB 2Z0BA 3A4DA 4Z0BH 1FO0A 4WEBH 2XXCB 5GS2H 2VXSL 4F2EA 2C9VA 1X9UA 3PPEA 3GFUA 5FGCE 2R39A 5FKAB 5AG9A 5DHVH 5EO1B 2YFNA 4L4VD 4AGLA 1PZCA 2DQEL 3AREA 2HH0L 2XA8L 4HWEH 3SEPA 2B3RA 4XOBA 2ATAA 5JTWA 1D3CA 5D96B 1X5KA 5AOMA 1JK8A 3BP7B 3NMEA 4ZXBA 1TCMA 1PD0A 3UROR 2FR4B 3QORB 3LZRA 2VLKD 2QZ5A 4OQ1A 4K9EH 3EO1A 4NERA 3VW3H 1LP9B 5ESAA 1N0LA 3D2UB 5MI0B 1KG0B 4HD5A 5IFAH 1I7TB 4MZRA 1MQ8A 3R06B 2VN6A 4JO2L 1AJ7H 1NGXB 1IAKB 2CJUL 3VFNA 4PREA 4YR6A 3OLGA 2VDQL 1V7MH 5DVPA 5A40E 1MJUH 5JW4M 1FH2A 2CBQA 4Q9RH 1ZXKA 1DJGA 4ADIA 4DJMA 1KCRH 3QNFA 3Q2WA 1AO7E 3M45A 2HTLD 4PY7B 1X9QA 1I7ZB 3G7TA 4G7QB 4PP2B 5EZJA 3SDAA 5L2KD 1CD1B 1IGFH 4G5AA 1JSYA 2WLYA 5EIVA 3HG0A 4JFYB 1E5AA 1FL5B 1JF1A 5HGBB 1KC5L 3BEVA 1EDQA 2WVSA 4GBXB 5D8JL 2F19L 2VABA 1JZIA 2D03H 4JFED 5CGBA 3T6ZA 2ESVB 1M3JA 1MAJA 1N18A 4U31A 4QO1B 2EIDA 5FYJD 4N0CD 1BMWA 2V9UA 2DWEA 1GC1H 4P8QA 4AQ1A 3PV7A 4OI9A 3SY0B 1PY0A 2R8SL 4N8UA 2BXYA 4UQCA 4L8BB 2YUZA 2EKSB 4NUJA 3MXWH 2NTSP 4WF7A 1QO3A 5GGRY 3T4AB 1KGCE 3NIFB 1B90A 4Q4EA 3ARFC 4DW2L 2NMSA 4HV8B 1D5MB 3OF6A 1F3JA 3ABKB 4XCCH 1QSFD 1T0OA 2PW1A 3QXAA 2QQLH 3KG5A 3ZTNL 2DQGL 4RMUA 1A4CA 4L3ED 3LS5H 4N8VB 1FFTB 4N2KA 1UEMA 3N42B 3H3PL 5C08B 4GINA 5GJTH 4S0SD 5G4MA 1A47A 1N19A 1UUSA 4OV6F 4RDQG 2BW5A 1R5VB 3W0WD 2G9HA 3D4CA 1OD9A 4PJ5B 4XNXH 4PV9A 2BK8A 4OFYA 5LCVH 4IMLA 4ODUA 2F8XC 1RZIA 4OH2A 5I6XB 2EO1A 3JZ7A 2LTQB 3ZDYF 1OGTA 1DBAL 3BQUC 3MRBB 5D4HA 3VG9C 5MENE 1RFDL 1LD9B 3RWGB 4G3YL 2MPVA 1GKEA 4Y4KD 2V5MA 4JVUA 5ECGA 2E6JA 1LP9E 1OT2A 2C9QA 5AENA 4R3SA 4YL9A 4K94C 3W57A 2JCWA 2APBA 3I2CH 3JTSB 4NRYA 5AZUA 3ULUL 1CLCA 3V6OA 4LIQH 1YEDA 3UAJC 2AJYL 1JZHA 1JOIA 1VFUA 1WS8A 2CR0A 2C7UB 2FX8H 1KYDA 5FHAH 3O3BA 5FYLH 3VA6A 3VD5A 4NZUH 3WDHA 4Z76A 2VMJA 5L6YH 3RWEA 5KBNC 3SJVB 4KK8C 3V5DB 1EUUA 4FFWC 3U7YL 2GBUA 1WFNA 2H2PC 3SQBB 3UJIL 4TVPL 3VXPA 1WGOA 4F15C 2OZNA 4G71B 4Z5RB 4OCYL 3GJFA 3C6SB 1COBA 1HIML 5L4MA 4JQXA 1X5JA 1ZEAH 3ZT6A 4CAGA 2N3JA 5KG9B 3NCYS 1M7XA 3QUGA 4AM0A 3QUXD 4GRLD 4OLXL 1R5WA 3O4LB 1NKRA 4OAWB 5CLWA 1DBMH 1FLTX 4BFGA 1MCNA 3ALXA 3CLEL 2YRLA 4Y0GA 2L7JA 1JYNA 2ADGA 4RMRA 4JRWA 1TJIH 3RNKA 2CXKA 3S37H 2UZIH 3SBPA 5DJXA 3QXDA 3TPKA 4H8PA 2FGWH 1TO5A 1VCBC 2FDBP 4PJCA 3LZFL 3K71A 5EEUA 2H32A 2FWLB 3KYNA 1UADC 3F58L 2YD3A 1MW0A 1P4IH 4R4BA 3RL1A 4AENA 2ICWB 5D6DA 2EEFA 4MZ3A 3T2LA 3Q05A 1SDYA 5H94A 3UYPB 3AROA 1JMZA 3L4WA 4HP5A 3WFCL 4EEEA 2X0UA 1U9KA 4S1RL 4QCIA 5AOJA 2DN7A 4TLKA 2QSTA 2G9KA 4PJ5E 1QFWH 3UPRA 1XT5A 2VDOL 1FL6A 2UYLA 3EUDA 4QRQA 2HPTA 4L5FE 1CDGA 2ZJSL 4L0PB 3VXSD 4M1GH 3DJTA 3QJQB 2FYYB 4YPGB 3TO4D 5IIEB 3OKDA 5LDSA 1I3RA 3MJ7A 4ZPTA 5IP4A 1UCBH 3APCA 1JPEA 1JTOA 2MPAH 5KYNA 4FA7B 5CGTA 2WXNA 2VXQH 4MZ2A 3DHJA 3ZKXC 1XF4A 4DZ8A 3JWOL 4HCGA 4LPUA 5ITFB 3MRGB 3EOTL 2VRQA 1XH2A 4PJXB 5L9DH 3LYRA 4X8XA 4Q9BA 2C3GA 4PBXA 4H13C 1WEJH 4G6JL 5SWSD 1EZLA 4BXSV 1IBFA 3II3A 3SJVE 4BK5C 4KKPA 1E4JA 3OXRB 2WPGA 1X5YA 4HMEA 1HHKA 3FQ4A 4FLQA 3JTBA 5B1CA 3FOMB 2W07B 5DQDH 4TNVF 4J7RA 3ATAA 3NIDB 5GSVB 3CCHB 4JFZH 2WXHA 5IB3A 4JS7A 4HEPG 3FW6A 3GMPB 4TTDD 2F58H 2B7DT 3D50A 5EN2B 3ZT7A 1D6EB 3BRDA 1HDMB 3O4LE 3KGRA 1K5NA 3G6JB 4OZIB 3WO4B 4X4ME 3KXFD 4P06A 4ES9A 1XSJA 2QADB 4U1LA 3NAAL 2ZUXA 5JPMC 