3DXAE

Crystal structure of the dm1 tcr in complex with hla-b*4405 and decamer ebv antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
244
structure length
244
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASRYRDDSYNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility complex HLA-B*4402
publication title Natural micropolymorphism in human leukocyte antigens provides a basis for genetic control of antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 244
sequence length 244
chains with identical sequence J, O
ec nomenclature
pdb deposition date 2008-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE02
1MEXL 2PCPB 3CFKB 4OFVA 2YXFA 2ID5A 1T6VN 1LVEA 3NN8A 4HH9A 4GG8B 3S88L 2JELL 3HHRB 5DTFB 3O2WL 3MRJB 5EUOA 5ACZB 4DWHA 2FB4H 3MV7E 3VE0B 3EGSB 3NIFF 5E0QA 4PJHE 4HUUA 5ERWB 2VDRH 5EU6E 3D3VE 2GJ6A 4NM4L 3PHOB 1C08B 2X4PB 4J1UB 1BECA 3UTPE 1ZHNA 1RJLA 4KZEL 1QLFA 3NPSB 3W11D 5F9OH 3CLEH 3NCYP 2HWZL 5FYLD 3QXUA 1HSAA 2RB8A 4WHTA 4HUNB 4RFNC 3C09B 5D7LE 5DRZA 5KBNC 2B20A 3RUGA 4J6RH 4HUWB 4FTVA 4XX1E 3GSOA 2NW3A 2DI7A 3ARVA 3KS0J 3I2CH 3IU4L 4XAKE 3VXUB 2V5MA 2BVQA 2RJMA 2DIJA 3F7QA 5E2TH 2EECA 4G9FA 4WWKA 4L3EB 4G7YH 4M7KL 3UTSB 4XP4L 3PHSA 5T1KA 4HGWB 5D96B 1CL7H 1ZOXA 4KI5C 2IAMA 3IDJB 3FQWB 5K93A 32C2A 1SBSH 5CJ8A 5C0EA 4NQCB 5EZOH 1T7VA 4KJQC 4X6DB 3MMEB 4FFVC 3DUSB 3TZVB 1J05A 5C08B 1XR9B 1WBXB 1YMMB 2Q8AL 3U7WH 3FQNB 1WEJL 3HRPA 4CMMA 4M6AA 5IVXA 3EOAA 3ZKMC 4MJIA 5HD8D 4LNVA 5EO1B 1FLRH 4GQ9H 4OFIA 4XRCB 2FX7L 5GRJH 3UTTA 1FFQA 2CJUL 1CGVA 3ZE0E 5MENE 2OQJA 3X17A 4XNUL 5FK9B 1NCBH 1U8JA 2NQCA 3HPLA 2QQKL 3RIFF 3V6OA 2IPTL 5GS0C 2NX5E 4F7PB 1TJHH 2AJUL 1N64H 2R1WB 5KVGL 5E1AA 4PREB 2D9CA 1CT8B 2ITCB 3FT2A 3B3IA 1MWAB 4MB4A 5CHNB 3FQXA 2R23A 1OB1A 4GH7B 4XC1L 5C0BD 1NGQH 1QYGH 1RZGB 2OI9C 3UPRA 1I8LA 4U7KA 4XXDB 1H3WM 2A6JA 2OJZL 3VFMA 1AKJD 4X5WB 5I1CL 5JA9A 4APQB 3NVQA 2ZUQB 3BISA 3B5HA 1KN2L 2DKMA 5ALCL 1ORQB 4Y5XC 4HHAB 4YO0A 2DWDB 2GFBA 4KVNL 3PQYE 4YBQC 5FCUL 2VISB 1G7JA 2E9IA 1D5MB 3JV6B 1IM3A 4HDIA 5E56A 4UUJA 1A7RL 4GBXD 1B6DA 1MUJA 3FO1B 3IFPA 3P40A 3ALXA 3BHBA 3C2AL 3GBMH 3JTTB 3LV3B 4LHUB 3GSQA 1CFBA 2AJZA 4ZUWA 1A7NL 5DVNA 1YMHA 3LY6A 1A6WL 4LPWA 1Y6NR 5IROA 2FD6L 3CXDH 1E4XL 1AGDB 4CDGC 5GSVB 1RZFH 5DJDB 5J06A 1A9EB 3RVVC 1CXIA 3SDAA 3TCLB 3K2UL 3T0VA 1KTDA 1JGUH 2HKHH 1QSFA 1IBGH 3DBXB 3OKLA 5J7CC 3UPCA 1QA9B 4PGJA 5L6YH 3GMLB 5FHBH 1FQ9C 5CZXD 2XWBB 1UM5L 2DTMH 5F8RC 3ULUF 2BXYA 1AR2A 3WIHA 4CNIB 3U0PA 2ESVB 4PJ9D 5EBGA 2DQJH 4NN5C 5JPNA 1WFUA 5CEXA 1ZHBA 4LLQA 1AQDB 3WFDL 4PJCE 4ZDHB 1WZ1H 4OCWL 4OV6F 2GW5A 3PJSB 1KOAA 3QIWA 2A73A 1EHNA 4C59B 4LCCC 1T89A 4HD9A 2IPUK 2F5BH 4OM1L 2LU4A 2WUBH 4M8QB 1DEEA 5DQ9A 1CGWA 3M1BA 1ZT1A 1Y18B 3EYSH 3O8XA 9CGTA 4YDKL 1G6RB 1ZA3B 4G6FD 5IW1B 3O3EB 2Q1EA 1KLUA 2J8UB 1V7MH 3OZ9L 1GAFL 3AFLA 4QLRA 4QRPD 3SKOA 2Z8WC 4JKKA 4LLMB 2CDEA 5H2BA 4PBWD 2PYEE 4PTUA 1F4XL 5HVFB 5I30H 1H5BC 4M6MH 4H0HB 2W9LA 3TT3L 3RHWF 4DAGL 1YC8A 2C1PA 4UTAH 4P46B 1HHHB 1L7IH 3D2UD 5DFVC 4Z0XB 3RA7H 1Q72L 2D7OA 2G60H 3MLSL 1TVDA 5A40E 2YMXH 4FFYH 2Z31D 4UT6L 4DUVA 2KBGA 1RI8A 2NY1D 2VLMD 3ZHDA 4OCSH 2YA1A 2QJDA 2Q20A 2YD3A 3QI9B 3H42H 1AHWC 2EDBA 5EPMB 1AGBA 3RWIB 4Z7OF 4NP4H 1LEGA 2XPGB 4D2NA 3C5ZA 1LO0L 4NJ9L 1FL3B 3VXMA 3BQUC 4NKOA 5F6IC 4H26B 4Z5RB 4W4NA 4MD0A 1IGTA 4FABH 2HFGH 1S7VB 3AM8A 4UNVA 5EU5B 3NACL 1F58H 4OF3A 3QCTH 4ZFOL 4AQ1B 2K9UA 1C1EH 3HI5L 1XGPA 1RUPL 3RZCA 3V0WH 4QHKJ 4NQED 3KXFB 1BFSA 4ZNEA 2BNUB 4MQ7A 2CUHA 1Z6JT 2J88H 2VQTA 5AEAA 1ZTXH 4QKXB 3QR2A 4DVRL 5JHLH 2Z92A 4PRHB 4U2ZA 4N1EA 3LOWA 1DANT 4DZBA 1FPTL 1FL5B 1ED3B 1IARB 3QDGE 3OKOA 3HNSH 4GXVL 3Q2CA 3WCYA 5JHDA 1ZT4A 1EUTA 3TA3B 4PJEB 4NO3A 2WW8A 1BX2B 1OGTB 4OUUA 1XGQB 5I75B 4GW1B 3BSZH 1CLOH 1TVBB 4YX2L 3WUWB 3VXSA 3ZYOA 3HPJB 1M71A 3HTLX 3KJ6H 1R3HA 1Z0MA 5K9OB 4NN6B 4Y4KD 5GGRY 1J8HB 5I2IA 1JK8B 1YYML 1IFHL 1MHEA 4KK8C 3L9RB 3P11H 3PWJB 1IE5A 2W65A 5CGYC 1AGEA 3NTCH 1IC4L 5B8CC 2OXHA 1JIBA 1F4HA 1A1NB 2GEEA 2D31B 2V7NB 4L9LA 3RP1A 4WW1B 4GW4B 5DO2C 5BRZE 3GGWB 3DYPA 3VFRB 4R7NA 1NCAH 4Z0BH 3DPBA 3DSNA 3BZ4A 4NGHL 43CAB 3PWLB 5DDHB 1WAAA 4QXUH 5MEOB 4N8VB 4XH2A 4Y8AA 5FUCE 3C87A 1CE1L 4BFEA 5C1MB 1XF2A 3MV7D 1FNHA 3VG0L 4JKLA 4H25B 5FB8B 2VC2H 2VN7A 3P4OB 1TCRA 4FQJH 5EU6D 2NY5H 5AD0B 3D3VD 4U1LA 2J6EA 5JA8B 5EUOE 4Y4HB 1YQVL 4M93C 3UTPD 5C9KA 2XN9B 5CJQH 3S4SA 1GC1L 2MHAA 4PP2B 3ZYIA 5DUBA 3ARGA 3CFDA 2GJ6E 3MCKB 4MVBD 1BBDH 1JTOA 5EO9A 2GQHA 5AUMA 1JWSA 4KU1A 4L8SC 5JIKA 2AEQH 1JPGB 3CAFA 2WUCL 2IF7A 4LIQE 5D7LD 1CFSA 1ZANH 3G5ZA 1I9JH 4NT6B 2E7CA 3HE6D 3SGKC 2ADIB 4XAKD 2YPKB 3QAZC 2BC4B 4NWTL 3CVIH 5CS7A 2MQ0A 3RUGE 4D9LL 4FTVE 2XKNA 1PKOA 3IJYB 5TDNA 3QISA 5D7SL 4TVPH 3LKSB 2CH8A 1F90H 4G9FE 3SKNB 3WFZA 5D93C 1FE8H 2FH8A 3QXWA 3C08L 3MBEA 3Q3GA 1F00I 2OZ4H 4H8WC 7FABL 4LVOB 5E6IA 5D5MF 4F9LC 1IM9B 1QVOA 4JJ5A 5I1LA 5E8NB 4IDJH 5HI3C 1FGNL 5DD1L 5I76A 2XIDA 4FQLH 1B90A 5DYOB 4FXLA 2AERT 5C0ND 4PGDB 3S6CA 3O2DA 2X4NA 3VGDA 5MEND 1DQDL 4XC3H 4Y19B 5IVXE 4YWGL 4MJIE 4HC1A 4JPIA 4HIEB 4GAYB 4JRXA 4NO0B 