3DXAE

Crystal structure of the dm1 tcr in complex with hla-b*4405 and decamer ebv antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
244
structure length
244
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASRYRDDSYNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natural micropolymorphism in human leukocyte antigens provides a basis for genetic control of antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility complex HLA-B*4402
total genus 47
structure length 244
sequence length 244
chains with identical sequence J, O
ec nomenclature
pdb deposition date 2008-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE02
4L4JA 1QQDB 4K71C 3D85D 4QOKB 5EBMA 4CJ1A 5C0EB 4Z7VB 1QR1A 4NSKA 1Q94B 3TH3T 4L29A 3PIQA 2F54A 2JB5L 4NDMB 3VFPB 1J0IA 4GRWF 4YDIH 3KLHD 3FL7A 4XI5C 1RZKC 3GMOB 4PJHB 1IC4H 3HG1A 4Y16C 3BGFB 2X89D 4FOMA 5FYLE 2VL5A 5HYQA 2YRZA 4UT6L 5EC2B 5A40E 3GZKA 3PP4L 1GZPA 4ZUSB 5FYLL 1U3HD 3U0PA 3LEVH 5TDPA 4M43L 1A4KA 1BEYH 2JIXD 2C4FT 4PG2A 4C54A 5IEHB 1QRKA 4U7SA 2DLFH 2GTWA 4Z7NE 5D1ZC 2NY2C 5ALCL 3DARA 3VFVA 4XWOC 1INQA 3W5MA 1A7RH 1NUNB 4QYOB 4GMSL 3K8LA 5JXAL 5IVZA 1P7HL 1NL0L 4YBLB 5EU6D 3VFRB 3REVB 3QEGL 1UH4A 1A5FL 1UM5L 2Z0BA 3VH8G 3NN8B 3IT8D 4JANB 3MRFA 1PFCA 5DRZA 4I0PC 2QSQA 5DWUH 5MEPB 4XH2B 1M05B 1UH3A 3ZLQC 4ZFGL 3EYVB 2OTPA 1OAYL 2J8UA 4UBDD 4XMPL 4FXLA 4LLMA 1MFCL 2XWJA 1YQVL 2NY6C 4NKIH 43C9B 2X4NB 1MJUH 2UYLA 1KB9K 2COQA 4WGVB 2PCPB 2HLFC 3T1FA 3UBXB 3HC0B 3U82B 3T1FB 3IAQA 5IW6B 1I7RB 1ACYH 1P2CA 4F9PC 5HGDB 3RVVD 2WBJC 1T6WA 3M07A 4FXGA 3MUHL 2A6DA 5JORA 4ESKA 1JV5B 5I15H 5IROA 3MRQA 4X99A 4QHNB 5IVXF 3DX7A 1XMWA 3VXME 2CKBB 1DEDA 4HLZH 4MVBC 1N6QL 4OCNC 1ERNA 2Z35A 4GAGL 3TO4B 3KYNA 5TJWK 2NY1C 2W91A 3BPOC 3UPAA 2D7QA 5I1HL 1J8KA 5C86A 5ICYB 4OM1L 4HUWB 2DIAA 4KROC 5K9OB 5KANI 2A6JB 3P3YA 2JJTA 1JHTA 2D31A 4NJAL 3BIKB 1M71B 5CZVH 1JYXA 4H1LA 5I8KL 3LB6C 5KSBF 1FAKT 5IV2B 4OD3L 1LK3H 5FCUL 5FHAL 3KPOB 4RGNC 1G6RL 5C07A 3I6LE 4UU9A 1OGTB 5C09A 4A6YL 3KLAB 5I1GL 2HMID 3ZKQD 3WE6B 4XZUA 2YKLH 4KJWC 3CVHH 1K4CA 2FX8L 1IAII 1FYTE 3IDIA 2YD3A 1F4WL 5EO0A 4FNLL 4LNRB 1HDMB 3K81A 1QBMH 1QFUL 3O2VL 2C5DC 3F65A 5C8JA 3TYGL 3DX8A 2WM0A 3UDWA 3GMOA 4C55A 3OXRA 5SWQB 1L6XA 3VCLA 2P48B 1R5IB 3MYZA 4NO2A 5FUCC 3F12B 2X9YA 5E6ID 5JOFA 2WP3O 4TN9A 3E3QC 1M7DA 3BWUC 3LKRA 1T1WA 2D03H 1J8HE 2IH3A 1IAOA 2IAMD 4ISVA 2OL3B 1MNUH 4C56B 3IKKA 4Z76A 3GSWA 1MJ8L 5HHMB 2OQJA 5B3JF 4CVXB 5F8RC 1OB1B 1VEMA 4P57A 1QLFA 3BP5B 3FAXA 3MUGA 1UJ3B 3G6AA 1W8OA 4X4ZA 1NH6A 2ITDA 5DJ6A 3EOBA 3EOAB 4WRLA 1OP9A 1RJZB 4KRNA 5DEZA 3OB0H 4OD1L 5CUSH 3MJ8A 3QIBA 3VXUB 2L4OA 5EA0H 5IW3A 1ZA6B 5MHSD 3ZE0E 1AHWC 3QQ9D 3QEUA 4K7PY 3RA7H 4XNUL 2VC2H 1SQ2N 5I1DB 1T20B 4U1SB 2HG5A 5EIIB 2QADC 4WUUE 4XPTL 2R2BA 5F7EH 3VDAA 1JWMB 4AMKH 4J4PD 3V0AC 1PLGL 1TXKA 3GJFH 1DBKL 1BVLB 2AQ3A 5D9SB 4AT6A 4MNHB 1TETH 2FNBA 4CVXA 3CVIH 1BFSA 1DANU 5JPNA 4N9OB 2HVJB 5GRVL 4F7PB 4EI6B 3ES6B 4P99A 3HHRB 4N8CH 5I9QB 4KI5D 5BZWA 5E03A 1V3JA 1VGEH 3ALXA 3WD5H 3P4MB 3P73A 2XY1A 2FEDC 3KPRE 3MOBL 1XIWC 1DDHA 3WFZA 2NW2B 5IOPB 1BBDL 4LRIA 1A64A 3ARGB 3QFJA 3VJ6B 3DX8B 4JKMA 4AQ1B 5TQ2L 3T2PA 3H9HB 1SY6H 4Y5XB 3SDCB 2YC1A 4DAGL 3T3PE 2ZCHL 3CFBB 1H0DB 1FNAA 1U2CA 4NNXB 3O6LL 5IW1A 4O58L 4PJFA 1UH2A 3BHBA 4R0LA 4XWGL 3L95A 1WBZB 3U0PB 1CFQA 4R26H 1KOAA 5DJDB 2RFXA 2BVEA 3NIFF 4Y7MA 1XGRA 5HGBB 4XAKD 4Y0GA 1X7QA 3P9WB 2Z8VC 1KELL 3TPUB 4G6KL 2FWOB 3LD8B 5GS0D 2X1XR 4XBPB 3A6CL 5B4MC 2D7PA 4NN7B 1FDLH 3UZVB 3SGDI 3O3AB 5CZXD 4BQCA 1XEDA 3RWIB 4PJEB 4HWZA 5HHNB 4M7ZB 3QHFL 4ODSL 5IW6A 1U95A 2FGWH 2Z8WC 5JOEA 3LS4H 4PJAA 1WCBA 3GBML 2V9TA 4J3VA 3T2QA 1H5BC 2PYFA 1D6EA 3C5ZD 3SJVA 3SO3B 1BVKA 1VFBB 1RQ5A 3ZT5A 5T1DH 3TLRA 4JM4L 3UTTD 4Q6IB 2OR8A 3MV7B 3QIWB 3ARDB 3IFPA 1JZ8A 3JTTA 4HDIA 2R56H 2D7MA 3CX5J 3KPLB 1NGYA 4UNTA 4YXHH 4H0HB 1KJVA 4F2MB 3FQNB 5C2BL 4PJ7A 3EO9H 5JQHC 1IE5A 5TFSL 4PRHD 1PW3A 1BGXL 1DBML 5TDOB 3BGMA 4QHKI 4X8JA 1ZHKA 4PB9H 2AXGA 3OV6A 1EHAA 1WZ1H 2IBGA 1NANI 4PJ7F 5M7QA 3QPXH 4J12A 4G8FB 3MV11 5L2JB 5D93C 4NZUH 1N8ZB 3JBG7 1MRCL 3ZT6A 3K4DA 1LEIA 2W07A 3MNWB 4LLWA 4G8EB 5EU5A 3RUGA 3OB0K 4NNYA 4PRPD 4L5FL 5EZLB 4MJIB 1I1FA 1I3RA 3UTOA 4UAOB 4YFLI 4OZFH 1GOFA 1IC7H 4PRID 5T1KB 3C08L 1C1EH 4X7SH 1OB1A 1INEL 1BP3B 4PLJC 1T21A 1EXUA 1L4IA 3ZSTA 2VMFA 4EDWL 3TNNB 3KS0J 4M4PA 3R8QA 4PFEA 3GJFK 3S34L 3VXOB 1N0XH 3WIFA 2I26N 4JM2A 4B41A 4LSTH 4JFEE 5ERWB 1IAOB 3DYOA 3RIFK 1M7DB 1T7XA 4ODXA 1E27A 3QO0B 1D9KB 4GBXC 4WI7A 2ZOKB 3R1GH 1EA9C 3CFCH 4H8WL 1CTOA 1QLEH 1IQWH 2DN7A 5CZXC 3TT1L 2DJUA 5E4IA 5GJSL 1SYSB 5D7LA 4RMVA 5D7SH 4W68A 2IANB 4JFEB 5F6HJ 4LF3B 4W6XB 1CD8A 1T4KA 1UB6A 4IMKA 5EC1A 2Q87A 2XKUA 5IHUL 3GI8H 1Q9LA 1MVUA 3OZ9H 3TJHD 3SKOA 4TTGA 1RIUH 1K8IB 3A6BH 1I8LC 4TUOA 1CIDA 1FYHB 1P4BL 1JFQH 1NCNA 4Q6IA 5FYJD 4G6JL 1XGTA 3EHBD 1HQ4A 5EO1A 3HZMA 1R3HB 3QUXB 5BXFA 4X9GA 1EZVX 1A47A 1Z6JT 3BGFC 3RVUC 1K2DB 3E0GA 1KYOJ 3CK0L 2YEZB 2YPKA 3NIFE 3LKQA 4QTIL 5GIRB 4WV1C 2HMIC 4OIAA 3MUJA 1SJXA 3K80A 3QUKB 2I9TA 1QKZH 1OP5K 3FO9A 4UT7L 2EYRA 3HRPA 1ORSB 