4AV0A

Structure of the fimh lectin domain in the trigonal space group, in complex with a methoxy phenyl propynyl alpha-d-mannoside at 2.1 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av0A00
3ZL1A 4AV4A 4XOCA 4AUUA 4XOBA 2UY7B 1PDKB 4XODA 2W07B 2XG4B 4X5RA 5F3FA 5FX3A 5ABZA 1N12A 2JTYA 5IQOA 4J3OH 2JMRA 1KIUB 1TR7A 1QUNB 3BFQG 4J3OG 5AAPA 5LNGA 2J2ZB 4XOAA 5AALA 2VCOA 2WMPB 2XG5B 5FWRA 5CGBA 4XOEA 4CSTA 3MCYA 3JWNE 5AB1A 4J3OF 4AVJA 3BFWA 1UWFA 4X50A 3BWUF 4AUJA 1N0LB 4AVIA 4XO9A 4XO8A 4X5QA 4X5PA 5F2FA 4AVHA 4ATTA 4CSSA 4AV0A 2UY6B 4AVKA 3JWNH 1KLFB 5IQNA 3SQBB 4CA4A 3ZPDA 4AV5A 5IQMA 3RFZA 5FLUA 4LOVA 5JQIB 3ME0B 3JWNG 4AUYA 5FS5A 5LNEA 4BUQA 1ZE3H 3ZL2A
chains in the Genus database with same CATH superfamily
1RHHB 5EOCL 4JM2D 3EYQD 2DQEH 4ISVB 3BE1H 3AACA 4XXDB 1H19A 3IJHA 3QXDB 4I89A 3PGCA 3ZVVA 5DUPH 3S37H 3QNXA 2CK0L 4J5VA 3ARBA 1S9WA 5TQ2H 3S3SA 2FECI 1ZD6A 1G1CA 4XCYA 2Q86A 3EOTL 2VZUA 4BK5C 2GSGB 3WTSA 4WUUE 2O6PA 2XWTA 3DVNB 4KNQA 3MLYH 3S88H 2BIHA 4UZGA 4Y1AE 2YAPA 4Z18A 5A7EA 5DUJA 1MXGA 1KTBA 2NDFA 3FCTA 5D1ZA 4PRAA 4TVPH 2FJFB 1U4EA 1UM6L 4Y1AB 2YD6A 3EJCA 3ABKB 2ICWB 4FLQA 3WY1A 4HMCA 3AB0B 1NGPL 4XAKE 4ACTA 1FFPA 2YPLB 2JKSA 1OP4A 4L8SB 1XAUA 5B22A 3ZXAC 3RY6C 2W65B 5FCUL 4POZC 2RH0A 1AP2B 4ODXB 3FB7B 1KLGA 2V5SA 3SE3A 4IBLT 1OD7A 3VFUB 3FUJA 7FABL 1QNIA 2WCSA 4OCYH 3ZDYB 5CD3A 2WTRB 3MV01 1MEXH 1XXDC 2DQJL 2WZ5A 5ADPH 4JLRA 3HC0A 4OV5A 4P99A 2IDQA 3DLQR 3U6XS 4IBSA 4YSDA 5T1LD 3V52L 3RWEB 3SGKC 3UACA 1Q0EA 1KXVC 3C60C 5EOTA 2F8XC 3U6XA 1EZVX 3MO1A 1K2DB 3NFSL 5MHSD 4HPYH 4J3OF 1E50A 5EN3A 3LRGA 1UWEL 4LSSH 4LSTH 4X4XB 4F9PA 4H8WH 4JPWL 1MNUH 2P5WE 2VDQL 3DWTA 1DVZA 3HE6B 3NESA 4M61A 4OKVB 4QHNA 2QPDB 5IBTH 5JDSB 1RUML 1ZTXE 5C6TH 5I1LA 1J48A 4G59C 1U93A 1PDKB 3GBNL 2P5EE 4XXCC 4RMSA 4HIIB 5LB1A 3ARFD 4IYKA 2K8MA 2CXGA 4NP4L 1AHWA 1Z5LA 2IGTA 4M7JH 5EOQH 1MJ8L 2W0FB 3LIUA 1L9SA 4NCC1 3TURA 1OGAD 3NCJH 2Y7NA 4UQ2A 2CGYA 1CD0A 4YHYC 3QUZD 2IH3B 3CN4A 4GAYB 3AS1A 3AZUA 4NLHA 4PD4J 5CP7A 3UAJA 3VQLA 1UD6A 2K0RA 5AZUA 1KDIA 2ZT9C 1KGIA 1R0AH 3VXRD 2EDNA 4BSJA 4L0YA 5E4AA 3MJ8B 4WI4A 4LPCA 2ZG2A 5HHOA 3JYCA 4TUKH 1H8OA 4GFTB 1CLCA 2CKBL 3VFVB 3OXRA 5KVMC 1I7UB 4JVPA 2WTRA 1HWHB 1B0GB 4XNUH 3TOPA 2X6VA 4XNMB 2NCEA 3MLRL 4R7NA 2YEVB 5EU5B 3U46A 4BKLA 4X7TB 3S2CA 3GMOA 2EXWC 4TNWK 2QPSA 1I1RA 4AK2A 4KI5D 3T0WA 3EDJA 3VYPA 1S7SA 4Y16A 4XMXA 2BWIA 1T0NB 2R51A 1D7DA 5A2IH 4A1RA 4PS4H 1S5HA 1LWRA 3TV8A 4XP5L 1OT2A 1MHPL 4POZD 3QUKA 4ZZFA 3FUEA 4BZYA 3DX9B 3LIZA 4F2MB 3QIWB 1ACXA 4N86A 5KJRH 4U6HB 3SO5A 1DE4B 1YRKA 5JHMA 5EEWA 1JVLA 3RY4A 3FFOA 5E2UL 3NRFA 1O0VA 3IDIB 1N4XL 1B2WL 1CT8B 1O5DT 4NQCA 5IWLC 4JVUA 1XF1A 3V9EA 2VZ1A 3G9AB 3RBGA 2XKUA 1BFTA 1CF8L 3ARFB 1FL5B 1FLRH 2WQWA 3GUFA 4HC1A 1ZXQA 2L7JA 4RA3A 5EFIB 5FA4A 4PSRA 5GZNC 5HP5A 2EKSB 3NDYE 3MLYL 2EUZA 1RFDH 3KPOA 4AJ0A 3U9PH 1QSVA 5DFTA 2R56H 1S7SB 4Y16B 4F1ZA 2IWGA 3VGGA 4G8FA 2ZKXA 4MGXA 4MAZA 3ME0B 5DUPL 2YARA 3STLA 5I2IA 5DQ9A 3CZGA 7PCYA 1D5IH 2OQJA 4ANXA 2DQEL 1NIEA 3QI9D 3GSUA 3VWJA 3V0VB 2YUXA 1F13A 1H9VA 4H8HA 2EDQA 5G2NA 4OW6A 4PW3A 3NCFB 2XZZA 5EPMA 5EMYA 3PJSA 1OAZH 1CICA 2FO4A 4PJ7B 1F1GA 4HLJA 5E8PA 2K6WA 3K8LA 1RUPH 4PJIB 5E9DB 2F5BH 2HRGA 4HIEA 5L6YL 8CGTA 1BLNB 1GA2A 1UOWA 2E6JA 3K71A 5C08D 2FGWH 1I3UA 3CG8A 5LNDA 4YHLH 2XXCB 3ENEA 3VFTA 1DL7H 2P28B 1LWJA 3JWNC 5AEAA 2ZOKA 2C1OA 3MFFB 4X9BA 2NY3C 5IZ7A 4EZMA 2HVJA 1G7QB 3BAEH 1OCWH 3UC0H 1A6WL 3PAUA 5DT1H 5EIVA 3RU8L 1U8NA 5KANI 2BSRA 5JHLH 1HH9B 1NC4B 4UBDC 3MV7A 1A6WH 4IOSA 5DT1L 3N3EA 1AQDB 1RZIB 1YY9D 2BIIA 5DJ0A 4P49A 3B9KB 3LRLA 5J1SC 2XV6B 1RZKC 4Z3EA 2Y7MA 4DGUA 3BZ4B 2PW2B 1IBYA 3MNWB 5F7BA 4YHLL 3Q8BA 12E8H 4JQIL 4KKQA 1QLRA 3HPLB 4S1RL 3RYMA 4FJYA 2FLBT 4L2YA 4PV9B 5IB4A 1IAOA 2NY3D 4X8XA 1LO5B 3DGDA 2WUBL 4RBPK 5A2KH 1DSFH 1K8DB 1T7WA 2LLNA 3VAEA 3WFEH 4DAGL 1Z9PA 4FABL 1WA2X 2GTZB 2IF7A 4MYWB 5AW1B 4N68A 1NDGB 4Z0XB 2OSWA 1IBBA 1UM4L 2PETA 2Q1EA 3NSXA 5CJOH 2ISDA 2QBWA 4PRID 3NAAL 4IRSB 5F1NB 2DWDB 2V8LA 1NEZB 1F90H 4QNPF 4UCFA 2CNYA 1P5VA 2XZQH 3CC5A 5EEZA 3B7RL 2HPTA 3T1WA 4J7RA 4RCAA 3P9MA 4XMVA 1OGTB 4R7VA 3V6OA 3HAEG 1UH3A 3P3RA 3VFRB 4N20A 1P1ZA 4JCWA 4NN7B 3KVDD 4JFSA 2ZUWA 3G5XB 1KEMH 2QKIB 4GYBA 1IGJB 5HHXH 4HG4K 5IIEA 2YPVH 4R5XA 2J1ZA 4A63A 3GBEA 5KBLA 5ESAA 3RL1B 4X5PA 5DJYB 4QXGL 4W70A 4PGBA 3HE6D 4OJDH 5E2UH 1SXCA 4PP1D 3KPQB 4N90E 4YO0B 3FO1A 1WP6A 3GXUB 1CFMA 2YSTA 4PREB 4BV1A 4CW1A 2GTWA 4LCCC 5D5ME 1A1NA 3U6RA 5I0ZA 5CLXA 4Y5YB 4Y19D 5L4FA 4GXVH 5IW3A 1FJ1A 1XGPA 2SODB 2XWDA 2EIDA 3NABH 3QEQE 4HKZB 4XPTH 2RB8A 5K1NA 5SWSB 4Y88A 4XPAL 3WIAA 1KGWA 3IFOB 3NIDF 1TEGA 3LEVH 2HUEA 5DVMA 3V10A 4QXTA 3ZMEA 1IEHA 3QCVH 4CMHC 3U2IA 5ACZA 1I8IB 4G6FB 4FYTA 1KTJA 4OZHE 3MXWL 3I3BA 1FFNA 3MRLA 4B9KC 1A64A 4A2MA 3GJEB 1DFBL 1XGTB 2XJLA 2EXTA 1IC4L 2EEAA 3MRFB 1G7MA 1G5GA 1FG2A 1WZAA 5EU6A 4PG2A 4XPTL 1TLKA 1J5DA 3VI4A 1GGUA 3UC2A 4HHWA 8FABB 1WQVT 5JPMC 4AM0Q 4QF1B 3FO9A 1LO5A 5T33L 1OOWA 2E6QA 2H32A 3MBWA 4LDCA 5IT2H 2J7LA 2OXHB 