2FX9L 2NX5D 2YKLL 1TNNA 3QDHA 1II4E 1KIQA 3UTTE 1Q94A 5C2BH 5C6WH 1X7QA 2V2WB 2V5SA 3KLHC 4A6YL 5DQDL 3SGJA 3V6OE 3KVQA 1A2YB 4R2GD 2VXQH 4PJ7A 5DJ0B 1CD0A 1WC7A 3HE7D 4WEUD 4MAYA 3QFJD 1QRNA 4CMHC 4XBGB 3L95A 1X3DA 3CVHH 3ZE1E 3X3GH 2NY5C 3PQYD 1QBLH 1UACH 2GSGB 4ONGH 3WIIH 1GXEA 5T1LB 1SEBB 1FC1A 2JIXD 4IRSB 2D7QA 2AK1L 4ZFOB 3WDJA 1O7SA 5LAXB 1F02I 4BQ9A 3FJTA 4P2OC 2BY1A 4PJDF 3ES6A 4DVBB 3DTXB 5J89A 3QNZA 3JUZA 1RHFA 4OKDA 4PJ8B 3ULVF 5I8OL 1RMFH 2VKXA 1UXWB 4LHJB 4AEIL 1DFBH 4OCNC 4MX7A 1HH9A 4XP9H 2Y6SD 3P73B 3PWVA 1CGXA 3HNVL 2P47B 3I50H 3G6JA 4U1KA 3AUVA 4RAHA 1QKZL 1JL8A 4JO3L 2DYPB 2OYPA 3I75B 3KPMB 4M6NH 4CVZA 3ARZA 5ENWB 3V6FB 5DMKA 5DMIH 1YPZF 4MNGA 5F1IA 4QRQB 1QSFE 1JYNA 2W59A 2DQFA 2PO6B 1MLBB 4RGND 3QUYD 3NZ8A 2HT4D 4MJ5B 2PXYD 3U0WH 4OFYD 2IH3A 3BT2L 1X44A 3KPRA 4ZFFA 2Q8BH 3QWRD 1VFAB 1U91A 5HY9B 4HJGA 4RGMC 1KJ2A 4I0PA 3RPIA 1QBML 3P2TA 4JPKL 1R3JA 2A1WH 4D94A 3HI1B 4ZYKB 1MREL 4OZIB 1MFEL 1RIVL 1DQLL 1I7UB 1TIUA 3FOLB 3CFJB 4D3CH 3RWHA 4K9EH 3BIAX 1ZSDB 3BYTA 4ERSL 2Q76A 3RWJA 4QYOA 4HGKC 3LCYA 4GG8A 5BOPA 4JPWH 1J1OH 4ZS6C 2PYED 3KJ4C 4NBZB 3AAZB 5DT1L 3SN6N 5EU7C 1RJYB 1P4IL 2VB5A 3Q5OA 3ILPB 3VE0A 3QEGH 1CD9B 1G7QA 2VKWA 4TSAH 4FFWD 2EKSA 1EHLL 3ARUA 1FVEA 2MJWA 1C08A 1L6XA 2V5RA 4J1UA 4DQOL 1YEDB 2NW2A 1RJZB 1VGEH 1VGKA 5JDSA 2EDFA 2YPVL 1CDHA 3BD4A 3ULUL 5BV7L 4I8DA 3MUY1 3CC5B 2CGRH 3QNYB 3BPLB 2VXVH 3WE6B 3UO1H 4J3UA 2UVEA 4PRNB 3PIQA 4FMKA 4QO1A 1IT9H 1GGIL 1WTGT 4R26L 3P77B 4PG2A 3DYMA 3O2VH 1MI5B 4P9HC 3VXUA 1I75A 1GPOL 4O2EB 3VGBA 4MNQB 1IEBB 3SE4C 3CFBA 1T83A 4P0DA 3VXME 1LO3L 1MFDL 1OPGH 3IAQA 2CXKA 4HX1B 3D39A 1U6AH 5ALBH 5D70L 2UYLA 4NQCA 2CPCA 5JORA 5C86A 3H9SB 1AXSA 3N0PB 2KZWA 5D2NC 4GMSH 4HPOL 4TVSa 1WBXA 1YMMA 3HZYA 1FL6B 1JPFA 2VH5H 1FGVH 1J0HA 3CCHA 5EO1A 4ONFH 1YNKH 1PY4A 4I3SL 4ZO7A 3QDGD 5LGHL 3T8XB 2Z35B 1QRKA 1TMCB 1ZLSH 5FK9A 5K9JL 4XPGH 1UCBL 2IQAB 1YY9D 4HK0B 1UB6A 3V4PL 4ONHB 4U1IB 4EI6B 3BE1H 2VDQH 5CWSB 3M17A 2VUYA 4K9EC 3L7FB 5I9QB 2R1WA 4LKXB 2J4WL 4M3KB 4FFZH 4P59H 5JHDE 5KOVC 4HIHB 4A6YB 3CZJA 2VQ1A 4OLXL 2KDGA 2NY4D 3HNTL 1OD9A 2NYYD 4PJAE 5CHNA 1CK0H 1MJ8H 3TNMA 2R0ZL 3DSFL 1IAIM 4JHBA 3QZWG 5GGRA 2CLZB 5JNYB 1UVQB 3ZO0A 1WZMA 4RFOL 4UAOC 1F13A 1XF4A 4HHAA 3WFCL 4DKEL 4JO2H 3IKCA 2R4RH 4PRDB 5E7BA 3VWJB 2VISA 1O5DT 5DMGC 1D5MA 1ND0B 3JV6A 4Z18A 1ZGLA 4MDJA 1X5XA 4UU9B 1V8HA 3DXAA 4KI1A 4OUOA 5EU4B 3QXAB 3EYUH 4JFOA 3JTTA 3W5MA 3LV3A 4U0QB 4FQXA 2HT2C 4EBQL 2EDTA 2JJTA 2DQCH 4PV8A 1I8IB 2VAAA 1KELH 2R2HB 3KYMA 3LSOA 5I8KL 1EXUB 1MCWW 3MCG1 3TBTA 1WAAE 4P49A 1NGWB 2C5DC 2FLRT 3L5XH 1G7MB 1QNZL 4Q9QL 1A9EA 2IPKA 4U0RC 4Z95H 3D87B 2CLRA 1OLLA 1QBAA 2E27H 2J3SA 4GG6B 3P4MB 2GJ6D 5MEPB 3OG6B 1CDIA 4BH8B 1ETZB 4OSUH 3GMLA 5GZND 2XA8H 3D9AL 3DX7A 1C16A 5H35A 3RL1B 5I1AB 2ZSWB 3DMMA 4HEPG 5JW4M 1HXYA 4KUCD 2YBRB 4CNIA 4KDVA 2ESVA 4XNZC 1OM3H 4FTVD 8FABB 1AQDA 2WWMD 4XPFL 4ZDHA 2Y06H 5C09A 5KG9A 1T80A 4G9FD 1X5AA 4WWKD 1HK6A 5C6TH 3ZKSD 1I7TB 1H3TA 4LF3B 3PDOA 5D7KD 2DB8A 1MJUH 4L3CA 4DGYH 1KTLB 1TZGH 4JM2B 4DUWA 3AS0A 1EERB 4POUB 1JUFB 4S1DC 1Y18A 4NBXB 1Y0LB 3PL6A 2R2CA 1I7ZB 3EYOA 1QOKA 5D7JB 5I73B 4MJID 3R0NA 3CSGA 4NYLB 2VXUL 4LVHC 2EDYA 3A6CH 5I8CB 3UTTD 3UJIH 2W60A 5CEZE 2EH7L 4IMKC 3EJYD 4PLNC 2PW1A 3FO2B 4PS4L 1UEYA 2AGJL 4JRXE 5GGTL 1NBZA 4KRPB 3K0WA 2DN7A 3RNQA 4Z0XA 4GRMB 1UJ3C 1R0AL 4BK4A 5B38G 3HAEG 3D69B 4WTZG 5HPOA 3ILQD 4PRID 4F9PA 4E41D 3ARBB 2QSTA 1CVSC 4RWYH 3HAEH 4PJ7E 4CRPA 5DURD 2KKQA 3ZHLA 1IAIH 4XBPB 1A5FH 4RMUA 4NQSB 1QRNE 1BOGB 1E6OL 1YY8B 1IAOB 4NHUB 4HGMA 2YD6A 1YEIL 3IT8D 1KCRH 1ZVSB 3AB0C 4PD4K 1RK0A 4LSTH 3KPQA 4ZUSB 4WGWB 1GOFA 1R6VA 1OAXH 1UQSA 2EYTB 2VABB 4JDTL 4MWFB 4XPBH 4JEGB 1JZ5A 4JN2B 3BUYA 4X83A 5DD0H 4MA7H 3QNXA 1OAUL 3KXFA 1MPAL 2YWYA 1FZKB 1F8TL 2VXSH 5HI5C 4PG9B 3GI9L 1NPUA 3LKRB 3MJ8B 4YNYB 2AK4B 2J2ZA 4ALAH 1A6VH 5DR5L 5E00B 4JFQB 4YQXH 1E0OB 2HRPH 4GRLD 1I1AB 3RDTC 2VZSA 3NFSH 4HWBH 1BZ7A 4K2UH 4DTGH 1ADQL 2ZKHL 5I1EL 1H8SA 2MOVA 2APVA 3GRWH 4TSBL 1QSFD 3QUMB 2PR4L 1IC5H 1J10A 5F7YC 3G6JE 1WICA 5L9DH 4YHLH 3LS5L 5E2VH 4JY5L 3O9WA 1NCNA 3FFCB 2ORBL 2XWTB 2Y72A 4IJ3B 4ZPTB 4MNGE 1EVTC 5IK3B 3Q0HA 4MJ2A 3TESA 2BOCB 2OR7A 1JTPA 1ZA6A 2YUXA 3HZVB 5HGHA 4JZOA 4E5XB 5K9OA 2P8LB 2G5RA 4J3XA 4YDLC 3VGAB 3LH2H 5FUZH 3KPRE 4WNQB 3QIWD 5GGVL 1YJDH 4D0DA 4NQDA 5HGDA 3K1DA 4WO4C 1XIWC 3UC0H 5BZWA 1VENA 2OLDA 3MOQA 4LSPL 2BSSA 4BFIB 3OKDB 3CXHJ 5FUOL 3VFSA 4L8CA 1V5JA 2H2SC 3ULVL 5IBTH 2C26A 4PJ5B 3MNVB 4KWUA 3BFOA 1WUNT 3QDAA 4H25A 4Y4FC 2QADB 1S9WB 4HKBB 2HJFA 1D6EB 5DRNA 4FQHB 3QULA 1JI2A 1BM3L 1M6OA 5EOTB 2XN9A 2VLLB 1RQ5A 3ETBF 3NOIA 5IM7B 2HTLD 3GMMA 3HN3A 3Q1SL 5DJCA 3SQBA 2YRLA 1JPGA 1FFPA 4JJHA 1A4JB 4UBDC 5DJYA 1P6FA 1DVFC 4WVRA 1NMAL 2ADIA 4OZGF 4HIJA 5J12C 1JTTA 1E4WH 2YPKA 4KI5F 2JJSC 1YN6A 1FNGA 4DKDC 3C5ZD 4KJWC 4PRPA 5JOPE 1DQTA 1TJGH 4H88H 3BGFB 4H1LG 2APWA 4OGAD 2UY6A 3VXUE 1KG0B 3INUH 5F7MC 3DVGB 5J1TC 3SKNA 2X70A 1DBBL 1XZ0B 1AXTL 4LLYA 2F8VA 1JFQH 3RZCD 3D39E 4UV7H 5E8DH 4YFDB 5FA4A 4L4VB 5DD5L 1RZKH 4HKJB 4PY7B 4NQCE 3IXTB 3NPZB 