2I9LB 5J6GB 1AR2A 4L3EA 5HVHC 3ZDYF 1JI2A 5CJ5A 3HPLA 4HAFA 2ICES 3MYJB 3O6FB 4ONHB 2N56A 1EUTA 1S5HA 2ZSVB 3DYMA 2AAVA 4JREB 4N0RA 3KS0H 3GB7A 1I1CA 1DBBL 5IFJB 1GGBH 3T3PF 5LWYL 1TZGL 2H8PA 1DBAL 4A6YA 1FE8H 1RU9L 3GMNB 1XF5B 1XGQA 4RMQA 3H8NA 2R1XA 2FECI 4PRAA 1CFQB 4NZJA 3TYFB 4P9MH 5DD6A 4R8WL 4GRMA 3I3EA 3MXWH 4RBPK 3QEQD 4EBQH 4R9HA 5CJQH 2PTVA 1MCJA 1LDPL 3S4SG 2J8UB 3V6ZA 2CDFB 3E2HB 2R0WH 4XP6L 2X44D 1M05A 5CD5D 1E27B 1RIHH 4YX2H 4E42B 4J4PC 4HJJH 2J3SA 4P2YA 5HGHB 4LBEA 1CFSB 1KC5H 2HLFD 2IGFH 4NQVA 1PG7X 4MJ5B 3RKDC 2RCSL 4HPYL 3QJHA 1NJ9A 4KK8C 4CN4A 3DURB 1EXUB 1U3JA 1HXYA 1ZHNB 15C8H 5MHSE 5DS8B 4WW2F 4IRJC 4RGNE 1T03H 1AGFA 3BAEL 3GMPB 1INQB 2VN7A 1UCTA 3REWB 3CDCA 1UB5B 3QDMB 3ZE1F 4B7IA 3UJTH 1KCUL 1FFRA 4CKVX 4LKXA 1S8DB 3MSPA 1CLOH 5C0AE 1J87A 4L29B 4MLSA 4UUJA 4QRQA 3VWJD 1F3RB 4XMLL 4KQ3L 3RWEA 5AD0A 5IVNA 3EHBC 3PWPB 3X3GH 4RA0C 1K5NB 1K6QH 4X83A 2XZQH 3M8OH 2FECL 3IETB 4N0FA 1LGVA 4BZYA 3ARBB 3PABB 3FMGH 3QUKA 2I9TB 4ZXBA 4GOSA 5KOMC 1GC1H 4OI8A 4B0MM 2CK2A 3HNSL 2HP4A 2PW2A 3OB8A 2Y06H 2J2ZA 1CFTB 1KNOA 1Z5LA 2EDXA 4S1QH 1FJ1A 5C92A 2B5IB 5LG1A 1NMCC 1R3JA 4J3OC 2HN7A 1G7IA 1QNZL 2NR6C 1RUPH 3FOLA 1FNEB 3NCMA 1KJ3H 1XGTB 3EYSL 1IGMH 1UACH 3IFLH 4P5MA 5E8EA 4EKXA 1GVIA 2H2SD 1F11A 1JZ4A 1YNTA 4S1SH 3TBSA 3VFMB 4LGPB 2CR3A 2R9HC 3CPLB 2R23B 3QEHB 1X5GA 3IVKA 4JN2B 4M1CC 5E2TH 3VGAB 1LEGA 2R23A 1QUNA 3WHXA 2VDKL 3ZE1E 5DTFA 2QQNH 1V3KA 3MRNA 2G60H 5JR1L 4M5ZL 1NMCB 3NA4A 5KVGL 5HDQL 5DD1L 2UY6A 5C70A 4Y89A 3PWPA 1W0VB 5E2JA 1R3JB 4ODHH 3QG7L 4OLVH 4TOYL 3NCFB 5CKAA 2VLJA 4RZCA 2J5LB 1MCBA 4O2EA 5KW9H 3ALPA 5D7IF 2WLYA 5FHBL 4LU5L 3D2UB 1W0WA 2BVPA 3GSOA 4HMEA 4KUCF 4M93C 5LQBL 1G7MA 5KAQF 1MHCA 2BVOB 1F02I 4P46A 3QUXC 5F1SA 2FIRT 4ZQKB 4JFDE 1AGDB 2ORBH 3SDDB 1YMHB 3VFNA 5IMKB 4F9PA 4K8RC 4PJ5A 4LRNL 4OCYH 3GEWB 1YJDH 1PZ5A 4GLRH 4M03A 5EOQH 1G9NC 2R4SL 4B7LA 1P7KA 3STBA 4RWYH 5F9JB 2BOBB 4JZOA 4OGXH 1DJSA 2X9WA 5DJ2B 3ARGD 3PGDA 1NBYB 4H8WC 5KSBA 1KPUA 2JLLA 1OW0C 4LSQL 4LSSL 4A2LA 1UM6H 2B7DT 2JJTC 5F7YC 1R5VB 4U2YA 1ZHKB 5LCVL 4QXTA 3TVMB 1FNGB 3EYUH 2FIKB 2ZOLA 4HUKB 4ERSL 1KLUA 1VADB 1B4RA 3K2UH 4S0SD 4HV8A 4AIZA 3B5TA 2H26A 3MLYH 2YPLB 5DVNA 4FA8A 1OPGL 3BISA 3MRQB 3P4MA 5EUOF 3QIWA 3UBXI 2D3VA 3PL6C 4NQSA 4NN5C 3LV3A 5IFHH 5GSVA 1PZ5B 5KSAC 4FG6C 1CICB 1CXLA 1TCMA 2OJEA 4FFVD 1CYGA 1KCSL 2XRAL 1FVEA 1T04B 3WUWG 1KCRH 4OAWB 2O26U 1GZPB 2R9HD 4PJFF 1W72B 2EYRB 3UYRH 3RGHA 1AXIB 4YDKL 5KAQG 1IZJA 4HXAH 2XWBB 4KK8D 5BS0B 3ARRA 3UTTB 1FNSH 4I0CC 3SDXF 4DTGH 1Y6KR 4M1DH 2ADFL 4JM2C 4JHBA 1G6VK 1Q0XL 3ULUF 2VDLL 1IGYB 3QEUB 4M3KB 3BKMH 1JNJA 2UUDH 2HFEA 1GGCL 2MHAA 4OGAD 2DICA 4JREC 4AEEA 5I8EB 3V8CA 4H20L 1IMHC 1AXTH 3DHJA 5JZ7D 3IJYA 4K9EL 3H9SA 3P30L 4XPGL 1SHMA 2RFXB 2NPLX 3VXSE 1D5IH 1JL8A 3G6AB 3RFZC 4U3CA 5D2NE 1LEGB 3PXHA 4NQDB 1ZSDB 3F5WB 4HIEB 3CZJA 5T3ZL 3GI9L 4WJ5A 1I3GL 1J0HA 5EPMA 4JFYB 4K23H 5DJYA 1WSST 4D9QE 1ITCA 1HQ4B 4GRLB 2A73A 4JKPH 3WLWC 1GXEA 4P48A 4R96B 1N6VA 1EFQA 4X5WA 2Q3ZA 2ATPB 4WO4D 4OGAC 1GHFL 4MA3B 1CGUA 1YYLH 1R3IH 3PQYD 3HR6A 3QSKB 3K8KA 4JDZB 4F7MB 3CLEL 3PQYB 2OZ4L 3VCLB 5HYFA 1KG0A 1OSPL 4P9HC 1BPVA 1U8PA 4U6VH 1JNNH 3QT2A 4OT1H 2AEQH 4Y19D 3AS1A 3DXAA 1CR9L 3F7VB 2GJ6A 4RGND 4G8GA 4LHUA 3TA3B 1QFWH 2XWTA 4ZYKB 4GQ9L 3TNMA 5C0DB 4ORGA 5T5FH 1FV1B 1QTYT 5C0RH 4GXUN 2AK4B 5DS8A 1SYVB 4MAUL 1F58L 3LCYA 3BP4A 5E8NA 2L0DA 5D9SA 1CQKA 4JB9L 4NQEA 4LVNB 1HINH 4IDJL 2D7TH 4X8JB 5DRNB 2DMKA 32C2B 1HQRA 4KI5C 3Q0HA 3MGTA 3V6OA 2G9HA 4JRYD 1I8MA 5EWIH 1SJEB 4NC1C 2RBLA 1FFPB 5FFLA 4YGVA 4KXZH 4M61A 3PWNB 3MBXL 5E2UH 4XT1C 4ZUTB 1KBGH 1L7IH 2ZG2A 1ZT4A 4CN6A 4YGAB 2PUQT 1RMFH 2EDYA 2XYCA 4OKVA 4ZDHB 4KTDL 4U7KA 1LILA 1DANT 4P2RD 2UZXB 1G0YR 4S2SA 5GISH 4XBEL 1RUKL 3HN3A 4K94H 3VXTB 5DD6B 1JI1A 1SEQH 5C0NC 1S78C 4X80L 1WIOA 3F6LA 4KTDH 2IPKA 5JA8B 5BW7C 2JJSA 4PJ9B 1JF5A 5D6CA 1TITA 3ULUL 1BF8A 1MEXH 2R2HB 4Y8AA 1MIMH 3FN3A 1S8DA 2F53B 1S9YA 1EFXA 1WAAA 2XZCH 3PGCA 1URLA 3LQZB 3SKNA 4D9QD 1NLBH 2GSIA 3IRZA 3OJMB 4Y4FA 5C08E 2N7AA 3OKEA 5I6XB 1T3FB 3IU3B 1MJ7L 4JLRA 1G9NH 4JG1H 4NRZA 3UTZA 3H9SE 4Z8FH 4PJXA 3NN8A 2D7TL 1NCCH 1EGJA 1EEYA 5GZND 3SDAA 4Y88A 3TVMA 5SWSD 5HYSG 1AQKL 5EOCH 2B1HH 2ZZUT 3WKMH 5E5RB 4FQXA 2G5BB 2YPLD 2X7LA 5K9QG 1A22B 3L3IB 4MX7B 3MRKB 4XZUB 4R2GC 2VE6A 1KB5L 1QFOA 1FZMB 4KUZL 3D0LA 1ROWA 3FJTA 2CMRL 3R0MA 4ZO7A 3BVNA 3GDBA 2VDQL 3AS2A 3EFDH 4OZIF 2EYSA 4V2CB 2EYTA 4QRPA 3PHQA 3VWKC 2EYTB 1MVFA 3MROA 5CZKA 2YA0A 2OZ4H 1T6VN 1VPOL 4HF5L 1NGPH 4LCWB 3T0XA 3TVMD 1YYLL 4ELMF 2V5YA 4X6EA 2X09A 3CSYA 4PGJA 1AGBB 2NZ9D 4DW2L 4CU6A 3FQXB 5MEOB 3QNZA 5GSRA 4HH9B 1R5WB 3GI9H 5CSGA 1XH3A 4PJHF 2QJDA 3OWEA 1A14H 4XHJD 1EFXD 5F7FA 4RBPH 1VB9A 1J10A 4X7TA 2CRMA 5D1ZD 3EGSA 2PXYD 4MA1B 4C56E 5CBAB 4GG6B 3RRQA 1U8KB 2VXQL 4N9GB 4IOFD 3S8WA 4KAQH 3FCTB 4H20H 4XBGB 3EDEA 5INCB 3V6BR 5I8OH 1R3HA 3ARGC 1UQSA 3ECBB 4QT5A 5ACMA 1CDYA 2HJKB 2IBZX 5I66B 4LASH 4MJID 9CGTA 4G8EA 3O3EB 4WWKA 5F89B 3MGAA 3QNYA 4KTEL 2L7JA 3MOAH 1LVEA 2PW2B 1O5DT 2IANA 3FONB 2BNUB 1JHLL 3IF1A 4NQUA 32C2A 3WKNA 