3GZKA 2KLSA 2A74B 2V4LA 5EIIA 3QWOA 4PJDE 3KYKH 2VXTL 1E8WA 2FX7H 3S3PA 4IKKA 3CDZA 3O3AA 2DI7A 2HG5B 2I25N 1S7UA 1FHGA 3KR3L 4MHHG 2VAAA 2ZOLA 5G55A 3TM6A 3UJIL 5IJKA 1Y1DA 1MHEA 3I84A 3D50A 3QUMH 2CBQA 4P5TA 2AS5M 4LIQE 3QUYA 4WY7H 5GJTH 2XG4A 5FUZL 3RVXD 4XCCL 1WCBB 4N0CD 3QPXH 3QT2A 1UZGA 4JFQB 5EORL 2E9JA 1QTYT 4OF8A 4IIQA 1BCIA 1BOGB 1HZHL 5FM5M 3SZ6A 3C6LD 1ORQB 2HLFD 3SOBL 4DP4X 5IJDC 4L3EB 4NJAH 3EIFA 2YGVA 4PJIA 3ZZLA 3WEMA 1YEIL 3VXRB 2AJ3B 5BCAA 2UWEA 1T66C 3DO4A 3F84A 3GGWA 3X3FH 3ZIMA 2HFEA 3UZQB 5IFJB 4WNQA 3HUJA 1URLA 3BYYA 1U3YA 3VWKB 3D25B 1CYWA 3GI9L 4BH7B 2HT2D 1P4BL 2UZXA 5I1JH 2QLVB 3VXOA 2R1XB 2VQTA 5E2VH 2GJ6E 1MEXL 1A7QL 1UM4H 1TUPA 5F0LB 3AREA 3V2AR 1URIA 5HHOE 4N8UA 1G7LB 3LKNB 3IDMA 4A2EA 3DXAB 2VLKE 1RVFH 1ML0A 1P69B 2F58L 3DURA 3LZPA 4B3VA 4ERSH 1Y7VA 1ZHLA 2MNWA 4JQIH 4IHBA 4KHXH 1G0DA 4HDIA 3UX9B 4PVBA 1GZQB 2HJFA 3G08B 2QFPA 5SWZE 4WI3A 3K4AA 5JHBA 4L29A 2AMGA 3WDHA 2E7CA 4L8DB 43C9A 2X9ZA 2Y7SA 4FMKA 4B53A 2DQMA 5JHLL 5FWQA 2CA4A 4Q4IA 4BH7A 3PDDA 2EC8A 2WLIA 3BPOB 3CZNA 4J12A 2KPNA 2FJGB 2VRKA 3I50H 2YZ1A 4QOKD 1DQMH 3LEXB 1IKNC 2EIEA 3UZEA 4LCWE 1NKOA 5E4EB 3QJRB 2GFBA 2BZCA 3FTUA 2W60A 3QPQD 4AZUA 5DWPA 1NCJA 1YMHA 4N5UA 3T3PE 2Y7OA 2VJXA 3NCWA 2AK4B 3DXAD 4QAWA 1U3HC 5KBDA 4P2QD 4F7TB 3SPVB 1CFTB 4FFYA 1J8HD 4I9WE 4QHKJ 1KJ3L 1WJ3A 2NRDA 3QORA 3V0HA 4DPBX 4L8BB 3AWFA 2VABB 4I2XA 3LZFH 3J07A 5MERB 3M7FB 4MAYC 3L3GB 4HFUL 3JBG7 4AH2A 5A16A 1JGLL 1KYDA 1YUHB 1ZLEA 4ZOBA 4XCEA 5EU7E 1TZHA 4BGLA 5D71H 3JWOC 5D6DA 4Y2DC 1EZLA 3NIFF 1G7HB 3T3PB 1Z3GH 2R56L 4ZUVA 1K4CA 2V7NB 4KNUA 3H3PH 4BFJA 4DTGH 5EO9B 3VD1A 1FBIL 2J4WL 1RIVL 4ZUSB 2C9QA 1AANA 3QRBA 5AVWB 1MLBB 4NRZA 2FJHB 4Q6YA 4V2BA 2PTTA 4XBPA 4LOVA 1KJ2A 4Y9CA 2VR4A 2DDQH 4JAMB 3TO2B 1RSYA 3QDMB 5F7LB 3V5KA 3KPPA 3WXWH 5DR5H 5IMLA 4L4JA 5BUAA 3VD5A 1NBYB 1FG2B 3SDCD 4O2FB 3VU2A 4MJ2A 2ITCA 5HJBA 4UQIM 3QYCA 4N8VG 4OZ4B 4RFOL 3WL9A 1E4WL 2W0FA 5JHDD 4J6RH 4JFEB 3OR7B 1IM3B 5KVGL 5L2KB 1FRGH 3Q2VA 2GVYA 1CTMA 4K4KA 2DTSA 4AM0A 4CMMA 1XL4A 3VXTA 2VC2L 2QQNL 2R2BB 1IE5A 3FQ4A 4C56A 2O5YH 4PRPD 1G5AA 3TT3H 4LLQA 5E6IC 1GPOL 2AI0H 3WDIA 4B9IA 2X4PA 4FTVE 1XBDA 3AM8C 3EYOA 4J28A 5A2LH 2L4OA 1UM5H 4MB4A 3DI2B 4GEJA 3N9GL 4WHYG 3MV7E 1NANI 3ZGHA 2FWLB 1PZ5A 1K5NB 3RAJH 3BAKA 1IGCH 4JFDD 1P4IH 1MCWM 1U8OA 5DA0B 4DKEL 5ALCL 1ZLSH 1HEZB 3II3A 3CFBB 1CL7I 2QGDA 4JL1A 2XFXB 1RJZB 4AV0A 3L9RB 3IKCA 1AQHA 1MHCB 3QEUB 3V6ZB 2B39A 4FADA 4JPSA 1PMYA 2WK2A 4NNYA 4IMLA 4XZUA 1SQ2N 3BUBA 4HKBB 4NHUA 3O2DH 1T7YA 3BP5A 1WG3A 1UXWB 2CXKA 5DS1A 3ZUNC 4CSTA 1WFJA 3D12B 2J12B 3MC0A 4OJFH 5AYQA 1DUZA 1MAMH 2OCJA 1P4UA 1G9NC 2HN7B 3H4HA 3L13A 3TNMA 3SOTA 2D7OA 5CZVH 5F7YC 5CKAA 3GMLA 5T8IA 4R97B 1P0SE 4FDWA 1UOLA 1PYWB 1K4DA 2HWZL 2YC1B 3LVEA 4AL8C 3NJHA 4N2HA 4JDEA 4HXBH 2B9AA 4RAHA 5BRZE 1TQTA 3KW8A 1H6UA 3QDHA 4HK3J 4L1LA 3GBNH 5K5YA 5KYUA 2WSKA 3F05A 4DIXA 1AD9B 2QDVA 5F9AC 3B5GA 3L3JB 1MFBL 1KIUB 2NMSA 2V3FA 3D52A 1GGTA 4HSAC 5A43C 3V4PH 4H8WL 4JPWH 4PUBH 1NOFA 1YEJL 2CJ3A 4LVNB 5C8JB 5I1IL 1J9TA 1UC6A 4RA0C 4FKEA 1KULA 1AGDB 2YQBA 4J2XA 4NKIL 4MAUH 4YIQB 2OZ4A 2V2WA 4MNHA 4YL4A 1OE1A 1V10A 4KX8A 5EC1A 4JBSA 2H6PB 3NRQA 3U9UB 2Y7QA 5JPNC 5DVOA 4GSQA 3TONA 3B9EA 3U0PA 4CNIA 1MCIA 5JIIA 3L4CA 5F7EL 4H2CA 2VISB 4JFEA 4EUPA 1HSBB 5C3TA 3WKNA 3C5XA 4JKWA 1NFDE 4Y4FA 4DQOL 1I8LC 5H35B 2JCWA 3AY2A 3ARGC 1OPOA 3HHSA 1QUNA 5GGTA 4PJHA 3K6NA 2K7QA 4LLAA 5DU7A 4Y7MA 3CFCL 3FU9A 4FJZA 1QYGH 3HZVB 4Q74A 1FIGL 3KVQA 3S37X 2DMGA 1AKJD 1CF1A 1IBHA 3ARGB 4YHOH 1HCVA 5AZ2H 3VJ6B 4F7EA 5JNYA 1E8ZA 4UTBA 1M7IB 1Z7JA 1WVZA 3MV7D 4YFLF 1H15A 2AQ3A 4RMUA 4ZAKA 3RPKA 2JTYA 3DMMC 2CIKB 2X9XA 3X12A 5I1CL 3T3MF 4LDEB 3CFBA 1BMWA 1TTBA 4IDLA 5AKSA 4JMNA 3KXFA 3CPLA 3SYQA 5C6WH 2DEXX 3WKPA 3VXNB 2VABA 4LFHD 5K39A 2HFTA 5MI0C 2G0LA 1SPDA 3SE4C 2ADFH 3C6LC 4JO4H 4DKDC 1IKNA 4LOFA 1DVFD 4J8RB 3U1SH 2HTKC 1MPAL 2BNQE 5CR1A 3DDFA 1TCRA 4PJXB 4U3CA 3IGFA 1A8JH 3E7JA 2VDPB 2Q3XA 3VGBA 2E7DA 3V95A 1AGCA 4Z3HA 2DYSB 3NZHH 2G5UA 3S35X 4FQHA 3CVCA 2O72A 3ASOB 4FXKC 1J05A 2IXQA 2Q20A 3E2HC 4WWKA 5D7SL 4D3CH 1Y0LB 3MV7B 1JNLL 5E1AA 3D69B 4KUCF 1X5ZA 1OGAB 2QMJA 3LQMA 4I18C 4JDVB 4WKZA 1JWUA 1OAQH 4CC4A 3VD3A 1YEDA 3VFNA 1MLCB 2ICWJ 2KLRA 4FQ2L 2VLJA 4CKQA 2NR6A 1YJDL 2F54B 2X89A 3VFTB 1NICA 1RZKL 4HIXH 3I9IA 4RRPA 2EABA 3BDYL 4FC3E 1T6VN 2UWEE 3EH4B 1QSZA 2Z4QB 4K07A 3QFJE 4NZTL 4PS3A 3HUJE 1SXZA 3KM2A 3IU4H 1ZE3C 2ADFL 1DQDL 3PNWB 5BQDA 3MUGA 1NBZB 2NY0B 1Z9OA 2BY1A 2YPLE 1MFEL 1QO3B 2GJ6A 2DM3A 2YD3A 4EIUA 2WZ0A 1L9OA 1J9RA 2O30A 3QDAA 1OP9A 2ZG1A 3QZLA 4LKXB 4M1CD 3FN9A 1BZEA 2ZAHA 1TFHA 3LAFA 1KCVH 5B39G 5B3NA 4Q6KA 5JOFB 2NSXA 4PRHA 3OXSA 2DIJA 4KTDL 1I7TB 4M93C 1J1XH 2EE0A 1CFQB 1V8HA 4XP4L 4ZW8A 4IBYA 2WB7A 1CXEA 5EF0A 4GQRA 1H0DB 2UY7A 4E9SA 2F15A 1M3JA 1F4YL 3N1MC 3L4XA 2VSKB 2P44B 1OTSC 3VYNA 1GC1L 4Z3GA 1E9PA 1G9HA 1KGCD 4XAWH 2A6IA 1FVEA 2OL3H 3K2MC 4CSSA 5AW5B 3CLEL 25C8L 3O0LA 5LBSA 3VMOA 4F24A 3LEXA 2AJUL 1MWAH 4POYA 5FO8A 3ATAA 3F7VA 2UZIL 2B59B 2PPFA 