3T1WA 4KXZI 4HOZA 4UUJA 2KI6A 2W65A 4Z18A 3UCQA 5IVNA 2KMWA 5DCCA 2WW8A 1A7PH 1WF5A 1TZIA 4FE9A 5AD0B 1HWGB 3J2PA 3WY3A 5MEPA 5MP6L 2ZT9C 4F7EA 1BJ8A 2CRMA 3KPPA 2A9CA 1P6WA 1AP2A 5IHHA 3BCDA 4TULL 1L9SA 4RFNC 5AW0B 2K8MA 1VPOL 4ZZFA 3KVQA 4YXKL 4Z7VE 1M56B 1SDAB 2WANA 3D07A 2FCBA 4BSVA 2XN9D 5LXGL 3OB0K 4ZPVA 5F9WC 3NA9L 1BZ7B 4YBQD 5D96C 1NFKA 3O45B 3PJNA 2QHLA 1JL8A 4NOFA 1ZXQA 4Y88A 3SGJC 1SOXA 1DHKA 4ZUSA 4TL4A 3QORC 4NO0A 1T7YA 4G80B 1FI8C 5ALCL 1JK9A 3CLFL 5EEWA 1ILSA 3HZMA 5MI0C 3GMNB 3QA3A 3WXWH 4PW4A 3C60B 3GGWA 2DMBA 2VMFA 3P69A 3NP4A 4S1SL 1JYWA 3VGDA 4XBPB 1GIGH 1WFTA 4ISVA 4R97C 4LPWA 2PXYD 4P9HH 2BP8B 3QZWB 1ZLSH 3QI9D 4QHNA 4QXGH 4O4YL 1QSZA 4QXVA 2WY3B 4PJXE 4PJ8A 1CDBA 3DK2A 4N2OA 4H26B 3T0DA 3GO1H 2DQHH 4P2YA 5BS0D 1XGYL 2HX9A 2BOBB 3MQIA 2V2TA 1ORSB 1S5HA 4GSDL 2L7QA 1B0RB 5E95B 2VXUH 3HPJA 2XRAL 4KXAA 2JELH 1U93A 4NYLA 3LN5B 2A9DA 4L3AA 4MCZA 1Y6MR 4DGYH 3R8QA 4JFQA 4M62H 1M1SA 1QLEL 1JIBA 2WLKA 4HIHB 5AVWB 2FEEI 4C56D 5HYQB 4BXVA 2RBLA 4UTBA 1GOHA 2GITA 1XEUA 2ZXCA 3BCFA 1NAML 3G6JE 3IK2A 4WW1B 4AUUA 4GI8A 2CXGA 5D9SA 1TJGL 4GRLC 5EU6B 2IAMB 1EMTH 1J1PL 3LB6D 2D31A 4NNYB 4U1IA 4AG4H 1CI5A 5LWYL 1Z9NA 5INDB 3LRSA 3PL6A 2C9AA 4MD5B 3DV6A 3MV11 4XAWH 4ZDHA 3R7RA 3S5LA 3QIBB 2NW2A 1IIIA 2PETA 4ZFFB 4ZMNA 1QUNB 4YDJB 1CN4A 1Y7VA 1CGTA 3TPUA 5FF6A 2F8VA 1FV1B 1H5BB 2EDOA 3ECBB 5KOMC 2I5YH 5JHMA 1GY2A 4HG4J 3FUHA 2JK5B 2OXGB 2V6HA 1RIHL 1CDCA 3LV3B 4PM1A 5I6XC 5CS7A 1QHOA 1M71A 5ACZB 1PG7L 4BA0A 4URKA 2AHIA 3U6RB 5IEHB 4PRHE 4I9XA 2O61A 4IRJD 3ZW3A 2EDNA 4MB4A 4WGWB 1HHIA 4KC3B 5SWZD 1A9BA 4PJAB 1EJOL 1KTLA 1HCZA 4X5XA 5JQ6L 1AQKH 1KXHA 3CSGA 4GKNA 1OGSA 1XD1A 2MQ3A 2D7OA 1CGYA 3MRRB 2ED6A 3BSGA 2XWBB 4KO6A 4UIKL 5HJBA 5E4EC 3RKDD 2CUMA 2OI9B 3QJFB 4DK6A 3LVTA 4HWBL 4BZYA 1AZCA 3ME0B 4F57L 1GY1A 4ORZC 4NXKA 2DQMA 1CFTB 2PWEA 5D2NC 1E6OH 2WWOA 3ZBMA 4A63A 4M6ML 3NCJL 4FEMA 3S35X 1KCUH 1VFBB 3U6XA 1QBLL 4AUYA 3ZL4L 4MVBD 1RZQA 1UA6L 1P9MA 2AJXH 3G6DH 5I1CL 1TUPA 5DR5H 1VSCA 4WW2F 4C83A 2AQSA 2BP5M 5DZJA 4FLOA 5F7FA 4G11A 4ETQA 2F5BH 2BSSB 2V37A 3OKMA 1BF2A 4UBDD 1KPRA 5C9JA 3S3JA 4PJEF 3CH8A 4U3XA 5HHXL 4PS3A 4EXKA 4OZGB 5D55A 1EHNA 2K6YA 4HK0A 3MXVH 4QT5B 4HPYL 1H8NA 3LKOA 3LNDA 4Y8DC 5F88B 1HHJA 3MCG1 3BIKA 1WO2A 5DMYA 5ICZA 1IKNC 1BX2A 3H7BB 2DLFH 3L1OL 5KYXA 2C3WA 2WZPD 5DRNB 3V2AR 3IJ9A 3U0PA 4PS8A 3U30B 1J7VR 3C5JA 3GK8L 4QHKJ 1BIHA 1KYOJ 3IDUA 5CEXA 5CR8A 4AGNA 2EINB 3WFHA 1ASPA 3B2VL 1BF8A 2WNGA 3GSNA 1KJMB 1ZHKA 1CFVH 3HZVA 2G2RA 3CU1A 4FG2A 5CCHE 2OMYA 4ZI8A 1IVTA 4KVNL 3KW7A 3E0GA 4MXQD 4PS4H 1PYWB 3VE0B 2BH0A 3DBSA 4H20H 4HKZA 5C6TL 5I1IH 3N40P 2HT2C 1FNFA 3NJHA 4I18C 2XFXA 3GMRA 2QELA 3Q6FB 4YBQC 1UGNA 4ZUWB 1AZBA 2YUVA 4P5RA 3MJ9H 4PJDF 1HI6A 4LSUH 3BP5A 2BVTA 2QV2A 2SODB 4KUCD 5IQNA 1B0GA 1I85A 4PJAE 5DTFB 2WN3A 3FQRB 1LXMA 1EEZA 1NMBH 1O7VA 4KV5F 3WNLA 5GIRA 2GB2A 4M5TA 3RDTB 2ZCZA 3LH2H 1J9QA 3L81A 2DYPA 3MLWH 1QUPA 4R90L 1DVQA 2WC7A 2Z7ZA 4GO9A 1T5KA 4XAKE 3IS1X 4G1EB 2RJMA 3QWRD 1MF2H 4FRWA 2MRYA 4ZYKA 4O2FA 1GW0A 3CVHH 4M00A 2GPZA 1KXVA 1J11A 3HI1B 4IBZA 4JMXA 5I1HL 4KUCF 3GEWB 1A1NA 4JDZA 5DD6A 1ECZA 3NZUA 2HLAA 1CDJA 2X4OB 5DZVA 5K39A 1NCUA 4D9LL 3O6FB 3H42L 4FS0A 3S88H 5CLTA 3O0RL 3ZL1A 