2WQRA 4PJ9C 5CD3A 3FHAA 5CD3B 2UVEA 4GW4B 2YK1H 2YHGA 3QRFM 4XCYA 1U8OA 2PW1B 3DJ9A 4LIQH 5IB5B 2BFVL 3FQWB 1QFWI 2Z93B 1T7ZA 3AB0C 5I6XC 1MHEB 2DQCH 2ZUWA 2CR6A 4LKXB 4HKZB 1OT2A 2H1PH 3DUSB 3MLYL 3MRRA 4HIXL 2C1PA 3MMEB 3DX6B 3VH8B 5DJ6B 4ERSH 1CGSH 3OJDA 4G8GD 3D69A 4XNYH 4PJ9D 1SYVA 5GRVK 3PNWB 5LCVH 4MCZA 3ZDZE 3QG6A 5GJTL 4HK0A 1Z3GH 3MRMA 2AJZA 3W82A 4F7EB 4L4VE 3N06B 3DRTB 1U91A 4OGXL 3HE6D 2CLVA 4FQQA 3FFDB 3VRIB 5L0QC 2XT1B 3FQWA 4V1DD 3GMRA 4KGLA 4MNQE 4LRNH 2B0SL 3DV4A 4H5SB 4LPVA 3DO7A 2IALA 4IOIA 5KSUA 4PRDB 4HS6A 2ORBL 2BRRL 2APVA 4JO2L 2I24N 5AZEL 1OCWL 3BDYL 4X6CE 2F5BH 2ZUQC 5LQBH 3CFJA 3M45A 5AYQA 4ONFH 4P3CH 4YBQC 2C3GA 5FHBH 5F8QC 5E8OB 1NGYB 5KW9L 1P9MC 2E6PA 3WL9A 4BSWA 3JTTB 4UQ2A 1CGYA 4OLVL 4TOYH 2DQHL 5LGKA 2JIXB 3OKYA 3GHBH 3TO4A 2X4TB 3D3VB 5DD1H 4OD2B 2FRGP 3OAZK 3VXNA 3P4NA 3BIKA 3MRJB 4G42B 3BFOA 1WCBB 1QSEA 3I02A 1EHXA 4HKJB 2QQNL 1ORSA 2I9LA 5J6GA 1ACZA 1KJ2L 2IFGA 4IJ3C 5T1LB 5HTSA 3NCBB 4OB5L 3TZVC 3OKLA 1D5ZA 4C83A 4JGMA 2IG2L 3VWKA 1MCEA 5L8JB 3ZHKA 4NJ9H 2EO9A 2ICCA 1CE6A 5D7LE 4I18C 3RY6A 2NY0C 3EYSH 3V6FA 1UCBL 1VSCA 4JFDB 1QPPA 1RUPL 1AJ7H 4NYLB 1QNZH 5DQJB 3NA9L 2R8SH 2AEPH 1YA5A 3KXFD 2EDQA 2OL3H 5EU6E 2PYEB 4KZDL 3TIDA 2DKSA 3CD4A 1QZ1A 4EZMA 2BY2A 1YDPB 2FJGA 4HQQL 2XTLA 1C12A 2IPKB 3DNKA 3PHQB 2QKIB 3IJHA 4WI2A 1NJ9B 4MNHA 1VEPA 3BD3A 2X1OA 2IBZY 1QD0A 2PXYC 3MJ7B 5DEGA 2E7MA 3DGGB 1BWWA 4M00A 2R2BB 4LLMB 4TNVK 4HKBA 2FBOJ 2IJ0C 1E4KA 3C87A 2ZJSH 1KGCD 4ZUTA 2DQEL 4RMRA 4PJCA 5KSAD 1AQDA 2VE6B 1RFDH 3D18B 4P49A 3UJTL 2ZPKH 1BQHG 3B9VA 4LEOA 4MA1C 4LIQE 1BOGB 1MRDL 1FL5B 2AVGA 5F1NA 3TIEB 4I0PB 3VFRA 1IGTA 5FIEA 2BHUA 4OFKA 5KZCD 4R97C 1H8OA 1AGDA 3TYFA 3EYOB 3UC0H 4XRCA 3WS3A 3KLDA 1CLZL 4PIRF 4YEFA 1XR8A 1C12B 2VTFA 4U1KB 1A1OA 4R7DA 5IMOA 3FB7B 4WEBL 5DJZB 1EV2E 25C8L 3L3OB 3EUUA 3U4BH 4OSUH 4FZ8L 4K2UL 2R0WL 4XP6H 2VH5H 3FFCA 2EKJA 1LDPH 5JUEL 1AY1L 3T0AA 3ZDXF 4PGCA 4HHAA 1XCTB 2GAZB 4QXWA 1BQSA 3FQRA 3GIZL 3EZ8A 4JFZL 4GKSB 4LQFH 5J0BA 3IFOA 3C6LD 5KJRL 4K7FA 4YE4H 1FE8L 3NPZB 3EDFA 4L8CB 2GYSA 5GGRA 1TZGH 1NCAL 3D39E 5IB3B 1ZAGA 2XZZA 3MLXL 1ZA6A 3V4PL 2AEWA 2H32A 4WFFE 1ZEAL 1JUFB 2B4CH 2H9GB 5AUMB 3QAZB 5HHMD 2YZ1A 3PJSA 4H26B 4NFDA 3LN4A 2BNQB 1F4HA 1RY7B 4PPTA 3SE3A 5IR1B 4F3FB 4ZSOA 1JGVL 5FEBA 4NM4L 4NN6B 1U95B 3TZVA 4U31A 2KQMA 1PSKL 5IMMA 4D2NA 5E94A 2OBGA 4Z7VF 1BFOA 5HD8C 1RZFH 1B2WL 3MC0A 4LHUG 5HVHB 1XFPA 3FOLB 1ES0B 4G6JH 3VRIA 2V2WB 4V1DA 4PJFE 1BX2B 1P4BH 4PJEF 3CFEB 5GGTL 4JE4B 3PDOA 2M1KA 5C3TA 1NCBH 3L9RB 4EUPB 1BREA 3KYKH 5C0JB 3QG6B 1QYGH 4PD4K 3QPQC 1XR8B 5SX5H 5GJSH 2YRPA 2ZCKH 5BRZD 3TF7C 1QLEL 2ZG1A 1I8KB 3H3KA 4UUJB 8FABB 3DUSA 5GS0H 5DSCA 1FL3B 3SEPA 3UMTA 4Z77B 4AK1A 1S78D 4R4NC 2PF6A 1TZIB 4G80A 4D0BA 2GITA 2PR4L 4F80A 2EECA 4DOHB 4QGYA 5GGUA 1NCUA 3BD4A 4EDWH 2VLJE 1WLHA 5EUKB 1F90H 2XI9A 5CGYC 4G9FE 3BZFB 1LO3H 3C08H 3R06A 1N26A 4L9LC 3S96B 1IC7L 3C2AH 4I0PA 1H8NA 5HHME 3BUYB 4V2BA 4PY7A 2B20A 5DHXB 1RZIB 4QYOA 2YRLA 3U7WH 1OGAD 1FZKA 1EVTC 1J8HB 1IGYA 1Z9SA 1SMAA 3MV9E 1CQYA 2JB6A 5EULV 4MGXA 4ORZC 5CD5C 1FLRH 2LTQC 5GGVY 5JPMB 4NZUL 5FCSH 1FNLA 1YEFH 3RDTD 1WZ1L 1MUJA 3VG0H 3GSXA 1FP5A 3T4YA 4N90E 4XPBL 2EDTA 4F7CA 1E6JH 1TQBC 5I71C 2C3XA 2AW2A 5C2BH 4YXHL 3GB7B 3CFIC 4NQSB 4ETYA 5MEOA 3WNNA 3HA0A 3PIQB 1LWRA 2V2WA 4PRIE 1FRGH 3FO1A 3DSFL 4MZ3A 3G5ZA 4H25A 1HSAA 1OGAB 3EOYG 4K55A 4O4YH 1FZOB 1JPFB 4X6FB 3WMSA 3PV7A 4OZFG 1U9KA 1YMME 2PXYB 1WIPA 4QXTB 4Y4KB 4YWGL 4PJAF 1J0YA 2FGWL 4ZO9A 2NYYC 5J06A 4OV5B 1CVRA 2NXZD 1IAKA 3QIUC 1H3XA 2FLBT 4CADB 3GGWA 4QRPD 3IDUA 5GRYA 1TJIH 3VXNB 2X4TA 1LE9A 3RVUD 4OZGA 2OL3A 4NPYB 4PYGA 3A6CH 3CH1A 3NMEA 3AB0B 5T1MB 3TBTB 2XG4A 4F8TA 2ICWB 4U6YB 5DHVB 2JJSC 3MRIA 3VRJB 5INDA 1UWXK 3QRGH 2CLRB 4OIBA 1MFDH 1MWAL 2KUTA 4I4WB 1BIIA 1R0AH 1TTUA 3WXVH 1J0KA 3SDAD 4X4YA 1YY9D 3D85B 3QIUD 5DD5L 2OTUA 3MV7E 5D1ZB 2O5ZH 5D7JB 5TQ0L 1KACB 3S36H 3O0RH 5K9JL 1H5BA 4Y2DB 2P8LA 1G84A 1B0RA 3SKUD 1T66D 5J1AB 1T2QL 2VXVH 3H3PL 5FUCE 2GQHA 5CILH 4DAGH 1TVBA 1XR9A 4ELME 1NCWL 3VXPA 4P2QA 4Q97A 2FD6L 1LO4H 2HVJA 3SN6N 5T3XL 5BMFL 2XTJC 1MHHA 2NY5H 5ID1B 1P53A 4AH2A 3JV4A 3J7HA 5FA4A 4FP8H 4JJ5B 1WGOA 1T83C 5IF0B 3HNTL 2X4RB 1L6ZA 4M7JH 4I77L 1DVFD 1EZVY 1U58B 5SX5K 1BOGA 3QR2A 2Z35B 2XNAB 1TJHL 4Z0XA 1EO8L 1NC2B 1YEHL 5DUML 4LARH 1NC2A 4NGHH 3IJSA 5LXGH 1OLZA 5B3JE 4JRYA 3DVGA 3DIFA 1HYSD 1DQQB 3MNZA 2AXGB 4GS7C 3LQAL 4GAFB 4H88L 4C56D 2Z91B 1YN7B 1SVCP 4JHAL 4P2RB 1DBKH 3EDJA 3L5HA 2VITA 1MWAB 1E4KC 4DUVA 1C5BL 1K5NA 3FHQA 1VCAA 1MI5A 2AI0H 1NEUA 4EN3D 1XZ0A 2LFGA 1IZKA 4KV5E 2Y07L 2XWTB 4PYHA 5DQ9A 2V7HB 4HGWA 2HVKB 2HFFA 5EA0L 3CX2A 2V5MA 4X9IA 3IDGA 1KIPA 4H0GA 4KV5F 4O2CA 2KPNA 4PGBA 2Q86B 1YZZA 3LPFA 1YMMA 3DXAD 4KKCD 3BZEB 4X7TB 3IXAA 5DEFA 3V0WH 3WN5A 2WUBL 1XGRB 5HGBA 2XXMB 4PV8A 5CP7A 3LS5L 3SGJC 3MROB 2DI9A 3I75A 5I30L 4YAQB 2W60B 4K9EC 5ILTL 4I3SH 4JZNB 3SE8L 2VLLA 3UZEA 1UJTA 4ZO6A 2WIIA 1RZKH 3CSYB 2DQJH 3S36X 1NUFA 4YH6A 2GFBA 4YXLL 3JV0A 1P69B 2H6PB 4NQXA 4PY8I 1N64H 2FZ3A 3L3HA 2ADIA 3KR3H 3O2VH 1T4KB 1UB6B 4U3HA 1ODAA 