3FTSA 3QI9B 5BRZB 3DBXA 1TSRA 3ETBJ 3BZDA 2PPCA 2VAAB 2ZOLB 5FFLA 3SDCB 5C8JA 1AQKL 4AOFA 3FRUA 1JHKL 2AZAA 1WISA 4FNTA 2IPKA 1HWWA 5INDB 1FNGB 2YD9A 3J7HA 4LLVA 2MCAA 1FA4A 3W57A 1CGWA 1BIIA 2B3IA 3L8QA 3WFCH 4AYFB 5KYYA 3T0EE 4F9PC 1HSAA 2NY1C 3D85B 4OIAA 1EEZB 1Y6KR 3OPZH 4YXHH 3RZCA 1PF3A 1OSEA 1JUFB 2WVSA 2IGLA 5DDHB 2Z8SA 4G80B 1YEJH 1I7TA 3AUVA 1XCQA 4GKSA 4K94L 2X70A 2NYYC 4GT0A 3PDOB 5ESQA 3MLUH 4P2RB 1YMMD 2VM4A 1QHQA 2JELL 4RGND 5DJ6A 1HOEA 2BPBA 4NI3A 5CUSH 5DUML 4GQ9H 3EJQA 4XMTA 3KH4A 4NUGH 1OGSA 5HGHA 2WXPA 5ICYB 4MAYB 1WFIA 5JPNB 1AO7D 2CSPA 4PRNA 2B1AH 1QBAA 3FJTA 5BV7L 1EHLL 4F15B 1KLFB 2E8ZA 4Q2ZB 2FAUA 1EGJH 3ZTDC 4UQCA 1CIDA 2BX5A 5DXWA 1JZ4A 3TEWA 5FA3A 5I73B 1DVFC 3OMZA 1IUZA 3FT0A 1C12A 1ETZB 3K2UL 3X14A 5F7MC 4RMVA 1HEZA 1UJ3A 2YBRB 3UOAB 4JM2A 4WF7A 1IKOP 3WHE0 1FYHB 1U3ZA 2A4CA 2AHIA 2EYRB 2X44D 1CFNB 1XMWA 3KYAA 4JKLA 4NXKA 4Z23A 3DYPA 3NCYP 1C5DA 2P8PB 1J0IA 5IVOA 4HBCL 3W0WE 3HC4L 1ZT7B 1MFCH 3KPLA 4DCQB 3BSZH 4NJ9H 4F3FB 1A6VH 1MG3C 4KK8C 2EJ1A 2WAHA 3ZZQA 4S0HA 4HKJB 1NH6A 1KACB 3UAEA 1BAFH 5AWNH 1SUHA 5L2JA 1A6UH 3N5AA 3NG5A 3VFWB 2YRPA 3DJ9A 2WXGA 2ZCLH 3QEGH 1C7TA 2J3SA 2DLHA 4GMSL 1SY6H 1Q72H 2NTSP 3PGFH 4GAJL 4N0CC 3ZZSA 1MWOA 4O02L 3KGUA 3WMQA 3KCWA 2AI0L 3T2PA 3P3SA 4QXUH 5DWUL 2GJZA 1K9TA 3X11B 2VDKH 3MO1B 4YHPB 2YS4A 4EN3D 2VC2H 3ILPA 4N8CH 5M7QA 4HS6A 2HH0L 2OA9A 4WK0B 4D9LL 4XPGH 5C09E 3TO2A 3V5KB 1TJIL 3LN5B 4I48B 1SYSA 3L17A 3CFNA 1PZCA 3SPJA 4J1UA 4ZS6C 4CN1A 1IEAA 2J1KA 1TVBA 2YK1H 5GZNA 1JXFA 3I02B 3ZYJA 1K4CB 5AFAA 3SYCA 4DUWA 3N2JA 1U3HA 1BOYA 1I75A 4PJHF 5KS9E 1TJGL 1W72A 3D39E 2OK0H 3W81A 5BV7B 4LCWB 4ILDA 4KX7A 5IMMB 3B56A 1I7ZB 2XPGB 5GSVB 4WK4B 5E8NA 5L2KD 4G6FD 1CDIA 1BZOA 1WWCA 4TUOB 3WEBA 5IF0A 3RLSA 3W37A 4QHMB 2JKXA 5DURD 5ADOL 1XT5A 1QW9A 4PJBE 1MQKH 2CALA 3JV5A 3QEQD 5FYLE 4XE0A 4WCYH 4QHUB 2BCKB 2GFBB 4HWUA 1C8PA 4WI8A 4RAUA 1UD3A 3Q6GH 1JCVA 2XBTA 1TDQA 3C9NA 1EXUA 3IDNB 4FL4B 2X4PB 3R18A 3LNFA 4G6JL 4F7PB 1KPUA 1GL4B 3QUMB 2JKJA 1KEGH 1GSMA 3PABA 1OD9A 3AAZB 1RUKH 1MCOH 2BHZA 3OJMB 4DP6X 4NSKB 4F7MB 3DRQB 4OIIH 4R8WH 3PHQB 3CZFB 1TJHH 4LVHB 1S9VA 4NZDA 2GIMA 2E59A 1KCLA 3J27A 1AKJB 1Q0YL 1WH0A 4NPYA 4U6YB 2FX9L 1I9IL 1JPST 3KBHE 1WZKA 4PRPA 3ESPA 2JIXB 1NCDL 2DYPB 3LRKA 5J7CC 5J13B 5C0CB 1F58H 2QSTA 5D7LB 3TNNB 3ILQD 2X4RB 4EZJA 3G6AA 1OHZA 3CH1A 3RKDC 4OZHF 3QFDB 1Z5HA 2HT4C 1MFVA 4AJVA 4XVTL 3TBYA 4KK5C 2ZD0A 3E8VA 4YXLH 2IH9A 3QJUB 1I1CA 2D8KA 1FL5A 4N26A 2FB4L 5I9QB 5K9KB 4IGBC 2ARJB 2BSDA 4A7VA 5D2LB 3N42B 4LSPL 1GJWA 3ZKQD 1LEGB 1ND0B 3EOBB 1GH7A 1IEBA 3GI9H 4A04A 1K85A 2AP2A 4UOQA 4AV5A 2VL4A 4FFVC 4DO6A 1DJIA 2YMTA 3FOMA 2EYSA 4GY4A 4NZJA 3T3PF 4P9MH 2WO2B 5GGQH 3ULVC 3US0A 1U3JA 4ZOEA 1CFTA 1OVZA 2QV2A 4NAMA 4XXCA 3VB8A 1IBGH 4XGZB 3SOBH 5JOPE 3GIVA 4PWGA 3VFOB 3CSFA 3GT6A 5LBVA 4G43A 2XTJB 3WMSA 4YBHA 4U6XA 2A73A 1U8IB 1BYPA 4KVNH 3O6FB 2X87A 1ZMYA 2DQIH 2OX5A 4TQIA 1A7RH 2DQGH 2VE6A 4TTGA 5F9WC 3L3OC 4EMZA 3PQYB 2FQGA 3HE7A 4BXSV 4B7LA 2X6UA 3MACL 1KB5L 1H6TA 3QDJA 4PB9H 3GSOA 4M7ZB 2Y6SC 5F8RC 3QWNA 4RIRA 5EZIH 3UP6A 4X6DA 2CM6A 4PJEA 2E47A 4F93B 2Z34A 4Z3TA 1KBGL 2ADJA 1AZVA 5D93C 2WBJA 4BFIB 4HUKB 4ZFQA 2KT6A 3EH2A 4TUJA 2FEJA 3QEQB 1DBMH 2WLJA 3FW6A 2K70A 3EJJX 2BY2A 1AHWC 3PRZA 4LK4A 4U1HB 2J8UF 2GKIA 1J5OH 3MUUA 1MCPL 4PJAA 4W6YB 4TTDC 3UADA 4K7PX 4TUUA 3RI5F 4EOWH 4H8VA 4TVSa 5AOZA 4BSVB 1SXSA 3KZ8A 1C5CH 1RULH 1WCQA 2HT3C 3NZ8B 3O4OC 2IADB 1B4TA 3OHMB 2C9VA 2CHWA 5DHYA 4N6RA 1M7DB 2KMWA 4ZMXA 1QEWA 2VN7A 4RMBA 3DHJA 4R2GD 3WOVA 4WJKB 3ZHKA 4R84A 5DJCB 1FF5A 4Y5YA 2PTUA 2X38A 4P3CL 4XX1E 1C5BL 5JDSA 5BVPH 4NQQA 4XP9L 1PU0A 4PJ8A 2B9BA 1KN2H 4HOWA 1X5IA 5HDQH 3A6CL 2CCLA 4FXKA 2GIXA 1MI5B 2LGNA 2RTTA 1TNMA 3DPBB 3N0AA 3NABL 1DBBL 2VDRL 1LE9A 2D2CC 4GXUN 3C8DA 4OFPA 4V1DD 4M5ZH 4XODA 2R83A 3F58L 2WLZA 1LEKA 4D0BA 1NLBL 3CFTA 3D1MC 4TQEH 4Q9BA 2XA8H 4ODHH 3REWB 1N7ML 3FB6B 3RUGA 4KZDH 1GYAA 1USZA 3ESVF 3RWFA 4I5BB 4FG6D 5FUOH 4PWEA 1WHOA 1IFHL 5TE7L 5IHUL 4UT6A 3TH2T 3WNOA 3VFPA 1C1EL 2BXZA 1ZSHA 1T5XB 3D33A 3BIBX 3LH2L 2NY1B 3RTQA 3T2QA 3VGAB 1AO7B 4TSCH 3RWGB 5LBSL 4MAYA 1KLGB 3UTTA 1O9ZA 4UAOB 5AVVB 3UXFA 2BSEA 2YSSB 4LU5L 5ISZE 2FHFA 1ZHNB 1HTYA 1A22B 4ICXA 3BLKA 3DX0A 3N04A 1CXLA 3OC5A 3Q3GA 3ZBMA 1MFAL 5CINH 1VJSA 4N9OB 2Z7ZA 5K9OA 2UWEB 3DPBA 3R1GL 1KPVA 1Q38A 5CCHE 4QTIH 4LSQH 2OR8A 2X89D 3H2WA 2NX5A 3O6LL 3L7FB 4JO3H 5C2BL 1PQZB 4OLXH 3HA0A 1U8KB 2IAMA 5K93A 1CFBA 2EDTA 4MXVE 1ODUA 2A6DB 3DMMA 3V4UL 3O6MH 3S48A 1XH1A 2R27A 2Z31C 4ANKA 2OTPA 3BD5A 2BSSA 1RSFA 4ZUWA 3UERA 5DD3H 2WQXA 1JGIA 5KVDL 1ICTA 4X6CB 5T1JA 2WO3B 3UYPB 2WQRA 3WJJA 3CVHL 1MVFA 2C9RA 5B7EA 3QXAB 2EKJA 5LCVL 1A4AA 2XWBA 4PRHD 5EO1B 2JCCF 3IM1A 5LXVA 2EIJB 4IRSC 5TDNB 1KG0A 4UB0H 1J12A 4AXWB 4PAZA 3ALPA 4OZIA 3Q1SL 3RU8H 3ULVF 1OOAA 1YYLL 1U8CB 5CEZL 5E9DA 1R34A 2XLLA 5CEXA 1HL4A 2XWJA 1G43A 3H9ZA 3TGXA 5I5RA 4JG9A 4RAVB 5CWSA 3VM5A 2OMXB 3B9AA 3GJEA 2OQJB 4U33A 3VWJB 1OPGL 2Z0UA 3P4MA 1QRNA 4FFWD 4GRMB 1VFAB 2XRAH 2J8UE 3M1BB 3BUQA 