3DXAE

Crystal structure of the dm1 tcr in complex with hla-b*4405 and decamer ebv antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
244
structure length
244
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASRYRDDSYNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility complex HLA-B*4402
publication title Natural micropolymorphism in human leukocyte antigens provides a basis for genetic control of antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 244
sequence length 244
chains with identical sequence J, O
ec nomenclature
pdb deposition date 2008-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dxaE02
3OHXB 3OZ9H 2KH2B 2DQFA 4AQOA 2R2EA 2DI8A 4JZOB 3STZA 4XWOD 3L3KB 3VGDA 4NQEE 2FJGB 5EH1A 4D8PB 4GUPA 5INDA 2XWTA 1RQ5A 1MOEA 4GRLA 3DGCR 5ESAB 5J9PB 1NAMH 2JB5L 3LEXB 5BZDB 1HWGB 3IDNB 4GSDH 4J4PA 4CVUA 1IM9A 4XC3H 4JPVL 3MRDB 1X5LA 3VW3L 2NY7L 1QSFE 2VZOA 3HCVB 3MBEA 2OJZH 2F5BH 2VDRH 3I3EA 1A7OH 4KK5C 2HKHH 4CMHC 1ZT7A 1I3RA 4E41D 2E7BA 3U0WH 1I7RB 3G5YA 3RTQD 5D71L 1IGJB 5HHXL 3LDBB 3NACH 2X4PB 2BSED 4KRPC 5EPMA 1IKNC 4NUGH 5K93A 2EDJA 5GPRA 4Y2OA 5DC9B 4DKAA 4H20H 1A3RH 4JPIA 3QIUD 4IHOB 3TPUB 1S7XA 3FL7A 3RWHB 1AR1C 3N1GC 1NLDL 3EFDH 4APQC 4NJ9H 3UTZA 1I1AC 5DJXB 4F57L 5J12B 3FO1A 4ELKA 1F3RB 2APWA 1EVUA 2JK5B 2BRRH 2VXUL 4L8DA 1WSST 1AC0A 3VRJB 4RRPA 5JDSA 3OKOB 4MNHB 3PWJA 5DJZB 2BY1A 2F19H 5HDQL 1OLZA 5LGJB 2OYPA 3L5WA 4UINL 4M1CD 2NX5E 2IG2H 4KVNL 1LEKA 4HJJL 4ZTOL 4WRLA 2Y7QB 5AAMA 1DE4B 2HRPL 1DBJH 5DD1L 5FM8A 1MHCB 1HDMB 4Z7WB 3MRGB 5CP3H 2OTWA 4RFOL 1QO3B 2XG5A 5CZVH 2XI9A 4B41A 5HYJD 2IH1A 1G7LA 2NXYD 2WSKA 4LP5A 4HMEA 4I0PB 3L3OA 4NYLA 5DHYB 1U3YA 5A2FA 2OS7A 5GGSY 1U3HB 3AU1B 4AIOA 2Y5EA 4YE4H 4Y1AA 1F2QA 1T22A 3G9AB 1MCPH 1CICC 2PW1A 1Y6NR 1TZHA 3AMKA 2NZ9C 5ICZA 3PL6C 1J8HE 1YZZA 2WK2A 4PJIB 1EGJL 2QSCL 5ENWB 2HWZH 3B2VL 1TJGH 4HIXH 4GRWH 4Y16C 4LCCB 1X6NA 2HTLD 2Z8SA 4JHBA 4KI5F 1QLEL 2P5WA 2NTFB 3ZDXE 3WJLC 5IBUB 4NSKA 4X0KB 4AH2A 5I1DB 3AM8C 3WBDA 3LRSB 3OPZL 2DQJL 2BDNL 4PY7A 3MPCA 2IQ9H 4PJEA 2Q20A 3VH8A 4FQJL 3QQ3A 3ZDZE 4B53A 5IT2H 2N56A 5GGSB 1OGTB 3CDGA 2AJUL 4DFIA 4F7MA 3ZT6A 3WUWG 1MEXH 3NABL 1WAAE 5E9DA 3LKSB 3N85L 5IBTL 3RWIB 4DKEH 1MH5A 3DBXB 4ZAKD 1LP9A 1WVZA 1R3LB 5HVGB 2NY4D 4JM2F 4UIMB 3OWEA 4JRWA 5ETUA 4CVXB 2BOBB 1A1MA 1XEDA 2VSDA 2VIRA 4HMCA 4NQCD 4UQ3B 5D8JL 4L1HA 3FQTA 5JHDA 3ILQD 5FYJL 5JA9A 2J6EH 3IDYB 2R56L 4UI2A 4OQ1A 1OAUL 2VL4A 5DGQA 1D5IH 4C56E 4S11A 4Y4HC 5KVDL 3W0WD 2IQAB 1OGAE 2WZPD 3JTSA 5IVNA 5C7XH 2IANB 1S9WA 4UDTA 3G5ZA 4ZYKA 4QHMA 4LLDA 5IHZB 1WITA 1BFVL 4KXZI 5TPWL 5ALBL 5GJSH 3EZ8A 1DQDH 4HK3J 3FB8A 3O8XD 3KJ6L 1BVKB 3LQZA 2V5TA 3T0XA 1AP2B 5IB3A 4ZQKB 4NO5B 2GSGA 5I9QB 1FRGL 1FZOB 1NSNL 2X09A 2X41A 5D2LB 4OCYL 4CUCA 4H25B 2X4NB 4HWUA 3TJEL 1RULH 1ETZB 3LN4B 5JO5B 4YO0A 3O9WA 1S5HB 4MSWB 4Z7QE 1U3ZA 4POUB 4Q6YA 5L2JA 3UPRA 2KQNA 4WU7A 3QEGL 1MELA 1V3LA 1W0WA 4LNVA 3MRFA 3UBXB 4ZFFA 3OV6A 4LNRA 1P69B 3QP3A 3KPLA 1QFHA 5EO1A 5DMIL 1KTLA 5DVKA 4WDIB 3TV3L 1FZJA 3WLBB 4X9GA 2VQ1A 4ORZC 2FB4L 3MO1A 3D39D 2BOCA 4QXUH 3H7LA 2HT3C 3SE8L 4BUGA 1LO3L 4Z5RB 2GCYB 5T3ZL 3P2TA 3VG9C 2Q8AL 2NY3C 3G6DL 1G9ML 4KROC 5H94A 2RQ8A 3GI9L 4J6RH 2FECL 1S9KC 1IC4L 5DUBA 4D0DB 1AC6A 1FE8H 3C60A 4CVZA 1KB9J 1CFSB 4Y4KB 3O3BA 5TQ0L 1BQHA 4I13B 3BUTA 2D31B 1FNAA 1H5BC 3P11L 4TVPH 5HBBA 5FEBA 1OSZA 3HUJB 2XZQH 4G6ML 1NEZG 4ONFL 1BD2B 3WUWB 4NP4L 4LIQE 4KJWD 5HSFA 1E4WH 2EDNA 3QUXB 5K33A 2P5EB 5IW6B 3K3QA 5J6GA 4PGEB 4JO4H 4PRDA 4X6DB 4LBEA 2BJML 2YPLB 3Q6FB 2V9RA 4HH9B 1GPOL 2EZ0D 3OQ3B 5CUSH 2FX8H 1T2JA 2EDRA 1KN4L 2AJYH 2YSSA 4PJ5E 3LKNA 4GAFB 1JK8A 1B6UA 1CXIA 2VDPH 1T7YA 2VL5B 4XMPH 3TZVD 4BH7B 3RIFF 3ARFC 5J3HC 5HDBF 3T3ME 1IGFH 3DIFA 1KPUA 5JORB 1H3GA 4DZBA 2ZOLA 2F54B 3QIWA 4HIHB 4YDIL 1UB5A 4N0FB 4HLZG 1N2RB 2L7JA 5FYKU 5DD5L 3UEZA 2YMXH 4E42B 4Z76B 1KJ2A 1AKJB 1OM3H 4PRPA 4XBPA 1OB1A 3RBSA 4NCC2 3QPXH 3NCYP 1YPZB 4OZGA 3NFNA 4D9QD 4Z18A 5AYUH 3GHBL 2DLFH 1A3LL 5IMMB 4KJYA 5CZKA 2ZJSH 5DS8A 3D5OF 1R24B 2R9HC 4XNUH 3OJDA 3L3GA 3MV7A 4TQEH 2D7MA 4EI5C 1QP1A 4X98A 1I85C 3P77B 2YD4A 3VFWB 5BJTA 1P7HL 4JFZH 5EORH 2MFNA 5C0RL 2VDKL 1SJXA 3FT2A 4ODWA 1B4RA 4K71B 1RJZB 4BYHA 2E27H 