4O5LH 1YMME 3UBXB 4NQVB 3O0RH 3S9DB 1G7HB 4Y19A 1L6ZA 4GAYA 3N1PC 3TFKD 1RZIA 3VG9C 2J12B 4YEEA 3AS2A 4G6JL 5F88B 5JW3L 5JHDD 3EDDA 5BS0A 4AIZB 3OGOE 5DHVH 5H8DA 4DW2H 4MXWL 2AI0H 1T66D 1EJOL 1U8QB 3F7YA 4Z77A 3FB7B 4HQQL 1CF8L 4QTHA 5I16B 5IFAL 2Q7YB 4HMDA 2LQRA 1NC4A 4KTYA 2VZUA 4K07A 4IS6A 3D0LB 4JFEB 4ODHH 3W11C 3ROLB 1HZHH 5CLTA 1LE5A 5SWSB 4ZSOA 1S9KC 1NMBH 4PJFF 1UWGH 1SMOA 2HH0H 5ILTH 3QO0B 4EN3B 4OCMC 3QEHA 3RKDD 1G9MH 3PNWB 2HTKD 2OK0H 3W0WA 2Y5EA 1YN7A 3NFNA 4YHKH 4XVSL 5DQJB 5FYJE 1EZVX 5D5MB 3P9MB 5MP6H 1I4FA 4DVBA 3DXAE 5HYEA 2NY2D 2CLVB 4KHTL 1R5VB 1D9KB 2V9RA 4FA8A 1D5IH 3SCMA 1NLBL 3FONA 4WENB 4G8EB 4X4XB 2VDML 4Y5YC 2BDNH 4N0FB 1UXWA 3SOBL 1KXQE 4G42A 1NFKA 4DEPC 4GAJL 4B41A 1KPUA 3A67H 3OR6A 4JVPA 1UZ8A 3HUJB 3OPZL 1M7IA 3LPFA 1U92B 5HD8C 4WFGD 3MRDB 3MRLB 3SGEH 3ARGD 4GUPB 5D2LF 4OCRH 5CBAB 3DI2B 4NZRL 5IV2B 4JY4B 2VDKL 1GIGH 1Z5LA 2AXHA 3EO0B 2XV6B 1YEHL 1N2RA 2P44B 2GT9A 3E0GA 3HMXH 4KROD 4R8WL 3T3ME 2HYMA 2VLRA 1VFAA 4K3HA 4HKZB 3IJSA 4JO4L 2ESVE 4XWOD 3EO9L 5TF0A 1HWHB 3HC4L 4IRZH 4OV5B 1YEGH 4IMLB 1T1ZB 1KXTB 5EC2B 4OZIA 2HRLA 5EBMA 5C09E 2WP3T 3V5KB 3EJZD 4V2CB 4K71C 1S9YB 1VEPA 5CZKA 3MBED 4PJDB 3MBXH 2XZQH 5E6ID 1KTKE 4KQ3H 1MCPL 2FBJH 5I0ZA 4GBXC 1KLGB 4U6XA 1OQOA 1RU9L 1CYGA 2IEPA 3MLWH 1INDH 4I0KA 5CINL 5TE6H 1J86A 2L7JA 2J8UE 3CPLA 3QIBB 5L2JB 5ICXA 5EZJB 2F53A 4JRXD 15C8H 1UWEH 2WZPD 5DUPL 2RIKA 3UTQA 4RFEB 1G9MC 1JMZA 1ZEAL 1YPZB 4YXKL 4XMLL 5KVFL 3D25A 4FOMA 2Y4SA 1UH3A 4YXHL 3RWDB 2X1WL 4HLZG 1BEYL 5DRXA 4NUGL 1NEZG 2FJFB 3BH8A 3QNYA 3WE6A 1A1MA 5LJYH 4MAYD 1VEMA 3FN0L 1QRND 1TJIL 3VRIA 5HDQH 4HLZH 1U3JA 2H3NA 4H5SA 4ZS7L 2R2EB 3V5DB 3ULSA 2P43B 2H9GA 4JZNB 4GSDH 5CZXC 5HSFA 4O2EA 3EFDH 5IW3A 3U7YL 4QOKA 1QSEA 4M61A 4ODUA 4XP1H 4DGVH 3R1GL 4PJ9C 4NKQB 3OKEB 4YGVB 3CNKA 4JPVH 5GHWL 2E6QA 3GMQB 5K9QG 5KSVB 3WJJC 5FGBC 5IFJB 2XACC 1F2XK 3H9SA 4W6WB 5FXCH 4FQPA 4Y1AB 2FLBT 3BPNB 2BVEA 3KXFE 4JFXA 1C5BH 1YNTA 1R3LA 4F57H 1EGJL 2CO6B 4Q7DA 1AD0B 5F7DB 3CD4A 3MO1B 3QDMB 4OJFL 4QHMA 5D2LA 2E6PA 4I4WB 4OD2A 3U48A 2XQYK 2G2RB 2GUOA 5FKAA 3T8XA 4DZ8A 3NGBB 1VACB 4OZFB 3TN0A 1W0VB 1P7HL 1QBBA 1A6AB 4N9GB 3CSBA 5C0GA 4ONHA 2VR5A 2X42A 1Q0YH 4WUUB 2NY6D 1D3CA 1OW0A 4Q9BA 1KACB 5EO0A 2RFXA 5HHNA 3S35H 5IMKB 2EXWD 3OJDA 2CIKB 4PY8J 1F4AA 2AV1B 2FJHB 1JZ6A 3MLRL 4FQQB 4RISH 2VE6A 2ADGB 3ABZA 2BHUA 2CLZA 4JFHD 3KPRD 1MRCH 4HUXB 1PG7H 4P3DA 1I9IH 2Z31C 2I26N 2H45A 2NY1C 5CD3A 2ILLA 5E1HB 3SJVA 3E8UH 1BD2B 3ZHKA 1H5BA 3TBYB 3VFPA 4FQIH 3U1SH 4WU7B 4M7ZB 1VB9A 4KQ4H 4EIGB 3QXAA 4NQDE 3W9EB 3UJTH 2I9TA 1UH4A 1AIFB 5HI4D 3EO1B 4XCEA 3RBGA 5I66A 3G04B 4HPYH 3BOVA 1RZJH 2ARJA 4KXZH 2ICEA 1HHKB 3MZTA 5ID1A 2YSSB 1T04B 4XX1G 4FQ1H 5GISH 1PGRB 4UTBH 1FVCB 3WIFA 2AKRB 1J1PH 4GG6A 2EO9A 2OL3H 3P4MA 1MJJA 3RTQB 1MFBH 3OKNB 1LEIA 2XWJA 1W72L 1ETZA 2XN9E 1S7RB 1ORSA 1N5YH 3BEVB 2AEWA 1ZWIB 4WU5B 1L0XA 3BP6A 1TQCC 1A3LH 4G8FA 3FOMB 1MQKH 1HKFA 5IB3A 3FAWA 1X5ZA 2FIKB 3GHBH 2VITB 2ZSWA 1KB5H 5KVDL 4WHCA 3HRZA 5E8OB 4D8PB 1KEGL 3L6FA 1ES0B 3GMNB 5JOPD 3F5WA 1MCFA 4PJXA 3VXUD 1MVUB 4ZAKA 1G7PA 4OLZL 4EQ2A 3PP4L 5LGKA 5HDOA 4L3ED 4PRPE 4NRXA 2AEIT 3UTSD 5GGVY 3D39D 4Y4KC 4NC1C 5DS8A 3VI4F 3R06B 1N7MH 4NQCD 5I1DB 2LFGA 3R0MA 5C08D 3OX8A 2BXZA 4YK4B 1YMMD 3EYFA 5EIIB 3UAJD 4ZXBB 3GNMH 3OAYH 4G43B 1AXIB 3QUZA 4Q0XL 2P8MA 3JBG7 4JHWH 1UM6L 1VPOH 5I8CA 1WJ3A 4Y19E 1K8IB 5B8CA 1KLFA 2OJEB 5AZEL 4U6HB 3U46B 3IFNH 5CUSL 2O5ZL 1NJ9B 1Q9LB 5IVZA 4R0LC 1NAKL 2D0GA 4NOBA 1P4LB 1QQDB 1RHHA 3D69A 4FNLL 1DQMH 4K8RL 1C5CL 2KUTA 5BS0E 2VL5A 2WK2A 3VXOB 5AWNL 3ARBA 4R4FH 3AC0A 5HYIA 2NR6D 5I1JH 3KWWB 4P3WA 1RZJC 1JYWA 3EYVB 1EV2E 4ZUVB 1A4KB 4XBPA 4P23A 1LDPH 4MVBC 1BQLH 4NQSA 3T4AA 5DMYA 1IAOA 2CO7B 3O6LH 4AG4H 4APQD 1OVZA 1U58A 5J6HA 1AP2B 1NAMA 2LAAA 2VWEE 2O5XH 3HE6C 3H2WA 1HKLL 2HFFB 1Q9OA 4YBLC 5DWUH 4ZSOE 4A2MA 3CDFA 5FYJD 1MLCB 4P5TB 4BH7A 5I15L 1QEWA 5IW6A 1OAKL 2HJKA 5DJAA 3UJJH 4L8SA 5FDYA 5I19L 4FQXD 2BRRL 3W0WE 2CR6A 1RPQA 3FL7A 1NFIB 3G5YA 5DSCB 1T3FA 1NCCH 3SGKA 4YZFE 5JUEH 5GS0L 4YHMH 4ODBD 2FGWH 2M8XA 3HC0B 3QIUA 5E99L 3VW3L 3FB5A 3GSNL 1MIEL 3PWPA 1I1AA 2AP2A 4G8GB 3ZT5A 4FXGA 1U8OA 4MGXA 1BJ8A 1DDHA 5E2JA 5L88H 1R5WB 4ZOAA 3S5LB 1DQJA 3X11A 5T3ZE 4OB5H 5GJSH 2FATL 3QHZH 5C0NC 2QLVB 1SYVA 3GSRA 2ATKA 2FB4L 3G6AB 1EEYB 1JGDA 3X12A 1NSNH 2FR4B 2XWTA 5IB1B 1AE6H 1T0NB 3S35X 1QPPA 5IK3A 4F9LA 2C4XA 2F19L 3C8KB 3V6ZB 3RGVA 4LLVA 2EYSB 3DMMD 1U8KB 5C0CA 1R24A 2ESVD 4P3CH 4GW5A 2IANB 4G3YH 1PG7X 5F9OL 3CLEL 4R2GC 4L4TB 1P7KA 1FNEA 4F7TB 3ZKXB 4U7MA 3HE7C 4U1MA 4JANB 1FSKC 5C09D 2VLRE 1KBGH 5EFIB 5KN5A 3KYAA 3BP5B 4J6RL 3TO4A 3WKMH 2I25N 3QB7C 5F44A 4JCMA 2D4DA 4EUPG 4OZIE 3I2CL 5KW9H 1YDPB 4CADA 1JWUA 5E2TL 3U7AA 4EUPH 1KNOA 3TIEA 4G7YL 3K8KA 1LGVA 5KZCD 2VZVA 2ARJQ 1S5IL 2BJMH 3PL6D 3KR3H 1CL7L 4X9IA 4PPTA 1HI6B 4PJ5A 1QZ1A 1SBSL 2O93L 2BOBB 3V5HA 5EZOL 1S9WA 3LAFA 4ACPA 1EFXA 3Q6FA 4HMEA 4JFZH 1JRHH 2CXGA 3U7WL 3CSYB 5EOTA 2F53E 4MLIA 4FQ2H 4P46D 1FLRL 4GQ9L 1N3NA 2NZ9D 1W72B 4GJTB 2WBJB 3TBSB 1R3KA 5C0JA 5I1GH 2H32H 2Y6SC 5CLWA 2C3WA 4LPYA 