4AV0A

Structure of the fimh lectin domain in the trigonal space group, in complex with a methoxy phenyl propynyl alpha-d-mannoside at 2.1 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av0A00
5FLUA 4AUUA 4AVIA 3ZL2A 1UWFA 4X50A 4X5QA 3BFWA 5AALA 2VCOA 4AUJA 4AV0A 4J3OG 5FWRA 2J2ZB 3JWNH 2WMPB 5AB1A 4J3OH 5LNEA 1ZE3H 4X5PA 4XOCA 4CSTA 5F2FA 4AV5A 5IQMA 1PDKB 3BWUF 4AVHA 4XOBA 5IQOA 4LOVA 5FS5A 1TR7A 3SQBB 3JWNG 5ABZA 4AV4A 3MCYA 5IQNA 5FX3A 4J3OF 2XG4B 4BUQA 1KIUB 4XO9A 4XO8A 2XG5B 1N0LB 1QUNB 4CSSA 4AVKA 3BFQG 4X5RA 5LNGA 3ME0B 1N12A 3JWNE 5CGBA 5AAPA 4XOAA 3RFZA 2UY7B 5F3FA 4XODA 3ZPDA 5JQIB 4AVJA 2W07B 2JMRA 4AUYA 2JTYA 3ZL1A 4CA4A 1KLFB 2UY6B 4ATTA 4XOEA
chains in the Genus database with same CATH superfamily
1U41A 4XNUH 2WVVB 3GSNH 5SX5K 2BSSB 3GMPB 4F3FB 4PWFA 4NNXA 1QLFB 1EHLH 4GG8B 1M1XA 4WI5A 1MWAH 3BUYA 4XB7A 3W9EB 1H5BB 4HWZA 4IBTA 4XCYB 5CO1A 3KJ4C 4XTRD 1D5RA 1QZNA 4I87A 4ELMA 3K3QA 1UM6H 2P28B 4FNQA 1SLUA 2Y06L 4GG6E 2ED6A 4ZO7A 5A2LH 1LILA 1O6SB 5GS3A 2A6JB 1C8QA 3MJ9A 5FUOL 3GS7A 1QEXA 4P9HL 3BDYH 4WEUD 5KSBA 4XP6L 2XX0A 3T0BA 3PIQA 2EQDA 5GZNC 1CG9A 1A2YA 2PXYC 4N8UA 4R5TA 3KPRA 1FFOA 1FNGA 4XAWL 2ICEB 2BNQD 3IFOA 4NQED 5HHQB 1J9SA 3DARA 4HPYH 2GCYA 3K8KA 1SXNA 1QBBA 2EKSB 2OCJA 1RFDL 4KJQD 1JNLH 4FRWA 4OY9A 2R0LH 4ZW7A 3QXAA 3T8MA 2GTQA 3KXFA 4ZUWA 5LN4A 5T5FH 4U3SB 3P9MA 5F21B 3DURA 2QFPA 3QHFH 3NSXA 3OKKA 4ONGL 1MCHA 2PYEE 5GRJH 1OF2A 4A1RA 2CDFB 4NAQA 4PS8A 1TZIB 3NEEA 5AW6B 1VFAA 3PHOB 7FABL 4UQCA 3A23A 2X38A 1MRFL 3Q9PA 4XNQA 3BYTA 3EZ8A 3NZ8B 4G6ML 3SY6A 4DTGH 1ID2A 4LL4A 4UQ2B 1EEZB 5DEJA 3NT0A 3TO2A 2A5UA 2DW5A 1TQTA 4NFBA 1CLZH 1Z0MA 1ZCRA 2R56L 4N2HA 4QNPF 1A7PL 2H45A 2OW6A 2IWFA 3NZUA 1NGWB 2MOGA 4JZJB 5IROD 3O3UN 4K23H 3SYOA 1GIGL 2XN9A 3HG1B 2W0FB 3L2LA 3AG1B 3CPLB 1EMTH 1K2DB 2F8VA 2N56A 1KELH 5IG7A 4NT6B 5I26A 1VADA 5IVXE 3FNKA 3UBFA 1AJ7L 2VMJA 2VRAA 5D1XB 2CKBL 2EDMA 2JKXA 1IGMH 1IARB 5T1KB 4P46D 4FERA 2DLFH 3ULVE 4UQ3B 4AIXA 3LN4A 3S37L 1AYOA 4L2LA 3J2PA 5IW6B 4PUBH 5I1CL 5C7ZA 3VD2A 3LSOB 3SDCA 2DQTH 4L29B 4OIFA 5KSVB 4LESA 2VDPL 3IF1A 3ZW3A 3BZDA 1PKQE 1SOSA 3KLKA 1YC8A 2WYTA 2W07B 4HLZH 4IOFD 3WE6B 2C9UA 3NJVA 3R18A 1U36A 1IIIA 3ES6B 4PWGA 4CADA 3NQIA 1WZ1L 3ZZLA 3V0EA 4NN5B 1RPKA 4M6AA 4ZRGA 1T04A 4AIZA 2DD8H 2G2RA 3KVDD 4U6HB 1O9WA 3GBDA 3ZL2A 1Q8MA 2JNZA 4OCRL 4KH9A 1WBXB 4Y2OA 4ZX6A 3V8OA 1DDTA 1WEJL 4LCVA 2BIPA 2ZTBA 3WD5H 4LGSB 5AL8A 1FSKB 3KPRD 5ALCL 1IO4C 2KKQA 1AGFA 1WE5A 1CQKA 3NIDB 4I4WB 4I3SL 2CO6A 4F37K 3RZCB 5F7EH 3ZR6A 1AD0B 2OSXA 5BZWA 1EZVY 5E00A 1IGIH 4ODVH 1IV8A 1K5WA 4R4BA 1JTPA 1OTSD 3KXFD 2ENPA 3LH2H 3LDBC 1LK3H 2QBWA 3ULUD 1C9SA 1IFRA 1NCAL 1HH9B 3JV5A 4QUOA 3CBKB 4Y16C 5GS1B 2GJPA 2CHDA 1EA9C 1TG8A 4JY6B 5KBDA 3U7AA 2X6CA 1EJFA 4FL4C 4BE5A 4A55A 5H35B 1VGKA 4AQAA 3REWA 1F3DJ 3DI3B 5I66A 4HXBH 3A4DA 3ZTJG 2W60B 2C9SA 5AW0B 5EOQH 4PMEA 2VDNH 3P0YH 4IOSA 1MN4A 3NYKA 1RHHA 1TETL 1N5AB 4AXWA 4JQIA 1LDSA 2XTJC 3L3HB 5DMYA 4XO9A 2XN9D 3CZNA 1RUPH 3QZNA 1G9ML 3NVQA 4W4OC 5DDHB 2HVJA 4N8CH 2ZUQB 4N2CA 5I8KH 4WO4B 1VGEH 3TT1H 2IPTH 1ZSHA 1RAMA 4WEBH 1ADQL 1KDJA 1V3MA 32C2B 1A0QL 1FFTB 4KMTL 2VL5B 3FUJA 4MQ7A 5IMMA 1S9YA 3A67L 1ETA1 3SDCD 2NTFB 4AGOA 5LLIC 5F7AA 3G6AA 3HI5L 4F24A 3RG1C 2A6KA 1AQKH 3IDIB 4F2ME 3TCLA 3SOTA 4XMTA 1IGJB 2FB4L 3T4YA 4HOZA 5HYQB 1MY7A 1PS3A 3HMXA 2DI7A 3QJUB 2PO6A 2YRZA 3GIVB 2HTKC 3CHPA 1JMZA 4M5YL 1J88A 5EOTB 3FUHA 1NAKH 2CH8A 3WFCH 4L8SC 3B1UA 3K2UL 3ZYJA 3IRZA 4FTVB 3Q6FA 2JMRA 3BRGC 2XFXB 5C0BE 1AIFA 2MCG1 2JKTM 2W91A 2H1PL 4M4PA 3FQ1A 4P2AA 4OLXH 5CFHA 2J55A 3SE6A 4PRPD 3VE0B 3BMVA 4W9FC 4ILDA 3VGEA 4PTTB 5E23A 2E56A 3HG1E 2QDWA 2WUCL 5A43C 1GGCL 3CD4A 1S7WA 2FNBA 2OXHA 4ZO6A 1HCVA 2IANB 1UCBL 4L3FA 1V05A 5D1XE 3RU8L 5AALA 1A4BA 2DAVA 5F7DB 4AH2A 3ZTNH 1P4LA 2WYHA 2J2ZB 3PWNB 3IJSA 3R7RA 1ZDSA 3H0TB 4E9VA 4FKEA 4PRNA 3L81A 2VSKB 1MIEH 1JVOA 2OCCB 2JTDA 5E24E 4J3OH 3UBXI 4CBPA 5CWSB 3DROA 2UZYA 3IDMA 1GYWA 4GMSL 1XCTB 3N91A 2QSQA 1DEEA 5J06A 5GIRA 5IB5B 3ATAA 3MRPB 1TKWA 4TVUA 2IOOA 3MLUH 3VMPA 4N0YL 4YWGH 1MI5A 3LRMA 4IOSD 5B4MD 5AW7B 4QRSB 1LNUB 2B77A 2G9HA 2WMPA 3EOAB 4MTMA 3WYRA 2WLIA 4IEFB 1P2CA 3QWRA 5EPMB 2LFGA 3CFMA 4OF0A 5DGRA 2CNYA 4FMKA 4HKXB 4MS8C 3BPNC 3RPBA 2A73B 5ES4B 3UZQB 3NIDE 3FW6A 3AM8A 2CUHA 1NC2A 5D1QD 1XEUA 5DJAA 1N5YL 3T4AB 2EDOA 5FUOH 3FCSA 1PU0A 1GGIL 2WO2B 4N2EA 3RWHA 2VLKB 4V33A 4XP6H 5E0FA 2E46A 5G5DB 3U25A 4XAWH 2KPWA 4WF7A 4GOSA 1K4CA 2FL5A 4HWBA 5C9KA 1RZ8B 5DVLA 4I1RA 3T0EC 3QXUA 4GQZA 2J6EL 3SKOB 2VDMH 1XF5B 3DSNB 3EKCA 4AZ8A 1COBA 3DTXB 2CWRA 2MKLC 2F08A 4U4BA 1JZFA 4NP4L 4TTDD 3O4OC 3OL2A 1DYZA 2X1QA 2Z92B 3D39D 3NPSB 2W38A 2MOVA 3IJ7A 4ONGH 2WCGA 5C09D 1F45A 1I3RB 3MRIA 3FTSA 1HHKA 2D31A 4M6NH 2JKWA 1LO4H 4UIMB 4DH2A 1BWMA 2HRLA 2FCBA 1BREA 4KTEL 4GRLC 1TQCC 3QO0A 1A8JH 1U93A 3MCKA 1U8MB 3MZTA 3GSOA 2FLBT 1AZUA 3AMKA 3D1MC 3M8OL 2PYEA 3ECQA 3DX8B 4QRRB 1UTDA 1A1NB 4UDTA 4CW1B 1MHPH 1ONQB 1JHKH 2C34A 4WDIA 3MTRA 4DP6X 4DERA 5F88A 3BISA 4AC2A 1GXEA 5T3XD 1ZVSB 