2OL3A 1CFTB 3W11D 3V6FB 4EEEA 3IJSA 3CVHB 1HKLL 1A64A 2CO6B 1LEGB 5L9DH 2I24N 3DROB 3ULUD 3WO3B 4JRXE 2CXGA 3W82A 2YD3A 1AIFA 1UQSA 3O45A 1GGIH 5C0AD 3DXAE 2GYSA 2R0LL 4O9HL 3PDOB 3R4DA 3Q0HA 2R0KL 4R4ND 2XWBA 2X7LB 4AEFA 2RAMA 2ESVB 2YEZB 4M5YL 4U1MB 4ZFOB 4HULB 1HWHB 5L8LB 3UTSA 3K1DA 2CKNA 3B5TA 1EHAA 3OAZH 1KNOA 1P6AB 2BHYA 4XPTL 2WIMA 3KXFB 3I75B 3KPNB 4JY6A 3TH3T 2XIDA 4U6YB 1NEZB 3H8NA 5F7NC 3JZ7A 2FWOA 4DEPB 1DUZB 1WWCA 3GUTB 4Q74A 1XF2B 3FTGB 5FYJU 4LSTH 1I8LC 1KIQB 4KPHH 3WS3B 3BKCH 2DMCA 4N0YL 4LKXB 5F89A 3SDCC 3WNNA 4GW1B 5H35A 4KHXL 3ZDYF 3PP4L 3EHBD 1PEWA 3CGTA 4LKCB 3F7QA 4Q9BA 5A3ID 2Z93B 3ZYZA 4HAGA 5C07A 5HI4D 4I8DA 4KK9D 2XTJB 5D1QD 1F4YH 2NY0B 2B2XL 4U3CA 3H3BC 4JGUA 3HRZB 1MWAL 4PJEF 1FNGB 1WBZB 3WL9A 4HH8A 5IM7B 2Q7NA 4WVRA 3TA3A 1KCRH 1N7MH 1UACH 4CJ1A 1FVDB 3EOAA 4XGZA 1RSFA 2V5SA 3PHQB 4MXWH 4NC2B 3ZDYE 4U3HA 4X6CB 1LP9F 4UILL 4RAUA 3GSUA 5J7CC 2J8OA 2VDOL 2ERJC 3U7WH 3WNKA 1QBBA 1RZGA 1YC8A 3F7PC 3TIDA 4PJEE 4P2YA 3SDXF 4PLKD 3U82B 4H26B 1FZMB 4M3KB 1T89C 4EVNB 1X5JA 3GIVB 3BGAA 4QRQA 4UTAL 1WZ1L 3F65A 4J3OC 5IHLB 1SJEB 4BQ6A 2ZSVB 4URTB 3SKOA 2DQEH 3C09B 1LGVA 2DQUH 5E9DE 3UJTL 2ADGA 4X8JA 1LP9E 1F3JA 4JFOA 1KG0B 1CXFA 3FQWA 4G42A 5DEGA 4HXBL 2FEEL 3HAEH 5FHAH 3PWVB 2XWJA 5EOTA 5JHDE 2Z8RA 2I9LB 2FX9H 3IAQA 2FJFB 1QACA 3EYSL 3FN3A 5F44A 5MI0C 1OAZL 1YECL 2CSPA 4HUNB 1AD0B 4LDOB 4N8CL 4RMQA 5F6IC 3WXVH 4Z8FH 3Q3GA 3SGEI 3T65B 4MA8H 3VGAB 5IR1B 1HCVA 3SBWA 1BJMA 1YEEL 3H6JA 1XGQB 4QCIB 3E2HC 2VO5A 2GFBA 4AM0A 3PWPB 4HS6B 2OMBA 1GJIA 2Y5TB 1S7QB 4HZAA 1K2DB 3HR5B 2PTUA 3W2DH 2DN7A 3EYUH 4O5LH 4OD2A 1HIMH 2E6JA 3CSYA 5LAXA 4KI5D 2G75A 3IU4L 4XWGL 4MQXD 3BPCA 3DSNA 3KPSD 5KG9B 4OCMC 1I3GH 4U6XB 3GM8A 1OAXH 2B4CH 4ZO8A 1RIUH 4LVOB 4WO4D 4U6HA 1QSZA 4LSVL 5C3TA 1M05A 1NCAL 5IVXB 3DV4B 3OAZK 2ZCKH 5SWZB 1PAMA 4YHIB 5F7YC 4BH8B 4R90H 3OL2A 3QUZD 1LK2B 2DYPB 4MWFB 4Z0XB 5JOFB 5ISZB 4UT9L 1ZTXL 3MROA 4PG9B 1YEDA 1QRND 3GO1L 2EDTA 5DZOA 1HNFA 3K8KA 1NC2A 2JELL 1KCSL 1WIOA 3QNYA 4O58H 1EX0A 4AENA 3EJZD 1WZKA 3HZKA 1H9VA 2GQHA 5FYLE 1KXTB 3IU3A 1D5BB 4P23C 1U8MB 3W81A 3EYFB 5E2WL 1CFQB 5L6YH 1JZ6A 1SMAA 2E7HA 4NQSA 2H2PC 1A21A 3IETA 5CJXA 1N64L 3V5KB 2G5BB 3ULUH 3V0WH 4PJHB 6CGTA 4PGDA 2HJKA 1ZE3C 3MUGA 3BQUC 3VWJA 1JGLH 1DBKL 1B0RA 3CX2A 4RFEA 1DEEB 1AY1H 4U1JA 2CLVB 3CMGA 3TBYB 5CEYB 3ALPA 4LRIA 4BZ1L 3KS0J 2C7UA 3CPLB 1S9YB 4ERSL 2J7LA 3QXAB 4JY5H 3SGJA 2HTKC 3OKEB 1GGBL 3U9UB 1Q9OA 3T08A 5D7LA 4JANB 5DEFB 1MHEA 2GAZB 3WKNA 1RVFH 2QADC 2H26A 5CSBA 2AQ2A 3ZT5A 3B9KC 4ODTH 5FF6A 5J4MA 5C0CA 1IEAA 3EGSB 2ZCLH 5AD0B 4UU9A 3QHZL 5CBEA 2ICEA 1RZ7L 2BNRA 4DUVA 1DVFA 1LDPL 4JKPL 1NFDE 1JNJA 4QHLA 3QEQA 5TQ2L 3QUYA 4V2BA 1CN4A 1XH3B 4XH2B 2CRZA 1W72H 2DD8L 1Q72H 2W07A 4PG2C 3MOAH 3PGDA 4DGVL 3H3PL 5I76A 4OZHA 1WIUA 3KJ4B 5F7WC 2CKBA 1NCUA 1FDLL 2P8LB 4PUBH 5EUOB 4M43H 2Y4SA 1IRAY 3JVGC 3QG6A 2J8UA 3VWKC 3ARBB 5BQ7A 5T1LA 5JLZB 4PRPE 3KLAA 4YHMH 5A40E 4JCMA 3CLFH 4OZGE 4K7FA 5J1TC 4OV5A 1VACB 2NY1B 5CINL 1X7QB 4MAUL 4HFWB 4YHOH 3IXTA 4KKLC 1Z3GH 1MY5A 3S34H 5EOCL 4G6KH 1G9MC 4MA7H 3FO2A 4Y4FB 5E8PA 3GSNB 4P3DB 2P48B 4BKLA 4F9PA 5TDNB 1Z2KA 1XIWB 1AJ7L 5IWLC 1OAQL 4XCYA 4BQBA 5BS0B 3SE3C 3CFBB 5IB2A 1L7TH 1T6WA 4WW1B 3UTPD 5FO9A 3UC0H 4HAFA 3VXRB 5HD8D 3M8OH 2A83A 5IEHA 4U7KA 1S3KL 1KIRA 4AIZB 5CJQL 4HUWA 2EEAA 5KS9B 4OLEA 3NIDF 3MRCB 2A6KA 1TVHA 1WWWX 3AREC 2WW8A 3NFPA 5J11C 4HBCL 5E5MA 5KSAA 3FB6B 1BZ7B 3VFRB 4FFVD 5KJRH 4IIQC 3UTSE 1G84A 1AR2A 4JRYD 4NJAL 5DI8A 4PJGA 1UYWH 3BXNB 4N8PA 2CJUH 2OTUA 3BH9A 2H9GA 4X5XB 1ERNA 3NIDE 3VI4F 5BVPH 5C0GB 1T4KA 5E4EC 2X4RB 3CFDA 4HS8H 1YNTA 1DQJA 1FO0L 15C8H 3MXVH 3QFDA 4YFLI 5JIPA 4PBVC 4S1DC 1A9EA 4MQ7B 3QDHA 3I85A 5ICXA 2IAND 2WUBH 3RUGF 4Y2DA 5DFVC 3TYGH 2PO6A 3VI4E 2ZOKA 3O6LH 3RPIA 4WEBL 3B8YA 1RJYB 5AG8A 4TSCH 3BSZH 5KOVC 4IRZH 5E2VH 3VG0H 4PRBB 2IPUG 3F8UB 3FFCA 3IFLH 1IQWH 5KSBA 1TJHH 1IM3A 5FA4B 2XRAH 1CDHA 5FECB 3DVGA 3P30L 4DOHB 3B5HA 3QAZB 3DWTA 1DL7H 2LABA 3QQ4B 1RUQH 2IPKB 3FT4A 4A2LA 1KLGB 2BY0A 4EI6B 1G6RA 1PZ5B 4HKXB 3GHEH 2P42B 1RUML 3BW9A 3FOLB 1LVEA 5KN5A 5HYJE 4LGSB 4P2OB 1XF4B 1VFBB 3H2WA 4PJ7A 2WWMC 1IAOB 3CCHA 3RWGA 3I6GB 4XP4H 4HGWB 4H0IA 4NWTH 1GZQA 3BFOA 1T5XB 