4OAWB 5JW5B 3ARPA 3KLAA 1NCBL 5IB4A 1S7QA 5IKCA 3QI9D 4G80B 1TJHL 1CICA 4AYFA 4WJ5A 1N64L 1GZPA 2FSEA 3E6HB 5MERB 2D7NA 4C4KO 1UT9A 4RGNC 3QUYC 5ETUB 4QF1B 2HT4C 4JR9H 2XTJE 3ZKQD 1S7SB 2PXYC 3PABB 1NGQL 1QYGL 4MCYA 4DN3H 3W5NA 4QOKE 5HHME 3HS0A 1I1CA 3VRLF 2GJZB 5D6CB 3NIGE 1QSEE 3RWEA 5EOCH 2ZUWA 2P5WA 1ZV5A 4K3EH 3N1QC 2KH2B 5E9DB 1HCVA 2A6KB 3RY6A 1PW3A 3KXFD 4HKJA 3D6GA 3SO3B 1P9MC 1CCZA 2H8PB 4Y8DC 3H9SE 3IXTA 1A3RH 3BZEB 1U8PB 1AGFA 5ID0A 1JNHB 3GSWB 2DI8A 3GBML 4LNRB 1EO8H 4R90L 1VDGA 1PYWB 3UBXA 2XZZA 2R4SH 4N0CD 1AH1A 1IQDA 5D2LE 2YOCA 4Z7NE 3DGGB 4I48B 2IH1A 3CXDL 3HI6H 3VCLA 5EULV 2V7HA 3TA3D 3TV3H 1I9RH 1MCOH 3O3DA 1RZFL 1A0QH 1CD1B 3O9WD 1T22A 4FP8H 4MLSA 1WIUA 4FFWC 1TVHB 3T65B 2HKHL 2FO4A 2YC1A 1IBGL 4HFUH 5SV4A 1QSZA 5L6YL 1CDJA 5FHBL 1Z3GH 1FFOB 1J8HD 3F58H 4JFEA 2DTML 4XCYB 5B39B 1CGSH 1EFQA 4LK4A 2R56H 4PJBF 4WHYH 3QO0A 1DZBA 2DQJL 5HYSB 5FKPB 3O81A 3SJVE 5IMLB 1VFOA 2E6JA 3WV0A 1WZ1L 2A83B 5CAYB 5DQJA 2E5EA 4N0UA 4MA1C 2VJXA 5HPMB 3LD8C 2CLVA 2V2XB 4R3SB 1IZKA 2WUBL 3TVMA 4MQSB 4Z7VF 5GSRB 2QHRH 5KS9F 4LIQH 3MJ7A 3EYSL 3U36B 1D7FA 3CUPA 1IGCH 5EZLB 1S9VB 1AO7B 4Y4HD 1V7ML 5ESQB 1H3VA 4U3HA 1HQ4B 2XN9D 2EDWA 2OI9B 1U92A 3BGAA 4M7JH 5F96H 4J3OC 1XGRB 4GG6E 2ZOKA 1QHOA 2AQ3A 2W9DH 4Y5XB 5I30L 4GKSA 1U3HA 4I3RH 5FM5M 4UTAL 1YY9C 5LKNA 1L7IL 2R1XB 4L3AA 4RSVA 4PJGF 1DCLA 5C0IB 4G6AD 3RA7L 1IGML 4PJIA 2G60L 1FAKT 2YMXL 4FFYL 3MRCA 1F3DH 4OGXL 5L2KA 4AM0B 2NY4C 1UYWL 2HFEB 4PR5B 2NYYC 4OCSL 4PJXE 4PJFB 5IJKC 5BQ7A 2FEEI 4MNHB 4O2CB 3D18B 3H42L 1VEOA 3WDHA 3CLFH 3P3YA 4NP4L 4P4KA 3CU1A 2DMCA 3STLB 2IQ9H 4MCZB 4OZHB 4FABL 2HFGL 1H3UA 1IM9D 3QCTL 1C1EL 2AJ3A 1KLGA 3C8HA 3OAUH 3V0WL 2BY2A 5FUCC 5HGBA 4Y19D 5L2JA 2WSKA 4Z76B 3OTTA 4NO0D 4Y16A 1XCQA 4IRJA 4YR6B 2DIAA 1ZTXL 5JHLL 3BI9X 5LCVH 2CRYA 1WSST 4Q6IB 3LN5A 3ARYA 4CVUA 1RULH 4DFIA 4KJYB 4RWHA 2FL5A 4PJBA 3HNSL 3AXLA 3RIAK 3KPOA 2O5YH 4LCCB 4HS6B 3K81A 1TZHB 3DX9B 4JLRA 3DI3B 1NC4D 2YRPA 4FG6D 5GZNC 1FYTA 3X14A 2C4FU 2X4SB 5D6DA 2O61B 1MHHA 3BSZL 1CLOL 3AMKA 4W6XB 1KJVA 5F93C 4M1CD 5T1LD 2OR9H 3ZDXE 1JNNH 1M1SA 3KJ6L 1MH5B 4WFEE 4RMRA 2Q87A 3P9LB 3MV9B 5AG8A 1QLEH 4OF7A 2WWMC 4C56B 5KSVA 5CILH 3NTCL 4WI3A 2CSPA 4JFDB 4WWKC 1UC6A 2EC9U 4R4BA 5IEHB 2FYYA 4EDWH 2IAMC 2F54B 3I84A 5F7DA 3QP3A 1JWMA 3MO1A 3QDMA 1A3QA 1DL7H 4I4WA 3CMGA 4Z0BL 3QG6A 5T3ZD 3QG7H 1BBJB 2D7TH 2RCSH 4QXUL 2FECL 4EVNA 3PWPE 1ZVYA 4NNYB 4ONOA 4X7TB 1K5NA 3WIHH 1W0WB 1S8DB 3VFWA 2NTFB 4W4OA 4RMTA 2VC2L 4FQJL 1AHWB 3NFPB 3LS4H 2NY5L 4LPVA 1B3JA 1H15B 3ECBB 1RVFH 3BQUB 4L29B 5F6IB 1U0QA 4OIIL 1GGCH 2W0FA 2AJYH 1OARH 2H41A 5L8JB 3EJYC 3FFCE 4YDJB 4X99B 2JB5H 2R1YA 3GZKA 2CIKA 3V6OC 4QRTB 4NKIH 1UKQA 1CIDA 4QNPF 1BBDL 1EAJA 1MIMH 3DV6B 3IAPA 4QRUB 4RDQG 4ZFZB 2AEQL 2CK0H 3WLWD 3ILQC 5C0CE 1ZANL 2CDGA 1I9JL 3TIDA 3KG5A 1HQRA 1BD2A 1V05A 2F15A 4R4ND 4HWZB 2Q6WA 3TBYA 1ACZA 1I8LC 5EC1B 1TITA 3U2SB 3MRHB 1HHIB 3Q5YA 3CVIL 1JE6A 2W38A 3WO4B 2EE9A 3BH9B 4M8VA 4P48A 2NY7L 5DK2A 3IGAB 4LPUA 3IDIA 1RIUH 4TVPL 1FLTX 5TE4H 5E94B 2DQGH 1F90L 1L7TH 4KDTC 1FE8L 3MNZA 5DK0A 3TGXA 3FTGB 2OZ4L 1RZ8B 3BD5A 3C60A 5GGUA 4HZLA 4M5YH 3GIVB 4F3FB 2FX8H 5CP7B 4PJ5E 1T4KA 3OXRB 3VD7A 5DVOA 2F53D 4U2YA 4IDJL 4RMWA 4WWID 4FQLL 2AKRA 3SEPA 1EHXA 2DKSA 5IROC 3OKNA 4GRLC 1UZ6F 1IC1A 4XC3L 4GKZA 1DLHB 3L7EA 3R8QA 2AV7A 4HEME 1NFDF 2FBOJ 2B2XH 3SDAC 1B0GB 1OWRM 3ET9F 4UQ2A 3TWCH 5C2BL 2WNGA 1OY3B 2C1OB 2PKDA 3MODH 4NRYB 1FRGH 4F7MB 1ES0A 3GEWB 5IF0A 5JPMB 2XTJD 5DD6A 1H3XA 4GQPH 4NO2A 4M7LL 4QOKD 1WCBB 5HHMD 3EYQD 4EI5A 2Q86B 1KPVA 3CMOH 3CVHL 3LEXA 1XR8A 3X3GL 1MQ8A 4NC2B 3WS6C 1I8MB 2BNRA 4QHLA 5IBUG 5DXWA 3R06A 1QBLL 1UACL 2I5YH 2IFGA 3ALPA 3V4UH 4LMQE 4ONGL 3WIIL 3ZDYF 2FO1A 3H9SD 3QIWC 4AEHH 4U1NB 2P5WE 3RIFK 5JXAH 4M93B 1T89C 1MCBA 3ZLQC 3DWTA 2OSLB 3G9VA 3L3HB 5T1DH 1RAMA 3GJFK 5E4EC 3IVKB 4LBEB 3GUTA 3DETD 1MFAH 5DVKA 3VDAA 3IDXH 3TN0D 1BZ9A 4MQXD 1XGYH 1RMFL 5DMJB 1XIWA 1Z9MA 2VDPH 3QAZB 4LPXA 4F33B 5EN2A 4DJMA 3VD9A 1DFBL 1DR9A 1E4KA 5A16A 4XP9L 3IFOA 4LCWB 3I50L 5DJ2A 5J9PB 4M6NL 3KWWA 5DMIL 1Z9SA 4OFKA 2RQ8A 2HTLC 1FG2A 3LZFH 5KAQG 5TQ0H 3VXRB 5CD5D 5FO8B 4X5XB 1AR1D 4XWGL 3QCVH 5FO7B 1HDMB 2DBLH 4JFEE 2HFFA 1B9ZA 1UG9A 3NCCB 1MLCA 2Q8BL 4PB0H 2IBBA 3C5ZC 4NCC1 4RNRB 1HEZB 3THMH 1YEJH 2A1WL 4PGEB 4OGAC 5JQ6H 2FEEL 1T20A 3S4SG 4ELMF 4TPRH 3AM8C 5D7IF 1NFIA 4N0UE 1DVFA 4HS8H 3CK0H 43C9B 4KV5E 4D3CL 2I9LA 1EEZA 3HC0A 3H9HB 1JGVH 3BVNB 3RZCC 5C3LD 3FHAA 1Y6KR 4LLDA 3MUZ1 4P4RB 1NFDA 4RQQA 3B5GA 3E6FB 2I07B 1P2CB 4W70A 3S5LA 5CJ5A 4JPWL 1J1OL 3G08A 2ZG2A 5FM4A 3T4YA 4F7CB 4BUHA 3LKNA 4PUBH 5FGCE 3HUJE 4HWNA 1U8HB 3AY4A 4I18B 3U30C 1QFWI 1EEYA 4PLJD 3QEGL 1B6UA 4WV1B 4TSAL 3TFKC 1AI1H 2WWKT 5BJTB 1K9TA 4X6CF 5E5MA 2HT3D 2EYSA 5C70A 1K2DB 1B0RA 2VLJA 3SDDA 1CBVL 1VGEL 1VERA 3RVUD 1IEAB 3GK8H 1T66C 3VH8A 4P2OB 4PJIE 4ZAKD 2CGRL 4OLVH 1CFQB 2VXVL 5DZNA 3UO1L 4TULH 5HBBA 2WANA 1IT9L 3X13B 2Y7QB 4HIIA 5JTWA 4JM2D 5CEZH 5IQ7H 3DUHA 1LK2A 3EOYG 1C8PA 1OWWA 2EC8A 3KPLB 4HC1H 4N1CA 3K1KC 2DTSA 4ZOCA 3RHWK 4AENB 1CGTA 1OPGL 4L8DB 3RKDC 2VLKB 