4OLUL 5IVOA 3ARZA 3IKCA 1NKOA 1S7QA 3OSKA 4CW1A 4EDXB 4L1DA 1DCLA 1NEZG 4BK5A 3T0BA 2YKLL 4E41B 4IOIB 5I16A 1DTUA 4X6BB 4NDMA 1BOYA 3QO1A 2NTFB 3G5ZB 4H25B 5D96C 5ADOL 3FAWA 2XN9E 2P5WD 2P7TA 2XPGA 4QXUH 5J1SC 3OKEB 1F4YH 4QXGH 1LK3L 5FCUH 5FHAH 3PWVB 3QCUL 3KYAA 3DVIA 4Q0XH 4WUKL 4ETQA 2V7NB 2DQDL 5C0GB 4FQ2H 1MJJB 5I8KH 2BNRB 1U8JA 3QB7C 4ZTPL 4G43B 4NJAH 2XWBA 3H0TB 3UROR 4YHZH 3EO1A 3E8UH 4OM1H 2DJSA 4APQC 1AO7A 4ZSOE 5JW5A 1UWXH 4KHXL 3QCVL 5EORL 1MSPA 1Q1JH 43CAA 1T3FA 3IU3A 4JLRB 1NLDL 4XCFL 5D7IE 3T08A 4L8SB 4P4RB 1N6QH 5J9PA 1S5IL 4LK4A 4NNYB 1BQHA 2C1OB 4ZAKA 1A6ZB 2EH8H 3L5WA 3O8XC 2R2EB 5I1KH 4TVPH 4IS6A 5E7FA 4D8PA 3MXVH 4JFHE 4XCYB 4M8QA 4WHDA 3BW9B 2J88L 5DRXA 3I85A 4ZAKC 4EQ3A 1WBYA 1JPGA 1NUGA 1MI5E 4EIZC 5CEZE 4HJGA 1CTNA 1RZJH 4UOW0 2HT4C 1FGNH 2V2XB 4MD0A 4ZFGH 1JWUA 4Q2ZA 4DGYH 4RDQF 4ZS6C 4WUUB 4NO3B 2F74B 2OI9B 1S9WA 4LCUB 1U8IA 2PO6D 2X1WL 4NZTL 4I8DA 5IB1A 1NL0H 1MHHB 1QRNB 5HI5C 3SE3C 4LPCA 5B3NA 4GMSH 5HYJD 2SEBA 4FQPA 3WNPA 4G5ZH 3IDNB 4MD5B 4WU5B 4YR6B 4MVBD 3O3AA 3B9KD 3QQNA 1S7RB 1CFBA 1D9KD 5C0FB 2DLFL 3MA9H 4JKLA 3QZWB 4XPHL 2ATPA 1S3KL 3DVNB 4Y19E 1F3JA 4L4TA 3C5ZC 5EBMB 3ORJA 4XAWH 1IFHL 3RIAF 4M43H 2PTTB 4ZO8A 5IMLA 1Z9LA 2DYPB 4BYHA 3MRBB 5C0AA 5EG6C 2G2RA 3MRGB 3TZVB 2W59A 4UT6H 1E4JA 4QHLA 4HLJA 3G9AB 4Z78A 1NMBL 2AJXL 3JXAA 2APXA 2FZ3B 5T1KD 2A6KA 2AXFA 2PNDA 3U4AA 3HAEH 4BZ1L 4FQLL 3SQBA 3I6KA 4NUGL 3UBXG 5IT2H 3BZ4A 2A9NL 3QFJE 1ZT1B 3C09C 1BBJB 3ZYZA 4GS7B 3ZSSA 4MSWB 2APFA 4X7DC 2NW3A 2EDHA 1D6VL 1DUYA 4MD4B 1E28A 5H37H 3V2AR 2EIZB 2C3WA 3RZCB 3DUHA 5IB2A 5TE4H 3IFOB 3NACL 4F33A 3K46A 3MV9D 3HZYB 4U49A 5CIPA 1VFAB 3UTQB 2YD7A 3F8UB 2EDBA 4GJTB 3U0WL 1ZWIB 5CMAA 3OKOB 5I1IL 1DSFH 1MLCB 5CWSB 3MACH 1NFIB 3RBSA 2X4NA 5CJOH 4HMCA 2XWJB 5E1AB 1EHLH 4AYFA 1FAIL 1IC5L 4EN3A 2X4OB 1J1OH 2A2QT 2R1YA 1P2CB 3X11B 4ALAL 4BA8A 1F8TH 1KXQE 5MP6H 2XN9A 2IPTH 3G5XA 1RUAH 4U1LA 2ED8A 2N7BA 4Z7OE 1V3MA 1QRNE 3BE1H 1I7ZA 4MXWH 2GUOA 3MREA 5H94B 3VWJB 2I60H 5F72S 2NY6D 3LHPH 5FOBB 3Q5YA 1S9KC 2BC4A 2KH2B 3S35L 4OLZL 3T2OA 4X4XB 3MRCA 4D0CA 2OTWA 2QQKL 5D5MF 5DF0A 3W2DL 2DWDB 1HQRB 4OLYH 4HUMB 5J7CC 4X7FC 4NQEE 5ACZB 1YECL 3NIGE 3BO8A 2DLGA 2LV4A 5DK2B 3F58L 3KPRD 1GL4B 1MELA 3RBGA 5JIPA 4I9WD 3K2MC 3GMMA 4Z77A 2GJJA 5MEQB 4JO3L 1N5YL 4Z76B 3MPCA 2VL4A 5HSFA 4NO0B 1A2YA 1WV7T 1BQLL 4HS8H 3L5XH 4F7PA 3BZDA 3GO1L 3QIUA 5JDSA 2BVOA 3F12A 1I7UA 1S7XA 4P46B 4OCXL 2F8VA 3D85A 3OXRB 4ZFFA 5GS1B 4UINH 4KUCD 1EJOL 1XF4A 3V0VA 4ODBD 5J4MA 3E6HA 1A9BB 5I1DA 2Y6SD 4U0RC 3VXRD 2F5AL 4G7YL 3C2SA 1CDCA 1BJMA 2D9CA 2JCCE 4NUJA 1W0VA 2W0KA 2OMNA 3PJSB 4H26A 1JCKA 4WWID 5IHBA 5T33L 1NFDE 2EKSB 4CL7A 1MIEL 4NCDA 3BEVA 4UB0H 4XVTL 5TE6L 2ZNXA 4BQ6A 4P2OD 4PJGF 4U6XB 1QLRA 1UJ3A 4GAYB 3TO2B 1CF8L 3FO2A 2PO6B 2BDNL 4Q9QH 1AKJD 3P0YL 3DV6B 4QLRA 2E7LC 4M6OL 4Z7WE 5IVXE 3S37H 3STZB 1DQTA 2E9IA 5E8EB 1R24B 2YMXL 4JRWA 1AGCB 2VIRB 3OR7A 4LPUA 5DUBA 3WFEH 3ESUF 3KPMA 5JHLL 3GJEB 5DR5L 2V5RA 3TPKA 3C5SA 4AM0B 2E3VA 3ILPA 3V5KA 4FFWC 4HCRL 3C6SB 4B53A 4JRXB 5KSVA 1R3KA 5BS0A 1MPAH 3U7YH 3BN9C 1QRNA 1GGUA 4XP1L 2CIIB 4G9DB 1CK0H 5IB1B 3MNVA 4NQDE 4PTTB 5E99H 2WBJA 3ZTNL 2Q8BH 1A4JB 1PQZB 2YD9A 4PP1D 4K8RH 3O8XA 4LLUB 1FH5H 1T7YA 4OF7A 5GSVB 1HSBA 3INUL 1JTTA 4RFOH 5CJBA 5A2LH 3WO4C 4EEEA 4TQEL 1FH5L 1E4XH 1WQVT 3VMNA 4U1KA 4JANA 4K8RL 1BJ1J 1YQ2A 1I7ZB 4N5ED 5ACZA 3I2CH 1CK0L 5KVFL 3ILQC 5K9KB 4LL9A 5DC9B 1A1NB 5ESAB 4WFHE 5JOPD 12E8H 3NH7H 5F7NC 4X9FA 3LDBC 3VXRE 2VWEE 5FM4A 5DR5H 4EN3B 4AEHH 5JW4N 4IDLA 3ARVA 1BD2D 4QRSB 3BKYL 4JPIB 3WFEL 4ZPVB 4HIIB 4NCC2 1MRFH 2YPLE 3SDDA 3PDGA 2Y7QA 5L2KB 3FT3A 4AENA 1ZLWK 5KVMC 4FFZL 4M6OH 1RHFA 1X6LA 1IQDA 1NGZB 3TESA 4L9LA 4Q9QL 2FJFA 3SDXB 5A2JH 2BY1A 5FKAB 3G6JE 5MERA 1JYWA 3P4LA 5E5MB 5D2NB 2CKBH 5D93B 5E1AA 5CS7A 3HZKA 1BJ8A 1ONQA 1NGQL 5HY9A 3MRFB 5T33H 3D48R 5C0EA 1FCCA 1X4YA 4Y5VA 1P6FA 2Y5TA 4HWBL 2VISA 4JFQA 3L3GB 2AJYH 3MV9A 4BSVA 4U1IA 2F5AH 1YPZE 4LVOB 5C0ND 3CZFB 2DTML 3X3FL 2H2PD 4ONGH 1A6AB 5C08A 4MB4A 4G6AD 5DMGC 2AS5M 4KKBC 2ENYA 1QACA 4WV1B 5HHOA 3UPRB 2EDEA 1WBXA 2VZUA 4K7PH 3O81A 1LO0L 1ZTXH 2BVYA 3O4LD 5DMJB 5FGCB 3GO1H 4N0UE 1UC6A 2DIJA 3QUYB 4UIKH 3RWHB 1GAFL 1T1YB 4OM0H 3QZWA 5SWZD 1CL7H 4X6DF 4OJFH 3GKWH 1LO2H 1B0GB 5BS0E 1RZGB 4ODTH 5DD3H 4O02L 1F2QA 4JDTL 1DQLL 4Y4HC 3PHOB 1MFAL 1KEML 4OZGE 3L3KB 2K1MA 5DFVD 3ARUA 1DQJA 5FA4B 4X0KB 3IETA 1PJ9A 2NY1B 3BPOB 5I0DA 2DQIL 4OLYL 1D9KA 3TWCH 4PTUA 1KPVB 3W2DH 1AP2A 2DKMA 3LRSA 3OTTA 3QA3A 2BVUA 4RFEA 3FQTB 3RWDB 1FO0H 4U1GB 4EI6A 4IEFB 3VA2C 1SJHA 2I60L 1G7QA 5C0BE 3WIHL 1RD6A 3TP4A 4MXWL 4JFFB 4Z7UF 2DWEB 3U2SB 4JCLA 5IB5A 5JMOC 2OK0L 3T0EC 1A21A 3M17B 4FS0A 4NHCL 4ZXBC 4DOHE 5E08L 3K1DA 4FQIL 5L88H 2HT4D 5I1JL 4PRPE 4DFIA 3TIEA 4LCCA 5HI3C 5B8CA 2V6HA 1UKSA 4EN3C 2EO1A 3LMJL 4QRRB 1IILE 5B38A 1J1OL 4LVOC 1FAIH 1IC5H 5F3BA 3ZZ1A 4ZTOH 4YHOL 1MCOL 3FB6B 5F7HA 2J6EH 2OXHA 5CJOL 1TZHB 1H3WM 3A67L 3DGGA 5T5NF 1CU4L 5L8KB 3U0WH 1D6EB 1HHHA 4LLDA 3KG5A 1JPTL 3GGWB 2OR7A 3CXDL 5FUZH 3C9NB 2CSPA 1NFKA 3VFSA 2F58H 1XF2A 3P11H 5JMRA 3QUZC 1YEEL 