1M57B 1FPTH 5H37H 1OAQH 2CPCA 5E6IB 1QHPA 2A6IB 2NZIA 2YSSA 4DKFL 5TH2A 3OZKA 1MFDL 3QHZL 3WO4C 4K8RL 1HNGA 4NRZA 4FTVB 4TUKL 4YC2C 2YGQA 4MD0A 1E7UA 1W15A 2QADC 2IQAB 2MNJB 3VVVA 4RMSA 2ADJB 1IM3B 1ZE3H 4QGTA 4DOHB 4LGPB 1XL4A 1X4XA 1DQQA 3FB7A 1OE3A 5F3HA 2C1PB 6FABH 5I8OH 4Y16C 5JOFB 1IC5L 1MI5A 1UM4L 3D0VB 3VQLA 4BQ6A 5KZCB 3GSWA 1FH5H 3KCPA 4S2SB 1OZTG 2IG2H 1JFQH 2OTWA 2R56L 3PYCA 4H8HA 5IFHL 5JORB 2IDUA 5ESQA 4G5ZL 4LSRH 2ZWSA 1HE8A 3Q5OA 3TEYA 1GHFL 3IDIA 3EJYC 4GH7B 1L7IL 4M48L 5FYLD 5LO7A 4NKIH 1GGTA 3K6SB 1XH1A 3HNVH 4GXVH 1A9EB 4RGOL 5HGAA 3GINA 5T5FH 1E7VA 3BP6A 5GJSH 4AKQA 3S48A 4JAMA 4XN8A 5D7IB 5C0RH 3K0WA 1U58A 5C0GA 3PP4H 2E9WA 4L29B 4YL4A 4MJID 3HE6A 4ZFZA 1XXFC 3QULA 2FJFA 3WDJA 2PYED 4GIOA 1ITCA 2YA2A 3LKQB 3WLBB 5E56A 4JO1H 3O6KH 3MUGA 1CZ8H 2P5EA 4BUGA 4HK3N 4PAZA 2WXPA 2ZSVB 3OX8B 1E3ZA 2ZSWB 5LBSA 1JWMA 4EOWL 1BFVH 1DVXA 2E7HA 2J3SA 3NZHL 3TH2T 1IQWL 3NRPA 1UWXK 2DWYA 3PWUB 1IGCH 3BJLA 2UV3A 3FQTA 1PIFA 2E86A 2EE9A 3LQZA 4WFHD 1DEEA 5BRZB 3GHEL 4OF6A 3RKDC 4YK4C 4EI0A 4WNQB 4RGND 2ROXA 3MV7D 2EVGA 1MJ7H 1H0DA 3DVGA 3HPLB 1T22B 2WJ5A 2IXQB 4ZUTA 3SDXA 5B7EA 3R1GL 1QVOA 2GUOB 3VXMD 4WSGA 1NCBH 1J05A 5CJ5A 5I8CB 4ZUVB 5L4FA 3DHMA 2VSDA 1BYPA 3MLTA 4YSRA 1KULA 4X6DB 4XPHL 2P7TA 4E9RA 2HG5A 1EXGA 2ADIB 2VDRH 3KPSD 1KJ2L 5DQ9A 1TXKA 4R7VA 4L8SB 2UXTA 4UBDC 4KHXH 3MODL 4GKSB 3A3YB 1SHMA 4UINL 3L9RB 2A1WL 4DERA 3DX9A 2PTTB 4G2AA 4MAUH 3FQ1A 4H2AA 3UX9B 3VDCA 5IMMA 3O11B 3BKML 1IC7L 1GSMA 1ADQA 4S1DC 4AE1A 1RP8A 1M1XB 1MCOL 2HP4A 3O2DA 1OP5K 3QZPA 1MLCB 4HDIA 5IHZB 4H0HB 1L9TA 1PQZA 2FL5A 1H5BC 3VGGA 3UDWC 1EZVX 2FWUA 2O6CA 3DJ9A 2NY0D 1U8IA 3D06A 3KLAA 2VZVA 2Y06L 5GHWL 4YHML 3C5SA 1HH9A 3KJ6H 4TNGA 3FFDB 1Q90A 2VZTA 5C0CA 3QRFM 4I5BA 2PN5A 5DRWB 3AM8C 5IG7B 5GPRA 5CP7B 1NUNB 2H1LM 2JCCF 2OL3H 3QJHA 4B0MM 3MLYH 4R0LA 5IVXE 2BNQA 3AWFA 1F11A 4WUUB 1MVUA 5D7IE 1E27B 1NLDL 1Q9OB 5A16B 3MNWB 1SN2A 5IVXF 5FUOH 3VWKD 2CLVA 2ARWA 3V0FA 1RZKL 1V10A 3E1F1 1IAII 1T3FA 4RBPK 2NY3D 2K6ZA 3BPLC 5HGDB 3U9UA 2N0MA 3EJUA 1ORQA 1W6WA 2OI9C 1NGQH 3QH3B 1EFXD 5ESVA 5KSAA 1KF9B 2CM6A 1DUYB 4J6IA 4RESB 4LKCB 4GFTB 4YNYA 1S7VB 1JNHA 1KIPB 4M7KH 5BRZE 5TTRA 4AEIL 1MSPA 1PDKB 5D5MF 2ZTBA 2FEEL 4HKXB 3H8NA 1GC1C 2VSMB 3CZFB 4U6HA 3MA7B 1ZLVH 5B39A 2R4RL 4AYEC 4IKLA 1W0YT 2R1YB 1E67A 4L3FA 1UVQA 3PJLA 1EH9A 4ANKA 2WNWA 5FFOA 3P9LB 1KLGA 3UTZA 4X6DE 1DEDA 1AZUA 5AVRB 3LKRB 4HHAA 1TQCC 4PHXA 2Y7LA 4L8DA 3AU1B 4MJHA 4N0YL 1WAAE 1SJVA 4GKLA 1GJWA 2FWOA 4GSXA 5E2TL 4KVCL 3RBGA 4GLRH 3L3JA 4IW4C 4JFDB 4OI8A 1ZJBA 4X6FA 4YHPA 3MOBH 3TCLA 3LPPA 2UY6B 5E9NA 2X3CA 4KUZL 5JIMA 5I66A 3LRKA 3WKMH 3PDGA 2VGLM 4FFYH 3TBTA 1QLRB 3PXLA 2XN1A 4NKMB 4RMWA 4LHJB 4HIJB 2XACC 3UYOD 4F33A 3QZLA 4Y1AE 2BDNH 1KPVA 1KTDB 4GKZB 1RLWA 3ELQA 5D1QE 3W1ZA 3WEXB 3MX0A 5BJTA 4FFTA 3V0EA 5AW1B 3MCKA 1W72H 4X98B 1XF2A 4PV1C 3W2DL 4EN3B 1U91B 3VXOA 5IQ7H 5DJCB 5TDPA 2R2EB 4X4YB 2B77A 1UXSB 3CSBA 1N6UA 1AIZA 4XX5A 1ZTXL 2VLKA 5FR3A 2G0KA 4WKXA 5DK3A 5E6YA 3MGAA 3MRNB 3O3UN 3P4LA 4WUUE 2KUTA 1S7XB 4TOYL 4WFGE 2Q8AH 2Z1PA 5FYKE 1RV6X 4DEPB 3WAJA 1C1EH 1SY6A 5TFSL 5C9KA 1XO8A 3X3FH 4K23L 1KYAA 5D4QA 1S3KH 5BO0D 4HJ1A 3KPRE 2F53D 1YEEL 2EDWA 1ZK5A 5CZKA 3RDTC 2H8PA 5LNEA 