1TO4A 4OJFL 5EO0A 4L8DA 3TO4B 2NY0B 4OAWB 1YYLH 1L6XA 4NKOB 4IJ3C 4H8HA 3EOBB 3WFDL 3FU6A 2B08A 1J1XH 3BPCB 2CKBH 2XY2A 1TLMA 3A3YB 2N7SA 5JIMA 3UBXA 3T71A 5AUMB 1MJ8L 1JV5B 5DXWA 2CIKB 4LSPL 5FYLE 3O3EA 1N64L 2O26U 5B21A 4XCFL 1FNFA 3CJJA 3B7SA 5BO0D 4ENED 2JJTA 1MI5D 4PWKA 1T21B 2AFNA 1QW9A 4H88L 1HFUA 1RMFL 5IVXA 2VDPH 3FO1A 4FTVE 2K1MA 2WKGA 5EN2B 5L8JB 2VDQH 4JHAH 5IB2B 2OLDA 1VESA 3QAZC 4NWUL 5F9OL 4B41A 3SBWC 1X5AA 4YLQT 1KF9B 2IV9A 3QWRD 2X09A 3SDDB 4DP9X 3WFEL 4G82A 2Z1PA 1FVCB 1Q9OA 1S5HB 3QJRB 1ACYL 1MJJB 3FCUB 1FJ1B 1XCWA 1U3YA 3O8XC 2X05A 3WNIA 4PD4K 3QH3A 5F1NB 1AS8A 5H4ZA 4YZWA 4Z7OF 3BAXA 5DTFB 1RHFA 1G4RA 4F7TA 2QADD 3AW5A 2IDSA 2PW1A 2CLRA 3H8NA 3NSYA 1PKQA 4JQIH 4OCRH 4P4KC 1URIA 5D5MF 3EH3B 2ED8A 2ZCLH 3X1BA 4UI2A 2H26B 1WEJH 3OKNB 1XGTA 4PJ5B 2IANE 4KRNA 5C0CB 3ROLA 3AQXA 4KQ4L 1KG0A 1XF3B 3ZGHA 4ONHA 5ALCH 1WFUA 4LKXA 3F58H 3KWTA 4EN3C 3O6FB 4QR7A 4KDTC 3BN3B 4RMWA 5EULV 4FXKB 3VNYA 1M9SA 2CAKA 2RCSL 3L9EA 1ORQA 1BFTA 5FHAH 4N22A 4XWOD 1DVZA 1QPPA 2XQBL 2QGEA 1JXKA 4ZX3A 1RZIA 2OTWA 2EACA 5FK9B 3F6JA 3FU8A 1TU2A 3B8YA 4WV1C 3AAZA 2QSCH 3QIBA 3HMXH 1NCAH 5GGSB 4YMPA 1WZKA 3ZL4L 4K94C 3PWJB 1HL8A 3HHRB 3VG0H 1VZIA 3MRCB 3II1A 4LXFA 4H1LG 2NY1D 1R6VA 2C3VB 1ZTXH 2O6DA 4PGCA 4UILH 3UDWC 1NPNA 1T5XB 2VJ8A 3RWIA 3VTMA 5E8EA 1WSST 4AYDC 1O7VA 5FYJU 2LU7A 5LAXA 4LMQE 1MZYA 3QZBA 2PYED 4I8DA 4TQIA 2ZKYA 4CN1A 4DW2L 6CGTA 3H3PL 4LVOC 1XGPB 1FRGH 1OD9A 2OYPA 1KLFB 2BSSA 1L7IL 5IV2A 1SLVA 1QLFA 4M7JL 1K6QH 4TV3A 5EBWB 4AZUA 3W2DL 1T83C 4N3TA 4FHJA 4BH8A 2PETA 1E9OB 3D25B 4XBMA 4YLCA 3MBEC 1HKLH 3PCYA 3U2SA 3BN9D 1N67A 3MRDA 4LSUL 5CIPA 1DQDH 2YJQA 4M6OH 4YDIL 1NFKA 3MLWL 2YXVA 1XDTT 1UJTA 3F65A 4GUCA 5J0BA 2CK2A 3HI5H 5AVTB 5HDWA 4M4RB 1QI3A 1NWPA 2QTEA 5D7SL 3WGVB 3FRUB 5I1LA 2EVIA 2FSDA 3MFFB 5J89A 2X10A 4ZZFA 2DLTA 3B34A 3KH4A 4HAFA 3CSPA 1A5FL 3VFPB 1HCYA 1HJCA 5EHFA 3TP4A 3WUWB 1O6TA 5I6OA 3K2UH 3OAUH 2YOCA 4F2MA 2E5EA 3MU3A 4NUMA 3AREA 4Y9GA 3KPPB 2ZYHA 5FKAB 3I02B 1CIUA 1KTJA 2H1PH 1XR8A 3DX9A 1UASA 2GC4C 4W9JC 2ZUTA 5L6YL 4D9RD 2IGFH 3W39B 4TUKH 3PHOA 4HJJH 1AGBB 5F1KC 2HFFB 1WWWX 4Z3JA 1XH3A 3D3VB 4QXVA 5LB1A 2WUCH 1VEPA 4P06A 2IAMC 5C0BA 1HN1A 4HQQH 3WY1A 3A24A 5GS0H 3WCYA 3MTXA 4WVRA 3S35X 5HGDB 1RY7B 4YE0A 1NGWA 2IO5A 1U2YA 4XXWA 2W0KA 3C09C 3AFLA 1DBJH 4NM8L 2J12B 2UUDH 5DFWH 3WMPA 1G7QA 1TEFA 4MAYC 4FQHB 1OSPL 1FBIH 5D1XA 5T1KA 3C5JA 4GW1B 4I3GA 1A6VH 2HT3C 3L3OB 3R4RA 4MXQD 3BPLC 4N0YH 3UEZA 4ABWA 2E7LA 1XGZA 4C57C 4S1QL 3QUZA 4KK5C 3VG9C 3CFIC 2HX7A 2WWMC 2EINB 1YRKA 3TPKA 3ISYA 1E6JL 2E7DA 5EO9B 5EH1A 1B9ZA 2X4UB 2W07A 1AY1L 5FEBA 3BPOB 3CMGA 5C0CE 2QR0B 3HG2A 3Q43A 5ACLA 3RJOA 5EEZA 2J1YA 3FTUA 5BXFA 4FYSA 3TBYA 1WBXA 3FT4A 3G6JA 4GQRA 3M88A 3BWUC 4K3HA 2YAEA 1GGIH 3H2PA 3L48A 4JVWA 3KD4A 1CVSC 1GYCA 3VW3H 5ELIA 4JO5A 3CFEA 5I74B 4EI6A 4I18A 1RVFL 2J6EH 2FD6L 2ICWI 5D55A 3II3A 4OD2B 5I0ZA 3IN0A 3HG0A 6PCYA 4GKZB 1CUOA 4JGNA 4LPXA 3QDJB 3ARED 1N7MH 1G1CA 3NIFB 2Z7YA 4X5WB 3F01A 1J1OH 3ULVH 1T2XA 3APCA 3JWOH 4ODUA 4HF5L 4A2EA 4PJGF 5KYYA 2W94A 2QVFB 3QYNA 4E0RB 4ZUUA 3VYOA 4A67A 4KTEH 1ZLUH 1HWHB 4PW3A 5H35A 4GUOA 1MVUA 1OQOA 3O3AB 5C0BD 3ZKXB 3FTVA 3OLEA 1RPQA 5D8JL 4QLRA 1GZQB 4LU5H 2D3LA 3N1QC 2EP6A 1KIPA 2ZZUT 1T4WA 15C8H 3WDHA 3AG3B 1RU9H 1NFDB 1WHOA 2XTLA 2VDOH 3HG1D 4PTUA 25C8H 4I0PA 1S7TB 4JM2F 3PQYE 1EFXB 4X7TA 5HSFA 4EKJA 4KNUA 1RIVH 2Z1KA 3D18B 3WL9A 2IOMA 5D1XD 5LGJA 3AT0A 2YWZA 5T1KD 3AXHA 1SJMA 1SBBA 3KH3A 1IIKA 3O9WA 4LSPH 5E5RB 3SSGA 5BV7L 4A2LA 1JIBA 5DMKA 5DVKA 4XGZB 5K9KA 2JKSA 2Z8SA 3KLDA 4EZMA 3QUZD 4H88H 1RMFH 1G7JB 3K6OA 3Q0HA 3SPHA 3BAKA 4F7CA 4XVJH 5B7FA 5HYQA 1WT5A 4NWUH 5F9OH 3ABZA 4JFXB 1ITCA 4XMVA 3QUKA 5SV4A 3CVIH 5IJVA 2HFTA 1PIFA 2Q7AA 1I1FB 3GRWL 3K8MA 1UA6L 3GHBL 3LZQA 3HCVA 3VRLE 3VXMB 3TN0C 4KX7A 4DVRL 1LK2B 4FTVA 4CVZB 5I8OH 4LDCA 3IVKB 3V7AE 4JFZH 3DOSA 2FEEL 3ZPDA 1TFHA 3ATEA 2P5PA 1VACB 4UZSA 3PPEA 3QJOA 2DYRB 3ZDXE 4RRPG 1BX2B 5GZOA 3K81A 3OKDB 4NQCE 3WKPA 3RFZC 2YD1A 5CSBA 1S7RA 5ALBL 2WZPA 5KVFL 3F12A 1G84A 3ZR5A 3RZCD 2AERT 4YIQB 5CIPH 4GAGH 4JO3H 4KQ3L 2O6CA 2IANA 4M1GL 2ICWA 5E6IC 1E50A 3BWZA 5DMGD 1H3PL 1L5GA 4AGMA 1TO5A 4BE6A 3O6LH 4F9PA 5EZIL 1JHLL 4O51A 1KIRA 3H3BC 3CBJB 4M7LH 4F7PA 4ZMZA 3PWNA 3H0TA 2BP8B 1EJ6A 3T2QA 2RD0A 2MTPA 3H9YA 3IPBA 3QZOA 3VWJB 2BCMA 4HMCA 1C16B 3HRZC 1XCTA 4KPHH 3NA4A 1Y1DA 3QI9A 1S7UB 3R06B 4FHKA 1QYGL 4G8FA 3HZKB 4B9JA 4Q9QL 4HT1L 4LHJB 3ECUA 1HE7A 3H3PH 4XC1H 3TONA 1MFDL 4JM0A 3CX2A 2A77H 3ECBB 4PCYA 2YEVB 3VQ1C 5IVOA 5D7HA 3EOAA 5A6MA 2BHZA 2QJDA 2G2PA 4I0PD 4WU7A 3RYMA 3W2DH 1FAKT 4P59L 3D69A 3KHOA 3TA4D 1CXIA 4AQ1A 5JORB 4JVPA 3BP4A 3EBGA 4YQXL 2I9LB 3HG3A 3MV01 3P4MB 4GQ9H 4H8WC 3O9WD 3TBCA 4EIBA 5MENE 3BDXA 1OHZA 3IPFA 2X0UA 4PP1D 3C5ZC 4YDIH 1OM3H 2B1HH 3SE9L 2YGOA 4QPEA 3DO3A 3Q5OA 2YMXL 1DVFC 1PEWA 1CT8A 2VZ3A 2FJHB 2LABA 3EYSH 1F5WA 4JFFE 3UL4A 5JXEC 2VZ1A 2VXQL 5FYLD 1RZ8A 3TA3C 4P9ML 2XBZA 2CBMA 3ABLB 3BP7B 3H4FA 2G0KA 3EJCA 4HX1A 4CC4A 4CU6A 4L8CA 1XF5A 3US0A 5IB4B 3KPQA 