4ALAC 2WIMA 3CJJA 4MDIB 3IPBA 3F7QA 4IOIA 2OX5B 3FTWA 4Q6IC 3J2PA 3AG4B 4OLUL 5A2CA 2Y5EA 3F85A 1IIIA 4BEIA 3SJVE 3N55A 3FQYA 4BDVB 5H2BB 2EKSA 1RIUH 3LPOA 2RALA 2XI9A 1M2VA 1Q9KA 1RUQH 3ZDXB 3TZVA 1SY6A 5DO2C 4WU7B 2Z9TA 2V5YA 3FU7A 1I8MB 5TDOB 1MCWW 2WVTA 3CK0H 2A9NL 3IAQA 1O7DE 1IM9B 1SNRA 1KBVA 4ZTOH 5FK9B 3VNYA 2EXYD 2O5ZL 2VDRH 5C0AA 4EEEA 2N0KA 3OKEB 1UWGL 4H1LB 5JMRA 5D1QE 2YR3A 3FQXA 5KYWA 4BWUA 5ANME 3ZDXE 5CBEB 1EHXA 2CPUA 3CXDH 3NCCB 1WGOA 2OJEA 2ED8A 3G6DH 3SGJA 4WV1B 1YC8A 4YBQC 1FE8L 5CN3A 1HL5A 4BRVA 2M83A 4X6DB 4EVNA 3B1UA 4R3SB 4TLUA 3GBML 35C8H 4X8JB 2GBTA 3D0AA 2OZ4L 1U2CA 3GDBA 4QT5B 1AQMA 1FI8C 1PZ2A 1KCWA 4IDJL 5DRZA 5DJAB 4AQ8C 1JPFA 4OCSL 5F0PB 1TR7A 4G9FA 1E4XL 2H6OA 5C86A 1NMCC 2NY7H 1L6PA 4TRPH 3S3JA 4H26B 1UVQB 4OF5A 5FHAH 2R8SH 1VEMA 2WCPA 2N4IA 1XVSA 1TTUA 2IGFH 4YH6A 5DQ9B 2R29A 5J3HD 5C0GB 3G5VA 1WT5A 5IG7B 4KY1L 3GSNL 4U3SA 4PRIE 1K8DA 3IETB 3Q2WA 5LQBH 1MLCA 3BH4A 2H8PA 3OHXA 5KSVB 4PBWD 3FCUB 1T03H 3VM7A 4KTGA 1AXIB 3U30B 2Y2WA 1A3RL 1N3NB 2BW4A 3MGOA 4FZEH 5D1ZC 3LDBC 4FLSA 4UT7H 3GBLA 4KKPA 5E6IB 1ES0A 5CJQL 1R0AL 3QWRA 2X6CA 4JHUA 1AGCB 4RISH 4OFYA 2X2HA 4U1KB 2ZIDA 3IRCA 4JPVL 4DZBA 2E6PA 2K7PA 2AVGA 1T21B 3M6DA 4GINA 5F6IB 3FCBA 4F91B 4DGYH 2DI9A 3T0ED 3FUIA 4IOIB 3ETBF 4QY8B 4PCYA 4RZCA 3H55A 1E4XH 2D7TL 2VM9A 1UT2A 4AMKL 4KITB 4JN1H 3NT0A 1YDPA 4LRIA 3NBNA 1VZHA 3VG9B 3Q3GB 1IGYA 1U9KA 3D08A 3F7YB 4HD5A 5BZXA 3ZDYE 1RUMH 4H40A 4IJ3B 3GBMH 4LSPH 4NENB 3K71B 4IU3B 5I76B 5HDWA 1HFUA 4IBZA 5JLZB 2ZSWB 3K7UA 1W2KT 2R29H 2FB4H 5FM4A 5J6GB 2Z35B 3IDJB 4Y4KD 1DJGA 5CSGA 4N0UB 1S2EA 3M1BA 3ZT6A 5ACZB 4BUHA 3FL7A 4JFOB 4HS6B 2J88H 3KBPA 5K9JH 4PJEE 2Y0SA 2EZ0C 2G3XA 1RJYA 1S9KC 4HOZA 4OD1H 3F5WA 2OZNA 1ONQA 1WF5A 1FVDA 1HESA 1Z9LA 4W9FC 4YR6A 2AXJA 2XWJB 4ZDHB 5DFAA 1QFUH 2Z64C 3ROOB 3MRHB 1Z3RA 5KVDE 5IUSA 3MZTA 1EQWA 3N1QC 4XZUB 3BD4A 2A4ZA 1WEJL 1CD9B 1I9IH 2AJVL 3VRJB 5L9DL 1VAHA 2I27N 4H4NA 4MA1B 4JZNA 4XNBA 4I77L 1TU2B 5GRYA 1KG0B 3PWPD 1X5AA 2PNDA 4YHZL 4XC1H 2ICWA 1RJZA 4AQOA 5C0AB 5BOPA 3FN3A 1GGIL 3DGGB 3ETSA 1AGFA 2KS0A 3RJOA 3BGFB 4XOEA 2DQUH 1JPEA 3KWVA 3SEPA 2PCFB 1D5ZA 4HH9A 5DJCA 4APQD 5EF1A 4ZMTA 2XVGA 4P4KC 4XCYB 1LEIB 4K3DL 4E5XB 1MCCA 2P24A 4YSOA 1AZUA 1UCBH 1VACB 2J43A 2Q8BL 1OARL 4QLWA 3TFBA 2FBOJ 3X1EA 1FYTD 3PF2A 2UVFA 5IFHH 2WWKO 2X88A 1CS6A 1P1ZB 3EFFA 2K45A 3EOTH 5D96C 4KI5F 3UTTB 1P9MA 3POHA 5EA0L 5AAMA 3CFEA 3LRMA 3ARSA 4QUOA 5LNEA 4FXGA 4QJ4B 2GT9A 4WFFD 5EA0H 3PL6C 3HI1A 1BBJA 3I6LE 3WENA 1DJSA 3DSNB 3BE1L 5BZWB 3SHSA 1CE1L 5F1NA 1JZEA 1L9MA 3CX5K 4XNQB 2ICWI 1I1FA 5EU5A 5ESQB 3U46B 4BKLB 2ZOUA 1OARH 3H42L 3L3IB 4QRTA 3V0IA 1S7TB 4G7YH 4UF7C 4JJ5A 1ITCA 1KTLB 1ED3B 1ONQB 4GG8B 4JFPA 4NQEB 3V0EA 3L48A 1HC1A 4PJ9A 3VD2A 3FFCE 2D7QA 5D8JL 3Q5YA 1BIHA 1K5WA 2HRPL 4Z7UB 4D9RD 2DWEA 1MHCA 4ODWA 1KT2A 1XF4A 3EYSL 4H5SA 1TJIH 3REWA 1X5FA 3B9KA 3GKWL 1WFNA 1UZ8A 1TTRA 3KS0J 4HPOH 4JGUA 1A0QL 4OLXL 5KVEH 3OB0K 4B9GA 2EVGA 4DGVL 5C2BH 3BT2L 4GW5A 4M7LL 2ITDB 3DROA 4QXUL 5C2UB 2ZWSA 3VXUB 3TBSB 1D2OA 3PY9A 1C9SA 2BW5A 4Q9QL 1KTDA 4YWGL 4G8GE 4M8UA 2TRHA 3O4LB 4W81A 1NDMA 2FIKB 1JFQL 4Z77B 2EDOA 4LEXH 2ICES 3RB5A 3RFZB 4OH2A 3WY3A 1EMTH 3IN0A 4NRYA 4F7KA 5JUEH 2F7PA 3QFGA 1IILE 3LQAC 4PRHB 4MNGE 3QXDA 3FONB 3BO8B 3L6FA 1PFOA 4GI6A 1U2YA 4JFED 4A39A 4OJCA 4LCWD 3N0PB 3QGVA 2JE8A 4BFFA 1KIPA 1UGKA 4LRNH 5CLZA 4KKLC 4X4YB 3F6IA 3STLB 2JJWA 1JMXA 3K2UH 5I2IB 1HZLA 1U92B 2XKNB 4MD0A 1AIFA 3OWEA 3P4LA 2K9FB 3V7AG 1NBZA 2VDML 1TQBB 1U8QB 4XVOA 2J8HA 5HBBA 4G80A 5BXFB 5E9DE 3LRSA 4XPBH 2JH2A 1T6BX 2YGNA 1EGJL 1F8TL 4WW2C 3FOLB 3GXTA 4MMYA 3CFKA 2EICA 1F3JB 4H13C 5AALA 4P23D 4KTEL 4DVBA 5DD6A 5LGYA 4OTXL 2OMWB 1FNGA 1A2YB 1X5MA 2F54D 4J3WA 4UT7L 4XZ4A 4P07A 3KCPB 2BIMA 1MIEH 5IV2A 3JWNH 2J8UA 3V4PB 4NQCD 2NZIA 3H8NA 1KFAH 2ADYA 3S3DB 1OGAA 3GMMB 4TF4A 3T0EC 2O61A 3DUHA 3RVXC 4U4BA 2P5WA 1EVTC 1YNKL 3WEXA 3HKFA 4PVNA 4Y5XB 1TOXA 4ELKB 3VXRA 1IGML 1F4WH 1A14H 5CZRA 1XB3A 4I8DA 2NR6C 2BDNL 4QXVA 3IJ9A 3MRGB 2R69L 4GBXB 3A22A 3WV0A 4HIJA 1JNNH 5HYQA 2YXWA 4M6AA 2IPTH 1CVSC 5KVEE 3RTQD 3HG4A 1JZ2A 1WA1X 3HS0A 4N8VB 2XPZA 4FTDA 4IDJH 4UTBL 3UFIA 4QKTA 4OZFG 4YX2L 1RU9H 3CMOH 5C0AE 3OR6B 1CLOH 1NMAL 4OIFA 2QVFB 2PWGA 3LZQA 2N56A 1A2YA 2NR6D 4BA0A 1R24A 4Y8DC 2M8XA 2P3YA 3G6DL 3OLIA 4LSVH 2C1PB 4N2LA 4PG9B 2YEQA 3MFGB 3DO7B 4LF3B 4RMQA 3VFVA 1YZZA 2FWOB 3HJEA 4HWNA 1S9VB 3SO3C 2CJUH 1T1WB 1SM3H 3SBWC 4ELME 1EAOA 2KZWA 4M56A 1N6UA 1FO0H 4NUMA 4OIBA 1XF3A 1NWPA 2VDRB 5BPPA 1YEDB 4HEME 3ARZA 4G9FE 4AENB 1IBGL 3E6HB 3W5MA 3BO8A 4U0RB 3WFHA 2BSTA 3FF7A 4YDKL 1UB6B 3DOHA 4AYBA 1CVRA 4OD2B 3FYEB 2Y2YA 4OF6A 4ZTEA 1IBZA 4XVUC 4L4TE 4R90L 2IVFC 1RIUL 3IWUA 3VMPA 3MCLL 5JO5A 3RKPA 4UIMA 3T5WA 5IQ7H 2XV3A 1JXJA 2WGNB 4Y2DB 1S7RB 1SVBA 2D73A 2GK0B 2J1WA 4NZRL 3WN6A 1J0HA 1A3ZA 5GSVA 2ITDA 3OKKA 3HNVH 3O0RH 4L1HA 2JQMA 1HCFX 3S35L 1R4XA 2B4CL 2X1OA 3ABZA 3D3VE 3II1A 2X9YA 1DO5A 1JRHH 3TA3D 2ZP9A 2ICEC 2VITB 4LVOC 4PWJA 4IKIA 1I3RB 3UPRB 1F3DJ 4HUUA 1NCDH 3FMGL 4JDEB 