1AIFB 1OQXA 1M6OB 4NKMB 3SKJL 1CBVH 2N4IA 1XH3B 3O41A 2NY2B 4NYLA 4F57H 5HHQB 4OLXH 4ZUUA 5GRWA 4MJIE 2DIBA 3D3VD 1C08A 1P1ZB 2HJLB 5IT2L 4OIIH 4QHMA 4NO2B 1JE6A 5E6IA 4MQ7A 3BIBX 1CE1H 3E6HB 4RCAA 3RTQA 5IHZA 3RGVA 3T8XB 2X41A 4EI5B 2FB4H 2AJXH 5JIIA 1JWSA 1HH6A 2E9BA 1JP5A 4WY7H 1ZLWH 3PE9A 2ITCA 2Z31D 4U1NB 4JY4A 2FL5A 5ESVB 5DLML 3WYRA 3MV8D 3DBXA 1AXSB 3UJIL 4XPHH 3T2NH 3BEWA 4OF5A 3SGEH 3MA9L 2BSRA 4F8QA 5HHXH 3IU4L 4JY5H 3KPNA 1SMOA 3WLWD 4HUVA 3IKCB 1K8IA 4OZHB 5BJTA 4XCEA 4G5ZL 4MX7A 3TV3L 1K8DB 5IGXL 3X17A 1IBGH 4YQXH 3GMLA 1H3UA 1KUMA 2CH8A 5A3IC 4L3EE 2P4AB 5IEKA 4NBYB 1HZHH 3QHZL 1KIQA 2X4UB 3RDTC 4ZNEE 5E2VH 4M6ML 4HFUL 3UTZB 3FO0H 1KFAL 4DQOL 5EB9A 2YC1B 4PJAE 1A3RH 1MCDA 3JV6A 5ERWA 1D5XA 2NY7H 3SQOH 4S11A 4KK9C 1RZJL 1RVFL 4XP5H 1Q9KB 4Y5XC 3SDCC 2P1YA 2BNQE 4PS4H 1NFDF 4GLRI 4PJ9A 3CFDA 4XCNA 3QULA 4LSRH 2J88H 4MS8C 2B1AL 1KIRA 3U9UB 1UFUA 5D2LE 2OZ4A 4PRPB 2E7LA 3DIFB 4R4ND 1ZGLM 2FCBA 5KTEL 4OBSA 3VGBA 2J8UE 3LB6D 3HS0B 3B2VL 1X4ZA 4OCSL 4YC2C 2HJFB 1T80A 2AJSL 2VR5A 4XCFH 3G08A 4JCMA 2BY0A 1ZE3C 3QCVH 4FTVE 1FORH 1HHHB 5DVLA 2ZUXA 3ULVC 1UM4H 5EU6A 4LLVA 3ARED 4GKZB 3FZUD 5KG9A 1IAIL 1MCPH 4ZTPH 3SDYL 3EDDA 1AC0A 4G8IA 1FL3A 4FQ2L 2IAMB 5GZOD 3AAZA 1DVFA 4Q0XL 4WUKH 1YEKH 2WINB 5FAAA 3QDGE 4QXUL 2DYPD 3RVVC 1JYNA 3V4VH 4QTHA 1JZ3A 2OP4H 4P9HH 3MA7A 5KANG 3WNLA 1NQBA 4LSDA 3BKCL 5D1ZA 1E6OH 3U48A 1LK2A 3AY4A 1U3HA 4PJIF 4Y4HB 4X0KA 1OWWA 2VABB 1I1AA 1GYAA 1UJ3C 2X89A 1EIBA 1L0YA 4CAGA 3F62A 1LNUA 1CFNB 5DHYA 4YXLH 4BQ8A 2V7NA 3GRWA 3LRSB 1BF2A 1RJLA 3Q1SL 5F96L 2XKSA 5DUPH 4KFZC 5T1MA 3TBTA 1IL1B 4UILL 4R3SA 2ICWI 3QQ4A 2FWOA 1S7VB 4NKOA 1GPOH 3TCLB 4DK3A 1YPZB 5DO2D 4I3SL 3SE8H 5ILTH 1JRHL 5MEQA 2DDQL 3MJ9L 2ZCLH 3N1GC 4GH7B 1MCWW 2CUMA 1CWVA 3JZ7A 2WUBH 3RZCC 4LCYA 3V0WL 3T0EE 2V17L 5ISZB 4JZJB 2IQAA 3VI4F 1S7SA 2YN3A 4PJ5E 3B6SB 3RVXC 5IP4A 1I9JL 4G6AC 4J3TA 4WCYH 3CCHB 4ZOEA 2P5EB 4KRPD 5DMGD 1H3TA 4F58L 2QHRL 3PWUA 5CIPH 4YK4B 4DZ8B 2CKBA 3HB3C 4RAUB 2Y07H 3VI3F 2W92A 3D39A 3MR9A 4QHNA 3KDMA 1HHKA 3C60D 3DETD 2AI0L 1I85A 2J6EA 4YAQA 4Y8DC 3B2UD 1C5BH 3BPLC 3V0VB 3C09B 4HUWA 4JRXD 1NCDH 4JHAH 5C7XL 5GRXG 1X5IA 3D3VE 1MHPL 1I9RH 2LTQB 1T5XB 3BRGC 1BM3H 3HC0A 5IBTL 1A6WL 1FVEB 1T04A 5I75B 4QRSA 2OJEB 4EVNB 5GZNC 4QO1A 5BV7L 4LARL 1ZS8A 2GK0B 3O41B 3TBVB 1YEHH 1EO8H 3T04D 4E9LA 1F2XK 1MCCA 2E8ZA 3FT2A 2A0LC 3C8DA 4I77H 1IQDB 1UWGH 2EEAA 4R7DB 4P59H 1RZIA 3HNTH 1MCIA 3LN5A 1A6VL 1A1NA 4FQCH 4P2RA 1T2XA 3UTQA 4JR9L 3ETBF 3O6MH 3CDGA 5I18L 3PG2A 4N68A 1WWAX 4MQXC 1M7IB 2X4PA 4EJ1C 1KYOK 3KPSA 5L9DL 4X98A 3HLAB 3W11C 5CILL 4X98B 1T2QH 3D0VA 3D9AH 4KDVA 2NLJB 3HI5H 2GTWB 3BKJH 4OBRA 3O0RL 3S96A 2BNRD 3I6KB 1S7QB 5J8OA 5L7XH 1PQZA 4OUUB 4YIQB 4PTTA 4YHKH 1R0AL 2EZ0D 5BQ7A 3NCYS 4NNPL 2QBWA 3CDYA 4W70A 4KZEL 2NY4C 2UUDK 2HFTA 2NX5E 2FJHA 3D6GA 1ORQB 4JRXE 1ZS8B 3PDOB 3ARDC 3VFTB 4KI5F 4UIMB 4Q6IC 1IL1A 3BN3B 1WC7B 4WW1B 4UOJA 3Q5TA 4NSKB 3W11D 4JZNA 1FC1A 2VLKA 5E0QA 3DRTA 2BCKB 4D9LL 2VR9A 1BFOB 4M5YH 4PGEA 3SGKA 2QTEA 4YBLC 1RURL 2FO4B 5CJXC 3ZDZF 1FFOA 3EJYD 4O2EB 3RZWA 2DQFA 1UZ6F 3I02B 3PQYA 4UT9H 1RIVH 4NC2B 1QSZA 4Y2DD 2JCCB 3OF6A 5IJVB 1JMZA 3L6FB 4O4YL 1T7VA 5GRUH 5HDOA 4IBLT 1FG9C 1FL6A 1DQDL 1U42A 4ONOA 4RX4A 3B9KC 3U36A 4NRYA 3S88L 4I2XB 4U0RB 4AG4L 5HXMA 4DKEH 1XGPA 4JVUA 1C5DB 3EYFA 4HBCH 3QUMB 1BAFH 3WHXB 1V7NL 2R69H 4NFCA 3NFNB 4JQXA 1CZ8H 1E6JL 2GTZB 2AERT 3NFNA 1C5CL 1XF4B 4K3EL 4UQ3B 4D0DB 5HGGS 1A6UL 5K9OA 1YEDA 3ARBA 3PABA 3VG0L 4J8RB 3MUZ1 5IM7A 4PUBH 1U0QA 4TRPH 4E41E 3FB6A 1KXVC 4D9RE 3WDHA 1FYTD 2VQ1A 2X42A 4OFIA 1NGXB 3DPBA 3ROLA 3WIFB 1H9VA 4FZEL 4P4RA 5SWSB 1EBAA 3QDGD 5GS1A 1NUDA 2P49B 1T1XA 1NEZB 1XGUA 2YA2A 1WK0A 2P5WE 3VFOA 3B9DA 4GUPB 3MODL 3QJHB 1G9ML 3RHWK 1K4DB 1ZA3A 1ZGLA 1NBVH 1BHGA 4LSUH 1XIWB 3DX6A 4KHTH 3CIQA 5IWLC 1BZ7A 3S3JA 5JHDA 4DK6A 3RWGA 2NX5D 4D0CB 1FSKB 3W9EA 3O6FC 1R3LA 3O3UN 5DI8A 3FTGB 2FX9H 4KDWA 2BSTA 3VFWB 4JHWL 1Q72L 1P7QB 2VUOA 4NOFA 2M2DA 1EK3A 4FQHA 5EU6B 2A74A 5EFIA 4OTXH 2XFXA 3SBWA 4NQVB 1MOEA 4NRXB 1KV3A 4OFVA 3OKDA 5GGUB 4JN1L 1N4XH 3VGHA 5IJKA 1TZIA 4D0BB 2H6PA 4IIQB 5BV7B 5GGTH 3NAAH 3KPNB 1T1YA 2PO6C 2FHCA 3MV7A 2YD5A 3HMWH 4RNRB 3OAYK 2W9LA 2VN4A 1GH7A 1KCVH 1B2WH 4XC1L 3VRLF 4J2XA 2EDJA 1CE6B 4TVPD 4OQTA 2OMBA 5FDWB 1OARH 1FBIH 2VXTL 1NAMA 4EOWL 3I6GA 1SM3L 1QFPA 4KJPC 4DZBB 4NM4H 2Z92A 5IKCA 4XVSL 2VLJD 3JVGA 2VLRE 4FQ1H 1U8JB 2YEZA 2ED7A 1MREL 2R0LL 4EVNA 3PWPD 3S98A 2Q86A 5L0QB 2VWEC 3MR9B 2EDFA 1U8QB 4YUEL 3W0WA 5AZ2H 1WFUA 4JKWA 3WFCL 5F97E 4BFIB 3PP3H 3AREC 5I0ZA 4ZS7H 3VXMB 4CW1B 4JPKL 4UV4H 1AIFA 5J12C 3RVTC 3GRWH 1S7SB 2AQ2A 2DAVA 1CLYH 3GIZH 4MNQD 2Q76A 3L5IA 4LLQB 4V1DE 3KPRB 3MRHB 2Q7YA 3RWJA 1RUQH 1J86A 1NAKH 4Z18A 1IEAA 1FGVH 1S7WB 3DWTA 4OFYD 2HLAB 3KYMB 5JUEH 1VFUA 5I17A 2GCYB 2W9DL 3SPVA 2W9EH 1BZ9B 4R3SB 5CGMA 3CFBA 4LMQE 2N1KA 5MI0B 1VKXA 3U4BL 5EU3B 3Q48A 3JWNC 2L7UA 4ZXBD 5D7LB 3SCMD 2R0KL 3C5JA 3OX8A 4BM7A 3T0EA 5CINH 2IALB 5KSUB 2EC9T 1YMMB 5D8JH 1KT2B 4YHYB 5C0FA 3HC4L 3RPIB 4MZ2A 3MMEA 4XNZB 1D3CA 2ZSWA 3G5YB 2BOCA 5DZOA 2CGRH 