5I76A 1UG9A 4FTVD 3SOBH 5E8PB 4ENZA 1LHZA 5D7JC 4JKKA 1XHHA 3S96B 5ETUB 4U1NB 4GFTB 1PNCA 2YPKB 4LL1A 4DK5A 1FPTL 2FJGB 2VQUA 5GZOD 3IMTA 3TYFB 3BP5A 4UIMA 2WZPD 1BQHA 3OKMB 1E5CA 3AGVA 1NFDE 1NAMB 2A9AA 4I5BA 4L1LA 5FW8A 3MRBB 3VA2C 2JI2A 2EEAA 5K9JH 4AUYA 3KYNA 2IAND 4IOIB 4QXGL 4CW1A 1ONQA 4XP1L 4LLVB 1V7ML 5DUBA 4YFDB 3D12B 5ENWA 2HMIC 1K5NA 1B6DA 1TENA 2Z91A 2L8AA 2XOTA 4ZG1A 3RVTC 1IKNA 3SE3A 5IM7B 1S7QB 3BT0A 3EW3B 1UB6B 4NKOA 5DWUL 3EOBA 4X50A 3MRLB 1A7NH 4LSRH 4LHUG 3MYJA 3BFOA 2F5AH 4M03A 4QHKJ 4Y1AB 1U21A 1JV5A 2B14A 4PS3A 5AUMA 1PJ9A 2I69A 5MEQA 2WM0A 4TSCH 4JY5L 5KN5A 1HL5A 4CNIA 4KJWD 1WFIA 4ERSL 4TSAH 4OGZA 1IE4A 2DWDA 3PWPB 4KRPB 4Y2DC 5IQ7L 1QACA 1E8YA 2FH6A 4JHVA 2LQRA 1YZZA 4GAYA 4DUVA 1OT1A 1AY1H 4Z0XA 3K71B 2DLHA 2NR6C 1HCZA 5I8CB 1BA9A 2JV6A 3OB0K 1KGIA 1KGXA 4L48A 2D7MA 3HKFA 4Q9CA 1FJ1A 3Q8BA 1GC1L 1F1AA 2DWXA 4PRHE 4NO2B 2Z4TA 3SYPA 5EC1B 3HBZA 2OXGB 3IJEA 1DQJA 2DQHL 5C0CA 4L9LA 1A02N 1O5DT 1OKEA 3ARBA 4H0IA 1OHQA 2WXNA 2YQBA 2D4FA 4YBLC 3SODB 2IDFA 3MRRB 3O6FA 3UO1H 2WUBH 5BW7A 5M94B 1RVFH 1Y07A 1P5VA 2AJUL 3E9UA 4M48H 1TIUA 2FD6H 3MRNA 4FXKA 3CHQA 3UIZA 4G83A 1ZLEA 1CL7I 3HIZA 1OO2A 5JOFA 3MNDA 4OLUL 4AQEA 5JPNA 4AQ8C 1TTAA 3U4AA 1DQKA 3U0PB 4WGVB 2COVD 1G5AA 3V4PB 1KJ2A 3RIKA 1I1AB 2F7QA 4MZIA 2DOCA 4HF5H 5JHBA 2DQIH 3QJZA 3FH8A 5JPMB 2LR4A 3MRCA 1FIEA 3G5YA 1MQKH 4H25A 1S7XB 1YAZA 4FQQB 4GAJL 4KV5E 3FUMA 2C3VA 4F92B 2CKNA 3BD4A 3HC4H 4HIXL 1VPOL 3AUWB 4S10A 5I1DA 2WP3T 1MG3C 2HJKB 3WHE0 1D5XB 3CFNA 3VH8A 3GS0A 5E4AA 5DJXB 1ETZA 4APXB 4ODTL 4NQSB 2B9BA 1NLBH 5I1KL 1QSVA 4DQOH 1TPXC 4U0QB 1Q94B 5C7XH 3NIFF 1A3RL 5GRXG 3FO0H 3L9RA 2KLSA 3TO4D 5KSAC 3RHWF 1VJSA 5B1KA 2O93L 2AK4B 3LHPL 4TUOB 2YAQA 1BMWA 4G71B 2VXSL 5DJ0B 3D25A 1CLOL 3N2JA 3O4LB 1QX1A 3FK3A 5DEZA 4I77L 1CLYL 1J8HA 3T77B 1IGTA 1TVDA 3RRQA 3OBAA 1RH8A 5L2JB 5EIQA 4G43B 4OD1L 4ZOEA 1OALA 1FCCA 3JUYA 3NIGB 5CEZL 5I5IA 3PQYA 1ZHNA 1PAMA 1K8IB 4XMKH 3SPGA 3V95A 4LCCC 3WLBB 1NOFA 3MFFA 4RNRA 2F74B 4ZQKB 1T1WB 3LN5A 1PZ3A 3IM1A 4WJ5B 1HQ4A 3C2AL 3SGKC 3SDDD 2VR3A 2VLRB 1M9WA 3DDGA 3GF8A 4ZAKC 1FGNH 2EO9A 1A7OH 4FZEL 2OMBA 5E4EC 4PB0L 1DQVA 2H2SD 4GI9A 3WXVL 1XB6A 2MHAB 1T0NA 1E8XA 3WAJA 2HSIA 3NCYS 4JUTA 3TTSA 4PJ5D 4U6YB 3KNBB 5AEAA 5C0CD 3EJZC 3LXCA 1NICA 3ARBD 2X6BA 1D5BA 2LLLA 2VSCA 4JDEA 4WHCA 4JG0H 5I5JA 1AGBA 3O6FD 4PJHF 3QEGH 2R8SL 2JB5H 2Y6TE 2CR3A 2FT8A 3E3QE 5EZJA 4MD5A 3KL3A 3HFML 4M1GH 4XPTH 4WW2B 1GZHA 3OMZA 4NQCA 2DTMH 4NM4H 5DD1L 3QGVA 3NRQA 3DVNA 2O5ZL 5D72L 4BZ1L 4MJ5B 2VN3A 4Q52A 1MUJB 4GBXC 1NBYB 4WY7H 5BZXA 1YEIH 5HP5A 3A6CL 5EBMB 4GFXA 1MG2C 2Z31C 4U3CA 3T3PF 4ZO8A 4UMSA 2BNUA 3MODL 4GW1A 5GHWL 4AKPA 5C0RL 2A38A 5B38B 1U8OA 1QYGH 3L3OA 4L2YA 4Q9QH 4HH9A 2XRAH 1EZVX 1N0XH 1MFDH 1RP9A 2ZONA 1A6TA 1KIUA 3CBRA 1RIHH 2ITCA 4HSCX 4NNYA 2WOYA 4ZK8A 4MD0B 4HKBA 3KGUA 1YEKL 4LKCB 2LFEA 5EO9A 3IJYB 4BA0A 5DK0A 1T1YB 2DBJA 3NOIA 3BWAA 1QSEA 1AXIB 1MW3A 2J8UF 1H6EA 2X6MA 3S5LG 4ABQA 2ITFA 2ZUYA 4HIHB 1BECA 4BKLB 1XD0A 4HUMB 1BF2A 3MCG1 5CEXB 5T1DL 1F1DA 5IOPB 3QXVA 4HBCH 1JPTH 4PEEA 2I07A 2BC4B 2WKOA 3VGAC 1D5MB 3SE9H 3PS6A 2W9EL 2CGYA 1LDPH 3I3BA 2WO3B 4NKQB 4X5XB 5F96L 2YMXH 1ACZA 3HG4A 5IBTL 3WEXB 5D7IA 1QRKA 1LE9B 1I82A 4G7YL 2NQCA 1MELA 1SQMA 1D5IH 1S9VB 2GT9B 3RGVC 3S4SA 2VXQH 1JDAA 4B97A 5MENA 3WHE1 2X9WA 4RFEB 4R90L 1OM9A 4BFKA 2O61A 4KJYA 2Y7LA 2FBJH 2NXYC 3H3KA 5IQ9A 1P5UB 1BXAA 3K1KC 4G5ZH 4BQ9A 3BAJA 5F9WC 1CDCA 5JUEH 2OMXB 1AKJA 1MCRA 1ZTMA 4JFFA 3NACH 1YNKL 4P4RA 2HPTA 3ZDZE 3BKMH 4J39A 3CH1A 4HCRL 2D9CA 1RURH 4NO5A 3KWWB 2Q7YB 5JIPA 1I1YB 1G9HA 4NHUA 1R3JA 1UXSA 1A1OB 1HEZA 2UWEF 2A0LC 1TVHB 4U0RB 4U1LA 3TNMA 3GXDA 2AK4E 5TF1H 3PJSB 2AC0A 1MAKA 1EHXA 3JWDL 4MDIA 1PMYA 1GZQA 3L3IA 3O4LE 4XP1H 4NQCD 3BZFB 1P7QA 1AR1B 1F6AB 5ACZB 1RCYA 3MRJA 1RUKL 5F7YC 5JW4R 5CHNA 35C8L 2KT6A 1S7TA 1DLFL 3EYFA 4C54A 5KJRH 3T65B 5DWUH 2DKUA 5JHMA 3PABB 1UGKA 4F8PA 2OPCA 2DQFA 3PL6B 5EWIL 3QWNA 5PAZA 2E0PA 4N85A 4K5NA 1JYXA 4PLNC 5D7KE 2LVEA 4L37B 1KJ2H 4JY5H 2Q2EB 3QZPA 3AU0A 4HSAC 3HAEA 4Y7OC 5F6HJ 3WIHL 1G7JA 4XWGL 3RY4A 1UVQA 3T2NH 5AOJA 3IDYB 2GTZA 2WW8A 5MI0B 2Z0UA 1IM3B 5SWZE 5D2NC 3I75A 4FFWD 1RKRA 4GMTL 1E4WH 1MEXL 2WBKA 5GGUB 1JDCA 3KWUA 1HNYA 1AE6H 1QVOB 3BD5A 1QR1B 3PG2A 2N1TE 1YEFL 3O45A 2K8QA 1LK2A 1RZFH 2PUQT 3ESUF 2WV3A 4O4YL 4U1MB 4CVZA 2EILB 1XIWC 1OAYH 3GBNH 2K6YA 2A74B 4ODSL 4PJFB 4QI3A 3IVKA 1M1SA 5IW1A 5CGYC 1EVTC 2HPOA 4EOWL 1BBJA 3ABKB 2FHCA 3ZLQC 4ZX4A 3OHMB 4NBXB 3HA0A 3KS0J 5B1JA 3VSVA 5IHZB 5MEND 1W9XA 4PRHA 5TF0A 1HINL 1ID5I 3B7UX 4JEGB 3ZL1A 2GB2A 2CJSA 2AJUH 4KXZH 4KQ0A 5FCSH 2BSDA 4P2OC 4HHAB 4TVPE 3I9GL 3RKPA 4MMYB 4XNMA 1DQLH 4HCFA 4JHWH 3QDJD 1KGCE 3QJHA 2H3NA 2V5TA 4JFFD 4YE4H 3Q1SH 4MSWA 1F58L 3FQUA 3GT6A 5F0PB 1A4JA 5E6UB 3BAYA 3BX7C 4RWYL 4FQ2L 3UEQA 5J11C 1RXLA 2HG5A 4FOMA 3T1WA 1F4YL 4OB5H 3WN5A 4TPRH 4GAJH 3UH8A 5AYTA 3VWJA 4F20A 1OV8A 1CDGA 1T7WA 4DCQA 3G04B 3JV4A 4KKBC 1VPOH 2CMRH 5IHUL 3SQOH 3QHTC 1S7UA 4MJHA 4PG2A 3F3HA 5E6ZA 2VUKA 5AB1A 2ESVB 5FDYA 5DYOA 