3VXTB 4BZ2L 3B2UD 3I50H 4PCKA 3IJYB 5IVZB 1OT1A 4UQBA 4ZS7L 3KPLA 4ODBD 3B6SB 2LABA 2WCSA 3BWUF 4M8QA 4O51B 1NDMA 4GAGH 4P9ML 3GJFK 3HZYB 1WLHA 3VFRB 3QR1A 4F27A 3OLIA 3MRFB 4QRRD 1SEBB 5TQ2H 4RRPG 4OD2B 4B3VA 5HYSG 2QHRL 4BKTC 4UDTA 4R7DB 4ACTA 4U1NA 5TDOB 4KX9A 2QQNH 1JCVA 2C9UA 4X6EA 5KANI 4RWYL 4YEEA 4B9ZA 4Q9CA 4MMXC 3PAZA 4CADA 2WWMC 5JXEC 4HGMA 5AOZA 3W5MA 4IYKA 1NOAA 3HLAB 4KK5D 1R75A 3QWNA 3VRLE 1P7KA 5JNYA 4L9LA 5T1LB 5CO1A 5DMKB 5E9DB 5FFLA 2E3VA 1D9KA 3PXJA 1T6WA 4HK3J 1S9XA 5A1AA 4L1TA 4NRXB 1QSFA 3TFKC 1O6SB 3QEQB 5ABDE 4HS3A 1E28B 1IGIL 3L3HA 1NINA 3FT9A 5EZLA 4L37A 2BIIA 4WI3A 3O9WD 2J4WH 3S34H 3GKWH 1I4FB 4YSSA 3RHWF 2VH5L 5LGKA 3P73A 2H1XA 5EWIL 1BOYA 1HNFA 2V3EA 2OSWA 4HIEA 4UIMB 3VXNA 3FTGB 4FXLA 4HJGB 4EDXB 2R1XA 1NFIB 1MEXH 2DTSA 4WJG3 2BIPA 4X8JA 4Q4IA 4FFZH 3R7QA 3NDYE 4X7SL 4YN3A 5ACMA 3HBPA 3V5HA 3MACL 1YUKB 3VSTA 1WBYA 1I7RA 2IBZX 4N0FA 1QI3A 3BGMA 2WNXA 3HS0A 4XNAA 4O58H 5HYJB 1RI8A 1DR9A 1SQMA 4MJJA 1CK0L 5IBTL 4M3HA 4DAGL 5HSFA 2XWTB 4LLWB 1AHWB 1QTYT 2AVFA 2FBJH 3ESPA 15C8H 1YQVL 2NY1C 1SYSA 4RISH 3U0WL 4NDMA 4UI2A 1KOAA 3U25A 4H25B 3BUYB 4MB1A 3FDWA 4PLNC 2RQ8A 3HW7A 1U36A 2VXSH 3F64A 3MU3A 2GEEA 4FI6A 2NDFA 5CZVL 2C4FU 4EXPX 3DYMA 3S4SA 2FNBA 3VU2A 2J6WA 4P05A 4BH7A 2CWRA 2MJWA 3I6KA 4QHKI 4WJ5A 3FQ2A 2DQEH 3TH3T 4QYAA 4WENB 2HH0H 3DTXA 4PW9A 2FLBT 2XA8H 2GI0A 3QW9A 1YY9C 3BVVA 1A1MB 3GIVB 1RAMA 4LDLB 4U1MA 3DUSA 1ZHNA 4LHUD 5L8KB 1ESOA 5IW1B 2XZQL 3C6LD 4UNIA 5GZNA 1OAYL 3D2TA 1CD8A 3IJSB 3O4OB 4Z7UB 1ND0B 1J8RA 1MWAL 1ES0B 2AV7B 4KNUA 1P6AB 5DGRA 4GT7A 4M61B 1PAMA 4JO2H 3WGUB 2CJUH 3PABB 1FFOA 3UOAB 3OAUL 3DURA 3PCYA 2VDQH 3RY6A 1LQBC 4HGWB 3D25B 1AZRA 1CXLA 1T89A 3QEQE 3Q8FA 1XR9B 4CRPA 1Z5YD 2APFA 2DQFB 4IK7A 4Y4HB 1JFHA 1H3GA 5D1QC 4EQ2A 2SEBB 4LGRB 2ICEB 5HI3C 3IEAA 1TCRB 2ATPA 4QF1B 2YD7A 4J6RL 1S7UA 4L1HA 2H6OA 4QOKA 43CAA 1TQWA 2R0ZL 1M6UA 1HZKA 1KC5H 5IW6A 4HUVA 5D8JH 3BSHA 2F19H 2EXWC 2QPDB 3KPQB 1L6ZA 1KV3A 4RVBA 3P0GB 1FO0L 1QEWB 2ADYA 1YNTA 4OKVB 4ORGB 4PMFA 5AFAA 4P9HC 4X50A 2WUBL 4HFWB 3C87A 3UACA 5GS0D 1QNIA 2YEZA 3VTMA 3MLPA 4BM7A 2VWEE 1QQDA 3OHXB 5I8EA 3EFFB 5J6HA 2MHAB 5ELIA 2R8SH 3AGWA 3QO1A 3EYOA 3MRPA 1MAML 5HYJE 2BSRA 3EXJA 2CAKA 3BWUC 5I0ZA 5I16B 3NZ8B 4DW2H 4K3JL 3TA3B 1T6BX 3BYTA 2KHAA 3QUMB 1EHLL 2R69A 1N5YL 3ZTNH 2DQGH 4UAOB 5A3IC 3H3PH 1JG9A 4DPBX 1AIFB 1YUHA 3FYIB 4DT2A 2WXIA 3NQIA 4URTB 5BXFB 1UJ3A 1RHHB 2VDRB 1A8ZA 3FT4B 1WZ1L 4U6XB 5JIKA 2QVIA 4XN9A 4YDMA 1KTRL 3DK0A 1UOWA 3CFBA 2XG5B 1QPKA 2JTDA 2KT6A 2WINB 4HJ0D 4RCAA 2ED9A 1W0WB 5ID1A 2CU9A 2ZXBA 4L1LA 3AW5A 1H8SA 1R3KB 1DBAH 3QJXA 1RFDH 5DA4A 4G3YH 5KTEL 3BFWA 1A6UL 4ZMVA 5EOQL 3ULUH 1ONQA 3SDYL 3GS0A 3AWEA 4Y2DA 5IV2B 5LGJB 5J89A 2AJYH 3MUUA 1UACL 4HU8A 3ARYA 4OGQC 3WL9B 2FWSA 1JPTL 1AMYA 1CIUA 1IGJB 1Y07A 2WLLB 1ZVNA 1RULL 4KXDA 3L3IA 1Q9LB 4LSTL 3U7YH 4A2DA 1FIEA 4ZXBB 1KZYA 4P59L 3UJIH 4TVPH 2XN9A 2YOCA 3SE3A 4P2QA 4C47A 4M6OL 2X4QA 4OCYH 1CICD 3KZ8A 1PSKL 5CJOL 4EN3C 4OV5B 1HIMH 4RZKA 4AL8L 1IAIL 3ZVVA 1VFOA 2FJGB 2KS0A 5F3BB 3NACL 5BVPL 3LVEA 4XCEB 3RWHB 3B9KA 2C1OB 3BVWA 3E8VA 1LNUA 4PREB 3Q2LA 4OLXH 4MDRA 4LBEA 1G7HA 4JPKL 4W9EC 3HG1A 3CLEH 4J3XA 5CAYB 4J8RB 3WS6A 5EZJB 4MXVF 1CF8L 3KPOB 4PRPA 1A7OL 