3EW3B 3T09A 1LILA 2CRIA 5EU3B 3QCVH 4BSWA 1UENA 3MRBA 4D3CL 5IMLA 3TF7C 5EB9A 3TYFA 1WWBX 5F1NB 4OFVA 5E03A 5H8DA 3JUYA 2IEPA 2P5WD 5EC1B 4Z7UB 3RY4A 3LKQA 2ZCHL 4L8SA 1QSEB 4F8QA 4MQTB 4BFBD 4I1NB 3VFOB 4Y4KD 4WW2C 1Q1JH 5DTFB 3NAAH 4PP1D 1KLUB 4HUVB 4PRIB 1R3IH 3STLA 4U1NB 2V2XB 4JFXB 3QJHB 3TJHD 1AI1H 3P4LA 1SEBB 2ZUYA 1A6VH 2NYYC 3PWUA 4MNGB 4NKMA 1BD2D 4YFDB 2Z92B 5I1JH 3WFEH 3QUXD 2A6DA 4JFDA 5EO9B 2CK2A 2IPTH 5F88B 1AO7A 5EBWA 3MXWL 3C5ZA 1NGPL 2YPLD 1MCRA 3GRWL 4P5TB 3HZMB 4R97B 4DKDC 4JKKA 3KPQA 2V9TA 4RZCB 1XFPA 2VABB 5CJOH 3W0WE 4TUKH 3F7RA 3P0GB 5EO0B 1MCOH 1RZIA 4NO0B 3RVWD 1PVHA 3S98A 4GBXC 3QJFB 3O2WL 3HNVH 4XMKH 4LU5H 1RJLB 1S7UB 4L3EB 1FG2B 3DUUB 3LSOB 5C08B 1YMMB 2D7NA 2F54D 4I3SL 5EC2A 1FORL 2FYYB 4RAVB 3FKUS 4UBDD 4RGNE 4S1RH 2HFFB 3MLXL 3L95A 2I9TB 2AK1L 4JZJB 3LKOB 2XTLA 3T1FA 1NH6A 1O7VA 2B1AL 1NDMB 5EA0L 2EYSB 4PB9L 4MA3A 3MNZA 4X9BA 3NCYS 4IMKC 4PGBB 1LO0H 4CU8A 1CVRA 3MYJB 5JXEC 4XNXL 5HY9A 1FNLA 5FYKD 2EIZB 2J4WL 1A7QL 2VDLH 3LVEA 3NZHL 3RVUC 1JWMB 3KLDA 3BUYA 5J8OA 5JHLL 3BAEL 5TF1L 3L3KA 1MAML 3X14B 5D93C 4JKWA 4NDMB 4NM4H 4GFTB 1N26A 3ORJA 4TNVF 1T03L 5F7DB 1UKQA 3PF2A 5DD3L 4PJ9C 4OZHF 3IDNA 4CMHB 2LVCA 1XGTB 1FFPA 2A9MH 2J8UF 4JM4L 2LE9A 3V9FA 2BNRE 3QFJA 4QXGL 2X4OB 4WWKC 3TFKC 1A6ZB 9CGTA 4HC1L 4KRPB 3WS6A 5CKAA 1Q9LB 1KYOK 2ESVD 4MAYD 4PP2B 5D2NA 1FNEB 4OZHE 1WJ3A 1FNSL 3ROOB 3KXFD 4HKZA 2J8UE 4P5KA 3IT8D 3RRQA 1HQ4B 2AVGA 4U1GC 4APQB 4JE4B 4LQFL 3V4UH 2NNAB 1UVQB 3T0WA 2VLLB 1BZQK 5C0FA 3X13B 4HUXB 5J13C 2R0ZL 3OKMB 1I1AB 1Z9OA 3SHSA 3K80A 4KKAC 3WN5A 1C5CH 5L2KA 1Z5LB 3DVNB 4ZUUA 1GIGL 1LE5A 1XR8B 2BCKA 3HS0A 4JAMB 1BQLH 3ZTJH 2R1XA 3L3HB 4Z7UF 2XTJD 3MOBL 5EDXA 2NY0D 4NCDA 5D9SA 3SDAC 1NBVL 5JOEA 2AXFB 5D7IB 1ITCA 2FATL 5DYOA 3ESVF 1S7VB 2AAVA 4EIZC 2RCSL 3D18B 3PE9A 2HFGL 4NRZA 5HHNA 3ARSA 3BN9D 1A6PA 2H32A 4OLWL 1CD0A 5GHWL 5JMRA 3SDYH 1RFDL 3F5WA 5E1AB 4NM8H 1DE4A 1GHFL 1B0WA 2P8PB 4JO3H 1MCDA 2HKFL 5TDPB 4Z7WA 3MLSH 3RZCB 1QO3A 2FL5A 5EBGA 1A4JB 4NQDA 3WEXA 3KPRA 3QISA 3KDMA 3RIFK 7CGTA 4XPFL 4I0PA 3QH3A 1CICB 4ZS7H 3PDDA 1K3ZA 3PL6B 1G7MB 4OFPA 3QEUB 1U3HA 3AU1A 4UUJB 1AQDB 4PJGE 1F58L 2IH3A 5GRJL 5I8OL 5DR5H 4N0UA 5JW5A 1N6QL 5IMKB 3DETD 4MMZC 3JWDH 4BSJA 4EOWH 3HR6A 2DQHH 2IALB 5TH2A 4NKOA 5ENWA 1KJMA 4DW2H 2CD0A 2QKIA 2Z8WC 4YHLH 5LBSH 2YA0A 3B2UC 5IESL 4OB5H 5KSBF 5I8KL 5CCKH 1HHGA 1K6QH 5IIEB 3CFKB 3RY5A 3BO8A 4LCUA 5DRXA 5CEXB 3QUMA 3AROA 3BE1H 1NL0L 5I1HH 2EH7L 5JQ6H 3U36B 1GYAA 5C0DB 3MRKB 1P9MC 1V7MH 4ISVA 4NN6C 5I2IB 1BVLA 4F2MA 4LARL 3TBTB 4HBQA 1EEUA 1QLFA 1ZEAH 3QB7C 1TTFA 1ONQB 4GMSH 4K94L 3MQIA 1MFAL 1MJ7L 3FFCE 4R7DA 4JHAH 2R29H 1FFOB 2VZSA 3GSRA 3R06B 1G7QA 1QKZH 2AJ3B 4LCIL 4UIMA 4OLYL 2MTPA 5ADPH 1CTOA 4G43A 3VFUA 2DQCH 4WFHE 1CFNB 3EOYG 3KNBB 3QNZA 4QLRA 1IAIH 2N7BA 4KDTC 5FUCC 4XPHL 4H5SA 2AKRB 4R7NB 3PIQA 4NFBA 5SWZD 2DYPD 3FQNA 3RGHA 1NCDH 3S3JA 5ISZD 3MLRH 5FV1L 5JZ7D 4X7TA 1K4CB 4OIBA 3LKRA 2BFVH 3QDJA 4PJ7E 4IRJC 3V0AC 1JNNH 1XGPA 4X6BB 1UM5H 2LU7A 2HLFD 1I9IL 1TVBA 3ARVA 1ZVYA 1BVKA 2PYEA 5I18H 4YXLL 4M93C 2OZ4A 5DSCB 2IWGA 4ZQKA 5IG7B 4NO5A 3NZ8B 3MLWH 3RDTA 8FABB 1ULVA 2YD6A 3GBNL 3L5XH 2GHWB 1Q8MA 2CIIB 2R15A 1S5HA 1NMCC 1DN0B 4CNIB 1NMAL 3CLEL 1ES0B 2CUIA 4KTDL 2EEDA 2PKDA 1MIMH 1CL7I 4WDIA 1F6AB 5D5MB 2VXVL 3F7YA 3BKYL 4CAGA 3K2UH 4LCWA 3VG9B 2NY3B 4JFDE 4F7CA 5EU4A 1JNHB 4ZSOA 2F74B 1AO7E 2ATPB 1V8HA 5IHBA 2GJ6B 4G8IA 1IEBB 2N1KA 4LVNC 3V8CA 2MHAB 1J5OH 2AQ3A 4DVRH 4N9GB 5DJYB 4FQ1L 1R3KB 4PJCE 3BPNB 2UUDK 2XZCH 4X5LA 3RWJA 2ADJA 5GGTH 3BZDA 3T2QA 4KZDL 4O02L 4UT6H 2R1WB 1QG3A 1NUNB 3GMLA 2I07A 1EUUA 1AHWC 1KC5H 4FQHA 4JB9L 3HFMH 5T5FH 1I1YB 2D03L 3E6FB 3BZFA 4XTRC 3HUJA 2ARJB 4F7TB 1MIEL 3OGCB 4IS6A 1RURL 2VDML 2ZPKH 4RX4D 3WUWA 1HN1A 1NBZA 1UC6A 4PFEA 3ARBD 1P4BL 3NN8A 4LPTA 1YQ2A 1JPST 25C8H 1J8KA 4DN4L 1K8DA 3EYOA 5IVOA 3WFZA 4MCZA 2R23B 5LCVH 3ZKMC 2H41A 2NY1D 4WFFD 4XVSH 3CFCH 3DOSA 4F37K 4MD0B 5DURD 5IROC 4DK6A 3ARFB 1Z6JT 3OBAA 2EC9T 2AS5M 4Y4FD 4S1QL 1QRNE 1CDGA 1U8LA 1L0XA 1GGYA 3AAZB 1F42A 3MA7A 3IYLW 4BH7A 2AEIT 1NC2D 1VESA 1XIWD 3OF6A 2FO4A 2NY5C 1PKQA 3V5DB 3SE9H 3CXDL 2AK4A 5BS0D 1SY6H 1NGXA 1Y18A 3SGKC 1WCQA 1U91B 1LNUB 3RZWA 4TSAH 2VISA 1U2HA 