2Z31D 4UYQA 5CIPH 5HYSG 1AACA 2BP5M 4TSAH 1WAPA 4PPTA 1A7PL 3FBKA 1A4KB 2CG9X 4MCZA 4OCMC 3U1SL 2B1HH 3MLPA 4EI5C 3L5WB 3ELQA 1NDTA 4X2UA 1EEUA 2D4FA 3V6BR 5JW4M 4HS8H 4IKNA 4XN5A 1BGXL 4HD9A 1MFDL 4WVRA 4OD3L 1N0XH 5DD3L 3AC0A 3HN5A 2CKBA 3JTBA 4UNTA 4CUCA 3HN8A 4M62H 1N8ZA 2D9CA 5JW4Q 3OKNB 4ZFOA 1IZKA 3F64A 2P4AB 5CJ8A 1F1DA 1MNNA 5ID0A 1MH5A 3TX4A 2QLYA 2GAZA 3IE9A 4WNSA 3KPTA 1VFUA 2XZCH 3IXTA 3N85L 5E2JA 4Y19A 1ACCA 4YHOL 5L0QB 1ZSDA 3T09A 1U3NA 1PZ5B 3PABB 4JG1L 5DHMC 4F27A 3IDGA 1XGYL 2W80C 4LEOA 3U7AA 4LSQL 2VLKD 4ENED 15C8H 4M6OH 4TSBL 4GKNB 1RQ5A 2DQHH 2OW6A 3PGDA 5ANHA 1MFAH 3ABLB 5CINL 5DLML 4FCHA 3Q7JA 3F3HA 4BZ1L 3SDAA 3N1GC 3RIFK 4LHUA 1P5UB 1TJGH 1JI1A 2Y3AA 1KTKE 1S5IL 1MI5D 4OQTA 4BHUI 5JIQA 5JQIB 3TLRA 3KPQA 2LVEA 1MW3A 1CBJA 2GB2A 5EIQA 3RNQB 1NCAL 1SDAB 2ZUUA 3PHOB 1NGZA 4O2EA 4H0GA 1FYTB 3GMQB 4UI2A 3EYVB 3IB4A 3TA3B 3ZMNA 1ZT4B 5AW6B 5IEHB 3Q13A 5E5LA 4UV7H 4LSUL 1EHKB 4U1MA 1C12B 2I7SA 4MJ6B 5LGJB 1ZS8A 4JRYA 1JWMB 2CIIB 1R3LA 5DVLA 4D9LH 4ZK8A 2C5DC 5B1JA 4S1SL 3DXAE 1PKQB 3L3OA 4N8CL 4ZMPA 5C1MB 2H32H 1NINA 4Y89A 5M94B 3ZE0F 2W0KA 3SDXF 5J57B 4P5SA 4M5ZL 2OTUA 4N1EA 4QLRA 4JCMA 3W9EB 1R3IH 4HSQA 5HGDB 3N40P 5AW7B 3E3QE 3V6OE 1MW1A 1MRFH 1Q72L 3PGFL 4Y4KB 3U2SA 4P2OD 5KG9A 5D2LE 5EOCJ 3BFOA 5AWNL 3LPWA 3GSUB 3RZWA 1TQBC 1LK2A 1G9MH 4BZ2L 3FQNB 1WIOA 3D9AL 4NNPL 1MFCL 1FDLL 4P9HH 4HBCH 3LKOB 4CA4A 2GK0A 3R8QA 2PR9A 4QY8A 3T71A 1C5CL 1RULL 2WWNA 4HJTA 5C0BA 4ES8A 4AITA 2ALWA 1HT6A 1ESOA 1U2HA 4R96A 4N0UE 3QPQC 3GSOB 3RNKB 2W92A 5FYKE 1G7IA 4YSTA 3DUUA 1G6RB 2DJMA 2AK4E 2R0WH 4PR5B 4E9TA 4K5PA 3BOVA 1QD0A 4YDIH 4Y1TA 3AWGA 4MMZB 5D5MA 2PCPA 2X28A 1VENA 3VXME 2ZNXA 1I9JL 2B77A 1LMIA 1REIA 4EDXA 1IAKA 3TS8A 1H9DA 3FRPA 1ZLDA 2BO0A 2D7MA 3P40A 1GOHA 4MHHI 3RX5A 4HWZA 1NMAH 4AUJA 4NZUL 2B59A 4MNQE 3VRLE 5H94A 1N68A 3LHPH 4DVRH 1JNHA 1KPRB 1UM5L 4GSDL 3W3BA 3FQRB 2ADGB 3P73B 1GYWA 4ZMAT 2BP0B 1TZGL 5I1KH 2DTML 4G7VL 5AZEH 4X5XA 3ARPA 1I4FA 1AR2A 1SOKA 5IMKA 4E9LA 2DIEA 4MNGA 1P2CB 4C47A 1A7OH 1DUYA 5DK2A 1NFDB 4IGBD 5DJAA 1JPFB 2X0WA 4U1JB 5HHVL 3W9EA 3RIFF 4S2SB 4WAFA 2Y23A 4GXUM 4E42B 5TD4A 2G60L 2XTJD 1QTSA 4JPKL 1MI5E 4JPIA 2IPUG 1WS8A 5F7UA 1PJWA 3BC9A 5FDWB 3WN5C 4APQA 3GZOA 3GRWL 2MPAL 4G8AC 2DDQL 2GEQA 3UZVA 2WLMA 1KCUH 1LHZA 3ZTEA 3QP3A 1RIVH 4JFXB 4F37K 2NYZA 2XN9E 3QIUB 3V6FB 3E8UL 5E1AB 4DEUA 3S5LB 1H3XA 2UZPA 2XG5A 2WWOA 5EU4B 5LXGL 2NY4D 2RACA 4PJ5A 3MV8E 5BVJB 4NZFA 1KWKA 4Y5XA 4XVTH 1AZZC 3QXWA 5D1XC 1ULVA 5I1GL 1NBVH 1TJMA 4KJPC 3MNZB 4QWWC 1G94A 1NCAH 3B5TA 4NWUH 4EDXB 5D4QA 5FKPB 4KOCA 1FVCA 4W9EC 2DQTH 3LOWA 1FVEB 4JDZA 5ESVB 3VFMB 2EIMB 4K8RC 3MOAL 5T1DL 1HK6A 4NFDA 1D5RA 4G42A 3UJTL 2ZWLT 5H2BA 4JFXA 4QCIB 3DV6A 2OL3A 4JDTH 2YGPA 2P8LB 1AG0A 2ZG3A 4JRXE 2B20A 5KSBF 4RMRA 1PIFA 4AGNA 5AKRA 1HNFA 1ZVSA 4AL8H 3HBZA 1HEHC 1LQSR 3OXSB 3FO0H 4Q4EA 3VGHA 3ZR6A 4E41B 1VFMA 4UQAA 3CVIH 4IBVA 5DTFA 4BUQA 4B96A 1LK3L 2WM0A 3QJXA 3VDAA 5IMMA 4JG1H 3JT0A 3VXOB 1K2DA 3U4BL 4WTWA 4A2LA 1IAIM 1OF2A 5FB8A 4FQXD 5LNGA 1T83A 4F8LA 1M4KA 2XY2A 3BEVA 3U0TA 4BWWA 5EUOF 5E0QA 1JF1B 2JIXD 3HVNA 4L0PB 3ARGA 3ISRA 4ELMA 5J8OA 3NZSA 4YSEA 1PX4A 3QQXA 5DC4B 1XGRA 2Z6FA 3NSJA 4G7YL 3QXAA 3QORD 3VWKC 3F65A 2AQPA 3CHOA 3MRCA 5IHZB 4XCNB 4KMTH 3N06B 4KRNA 1OB0A 2LV4A 4JG0H 1E27A 4BH8A 4OF3A 1HHGB 4HUWB 3OPUA 3R19A 4HWZB 3D69A 3HS9A 3TPKA 1WTGT 3CNKA 3VI3F 1U8MA 2NUPB 2BP8B 1MFMA 4JO4L 2NY1D 4HJ0C 5CZXC 3R8BB 1P5UA 4DPAX 4ZMOA 3U9UA 3DNKA 4DO5A 3EUDA 4LLQB 2MQ0A 2OSLA 4FQQB 2V33A 4PJXA 2MHAA 3HB3B 2VW6A 2YD1A 3LB6C 4PJ9B 5AB2A 1MJJA 2QJDA 1BBDL 3F6JA 3COOA 3D85D 1SFDA 2F1BA 3E1ZA 1IZJA 4LHUG 4J6IA 1CTNA 3D3VA 1UB6A 4V33A 1UUSA 2DLFH 4D7PA 1FO0A 3OKNA 2JI3A 4ZFOB 2VZVA 4HGMA 1F45A 3E80A 5IK3B 1ZHNA 2XQ0A 3S98A 3VE0B 1ZGLP 3P77A 2OMTA 5EBMA 3K80A 3CVIL 5JHDA 4I3RL 2DWSA 3MMEB 4JZJA 4EIBA 1J88A 4GMSH 1OAKL 5J6HB 4BYHA 3DOIA 3RGBA 5TPWH 2V9UA 3QQ3B 3W0WB 3C5JA 4OCWL 2HUHA 5GHWH 4PGEA 4RH4A 4F8QA 5DZJA 4LVNC 1X9UA 4LF3A 2Y1YA 2JB5H 3CIAA 4W9ZA 2Z8RA 1MCHA 1VB9A 4J3UA 4ZQKA 3D4GA 4DGIH 3MGAA 4AIXA 1LEIA 1SBSL 3O2VH 4ZPTB 3O4OB 1RZJH 1MCDA 2X2UA 3CE1A 4FGMA 3NEXA 1JZ3A 3FCGA 4BFEA 3QPKA 4OB5H 3FTXA 4N24A 2WLHA 2X53A 2PPDA 1KJVB 4KROB 3QORB 3TF7C 1T83C 4Y9GA 4C56E 3GTTA 2DBLL 3FQUA 5AW0B 3R0NA 5GGRA 5J9PB 1Z0NA 1X7QA 2Q86B 2DD8L 3CDCA 2HVJB 1JGEB 2XN9B 1X5LA 1TZ8A 2I9TA 3EDEA 1BLIA 2QKIA 1VEOA 1C08B 3HPJA 3J8F7 5E6ZA 2KZ1B 4K3HA 4G8EA 5F3BB 2LE9A 4XCFH 4AVKA 2CRIA 4WWKC 3BIKB 3PHAA 1A1OB 2G60H 4NO0D 1X4XA 3RVUD 3IXTB 4P2OC 5GS0D 4JPVH 1JP5A 3M1CA 3V4PA 3VXTB 4RISL 2FQEA 4PJFA 3Q2CA 1IGMH 3HRZB 4N3UA 4AYMC 1CDYA 3QCTH 1WUZA 4AEFA 2VTFA 1FNEA 2J5LB 2AXGB 1OHQA 3A24A 2GBVA 2J8OA 2YFOA 1VF5C 1IGYB 2DIBA 3F7YA 4H7VA 4PCSA 2KERA 4PGDB 1DLHA 3CBKB 1AMXA 3FXIC 3PCYA 4PJBB 4NIYE 5KBMA 3EBIA 4QRSA 5JQHC 3PV6B 4PJEB 4AGPA 5GGRY 1JNJA 4YPJA 3NRPA 4DOHE 4FI7A 4NM8H 1P4IL 2KQMA 1MAKA 1YPZE 1L6XA 4GRWH 1WBYA 4OZIF 2BNRE 2ZUXA 4CSZA 2FUTA 1CURA 4GUQA 3X1GA 3G3LA 1JG9A 3BW9A 4F9LC 2H3NB 3LS5H 2IH1A 