2AXGB 3QIWA 1R47A 5F9AC 1N9PA 3V7MA 1MRDL 3VUAA 2VB5A 4Z3EA 3F7YA 2X89A 1ZGLA 1TU2B 4XPAL 4B50A 5C0IA 4NM4L 4Z3HA 4NFCA 4J2QA 3RFRA 3DSFL 4LLQA 4A67A 1JF1B 3LZFH 5AVZB 4Q14A 4G1MB 1BZQK 2PYFB 1JI1A 2E0PA 3F58H 3L3KA 3ARDA 4GYBA 5FDWB 1G0DA 1MNUL 3FSVA 2J7LA 3QPQC 4ZX6A 5BS0A 4KJWC 3LZOA 4MB3A 4NQVB 3H0TA 2WVVA 1S7WA 1NAKL 2O5YL 2BY0A 1DL7L 4YH6A 4X2UA 4NJ9L 2JXMA 3UAEA 3WFCH 3WKPA 1X5FA 1EBPA 2QT6A 3I75A 4FNLL 4OW6A 4S1RH 4PRDA 4QIRA 2JJUA 4N24A 3REVB 3ZKMC 4DVBB 1F6AB 4AZ8A 4H0GA 3EDEA 3T0WA 2IMNA 1YPZF 3I74A 5KSBA 4L4TE 3U9WA 2VDOH 1NANH 2FNWA 2YRZA 1R34A 2KERA 2YWZA 2ZJSH 1TPXB 3QUZD 1F02I 4PN6A 5HBBA 3QXAB 5SX4I 3MJ8B 4CMHB 1UHVA 4X7FC 1AGFA 4RX4D 3QQ4A 5D1ZC 3MROB 5J1TC 3JWOH 4AC4A 3KVPA 1YVLA 2G9HB 3VH8B 2B39A 3IKCB 3B7TA 3EOTH 4RDQF 2IH9A 2LV4A 4IMLB 1I8IA 1JGDA 4O02A 2B4CL 5DVLA 4LCWA 3IAQA 4G6JH 4OI7A 1YA5A 1BDYA 2P8LA 3T1FB 3TVMB 4OJAA 3JVGC 4PPTA 5DJ6A 1OGTB 2NXZD 3OZLA 5LJYH 1RZJL 1G7QA 1CFSB 1OLLA 2IF7A 5E1AA 4R3SB 1AXSB 5FGBC 4J23A 4LPTA 3BZFA 1LQSR 3EH4B 4HQQL 4PRAB 5GGTL 4PWGA 3PREA 2DH2A 4AYGA 3SDDD 4XPTL 2EC8A 5SWZA 1X9RA 2XWRA 3IKKA 1JZ4A 1AZNA 2ENQA 3NAAH 4JPIA 3FU9A 4N2NA 3JWDL 3R0MA 2DQUL 2AI0L 5C3TA 3VFWB 5F0MB 1PFCA 1E5UI 4P46A 4U1SB 4U49A 3H6AA 5CR1A 4YDLB 2DI7A 4JLRA 2EE0A 1CGXA 4JGUA 4RA3A 1AZVA 2VLRA 5D7JB 5MP6H 3V79C 4I0PD 5D6CB 1JV2B 2J8UE 3BYYA 4JG0L 1QI4A 2ID5A 1DZ0A 4TULH 2J8UF 5D93B 5CEYA 2YAEA 3SQOL 4IGBD 5I24A 4F58L 5GRZA 1VPOH 2YN5A 4YXKH 4JUSA 2FH8A 2J56A 5I0XA 4Q2ZB 2FHFA 1ZT7A 3SBWA 1HL5A 1II4E 2P52A 5LXGH 1WZKA 1ZIAA 2G2PA 4ODVL 1BXUA 1ZE3C 3RNKB 4A2FA 3UC0L 3EFDL 3NA9H 5FKPB 4ELMA 5C6PB 2LE9A 4FL4B 3QXDB 5B38G 3TN0B 2C4XA 3X2QB 5KYYA 3MA9L 1GAFL 4FADA 3NEOA 2H0PA 2H32B 3B1TA 3VA2C 2H1PL 3K8LA 5IF0A 5ALCH 3CLFH 3O4OC 4AENB 3BKCL 3GSVA 4B9PA 3SCMB 4A2MA 5EC1B 2TAAA 4S1SH 3VACA 1IL1B 2YGVA 4YHZL 4N1EA 1QX1A 3KGSA 3QCVL 4XB8A 2ZYSA 2PLTA 2E7LA 2YPVL 5F97E 5AOIA 2WZPA 1NCHA 4DK5A 4XMVA 5F1NA 4LZKA 2X09A 3EG9B 1EAJA 4EDWL 2R29L 5E1GA 5F0PB 3EHBB 4FQ1L 4O4YH 2OPCA 5ETUA 4KFMA 1XF1A 1Z5LA 2D4FA 4QRQB 4FHKA 4EI5D 5I18L 3LTVA 1EXUA 1NCWL 1XGYH 2X5PA 1INQB 3GXTA 4ZPTB 4WVRA 5HVHB 1TF4A 2UZPA 1G43A 4GSDH 3TBYA 1KCWA 4N2EA 4LDEB 4M03A 2C3VA 2XRAH 4F3FB 4XZUB 3RUGF 1UOKA 5D2LA 1RPUA 4KH9A 3TIEB 5AVXB 2QR0A 3RNQB 3BXNB 4K7PL 3KWWA 3UG4A 5L2JA 3JQOB 1CICC 4IU3B 2AGJL 3ARWA 1QLEH 3TBVA 3EYFA 3OHXC 4XGZA 4KZEL 1W91A 2QV4A 1NAMH 5F1OB 4JZOB 4CC4A 1TJGH 4PJFF 1IAOA 4FGMA 4YXHL 2OX5A 3H2PA 1T66D 4WWKB 4ZOEA 5DUJA 3B83A 4BH8A 4ZS6D 1J1PH 5FK9B 5LUMA 2GK0A 4HA1A 4Y4FB 3TA3C 5KN5B 4XN1A 3CZJA 1XIWD 3L17A 4G8FA 5LWYH 1L5GB 1IEBB 3IF1A 1MCWM 3QWRA 3RZCB 5IB3B 5DLML 3B56A 1CCZA 4LL1A 3WG7B 3MZGB 4NKOB 3F7PC 4X4XA 1K4CB 3KR3L 3KYAA 4LLYA 3W11C 2MOVA 4OCLC 2VT0A 1LEGB 1RIHH 4HUXA 3ZHNA 3MO1A 2M8XA 1K8DA 3DROA 5MEOB 1ZT4B 3U4EB 1PG7H 1T2XA 1KYUA 4NAJA 2NX5B 1BM7A 4L0YA 1ZKAA 3KPPB 1AP2B 4PWHA 2NT1A 4KAQL 5GXBB 4KJYA 4OJYA 3ARVA 5IK3A 5FCSH 1EJOH 5JQ6H 3CDYA 4B3EA 2YPLA 2WMPA 3D2UD 1JZFA 2PP9A 4UIKH 1CFQB 1JDCA 4HWBH 4F57H 4JRLA 4GQZA 3Q8EA 4OFDA 2AQNA 2F0CA 2IMMA 2WOYA 1BJ1J 4IBUA 1O5PA 4M6MH 3NCJH 2V5YA 1JK9B 3ATEA 1QBLH 1ZHLB 2Z93A 3WJLA 3ZL4H 4CJ0A 1MFCL 1UA6H 5I1CH 4HEMA 1JYXA 3UGUA 5ICYA 2R9HC 2ZP0T 3T0XA 