1U6AL 5JIIA 5CSZB 3EUUA 4LRNH 2HTKC 5ALBL 4L9LC 4XBEH 1MRFL 3F62A 3QUZD 4YHYB 1S7TA 1G1CA 4GMSL 1U8NB 2YRZA 3B4NA 2NY2C 3B8YA 4U1SA 5FEBA 4O2FA 4K7FA 2VH5L 3BXNB 1FGVL 1N59B 4GRWF 5ESVB 1KT2B 1UKTA 3LRSB 2D4FA 4KRPD 4ONFL 1JV5B 1YNKL 3FCTB 1F11A 2WIIB 1W72A 4ZQKB 5H94B 3SDCA 2P5EB 4BSWB 5CP3A 4OAWA 1ZLSL 1UH2A 1BQHA 4XPGL 3MUGA 3ARBD 4AIXA 4I13B 1U8MB 2VDQL 3BE1L 1UENA 4OGYL 1MFNA 1J0ZA 2XRAH 1U8IA 4U7SA 1IL1B 4HUKB 4PJBE 5D1ZB 4P23D 2PYFA 4Y5YA 3ARGC 3MC0A 1UWXH 3AGVA 4FFZL 4P59L 2B4CC 5C0AB 3ZT6A 4WFED 4QF1A 3QJHB 1CK0L 1MJ8L 1FYTE 3IDMA 3PABA 4H1LA 4KROC 2YEZA 4PP1D 4YIQB 5AAMA 3H3PH 3N50A 3CVHB 5I8EB 1LWRA 1SJXA 1Q38A 4XWOC 5B4MD 4KGJA 2ZUUA 3OMZA 4JO2L 3QH3A 4AJ0A 4G6MH 4KDWA 4QHNA 1OD7A 2R4RL 3RWGA 3VFUB 5IGXH 3GSUB 5I1IH 2N7AA 1BP3B 3O41B 1F4YH 3QIUD 4P2RA 1RJCA 3PWPD 3MBEC 1I1AD 3KHQA 4UOJA 3RNKB 1JPSH 1X5IA 2IJ0C 2WLYA 2DQCL 5E6IC 3QDME 1KELL 4KRNA 4ZNCD 1F3JB 3QQNA 4U6TA 4D0BA 1JN6A 1LO4H 5LWYH 1AKJA 3L5XL 2LU3A 3UTZB 3LDBC 3SE9H 3FFCD 4YDVA 4Z95L 1KJ2H 3MFFB 4GKOA 2E27L 4I2XB 1LQSR 3RGVD 3FT3B 1I1YB 2ADFH 2V9TA 5C0CD 4OSUL 4J3VA 2XA8L 3SGJC 2YZ1A 1AC0A 5JDJA 5D2NB 3RI5F 4MAYC 2BCKA 3W81A 3S96B 2UVFA 2MCG1 3MRIB 4B53A 1QO3B 4P5MA 2PW2B 3LMJH 4HS3A 1OM3L 3SPVB 1UWXK 3TO4D 5HYSA 3RWFA 1RV6X 1CLZH 1P7QB 1BD2E 4MD5B 1T1XA 5E4IA 3TPUB 2ICES 3DGCR 3DNKA 2Y06L 2B1HH 4YHIA 1G6VK 5JXEA 5C8JA 4X5LA 3U9UB 3MTRA 4JAMB 5KSBA 5C6TL 1BGXH 5MHSE 4TUOB 5C07A 1MJUL 1HXMB 5IQ9A 4R3SA 4RRPG 1TZGL 3QUKA 4DGYL 4OLUH 4PJ5D 3LEYH 3WNKA 4H0GA 4Q2ZB 5GSRA 4IIQB 3GSNA 4X7CC 3NCYS 1EFXD 5E8EA 2EKJA 3DO7A 5IFHH 4LSUH 4PGCA 4LCIH 1HH6B 1AO7A 1O7VA 5GRUH 4PRBB 3KYNA 2YA0A 2XKUA 3MRRA 1CXLA 4RMVA 1F2QA 3GDBA 1X5GA 2V17H 5L8KB 3SGEI 1NUGA 5FGBA 1NBYA 3UJIL 1LO5A 4LKCA 1BFTA 2EDKA 4P2QA 3VJ6B 2BNQA 4R96B 1MCJA 2R1XA 5C0IA 3VXPB 4PGBB 2NY6C 2Z91A 1A47A 5DRWB 2ENYA 5ADOH 1NGYB 4XZUB 1KJMA 5FECA 1CFTB 3H8NA 4RWYL 1LEKA 2EXWC 2QSQA 5D1QA 4YUEH 4PRAB 5F9DC 3LN4B 1IAIL 4ODWB 1A5FL 2W0LA 1TPXB 4AQOA 5ACLA 2FZ3A 2P5WD 3PWUA 2X1QA 4PGZA 1PLGH 1KCRL 3QFDB 2JK5B 3O6FA 4LSTL 3STLA 4CN1A 2RR3A 4FZ8H 4L4VD 2BNRE 1OAXL 4LARH 2X4QB 3MRMB 3S36L 1ONQB 3D2UA 4X8JA 4XPBL 4Z7VB 1LHZA 5DD0L 5KS9B 3HCVA 1NGXA 4PJHF 5GRYA 5HI4C 2VXSL 1GCFA 3LHPH 4CGTA 4ALAL 1A6VL 1M7DA 3FRUA 2BVOA 4YQXL 1QR4A 4XNZB 2MKWA 3O3UN 3NFSL 2R69L 4HWBL 3AREB 4K2UL 4DTGL 5GJTH 4QNPE 4PLKD 2VDNH 2XZAH 1A7QH 3NZHH 2Z4QB 3LN9A 3OKKA 3GRWL 1S5HB 3QWOA 4Z78A 1IC5L 2BVPA 3F6IA 4PJGB 1TZHA 3DX9A 5L9DL 5FYJH 5E2VL 4EOWH 1U8LB 1Q9KB 4G5ZH 1NGPH 4JFED 1KCKA 2O61A 5SWSD 4ZODA 4KK5D 1NLDH 1I85A 5TF1H 1FG9C 3OBAA 4UB0H 1MH5A 4YC2B 1QACA 1JF1B 4NDMA 4ETQA 1BZQK 3VFTB 4NM8H 4QRSA 5E5UB 1LD9A 3LH2L 3DRQA 4OKVB 4PG2C 3F7RA 5DEZA 3QZWB 4CVXA 3JWOC 4N9OB 4X6EA 2XFXA 2VSDA 1YJDL 1T83C 2I60H 2HMID 5TDOA 3UC0L 4X7SH 5A3ID 3MOAH 3TVMD 3UYPA 3ZE0F 4ELKA 2QSVA 5E2WH 4KMQA 3DURA 4XNMA 4KMTH 1JGEB 2DF3A 2R2BB 3RVWD 3O11B 1WVZA 2PNDA 4G8GE 4X7TA 3MYJB 5IBTL 3UAJC 1NBVH 1W0WA 1S8DA 2YD7A 4CW1A 1VFUA 4NSKB 4KKBD 4Y4KA 2G75A 4C83A 2EDQA 3HR5A 4DGIH 1CFNA 3ECBA 4L29A 3AB0B 3P4NA 5A2FA 1U3HD 1T2JA 1MCNA 1WBZA 4PTTA 3DX6B 3V0VB 3FB8B 1Z0NA 4LSRH 3IJHB 3RY4A 3LQZB 4WI5A 5GQBA 3DV6A 1ZT7B 2FHCA 3STZA 2VLJE 5BVPH 3BRFA 1FNFA 4ODSH 4X98B 2NR6C 3LKOB 5FYKE 4HWZA 1E4WL 5KJRH 2PTTB 5EC1A 3WLBB 3U2SA 3MRHA 1HHIA 2JELH 4P4KD 4APQC 1TJGL 1CGYA 3RDTB 4H88L 1F45A 1BIIB 3H9YA 5M7QA 3TYFA 3INUL 5FDWB 1CFVH 5DJZA 1C5DA 3ULVD 1TDQA 1CDBA 1JFQL 3VFVA 5CMAA 2A0LD 4UV7L 5CIPA 5E8DL 4X6BB 5K9KB 5CP7A 2R0WH 3H7BB 5F9WC 4KKAD 1RZKL 4FQXC 3U0TB 5DJXA 3G5VB 3OXRA 2QQNH 2JJTC 3FN9A 3ROOB 4F2MA 4Y16D 3ARFA 4UINL 3K4ZA 1IGYB 4IRJD 5EUKB 3E3QE 5FYLE 3F7VB 1FORH 2YA2A 4O5LL 4XMPH 3F6LA 2YD8A 4PB9H 1OGAB 3B2UD 3TH4T 3O0RL 1G7LB 5EB9A 4YDLB 4YHPB 1DLHA 2VR9A 1CXFA 3H3BC 2XXMB 1XH3B 5FV1L 1GGBH 4PJCF 4XP4H 4WO4B 1EIBA 3VMNA 3MLYH 2CKBA 2AI0L 4QTIL 1FYTD 5C0RL 3C6LA 4N8PA 3ZYZA 4HKXB 3HAEB 3DMMC 2Q86A 3QBTB 3OJ2C 4ODVH 4U05A 3FO0H 1LNUA 1SHMA 5DA4A 4OF0A 4ODHL 1CIUA 1HZHL 4Y4FB 4QGTA 1NMBL 1PVHA 4MHHG 1MJ7L 2OP4H 1HOCB 2ZP0T 1UWGL 5ILTL 2HH0L 4Y1AD 4CU8A 1G9ML 1NKOA 3VFOA 5KSAB 4R9HA 5HHOB 2OK0L 2HJLB 4I5BB 4YHKL 3QDMD 5I18H 3G6DH 2D03H 5MP6L 4P2RE 3EOTH 3QFJA 3CU7A 3PL6C 1D5IL 2HLAB 4P57A 3O4LB 4F7EB 2BDNL 1FVDB 4XC1H 5J12B 4MD4A 2NY3B 4WUUD 5I17A 1ZS8A 3BO8B 3A67L 1IGIH 1BWWA 4GKNA 5DHYA 5I1CH 4J8RA 3QXVA 5IB5B 4XPHH 4ZOBA 1RK1B 3HA0A 3WFHA 4Y5VB 3HR6A 5FM5O 2JKXA 3UP1A 3V79C 4OCRL 4M4PA 4S1SH 1GIGL 3S3PA 4F9PC 2BP3A 4JFYA 1OF2A 4BSJA 4M1DH 1KCSH 1NMCC 3HMXL 3WJLC 1BD2D 2N1KA 3QI9C 2GITA 1I3RB 4HWEH 4NUJB 3E1F1 3L5HA 3T0EA 3KGRA 1A6PA 4RNRA 4TUJB 5MHSD 4WY7H 1JZ7A 4JFFB 4XHQA 4PGEA 5LQBH 4IRZL 1JMXA 1YEGL 1MHCA 2H2PD 4LASH 4UI2A 4TQEH 3K2UH 5A2KH 5KSBE 3I6GB 5J3HD 5C07E 5GS2D 3PV6A 4MJ6B 3T2NH 3BVNA 5C0DB 1FZOA 3C60D 3MBXL 4OZ4B 3KPTA 3LQAH 3P0GB 4JRYB 4KQ3L 4J2XA 3E6FA 1D5XB 1P2CA 2FBJL 2I07A 2JCCA 2PXYA 4IOIB 2DMBA 4QHUB 4RAVB 4GLRH 1LE9A 2QR0B 5HJ3B 2ERJB 3MLWL 1INDL 1A64A 1FN4A 5TE6L 1AO7E 1BFOB 3HB3D 1N8ZB 4N0CC 4UIMA 3WN5B 4WV1A 5DLMH 15C8L 1UWEL 4OCWH 1VADB 4WI7A 