2D7OA 1R5WB 1Q4NX 12E8H 1JWSA 4XI5D 1GCFA 1P7QD 2L04A 5GGQH 3RWGB 1NKGA 2WXOA 3WN6A 3S8FB 3PWUA 3QUMA 2HN7A 4TL5A 3UJIL 5G4MA 3LQZA 2ICES 1N70A 5A2CA 2VXSH 3CU1A 1DLHB 1UKTA 1CLOH 3W0WB 5HYFA 3FB7B 4MCYB 4XX1E 1AC0A 4LNRB 1OE3A 4I77H 4LVNB 1CLYH 3P4MA 4QD2E 2ZWSA 1JUFA 4WI8A 2WQVA 4TQEH 4D7BA 3DK0A 1FFQA 3RIFK 3QCTL 5C0FA 4ZW3A 1CZ8L 3VDCA 4R83A 4WI3A 2XKSA 5CEZH 1XAUA 2B2XH 1H3TA 4H8PA 4N2NA 3ZO9A 2FJHA 1BQLH 3FCTB 5A1AA 3LEXA 2V2TB 3JTTB 4R2GC 3IKKA 2E6JA 3ZDYF 5FKPB 5HHXH 5CD3A 5LNGA 1FVDA 3O0RH 2MCPH 5DLLA 5E8PA 1UXLA 4ZD3L 3UZVA 1VFUA 4JKWA 4ZMTA 2AANA 3ETTA 4WNQA 4PJ6A 4TNVK 3VFWB 4NQDB 2BP3A 2LAGB 5ERWA 3AWFA 4Z95L 3NIGF 5AB0A 5DRWB 4R5VA 3CSTA 3ZE0F 3KR3L 5GS2D 4JDVB 4OGXL 1A3LL 4BWWA 3TYFA 4E5XG 3CGTA 4PRHD 3OKMA 2VISB 2ZXEB 4OKDA 1NAMA 3IE4A 2L3BA 4KK6C 1UZ6E 1TLKA 1G7IB 3QRFM 4XPHH 4ZOBA 5LGHH 1KJ3H 3ZHNA 5C0EA 3IFNL 1JZ6A 4ZTPL 2VH5H 4QRFA 4AJ0A 2G3XA 2L7JA 3DA0A 3J8F7 5DD1H 4LLVA 2HTLD 1SVBA 2ADIA 5LCVA 3EF4A 5JO5B 2YKLH 3B2MA 1NDGB 3RWEA 2P45B 1S7QA 3G5ZA 4PRAB 3A6CH 1N59A 2C9XA 2X3BA 3D9AL 3K0WA 1OARL 5BVPL 3QC6X 3K2IA 3VWJD 1G0XA 3MACH 1A3QA 5EEYA 3LS5L 1DVSA 4L3AA 3VTAA 5C0RH 1JI1A 4JPVH 3ZK0A 3LIZL 2D4DA 2FX9L 4WW2F 3UAAA 2VCOA 3ZE1E 4KUZL 4M1CC 2PXYB 2VLME 3BGAA 1YEKH 4EIGB 4PJFE 1NGXB 5F7UA 1JZEA 1U8CA 1N2RA 3K71A 4XXCA 4E9TA 3L4XA 3SBPA 3TXAA 1KIQB 5KBPA 2XWBA 5I6MA 1NSNH 4JKPH 3LV3B 5T1DH 4PB9L 1ANUA 1UD2A 5TDPA 1JNNH 3GSUB 1OSEA 2OXGA 4NCC1 1M2OA 1JHTA 3MREA 1VFOA 3HS9A 1FO0L 1OANA 1NPUA 3GHPA 3QXTA 5IBTH 2Q6WB 2J7LA 2X1WL 3GBMH 2YPLB 2FO1A 4M5ZH 3SCMC 1NUNB 4U33A 5CP3A 2H32B 3ZKND 4APQC 5C6PB 1AP2B 1F3JB 4QCIA 3IMBA 1QFUH 3HNSL 1D6VH 2XJKA 3B9AA 3LH9A 4GH7B 4H20H 1IGCH 4N2AA 5AW5B 4F58L 4YX2L 3LKRA 3HAEH 4XO8A 5ESQA 3S6CA 2DLIA 4MLIA 1MAML 4Z7AA 1WFNA 3FO2A 1BFVL 3V4VB 3CHSA 1KYAA 4TLUA 2RQEA 1D6EA 3EGDB 1KCWA 5KS9B 4JNXA 4ISVA 3X13A 2VXUL 3MNZB 3GXUB 3D85A 1UD6A 3AS2A 2WANA 5CNHA 5I1GL 3VD4A 1G7LB 1SFDA 3A5VA 3X1FA 1A7BA 3D09A 3QDMB 3WO4C 2IH1B 1J11A 3BMWA 3N5AA 4XNYH 5IW3A 2ZWKA 1V54B 4MNQE 3H7BB 3JZ7A 2Z35B 4MCZA 4NQSA 4MZ3A 5FF6B 4CMHC 1KB5A 3WXWH 1AXSB 3IAQA 3ARDB 2O5YL 1QQDB 4CDGC 2Z8WC 3HRPA 3Q8FA 4WTQA 2AK4A 1DLFH 4TUOA 4WUUE 1ROCA 1BP3B 2OMUA 3C08L 4IOFC 4R7VA 2CRYA 3B3IA 3O4LA 4WI7A 3ATDA 4WIQA 5EWIH 5IHBA 4Y1AD 2GSGB 3NEOA 2R1YB 3X1GA 4NJAH 4L9DA 5L2JA 3UTPE 4RMBA 5I24A 4RQQA 4KRPD 4NOBA 4UMGA 2F1EA 2HX8A 1SUHA 4OVUA 4AY0A 3VFOB 3WJJA 3QFJE 2Q3ZA 4U1IB 4DN4H 4HOMA 1SJEA 1T1WA 3OM3B 3LKSB 3GO1H 4GMTH 1WK0A 4GRWB 4WJ5A 2X1PA 1MEXH 4NQDE 3O3DA 1WITA 4PJ8A 4BK4A 4W6YB 1T0MB 2UY6A 5I17A 4J3OC 2QL1A 3S36X 5LG6A 3KLHC 4NO3B 1E65A 4FQCH 4KZDL 1AC6A 3GB7A 4O4YH 1BQRA 3U4EB 4TQHA 2IDUA 2MHAA 5D1ZC 5SWZA 1JGVH 3CXDH 5T3XL 4Y8AA 2IF7A 4EOWH 3U9UA 4EN2A 3KNBA 3IK2A 1ZANH 4Y16B 3ATFA 2CSPA 5E2VL 3RTLA 3MRMA 3RDJA 2AQSA 5KTEL 4FL4B 1KXTB 2CO7B 4A7GF 4DP2X 3CFDB 3O41B 3P4NB 4OZGF 3OAWA 2ARJQ 4E36A 1IAMA 3F5WB 3Q3GA 1JXDA 1JAEA 3V9CA 3T1FB 2VIRA 4IQHA 5AW4B 1MJ7L 3QUYC 3CX5J 1SXZA 1IBFA 4CJ1A 1UB5B 5IQNA 4NRZB 2BNRB 2XTJB 1FL5A 2BVOB 5FX3A 1EEUA 2EH7L 2CIIB 2GVYA 5IEHB 1QO3A 1S3KH 3BKCL 4KK9C 5JW3L 3OZ9H 1QPXA 5T1MB 5D6DC 2VUYA 3S3CB 5D6CA 3QNZA 3RQ3A 1ED3B 1DE4A 2WQXA 1EEYA 2AJXL 3ME0B 5CJXA 4JPIB 3NFPB 4MD0A 4LKCA 5JHLA 5D5ME 1NJ9B 1QBAA 4O2FB 4R5XA 5CGBA 3U4BL 1T1YA 2CCVA 2AK4D 2FBOJ 4KTDL 2ERJC 2MQGA 1OW0A 4OLWL 3L5IA 1JK9B 3O4LD 1QTPA 3BE1L 3V4UL 1UWYA 3S8WA 2DQEH 1DZ0A 2X9YA 5HJBA 4CSPA 1XH0A 4YBQD 2DM3A 4AJVA 1AO7B 2UZPA 4FXLA 4NIKB 4ZMOA 3N85H 2C5DC 2PTUA 2WN2A 5M95B 5E8DL 5ICZA 1CXFA 3TBSB 1ADWA 5DJCB 4P5KA 4EF3A 3HLAB 3CDFA 3VYNA 4ACTA 4DEUA 1S9VA 4JX0A 4QO1B 5TPWH 3BGFC 1MDTA 5D7KD 2R4SH 1KYFA 2R83A 2VLRD 3CLFH 1GTNA 5MEOA 1P5UA 5CN3A 2NW2A 5B8CC 1TCRB 2ZF9A 3CFBA 4M62L 1HT6A 4LOUD 3RTQA 5SWZD 4YSQA 5I0DA 4JHBA 2QQQA 2WP3O 4K8RD 2VQ4A 4Z95H 5L8LB 2Q7YA 1YJDL 2NSXA 4GSRA 3WEAA 4OGXH 1A3LH 2BLFA 1FVEA 1B4LA 1A1OA 4RFNC 3Q05A 5ISZE 4B9GA 1DDHB 4N8VA 1ZOXA 1FZKB 1OAKH 5EV7A 4ZI8A 5KJ7E 3VAEA 5F9JA 2VDRL 2B20A 5E1AB 3VXUE 3MBWA 2ZUWA 4MMXC 4ZTPH 4F57H 3TESA 3D07A 3IYLW 5KYNA 5E5MB 2Y07L 1F6AA 5ACZA 1QHOA 1RV6X 3QNXB 3GSXA 5KEZA 4EIZC 1EK3A 3MFGB 2AKRA 4JN2A 3D9AH 4LCYA 4TVPD 3T65A 3PABA 5BVPH 1WPCA 3UXFA 1T22A 3HVDA 2ZE0A 1R0AH 2X3CA 4JRYB 5HHMB 3GXNA 2IPUK 5DJZA 3LIZH 1FHGA 2FX9H 2YS4A 1JF1B 5CSZB 5DHVA 5DZ9A 2XX1A 2IH9A 4D9LL 3CQPA 1H3WM 4WFGE 1HAWA 1MDAA 3ESMA 1IM3A 3CQQA 4X4YB 2CUIA 4X98B 4JJ5B 3T0EB 5KANI 1PZDA 2ZPKL 5CFAA 1ZY9A 1F6LL 3E6FB 3FQWA 2PO6C 1TJGH 3M7FB 2I5YH 3V5DB 2B4CH 4YO0B 4PB9H 1PIGA 2NW3A 1KCVL 5HPOA 2IWEA 5T3ZE 3O4OB 4ZXBA 5F1IA 1XL4A 4TTDC 1R3KA 3BJLA 4LLQA 4M93C 1VZGA 2VWEE 4B9KC 4EPSA 3MYZA 5DMIH 1FO0H 5GJTH 2V8MA 3BZ5A 3LEYH 1CFSA 3KYMA 4WW1B 2Q9OA 1JK8B 4PCKA 2Z6FA 4QRPE 3D0VB 3KZ8A 4GRLB 4U1SB 1TQCB 4A7QA 5IB3A 4ZPTB 5HD8D 2F15A 1G9MC 4QY8A 1ZV9A 3GKWL 4ORGB 4YVUA 3QO1A 1DSFL 3RX8A 3TZVC 4EZKA 5DRXB 1B3JA 2A9DA 4YX2H 3WBDA 1GYAA 2XNAB 5EU4A 3MBXH 3RTQD 1F8TL 3L4WA 3ABGA 1OP3H 3GM0A 4HUNB 4YPJA 4P5RA 1CGUA 2B59A 4WKZA 1QMUA 3GMQB 4UTCA 