3ARBC 2Z8RA 2HX7A 2K0RA 5DGQA 5EUKA 4GBXD 3UAAA 5HHXH 3FT2B 2OSYA 5JLZA 4QLWA 3VGAC 4QHNB 5DUPL 4ZMYA 2VSCA 2ESVD 3MNZA 3POCA 4PJ8B 4KFZC 1HL8A 5E03A 3VQ2C 4HPYH 5B3SB 5H35A 2C9XA 5EO9B 3IDYC 1FBIL 4IQHA 4F2MA 25C8L 1E9QB 2X4NA 4CGTA 2AP2A 2MQCA 3IMVA 3L1OH 1WFIA 2L4OA 2A83B 3ABLB 4IMKA 1R6VA 2BX5A 2CUIA 3ZSTA 4DP4X 2W5PA 2KPNA 3GK8H 3BH9B 3Q06A 3VXQA 3ZE2B 1FNGB 1DANU 3B2VH 1H3WM 4W9FC 3C8DA 1KGWA 5C08D 4POZD 3W56A 4JRYD 4NI3A 2Y9RT 1FVEB 4IGBC 3X1FA 3FHAA 3NIGB 5A2CA 4ZO8A 4JY4A 4N2GA 5IMKB 2OR7A 4KVNH 1TPXC 1WTLA 2J1YA 3NIFF 4X8GA 3COOA 4TF4A 5C6TH 3PL6B 4CMHC 3DV6B 4JCWA 2NX5E 2PTUA 5KUMA 2OCCB 2IH1A 2DLTA 2E4TA 3ATDA 4MKTA 4R2GB 3CLWA 5TF1L 2BVQB 4HKJA 3WFEL 3TPUB 3HHSA 5FF6B 5CD3B 5FCUL 5EPMB 3GSRA 3HG3A 3D69A 5C0BB 3ABGA 2PWFA 4B97A 1P6FA 1ZWIB 1LM8V 3NZSA 3U82B 4ZFGL 3GRWA 3CC5B 3EGDA 1KEML 2P8MB 1U3HB 3OKEA 3KM2A 4R90H 3WY2A 1UJTA 3DOSA 1S46A 2H3XC 1OALA 2ZOKB 4RMQA 3WMPA 4F7PB 1NKOA 3LXUX 2E6PA 3ZR5A 2UXVA 2YSTA 4NX0A 2O61B 1BZEA 5I1HH 2HYMA 2GAZA 2G4GA 3KL3A 4EKXA 1B9KA 2K9FB 4IIQB 3NEEA 4U7SA 3UL4A 1OQXA 3IJEB 4D9LH 1QYGL 5FW8A 1R5IA 3H42H 3V0HA 3FN9A 4X5XB 3W82A 2CNZA 3O0RH 3WOVA 3CHOA 3WY1A 5F7WC 1P7HL 4ERSL 2AZUA 4DKFH 2ZUWA 2ZICA 2B1AL 3UTTA 5C97A 5I1GL 5J0BA 1MFDH 2AJ3B 3QHZH 2P5WA 3SPGA 4K8RH 2DEWX 4TUKH 4ZMZA 4GW5A 3GSNL 2AXHA 4H1LA 3FT3A 4H88L 1MJJA 5JZ7C 5I23A 2WM0A 1J0HA 3NSDA 2HFFB 1MREL 4O00A 1HQ4B 3DOIA 4N8CL 4IK6A 3T0EB 2OFQA 4QHLA 5D7JC 4TYUA 1FYTD 4PTTA 1XH3B 4X6BA 1IC5H 1JVLA 1UM4H 2Y1AA 3RIAF 5JMRA 2YEQA 1OY3B 4PJ9A 1Z5HA 1JHKL 3HR5A 1UZGA 2NCEA 1HOCA 1T66C 4HJUA 2R56H 1GKOA 4ZS6C 5IFHH 1I8AA 3KDPB 2VDOB 2FUQA 4WO4A 5AKVA 1HCVA 5EBWA 4G5ZH 3DNKA 3ZE2E 1GHFH 2F8IA 3V55A 3LKOB 1L7IH 4M48H 2GJ6B 1ZT1A 2IPUK 1HHJB 5CNHA 1FYHB 1T0MB 4N1HB 4P5TA 1E9PA 2G5UA 3NIGE 3LIUA 1XCQB 4K5LA 2ITDA 4RGOH 4F9LC 5BZZA 2G3ZA 4G6FD 1IV8A 4AVHA 5DHEA 1CO1A 3SCMC 4A39A 2VKWA 2BNRB 3ULUF 1MLBA 1W6LA 5G5DA 3RWDA 2IFGA 2WLIB 3AXLB 4UNUA 4A7GA 43C9A 3QPXL 4HMDA 1A3QA 2CIKB 3OB0H 4BCXA 1I8LC 2PW2A 4JFWA 1X5HA 4LO9A 5C0BE 4TVPE 4CVZA 4EOWH 5J6GA 3GSUB 2VDPB 1DJXA 3NCCB 3NZHH 2CSPA 3P3UA 1NEUA 1U8LB 3S3SA 3GHEH 4NZJA 4RAHA 3S8WA 2WXRA 5HVHC 1DQJA 4APQA 4IRSD 1T80A 4PS7A 1UZ6E 2IDSA 2CK2A 1HQRB 2VQUA 4Z7NB 5DJAA 4A66A 3SDCD 1DN0A 3R1GH 4YLBA 1TT6A 4E41A 1JP5A 4WI0A 1AYOA 4KXZH 3B1UA 3VVWA 4R7NA 1JN6A 5JHDE 3BMVA 2NY6B 5GGSB 1L9PA 3OR7A 1TQSA 2P80A 4FN0A 4XPHH 4B9CA 1OTTD 2FO8A 2XLLA 2DL9A 2LLGA 5F0JB 1KJ2H 5B8CC 1TOXA 1ZV5A 1UT9A 4L2LA 1ZS8A 4Z7OF 3MODH 4WWKC 4O2FB 5F8RC 1W80A 1QRNA 2F53A 2V3DA 4UINH 3ZE1B 5HDQL 2A1WH 3VYPA 1A1NB 2VL5A 1A6WL 4JDZB 1M6OB 3BKMH 1IC7H 1Z0MA 5EF0A 4FCHA 3V9FA 3T0EE 4BYHA 1D5BB 3RZCC 3NIDF 1G1CA 4Q6IA 4YZFE 5HHQB 2J5WA 1MCOH 2VLME 3QK0A 4Z7QB 3AG4B 4M93B 3CC1A 1G7JA 3HKZA 2CE6A 1ZDQA 4A7VA 4QRRA 1E8XA 2HMID 4JKMA 1GCFA 1NCTA 4K7PY 5LDUA 1FHNA 4YHMH 5GHWH 1XSOA 2Y06H 3K6OA 4QXUL 3RI5K 5LBSL 3WN5C 3GSOA 3PHOB 4WV1A 1BQRA 1CU4L 1TSRA 2EECA 3GTTA 3E6HA 1HZHL 2XT1B 1RUQL 2BMKA 4H0LC 3ZZLA 4AQEA 5F9JA 1MI5B 2OMVA 1XZWA 3MRHA 2NRDA 2IC2A 3LRMA 3MRJA 1NLDH 4LARL 1MFVA 4RQQA 2BNRE 2EKJA 5EIIB 2OCJA 4DNLA 2BJML 1RZKH 5HY9A 1PVHA 3ZTCC 1U8NA 4BGDA 2M2DA 3C60D 5BZDB 3IDIB 4LL9A 5FPIA 2WQAA 2AJVL 4G72B 3SN6N 