4JM2B 3QDGB 4U0QB 3T1WA 2DQEH 5MI0C 1RUML 4JY6A 4MAYB 2JE8A 5L6YH 1D5MB 4QRTA 5IK3B 1T83A 1F4XH 1MWAA 4OLWH 4NBZB 2FBJL 1YEGL 3TVMC 4P3WA 4CU7A 4Z95L 3BMWA 2C9AA 5TDOA 1JWMA 3VD9A 5EZLA 1N59A 3DROB 2BNUA 3O3BB 2HH0L 3PWNA 4ZMAT 4XNQB 4E5XB 1MY7A 4LMQI 4RFNC 4O51A 5DHVA 3NA9H 2R8SL 1DN2A 5J11C 4GAJL 2K7PA 1JPST 5F1OB 1AI1L 1EERB 4R4FL 5ENWB 2VSDA 3BMVA 1EX0A 3QUML 1U58A 3T77B 1X5JA 2YPVH 3BRDA 1FFNA 1MAML 3IRPX 5D5ME 4Q9RH 4DGIL 2IAND 4WUUD 1WUNT 1IAIM 4CADA 5JQ6L 2EDNA 4OB5H 4P4KD 4DVBB 2AK1L 4JO4H 3QFDB 3HFMH 3Q6GL 1JVKA 4CU8A 3BSZL 1TNMA 3FN9A 2E27H 1I3UA 3U36B 5CEXA 3B5HA 3B3IB 4JHZA 3GUTB 2H3NA 1N3NB 4M7LT 4YHIA 2VDOL 5GS0C 1IC1A 2DQHH 3MYJA 5F9DC 5BO1L 5T3XD 1AO7B 2P46B 4M7LL 5I1EL 4GXVL 4U1JB 2J4WL 4P3CL 2MCPL 4YHNA 3RNKA 2VLMD 5HHNA 2R1WA 3IAGC 5KVEL 2X5PA 2ZKHH 3BDYH 1OCWH 4MNGB 3M1BB 3MRIB 5AZEH 3VRJA 4HKJA 4ETQB 3HB3D 2BRRH 1RPQA 3B43A 5J13C 3SBWC 5DZLA 2B0SH 1S9XB 5FYJU 2DQTL 2GCYA 4U1HA 3PWUB 3KPOA 5GPRA 5H35B 5IROC 4WHTA 5CEXB 2MCG1 3TJEL 5DJYB 3KNBB 4KXZI 4MWFB 4QOKE 2IQ9H 2WIIB 5GRJH 3WSQH 2I5YH 4ZG1A 1NC4D 2EDRA 2VDMH 1QSFB 3RDTB 5DK2A 2DQGL 4PB0H 1MQKL 4NKQB 1OAZH 1SYSA 4PJFB 4NO0D 4GSDH 3JTSA 2GFBB 5I19L 3DRQA 4H0IA 2R0ZH 5FYJH 1CGSL 3WJJC 2WUCH 5FK9A 2IADB 4NN6C 1DEEB 4DGVH 2IH1B 2DTSA 1PZUB 5C6TL 6FABH 1A1MA 5DA4A 2B4CC 4TSCH 3V6OE 3HUJF 1HWHB 3SE9H 3X12B 5CCKH 3CSGA 3O8XB 4LIQL 4LLUA 3SDXA 1ZA3B 3P2TA 2YK1L 2FX7L 3RKPA 3VJ6A 1GGIL 1NAMB 4S0TD 4DVBA 3JUYA 3MOAL 1C08B 1P1ZA 4U4BA 3QI9A 4IRZH 3OBAA 3SY0B 4HEPG 2O5YL 2HWZL 4KTEH 1R3KB 3LKOB 3B83A 3RAJH 5GZOC 5EUOA 1EEZB 2YBRA 1MY5A 3QDMD 4AZ8A 4ZODA 1HIMH 2WINA 4N8VB 2R2HA 3MBEA 3ES6A 4K3DH 4RISH 3QAZC 5I8OL 1RJCA 4DN3L 4PJDA 4F9LA 3TT3L 4BZ2L 2ARJQ 3IDXH 4NP4L 5D70H 3STZA 2B8OT 1G7PB 4LAQL 2ITDB 1JGUL 3VFGL 2ENSA 1KEGL 1TDQA 4NWUH 3CVHA 2A83B 3HR5A 1ITBB 3PWLB 5DD0L 1A6TB 3FRUB 5TDNA 3N9GL 1F3DH 4FFYH 1OF2A 3WFDL 1OD7A 4DW2H 4P46C 4RGNB 2C3VB 2X1PA 3LQMA 4YHML 1CIUA 2K9UA 2WWKO 2MTPA 3QXTA 4TNWF 2BSSB 3VDCA 5GGSA 1NGPL 4TSBH 1VPOH 3KJ6H 2DQFB 1L9MA 4P4KA 2P24B 5I1CL 4RMTA 4HWZB 7FABH 1Q9WA 2XTJD 5D5MA 4IM8A 1KG0B 3MZGB 4RFEB 4LHUD 4OZHE 1BLNA 1S7VA 2I25N 4H5SA 4NZRH 3EFDL 1YEIL 2DI7A 1G0DA 2VDQH 1INDH 2FH8A 4NWTH 1A1MB 2UV3A 3F7VA 5DMKA 4QOKA 1MF2L 1HI6B 4Z0BH 5ITFB 1KB5H 4OCMC 1H3GA 1UZ6E 4JFYA 2Y23A 1U8MB 2AV7A 4W81A 3WKML 3FB7A 1HDMA 1AQKH 1U3HB 2VKXA 2GTZA 3HAEB 2CRIA 2XQYG 4JN2A 2C7UB 3GSUA 5D4QA 3D5OF 1ZANL 5HYSB 4Y16A 1NCCL 3B4NA 5ICYA 4Z0BL 1JZ7A 3NZ8A 4FTVD 4MJ5A 4QWWD 2NXYC 4BSVB 2DL9A 1MJ7H 1G7HA 4NWTL 1AR1C 4NNXA 1YEIH 1S7TB 3MZTA 3QXDB 4NZRL 2HFEB 2MHAB 1H0DA 4H1LB 5F7DB 4MDIA 3WN5C 3L3JA 4XC3L 5LBSH 5HHPA 5ANMB 3ULUH 4TSBL 2FJFB 4I18A 3RY6C 1SEQL 1H15A 3IJYB 1NCTA 4LCIH 4K94L 4XBEH 2IANE 1CVSC 5KSAB 1HSAB 4IRSA 1EAPB 4YHMH 1OM3H 2EC8A 4IJ3B 1NDGB 1ONQB 2XY2A 3LIZH 3MBXH 5E2UL 3TIDB 1EEZA 2YBRB 1BD2B 4P5KB 3N9GH 5C9KA 4L3CA 4Y4KD 4R2GD 2Y36H 3BESR 4OFYA 4KVNH 5DJAB 4NWUL 2ADGA 4C4KO 2PYED 1QPXA 1JGEB 2AXHA 1J0JA 4G6ML 2IMMA 4LAQH 4XXDB 3THML 4P3DA 2VZSA 2WMPA 1HINL 5D70L 4GQPH 3IDXL 3ME0A 1G6RB 4J4PA 2UYLB 1F58H 1AD9A 3BGAA 2DWDA 3IYLW 2J5LC 4JFPB 3LVEA 5C0RL 1WWCA 4HH9A 5DZNA 5GHWL 4K3DL 4RISL 3WLBB 2PKDA 1I1YA 1HIML 3WIHA 3N1MC 2IH1A 3RAJL 4RGOH 5C0BA 2HWZH 2A77H 4U6HA 4X6BA 3R8BB 1J9CT 4KQ4H 4NT6B 5F1IA 4BSWB 1I8KA 1QO3B 2AXFB 4GRLC 3TH2T 4QRPB 1YY8A 4TPRH 5EC2A 5KSBB 4Y1AD 5IBLC 1OSPH 5J56B 1B3JA 4LOUC 3LKPB 5GGTA 4TSCL 4WHTB 1G7HB 4PJ5D 3C6SA 3PP3K 5C6TH 6FABL 1P5VA 1F4AA 1T0MA 2HTKC 1J18A 3N1QC 2WUCL 2LU3A 2R0ZL 5FYJL 3HI6H 5I19H 4WVRA 4K23L 1YEJH 2AJUL 3MNVB 3LSOA 5T3ZH 4JVPA 5IBUG 1T1XB 3VGAC 2EC9U 3KJ4B 1MQKH 3AU1A 2YSSB 4PRHB 5DGQA 3S5LB 4UI2A 1ZVSB 4HK3N 1D5IL 2P43B 2I5YL 4HXBH 2X1QA 4LNRA 3WSQL 4XPGH 4LHJB 4UDUA 3IVKB 5INDB 3TJEH 1I8LA 3D39B 5C07D 1OGAE 3MLWL 1IGCH 2NR6D 3SPVB 2CO7B 2NX5A 4CGTA 5IMMB 2B39A 5JNYB 2ADFH 1KTDA 5BOZG 4MDJB 1VERA 1FNSL 2WSKA 1JIBA 4HXAL 4LF3A 5D1XB 3UYRL 5I1EH 2BJMH 3IFNL 1T66C 5D1XD 3VFMA 3QNXA 1AGEA 1UZ8A 2BERA 4HIJB 3U9PL 4RQQA 4D8PB 3LOWA 1IGFH 5IFHL 2OR9H 1SY6A 4WW1A 5IB3A 3UYOD 5I9QC 2MFNA 5GGRB 4IRJB 2EDLA 4MD5A 3Q6GH 2AK1H 3PHSA 3PGFL 3AU1B 4KDTC 4L8BB 5DYOB 3LKSA 2D0HA 3CGTA 4DZBA 5JQ6H 4Z7UA 1W72A 4WEMB 1A0QH 5ALBH 5EO9B 2VXUH 4M7KL 1K3ZA 2Q6WB 3OJDB 2YPVL 3MJ6A 2Q3AA 4LSQH 4OUOA 3MLPA 1B4JL 3SO5A 3QUMH 2JF1A 1H3VA 1GZQA 2GY5A 1HILA 4M8VA 3I3DA 5A43C 1UB5A 1JK8A 1JF1A 5EOQL 1T22B 1QSFE 3HE7C 4OCYL 3MGOB 3ZDXE 3MREB 4M7KH 2VXUL 4NHUA 4J3UA 1A0QL 4ELKB 3FQUA 1NDMA 2KKQA 2I07A 1CD0A 1RUMH 1B0GA 1WT5C 2GSGA 1ZT7B 3K4AA 2RIKA 5A16B 3HLAA 5BRZB 4EUPH 2NY0B 5TH2A 3BT2L 3RNQA 4FABH 3QG7H 2OR9L 1EDQA 3UEZA 1UQSB 4QT5B 2QADB 3QYCA 1N2RB 4M5ZH 4WIQA 2DJ4A 2MJWA 2G60L 4Q58C 4QEGA 4U2ZA 1W72H 5CINL 3IS0X 3N50A 3O11A 5KS9B 1F5WA 4HKXB 4P3DB 2R0KH 2VDKH 3HG1E 4K94C 4GRLD 3S6CA 4UNUA 1I8IB 1EJ6A 2GT9A 3IXAB 3MFGB 1X44A 2BNRA 2GK0A 1X3DA 5K33A 3AFLA 4BFIA 1E28B 3VI3E 4BUHA 2W9EL 3L3JB 1NDGA 2NCMA 3MLWH 3WFHB 5DJXA 3WDIA 5J57B 3TN0A 1NAKL 3P9LB 3VD7A 4BSJA 2VIRA 3OR7B 5I73B 3GMQA 4WI3A 5F7WC 3HUJB 3QDJB 2Z92B 1KSRA 4UQ3A 