1UZ8B 1OHQA 4FQQA 1KB5L 2QSTA 2HH0L 2W60A 1SYVB 1ZGLB 1AKJA 3CVIH 2ICES 3WIIH 5IQ7H 1XR9B 3CNKA 4XRCB 4JO2L 5BZWA 3VDBA 3PABB 4LL9A 3UJJL 4EQ3A 5DRWA 4NKIH 3QFJE 2PXYB 3WHXB 4EI5B 1N8ZB 5T33L 4X4YB 2P24A 1PG7H 2XN9A 3JV4A 3L7FA 4NRXA 4XAKD 4Q6IC 3Q1SL 5D2NE 5DZNA 2BSTB 4ZFGL 1JMXA 1MUJA 3LS4H 1JGVL 4ZDHB 4I2XB 5TFSH 1T1XB 3EO9L 3RX8A 5HI5C 3DSFH 1JF1B 4NZDA 1CE1H 3VFWA 4J3XA 1FBIL 3PHOA 4AEHH 5FOBB 3QQ9D 4KJQD 1WFNA 3LZFH 3UCRA 1MRFH 4GQPH 3RU8H 4DJMA 4M4RA 2IMMA 4YGVB 5L2KE 3DUSB 1LEGA 2VH5H 4JFFD 1RUPL 1EDQA 3MGTB 2O5XH 3NMEA 2AABH 1AXTH 4YR6A 3WIHL 4M62H 1FSKC 4YHZH 3MODH 3ALXA 3QEQD 4TPRH 4D2NA 2VQTA 3IFPB 1JHLH 1TIUA 5CEZD 3PDOA 1YEIL 3JSSA 1UZ6E 3MRMB 2X7LA 3VMNA 1AGCA 1KENH 3U46A 4Y5XA 2XKNB 1NUDA 3UYRL 2H1PH 3WSQH 4I77H 3V6BR 3FZUD 5CSZA 3T0AA 4I18C 1YNLL 1ED3B 5D5MF 5E6IB 3W39B 4LFHG 4G6JH 1TQBC 1EGJA 4G6AD 1FH5H 3SDCB 3ZHKA 1A02N 1QPPA 3H9ZA 3RWCA 4XXCA 1A14H 43CAB 1YA5A 4Z7WE 2PYFB 1B0GB 1MLBB 4R4BA 1OOAA 1C12B 4OLZH 3JBG7 1JHKL 2W0FA 3FCTB 3CSPA 3TVMD 1JFQL 3FONB 1G7PB 3HA0A 3KPRE 4NQDE 1KT2B 4LKCA 1R5IB 1A22B 1WBYA 4JQXC 3M45A 1MFDH 2X4SB 3NA9L 3JUZA 1ORQA 1Q9WB 4N0UE 5JTWA 4PTTA 4R3SB 3V8OA 1WWAX 4PR5A 4RWHA 4AMKL 4K7PL 4N1CA 3CDCA 2L7UA 4PJIE 3PJSB 4WUKH 4J2XA 4KTEL 2X40A 5CD5C 3PHQA 1INDH 2O5YH 2RHEA 4WHCA 2GK0A 2XT1B 4X6CA 1MREL 2FLBT 3DI2B 5F96L 3MZTA 1QSED 3VFGH 1PSKL 4BELD 2HA1A 4YIQA 3BWAA 3QO1B 5I1GL 3VXPA 4H26A 2WBJC 2AXGB 3ZE0E 3DRTA 4PRID 3MNVB 1MJ8H 1M7DB 1SJEA 1FCCA 4H0GA 4JDTH 5GJTL 2VITB 5FO7B 2AGJL 2AJVH 1KCUH 5E99H 3B9KA 3TO4C 5MHSE 1UCBL 1NGZB 4WIQA 4KK6D 4MD4A 5IB5A 2BXYA 1K5NB 4NQVB 5F6IB 4XP6H 3O41B 4PRAA 2X05A 3U0PB 4QT5A 3O2VH 5LVEA 3LIZL 4HS3A 4P5TD 1ACZA 1TMCB 4R6UA 5E00A 5HJ3B 1X5ZA 3E2HB 2R2HA 1E27A 2CDGA 3WUZA 7FABL 3S5LA 1G7JA 1RIVH 5I1LA 1MHHA 1C16B 4ZO6A 1HXMB 5CILH 4FZ8H 1OT2A 4DUWA 1CU4L 3MRHA 4GT7A 4HCRH 4MLSA 4NO0D 2MSPA 3BPLB 3QDJE 2ICWJ 3Q6GH 3LH2H 3MNWA 2AI0H 1S7QA 3JVGA 1BZ9A 4XCNA 4JPKH 5DRZB 1WEJH 4U1HA 4L3ED 1H15B 1T0NA 4XPAH 1MCBA 4IDJH 5C08D 4MYWB 5KANG 3E1F1 4P59L 4GG6B 4FTVB 4PV9B 5B39G 2JIXA 3HPJB 2YZ1A 2CDEA 3RVVD 3L6FB 4HIIA 3SY0B 5GGVL 1MQKL 2HFTA 4HMDA 2DBLH 5T3XD 2PETA 32C2A 3QULB 3HI5H 4OCXH 3HI1A 3GMOB 4P2RB 5F3HB 4E5XB 4EN3D 4LVEA 4GXVL 3SPVB 3MCKB 1QNZH 1RU9H 3OKNB 3P0VL 4OLUL 5JOFA 3V52L 4FQ2L 4DGYH 3DURB 3N9GL 1BM3L 1F4WH 3BH8A 5F8RC 3SE3A 1ZSDA 4P23B 4HIEB 3WKML 3FQRA 2F58H 2FHFA 2JCCB 3CU1A 3DYMA 4LCWE 3AS0A 4HPOH 1C7TA 2MPAL 3FOMA 5FCUH 4KAQH 3QUKB 2W65A 1HHIA 4ZSOE 3GGWB 1CFQA 1CZ8L 1JI1A 5IK3A 3DMMC 4K8RL 1CGSH 4QTIL 4K3DL 3BQUB 1U8IA 2R4RH 4KK5D 4J3SA 1EJOL 4H1LA 3MRQB 4FZEL 4PJHA 1KIUA 4G8FA 3ILPA 1S78C 2A6JA 3VXUA 2EEBA 1MJUH 4XB8A 1EO5A 5BMFL 3ZTNL 1CG9B 4YHPB 4KDWA 5DC4B 5CEZH 4IDLA 2B5IB 2D0HA 1HZHL 1ND0B 3MLTA 5C6PB 4KRPD 1MLCB 3BIKB 1QR4A 4NNYA 4NWUH 5CEYA 1YY8A 2PR4H 5ECJE 2QADB 1CF8L 3CPLA 3HUJE 2CKBH 2E7LC 2NW3B 3QXAA 3C8HA 3OKDB 3PGCB 1AR1D 1BD2E 4LMQI 4FS0A 3OJ2C 4JANA 5I6XC 5BVJA 4GG8B 4APQD 2P5EE 1AGEB 3ARXA 3VGGA 1KCKA 2AJSL 3P0YL 3ARRA 1I7TA 4XAWH 3IFOA 1I1AD 1ZANL 2ORBL 3BDYH 4O2CB 4TNWF 4JPWH 3KYNA 1DBMH 1C5DA 3NIGF 4G7YH 5D96C 5HGBA 2WIIB 1KGCD 2ZUUA 5DGRA 4M9PA 4CDGC 5IFHL 3EOTL 3TBSB 5C0EA 4Y5VA 3BGMA 4NGHH 1PKQE 5IHUL 4OUOA 5EZJB 3VWKB 3D69A 1A0QH 4D9RE 3VD7A 4L3CA 4C57C 2F54E 4FNLH 1V3MA 3VFTB 1S7RB 4XNQB 4OF6A 2R2BB 4GW4B 1KYOJ 5FA3B 2WM0A 3HE6C 5B39B 3BRGC 2C26A 3EOBA 3L5JA 3TNMB 1T3FA 3MGOB 5D6CB 1HI6A 2NLJB 4N90D 2DM2A 4U1SA 1KPRB 4MB4A 1OPGL 5IFJA 5AZ2L 1G9NH 3GBMH 1L4IA 5MERA 4JFYA 1V5JA 3R8BB 3ZMRA 4AT6B 4NBXB 5IV2A 5EIVA 1YEJL 4OBRA 2IC2A 1CICD 5DC0A 4XNMB 5AUMB 3MLPA 2NZ9D 3PL6D 3H7BB 5TDNA 4MD5B 3GMNA 5FYKE 5I0ZA 1SJHB 3MFFA 5ADOL 4Y16D 3FO9B 4XP1L 3FFDA 1PBYA 1ZHNA 5J1AA 4AJ0A 1JZ3A 4M00A 1GAFH 4MNQA 2HLAB 5GRUH 4WTZG 4Z95L 1A6TB 4OIIH 3VXRA 3AREB 2J5LB 2GY5A 4OCNC 1XGYH 2BMKB 3BEWB 4ALAL 5LGHH 5J11B 2C3HA 2O5ZH 5HGHA 3KLHC 5F1IA 1A2YB 1G9EA 1IKFL 4IIQB 3T2NH 4PJFB 3BP6A 5HHOA 2X44D 3A0OA 5GIRA 4YNYA 3MA9L 3TP4A 2IGFL 1NAML 5BV7L 1MFEH 3D3VD 4GSDL 5E4EB 5HXMA 4L8CA 1UCTA 4PJAF 4EDXB 5C0IB 3ZKNC 3HN3A 1MWAA 4QHKJ 4N5EC 1HINH 4PLJC 2L0DA 5E70A 2GSIA 4BK4A 4X5XA 3KXFE 5KSVB 1MCHA 4Y4HD 2F5BL 3S36H 5C0GA 3T0DA 2GJZB 2HKHL 1IGYA 