3BWZA 4U1NB 3L08A 3RWIB 1ORSB 4ZFGL 1QASA 2X2JA 1IO4C 3CLEH 1GR7A 3QUXD 1MRCL 3L81A 1R33A 2EDMA 4X9YA 2OL3B 1UTDA 2HVBA 3FT9A 3T4YA 5FGCE 2J44A 4WK2B 2GC7C 1AZCA 2AV7B 5D7IB 5CJOL 5HDBF 2VWEE 3P73A 4XP4H 2LT9A 1FRGL 1KGYE 4XC3H 4YSRA 2G3MA 3MDJA 3ESMA 3IGAB 3AFLA 5IG7A 3JV4B 2ROYA 5FGBC 1SXAA 2A0LD 3GMMA 5HHME 4JM2F 3VXMA 3ZKMC 1QZ1A 5F70A 4HFWB 4JX0A 5I71B 3QNZB 2H9GB 3AU1B 3WXWL 4A2DA 4XRCA 3VGFA 1BQKA 1OCZB 2EINB 3HG2A 2IH1B 1PLBA 2BMKB 2BSTB 1QKZL 3IU4L 4MNQA 3VMNA 1J8HE 1R3IL 3FB5A 4XB7A 3QQ9D 3ULVL 4WW1B 4IEFA 4C83A 4PBDA 5GSRB 4DGVH 4XX5A 1XCTB 4J3OD 4R96B 3BWSA 1ZLUK 1CUOA 1ZPUA 3Q44A 1A8ZA 5LAPA 3UZVB 3DX8B 2W81C 5JOEA 3O2WL 4QF1A 5ITFA 1Z3GL 1D9KB 4OGXH 4WV1A 5ICXA 3EYSH 3VD7A 1RUQL 5CXPA 3SKNB 3EXLA 4JREC 4FQ2H 4FL4C 4R26H 3B8SA 4N4YB 3M8OH 3LXAA 3OAZH 4E0RB 1LP9F 4R2GC 5D7JB 4CU8A 4X80H 3QJFB 2MOGA 3G7TA 3OKEA 4PG9A 1G7HA 4PJ8C 1A9EB 1A5FH 2LU3A 5TH2B 5KYXA 3DTXA 4PRBB 4RQQA 3HFMH 3MV9B 2R0LL 3R06B 3G5YB 1X7SA 4NQCB 1GZHC 1GJIA 3EFFB 1CE1H 3NYKA 3QNFA 3T1FA 1N64L 1NIDA 3NJVA 2JXMA 2QEJA 4HMDA 5D2NE 4L8BA 3ARWA 3D2UD 1N6VA 4OLWL 3FU0A 1KB9J 4KNSA 2XN9A 1EK3A 1GGBH 2NXYC 3TIDB 4BQ6A 4IQHA 1ORQA 4KH2A 4N0FB 5F7AA 1RFDL 4K5MA 1R5WA 4HH9B 4HIPA 5DMYA 5IFHL 1HQ4A 3X17A 4L05A 4NQXA 3VI3A 2MTAA 3DSFL 1QBLH 2KBGA 3GZQA 3BQUA 1T1YA 1EHAA 3EZ8A 6FABL 1BF2A 3GXMA 3P1VA 4U1LB 4K7PH 3QDGA 2W91A 1QQDA 3GTVA 1CLVA 1NEPA 1DZBA 2NY2B 4W9CC 4S1QH 4ZXBC 3O41B 1TKWB 2YGQA 3KE0A 1G9MC 2WY3B 3SDDD 4ORZC 3SGEH 5I1HL 3H2QA 3RHWK 1LP9E 1SN0A 3G6JB 4JFDE 4HBQA 2XVBA 3MRHA 2YKLL 5D96B 4E41D 2ENYA 3FQNA 1E9QB 5DO2D 5ID1A 1ZHLB 5HYFA 1NUGA 1TETH 3OLDA 4PV8A 1U8LA 2DWTA 1MHPH 4I1RA 4DQOH 1BREA 3KLHD 4JO3L 1GRWA 3DVGB 3TZVC 1M2OA 3K2IA 4M9PA 1EHNA 1TZIA 3FT3A 4DHLA 1TYJA 2PO6B 3KYOA 2RCSH 3EJZD 3NPSC 3WE1A 2ADIA 4PJEF 2UYLB 1U92A 2L7UA 1AP2A 3L3DA 4L4TB 1NEZA 4TQHA 1CGUA 1ZJAA 5ABZA 4YHPA 1JPGB 3H7LA 4NKMB 5K9JL 4P5RA 2QR0A 1ZOXA 1H3VA 3IFPA 2JCCB 4I9XA 4QTFA 3HI1B 3MRKB 1PAMA 4PFEA 3VACA 3ULUF 1PIGA 2UUDK 2PYEA 4ZO9A 3A4AA 2A74C 1VA9A 4RFEB 2ZWYA 1AS7A 4ODSH 4U1MB 4J4PC 3GLEA 4ZX3A 1Z9NA 3JV6B 3VX1A 3UTPE 3RZCD 1WBXA 3FQTA 3NIDB 4NBXB 1D6EB 3PS6A 5D4IA 2LR4A 4R90H 4UDUA 3TEUA 2X6AA 2Z8VC 2DZEA 4V2CB 2BOBA 5F6HJ 2D7TH 1S7QA 5A2FA 5IROD 3ARBB 5JXED 4LIQH 1KYOK 3KH3A 2CDGB 1RZIA 4FXGC 2F7RA 1NCCH 3WNIA 3QQNA 4PGBB 1EEQA 1KLUA 1G84A 3NCJL 43CAA 1YMMA 2VDNB 4OF0A 2F1AA 5DZPA 3VH8A 1UJ3B 2YBRA 3BKJL 1UZ8B 3BRFA 2VUOA 2MOVA 1B3IA 4MQ7B 4UT9L 4F7CB 3OAYH 4D0DB 1AO7A 2VZ3A 3ARRA 5JW5A 1H3TA 5GRXG 4KJWD 2F6AA 3RBSA 3JTSB 1UEMA 2LQRA 1SHWA 2JFCA 3AADB 3PWUB 3WNMA 4LDOB 1EJFA 5HPMA 2Q0ZX 4C55A 3BVNA 3M17B 3E6FB 4H20L 3SO3B 2BVTA 5IIEB 5DJ8A 2Y3NA 3TBVA 1E7UA 3VFUA 1OLZA 3VI4B 3MMEA 3MXVL 5E5MB 1J11A 2HJLB 3LB6D 5ISZB 2D7PA 3DK2A 3KLQA 2APBA 3QG6A 1KYOJ 3AREC 1KZYA 2ILLA 3EJYC 2Y07L 4HGWA 3RY5A 1FFPB 1AD0B 1FZJB 3ARFC 3UJJH 5KJ7E 4PGCB 2OP4L 2VDMB 2V5MA 4X6EA 1IQDA 4TN9A 2ZUTA 1T20A 4OLYL 3O8XC 4ZUSA 2X3AA 4PS8A 1M71A 3TT3L 2CO1A 1A4KA 4MCZB 4KH9A 4WEBL 1IGFH 1E8XA 5SWZB 1XL6A 3UYRL 3BZ4A 3O3UN 2XTJE 1R24B 4B6ZA 5KW9H 2IPKB 4Z7QF 4P46C 4MJHA 3C87A 1TZHB 3W82A 3AB0C 2IDFA 5DZLA 1G7PA 2R1WB 1SJHA 1JYWA 2ZCZA 4BA8A 1L7TL 3MACH 2FNBA 3UZEC 1G0YR 4M29A 2XWZA 3VXPA 3CN0A 2OMNA 5FYLH 4UANA 2VN4A 3MGOB 5D1QC 5H37G 1RZPA 1HL9A 3T2NL 2XOTA 3KGTA 4YUEH 1EEYB 2Y24A 3SCMA 3U82B 1FV1A 4FQCH 2J4WH 4NYLA 5DJYA 1QR1B 1TMQA 1F8TH 3UTQB 1U30A 1OANA 2P26A 4DEPC 5JW4N 4HOXA 1SUJA 2AITA 5EUKA 3WNPA 5BO1H 3BGFC 3KG5A 1ECYA 4M1GH 2X09A 9PCYA 3UGXA 2AV1B 3ZE1E 2BVOB 3BGAA 3EJZC 43C9B 1I8AA 1DBAH 4J3VA 4PJ7A 3ULAB 5CEXB 1SMAA 2H2SD 4XNMA 2CU9A 2L3BA 5J6GA 5JORA 2JKRM 1HJBC 3EJTA 3NVQA 3C5ZB 2EE3A 5IQLA 1BJ1J 5E94A 1NLDH 4OLVL 5DC2A 3NA4A 3QH3A 1FV1B 2ENSA 4M93B 4WJG3 5BNXD 2X40A 4YFDB 3TA4D 2XC8A 1BQUA 1QZNA 4OQTH 4M48H 3RZCC 2WP3T 1JE6A 3C2SA 4W6WB 2FX9H 3KWWA 4WKZB 3BPLB 3LV3B 3MV8D 4R0LA 4HULB 3CZJA 3ECUA 2A9DA 1NBQA 1JK9B 3OLGA 2R15A 4XMZA 3TIEB 1WIPA 3POCA 1G7PB 4MNQB 3UYOD 5D7KD 5IFJA 1ES0B 1I53A 1UQSA 3QO0B 2NUTA 2YRLA 3NSDA 4U6HA 5ISZD 3PXJA 1YECH 1T22B 4IRJA 2WXLA 3O6KH 1AVAA 2EILB 2WZ6A 4HHAB 4WSJA 5ELIA 3V6FA 1RUKL 4G3YH 3IDIA 4MS8C 4L23A 2FEEI 4NHCL 4JFQA 5AL8A 3QXVA 3ETTA 1BW8A 4NQED 3GMRB 1HH6B 4TXVB 1OTTC 1TT6A 1JV5A 4MDJB 1O6SB 4MD5A 3GMNA 2QT6A 4LLYA 1OP5K 3V4UH 5E6SB 5FW8A 3ESNA 4DKFL 2YA2A 2JCCA 2O61B 4TNEA 3MSPA 5D1XB 3QH3B 3SD2A 1YEGL 1D7BA 4HT1L 2FZ3A 3GHBL 1F02I 4Y1SA 4A6YL 2E76C 2F74B 4P2QA 4X4KA 3PHSA 4YC2B 4IBTA 4I1PA 4UT6H 4X7CC 3X12B 2XUWA 4PLJD 1J7VR 3RDJA 3RJQB 1Q94B 1HIML 2J55A 1UWXH 3DYOA 4YQXL 4X4ME 4NQSA 4Z7NF 4ES9A 3B2XA 1M7UA 3Q6FA 2DJUA 3EJRA 4UILH 4DWHA 3C08L 5CIPA 3HZMA 4WY7L 5GGSA 4NN6C 2BNQD 1KGCE 1ZV5A 5I16A 1CE6A 1C1EH 2HPOA 3OZ9H 1UH4A 3BN9C 4MQ7A 3RILA 2D0GA 3LKPB 3MRJA 4FYQA 4F7CA 4XNAA 2JB6B 5DCCA 3F7RA 2C34A 4EUPB 4JM4H 2QADB 1Z5LB 1EFXB 4X5QA 4LOUD 3AS0A 1QSEE 2Z7UA 2AQNA 4JFTA 1CG9A 1OT1A 3K46A 4OZGE 3L7EB 4GBXC 4TQEL 2NY6C 3D0LB 4KHTH 3WSQL 5I8EB 1JYNA 1BAGA 1MFUA 1Q1JH 4MTMA 3QDJD 2PW1B 2A38A 