5IMLB 2R0LL 4PRIA 2DKUA 2NQCA 2V8MA 4YO0A 3UGXA 1JGIA 4PGCA 4GKOA 4G6AD 4JAMB 5G2NA 4D0CB 4UT7L 5E6ZA 3TCTA 3AQDA 3GD1C 3HE6B 4NIKB 4ZFZB 3D39B 1ADQL 2R4RH 3IBEA 2J88L 2Z8WC 3QULB 4W9GC 4LEEA 4HOXA 3QDMA 3FBQA 3O2DL 4FNQA 2P5EB 3LDBC 4P23D 3GJEB 4D9QE 3RGVC 2EDXA 4XVJL 4DPRA 5T1MB 1AVAA 4MA3A 3UP1A 1TTUA 2ZE0A 5FX3A 2YK1L 3NCEB 1ADWA 3F6IA 3FQTB 2X40A 3LQZB 3MV9D 4E42B 1DEEB 1UWFA 4N0YH 1I1AD 4CKQA 4EF3A 1AANA 2XETA 2ZONA 3BAKA 3IDJB 1JZ2A 5E2TH 4KVCH 2IEPA 2IDFA 1AZZC 3WEAA 1H0DB 2UWEB 2YR3A 1F41A 4AE0A 5EU6D 3ULVL 3BLPX 4KUZH 5FO9B 2IAMD 4HETA 4PBDA 4QYOA 4DFHA 1Z32X 3NRQA 3SE9L 4X7CC 4BWWA 4Z7QE 1MH5B 1DLFL 3CFDA 4UWQB 3V8OA 1U8HB 4MRCA 5DQ9B 1B0WA 1MZZA 1QSEB 3EO0A 1RH8A 3BESR 4KK6D 2WTRB 3CDZA 3K2IA 1R1CA 3LSOA 4FXTA 5AW5B 5HPMB 4N9GA 3TESA 2WHVA 4GP4B 3W2DH 3WJMA 1R24B 1GGYA 2FZ3A 2JJVA 1KNOA 4D0DB 3ULUC 5CCKL 1AC0A 4MWFA 3S5LG 3PWPB 2NR6D 1C5CL 1UH2A 4DN3L 4IBYA 4DSYA 2QSCL 4LAQL 1ZTXH 5KSUB 4R2GC 5BZWB 1G7LB 4HDIB 5F6IC 4FI8A 3EDDA 4QRSA 5C09D 4TOYH 3IGKA 2FL5B 5B3JE 3OG4B 5TFSH 3L7EA 4K23H 4BIKA 4JFHD 3GI9L 2F5AL 1YEEH 4OLYL 3C5SB 2Y36L 4G8GA 3D05A 4BZ2H 5AWNL 4N26A 4I5BB 1FNSL 4ZS7H 3RFZA 1BLNA 3RU8L 1IUZA 4AYBA 1WCBA 3AUWB 4JFFB 1YEJL 1OE1A 4P9MH 2R2BB 1CFNA 3RX7A 5C2BL 5DS1A 3OMNB 4ONGL 4LF3A 1F4WL 4I9WE 2PP7A 3AFLA 2CLVB 2QHRH 1AR2A 4XH2A 4JM2D 3D39E 2IADA 2BVUA 4M1CC 4MQXC 3WIAA 4J28A 5FM5M 4PWKA 2WZ5A 2L3BA 4JGNA 3RP1A 1LO5A 2K7QA 4RWYH 5KBMA 4YHYC 4P3DB 4NO2B 3O41A 4QRPB 1I8KB 4XNZC 3SDCC 3Q5YA 4EBQL 4HVBA 3UEQA 3RL2B 3VB9A 2VTFA 2JWYA 3TU6A 2LU7A 3D33A 3ARSA 1DO6A 4YNYB 1X7SA 1JGEA 5LAPA 2DKSA 4JM2F 3SBRA 1OSZA 3GDCA 1QBAA 4FFVD 2PO6A 1Z9PA 2UWEE 1BQHA 1Z3RA 4LPVA 1UVQB 1IGIH 1L6XA 1U92A 3OB8A 4X6CB 3BSZL 2CLZB 4KRPB 3G5WA 4Z78A 1SY6L 3UTZB 1G9ML 4DUVA 1NFAA 4X4KA 2M83A 1LEIA 1FFRA 2Y5TA 2VH5H 3IDNA 3PWVB 4UOW0 4OFQA 4V1DB 2XKNA 3KDMA 5EWIH 1OF2A 1Q0YH 2CO6A 4GRWH 5KSVA 3QYMA 3Q0HA 2YLHA 3IVKB 4Z3JA 1X4YA 3JWOC 3TH4T 1WC7A 4KMLB 1CLZL 3PWPE 3SYQA 4KO9A 3T3ME 4XWOC 5I66B 1HL4A 1XBDA 4TUUA 4X7SH 3T3MF 1JF6A 2DI8A 3SD2A 3JT0A 2RAMA 3HN5A 3MACH 2HXAA 5EUOE 1CVRA 1ETB1 4XXWA 4G70B 3VFPA 4V33A 4ZW7A 5L88L 1YN6A 3O6ML 3ZYIA 3TZVA 4UV4L 3MX0B 1CK0H 5FYJL 2JKLA 5IBTH 4OZ4A 4B0MB 4XNQA 3U0TA 4DAGH 2ROYA 4IKIA 1D2OA 2DZEA 1FNEA 1YQVH 1YDPA 4UILL 4E2OA 3U0WH 4ZOAA 1DQDL 3ULSA 3PWLA 4RAVB 1UD3A 5EZOL 4JFFE 5CZVH 1SHWA 5ECJE 4R84A 4NENB 3V4VA 1SGKA 2ALWA 3N3EA 2AXFA 5CSZB 4FA6A 2R0WL 2A9BA 4KNTA 2G3MA 1U8MA 3C09C 4OIIL 1MCSA 2NY6C 5EB9A 2BS71 2GCYB 2QKSA 4IIZA 1EO8L 4FULA 4P5MA 4M3JA 3MN8A 1S9KC 3LKNB 4RNRB 4QRPE 5E6ID 5IROA 5LAXA 3MR9B 3WKQA 2X4RA 2XZQH 1OAYH 5E4AA 4FTVD 4P23C 3W9DB 1N8OE 3BWZA 1G6RA 4W9ZA 5AYUL 4K7FB 5E8PB 3DX8B 3THML 4B9GA 4OGYL 3L1GA 3Q3GA 1T83A 1RERA 4AIEA 1UB6A 3OAUH 1PS3A 2CGRL 3QEHA 4L8CB 4M93C 2BERA 1I1AC 1XGPA 3PU7A 2TRYA 3FPYA 4X6EB 5LQBL 4U4IA 1KB5A 4X6CE 1MUJA 5D71L 5DZLA 4CADB 3BH8A 1D5XB 3WO3B 3A22A 2JB6A 1SEQL 3TJEL 3N85L 3CX5J 4J6RH 3QIUD 1QFHA 4JKWA 4V1DE 4L9LB 2R0ZH 5IWLC 1GYAA 4UNVA 3ECVA 5A2IH 1A5FL 1FO0H 1WBXA 3QUZA 2OSLA 5I74B 4KJQD 2A77L 2WXLA 1OP5H 4NN6B 2CUHA 2WUBH 2MOQA 1RMFL 2LAAA 5J1SC 3QAQA 3U48A 3BQUA 5JW4Q 1AS6A 1P53A 3VRIA 4IBSA 1MAMH 2Z31B 4A6YL 2CR3A 1E4KA 3B37A 4WEUD 4ZMXA 