4XNZC 1R3HA 3IDMA 2OQJB 3HG1A 3ULVD 4GS7B 3U0WL 3BP5A 4DFHA 5K9OA 2ICCA 4MQ7A 4XXDA 1DSFH 2NZIA 4PTUB 1BIIB 2BC4B 4NUGL 3F62A 4UQ2A 3ARDB 5IF0A 3T77B 1A3RL 3R1GL 2XTJE 1RJYA 2IAMC 1B4JL 1WICA 3ZSTA 4BSVB 3IFNH 4W81A 4NJ9L 3DX8A 2QL1A 5D72H 5GGRA 3SN6N 2NY2C 3IDIB 3OKKB 4YBLB 5GRVK 5FECA 4MLIA 4P46A 2A0LC 2NY6C 5CHNA 5FYJE 5I66A 2CQVA 4QYOB 3X12A 4NQXA 4X6CE 1PGRB 4WTWA 3IVKB 3MV9A 1IC5H 4ETQB 4HKXA 2KZ1B 4JFEA 4OKDA 4F33A 1LQSR 4BFIB 2IG2L 3O6FA 4P2OA 3VU2A 1J0ZA 4OM1H 5FUZH 1IAOA 2HT3D 1MRDH 4HZLB 5EFIB 4J3WA 3BKJH 4OQTL 3VFMB 2X4TB 2X4UB 4HGWA 3WFHB 2VLJB 4PJ9A 2NY3D 1T1YA 2BSSA 4KROD 2FBJL 5T5NF 2MNUA 4W6XB 3BZ4B 1JUFA 2GJ6D 4H8WL 4ZPVB 4Y19B 3UAJC 4JM2C 1JTTA 4L8BB 1GVIA 4NNPL 4PRHA 1D5XB 4XVTH 4X4XA 1MCPL 5I1IH 4FFZH 2NW2B 4YDLC 4QRRB 5D6DA 1UH2A 4WTXA 3PWPE 1R5WB 3FMGL 3H9SB 4PBWD 1Q94A 3WE6B 5GS2D 3BP7B 5F7HA 1ZLVH 2HWZL 1TJGL 4HIXL 5KTEH 4U1NA 2AQ1A 5BO1H 1J1OH 3IAGC 1CDYA 1KACB 4JQVC 4V2CB 2GKIA 1CBVL 2QR0A 3T3PF 2X2YA 3I9GL 2IQ9L 2C1PB 1JBJA 4HQQH 4JREC 4LASH 3DVIA 1WZMA 5IT2L 5F88A 5T1KB 4BQ9A 2DI7A 2YKLH 2LU3A 3VI3E 5T3ZE 5IB1B 2A73A 5C0BB 2XZZA 4POZC 5IVXE 5SWSA 4DKEL 4UZGA 3G6JA 4GBXB 4GAYA 3ARFD 3GMPA 2UZIH 5J3HD 5SX5H 1YMHA 2EKJA 1QFWI 2DMKA 3T3PE 1VB9A 5D1ZB 3UXFA 1CT8A 1CL7L 4ORGB 5EO0A 1K4DB 3RWEA 4M7JH 1MFBH 3BVNB 1DN2A 3RY6C 5EIIA 1RIHH 1ZLSH 3BMVA 2W9EH 3WO4C 3GIZH 3PGFH 1D5IL 5H2BB 5EZOH 1MI5B 1YMMA 5I71B 1U9KA 4J3VA 2B1HH 5MP6H 1NANI 1TZIA 1CTNA 1WZLA 1XMWA 2JJTA 4TTDC 1KBGH 4GXUN 3RPKA 5GS0H 3LKOA 2PF6A 1DQDL 3DUHA 4CADB 3RWDA 1OD7A 4NFCA 3MRIB 1A6WH 4XX1G 4NIKB 4PJHE 3SJVA 4ZUWA 4OF5A 3O6KH 2R9HD 3IF1B 2PXYD 1U0QA 1SYSB 1PW3A 4EI5D 5FO8B 3O2DH 2APBA 4YQXH 3TT1L 3MRPA 1WK0A 4EKXA 1EERB 2J1KA 4JJ5B 4S2SB 3MYJA 3G6AB 3PWNB 1D9KB 1CXLA 1RULL 3O6ML 2MQCA 2EIZA 4FXGB 1QYGL 3B9DA 3OG6B 3L7EB 3GMMB 1HHHB 2QHLA 5DMGC 1I7UB 3CJJA 5JW4N 1SM3L 4LSPH 1OTUC 1JF5A 1VCAA 4RQQB 4LPXA 3UPCA 4D0BA 3CZFB 1A9BB 4WWKB 1QEWB 1MF2H 2APXA 4ETYA 4QOKB 4U1LB 5JMOC 1CVSC 4QTHA 5CIPB 4H88L 1QQDB 1HYRC 4QHUA 4P0DA 4OFDA 3RIAK 1W0VB 4OUUA 4KJPC 3G5XB 5DK2A 1S7SA 4GRLC 4PP2A 3V79C 4J8RB 1WV7T 4U1GB 4J6RL 3QDGB 5LXGH 1JMZA 1JJUA 5T1MA 4J4PC 4L4TB 5E6ID 5EUOE 1X5XA 2COQA 4OZ4A 5J13B 3U48A 1WC7A 3D25B 3SDCD 3WXWL 3MBEC 2C3GA 5L88H 5EUKB 4OFYD 4Z7VF 1EBPA 3F7VA 4GLRH 4Y5YB 2VLLA 5I30H 4PJXA 4OF8A 5JOPD 4P2QB 4FABH 3OKMA 2EH8L 2XZQL 3SDAB 1CXEA 4WW2F 1Z5LA 3MRRB 3DVNA 1F2XK 5A43C 4CW1A 4EXKA 2ED7A 3OAUL 4JO4L 1KIPA 5HHPB 5ACZB 4OCSL 1D3CA 3NFSH 3FT3B 2FX8L 4EDWH 4WFED 2OP4H 5SX5K 1WT5A 4GO6B 4ZO7A 2AK4D 3MRNB 2VLKB 4FQXA 1LK3H 4F58H 1B2WH 2BHZA 5IJVA 5J6HA 1S7VA 4GW5B 3QQNA 4PREA 3WNMA 3GJFH 2A74A 1E4KA 5I1EH 5FKAB 3WFBH 2VDPL 3PUCA 5GZNC 4MVBC 3VXRE 3DPBA 5I17B 1UXWB 1FO0A 4UV4L 3DO7B 4WV1C 3SCMC 4R4FH 1EEYA 1VADA 4ZTPL 3QUMH 2CMRL 5HGAA 1J05A 2DL9A 1K8IB 1NDGA 4JDVA 1IT9H 5GS2H 1UA6H 1TVDA 2B8OT 3EIFA 5FB8A 3RZCA 2WMPA 2GI7A 1NGYA 1RUAH 3ZYIA 1NCTA 1HSBA 5FCSH 1I4FB 4JG0H 4I9WD 4OCRH 1T1WA 1HSAA 1H8NA 2XN9D 5C09B 2H45A 3KYOA 1OM3L 1G7MA 3T0VA 5F3BA 2GTZB 3A67L 5IMKA 3U6RA 4G9DA 2K3TA 3ABZA 3PHSA 3DTXA 4DGIL 1MCKA 1F4XL 3NBNA 5AYUL 2CGRH 5MENB 3TNNB 3E3QE 1EMTH 3HG1E 2FSEA 2PW2B 4XNUL 5TDOA 3VXMA 2QHRH 4M8VA 3GSOA 5JPNB 2AV1B 3CFEB 4EBQH 4X6FA 2P49B 5DK0A 1VFAB 4FQIL 4XVUC 5DD6B 4K2UH 3THMH 4LK4A 3I50L 5FDWB 1P1ZA 3QO0A 4Y88A 3TBTA 5F8QC 2FIKA 2BVEA 1N4XL 3F12A 2EE6A 3P4OB 3NOIA 5DHVA 1RI8A 4FTVD 2I60H 5F7LB 4UIKH 3C8KB 1P7QA 3R06A 5L9DL 2K7QA 5DJAB 1CLOH 3IKCB 4DOHE 1JRHH 1GGIL 4LPCA 4OM0L 1IBGH 3RGVA 2BSRA 1L7IL 2MMXA 4I3RH 4P2RD 1I9JL 3ULSA 1PFCA 1QBMH 1GC1C 4IOIB 4LFHD 1TETH 1C08A 3GSXA 3MV9E 3OKLB 1QSVA 2EO1A 1BP3B 4IRJB 2ZG1A 3CH1A 1RZFH 1P7KA 4YPGB 2DQIL 4A6YH 4P23D 5T1DH 4NKQB 2YWYA 1G7HB 1QTYT 1BFOB 5DJ2A 4M93B 3VXTA 3JWDC 2H2PD 2LAAA 3OJVC 2FZ3A 4HX1A 4LSTL 4I0CC 4KPHL 4HV8B 1H3WM 4U1IA 2A6IA 2V5RA 3ES6B 2V2TB 3T4YA 5D1XB 1FLRH 5F1OB 3P9MB 5E2UH 1T20B 5IG7A 2H6PB 1NMCB 1RK0A 4KQ4L 3BQUD 5C2BL 1UWXK 3ELAT 2VE6B 2M1KA 1F4YL 4YDKH 5IJKC 2G9HB 3GRWA 5ALCH 4V1DA 1JTPA 3DLQR 1QSEE 4Q6IA 2YXMA 3GJFK 3PXJA 3U7YH 3D2UA 3S37X 3MCLH 2X1PA 3L3IB 2DRUA 1KTDA 1J0KA 4WFGE 4FXKB 3BN3B 4MXWL 5GGUB 4ELMB 1D6VH 2DWDB 5I8CA 1DEDA 5I1KH 1CD1B 3VRLF 2QADD 