1UJ3A 3Q2NA 4S1DC 1W80A 2NY7H 3TYGL 3HB3C 1HJBC 1DN0A 4HJ0C 4IJ3B 3KHQA 8CGTA 4AEIH 2VXUH 2EUVA 4R7NB 1FL6B 1HYSC 4PM1A 2I60H 3QNYB 4B0MM 4KAQL 2EXYC 5TE7L 1VHPA 2ZWYA 4FLRA 3NRPA 3D48R 3GZOA 3BAEL 4XXDB 2GQHA 1YEDB 3DX0A 1AR1D 3QZLA 5E94B 4DGYL 4WEMB 4BXVA 3KPSE 3QAZB 1AO7E 1I7ZB 2ZSWB 4N9GA 3K5SA 4H0GA 2C9QA 2PWEA 2B5IC 3ZJAA 3KVPA 3DVGA 1CDUA 3C08H 4WSKA 5EIIG 3O8XB 4MNQA 4PRIE 3FB7A 4MCYA 3L4TA 2KI6A 3PL6D 3IETB 3REVA 2E76C 3GIZL 1BZ7A 2H8PA 3NSFA 3F6LA 4HIQA 1BBDH 2ZAIA 4URKA 3AM8C 2QADC 4QYAA 3NK3A 4GIOA 3DX6B 3N43B 2QFRA 1D7CA 2YD4A 4WUUA 2VDKB 4BFBD 4PG9A 1Q0YL 4EZLA 5GS0C 4RWHA 1U9KA 4KVCL 1NGPL 3FCTA 1AHKA 5B7MA 1IM3D 4EN3B 1ZHLA 3QRLA 4BSWB 1EAQA 2G2NA 3JTTA 4DP4X 3DUSA 3DSFH 3U7YH 3V5KA 3BUTA 4X4ZA 5FDWA 1GOHA 1PG7L 4BFGA 3TWYA 3ESPA 2H2PC 5BUAA 3DYPA 4KZDH 1FA4A 3C12A 3L3GB 3QFJA 2VLMD 3DECA 1IBZA 4ZXBD 4F7KA 4YJZL 4ZMWA 1INEH 3CZEA 4WV1B 5JHLH 1BQSA 1MCCA 4M1DL 1Q9LB 1AH1A 2Z93A 2P44B 3E6HB 3SYQA 5DRWA 2GK0B 1B0GA 1MHEB 2C9VA 4Z6AT 4U6XA 2FECI 5TQ2H 4W9KC 3DIDA 1UACL 2R2HB 4L5FE 1QTYT 2ZNXA 1D5ZA 2NY1C 3C8KB 3P0GB 4BD4A 2NT0A 3L6FA 1REIA 2XV2A 1UYWL 4Y4HA 3RURA 4TULH 3K2KA 1MF2L 2FE0A 3QJFB 5D7LB 2EECA 1U8LB 3Q6GL 4QF1A 4G7RB 2HJFB 4TNEA 4RETB 4FG4A 1FDLL 2X70A 3SYAA 1PJWA 5JO5A 2XVBA 3DUHA 1IKFL 2NY3B 3MBEB 2EIEA 3S35H 3NPZB 1M7DA 3T0EE 4XBPA 3LQAL 4X6BA 3BN9C 1SZNA 3BXNA 4MRBA 3C9NB 4NKMB 2XPGB 3LJ3A 5B22A 1NCCL 2AXFB 2JJTC 2FO8A 2R23B 3PF2A 5GZNA 1FWXA 5AB2A 2CUMA 3OLIA 4KO9A 3SKMB 5C0AB 1VB9A 2BIMA 2YAOA 3U4BH 1NGXA 1MSPA 4OKVB 1GGYA 2XACC 4QXTA 3ULVC 3JWOC 1NEZA 1VRSA 2ZCZA 2V2WA 3I6KA 4N2MA 4OLWH 3V0GA 1LEGB 4X4ME 4KNQA 4MNQD 1NMBL 4LZKA 3UGUA 3UP1A 3TX4A 3V4UH 2BH0A 2O6PA 3LV3A 5EZPA 4UQAA 2GSIB 4XP9H 5A3IC 4EUPG 1MCWW 5D5MA 3WS3A 3MA9L 4KUCD 1T2QL 2G4GA 1A4KA 2WCSA 2XQYA 5I2IB 4F8NA 3II2A 4BSJA 4DETA 4HK0A 2WLMA 1TUPA 2XC8A 3GSWA 5GJSL 4AYEC 1RUQL 4QWWD 1MCPH 2H32A 4FMFA 4BSVB 4MHHI 5A40E 2L7QA 3UTPD 1AP2A 1F3JA 2HFEB 3HMWH 4U4IA 4E5XB 2IAMB 4MBOA 5EU6E 4JG1H 5D70L 2WXQA 5DHVH 3D4ZA 4JO4L 3QFJD 1F97A 2Q87A 1WGOA 3FO9A 4YXLL 3D2TA 1ZV2A 2NY2C 2OP4L 4YHMH 4OZHB 4NQDD 1H15A 2FATL 2FGWH 4JZOB 5EZOL 3NJKA 2EKJA 3C09B 3BO8A 2K78A 1YJDH 3QIBC 3KPLA 3EGDA 5I1EL 1I53A 1ZEAL 3HNVL 5CEYB 3V0AC 1NCWL 4QRQA 4XZUA 4MAYB 3SQBA 1U8PB 3O3BB 1NBZB 5C0IB 4HPOL 1SEQH 1ZRUA 5ADOH 1XMWA 3H1ZA 4YDVA 4WKXA 1IZKA 1H9VA 4D0BA 4Y4HD 1ML0A 3FHEA 1KY7A 2HJLB 1R34A 2G5BB 3QRGL 3TS8A 4AG4L 3LRSA 3KLSA 4G8GB 3VG9B 2Z35A 2OJ1A 4MXQC 5EC2A 2N7AA 4OIBA 5ISZA 5HGAB 1AHWA 1AQHA 3EDFA 3Q2LA 1QQDA 1OD7A 5M7QA 5MEPB 3FYIB 1T1ZB 1QFWL 3VXUA 6FABH 2JSFA 1NMAL 4O5LL 4QXUL 5H94A 3ZHLA 1XH2A 5T5NG 1J05B 1M56B 3C8DA 5CLXA 1JTOA 2PTTB 1BLNB 4NWTL 3CVHA 5HJGA 3VGGA 3QFDB 4HLEA 1ZGLB 5HI4C 3UP6A 5CJQH 2R1YA 2VW6A 4C8XA 4JDTL 3FDWA 4YHZH 3MLVH 5ITFB 2IDCA 1CQYA 5GZND 2KDGA 3QUXA 2F19L 1F4AA 2C4FU 2JKJA 3AQDA 3HS0C 3VFOA 4TF4A 1XGUB 8FABA 2ZKHL 3VRJA 5DJDA 1BQUA 4FDWA 2ZPKH 4ANKA 4GXVL 4FF9A 2A4EA 1KWGA 5H37H 3FQNB 5BMFL 1VA9A 4LCUA 3BVNB 4MNHB 2DI8A 1IFHL 3PU7A 5GGTL 4U6VH 4NSKB 2QEJA 5J12C 1NGQL 2BIHA 2HVBA 5LBGA 1SLXA 3RDTA 1RK1B 4X9HA 4KZEL 2FJSA 1M6UA 2NDFA 2YPLD 3U79A 2C7UB 3Q13A 3MZGB 5LNEA 4YGVA 1SDAB 3GMOA 5FHBL 3CK0L 1M7IA 2YLKA 4HKZB 4PRBA 3NCYP 3VDAA 1H6TA 2ZCKH 1U91B 1WCQA 2VZTA 5IQMA 2C3HA 2DZEA 5GRUH 4OCYL 1DSFH 4OZFA 2DBLH 3CXFA 1H3XA 2R1XB 1A6WH 3FTXA 2AQTA 2OL3L 3CV5A 4YHKH 1F8TH 4QRPA 4PJXF 4DPBX 1WF5A 4XMPL 3S7GA 1SBSL 5EORL 3QQ3B 3TBTA 2UYLA 3V5HB 4UNTA 4Q4EA 4XAKE 5EU3A 2RALA 4W4OA 3TYGH 4LQ1A 1IEBB 5LGKA 2G60H 2CCWA 4B5EA 1J0JA 1I3UA 3OMNB 5T1MA 5INCB 1SYSB 2AEIT 5TE7H 5I1JH 3QDMD 1ETB1 5CN1A 3BAEH 3FONB 3OR6A 3FT9A 2J20A 4NZTL 1TOXA 5DJ2B 4DK6A 4K7PX 1I7TA 1QNZL 5ISZD 5I30H 5KYXA 1U8NB 1LWHA 5EUKB 3EO0A 2Y1YA 3QUHA 4HS6B 1GMEA 1HSAB 4O2FA 3ZTDC 1VKXA 2V5SA 3L5WB 3UTQB 4IHOB 3VXUD 1VZHA 3P40A 4N26A 5IEKB 1TZHB 5DUPL 1QWNA 4E41B 4HIEB 3VGBA 4F1ZA 3BAIA 4L8SA 3TN0B 1J0IA 1ZA6A 5IHLB 3GIZH 1T1XA 1YPZE 3KPSA 4XPAH 4YEFA 4ZFGH 1DZBA 5IIEB 3MRKB 1E3XA 2UY7B 1JMXA 3HZVB 5EB9A 5F3FA 1MCIA 4JE4B 3EG9A 2CG9X 3QUXD 4BM7A 3TBSA 5K9OA 3RFZB 5DJCA 4LRNL 4PRIA 2BOLA 3ILDA 1ND0B 2G0LA 3ZMEA 4QO1A 2Q3XA 4OZHE 4I18C 1U8QB 3DVIA 2QPFA 2A9NL 1ZS2A 5LXGL 1PQZA 1TCRA 3N1FC 4G7VH 1C12A 4LSVL 5E6IB 4YHYB 4AIEA 4ZZKA 1L4IA 2JJUA 2OR8A 1XGYH 1JF6A 1IBGL 1RZKL 3DUUA 1JWMB 3FQ2A 2RR3A 4M1DH 3VQ2C 4F7MB 1USZA 2IH8A 3OQ3B 4WNJA 3KPNB 4X7SL 1J48A 4Y16D 3BKJH 3QPXH 4WFEE 2P8MB 5DHYA 3EJQA 4HLZG 2AJVH 2X6VA 4HGWB 4FEMA 4WFHD 5T3ZD 4LDLB 3HRZB 4R7XA 4XBEH 1P9MC 1ZIBA 3MLSH 3J07A 1OPGL 5C07B 1IBBA 1RIUL 3GMNB 1K4DB 4K3JH 4KVNL 1JOIA 3POHA 2DM4A 3BQVA 2CHZA 2IDTA 4QRPD 3SGJC 1BFSA 2UXGA 3QNXA 4R96A 2XDHA 4JM2A 5DD6A 1TQUA 5I19L 1PFCA 3KPTA 1F11A 3M6DA 2PR9A 4QYOA 1U6AL 4P99A 3F7VB 3KPOB 4UT6A 2F7IA 3BZ4B 1A6AB 3T3MF 4LSTL 4PWEA 4N0RA 4GRMA 1OWRM 3MRGA 1PZCA 1XGRB 3O9WC 3C5ZB 4I88A 3RVUC 5ADPH 1JF1A 1ZA3B 4L8BB 1DVFB 3DPBA 1NCCH 5D2LF 1FH5H 3H2WA 3QK0A 2AQPA 1PDKA 1LEKA 4Q14A 2OI9C 1FC1A 2K6ZA 2Q0ZX 1QUNB 3LKPB 4X98A 4XMUA 