4D0DA 3HNSH 2YPKB 3ARTA 3QH3B 4HKXA 4P2OC 1YUHB 1MUJB 3TFKD 4TUJA 3C8KA 3LEYH 4F3FA 2XZQL 3M8OL 2XXCB 4MSWA 2YWZA 3QWOB 3GNMH 5BVPH 5AZ2L 3X3GL 4QY8A 1TZHA 4RNRA 1HHGB 4ZUVB 2VLRD 1JRHI 1CLOL 1KN4H 4NKDA 1NPUA 1B6UA 1RHHA 1BFVL 1MREH 4OGYH 5F9WB 4LCYB 3HPJB 4OFPA 4L8CA 5D7LD 1U41A 5HGAA 4NRXA 3BAEH 3CAFA 1SM3H 3EOAA 4MXVF 3MUGB 2RQ8A 3LKNA 4RIRA 2RCSH 3QIUB 3DVNA 3C60A 2HJFA 4OF0A 3MA7B 1U8IB 3HMXA 1S9VA 4HJJL 4ODWB 4O51B 2A77L 5BRZE 5FO7A 4JM2D 1OTUC 3NAAL 5AAMA 1S9YB 1TLKA 3D2UD 3ZKXC 1GZQB 1OOAA 1UXSA 3ZHDA 1I4FA 3VXSB 4PTUB 2WBJB 3WIIL 2EDDA 2D7OA 4IMLA 3MXWL 4PGZA 1NEZA 1XGUB 1G7MB 3VXRA 1FVCB 1Q72H 2HKFH 2VYRE 1IM3B 2F74A 2CD0A 3IXTB 4I4WA 4PY8J 4G6MH 2FX9L 4I48B 3GSNH 4MJ6B 4KVNL 4HGMA 2OTWB 3DO3A 2Y36L 1GGBL 2PYEE 1DBBH 4N0YH 3NIGF 1VKXB 3C60B 4HDIB 4KHTL 1U8LA 1FPTH 3MGTB 4GKNB 3R0NA 3OQ3B 3EBAA 3G6JA 4TTDC 5L8LB 1LQSR 5D1QD 3S3PA 4WV1A 4LCIL 5F21B 3V5DA 1B90A 1KJMA 4QTIH 4FZEH 4GG6F 4Z6AT 4LEXH 2BXZA 2X9XA 5B38G 1B88A 4JFOB 1RJYB 2ICEB 1JTPA 3C5ZA 3QCTH 4U6TA 2X6MA 3WFHA 4KJYA 4TRPL 1NKRA 4F37F 3LZFH 4XCNB 3A6BL 1RIUL 1CI5A 3ZT7A 1I7TA 5ISZE 5FKAA 1L9NA 5F7MC 1LP9E 2LQRA 2R69L 3CMGA 4J23A 4HBCL 4AG4H 1G1CA 3DSNA 4BH8B 1HK6A 3CFCL 1BZ9A 3BH9A 3QXDA 2CDGB 5DDHA 2Z9TA 1HHGA 4OI9A 3H9YA 1INDL 3DETC 2P5ED 4OZHF 2WNGA 4EDXA 5IEKB 3CC5A 4LSTL 4JM2F 5HHOB 3UPRA 1JHTB 3S34H 1IRAY 1RURH 3DURA 3PWJB 4KJWD 4M5YL 3OHXB 2HT3D 3E6FB 2FSEA 1IGTB 5IVZB 3UPCA 2BSRB 1J1XH 5J1TC 4N0CC 1FZOA 4LCWD 4PLNC 5HDBE 1DQML 3MRCB 3MV01 5TH2B 4CJ0A 5DI8B 4KRMB 2VLLB 4Y5XA 3SDCA 1LO5A 3V6ZB 1YC7A 5DO2C 3WFDH 3PF2A 4HKBB 1HH6B 5FKPA 3ULVD 2CXGA 1OHQA 2R39A 3LN9A 4LPWA 3QPXL 4YHNB 4NFBA 2DQUL 1KEGH 3VFGH 3HE7B 2P24A 4XVUD 1HCFX 2OXGA 4UTAL 3UBXA 1AD0B 3JWDC 4NO5A 4BZ2H 5TFSH 1DLHA 4GW1B 5I1AB 3X11A 3HI5L 3O4OC 4HUXB 2H45A 5GQBA 1N3NA 4DN3H 1SEBA 1TENA 3GFUA 5EZJA 3WBDA 4LLWB 4I5BB 5H2BB 3DI3B 1FFPA 4L4TD 1EVUA 5CP3H 1QR1B 2O5YH 2Z31A 3EW3B 3OKMB 3B9KA 4IRZL 5B8CB 3VMPA 4FQCL 5DYOA 3WO3B 2ZUTA 3QUZB 3BGMB 1GGIH 2VDRL 1DQQA 4P59L 5D7JD 5HYJA 2E7BA 3MCKA 5E8NB 4FQXC 1OLLA 1PEWA 1PG7H 4G42A 3X14B 5EU3A 3TJHC 1SJEA 5BV7H 1F00I 1WAAF 3D3VA 3RGVC 2G5RA 3WHE1 3N1FC 5E6IC 5EZJB 1A6WH 5F93C 4G6KH 1BM3L 5HYIA 1MHPH 3S97C 1TIUA 3VGGA 5ISZA 1PD6A 3KPTA 4EXKA 5C7XH 4GSDL 1YUHA 2QHLA 4LPYA 5EC1B 4AEIL 4IMLB 1OAZL 3O9WC 3RVWC 4WEUD 1ZLVK 2NNAA 5E2WL 3GSOB 1NBQA 1JN6B 4PB0L 3S5LA 5FO8B 2VDML 3L9RA 3UO1L 1T7WA 3X12A 2IQ9L 5C0BD 4O58H 5HDLA 1OY3B 3JV6B 4LHUB 3OR6B 2QHRH 4ODXB 5J89A 5E9DB 1I9JH 1EGJH 2NTFA 5D7JA 1HH9A 1GSMA 1D5BA 2ZCHH 5E5MA 4KKAD 5ESQB 2YUWA 1IKFL 2EXWD 2VJXA 3JTSB 4ZFZA 4UTBH 2HTLD 2ERJC 4KROB 4RWHA 5C0CB 1J7VR 3PWJA 3BP7B 5KN5B 2JKXA 1NMAL 2E7CA 3TO2A 2ZG3A 1OL0A 4M7LH 1GPOL 4KPHL 3CZFA 5KBNC 4HUVB 2FHBA 3O3DA 1XGYH 2IWGA 5IG7B 2HTKD 4YZFE 3RUGB 2E9WA 2VDOH 5LGJA 4U1HB 1IKNC 1KN2H 2O61B 1WBXB 1QVOA 1NANH 1KPRA 5E8DL 4X99B 2Q76B 4LLQA 5L2KE 1EPFA 3HR5B 5A2IH 3K74B 4DEPC 1M7IA 3HFML 3UTTE 4KK5C 1TETL 1ZHBB 2EXYC 4PJXE 4P9HL 2P42B 4WFGD 3SDCD 1LD9B 1OTUD 4AMKL 4Q9RL 3V4VL 5F7EL 4XPTH 4FQJH 2VC2L 3EJJX 3CFKA 8CGTA 4XNUH 1I1YB 1CLCA 3QP3A 4R4FH 5SWZA 5C6WH 3DX9A 5IIEB 2NY0D 5HYEA 3RIFF 1WEJH 4RRPA 1MCPL 1IAIH 4OD1H 3OGCA 1D9KC 4N90D 4I13B 4Z95H 1HNFA 1FORL 1OSZA 3KHQA 3VXTA 4HK3J 4OLWL 4XVUC 3IDYC 2MQ0A 4KWUA 3LKQB 1T1ZA 3P4OA 1F4XL 3ARDD 5L6YL 3RZCA 3OAYH 3RNQB 2WWMD 3KDMB 2BSTB 1H8SA 5A16A 1FZKB 5KTEH 4M9PA 1QVOB 2OYPA 4XBPA 1LEKA 2BOBA 1PGRB 4J6RH 3DTXB 2DM3A 4J8RA 4ZNCD 5FYLD 1FSKC 2B1AH 2XFXB 3KGRA 3KPPB 4HJ0D 5I73C 1YEDB 1A4JA 3V5HA 3VXRB 5KN5A 3L3HB 2JJUA 4G80B 1QBML 4FNLH 1QLRB 3B2UC 1F4WH 2NXYB 2C26A 1A3RL 5IFJA 3CVHL 4C56A 1ULVA 1BD2A 4WI4A 4A6YH 4KK6D 1ZVHA 1FZMA 4G8GB 4M6MH 5MENE 2W9DH 2IQAB 3HCVB 3SOBL 2ERJB 4C57C 1FGVL 1A9BA 3FOMA 5CZVL 5HYQB 3H7LA 4YQXL 3UX9B 4HJ0C 1CLYL 1NFDA 3IDMA 4L8SC 3PHOA 5HHOE 2EE3A 3JWDL 5JIKA 5E6IB 2ED9A 4JPKH 1QSEB 4UV4L 4RGMC 5HHXL 4GAYA 2AK4E 3BRFA 4ZOAA 4GAGH 2YZ8A 1S7TA 4OCWL 4M9OA 3UJIH 1OGTA 3WFCH 5IVXA 4YUEH 2XKNA 5EU4B 1ZGLP 4PV9B 5FM5M 1XZ0B 5EU5B 4HS3A 3EO0B 3L7EA 5JO5B 1MQ8A 4KDTA 3VD3A 2R0LH 4Z7QF 3RL2B 2AABH 4HJGB 4XVSH 4KKAC 5F6HI 2A83A 1ACYL 3MV8E 3CFJB 3LD8C 2OSLA 4PG2C 4GKSA 4EOWH 1CE1L 4QHKJ 3UZQA 3ZTJG 4F7TA 4MHHG 1EBPA 1BFTA 4I2XA 4MJ2A 4OIIL 1MJUL 4NT6A 5JHDE 4XC1H 2NY3C 3WHE0 2Y5TB 1YQVH 2BMKB 4CMMA 4RA3A 4OLXL 1PDKA 4F57L 2X4QA 4JG0L 4XMPH 4LLAA 3LY6A 4HD9A 4X5LA 3IDNA 3P11L 1MAKA 2F58L 1N59B 1N4XL 4L8SA 1DLHB 4GW1A 3CXDH 3QEGH 1JPTH 2GAZA 1AD0A 4OTXL 4EUPG 4PJAB 4P57B 1HXYB 4PGCB 5J3HC 1W2KT 1MFBL 3ZYOA 3WCYA 3EGSB 5JXAH 1CDBA 3FT2B 3HS0A 4W4NA 4JHWH 2O93L 2Y6SC 4YHOH 1A7RL 2C3VA 2K7QA 3ZKND 3G5YA 1HHJA 3LMJH 3PWVA 3D18A 4QNPE 1G9MC 4PRNB 3UTPE 2M26A 1G9EA 5FOBA 1IGIH 1YY8B 1BEYL 2XQBL 3LKNB 1NBVL 4LSUL 5C07E 1ZWIA 5CMAB 4K3JL 3IGAB 2YXMA 5HHVH 4KC3B 2OK0H 4KKLD 3LQAC 3TN0D 1R5VA 1NBZA 5E1HB 3NFSH 4QRUA 1IM9A 4TUKH 4YDJA 4IHOA 2HT2D 4U6YA 4MD4A 1LEKB 3VFWA 1DN0B 3V7AE 4MDIB 2AKRB 1JF1B 3S4SA 3UTSA 2JB5H 4BQ9A 1SBSH 3CC5B 4ZUVA 3KXFB 4OZIB 1TFHA 3TWCL 4POYA 2A73B 4GRLA 2CRYA 3GJFA 1UVQA 1AXSA 2DQIH 3CXHJ 