4M43H 4X4YB 2EDXA 1HILA 3LKPB 4HAGA 2MPAH 1K2DA 3TA3C 4BJLA 5F21B 4P2QE 2BNQE 2KQNA 3FAXA 5C7XH 3O9WC 5F7KC 3AU1A 2IALB 3MRGA 4V1DB 4JDZA 3SDXA 1XF3A 3ARDA 1NC2A 5I75C 2FWOA 3RX7A 5HDQL 5F1KC 4EI5D 5J13C 3CH8A 4GFTB 4YHNB 1G0XA 4NN6C 3IAGC 3O3BA 3EFDL 2BNRD 3MNWA 4DEPB 4M03A 3RQ3A 2VNCA 4ELMB 4AENA 1DLFL 2DJ4A 4XP1L 4JY6B 1BF2A 5D7IB 4DGVL 4PYGA 3F12A 4JPVL 1WV7T 2VLKA 4OZHE 1WBYB 5IG7B 2JB6B 2J7LA 5EUOF 1P5UA 3QEQB 3MRPB 2AABH 2EDNA 3ZE2E 1FFNB 1FC2D 1OAZH 1KC5H 5TDPA 1C5BL 4OF6A 2Q3AA 4F57L 4M9PA 1WTLA 1MOEA 4ZQKA 5GS1A 2P5EA 3J7HA 4BSWA 4Y4HC 1KFAH 4LL9A 5C0BB 1HE7A 1Q0YL 4KUCF 4CUCA 3BWAB 1G9NH 3HLAB 2EE3A 1IL1A 3RUGF 5DHVB 3MGTB 4ZUUA 4K71B 3WYRA 2A74A 2C7UA 1FNAA 5INCA 3LQAC 2G9HB 1QG3A 2IWGA 1HHJA 3S35L 4Z7WF 1H0DA 3KPNA 5LXGL 3BUTA 4RISL 3MGAA 4G6AC 2H6PB 3VXQB 4GBXB 5ANMB 4P5TD 4O4YL 5J56B 2XNAA 1I9IL 3JV0A 5CZVH 5T3ZH 1OQXA 1OP3H 3E8UL 5HVHB 4AMKH 3VFUA 1WWCA 3GSUA 1YECH 4FQIL 3U1SL 2FJGA 5IVXF 4CVWA 1D5BB 3MQIA 4KQ4L 2BK8A 5GIRB 1QLRA 4Z7UA 3UJTL 2X05A 3U4EB 4G8GD 3RNKA 5I71C 3TJHD 3MROA 4LVOC 1LP9A 3FB6B 3QRGL 1NGZA 4HPYL 1FV1B 1FZMB 2ICCA 4POYA 2A6IB 5EZIH 1KULA 3L3JB 1SYSA 4DKAA 1ZHLA 4PD4J 4FQ1L 5GISL 2UUDH 4UTBL 4NC1E 2J8OA 4L9DA 1J1PL 3PWNA 2OL3L 1FZJB 3OSKA 1MFBL 5CEYA 5DA0B 3ZE1F 2VLJD 5IR1A 3SDDD 1N5YL 1K4CB 2EIZB 2IAND 1FP5A 3CZFB 1A3LL 1MQKL 2B1AH 5FYKD 3EHBD 4N90E 4QEGA 3GJEA 4ZG1A 1G6RL 5SX5K 3GHBL 1KB5L 3CJJA 3S96A 1CTNA 2H26B 1QO3A 5GXBB 1NDMA 4DCQB 3C9NB 1TZIA 5C0FB 3QHTC 3L3DB 2VWEC 4HWUA 5IMMA 1AC6A 2HVJB 2V9QA 1A1OB 4M1CC 2GK0B 3JTSB 1HXMA 5C9JB 1G9NC 3TBVA 5BXFA 4S2SA 3X3FH 4QRPB 5EA0H 1MCRA 3UROR 2C3VB 1N7ML 1ZK9A 3HZMB 3PGDA 2ZUYA 4LQFH 4XCFH 1VKXA 1X4XA 5IEKB 5DK3A 4UOW1 1HH6A 2WUCH 5DC9B 2QEJA 4KKCD 3SCMC 2BVTA 1HNGA 1R3IH 3GNML 4KTEH 1BF8A 2R0LL 3TLRA 4Y88A 3VRJB 5GZOD 2GTWB 3BGMA 2CQVA 2X4UB 4JHWL 2WBJD 1OP9A 1VPOL 4NWTH 3SDCD 4Z7WA 4NO5B 5HHXL 2YR3A 4OT1L 2ZPKH 1QSVA 2QHLA 5EWIH 1S7WA 4FXKA 4XGZA 2P49B 3WEXB 1HIMH 3IFNL 4K7PY 4JGMA 5HHQB 4HK3J 2WIMA 1DQML 3GSVB 4XVTH 4JM4H 4OLWH 2VYRE 4R4FL 3KPSA 4LSVH 5I1JL 2BSRB 1FHGA 3OXSB 3QQ3B 4U6YA 3CH1B 3IDGB 3LN4A 1NEZB 5GRZA 3RL2B 1LDPL 3OV6A 1BQLL 1EBPA 5MEQA 5GGSB 1ODAA 3O6LL 4AG4L 5TJWK 3WLWC 6FABH 1I8KB 4NQEB 5DJ8A 1DQDH 3QFDA 4UDUA 2JK5A 3HZKB 4J12A 4RDQF 5ICZA 2O5XL 3MCLH 2BSTA 5FCSH 3CX5K 4R4NC 5DWUL 1JZ3A 5F6HJ 1NCUA 4RAUA 4EXKA 3BPCB 5T3XE 3MV8A 4M48H 4JG0L 5GGQH 4P2RD 1YUHA 3UJJL 3G5XB 1INQA 3ESUF 5I1KL 3DVNB 1Q9WB 4PRIA 4E41A 3O45A 4QY8A 3GKWH 1NCCL 5JUEL 4YHML 1OT1A 2FGWL 2MCPH 4O58H 3W39B 3TJEH 3QFJE 1DN0B 2QSCH 3VGHA 3DUUB 3UXFA 3REWA 2VERN 1IGJB 3AREA 5L88L 1GHFH 3TBWB 4DKFH 4YJZL 4K8RD 2EO1A 1J87A 4OB5L 4KK9D 1I1FB 3QHZL 5INDA 1F42A 1ZE3C 1FO0H 4KDTA 3WS3B 1R5IB 1T1WB 1GC1C 2XY1A 4OIAA 1NSNL 3PP3H 1Q9KA 4WHDA 2P7TB 5D72H 1AE6L 2A9MH 2D3VA 4YBHA 4GOSA 3BPLC 3S8WA 5TGBA 5IUSA 1CDGA 3ZKMD 1KCVH 1PBYA 4GRLA 4XCNA 5ITBH 4JO1H 2XTJC 3UEZA 3B8SA 1P1ZA 2CKNA 4YHOH 1KBGL 3GMOB 5JXED 3T0EE 3B6SB 3M8OH 3ORJA 1XF5B 3EYQC 4EXPX 5C07D 3T77B 3WKML 5FHAH 1SJHA 1F6LL 3MV7B 3TO2B 4MXQD 1YA5A 5HHPA 1VSCA 2WLZA 2AXJA 1CD8A 2NXZB 4JHZA 3D3VB 3GMPB 1VFBA 2BJML 2HVKA 4YAQB 3QDJA 3KR3L 3QXDB 3QUXB 1AO7D 4RGNE 3TT1H 4JVUA 2IGFH 2ZOLA 4RIRB 3TNNB 2JCCE 3O3AA 3A6BH 2ICWB 3WS6A 3DETC 4PJAF 4MSWA 1JRHL 3TN0C 2AJXH 2OL3B 3IS0X 4MQXC 4P2QD 4MAUL 2BNQD 3HE6B 5SWZA 3V0VA 4YBLB 1UCTA 4FQ2L 1MCDA 3MRNB 1BJMA 1SEQH 1UB5B 4ENED 1OW0C 1TFHA 5I1GL 1Q0XH 1KIPB 1T7XA 2R39A 1EMTH 3MLTB 1KIRA 4O51B 1RUAH 2DJUA 2XY2A 3VFNA 4NKDA 1KB5B 5D1QD 5ESAA 1TTUA 3SDXE 5M94B 4M1GH 3PP3K 2GAZB 4HJJH 4Y89A 3D0VB 5F1NB 4JR9L 2A6DA 3KNBA 3GBNH 2OTUA 5CD5C 1I3GH 3QEUB 3O6FD 4LLUA 1AR1C 4KTDH 5GRVK 3SKMA 5KAQF 2B7DT 4DN3L 1E28A 1WAAF 3MV11 4EIZC 5IMOB 5KTEH 5EOCL 4K3EL 2P24A 3OG4B 4WRLA 5MENB 2X4TA 4TNVF 1T1YA 2VLKE 3H7BA 4ZMAT 4IHOA 2NX5B 5BV7H 1A3RL 4N0YH 1EO8L 4WW2A 4KUZH 4F37F 4GXUN 5TFSH 2R4SL 2BMKB 1IAKA 3D85B 1N0XH 3ZMRA 3OGCA 3HE7B 1AGCB 1YQ2A 3KYOB 5HDBF 1NAMH 2P5EE 2UWEB 3V7AE 3HI6L 2VIRB 2Y5TA 1E6JH 2VZ3A 3TV3L 1I9RL 4DUXA 1MCOL 1CG9B 1A0QL 4FP8L 4PLJC 3VXNB 3FFDA 4JQIH 3PQYB 1GZQB 3CDGA 1CR9H 3BJLA 1NL0H 4E42B 5JO5B 2HT3C 3LKQA 3MRFB 1Z3GL 3B83A 2E9BA 3RVUC 3F58L 2XQBH 2WBWB 12E8H 5SWQB 1JHTB 2X4RB 3K4DA 5GGSY 5IHZA 4ZAKC 1X4YA 3FQUB 1CGSL 2LTQC 2R56L 2NY0D 1MAMH 5F3BA 1HOCA 1NCWH 4BQCA 3RU8H 5F9AC 3WHE0 3GSXB 2X40A 2QKIB 1S78D 2DLHA 1J0KA 5ITFA 4JM2C 5CSBA 2BRQA 4PJAA 2YK1H 4H8WH 2DLTA 1OOAA 4Z7UE 4UT7L 4UNTA 4OLYH 2HG5A 3J8F7 1MF2H 2V6HA 1LP9E 8CGTA 1MIEH 2R0ZH 3H0TA 2QHRL 1S7UB 3JV4A 3VD3A 4LIQL 1NUFA 3DROA 3QUZC 3U79A 3QUYB 1QP1A 1SY6L 4JREC 4PJ7F 5DJ6A 3DX8B 5DD3H 3IF1B 4M7JL 4Y5VA 2FHBA 4PJCB 5F96L 3RFZC 1OAYH 3OQ3B 4KRPC 1WZKA 4QCIB 3MA7A 4N90D 3IXAB 2W9DL 1DBMH 3HG1B 4LVEA 3T2PA 3L3KA 4I3RL 5BV7C 3ARBC 1LO2L 3MXVH 1Q1JH 3QO1B 4P23C 1EAPA 2OCFD 2QQLH 4LP5A 5T1MB 1XGTA 1KV3A 3MLZL 1XCTB 3T3PE 3WNNA 2F74A 2FHFA 4QRRB 3BN9D 3MRKA 1DP0A 1KTRL 2AEPH 3FRPA 3LQMA 4LLWA 4PP1C 3PGCB 3CLFL 5I1HH 4BKLA 3OR7B 5BVJB 1ZHKB 5IOPB 2PYEB 3U6RA 4NNXA 4M6OH 2AXFB 1FJ1A 4JQXA 5B4MC 1KCUL 5E5RB 1Z2KA 