3P9WB 4W9GC 2HTKD 3B2VL 3WJLC 3LZNA 3QHZH 4X7EC 5I18H 1OAUH 1Y1UA 4UDUA 5DWPA 1G0DA 2WOBA 2EYRB 5ICXB 3ZO0A 5C6TL 5CP7B 1S7SA 3BP6B 4LEOB 3VXRE 4PJ9C 3KPSD 4R7DA 1AO7D 3V6OC 3OG4B 5D7JB 1V5JA 5B39G 1WAAF 2E47A 2NSMA 2P52A 1CICA 4W9LC 4X4MA 1F3DH 2VXVL 5L4JA 1I3VA 4PRID 4WW1A 3TWCL 5GJSH 2XA3A 2YPVL 1CFVL 2X4TB 3CVHH 5JNYB 5FA4B 3FXIC 2JB6A 4XO4A 5DCCA 1KPRB 4AKQA 4FQJH 4H4NA 3QG6B 1U3NA 4ORGA 4A38A 5IFJB 4JBSA 5DRXA 1MREL 3JT2A 4JO4H 2EYSB 1Z9PA 3DJRA 3EH1A 4L4JA 4TUJB 1E9PA 1D2OA 4YL4A 4F9PC 3EGSA 5AVXB 3GMQA 4V1DB 4TXVB 2BSEA 5T1LB 1KEML 1JCKA 1SDDA 5JHDB 5EU6A 1LLAA 3OTTA 1AXTH 3HNVH 3PP4L 1HAUA 1MZZA 4R7NA 1FL6A 1BVLA 1W8OA 1D9KC 3W38A 1INDH 1DJIA 5LQBL 4WZ9A 4ZUSA 2C26A 3BAWA 3R8QA 1KCUL 2OR7A 1MRCL 3EBHA 3QI9C 4LCWE 3QRGH 3VI3B 4Y2DB 3US9A 5J1SC 5IGXL 2VERA 2GYSA 3BD3A 2K4WA 3FQ4A 4POZC 5BOPA 3M17A 3BRDA 5CZVH 1KDIA 3VU1A 1ZT7B 2ARWA 2NYYC 3K6FA 3PGFH 3KEHA 2X4RB 1NMAH 2Y23A 2VE6A 3HI6L 4JFSA 4QXUH 1F90L 3RUGB 4MS8D 2VZSA 4OZFH 4BRJA 2AI0H 4K3DL 4MWFA 2GFBA 3ARGC 3BCFA 5L2KB 4ZSOB 2ZYSA 5DVMA 2YN5A 1LQBC 4P4KA 4JDTH 1CYXA 3CZJA 3PAVA 4XOBA 3DX6A 3PY9A 5FM8A 1X7SA 4JRXB 4QHMB 5DRNB 3IE9A 2D9QB 3EADA 1J86A 3ORJA 5FUCE 4YBLB 2ZKHH 4KDTA 4UZUA 3T0ED 3TASA 1ZMYA 3I3DA 1IM9A 4ZFOB 5FO7B 1AACA 4AEEA 1OE2A 4MD4A 2DIBA 4CC4C 1KB9J 1G0YR 5B3JF 4OGQC 3CN1A 2CUAA 5IMOB 5BNXD 5CLZA 1IFHH 1B3IA 1G1YA 2OX5B 3PREA 4JFOA 3ZIYA 2EEXA 4PJEB 1Q9LA 3EYVB 4UBDC 3G9AB 1L0YA 2X40A 5C07E 4KZEH 3NFSH 1DJXA 3HVNA 3V0DA 4OTXH 4MX7B 2BVQB 3WEBA 3O81A 4HIIB 1XZ0A 5EZLB 1BJ8A 5FHBH 3VI4F 3CK0H 4GRLD 3UDWA 4OJYA 3X3FH 3VFSB 3C8KA 2BY0A 2Z7WA 4R8WL 2GI7A 3SJVE 1YY8A 1MHCB 4S0TD 1JE6A 2C1OB 3PUUA 3VFGL 2P1YA 4XHQA 1L9RA 4MB1A 1DL7L 3ZQ9A 5ID0B 2OL3H 1MLCB 1TPXB 3C6SA 2YD3A 4ZS6C 2HJFA 2MRYA 3MVSA 5JHAA 2QVKA 3F7RA 4MXVF 5F1SA 2E59A 4XMPH 5AB9A 7CGTA 1MFEL 2N59A 4PP2B 5KSAB 3E80A 1T83A 2RH0A 1OGSA 3I3EA 2X6UA 5E70A 1IKNC 1RJLA 3SE3C 3MV9E 5D71H 1CE6B 1K3ZA 4GSDH 1H6FA 4BHUI 5EU5B 5FLUA 1MFAH 4PJAB 2AQRA 5BS0E 4NKMA 1TTUA 2AXFA 4LCCB 4G6KH 2W0PA 3SKMA 4PWHA 5A16B 2ZYIA 2P43B 2PNDA 1I4FB 1LP9B 2X12A 1F1GA 4GAFB 5F7LB 5EOCL 2R7EA 4ZAKB 4YHPB 5AAWA 3O8XD 2GIYA 3MHZA 4UIKL 3NJMA 2I26N 5I23A 5E4EB 4R4NC 2JCCF 3HR5A 1SYVA 2GSIA 1YMHA 2VC2H 3IB4A 3RWCA 3PXHA 1QSFB 2H2SC 4L5FH 4P4KD 4ONFL 1L0QA 4GSXA 3MN8A 4JFVA 3MNWB 2V2XB 1ZHKB 2X4PA 4L9LC 1WGVA 2BJMH 4EN3D 1MY5A 2HT4C 4UT6H 5GGVH 4ANVA 1YPZA 2YA0A 4BSVA 4X6CF 1IM9D 1OAQH 1KTCA 1PG7W 2HFEA 1JGDB 5BW7C 3LCYA 2A9NH 5JHDE 4LPTA 2D73A 2CDEB 2VTFA 2APWA 4X8JB 2BY2A 1TQBC 1CJYA 1H8LA 2FJUB 1OGTB 5JPNC 1D7FA 1RZKH 4WWNA 4OZHA 3OGCB 1F00I 4YR6A 1CFQA 3B8SA 3S37X 4GBXB 4X7SH 1KJVB 2VNCA 3STLA 3VI3E 2YIHA 4YOKA 5CEYA 1F3RB 1BZ9B 3L1OH 2X1OA 2Z31B 3N42B 4HS8L 5I16A 4Q89A 4F9LC 3VXPA 3CE1A 3O3BA 3U6XS 4UF7C 5EEVA 1Q0XL 2C1PB 3ECVA 4OLEA 4RMRA 5IK3B 1X5LA 5F7FA 1FFPB 4PV8A 1OPGH 2R29A 5IR1B 4XMXA 3MLXH 2J4WL 1BIIB 4QKXB 5ESAA 3SKUD 4ORZC 5HGAA 3RVWC 4HS3A 2I7SA 1FNAA 4JKMA 4ZSOE 4X99B 1LQSR 3L3DB 5I19H 1G6RB 1T1ZA 4HUUB 4U1JB 4A2FA 5F3BB 1T7XA 1YYML 2VN7A 3F64A 4JQXC 2PYFA 3MBED 4NHCH 4XC3H 1J05A 2SODB 4ODWA 5E08L 5KVGE 2RACA 1INQA 1ZHBA 3RA7L 1B4TA 3ARRA 2ZYRA 4OZ4A 4PGEB 4KRMB 5K1VA 2JXMA 1YUHA 4ZNCD 3VGAB 1JVKA 4BHUA 4XAKD 5HYJB 5F89B 5FYJE 3DYMA 4R0LA 4TRPH 2DWTA 7TAAA 3BUDA 1XGUA 3RGVB 4OD3L 5LBSA 1C08B 3DGCR 1OF0A 4PJEE 4N0FB 1YNTF 2DRUA 4Q8BA 2BDNH 2NXYB 3NFNB 2IMMA 3NP3A 4HZLB 5FWQA 3VFUA 1DR9A 3T0WA 2RJMA 4XCCH 3SDXB 5F9WB 3BVNA 4YHNB 4MNHA 4O02A 4U1HA 2VDLB 2XHNA 3LHAA 5TDNB 4YDKH 5EBLB 5F93C 1VIWA 4NDMA 4LQFL 4ZTOL 2D2OA 1LJMA 2WLZA 2AAAA 1IEAB 1KTLA 1RK1A 2VR9A 4CMMA 2QTVA 1ZLDA 3GEFA 2VXVH 3RJQB 2NTSP 5CINL 3KGSA 1YC7A 1WFMA 3U2JA 1CS6A 3VXRA 4HKZA 1Z1WA 1T6WA 2IAMD 1ORSB 1U91A 4G9DA 4TOYL 5SWQA 3U9WA 2CJUL 2OTUB 1QRNE 4ELDA 5J9PB 1MREH 4ZUVB 2R1XA 5DRZB 4Y4KA 2PCFB 3WMQA 4XVTH 1R5VA 1S5IH 3HHSB 1X5XA 3QQ3A 5FS5A 5FO9A 3QORA 2Z8VC 4TM9A 5K5YA 3FUIA 4MJ4A 2ZOWA 1CBVL 4MAYD 1SFHA 3M46A 4URTB 1KGWA 2H7WA 2NZ9C 1ODAA 3CDZA 3SQRA 1H3VA 2VO8A 5LQBH 3AJ7A 3V0VB 3NZHL 1DUYA 5A2JH 3ZSTA 1YDPA 4PS4L 3HR6A 4DZ8B 5I15L 2XZCH 3FONA 4HHGA 4WFED 2YSTA 4KK5D 4JREC 1RSFA 3EDDA 4MXWL 2XIDA 2WWMD 4G3YL 4OLVL 4OU3A 5DJ2A 4B95C 5IGXH 2XFGB 4B50A 3FQXB 1U8NA 3QPKA 5FW7A 2R2EB 5KBKA 4PJ7F 4HS6A 2P5WE 5D2NB 5CKAA 4QHKI 1HSAA 1XT5A 2J8OA 3L5WA 4Y19B 3UTQA 2EUXA 2J8UA 3GXIA 4IHOA 1OP5H 4G7QB 2UZIL 4I9XA 4LCWA 1QZ1A 1F90H 4IW4C 4YNYB 4U2ZA 3MCLL 2B0SL 3VCLA 1XIWB 1WWAX 3MOAL 3OPUA 4QRUA 4BH7B 1OP4A 2Y24A 4KI5F 4MJ6B 1OIOA 4A6YA 1EGJA 1WTGT 4IS6A 4XOAA 3RFZA 4LEEA 1A14L 1KBBA 3Q06A 2E4FA 2C3XA 2JLPA 3GSNB 1NAML 4Z7WF 3SY0A 2Y6SC 2Y7MA 3F2LA 1F4WL 2NX5B 3H42H 4TYUA 4WNSA 4ADIA 2ODIA 1U8QA 5CMAA 4AQOA 2AQ2A 4IMLA 1QLEH 4P2OB 3OG6B 4NN6C 4BUHA 5FGBC 2RTTA 4M29A 1MWAB 1OAXL 4AL8L 4C58B 3CUPB 2GJ6E 5DYFA 4CA4A 1YNLL 1I8UA 4K7FB 5I8EA 1NOLA 2ATPB 5LXVA 1OGAB 4N0UB 1URLA 3MRHB 1EHNA 3T6VA 4J28A 4YHIA 4PJCF 4F7MA 2FQEA 1PD6A 2CLZB 1P7KB 2QLVB 5J11B 4N6RB 1RUAH 2AJSL 3FT3B 3WSQL 1HE8A 3VXRD 4ZJ9A 3RIAK 2OV0A 