4Z7VF 4IRZH 4LOEA 2MRYA 1ZJBA 1VACA 2WQSA 2GITB 1SY6L 1ZCRA 4MJIB 2P80A 4XOAA 3TBSA 2IQAA 2IADA 3H85A 4G5ZL 5FDYA 3T0EB 2X4UA 3UAAA 5FECB 4IBQA 4ABWA 4GP8B 5KYNA 4JVWA 3HCVA 1MJ7H 1WWWX 3PPEA 4JREB 4DETA 4FRWA 3BVDB 4NGHH 1IBFA 3HC4H 4U1HA 3RWGA 2NY6D 3WEAA 3FCSA 4CVZB 3DRTB 3SCMC 5BQ7A 3G5ZB 4H20H 3ZHDA 4HWEL 4QPEA 4ZUTB 3LEVL 2VR6A 5DYOA 1LP9A 2DMCA 2HN7A 1BJMA 3MUHL 4IU2A 5CWSB 4ZAKC 2CD0A 1I3GL 5FEBA 5IR1B 4LSRH 3ZE1F 4Q89A 3BZEB 3EADA 2NX5D 5ITFB 3MX0B 4UT9H 3SBWA 2WYZA 2RAMA 2W65A 2EDKA 3FSZA 1YA5A 1Z0MA 3BRDA 3NIFE 5EOQL 3K81A 4M03A 4ADJA 4LPWA 2UXVA 4PJ8D 1AHKA 1ZA6B 3OJDB 4LIQL 5J6HA 1D5MA 3MRPA 3W39B 3RWHB 1J1PH 5TQ0H 3KNBA 1FQ9C 1NOLA 1NGYA 2O26U 2H9GA 1A3RH 3VWJC 3SDYH 4GQ9L 2C4FT 4UM8A 2PYEE 4UQ3B 4G43B 1DDHB 3OAZK 3MREB 4K7FA 5LDSA 3EUUA 1FO0B 1N5YH 4ABUA 3LN9A 2VQ1B 3BN3B 5HHMB 3FS9A 4LBEB 2B15A 4RZCB 2Q2EB 1CZ8L 5IB4B 1LNUB 1XF2A 3CFUA 4YEEA 1D5ZB 2WQVA 2VO5A 3HAEB 3NFSH 4HV8A 5SX4H 4FN0A 4P46B 3VRIB 4PJAB 1HE8A 2CA3A 4AUUA 5C0IB 4PP2A 2XX0A 1Q9OB 4GJTB 2EH7L 2PYEB 1VZIA 3L4UA 4FFWC 4M43H 3BW9B 1JFHA 3GS7A 5DJ0B 4RDQG 3UTTD 4UQBA 5EBWB 1F90L 2C3WA 4AENA 2P52A 1E8YA 35C8L 5EZJB 1K3IA 4TM9A 3V5DA 3MROB 2IBGA 3HRZC 5IHBA 4OCYL 3KPPB 1P7QA 3KGSA 4FQXC 4JAMA 4EQ2A 4I1NB 3FH8A 5INCB 4FNQA 2YO3A 3FFCB 2OFQA 4PJ7F 2F5AL 4M3JA 3QIBA 3LQAL 1Q0XL 5SWQB 1RJLA 2CGRL 1F4YH 3H53A 3WLWC 1NCWL 2VDLH 32C2B 4Q56A 5IESH 4FP8L 1IL1A 2WIIA 3WIHH 3QA3A 1VFOA 2AQTA 5I0WA 2Z91B 1NGPH 1ZA3A 3C5ZD 1WWBX 3NEEA 4J2QA 4ONHA 4PMEA 4WWID 1TMCB 1ZWIA 2E75C 1R47A 3AU1A 3VGAC 1FGVH 5F72S 4DO4A 3R7QA 3QHZH 2WZAA 2X4OA 5MEPA 1IC1A 1NCBL 3DX3A 1OCWL 1CQKA 1GGBL 4BFOA 4R8WL 1EXUB 5FYLD 4G71B 1WK0A 4F20A 4TVPE 1KB9K 4AQ1A 1P7HL 2XYCA 2FQDA 1OEZW 2BSCA 2N01B 5DMIH 4OCRL 2H2PD 5JO5B 2O5XH 4L3CA 5DO8A 3O4LD 1D9KC 3D51A 2MNUA 2A83A 4QRPA 5E70A 5EFIA 5FA4B 4L5FH 1ZANL 1A5FL 4HEPG 2KL6A 3HI5H 5FYKH 1AG6A 4WJ5B 4CGUB 4HYTB 3U4AA 4HK3N 4DUXA 1TTGA 2MCPL 5FK9A 1S7VA 1OPGH 2D31A 2CRZA 2PABA 3GB7B 3R06A 1D2PA 2EUWA 3EH5B 5GS3A 1XEDA 2EACA 2KQNA 3MZGB 1JL8A 2NY4B 4DSYA 3SKJL 2PYED 1XCWA 5F89B 2BZDA 2VDPH 4WFHE 4HDIB 3U9PL 4JFFD 1YYLH 5HGAA 3LXBA 2FWOA 4MJIE 5AVQB 2Q7YB 1VESA 4R5VA 5C9JA 1OTSD 3O45A 5EH1A 5HHPA 3S5YA 2VW7A 2XZAL 1Z9SB 3CZFA 1RK0A 4Q58C 3UABA 5IREA 5IHLB 1A4JA 2QQLL 4JQXC 1MIMH 1W6LA 5GPRA 3BIKA 4XOCA 5TE6H 3NPZB 4XWGH 4R6UA 1FORH 1IGTA 2IEPA 3ZIYA 2J1YA 5HYJD 2AJYL 3VWKA 5AKTA 3FSAA 4KK9D 5D7EA 3PL6A 4NO2A 3NH7L 1R3HB 3QNZA 4Y5VA 5C07D 4A66A 2R4SH 4O2CA 4BHUA 1AHMA 4X5XB 3HG3A 1BWWA 2XX1A 2A73B 1H5BA 5CBEA 1JMZA 1TEYA 4I13B 4K23H 5F97E 2VLRB 4X98A 2HXAA 1QYGL 4N85A 3I9PA 4NN6B 3SYPA 5JOPD 4PS4L 1JBJA 4AJWA 2DQCH 2I60L 2JJTA 4D2NA 1DSYA 2TAAA 2AABL 4I85A 3A67H 1UH2A 3FFCD 5D9SB 2VDOB 2F61A 3BAXA 2B5IC 2JK5A 2ZAIA 1IEBB 5CGYD 4OJYA 3OF6D 3JZ7A 1TQUA 4GW5B 4ZX4A 5BOJA 3EGDB 1CLYH 1T7XA 4N90D 2X6BA 3NP3A 5CJ5A 2OJZH 4J3OC 1NBCA 2NNAB 3QZWA 4P2OB 5IB1A 3X1FA 1OAUL 4XCNA 4L8CA 2XN2A 2H0EA 1EAJA 3MLWH 3HZ3A 5D1QA 5DEFB 1KXTA 3MLRH 3APFA 5TK2A 3IVKA 3CFDB 4QEGA 1MHHB 2GHZA 2XWXA 3FO2A 3MUJA 1LLAA 4G70B 4JGNA 5IW6B 3D34A 1PY4A 3PUUA 1TVBB 2FK9A 4PJGE 1J5IA 3F01A 3WMPA 1OW0A 4UINL 1LILA 5D7LA 2QZ5A 3MRDA 3IMBA 2EVIA 1XR9B 3HZYB 3P30L 4J4PD 4RWHA 4ODHL 3P0VL 5T1MB 4ZFOL 4OV6F 2BM3A 3FT4B 4K8RD 4YHNB 5HI5D 3TBTB 4XNYH 4O9HL 1UASA 3TO4B 3CFIC 1EHLH 4FQXA 2DOCA 2XQYA 3V4VH 1FFNB 3MRLB 5AAWA 3ZE2B 2FATH 1YPZB 2JF1A 4LKCA 4GG6B 3CSTA 1FZOB 3OX8B 4NUGL 2WOBA 3REVA 1QPXA 3BYTA 2YQ2A 3MLUL 3ULVD 1G9NL 3IJ7A 1E5BA 3AWEA 4F3FA 2X4UB 2XTLA 4OGAD 1JZDC 3U1PA 1GY1A 1A47A 2WKOA 3PP4H 1C5DB 4HG4J 4ALAL 3K2KA 4D0BB 5J4MA 3EH1A 1MWAA 1L0YA 3DHUA 2MMXA 5GGRB 5J9PA 4HJUA 4R7XA 4HKJA 1RK1B 4W9IC 1OCCB 3OWRA 3MA7B 3ARBC 5KYUB 1UXSA 3OKLA 3DGGA 3KEDA 5AOMA 5IQNA 2BH0A 4NQUA 4ZSOB 4Y1AD 1AOZA 2CHNA 1BHGA 1WPCA 3WLBB 2W88A 4KRLB 4BCXA 3IDXL 4GW4B 4YEFA 1UXMA 4O5LH 3RIKA 3QQDA 1JZ7A 2GSIB 1I31A 4JB9H 3RDTA 4BK4A 3N9GH 3HMWH 2AJUH 2B14A 1JDCA 1OAKH 2WV3A 4ZQKB 2D4DA 3G5XA 4I3RH 3V4VB 5DJ2A 3BWUC 5EZIL 4M8RA 4YSAA 3SDCC 1ZK5A 1I82A 1XB8A 4AKQA 5I6PA 3Q9QA 2IALA 2X4NB 4IKLA 2KZKA 2EDWA 3QUZA 2FBJL 1S8DB 3AG2B 3B9KD 3G9VA 5B1KA 4ZFFA 1WD8A 4JZJB 1QP1A 2W1NA 3GPSA 3CFEB 4OI9A 3WIIH 3GF8A 4QRFA 3FUKA 3JYBA 3MR9B 4UNUA 1FORL 5DVKA 2HX7A 4QRRB 2CKBB 2ZOOA 4EN3A 3N43B 3D30A 3NCBB 4NWTL 4PN6A 4YNYA 3FTZA 2UVEA 1MFEH 4YDJA 1FNSL 5GGQL 3B2DC 4QO1B 2ZXGA 5FO7A 5L7XL 2VLKB 1KCRH 4XXWA 5HI3C 4DW2H 3ULUE 2ZX6A 2PW1A 4NPJA 1XCTA 2DMHA 2H45A 4YFEA 2YIHA 3BP7A 2Y5QA 3CHSA 5T3XE 3IE4A 4XP1H 5J12C 1A9VA 1GHFH 1LE9B 5E08H 1U3HD 2Y5TB 1TQVA 4EPSA 3UPRA 3HE6C 1DQQA 4N0YL 1F4XH 3QR0A 4XTRD 1JK9A 3TIEA 1ADQA 1MCJA 1SFHA 4PLOB 3BPOC 2F2HA 1SHMA 3RNKA 3VRJA 4J8RA 2BXYA 2FT7A 3KPRA 5D7SH 1RD6A 4M1DL 3ZDXF 4BQ9A 4S0TD 3SKOB 3C60B 4L5FL 1XGQA 5DFVC 1IKFH 2FJHA 5EUOA 1QTPA 4QYOB 4ELMB 2EIZB 1OAXH 2VMCA 3FRPG 6TAAA 1LK3H 3VXUE 3CQPA 3H9SA 1TPXB 4X6CE 1B2YA 4HIHB 1YQ2A 4JFFB 4NO2B 4XVSL 2A77L 4U1NA 3TTYA 4MLIA 4U1IA 3I6GB 4MA7H 4WFGD 5CZXD 5EZLB 2J2ZA 4XCEB 5I73C 5D1ZI 2NQ3A 