3G6JF 5EU6B 1VFUA 4U4BA 4UB0H 5HYIA 4MX7A 3O9WC 3QG7L 4LVNB 4YAQB 2VXSL 1JNHA 1RHFA 2ATPA 4AQ1B 5I0DA 1FJ1B 1FFQA 4HWZA 1WBXB 5DVOA 1SBSL 2DQEL 1U58A 2DQUL 1NMBL 2IADB 4JPVH 4BFGA 1OW0A 1ZLUH 3VW3H 2NY7H 1U8PB 4IMLB 3G6JE 3EBAA 1HEZA 1UKTA 4N9GA 4TUOB 1AHWB 1NJ9A 2ATKA 3IJYA 3M07A 4NBYB 1JYWA 2FX9L 2DDQL 4I18A 2OXGA 2BX5A 4X6EB 3LKPB 3G9VA 3HRPA 3O11B 5D71H 3E6FA 3IDXL 5HHXH 3GFUA 3VWKD 3FQUB 5I15H 3WXVL 1EEZA 3VJ6B 3WDIA 1YMME 4F7TA 1HCFX 4XP9H 2YUWA 4YHYC 2VC2H 2A38A 1BLNB 4E41B 5CWSB 1FNHA 3C60C 3RTQB 3QIBA 3VFSB 2WWKO 3ESUF 3MV11 3MREA 3MCG1 3C9NB 4GRMA 4KKLD 3BESR 3EYUL 4XCCL 4O5LL 1HIML 3OR7A 2FHCA 2EDFA 3BZEA 4IOSD 4O2FB 3S88H 2WP3O 3Q48A 4F57H 1HH9A 2EICA 1I1FA 4HC1A 4K23L 4LAQH 5HDQH 3JV6A 1JGEA 2ZCKL 2MOVA 3SKMA 4UINH 4R90L 3FRUA 2EYTB 4DVBB 1WLHA 5K9QG 5E24E 4KVNH 5CMAB 1ZK9A 2BK8A 4ZTOH 2HG5B 3ARED 4KKNA 5C92A 1VFMA 3T8XB 2HRPH 3ALWA 5DQJA 1DQQA 4O58L 1ZHKB 3L9RA 4P9HC 5IKCB 3VXSB 2GITA 3V6ZA 1ZV5A 2OMNA 3LN5A 3QIWC 4PJXF 2BNQA 4E9LA 1N5AA 4DAGH 4G8EB 3ULUL 5C8JA 1UB6A 3FN0L 5A2LH 4ZDHA 1SBBA 4I2XA 2F5AL 3GSVB 4PV8B 2NXYB 1FYTA 4S1DD 3ZZ1A 4LCYB 3MSPA 1JGLL 2QSCH 1T7WA 2VLRB 3GJEB 1AY1L 1OT1A 4KI1A 5FOBA 4KVCH 1QLEH 2XY1A 2YPKA 1F13A 4PJXE 5DFVD 1PYWA 1FSKB 1UXSA 2BDNH 4G9FB 2DLGA 3VFVB 1DP0A 3PQYA 1MY7A 1D7FA 1S9VB 4JY5L 2C4FT 5FKPA 3M1BA 1MCIA 2ARJQ 1RVFL 1Z0NA 2AJUH 5E0QA 1MAKA 4ODTL 3G5VA 3IFPA 1DLHB 3NABH 1ZLUK 5IBTH 5I1CH 4ODXB 5DDHA 3MRMA 2ZCLL 3QI9A 5JIIA 1LE9A 5C86A 1TQBB 1J18A 3ZKSD 3MRJB 3VXQA 2VDQH 1ZGLP 4HKJA 4LEOB 4MJID 5I8EA 5CJ8A 5DWUH 2E6PA 3OXSA 1OAUH 2OJEB 2O93L 3N1QC 4MA1C 3RNQA 3UZVB 2W59A 4ZAKB 3TN0A 4S1SL 2NY4B 5BCAA 4TNWK 1W72L 2R4SL 3HAEG 4P5MA 3IJHA 3CFJA 4N90E 3MOAL 2Q8BH 1NBQA 3DX7B 3LEYH 2WWMD 43CAA 4G8GB 1OF2B 2YHGA 4L4VA 1VEOA 4PUBL 2CDFB 2LAGB 3EYQD 4UOW1 4M43L 5TPWH 3QT2A 5ALBH 3FONA 5C9JA 1KT2A 2BVPB 1IL1A 2F8VA 5DJ6B 2VZTA 3MV01 4LPYA 4YHML 2FECI 2HJLA 4QXTA 4EUPA 4WEMB 5JIKA 1FRGH 4OAWA 4YHOL 3GSQB 4DCQB 1ZA6B 1A1OA 35C8H 3DECA 4Y19D 2DIAA 3PJSA 3KWWA 3TJEH 4PJ8A 5GSRA 4OGXH 3O8XB 4G6KL 3FRPG 4MA7L 3VFPB 3VXME 2WBJB 1J86A 3X3GL 1ZT1B 3IXAA 1IQDA 3QEGH 2RBLA 1KJ3H 1QA9B 3GMRB 1U8OA 3JWOL 4MB3A 3H9SD 3PV6B 4PJDA 5IEKB 5MEOB 2NYYD 1L7TL 2CLZB 1AXSA 3TO4B 4OZIB 5DMIH 4WJ5A 3UC0L 5GSVA 5HHOD 3TA3C 3M8OL 4NO3B 5TGBA 1NLBH 4IRSC 2OSLA 1T5WA 2NPLX 4QY8A 3BRDA 1NGZA 5A16A 4P57A 5JR1L 3TO2B 1K5NA 1I7ZB 5T1KD 4LDEB 3OTTA 2Q8AH 3A6CH 3LMJL 3G6DH 5C0BD 1G9MH 3I02A 1WISA 4NO2A 3ULVE 1LO5A 4KMQA 1BBJB 4GBXD 4YBHA 2R0WH 2CJUL 4PGCB 4N0CC 3LCYA 5D1ZD 1QUNA 1ZLWH 5BVPL 4LF3B 5TQ0H 5KVMC 2FBOJ 1Q38A 2J2ZA 4Q9RH 3EO1A 4I5BB 4X8XA 15C8L 3P11H 3LB6C 3MXVL 3NIFE 4IJ3C 3H9YA 1H15A 1JPFB 3L5HA 4ONFH 4UOW0 1MI5D 3C2AH 4PV9A 4QRPB 1MCWM 1V3KA 1EFQA 2FH8A 3HPJA 2WUBL 1NCBL 1QLRB 2DM3A 3B5GA 3ARGC 2YBRB 3TYGL 3SBWC 3EJJX 3QULA 1L6XA 4H1LH 2YD2A 4LSSL 2A9NH 1KPVB 2GIYA 1GPOH 2VYRE 5MEPA 1WCBB 4NOFA 3NGBB 5F3HA 4E5XA 4Q9QL 3GK8H 3O4LB 3S97C 2C1OA 3IFLL 2XFXA 1LMKA 5JXED 4LLVB 4WNQB 5E94B 4LLUB 1PG7X 1I8IB 1BIHA 3I6KB 1C1EH 4TUJA 2NXZC 2XRAL 3HAEB 1D5MA 3RVUD 3CMOL 5D7JA 3DURA 3TWCL 3BEVB 1DL7L 4GKNB 1D9KD 3OB8A 1RUQL 5FGRA 4Q58C 4HIEA 3DMMB 4P4KA 4AL8H 2HRLA 4JG1L 1LWRA 4ZFZB 4PYHA 4NOBA 4YDIH 3HZVB 1AGDB 5IUSA 4IBLT 1MFNA 2WLYA 1INEL 4U6VH 2K7PA 2XPGB 4ZUTA 2FR4B 4BFEA 1WTLA 1SHMA 4NNXA 2Q86B 1KJVB 4FQPA 1CQKA 4WWKD 4XP4L 1XF3B 5B3JF 3TFKD 1AGFB 1QFWL 2R69H 4NWTL 1MCLA 4J1UA 4QOKD 3QDMB 2NX5A 3GHBH 5J06A 1A7BA 4FQLL 1A3LH 3MJ8A 1FL3A 3W9DB 5EBLA 5DA0B 3V0VA 4RGNC 3HE7A 2X5PA 3P3YA 3UTOA 1Q9KA 1F4HA 3CZJA 5CJXC 3C6LA 4G7VL 5B3JE 4L4TD 3P9LB 3OKDA 1FN4B 1DJSA 1RHHB 5C0RH 2W1NA 2VDKH 3X11B 5JDJA 4Y89A 3R0NA 1E6OL 3NAAL 2BY3A 4KKAD 1NC4D 4Z7NF 3BT2H 4K9EC 1R3IL 3VWJC 1GZPA 1H0DA 1W8OA 1KB5A 3OGOE 3ZO0A 5D96B 4P2QD 1A6VL 1HKLH 4HKBB 5SWSD 3H9HA 5E8NA 4NN7C 4LRIC 4X5WB 4HWBH 3SDAD 2OR7A 1FAIL 4NQEB 2GUOA 5I1JL 3WFEL 1KF9B 3SGJC 4O9HH 2IPTL 5DA4A 2LTQC 2R0KH 1GRWA 5I1AA 1BQUA 4M5YH 1CQYA 4Z7NE 4HWEH 3FO0L 4QNPE 3HC4H 3SDDA 3HE6B 1JZ5A 3D85A 4R0LA 4ZODA 4R8WH 3LQAC 2VLKD 1QSFB 4XPTH 1ZLWK 5ESVB 5TE4L 5C0AB 2V2WA 3VFTA 4TUKL 3KAAA 3TC9A 4NKDA 4GAJL 3O3UN 12E8L 1CGTA 4LP4A 1DVFC 3MGOA 4LLMA 1DR9A 3QUYC 4N0YH 3SJVD 4DTGL 1DFBL 