3P69A 4FNPA 4FFYA 3D50A 5F9AC 1DQQB 3UPCA 2HG0A 2EDLA 1W16A 1CWVA 2VR5A 3DXAB 3BWSA 3EYQC 5C07A 1E27B 1NFAA 1SPDA 3K2MC 1K4DA 2JKIS 1DL7H 4LBEA 4Y4KD 5C3LD 1F41A 1WS8A 1BEYH 1HEHC 2ZSVB 3HN3A 3S9DB 3KMDA 3ETBJ 1A4CA 3N55A 2B15A 3VXOB 1FGVL 3SJVA 2PWFA 3UBXG 1QASA 3F7VA 3BZ4A 5TDOA 4B60A 4CKQA 4CGTA 1HTYA 5IFAL 2BP0A 3GMRB 3VVWA 4EVNA 4AT6A 4B5ZA 3GGWA 1Z3RA 4L8BA 4X42A 1DVFA 2WXGA 4NQXB 3SDXE 1JGUH 3TF7C 4P2QB 3MV9A 2X4QB 5EO1B 5JXEA 3JV6A 4XCEB 4R2GB 1CVRA 3TA3A 3Q5YA 4LCWD 2WJ5A 4EXKA 3QQDB 3CMOH 4TNGA 5BS0A 1YO4A 2EYRA 2Y7NA 5BVJB 1KSRA 3TN0D 1WP6A 2PW2A 4H2CA 4LEOA 3LMJH 4JFYB 1HXYA 4N24A 1JYVA 3V4PL 4ZFZB 43C9A 3UYOD 3T2LA 1CMOA 5GISH 1E4XL 3LD8C 4ZOAA 3WKML 4I85A 1J8SA 4OF5A 4FA7B 3EAKA 1FCGA 3L17A 1B2YA 3P3TA 4MJIB 1ZT1B 2JK5B 5B1JC 4OIIH 4HUVB 3FTWA 3K4ZA 3N0AA 2OSLB 3EYUH 4AYID 4OJDH 1VDGA 2KBGA 3GXFA 1YEEL 4HC1A 5E6ID 5F6IB 5LWYH 4OFYD 4DKFL 5E1GA 3MGAA 2FBRA 4TUJA 1F02I 2YC1A 1N68A 2F68X 1QSZA 2R0WH 5LBSH 2IGLA 4BFIB 5AKTA 1EHKB 2HTLC 1EHAA 2F61A 5JHDA 4PJDB 1IC5L 1S9XB 3OWEA 3LKQA 2F58H 3HKZA 4J8RA 2D3VA 4NAMA 2WZ6A 5D2NE 3WN5C 3ZHKA 4NRYA 4O02H 5IFHL 5DHDA 1Q1JL 1QD0A 4PMFA 2DDQL 4LPYA 5C07D 2BZ7A 3G5VA 4PG2C 3ETSA 4KKCC 3VI3A 2J4WH 4MVBC 4J6IA 4J3TA 5FXCH 3BESR 1U8JB 2W65B 1OB1A 4FABL 2PCYA 3EFOB 3MV8E 3VUAA 5C0NC 5EUOF 4UTBA 3SJVD 5I71C 2AEQH 4Y5YC 2X4RA 1ZS8B 3NGBC 4G42B 3LH8A 2VQ1A 3F7LA 5E08H 3FB5B 5KVEE 3LZRA 1X44A 2P3YA 2BVPB 4IK7A 5CLWA 1KJMA 2F54E 2WTOA 1JL8A 4WI4A 4OZIF 2ADJB 2VABB 4F5CE 4ZSOA 5IJCC 3GSRA 4FFZA 2DMCA 1ZD6A 4NZRH 2AJZB 4CSTA 3ZE2F 3FULA 1DVFD 2WLKA 4HUWB 4QHMA 5DRNA 3CDGB 3WIFA 3MV9D 3SCMB 2VDNB 1OGAE 4N0UE 2AK1L 1IQWH 2DM7A 5DVOA 5JXED 3F7QA 3BHBB 1JPFB 3SGDH 3TA3D 4APQB 2I9TB 3AU1A 1OE1A 1LO0H 3CSYB 3GK8L 4M6MH 5FO7A 4ADGA 4Y0GA 5BS0D 1FLTX 4IKNA 1JZJA 3X12B 1G9NL 1GSKA 1I3GH 5IMOA 4AK2A 1VCAA 2DMGA 1MCOL 1N6QL 4IDJL 3GNML 1ZT4A 5D7JD 3RWFB 4PJEA 4YC2C 2R39A 3LVEA 5L7XL 1TJMA 1JDDA 2P49B 4P57B 4NUJA 3RX5A 6FABL 4WLCA 1NIBA 1ET8A 1U2HA 1TMQA 2BVQA 3S36H 4X9GA 2P46B 2RA1A 5DVNA 5EZLA 3ZZQA 3NESA 3ZRFC 1TJHL 3ULSB 4EI5C 1MPAH 4LAQL 3GRBA 4P46B 3PNWB 3B43A 5FM4A 3WO4B 1MHCA 2BFVL 4NEHB 3V6FA 3THMH 4NAJA 1R9FA 5EF0A 5AD0B 4A6YH 3BIKA 1EGJH 3FF8A 4OGYL 1AOZA 3DTUB 4N20A 5H2BA 3LRHA 4F8TA 3L3JB 5JLZB 4OQ1A 2XV0A 2HMID 4HUKB 3NH7H 4JN1H 2F6AA 2V0AA 4V1DD 2WTRB 3OJDA 3RVTD 4KDWA 5JHDD 3S8GB 1N3NB 4NNXB 1QRNA 1CXKA 1M1XB 3WV0A 2XKNB 4P2QE 5A7BA 2NDGA 3O6KL 4JFUA 2B39A 3T6WA 5LNDA 1C8PA 2IAAC 4RBPH 3NZHH 1ZVYA 2XQYK 4BEIA 2GABA 1CGSH 2NT1A 4N1CA 2BCKA 4J2XA 3D51A 3IU3B 1SXBA 3L2NA 4FI7A 4OLVH 2IC2A 3KYOA 2X7LA 5KSBB 2HKFL 1W72L 5TGBA 4YGAB 5ESVA 3KPRB 1FNGB 3SGKA 4FFYH 3S5ZA 2ZX9A 2NR6D 3DYOA 1IMHC 4P07A 5HBBA 4X8GA 2GCYB 4QHUB 3HE7A 5F6HI 2WAHA 1JXFA 1II4E 2A1WH 3KG5A 1EUUA 1CF8H 4MJIE 3ZX1A 3MCLH 5CGMA 4K07A 3W9DA 5L2KD 4UCFA 2JI1A 2P5WA 4LLUB 5T5NF 3FPYA 3KXFB 3NABH 4ZUWB 1XBRA 3P9MB 1F86A 3NCMA 5TK4A 3D7PA 3ARFC 2V2XA 3OKKB 1GJIA 1XBDA 4FYQA 4PY7A 1A14H 1QI4A 3U4KA 5L9DH 3UJTH 1H3UA 1OF2B 4FNLL 1MIML 2HRPL 4HUXB 2YFNA 1T89C 2EH8L 1K8DB 1RI8A 2DMKA 3KYAA 4Y2LA 5GSVA 3WOVA 3Q48A 5FYJD 1OAXH 1IAII 2ORBL 4JKLA 1EH9A 1YNLH 1NWOA 3P3UA 1R3HB 1OGTA 5IREA 4H40A 3TO2B 2AV1A 3I9IA 3WFHA 1KCSH 3O2WH 5KJ4A 2CK0L 5I6XC 4MA8H 3G7TA 3OGCA 4K55A 3N44B 3BVVA 3ENEA 4GBXA 2XN0A 4KGLA 4WUKL 2ENJA 3OXRA 3SDAC 2XN9B 4D3CL 1BZ9A 2Z31A 2BSRA 2GJ6A 2WZAA 2A6IB 2PTVA 5IG7B 5K59E 4OJAA 1E4HA 4YDLC 3T08A 1MFBL 5C2BH 3PYCA 1XZWA 2G3NA 4OLYH 4HFWA 3N41F 5F1OB 3FN0L 4IRZA 4N5EC 5CCKL 2VDMB 3LN4B 4KJPC 2XV6B 3AVEA 2B4CC 4FZ8H 1BGXH 1UWXH 1TTCA 2CO1A 4YK4C 3VNZA 2ENQA 3IF1B 4XB3A 3P02A 4X99A 3L4CA 2ERJB 1QFWM 1UM4L 4MRCA 1E3FA 1NH6A 3JZYA 4HC1H 3FU3A 3FFCB 5FGSA 1AG0A 3DK2A 1CGWA 4JANA 1YVLA 2OK0H 4G6FD 4PGEA 3L7EA 4AIZB 3VGFA 2G2RB 4YBQC 3D4CA 3P3RA 3QJTB 3DBSA 4Y2OB 4ETQA 5FOJA 2EJ1A 3ETBF 1BDYA 4EZJA 4FS0A 2CLVB 4IIQC 4HJGA 2DQDH 3D0LA 1M3IA 1EX0A 2YQ3A 3EJSA 1AGFB 3CFCH 3TBWA 3QIWA 4QEGA 3S3BB 4KBPA 4RFOL 4ZAKD 2CO6B 5C6WH 3HE7D 4PJ8C 4FA6A 3IJHA 2XV3A 1SRDA 1BJ1H 5GRVL 2CKBB 1QSFD 3LEVL 4Z23A 4R4BB 2IPUG 1ZXKA 1DQTA 1GHFH 2AABL 4RISL 3V2AR 1E4XH 4IU3B 2FX7H 1IEAA 3EJZD 4JB9H 3WKMH 4AYMC 4UTBH 1MCNA 3Q2WA 2JLLA 4Z0BH 3W56A 4A7GA 3CH8A 3MRQA 3MROA 3K4AA 2VDQB 2OS7A 4WWPA 1VGKB 3GBEA 2PPAA 4AQAB 1ORSA 2AGJL 4FFZH 2DIEA 5I66B 1R24A 5J9PA 2C8NA 4MMXB 3CXHJ 1LTXA 1V55B 2WXHA 4AIOA 1QFHA 4DKFH 4KHXL 1JZGA 2HP4A 1BCIA 3LPFA 1RHHB 2Y7QB 3PE9A 4AXWB 3RL2A 7PCYA 4GBXD 1E30A 3H9SB 1UQSA 4HWEL 4FG0A 1IC5H 1RERA 1WZLA 1M2VA 3BH4A 3BUPA 2Z31D 5E4OA 4RGOH 5FYJH 2HVJB 4QHLA 4DHLA 4L0PB 5KSBE 1HKFA 2XA8L 1KLUA 3D33A 3C6LA 1Q1JH 2DY2A 2DDQH 3WHXA 2JELL 3GSVB 4TNWK 5IMMB 4MQ7B 1S9YB 2KUTA 5CJXC 2R2EA 1BLIA 3APFA 3TCLB 5D2NA 2BSCA 1B90A 4N3UA 4JG9A 2FWUA 3T4YB 3N0PB 4UINH 5JA9A 4PJDF 2PO6B 2DLGA 2BW4A 1OW0C 3QE5A 4HFUL 4F33A 4M5SA 3EBIA 2WXIA 3GZKA 4FJZA 1XIWA 2XPYA 2WVUA 2AXHA 4BH7A 3MV8A 4XCNB 1ROWA 1UGNA 3I85A 4M93B 2AQNA 4IRJA 2FEJA 5CZXD 1RZGA 3MXWL 4HGMA 1AIFB 1YQVH 2FHBA 5I6PA 4DNLA 1WYJA 5DD3L 