4Z7VE 5GS2H 2R15A 4JY4B 3I84A 3QXUA 1OSZB 2E5EA 3MCLL 4PJCE 4YNYB 1WISA 2B2XL 1F45A 5CBAA 1EO7A 1M4KA 2Y72A 4J3SA 4ZUWB 4D3CH 4G7VL 3CUPA 3MLSL 3MRBA 1CZ8L 4ODTL 3PXJA 5DD3L 5T1LD 5IMLB 1V7NH 4IRJA 4Z7WA 3QEQB 2W0FA 4ODVL 4X7EC 4Y5VB 4KU1A 4L4TE 5SX4I 3V6FB 4NQCE 4ODUB 2LABA 5E9DA 1FIGL 1DQDH 3IDYB 5GRUL 1ZTXL 1LO0H 5HI4C 4OF3A 4TNWK 4GRWH 5D5MB 1RIVL 4UT9L 4I18B 4XPAH 2FR4A 4N5UA 4OQTH 2A6IA 3TA3C 4IOFC 3X3FH 4Y19B 4FRWA 3DMMA 5HVGB 1I9IL 1A8JH 2AJYL 4LRIC 1JGLH 4LLDB 4HWBH 4DZ8A 3OG6B 3EO0A 4NCC1 4Q7DA 4P5MB 1ZKAA 1OD9A 3ZE0F 4P2OB 4QHUB 1U8LB 3IJSB 2AGJL 4DWHA 5TPWL 4R4BA 3IS1X 5DQDH 1XF1A 1S7RA 5TF1H 1J1PL 2ATKA 3H42H 2I07B 3NABH 1RULL 4KZEH 5HYSA 3MCKB 4NNPH 1Z0NA 3HNVH 3MRGA 2G2RB 1KB5B 4UDTA 1BVZA 5DRNA 1OWRM 4O2FA 3GSQB 1MRFL 1XCTA 4J3XA 3BKYH 2Y4SA 4JKKA 3UCRA 2E6JA 2C3HA 1GRWA 4AEHL 1DFBL 1T89C 1I4FB 3OG4B 1SJHB 3VXSA 5H2BA 1X5AA 1DL7L 4HAGA 1TQCC 3RKDD 4HWUA 3DLQR 3NH7L 12E8L 5L9DH 4M6NL 3TA3A 1M6OA 1K4DA 1H5BB 1HYRC 1UA6H 5ITBH 2MQ3A 3D25A 1KT2A 4KRLB 3QUYC 4RMWA 5I18H 5T1KA 3O6ML 4JR9H 5SWQA 5EU7C 4GFTB 5KS9F 2F8OA 4M7ZC 3D1MC 4QTHB 1KB5A 4UDTB 2XACC 5KSVB 5C0AD 4G43A 1FFNB 3V95A 2BRQA 3MOQA 3VFPA 2NLJA 1LO5B 4ODWA 4JDZA 2IFFH 4F7MA 1FFQA 4Q74A 1RHHB 2UWEE 3EJZD 3SO3C 2XZAL 3EOTL 1Z2KA 4DKFL 1BQHB 3ZTNH 3FFCD 4YBHA 4MCYA 4FMKA 1CICC 1WIUA 2Z8SA 4WHCA 4Z7QE 1G7PA 3P77B 5D2LB 4E0RA 1I9RL 3QNXB 1A3LH 1VFMA 1M71A 1Q8MA 1NCDL 3BP5A 2GEEA 2APWA 2EIEA 5DFVC 2XN9B 2R1XB 1A6AA 4U6XA 4Y4HD 4O5LH 5E5UB 3HMXH 3V52L 4M62H 4FTVB 4P5KA 3QQ3A 1Q0YL 2P8LB 1FC2D 1U8HA 3RUGF 4F58H 1EAJA 4I9WE 4NOBA 5CSZB 3VI4E 4PLJD 5KSAA 1T5XA 1R5IA 5BZDA 3S37L 1ZHBA 3HE7A 4POUB 5D1QC 3P0YH 4HGKC 5IKCB 5E00A 2FR4B 5I1LB 5TGBB 4PJBB 2WWMC 4M02A 2FATL 5E00B 3MV9B 3AY4C 2ZCLL 3MJ9H 3O2DL 4X6CB 4APQB 1T0PB 3SDDC 4YJZL 1MIEH 4UB0L 4OLEA 2FO1A 2CDEA 5F1NB 3JV5A 3H7BB 4KJYB 1X5HA 5DURB 3FN0H 3ARFB 3GJFB 4I3RL 5LGJB 4P5TD 2O5XL 5D1XC 4YXKL 1OW0A 2VZOA 5F96H 3Q1SH 4P5TB 5D7KE 3MRHA 2Q7YB 3G6DL 1WWWX 4NQDA 1QBLH 3RIAK 2DLEA 3HAEA 4Y5YC 5LVEA 4RAHA 1AO7D 1NBZB 3QDHA 3REVA 4OCXH 1UXWB 3VWKD 1E6OL 4Y4KA 5EBWB 2XQYK 4EI5A 1U93B 1M7XA 5MEND 3RTQB 5IHZB 2LVCA 4NKOB 4LKCA 3L5XL 4RGMB 1CXIA 4HS8L 5E6YA 4EI5C 2DBLH 3BH9B 1T22A 1BQLH 3TEUA 5KS9E 1WTGT 3QJFB 2ITCB 3FFDA 1QFHA 3MRKA 4P2QE 1JK8B 4WU7B 5EZOH 4HGWB 4JO3H 3MV8B 3ARSA 4YPGA 4G9FD 2GUOB 3SDYH 4WU5A 4YR6A 3TO4D 5TGBA 1OP3K 3U0TA 1FVCA 1YECH 3BZEA 1UM4L 4CN1A 3G5XB 3FT3B 4AENB 3D69B 4JFFA 2NXYD 1YN7A 4HIIA 4XGZA 2APTA 4R90L 4WO4C 4EUPA 2QQKH 3DI2B 1L7TL 4RX4D 5F9AC 2AJSH 4L3CB 3S35H 3RVTD 4FTVA 3PGCB 3SKNB 4OCSH 1KJ2B 3BQUA 2F54B 3ARQA 4CVWA 3LHPL 3QWRD 3OF6D 3RI5F 1MCWM 5DVMA 3SGEI 1ZGLB 4Y2DA 4HWEH 3GJEA 1NFIA 1YNLH 4QRRA 1GIGL 1KJMB 3SGDH 1ZXQA 4RIRB 1PKOA 2RJMA 5F3HA 4LSRL 1RUAL 5DVKA 5I2IA 5GGVL 4OCRL 5F3HB 3JWOH 3CMOH 4QOKD 1PY9A 4PS4L 2VAJA 2MMXA 4X5XB 5ANMA 5ENWA 1EMTH 3HRZA 3L3DB 5JO5A 1XGPB 2A9ML 4YO0A 1R6VA 4YFLF 1FZJB 1V7MH 1B0WA 1KFAH 3FO0L 3ECBA 4WNQA 1MCNA 5D1QB 3B6SA 2H32B 1AGEB 1DSFL 5E2VL 1IM3A 4WTZG 1HOCB 5IJVA 5KOVC 3QHZH 5GRZA 4N9GA 3DMMB 3ZMRA 1NSNL 3ARPA 1QFWM 5ICXA 3NACH 5IK3A 1IBGL 1T2JA 4ZXBB 1C5DA 3EYFB 4ACPA 1BECA 3TCLA 3GMQB 1D6VH 2NX5B 3L3GA 4NM8H 5ID0B 4ISVB 1D5BB 1O0VA 3IU4H 4JY5L 1T1WB 2YA1A 3MRDA 3LH2H 3KPSD 3KLAA 3DXAB 3MRDB 1T0MB 1NC2D 4FQQB 4G6FB 4NUGH 2D2OA 2CIKB 2V2TB 3QUYA 4YPJA 3T0EB 1LHZA 1Q9WB 2GT9B 2VAAB 1X4XA 4O2FB 1NMBH 5C8JB 4LGSB 3OHXA 2CLRA 4YDLB 4OZFA 4XCEB 1FVDB 3D87B 4X9BA 4XAWL 2PXYA 4R4BB 2ZUYA 4MWFA 4LVHB 1YN6B 5DMYA 1S3KH 4PR5A 1FZJA 2A38A 2JB6B 2OX5A 3LH2L 4L4VA 3QI9D 4MMZC 1J8HA 1N0LA 3C8KB 1YEEH 3K4ZA 2LU7A 3Q2CA 2A6IB 1X5FA 1AD9B 5I1LA 5B39A 2EIDA 1I7RA 5FUZL 4E41D 2BCKA 4HHAB 5I8CB 5HI5D 1CU4H 4GO6B 3PV6A 5L2KA 3O6FD 1V7ML 3T4AB 5ACLA 4MS8D 1MCOH 4ZTOL 5DQJA 1TJGH 3NIDE 4NO0A 1EFXB 2Z31C 3KPQB 1QHPA 3BX7C 3QI9B 3CMOL 5I1JH 1NC4A 2NXZB 1XCQA 5E08H 2UVFA 5FUOL 5I74B 1NC4B 5DFWH 5L2KD 2FIKA 3NOIA 4HFWA 4LLYA 1HHIB 1TQBB 4K8RD 1FNGA 2I27N 2WZPD 1GIGH 4TVPL 5I1KL 1ZOXA 1NGXA 3T0WA 2XTJE 2EH8L 1FO0L 1VA9A 2AKRA 1NBYA 3S4SB 3UTSB 1A7NL 1KENL 1AGBA 3VD5A 1S5IH 3VFVB 5JW4M 4Z0XB 2BHZA 4NN5B 3VXMD 4R90H 4JFXB 4OZ4A 3QUZD 3BZ4B 1R24A 5EORH 1UADC 1I1AD 2Z8RA 4KHXH 3E6FA 5AWNH 3S37X 4GRMB 5EUKA 4Y16B 2OSLB 5IB2B 3M17A 5KZCB 5I74C 1MCRA 1KEMH 3U2SA 3W0WE 1DQLH 2RGSA 4JDTH 4QRTB 1R3LB 1DE4A 4O02H 2DYPA 5JNYA 2M8XA 1LO2L 4M1GL 4N8PA 3QCUH 3GKWL 5ESQA 4OJFL 1F4YL 4QXGL 3HKFA 4JFDA 5C71A 8FABA 5ADOH 4OM0L 2DBLL 3QUYD 1GAFH 1B0RB 1SJVA 4UIKL 2W38A 4U1NA 5ESVA 2Q6WA 3I9GH 4XI5D 3UAJD 4K7PL 1G0XA 1QSVA 2XA3A 4FFWD 1J0ZA 3QIWC 3OJ2C 2IMNA 4OLUH 4PJBA 3SDAB 4Z7WF 3RX7A 3KR3L 1OAKL 1JN6A 1N64L 4ONGL 5FGBC 3DUUA 3NFPA 4OI7A 2JELL 3LSOB 3S5LG 5ITFA 3GSNA 1EHNA 4CUCA 5FGBA 2UWEB 4YXKH 2O5XH 1F6AB 4JO1H 2IAMC 5D71H 3WE6A 3OR6A 1I1FB 1I3RB 3WFBL 1YNTB 5BXFB 3G04A 2DQJL 5EZIH 1RZKL 3BPNC 1NGQH 1AGCA 5DUBB 5FB8A 2VLME 3L3OA 2WBKA 2CKBL 5I30H 2ESVD 3RWJB 1A9EA 3QFDA 3OGOE 5ICXB 4HCRA 4TUJB 2D31B 2GJ6D 5LKNA 2CUHA 4XRCB 4JFEA 5IR1A 4MLIA 2B5IC 1WBYB 4FFZH 2CKNA 5C0AB 1G7JB 1T5WB 5H8DA 5DK3A