1FIEA 2VLME 4ZOCA 1A5FL 3L3JB 2FEEI 3G04B 2CRYA 5EZLA 5I74B 4S1RL 1U8HB 2P46B 3WIHA 2BNQE 2YD8A 1PX3A 5C09D 3TH4T 5AUMA 1P5UA 4O51B 3V95A 5CP7B 1MWAH 1DANU 1N0XH 1OGAA 1ACYH 1YJDC 1I8MA 3GSWB 3MLZH 4I2XE 3B2UD 5INCA 4AG4H 2HVJB 4U05A 2YA2A 3KYAA 2UYLB 3N1MC 5MEND 1E28A 5D1QB 3CH8A 1BX2B 1A6TA 4ZPTA 2XG4A 4C4KO 3CUPB 5F9JB 4LLYB 2VDOH 2X9YA 3VMOA 4M3JA 3B8SA 1W72B 2VDLL 3IS0X 2M8XA 4I48A 3S4SG 4UTAH 4PPTA 1F11A 4PJFA 5EN2A 5IW1B 3UJTH 4Z78B 1OARL 1QFOA 5EU7E 1S8DB 5SX4I 1XCTA 2KBGA 4XNZB 4HXBH 1T21A 2A9ML 1N3NB 1HHKB 1FL6B 3CK0H 3QHFH 5HPMB 3EYSH 2IMNA 5JW3L 5F7EL 1A3QA 1YECH 4N8CH 4ZUVB 4KZEL 5IB4A 4CKVX 3LRHA 5ANMB 1VHPA 5KSAC 2C3VA 4IRJD 4KQ3H 4J7RA 5JOPE 1YEEH 4OGZA 5SWQB 2IAMB 4XHJC 4L4VE 4PTUA 2FEDC 1J8HB 4JN2A 3ARDA 2C3WA 2ITDB 1JCKA 1A1NB 3V4UL 2DI9A 1XF5A 3T2PA 2EC8A 4FFYL 2NY6B 2XYCA 1M7IB 4PJDF 3V5HB 1I1RA 3IU4H 4WFEE 3KPMB 1C5CL 1X44A 2EXYC 4MCYB 3W11C 1VKXA 4QGYA 1AD9B 1S7TA 4QYOA 1NCAH 2DQDH 4MJ6B 4Y2DC 5DJ0B 5SX4H 2PO6C 3TIEA 3RX7A 4LHUA 1NFKA 3KVQA 4PJDE 1IE5A 1ZTXH 1U8NB 4XNYH 5ITFA 3QWRA 1HQRA 1XGRA 1R5VB 1MCSA 2CIKA 3X3FL 2BVQA 5EU6D 2D7TH 2ADIA 4O4YH 1OLLA 4NM8L 4HFUH 4JO3L 4JM2B 2BVTA 3PWLB 3MLSL 2CLRB 4D0CA 1HXYA 2BVUA 1U36A 5DJ8B 3TCLB 2NCMA 4YDLB 4M4PA 1QRKA 5FOJA 4XBEH 4WU5B 5K9JL 5BRZB 5LQBL 2Z91B 5DR5L 5DJDB 4NRYB 5IBUG 3KPOB 1DBKH 4EOWL 3RJQB 1U8QA 1JZ4A 3SKNB 2B20A 2DQHL 4BZ1H 4DW2L 3T4AA 5LBSL 1ZA3B 3S4SB 1EFXA 5CCKL 1YEGL 2OI9C 3QNXB 1MCNA 4LLWA 3BE1L 5I1HL 1VFOA 3ZKMD 5JQ6L 2OXHA 4L8SC 4BM7A 3BGFC 1YN7B 4LSRL 4PLKC 5I16B 5IVZA 5HGGS 4P2RE 1TLKA 1RK1A 3UX9B 4Z77A 1MNUH 1SVZA 1QKZL 5ERWB 3SGDH 1RAMA 5ADPL 1NCCH 3CSBA 4G80B 3RL1A 1LDPH 2BNUA 3WO4B 2DQCL 3TBVA 2BVOA 2ZKHL 2VR9A 5TQ2H 5GS1A 3D9AH 1X5AA 1IGMH 2Y25A 3UZEA 1IAIL 4HXAL 2YPVH 1JYXA 1JV5A 2JCCE 3E6HB 3H3PH 4DGVH 3IGAB 3C5ZC 3JWOC 5CSGA 2W9LA 4WV1A 3SCMA 3TLRA 4N8VG 4JRXA 3V7AG 1FDLH 2X70B 1EHXA 3MLRL 3DXAA 1MJJA 3RKDC 4U2YA 2Z31A 5FYKL 3QA3B 1JNNL 1CFVL 2P44B 1T04A 4TVPD 1UM5L 4CMMB 1YDPB 3JWNC 3DX6B 3MR9B 5CINH 1OWWA 4GKZA 3VXSD 3INUL 4HUUB 1OP3H 3O3AA 1ORSA 5I18L 1SYSA 2JKXA 1S9XB 3MLWL 4LPWA 4YFEA 5EOCH 3UBXG 1F3DH 3CVHL 5HI5D 4HWNA 1AJ7H 4M9OA 1OAQH 1AE6L 2D0FA 3S36X 4HHAB 4UTBL 3ZTJG 5B4MC 3GMQB 5E8OA 3L1OL 1ODAA 3MUY1 2EDDA 4PJ5B 2Z4QB 3ZDXF 2VLRD 3WNLA 3C5SA 3C2SA 4ZFOL 4CN6A 1S3KH 3EO0A 3EAKA 1BPVA 3I6LD 1ZHLA 4WUUA 3CC5A 3C5JA 3ZDZF 4G9FD 2DQFB 2R2EB 3CZFA 4L9LA 3K2UL 3STZB 1JWUA 4DUXA 1X6LA 4GUPB 1F5WA 5INDB 3VFNA 2XWTB 1WAAF 4HBCH 4GRLB 2Y6SC 5BOPA 3QCTH 1UJ3A 3VH8G 1IM9B 1OAKH 4ZG1A 3QDGA 1YC7A 3MBEB 1F8TL 5GS0C 2V6HA 3EFFA 1ZT7B 5GGTL 2F8XC 3U30B 3D25A 1I3RB 5DJCB 3I2CL 3G5YB 4JRYB 1EH9A 2XV6B 4CVWA 2RFXA 2ED8A 5EPMB 4G8GD 3S35L 3WS6C 2FRGP 4GKSA 4ODVL 3JTTB 5D2NC 1TCRA 2AEQH 4WEBH 2QQNL 3H0TA 4JPIB 1TNMA 3CSGA 3LDBC 1T2QH 1T83A 3T2OA 4ZXBA 1S5IH 1XZ0A 1NAMA 3VA6A 5HI3C 3MZGB 2MJWA 5F72S 3ISWA 4M1DH 1F4AA 5IJKA 5IGXL 5DMKA 1A7NL 4XVSL 3CFCL 1FIGH 3P30H 3AXLA 3FO1B 4Z7QF 4ELKB 4L8DB 3WN5C 4N8VB 2WBJD 5JDSB 4J3TA 3PWJB 4M48L 3DO7A 3VGBA 2KKQA 5J12C 4YDJA 5DZLA 3T0EA 5DQ9A 3SE9L 3L5WB 1SY6L 4U31A 1RUMH 2Y72A 1ITBB 4QHNA 4F7EA 4YFLF 3TO4D 4TSAL 2AV7A 1LEKB 4PJFE 1FG9C 1WFUA 3MV8D 4X9HA 1G7IA 2XKUA 5ID1A 4HJGB 3CVIL 3LOWA 1II4E 3LHPH 3WIIL 2GTZA 3PNWA 2OTWB 4MS8C 5ESQA 2EDYA 4ZD3L 2IH1B 2PTVA 1G7LB 4D3CH 3J8F7 3L3OB 4NYLB 3UTTA 4FQCH 1PG7L 3P4MA 1BQSA 4Y1AB 4YX2L 3DJ9A 1T22B 2ZCHH 2NY5H 3LS4L 4KXZH 4I0PC 4YXKH 2PW1B 3MLUL 1P84K 1TZHB 3PQYD 5TFSL 5ICZB 2V7HA 1U3HC 3DSFL 2JF1A 1EIBA 1ADQL 1F90L 2ZUWA 2LFGA 2F8OA 4PRNA 1EV2E 3T0BA 1YN6A 2HFEB 2P5WB 4D94A 4AH2B 4NSKB 4YZFF 5FV2A 1D5ZA 1MCWW 1BQHG 5D7KE 4PY7B 4OQTA 5KVGH 1NGWA 1N59A 2CK0H 4QRPD 3AS3A 4PJEB 3RU8L 4LCCC 4F80A 2P1YA 3VH8B 2W9DH 3QQ3B 4TOYL 4G3YL 5CP3A 2O5XL 1YY9C 2AABL 1AXTL 3MXWH 4M62L 1KFAH 1QFUL 3CDGB 3ZL4L 4YHZL 4F7MB 4TPRL 1FQ9C 5E9DB 1MH5B 1LP9B 3O4LD 4IOIA 5ETUB 1E4XI 4YZFE 1SEQL 1URLA 2FJHB 3DNKA 1A1MB 4KV5E 2VIRB 4I77L 1ZVHA 4R9HA 4JFPA 5JHDB 4PS4H 3SDXB 3T3MF 4OZFA 3UP1A 1JN6A 2HN7A 3O2WH 4IOFC 4G6JL 1TTUA 2H2SC 4LLAA 1GL4B 1FH5L 4F15C 3DMMD 3M17A 3DRQA 3JTSB 4I3SH 4EJ1C 1A14L 1FORH 2VLJE 1S9WB 3G5ZB 4ZYKB 1NFDA 4LLDB 4QHMB 4JDZA 5D1XA 3MLXH 4RBPH 4YHNA 2BXZA 3P9MA 1S78D 