1EVUA 4QHNB 5CJOL 3RGVD 3UTTB 2F54A 3TH3T 4RLDA 3QVAA 2F7PA 4G2AA 4A66A 4K9JA 4FKKA 4LPWA 2MMXA 1A9VA 2NXYD 4H1LH 2EABA 4FI8A 1MWAA 3TZVB 1FN4A 1S7WB 2OXHB 2X6AA 2Y2YA 1OOAA 5FO2A 1UT2A 1Q90A 2N4IA 4U7KA 4HZAA 5FGRA 1N6QH 4IDJH 3ZU8A 2J21A 1PZBA 3KBFA 2XWZA 4UWQB 1NCOA 4HGKC 3NCJL 4XT1C 2GJZB 2CLZA 1M3JA 1P4LB 2ZAHA 3FH5A 3IJSB 5E6SB 1BQHG 4FQLH 2MCAA 3FT3A 4LAJH 2ZXDA 1TSHA 2A0LD 3BKYL 4RRPA 5KYUA 4O9HH 3DROB 2UZYB 2X44D 3CVCA 3IDMB 3MRFA 5EA0H 5ABAA 3WIIL 4LAQH 1DEEB 4LSQL 5GIRB 3IT8D 3TCTA 4AOFA 1E27A 2FQGA 1TKWB 4IBSA 1G7PA 4OGYH 4HMDA 3FFCE 1MI5B 4N25A 5AZEH 2NUTA 4HJIA 2DQ6A 4R4FH 4PYGA 5T5FA 1D7BA 2B5IB 2WMPB 2G9HB 4HLJA 1XQ4A 2WLIB 3ARZA 3S5YA 5BUGA 2HCZX 2DM2A 1A64A 2ZJSH 1AGCA 4X0NA 4BYHA 1MCEA 3P9LB 2WNWA 3DJ9A 3LPOA 1EBPA 2HT2C 3LZOA 3N06B 4IRSA 1AZNA 3F7PC 1PL3A 4X6FA 4XVSL 4YSRA 2CGRL 5I0VA 2M83A 3C6LD 3CG8A 4BELD 4C4UA 1ZK5A 2QADB 3VD0A 1MNUL 1MRDH 1NC2B 1NZRA 2VMFA 4E9SA 2VN5A 1YEHH 4P2QA 2V5YA 2V9RA 1W72H 1CURA 2X4QA 4J27A 5FM5M 4NKDA 5HDRA 3ZQWA 2ZICA 3LY6A 1UHVA 4R7LA 1K4CB 4AWJC 2W1NA 3BIBX 3NEXA 1YJDC 4IRZH 1I9RH 5HDBB 5A2AA 1CFNB 4AZ8B 1VFBB 4H0LC 1M6OB 3A6BH 2WZ5A 1UOKA 1XIWD 3RKDC 1KBVA 4ELMF 5TE6H 1CGVA 4KOCA 4ZXBC 2OMYB 3V4VL 1NCBH 5E0QA 1CPUA 5FCUL 4DEWA 4PJIF 1YLBB 3MRIB 1SEBA 4PJXE 3UG5A 4JDZA 4MJIA 3SD5A 1KACB 4MFHA 4GLRH 1HHKB 5E5UB 4HUVA 3K72A 4NZUH 2NX5D 2MQ0A 2EE6A 2EH8H 2NY1B 3QZWA 3QARA 4DUXA 2OSLA 2XG4A 1HI6A 3AROA 3H9SE 3QIUC 3QDAA 4P2OD 3QO0B 5ICUA 3V6ZA 3X11A 1U93B 3ESNA 2ORBH 3IWUA 3MCKB 1I9IH 1BM3H 3GSOB 4GW4B 4P2RE 2R69A 1OGAD 4HIPA 4UDTB 4CL7A 2CK0H 4WDIB 4I0KA 4X9FA 3FT1A 4YAQA 3U1QA 1IJ9A 1JERA 4HPHA 4M3KB 1C1EL 2IH3B 4GIAA 4WUKH 4EXPX 5ABDE 4L8DB 3ULUF 1UJ3C 5HVHC 1S9XA 1TTRA 2ZXWB 2YWYA 2DQJL 1QAWA 4BZ2L 1JCVA 4HXAH 1AD9A 4KKBD 3MGOA 5DT1L 1XCXA 2GSMB 2IADB 3OV6A 3UBXB 3AADB 5CCKH 3NTCL 2E9WA 6TAAA 3FOLA 4KDVA 5BQ7A 1EXUA 2BRRL 2V8LA 2X2UA 4MGXA 1LO2H 4GS7C 4YFLF 4QJ5B 5IVXB 1OP9A 3TEYA 5TFSL 3P11L 3MX0B 3OJ2C 4WEEA 4GKOA 4X7CC 1A7QL 3SE8H 3VM5A 1CFTA 3WMSA 1Q9OB 1SVCP 5D1ZI 3UTTE 1IILE 3IGAA 1IAIH 3QH3B 4AENA 3CLWA 4LHUA 3UGEA 4F7TB 3KS0H 2PW1B 2AJZA 3L5XL 3QR0A 3TV3L 2CLRB 1PKQB 1ZE3H 4HG4J 2H6OA 4QKTA 1B2WH 3WG7B 3CDGA 2Y9RT 1XGTB 4P2QD 4JRFA 3SCMA 3U1PA 3ROLB 1KG0B 1GPOL 4M7KL 4ONHB 1OP5K 1JPFA 2BOCA 4R2GD 5JXAL 2BWDA 3B7RL 3CSYA 4ZS7L 3WUWG 1IVTA 1KXVC 2VDOB 3TJPA 3HUJE 4IKIA 4KY1L 2WGNB 4BKTC 4BXSV 5IESL 1RUMH 3FOMA 4D7PA 5D9SA 4JCWA 2ZOTA 1KEGH 2YGPA 1GS8A 4RDBA 2XZQL 5ACMA 2NY2B 4QTFA 2CU9A 2AABH 2DIAA 5TE4H 3GS4A 1ZSDA 3GTTA 2OTWB 4DAGH 4F8LA 3WO3B 4PWJA 2XXGA 3AG4B 1NTDA 3B1TA 3AAZB 3F84A 3QIBB 4P57A 3MJ8A 1MCSA 4MJID 3V7AG 1GA2A 4ZX5A 3P3SA 1QWUA 2W9DH 3KJ6L 1YEJL 4KK6D 2VSMB 3AXIA 4PGCB 4AK1A 2ZUVA 3MI6A 4P3CL 4PGBA 4FJ6A 3RWIB 5E8EB 3QR1A 5LAXB 4Y4HC 4BGDA 5GRWA 4EQ3A 2WD0A 4LGRB 5EF1A 4IKKA 5I9QC 1E6OL 2WC7A 1UZ8A 3PGDA 3ELQA 2GUOB 1I85C 2WTRA 4KXAA 1UFGA 2BS9A 1N3NA 5IV2B 2EVGA 3IRCA 2YR3A 1DBAH 4LRIA 4YUEH 2XKNA 4BH8B 2XA8H 2YA2A 3W5MA 1KTKE 1JNHA 2CE6A 1KGJA 5EMYA 5KOMC 5ILTH 1WFTA 4OT1L 3U2SB 5BZDB 1S9KC 4Q58C 1JWUA 2FUQA 2GAZA 2JELH 3FB6A 3MRDB 4L1SA 4M02A 4PJBF 3IU3A 4FG2A 5CIPB 5HDBE 2YMTA 4M1CD 5SV3A 1A25A 3D4GA 1VSCA 3HS0B 1IBDA 5I73B 4UT9L 3SEPA 5I1LB 4JZJC 5E99H 3AWEA 1NA8A 2E4TA 2K45A 2KDYA 1SN0A 5DFVC 4AEHL 2ED7A 1X9LA 3NSJA 2WXRA 1DBML 1JPGA 4QHUA 4XN8A 1E5BA 4FQXA 4CILA 2KZWA 3ZZSA 5DZVA 4K7PH 1I8KA 4LVEA 5JQ6L 4F2MB 5D1ZA 4YBHA 4BWTA 5J12B 1EDYA 4LLUA 4Z8FL 3AREB 3MLYH 1DQML 5E2TL 4YSPA 3MXWH 3P77A 1ZPUA 3B7TA 1XEDA 3SCMD 1XR8B 1YCSA 3FUDA 4IBYA 1IEHA 3DX9B 4I9WE 5TQ0L 4HUXA 4GP5B 4APQD 4FG6C 4ODXB 2J8HA 3WLWC 1XH3B 1K8DA 5F3HB 1Z5LB 5DS1A 4FTDA 4XOCA 4XN9A 5KVDL 1B0RA 4HALA 2EXSA 3QUYA 4JLRA 4K0OA 5C0BB 4YHLL 2ADFL 4Z1PA 2ZWZA 1R3HA 1QW8A 1P6FA 1R33A 1CR9L 1X5ZA 2QV2A 3HN5A 3GJFA 4OCNC 3RHWK 3GTVA 4DKDC 2WJ7A 4S0HA 1PZSA 2FT7A 3N9GL 2B7DT 1W8NA 4G1EB 4FAAB 2NZIA 3BT2L 1PYWA 3QXDA 2V9QA 2A6IA 5D6DA 3BKYH 5HJDA 1G7QB 3GUFA 3GI9H 2R4RL 1WISA 1PFOA 1IC7L 3C5JB 4DIXA 5F7BA 5BO1L 1HIML 2VMDA 4W6WB 2DJMA 2QHRH 5HY9A 1GY2A 4BFOA 5HDOA 3QBTB 3QUZB 1RZ7L 4KKAC 4P5SA 3OPZH 5AW2B 4RAUA 3PP3H 1AHWC 2HFGL 4XMWA 3TFKC 3OC5A 4LLMA 1NM9A 1JF5A 2EIJB 4XMLH 3FMGL 4K2UL 5GS1C 4D9QE 4B53A 3SZKC 2R69H 1P4IL 3FFCA 5E6YA 4XPGH 3OJMB 3TFBA 1UD5A 2YD5A 3R0MA 4QOKB 3HAEG 3VDBA 1HZKA 1MNUH 5BXFB 4QGYA 4CVUA 4QDGA 3TBYB 1JNJA 3FH7A 3FT4B 3G6JB 4NFDA 2PLTA 1IL1A 3WTTA 3NJNA 1JPST 2CLVA 2NY4D 2YK1L 1J5DA 1CE1H 3QUXC 2G4EA 3S3JA 4J7RA 4XNXH 3CFEB 1UH3A 2FH8A 3I2CL 1UD3A 4I18B 3RVVD 4EI6B 2J1XA 4DGUA 4AVJA 3B9VA 3MDJA 5B8CA 5AWNH 3CZFA 4J3OD 2C9AA 4FQXD 3DX3A 3KLHD 4WO4C 3VI4E 3ESOA 4XN2A 1QHPA 2WINA 4RAVA 4WFFE 2CKBA 3S5LA 4UTAL 5D1ZD 1KFAL 1RZPA 1CDBA 4BFRA 4AYFA 4F27A 2E86A 5DQJA 2EDDA 4IU3A 2KQMA 5C8JB 3P1VA 4QXWA 4ODUB 1PSKL 5F0MB 4LT7A 3RDTC 4A39A 4E9WA 4QRAA 2GIMA 5KYYB 4PU2A 4ZUUB 3CC5B 5JDSA 4B7IA 5E1HB 1J0KA 5GGVY 2AEPL 1ILUA 1MVUB 1CBJA 3GJEA 4C83A 3MGTB 4PVLA 4GG6F 3QUYD 4MMXA 2VWEC 3RNQA 2K8MA 4MAUL 1P84J 1XD1A 3TLRA 1JYNA 3QCVL