3Q43A 4PJIB 5CBEA 4MSWA 3FT1A 2X4TB 2ED8A 2Z7YA 3EYQD 1MXGA 4K3JH 2ENSA 5CHNA 1EHLH 4V2BA 1LILA 4OU3A 1N5YH 5HI4C 2Q6WB 4TVSa 1VF5C 1EO7A 3X13B 5H4ZA 4JRFA 4G9FB 2TSAA 5EU4B 2APVA 4LE8A 1MHHA 5T1KA 3ZO9A 4XBEL 4UQ3A 4RBPH 3IJ8A 4N0FB 3VM5A 1WZ1H 5TGBA 4YHIA 3HC0B 3VXUE 3NQKA 1XBRA 4PJHA 4BRJA 3VTTA 1OXYA 5DA0B 3FCGA 2IWFA 4XI5D 3VWJD 3V7AE 1XFPA 1RIVL 3AQYA 2EVJA 5B1KA 4IHOA 4FKEA 4NAMA 5FM5O 1BQ5A 4IS6A 5KTEH 2FJUB 5E00B 4XCFL 4OZFH 1A6UH 2R2HA 1JZEA 2I7SA 1VACB 5EOQH 3LS4L 1E5YA 3SDYH 5GSRA 2EXYD 2DWDA 2EDQA 3VXRB 2YOAA 1OP9A 1UACH 2W0KA 1AKJD 3UERA 1JPTH 1CIDA 5SV3A 1RULH 5K9KA 4WWID 4OR1A 5ISZB 4Y5VA 3QR2A 4LSTH 4C8XA 1I8MA 4P59H 1QWUA 4M6OH 4U1JA 3EYVB 1PSKH 3QNXA 4P99A 3HUJB 5CJOH 3ZHLA 2H6PA 1F1DA 3HNTL 4BDVB 4ELKB 3RWIA 4M7ZC 4PLKD 4AL8H 1IAIH 1KB9J 5MHSE 3NACH 1IKOP 5BVPH 2BOCA 3N41F 4FI7A 6TAAA 3S3DB 5JW5A 1CFMA 2FTAA 4UQEA 5LG1A 4TMPA 2AC0A 2APWA 4AIZA 2EYSB 4JPKH 2WBXA 2HJLA 3BUDA 3ET9F 3H9HA 4HOWA 2R0KL 1CF8H 1A7OH 2BP0A 1CDHA 1MRDH 2R23A 1FFPA 5I28A 2DRUA 3E7JA 4I77L 1XGUB 1X5AA 2ATPB 4XPAH 4NM4H 3GT6A 4DP7X 3PNWB 3DSFH 4QOKB 3A0OA 2OR8A 4JX0A 1IFHL 4P4KB 4PJIE 3BZDA 4PJGE 3DMMB 1AO7A 4G8AC 4N1CA 1DDHA 4UYQA 3KAAA 1MNUH 2HJKB 4FQXC 4PJGF 4HUWB 1ZPUA 5D7LB 2C9SA 3SE4A 3O8XB 3P3TA 3QG6B 4KPHL 1D7DA 3N43F 5JHLA 4ATTA 1NAKH 1DL7H 3BISA 4G9FE 4KI5E 4NJ9H 3JV4A 2OULB 5F89B 2BXZA 1PKQA 1BVLA 3SKOA 3ATBA 3TNMA 2O6PA 4FNLH 1QQDB 1ROCA 4BK5A 3D34A 5J6HB 4EIBA 3S7GA 1AQDA 3ROOB 3RWFB 3T8XB 5E5MA 3MRPB 2VDLL 2BSRB 1HVXA 2XWJA 3UZVA 3UZQB 4E9TA 2IGLA 3G6AA 1PCSA 2AJZB 1SJMA 4QXTA 4V11A 3T71A 4MD4A 2DY2A 4B5ZA 4W4OC 3RVXC 1T1XA 3GJFH 3N2JA 4JL1A 2Q3ZA 3PV6B 3QFJB 3MFFA 5B39G 2Z92A 3CSTA 4KKLD 3INUL 2RHEA 2QLYA 3M17A 4Y2OA 1YUHB 1HTYA 1TQBB 1ZV9A 4GFXA 2LAGB 5IB4B 3G5YA 2E9IA 4U3CA 4FQQA 5FGRA 2FSEA 2KC0A 2UX7A 4JFDD 2QEJA 5DJZB 3VXRE 2VISB 1S7TA 1OPGL 4FHBD 4R96A 4KRPC 4HX1A 2XIDA 3TEXA 2E56A 2HX8A 3VI4A 2B4CH 5EBLA 4NO3B 3HZKB 5ISZE 5ID1B 5AB9A 3TL5A 1OE2A 3P4NA 5C07D 3SO3B 1XTLA 1ZOXA 1RZJH 5FKAA 4LVOC 5EO1A 2XC8A 4FQ2L 3HUJE 1VA9A 1OP3H 1YMME 1HK6A 1ONQB 3FRPB 4HQQH 5LG6A 5GGTH 1WWWX 2E5EA 1RURL 4ANUA 5JOPE 4HUNB 3M88A 3FHQA 4XPTH 1FF5A 3BP7A 1JPFB 2ISDA 4FNTA 5I71B 3QORA 2UZYA 4HIXL 1LP9A 1DVFC 1WSST 2AQPA 2FGZA 3JWDH 2LVCA 2DQUH 2AI0H 3D2UA 1KG0A 2HT4D 2WLNA 4OCNC 4XO8A 1I7TA 2HRPL 5ILTL 4BQ9A 2VMCA 3V9CA 1NGXA 1IAKA 2CKBA 4C58B 3KBPA 1H19A 1KBGL 2UVFA 3BWAB 4JG0H 4PY7A 1F42A 4PP2A 1I7ZA 3SQOH 4C59B 5D7LE 4F58H 4DGIL 5KYWB 1CD1A 4K8RC 2CDFB 4K5PA 3WS3B 4PCSA 2BHUA 4IBVA 5HHMB 4XO5A 4PRPB 3P3YA 1NGYB 1T0PB 4ODVH 1FL5A 2ZKYA 2ZOLB 1XCTB 5HGBA 3UC0H 3EFDH 4N8PA 3F83A 4IOIA 4UMGA 4O02L 1PU0A 2X2YA 3OV6A 3QDJD 5C0IB 1EHKB 3HCVA 3MA9H 1UASA 1GAFH 1XR8B 2W0LA 4P4RB 4N2AA 4IKKA 3BW9B 2H1PH 2CCWA 4QO1A 3I3BA 1GGBL 3MBED 5IBUG 3MMEB 2WBJD 3BKCH 1U6AL 1OQOA 3F5WA 3QFJE 1VFAB 2C4FT 3H0TB 3WD5L 2HLEB 4YHZH 3SY0A 4CU7A 3L4ZA 3QCVH 4R5XA 5T1LD 4DH2A 4L8BA 1R0AL 2YPVH 1A6TA 2EKSA 2YAQA 5E9DD 2WKOF 1K3ZA 3SO5A 4E0RB 2IPUG 5JIDA 2ZUQC 4JPWL 4AZ8B 4EDWH 1XX9C 1X7TA 2R29H 4NJAL 4FQ1H 4HV8A 1VADB 5I18H 2XWCA 4N8VA 1NCWH 4XNBA 5IHUL 3I9IA 4XXCC 5C08A 2X3BA 4PIRF 3ZZQA 2R51A 1R5VA 1ZTXE 3V4PL 2A74B 2VR9A 3FH7A 3QQ4B 5CILL 2ZWZA 4PJ5A 1BD2D