3SDXA 3AQZA 1KN4L 1YNTF 3LN4B 4LP5A 2BP0A 3IMVA 4X9GA 1J18A 3PDOA 4G6JH 3AVEA 3W5NA 2EECA 1CR9L 3HLKA 1IAII 1M42A 4ZO8A 3U7YL 2O93L 2FBJH 4IBUA 3Q06A 4DQAA 4ZW6A 3DA0A 2A0LC 4NPYB 2Q9OA 1MQKL 1N70A 3CVBA 1FIGH 3X3GL 3P3UA 1B0RA 1WO2A 4FZ8L 1GYVA 4XMWA 4MCYA 4DZ8B 4DPRA 3WNLA 4PS7A 4U1SA 2NY5L 5GGUB 1BPVA 3LZRA 3WTVA 2EC9U 3DX1A 3MOBH 2FHBA 3KEHA 4GIPD 1HU8A 4HAGA 5D7JD 5T5FA 4NBZB 5D6DC 1NGXA 2R1WA 3DPDA 3H7BB 3I2CL 1QFWI 3THML 4HUXA 2BWDA 2VXQA 5DQJA 3GRWH 4HS3A 3FHQA 4QHUA 5F6IC 1E9PB 1W16A 5AYUL 3CPLB 3LD8C 2XVKA 2APWA 2HLAA 4XXWC 1HXYB 1N5AB 2G2PA 5C07B 2H1LM 4QJ5B 4UNVA 3CDFA 4R4FL 5LG6A 5FUZH 4EI5D 2R7EB 2V17L 1A7OL 4ZFFB 4XPGL 3V4PL 3PIQA 1OL0A 5E2WL 1S3KH 5JNYB 3P4MB 3T8MA 3MV8B 2I7OA 3RY6A 4Z1PA 4LL1A 4N5ED 4O58H 3KR3H 1E4KC 2WBXA 4BM7A 3BIAX 5EZLA 3L4WA 2E7LA 3JQOB 5DK2B 5D70L 2P43B 3QIBC 4FNLH 2ZCLL 3QEGL 3ULSB 3IXAB 2I32A 3AU0A 3T6ZA 1KV3A 1CXFA 4WW2F 1ASPA 4L3EA 4UUJB 5T1LB 2PTVA 5IB3B 3CFJA 1T1XA 2AJZB 4O9HH 2WXMA 4FNPA 1QR1A 2UXTA 4JS7A 5HHOB 5IVXA 1AR1C 4NJ9L 3SYAA 4KJQD 3RFRA 3BSZL 5B1CA 3EYUL 4MWFB 5DQJB 4NFBA 1OGAE 2X10A 3L1OH 2OTWA 1RKRA 2H6PA 2EH8L 2VRQA 4PRDB 3TBBA 2YXVA 3RVVC 4DN3L 4X5RA 3UBXG 5EBWA 2AQRA 1BYOA 4FX5A 1CGSH 1FC1A 1WSST 3ATFA 1BEXA 4Z7VA 3G6JF 2VERN 1Q9WA 4FG6C 3MYJA 1INQB 2ZUQC 5HI4C 3FQ2A 3QE5A 3LJ3A 4AW7A 1QFPA 3VFSB 1IBDA 2WTOA 4D94A 3OMIB 1RZJC 5ES4B 4ODVL 4JRWA 2V9RA 1JZIA 2AABH 3OKOA 5F93C 5GRVL 3BEWA 3MCKA 3S8GB 4I0PC 3UTSA 2V2XB 4YDJB 1DVTA 3GNML 3V4LA 2O5YL 3VFGH 1OALA 2R4RH 4PJCA 3SDDA 4K71B 1UZ6F 1NC4D 1M9WA 3L9YA 4CVXB 4FJ6A 2MJWA 1HXMA 3FT2A 5GRZA 3RQ3A 5F7KC 5F7DB 3MVSA 4IM8A 4PJGA 5KVGH 4R4FH 1S8DA 3L54A 1CK0L 4M6ML 1AQ8A 2V6HA 3CDGA 1U8LB 1NGWA 4FAAB 4HUVB 4HIQA 3QEUA 5GRJH 2OPCA 4AQAA 1JWMA 2CIIA 1GIGH 3WNNA 3ZTJH 2PMZA 5DEFA 2GEEA 2YD0A 5TDPA 4KUZL 3I6KA 2V5RA 3GLDA 3KPRB 4KGLA 5DQDL 1B6UA 3HBPA 1FFOB 2FRGP 1BD2D 3ZDZB 2A9ML 3CH8A 3KLHC 1QQDB 5I1AA 2DQFA 2Q7NA 4PP1C 4KRMB 1SZNA 5CEYB 4OUOA 3ZE1B 4DEPB 3ZGIA 3H2PA 4XAWL 5FYKU 2VYRE 1AZRA 1B9KA 1JGLH 4WEEA 5JZ7C 3JV6A 2VXSH 1VLXA 2IV9A 2X3CA 2G5RA 3U7YH 5T1KA 2P8PA 2YMOA 2BOLA 4KTDH 4M7ZC 2XNAB 1D5BA 4ELKA 1DSFL 5JR1L 4B50A 1KYAA 4R4ND 5AG8A 2HRLA 3MNZA 1RZ7H 1KN4H 1E65A 3P2DA 2OTWB 3H9HB 4Z5RA 4JQIA 2C3XA 2FECL 3QIWC 2NOYA 2GAZB 3O3BA 5DC9B 1ZRUA 3K72B 1KJ2B 2EZ0D 1HHJB 1KCBA 1UADC 4QRQB 4FCAA 4CC0A 1NCBH 3TO4A 5C7XH 2H26A 2ZYHA 2RQ8A 4EXKA 2X3BA 4O2FA 5DHXB 1MVUA 1X5YA 4WHDA 1NBYA 2EVHA 2P5EB 3GHEL 2B7DT 5C0ND 5LLIC 5HHMD 1IFGA 2GUYA 1XH0A 4XHJC 3P0YL 4FFTA 2V3EA 3JWOL 1SMOA 4HJJH 3U48A 3L5IA 1E9OB 4CDGC 5IW1B 4FP8H 4QRRD 5DS8A 2ZUVA 3B2VL 3LPFA 1NCTA 4HOMA 2CGRH 1S7VB 5F1OB 3VXQB 5E9DD 1G6RL 2I07A 4N0YH 2G9HB 1AJ7H 2VLRE 1KOAA 4X6FA 4CVZA 2OMZA 1QLFA 4TPRH 5CAYB 4NQXB 5FHBL 1HXYA 5E2VL 1BMGA 3FTYA 1RK1A 2B3RA 1BOGA 2F19H 4JY4A 4L4VD 3RGVD 2IANE 1YMHB 4KJPD 4FLHA 4Z7UE 4IMKA 1SOSA 2AVFA 4A2GA 3X3FL 2AXFA 4JRYD 3QJVB 4H1LG 1Z66A 3H7BA 3O4LE 3SPVA 1JPTH 4NJAL 2BWQA 3U1QA 3LDBB 3TJHC 4ORGA 1UT1A 1ILUA 4UM9A 3D0LA 3K6FA 5FO8B 3S34H 1KIRB 5A2BA 2R0KH 1FPTL 4NC1C 4PJ5B 1J0ZA 2WB1A 2EYTA 4HWBA 5FYLL 1CI3M 2G9HA 4KU1A 2EO1A 5T3ZL 1QATA 4X5WB 3HUJF 3WL9B 3KPRE 3NCEB 2R69A 1ZV9A 1B2WH 4A38A 1GOGA 3UJIH 2G5BA 3SDYL 3EYFA 3DXAA 4JJ5B 4XPFL 2E5EA 4BIKA 3JWDH 5E4IA 5C0DA 4YC2C 4P4KA 4N2FA 2OSYA 2ZF9A 2D2OA 2P5EA 4D9RE 3TESA 3L4TA 1OAYH 3WY2A 1G7MB 2HX8A 3FTVA 4UTAH 2LHAA 1BVLB 2NXYD 1RU9L 1XCXA 2VAJA 3CMOL 3DX2A 5IB3A 4WW1A 3ECWA 5DVPA 3WIFB 1ETJA 3MA9L 4OLYH 1KC5L 2XFGB 5F7EH 3MCYA 5F89A 1R9FA 1GW0A 1QW8A 3GMPB 3Q48A 3S96B 4ZW5A 3MJGX 2K9UA 3QUZB 1JNNL 5F88B 1INDL 3IFLH 1SEBB 5CSZA 3S2AA 3GO1L 1NJ9B 1KCSL 1LD9A 1VFBB 4NKIH 4JANB 3TJEH 1DQLL 4NQDA 4WENB 4G8IA 4MA1C 4ALAH 5IEKA 4MQXC 1A14L 3MXVH 3GXDA 4X7EC 4G9FD 3PP4L 2P24B 1FH5H 4QOKE 2ZOTA 2C9AA 4TULL 2AK4A 2BINA 3VTTA 4L48A 4ZUUB 3GQFA 3EYVA 1HSBA 2AEPL 4TUKL 2FYVA 3IFNH 2MH4A 3B2PA 5D1ZD 3GLAA 3L95A 1DN0A 3QQ9C 1QSFB 3D0VB 1BJ8A 4Z95H 3OQ3B 4XTRC 2CR3A 1XR8B 3DX7B 5EIIB 3FB8B 1DQVA 2BOCA 3UTOA 2K4WA 3OBAA 4BZ1A 5B38G 4FHJA 3GC3A 4BGDA 2C7FA 1NJ9A 2A9CA 4PJFF 4M7JL 2HG5A 1VGKB 4EAEA 3IYLW 4QTHB 3B3IA 5AVXB 3NZUA 4K5LA 4I4WB 5HDRA 1DEEA 3O8XA 2UZYB 5G4OA 3O2DL 5SWZD 3L5XL 3IDGB 3CFKB 3GTNA 2BS71 4P57A 3BMWA 2A7BA 4WTZA 1YAZA 4N6QA 3N1FC 5F6HI 3VFRA 1U6AH 1NIFA 1QBBA 5HGAB 2R0ZH 1T20B 5IBTL 5BS0E 2Z7WA 3BH8A 4QRQA 4S10A 4RESB 5D93B 1FN4A 3UBHA 5DZOA 1E3FA 1YN6B 1UWEH 4LSSL 4LSTL 4NQCE 4NSKA 1K4DB 4LB8A 4UILL 1P7QB 1RZQA 3HBQA 3ROLA 1EMTL 1WUNT 2IALB 2X4NA 3FPYA 4NENA 1LTXA 2Z4TA 5IK3A 3DOSB 4B3EA 4L37B 4AKPA 3TBWA 1R3JA 2WN2A 2EXWD 3LPPA 3HPJB 4FFVD 4Q9QH 2GITA 4PP2B 2R1YB 1ZV2A 4NHUB 1HKLH 4CU7A 3JT2A 3KHOA 4JMXA 2SEBB 4FKHA 2F9BT 1NDMB 2WXFA 5CFAA 2A9BA 4KBPA 1MHHA 3DHMA 5IBLC 2R4SL 3D39D 4FYSA 2F7IA 3ECBB 2E7BA 3L9RA 7TAAA 4PW4A 4RLDA 1TTFA 1FJ1B 1L0QA 1H3WM 2F8OA 5DEJA 3HIZA 1U8MB 1U8OB 4HETA 1TU2A 2OYPA 4KTYA 5TE6L 3T2LA 3FF8A 5D8JH 1UCTA 2VDLB 4P5TC 4S1QL 3WCYA 4JFDB 1FH2A 3DX6B 3B34A 4GI8A 3RVUC 3T4AA 2LU7A 3ULUD 3QRFM 5CZKA 3CHQA 2XT1B