2IQ9L 4EUPB 2DS4A 4JRYA 3CFCL 3G6JF 4KJPD 3QA3B 4XTRD 3ARFD 4XXCA 2QR0A 2MQ3A 3OAUL 5FA3A 3SKJH 3QIUC 1T0MB 2LU7A 3MJ9A 3MGOA 5IIEB 2KL6A 1I1AC 1F6FB 3FKUS 4WEBH 3WN5A 4XPFH 3GB7B 2ZCHL 5CGYD 1UXSB 3QCUH 1TNMA 4S1RH 1RUMH 5ISZA 5E95B 2EEBA 4Z7WE 1EA9C 5LCVL 1PX4A 3VWKB 1DUZB 4NQXB 4EKXA 3OHXA 5D7KE 4RBPH 3AVEA 5EBWA 1RULL 2H32B 5F7FA 3C6LD 4MA1B 4IJ3C 3L3OA 3FQTB 2O5YL 4TTDD 2ZSVA 3RGVC 4XCCH 2ZNWA 4LGSB 3KPSE 4JZJB 5EIVA 5AYQA 3UBXG 1T5WA 1XGUA 4H20H 4N8CH 4PLOB 4LDEB 5E2UH 1PKQA 5J1AA 1M05B 3L3IB 5JR1H 2OR9L 5T3XD 3T08A 4ZFGH 4JY6A 3TO4C 4UQ3A 5FO9A 1QLEL 1PQZB 5IG7A 4ZUTA 3QJFB 1OSPL 1YEKH 4YPGB 1U93A 5CILL 2N4IA 1T03H 5BW7A 5BO1H 3MV8E 3BZFB 1FFNA 4ESKA 4NRZB 1U2HA 3IETB 4KC3B 4PRIE 4EDWL 4E41E 1DL7L 1U95A 3NCJH 4ODXB 3BKYH 5JLZB 5J11B 1KPRA 3QG7L 5DEGB 4G9DB 2D7TL 2RCSL 2YPLA 4LCWD 1JYXA 2NY4B 3WIHL 2SEBA 4WI8A 1CI5A 3B2VH 1JBJA 3DVIA 3BD3A 3BWAA 3BW9B 5DHVA 3LS4L 3NA4A 5HHVH 3ZL4L 3C5JB 2IBZX 4NKMB 1C12A 1LDSA 1RVFL 5J6GB 2ADJA 5D1XA 3DARA 1GGCL 2GCYA 2AJYL 1OARL 3VXRD 1OCWH 1MPAH 5EU3A 2JB5L 1F8TH 4KRMB 5E6ZA 4Y2DA 4NKIL 3MPCA 1JZ4A 5IVOA 3T1FB 1DBKH 5C92A 3FHQA 5BRZB 1CICC 4RBPK 1MIML 3BEWB 2VDLH 2M2DA 2ITDA 5ICYB 2CK0L 3T0ED 2NLJB 4L8BA 1ZGLP 4LCYA 4P9HH 5HVWA 3GIZH 1DJSA 3BGFC 1QR1A 1CDUA 2ICWJ 1MRDH 3NN8B 2Z8VC 4HH9B 4B0MM 4BA8A 4KGLA 2Z93B 3V4VH 1D5BA 5IESH 4U6VH 5LBSH 4HF5L 4QHKI 5EUOB 4OCYH 4XI5D 3KLHD 1SVZA 1RIUL 4JY5H 4I9WE 3RY6C 5L0QC 2X7LA 2ORBH 1B2WH 4HUUB 2DLGA 5TE4L 2F5AH 3FB6A 2DQGL 4OLEA 4AT6B 2ED7A 3MRQB 1L7TL 5F89B 3QDJE 2QV2A 3L3JA 4M5YL 1KSRA 2FX8L 1SJEB 1RJLB 3K2MC 1QLFB 2WINA 1DE4B 3MRBA 3I02A 4F8QA 5F7WC 1HSAB 1G0DA 1FDLH 2N7BA 5GGVH 4WHTB 4XVUD 5DRZB 5HGAA 3RUGB 1BAFH 4FTVB 3GSOB 2NW3B 5SWZE 1KIUA 4PLKC 1S9XA 1K8DA 2BVQB 2DQEH 2B2XL 1JGLH 2PCPA 2WMPA 3CFKA 3ARDD 1NC2D 4G9FB 4WWKB 4Y7MA 3TWCL 1JPTH 4KVCH 3MODL 4OQTA 4AEEA 1P53A 1FRGL 5T1KB 5DTFA 4RX4D 3TYGH 2IAMB 3MRJA 2CMRH 3ELAT 32C2B 5ACZA 2V2TB 5C0EB 1A14H 3CX2A 4KKLD 4FHBD 3EGSA 4IOSD 5C3TA 1A1OA 4M62H 1J05B 2E7MA 4X6FB 5ERWA 4TVPD 3CMOL 4CMMB 3PHOA 5IVXB 2VLKD 2X4PA 3EOAB 4JQVA 4MJIB 2C3VA 4TUKH 2I5YL 4RRPA 3V4UL 4JB9L 3OWEA 5EOQH 2OQJB 5JXAL 4NFBA 2HMIC 1U8JB 4M3JA 5A3IC 3HPLB 5T1DL 3EZ8A 3TVMC 1BQUA 2XZCH 5JOEA 4HUWA 3VRJA 2GTWA 1MFAL 3S98A 5A2LH 3WXVH 2P5ED 2EDLA 2VAJA 4XPTH 4NO5A 3RVWC 3IDXL 1A22B 4L3EA 3B3IB 3T3MF 1XGYL 3FQXB 3P0VH 2R23B 1OB1B 3UTSA 4KKBC 4W81A 5DEFB 3UPRB 2VDPL 4HGWA 3IDJA 3VFMB 3QPQD 3FQWA 5D1ZD 4DFHA 4JN1L 2P45B 4Z6AT 1A6TB 5C0AD 3MLVH 5F7UA 4X6DA 3MMEA 3DUSA 3TZVA 4D9RE 1U3HC 5C08A 1XR9A 2BSRA 5DD5H 2GFBB 3UCRA 2RBLA 3FQNA 3CGTA 1QFUH 1IM3B 3LZFL 4HDIB 1MUJB 3UYRH 4I3GA 3IFPB 5TQ0L 5GGSA 4N1HB 3ALWA 3BHBB 1I8KA 5I6XC 4XRCA 1UA6H 3GSQB 2AJZB 4ZUWB 3QCVL 2DBLL 4WCYH 3QUML 3BPCA 4PB0L 2J8UF 4FMFA 4F7PA 3THML 1YEJL 4P4KC 1A9BB 2N56A 5JQ6L 4PREA 4PBXA 1CT8A 2ITCA 3SDAB 1EJOH 1MWAA 4HS8L 3CK0L 2DM3A 1N5AB 1IVLA 1RZGA 3OKLB 4XXDA 4UILH 1JGVL 4JE4B 3DUUA 4X5WA 2A0LC 2BY0A 3U82B 4APQA 1IGJA 4KKAC 1ORQA 2A2QT 2DWDA 3ARQA 4Y16C 4IRJC 4FZEH 1I1FA 4FQCH 3IDYC 5IWLC 3U0PB 4PUBL 2DLFH 4LU5H 4KKNA 3B2UC 5JPNB 3FO1A 5CEXB 1ZHBB 4LLQB 3DHMA 4LHUA 1AI1L 4OTXH 3QIWB 4LPCA 1D6VH 1CXKA 3GK8L 1SVCP 1AGDA 1AFVL 5GSVA 1WLHA 4OLVL 5DJDA 5D6DC 3M1BB 1ZT1B 3O8XB 3JUYA 2CUIA 4TULL 3TF7C 4UZGA 3TCLA 2HFTA 1KLUB 3RBSA 3OPZH 3DBXA 3SKOB 4NFDA 5CEZL 1QA9A 5IQ7L 2AXGB 2MKLC 3B9EA 3GJFB 2CDEB 5H2BB 1N0LA 4WFGE 2XWBA 4PTUB 4NZRH 3RY5A 1DANU 3QUXA 2C1PB 4JRYE 4LRNL 3BPOB 5HDBE 1I7RB 4RIRA 1NCDH 4R8WH 4XBEL 3ZKND 1U2CA 1EEQA 1DBJH 4PJEF 1T21B 4M5ZH 4R97B 3PJSA 4JO4H 3PDGA 3NGBC 3GFUA 3LRHA 4W4OC 1UB5A 3IRZA 5MI0C 1AGBB 4M8QA 5ISZE 1LEGB 5JW4R 3BKCH 3VXMB 4HUVB 4NKOB 3KPSD 4MD0B 5EOCJ 1G6RA 1P5VA 1ZA3A 1IGTB 2XRAL 3O3EA 5IW1A 2J8UA 4YFEA 1SMAA 3LB6D 2GAZA 3D0VA 1XGPB 4LLMA 1ZLUH 1BIHA 3RZCB 4HMCA 2XKSA 5F1NA 4NHCH 1MCIA 2Y9RT 3ZSSA 4HG4J 1PKQE 5IBLD 4MQ7B 2D9QB 3H3PL 4LSSH 3RAJH 4P46A 3MLPA 1CQKA 1HHHA 3MV8D 5SV3A 2Z92B 3U30B 4GMTH 4O02L 4DZBB 4XP6H 5IGXL 2H2PC 5IBUB 5I1IL 2EDEA 4HFWB 3OF6A 4RA0C 1KJ3H 3OKOB 3WJLA 1F4YL 3QI9A 3V8CA 3RVTD 3ZTJG 5EPMA 3RWIA 4NO3B 2XPGA 3C60C 3M45A 6CGTA 1FL3A 2L0DA 3D85A 3ARED 5FOBB 4OUUB 3E2HC 4H26A 4Z5RA 3ZTJH 3REVB 1AGCA 3KYOA 2DDQL 1WIPA 2UWEA 1S7VA 5EU5A 3VXSB 1H3PH 2VIRA 2YPLE 2ZCLH 1LO4L 5LWYL 2K7QA 4L4JA 3HB3C 3VXNA 5I2IB 1MHEB 1GZQA 5TQ2H 3FN3A 2W65B 4LVNB 1AGEB 1AD9B 4GAGH 2BNUA 2X89A 3FMGH 4K3GA 2ADFL 4X80H 3MRFA 3L1OL 2HP4A 1EX0A 3T0XA 4PRHA 1HYSD 3S5LG 4R7NB 2B8OT 1MCQA 1FL5A 2NY2B 3BZ4B 1ED3A 1UM4H 4EI5C 3LMJL 4XH2B 3UDWA 4ZO9A 4R7DB 4U33A 4Z8FH 1XF2B 1ZLUK 4XP5H 4MHHI 3TA3A 4I9WD 1QFWH 4PJEA 1NBQA 1BX2A 1DBAH 2B1HL 1TCRB 4M00A 1OGTA 1T5XB 1BGXL 4U1LB 1XGQA 2YUWA 3NA9H 2GHWB 4GW1A 4N0RA 4ODTH 2EXYC 5ADPH 3HC3H 3QDJD 2JLLA 4GS7C 5DFTA 1TVBA 2OBGA 3WUWA 3HPJA 4OLUL 1SM3H 2FRGP 3LEYL 3VH8G 3KPPB 2MHAB 5DUBB 3ARGB 3CFDB 1J8HA 1OP5H 1IEHA 1EDQA 1KB9K 4WDIB 1JK8A 5EO9B 1JWSB 4LSUL 5IFHL 3NBNA 3L9RA 2YUVA 5FYKH 4JFHE 3TP4A 4LCIL 3PWJA 3DX8A 1CFSB 1F3DJ 2D0HA 4KAQH 5SWZD 1A1NA 2D31A 4X9GA 2V7NA 2V17L 4QCIA 2B39A 3BWUC 4WW1A 1E4KC 3IU3B 4GW4A 2DQUH 3HG1A 3GGWA 3VFRA 2LE9A 1F4WH 2XKNB 4OD3H 43CAA 3PWLA 5DDHA 5TDNB 1JHKL 4ZPVB 5F71A 4N8VA 5MEOA 4BFGA 2DQIH 2DQHL 1TQBB 4LEOB 5ADOL 5FB8A 1IC7H 3P4OA 2HLFD 3Q3GB 2IC2A 5T1MA 1XCTA 5AD0A 1FBIH 1WCQA 2ZUXA 5FYLH 4YZFF 5M95B 1QVOB 4Y4HA 4JJ5B 5I1LB 4QRRA 3PE9A 4UOW0 5IOPA 2W0KA 2DL2A 4P5TC 4PP2A 5CKGA 2X4NB 1PLGL 3MCKA 1BQHG 2D7PA 4JPIB 4JRXB 1CN4A 4K3DH 5CP3H 4QXTB 4LARL 3H6JA 1KIQB 4NT6A 3U4AA 1Q94B 1X7QB 4GLRI 3N85L 2YWZA 1V3KA 5IIEA 2BC4A 3I3DA 2YD1A 3LHPL 3TJHC 5HVGB 4OI7A 4PJ7B 3GB7A 4OIBA 4OLZH 3IJYA 1UADC 5HYQB 3AS1A 4H1LH 3L95B 3LKSA 4L3EE 4NQXA 3AY4C 3UTSE 5GJTL 4D9RD 5CJBA 4LAQH 4NWUH 2VDNL 4K94H 2XZAL 1A7QL 3NZHL 1DSFH 1DN2A 1OTUD 1IM9A 4JKPH 1OLZA 3WNMA 4OZIF 4TSCH 5E8NA 3V6BR 5FYJL 1J0YA 4X6DE 5DYOA 4EOWL 1YC7A 3SDDC 4G5ZL 5C08E 2EIDA 4PGDA 1NGPL 2DLEA 1T2QH 3EHBC 1JHLH 4HIEA 3VD5A 1DQQB 4NO0A 3JSSA 3L3IA 5I0DA 4UB0L 5F1OB 3T1WA 3QNZB 5KSAD 4D9QD 2V2WA 2AQ1A 4UMGA 3QPXH 5CUSH 1A2YA 4MX7B 1HH9B 5DJ0A 3BZFA 3PWVB 4U3CA 3M07A 2XOTA 3B9AA 3G6JB 2I60L 4U1KB 4X7SL 2EYRB 3MOAL 4XBGA 4CVZB 4XVJH 3DO3A 2A38A 5DMKB 4OM0H 3MX0A 2VQUA 2NY3D 4MNGB 5E2WL 5F1IB 5D71H 1IGFH 2DQFB 4KMTL 3E3QC 2ED8A 3NZ8B 2GSGA 2DAVA 4ZD3H 5HYSG 5T1LA 1NBVL 2DRUA 1SEBA 4KKCC 1JZ8A 2ZNXA 4HBCH 4HT1H 3C8DA 1HKLH 5GZOC 4IRSA 3BW9A 3KPRB 4ZFFB 4ZFOA 5LAXA 2W92A 1U91B 4NKMA 3SDCC 4HJGB 3S7GA 1OAKH 1KJ2B 4I0PB 1ROWA 3RPIB 4MXVE 1R3JB 3DTXA 3NIGF 4GRWH 4LSRL 5JOFB 3CIQA 1A7OH 5T5FH 4PJ8A 3BEWA 2R0KH 3RGHA 1P84K 3RWHB 2HKFL 4XPAH 3GSNH 4LEXL 5BVPL 4RZCB 2Q76B 3P73A 4ODSL 1ITCA 1INEH 3RWJB 4QYOB 5C2UB 5KJRL 2DYPA 3I75A 3KPMA 1IQWH 2Z93A 5ENWA 3V6FA 3QSKB 2FATH 4Z7NF 1UJTA 3BDYH 4K94C 2CRMA 1IILE 4QRQA 2PO6A 1MLBA 4RA3A 4POZD 1G7QB 4JRYD 3S37H 3SO3C 4AT6A 1ACYH 2EKSB 4MJ5A 1CFVL 3MRQA 2F19H 4YXLH 1YNLH 5F89A 5GRWA 1FVEB 3IB4A 2NW2B 1SJEA 2R0WL 1VGKB 5HY9A 5JDSB 4JCLA 2ED9A 2QQNL 1DE4A 1SY6A 3HI1A 4ZYKA 4O9HL 1JYVA 1FORL 3D1MC 4XMPL 5ISZD 2AS5M 4PB9L 1I7UA 1E27B 2Z9TA 3PIQB 3FOLA 3CFJA 3P0YH 3BKJH 1ZSDA 2BSED 3P4LA 4JG1H 4V1DD 4K8RC 3CFBB 4KK9C 4AL8H 1U3ZA 1GGBL 1A6ZB 4NJAL 3N9GH 1S5IH 4YLQT 3MLYL 3D39B 1P4BH 3AAZA 3VU2A 1RJYA 4UIKH 2UYLB 2V2TA 2E7HA 3BJ91 1FYHB 3ILPA 3U4BH 5JORB 3PG2A 1AXSB 4X6FA 2X2YA 4ODVL 3TH2T 3FO0L 3HZYB 1JPFB 3CCHB 2B5IB 1YEDA 5K59E 1RJZA 3IDUA 1MSPA 2NXYD 1GOHA 2X6MA 3QEQD 2GY5A 2OP4L 5JXEC 3CC5A 5KANG 4KHXL 2CR3A 4GG6F 1X6LA 1UB6B 4PRNA 4MXQC 1GYAA 3RX8A 4QXGH 3M17B 2EH8H 5I18L 3G6DL 2D03L 3P77A 1MI5A 2P48B 1BJ1H 1ERNA 1PSKH 2VQ1B 3EOTL 4MNQA 1IEBA 2YPLD 4ETYA 3TNMB 2IPUG 3JVGA 1AQKL 5B21A 5DEFA 2OR8A 4HX1A 4B7IA 5GGRB 4C57C 2E7LA 2UWEE 1IGIL 3KDMB 3U9PH 4PJXF 4F58H 4JRWA 4XPHL 2KPNA 1A6TA 5D1XD 1XF4B 3BZDA 3IKCB 4M02A 4Y2DD 2DWEB 3T2QA 1FL6A 4ENEC 3K46A 4UDTB 1ZGLB 4S1SL 4MDJB 4JM2F 3D5OF 3DXAB 1RURH 2ZG1A 1BOYA 2Q3ZA 4JFOB 4R90H 5F9WB 4FQXB 4M1DL 1KCSL 2Z35A 4PRHE 4OCLC 4CU7A 4PV8B 5D1QC 2VAAB 3I3EA 4WFHE 4HWEL 3KYMB 3LSOB 2IQAA 4HK0A 4U1IA 3WFEH 4EI6A 5CWSA 2EZ0D 3TBTB 4WY7L 4M4RA 3UZEA 1JF6A 5LQBL 3L7FA 4JFPB 1A9BA 3LIZH 3PHQB 4LKXA 4A6YA 4HIHA 3O6FC 2IPKB 1Z9OA 1TETH 4LASL 4YEFA 4PJEE 4TQEL 1MNUH 2CLRB 2F8OA 1KEML 1N5AA 3T2NL 2VUOA 4YE4H 5JNYA 2P42B 3LQAL 1UVQA 3SE3A 3C6SB 3RI5K 4Q9RH 1WITA 4NC0B 3WBDA 3DX7B 5AZ2H 1C16B 5H35B 1J8HE 4NN7C 3GHEH 4OFDA 3NCFB 3DMMB 2COQA 4PRDA 1HXYB 3VWJA 4X9BA 1WT5A 1ND0A 4MZ2A 4Q6IC 4UU9A 5EU4A 4MB5A 3WKNA 1YYLH 5DLML 3T0DA 4NCC2 5AYUH 5T33H 1CLYH 3ZDXF 5C09B 1A6UH 4TOYH 5KG9B 4M43L 2DQTH 2YD9A 1I8IA 4QWWD 3HG1E 2R8SH 2MPAL 2R2HA 1JNJA 1FCGA 3PDOB 3K7UA 5C7XL 1EXUA 4L3CB 4N68A 1NGWA 1G7MA 4XT1C 5CIPH 2CIIB 5KZCB 2ZUVA 1I85C 1VA9A 2G5BB 2ZCKH 3PL6B 2LAGB 3EYOB 3MA9H 5MEPA 4QRRE 4BH8A 5FIEA 2AXGA 2DM2A 2Z0BA 3GJFA 4X4ZA 3S37X 2NY0C 1Q8MA 2W60B 2OMNA 1IKFH 3RL1A 4UT9H 5I1AA 4HH8A 2PW1B 1S78C 2YBRA 4DK3A 4WTXA 1NBZB 1I7RA 3BIBX 3RNQB 3F8UB 3EW3B 3HFMH 1IGMH 2CKBH 2XICA 5CJOH 8FABA 2AABL 5ECJE 1E4JA 1T21A 4C55A 1OAZL 3V0AC 1SJVA 2YXMA 5HYJB 4OGXH 1KC5L 4LSQH 4LCUB 1UYWH 1NMCB 5D4QA 5BMFH 1I7TA 35C8H 4LF3A 5E08H 3ZSTA 1KTLA 4JM2A 4IOFD 4U49A 3B9VA 1JUFA 4OF5A 4HUVA 1KFAL 3S97C 4DK6A 1RK0B 3TZVD 5T3XH 3KLSA 1Y0LA 3KPQB 1I7ZA 1G9NL 5D7JA 1UQSB 4YHZH 4NZUH 1WFOA 4NYLA 3BUYB 3QNXB 3DV4B 3RVXD 1OAQH 5D8JH 3B9KB 3FZUD 1RZ7H 3FO2A 3OKMB 4HBQA 3EDKA 4GRMA 3I9GH 5T3ZL 5CZVL 3WO4C 1BZ7B 4Z9KB 4AMKL 4MB3A 3BN9C 4HFWA 1YECL 5TE7H 4PBVC 1BOGA 1MHPH 1YY8A 3O9WB 4NHUA 3T0WA 5FOBA 3CFIC 1ZVSA 2IADB 3REVA 4KJPC 4XTRC 3ARFC 4ZUSA 1QFHA 5EZIL 5J13B 5JMRA 1ZA6B 5HGHB 4JZOB 2EYTA 2VABA 4MWFA 3U83A 1X5HA 4F15C 2YD2A 4JN2A 4LHUD 1FZKA 2CRIA 3UZQA 1AD9A 4PG9A 3VDCA 3LKRA 4MS8D 3MJ8A 4YNYA 2AK4A 4D0DB 4NQDB 5HGDB 5E00A 4JFQA 2UZYB 5BZWB 3SGDH 1CZ8H 2BSSB 2B1AL 3C6LC 4XNXH 3VFSB 4U3XA 1A7PH 3MACH 4TTDC 4C4KT 1IZJA 1MFCH 4L8CB 2NTSP 3MXWH 3OAYK 4R7DA 3QUMA 5FV2A 5B3NA 3MFGB 3SBWC 2L4OA 3VD4A 3FFCA 2NXZD 5KSUB 4HJ0D 1T5XA 2HJFB 5DRNB 2VDRL 3QULB 1WFNA 4ZPTA 4OD1H 4HSQA 4OIIH 3RWCB 3SE8H 1M6OB 3QUXD 3X3FL 5EA0L 2BOCA 4YDIH 3NIDE 3HZVA 3KPPA 4C54A 4E5XA 2P8LA 3GMMB 3RJDA 4LQFL 5IT2H 4WDIA 4XCFL 2VN4A 5DJCB 1FFPB 4WNQA