2AK1H 4NHCH 4Y19E 1K3IA 1MFDL 3FB8B 2B1AH 1J11A 4OD3L 2ZG2A 1CCZA 5EA0H 4L4JA 4DWHA 3QDMD 4PB9H 3LQZB 5IFAL 3SEPA 5IB3B 3HC0A 2GSGB 4S0SD 4QRRE 5HVHC 5E8DL 3H9SE 4WUKL 3ROLA 3NCJH 4XNXH 2FGWH 1INDL 5CD3A 4YO0B 3O9WB 1QFWM 2J4WH 1RZKC 4JFHE 1CD1A 3RDTC 1NKRA 5HHVL 5L2JB 2FLRT 3UPRB 5JHLH 2OX5A 2DTML 1W0WB 3REVA 4NHUA 3VFGL 3KYMA 1MAMH 4ZFFB 4LNRB 2MQ3A 4S0TD 5DUMH 1MJ8L 1KTLB 2VAAA 4M8QA 2HJFA 4YUEL 5DD3H 4JDTL 2F53D 5KVEH 2Y1VA 2ZNWA 1KCUL 4JM4H 3MO1B 1CE6A 4NQED 3OXRA 1GCFA 1U8KB 2CR3A 2BOCB 4M6AA 4QXGH 1NFIA 4XHQA 1UWEL 3O2VL 4M7KL 3SE4C 5H94B 3U4EA 4YHYB 2EKSA 3HE6D 1NQBA 3O11A 3OMZA 5DUBB 4NZRL 3DGGB 1QSFD 1RIVL 3B9EA 1FNSH 3D0LA 3C60B 2ITCA 4CVZB 2VUOA 3MRLA 4LPVA 2YC1A 5CILL 3GSNL 1REIA 4WI6A 1BQHB 4GXUM 3OR6A 3VXNA 4HCRL 3TGXA 4MAYB 2XNAA 2WANA 4RIRA 2ZUQB 4RFNB 3RTQA 3VFSA 4JPKL 1OSZB 1WEJL 1NEUA 3QXWA 4YLQT 4M7ZB 4XPAL 1TQCC 4IDJL 4HK3N 3EYVA 4RGMB 1A4KA 3PG2A 3TJHC 4PRDB 4E0RA 4MJ5A 3QIUA 1VERA 5I75C 1NBVH 4KDVA 1UJTA 4UDUA 4JR9L 1BFTA 1KCVH 1QNZL 4L29B 1RU9L 4R2GC 1G0DA 2HFGH 2YSSB 3LKNB 1JK8B 2EYTA 1H3VA 5JW4M 3KLHD 4DGYL 5GHWH 1F4WL 4NZTH 3RNKA 1RFDH 3HNTH 2X4QA 4WUUE 2QQLL 4MMXC 4X7SL 4M61A 2F58L 4GAGL 1KPUB 2HKFH 4DZBB 3MYZA 2ZOLB 3QIWB 1ZHKA 5FCUL 1UB5B 4RBPK 4KAQL 4LLQA 4QOKE 4ODHH 1D6EA 4IRSA 1CLZH 1KJ2B 2SEBA 2XZAH 4F7PA 4PLJD 3V6OA 5HGDA 1CGSL 1JPSH 5FIEA 5KW9L 4XBPB 1HILA 1OB1B 1F00I 2R4RL 5GRJH 1N6QH 1EAPA 1KSRA 4G8EA 2FD6L 4PJBA 2IFFL 3NFNB 3QDGE 3J7HA 1MJUL 1P6FA 1FVEA 5HYJA 2C5DC 1YEKL 4KJYB 5DS8B 5CEZL 3QZWA 3BKMH 3OJDB 3L3GB 3MV7B 5LWYL 3SO5A 5F97E 3ZE1E 5B38A 4X98B 2PR4L 1FCGA 2E9IA 4TSBL 5BJTB 2IAMD 1NL0H 3MGAA 2EH7H 1J8HD 4GQ9H 1U95A 3FT2B 5IMOB 4ODWB 2OR8A 4GJTB 2O61A 2OL3B 4JQIL 2NY2D 4K94H 4P4RA 2PTTA 1MFAH 1MJ7H 2AEWA 3ARGA 1AGBB 3IJSB 3IAPA 2A0LD 2NY6D 3P73A 4EUPH 2VZVA 3P4NA 4LCIH 2AP2A 1HE7A 3BDYL 5F9AC 2EDBA 2VZ1A 3D85D 4OLYH 1HOCA 4MA1B 3I3BA 1AIFB 1UQSB 4G7YL 4RMWA 4XT1C 4OFKA 5GRVL 4OKVA 4XPHH 2XWBB 2EYRA 2Q76A 4ZAKA 3UTSB 3T0EE 2UWEA 4ONGL 5FGCE 5TE6H 1CGXA 4NQCA 2DJUA 4FNLL 1ZWIB 1BOGA 3ZE2E 5MEQA 4XX1E 1XCQA 4Y5XC 4YWGH 2Z35A 4OFIA 3MBXH 2FWOB 5DMYA 4G5ZL 5IBLC 2FCBA 4C56D 5DJ6A 4YK4B 1DDHA 3W0WA 1ZAGA 5F89B 3UAJD 4JM2D 1IC7L 3DYPA 1G9NL 2I26N 5H35B 4HT1L 3TESA 1A6AA 3KPPA 3QEHA 4XXCC 2AXHA 5C07B 4U7SA 2H3NA 3GSQA 4DKFH 1W2KT 3UTTE 1ZHBA 3SGEH 5JPMA 1IAKA 1QOKA 2H8PA 3O8XA 5KZCD 3VFPA 3ZKXC 2HT2C 5BRZD 1H8SA 2WBWB 3WL9B 1NMAH 3TA3B 1RD6A 4KTDH 4QRTB 4O2EB 2MKLC 3EOAB 4XGZB 3RUGB 2EDOA 2FDBP 1GOFA 1GAFL 1I1CA 2VSCA 1B90A 5F9OH 5GRUL 4RAUB 3GSUB 2AJXL 3MLVL 1IVLA 5LGHL 1CLYL 2IBBA 3TIDB 1IC1A 3QCUH 2O5ZL 3D87B 1JPTH 4Y0GA 4POZD 4QRQB 3GKWH 1I7ZA 5HHME 4GRWF 2X89D 1JZ7A 1LD9A 3EDFA 4X8JB 1F3JB 4JFOB 1MFEL 3CU7A 1MVUA 3QWOA 3IKKA 1NFDF 1UM4L 2NR6C 3FQWB 4FQ1H 4G42B 5DEGB 4YHKH 3D39A 4Z0BL 5T3XL 2XWJB 5EOTB 4O02H 1ZS8A 3BDXA 2QSVA 4U6TA 5KVFH 1Z9SA 2Q6WA 2CXKA 4GRWE 3LV3A 5KAQG 1MPAH 1U8JA 4WENB 4TTDD 1JIBA 3Q3GB 1MIEH 1OTSC 1FFNA 2VDMH 1DSFL 3U9PH 5K9KA 1CDIA 2GFBB 3RL2A 4AM0B 1YYLL 1R3JA 2ARWA 3S9DB 5IOPB 1QLRA 1P4LA 1IAIM 4PGZA 2P7TA 4OZGF 1KCLA 3U2SA 1FGVL 4BJLA 1SJVA 2WLZA 4NFDA 1BBDL 2NXZB 4OD2B 5ICYA 4HDIA 3CSYB 5LAXB 2G75B 3UTQA 3HNSH 1U92A 3NTCH 3BPCB 4DQOH 4LLUA 3VGFA 3S7GA 1KELH 5KANI 2I25N 4S1QH 1CGYA 1T7XA 1DLFH 3TCXA 4ELME 1KEGL 1M05B 4X99A 4GKNA 5DMGD 2JLLA 4LSDA 5DURB 3S96A 4I0KA 2IBZX 3VCLA 1IC5L 2W91A 3HZVA 4PJ5D 1YEDB 2BERA 2ZSWA 3BRFA 3ARUA 4HK0A 3TZVA 4U0QB 4ODUA 2QEJA 4QRUA 1KB5H 4F3FA 1OP9A 1NC2B 1G1CA 1CD8A 5HVWA 3QNYB 4OM1L 1QVOB 4QGTA 1FHGA 1KJVA 5F21B 1CGUA 5FUZL 5B3NA 4AENB 1K85A 1XF3A 3HZKB 4KJPD 4TN9A 4RMTA 3IU3B 3UJJH 4P3WA 4RGNB 1OP5H 3FRPA 4RWYL 4GRLD 2HLFC 4NQSB 3JV0A 4WHYH 3GB7A 3IETB 3VA2C 4J4PD 2AEPL 1IM9D 1I3UA 3Q1SH 4ZO9A 2HT4C 2HJKB 4U1KA 4XVTL 5L7XH 3MUGB 3MBED 3KYKL 3Q5OA 3VWJB 3QXDA 1B0RB 2CO7B 4FFZL 4RFEB 5I1IL 2EIDA 4B5EA 5I19L 4IM8A 3AUVA 4U1JB 1V3JA 4W4OC 2YN3A 4E41E 5C3LD 4NN7B 3WIFA 2AJZA 3MMEA 1E4JA 2C7UB 4OI8A 3AVEA 3SKJL 1J1OL 3QXTA 4YXHL 1Q9OB 2LTQB 5D7LB 4D9LH 1RUPH 1A7PL 3HPLA 1T1ZA 3BJLA 1JGDA 4NUJB 2H26B 3WIHH 5DLMH 4KHTH 2EDWA 4LASL 5B8CA 3E8UL 5FF6B 5J57B 4BUHA 5C0CB 3BP4A 1YEIH 2YKLL 1DUYB 1IEAB 1UWGL 4RA0C 3ECBA 2NMSA 2Q7YA 4UU9B 4MXVF 5CBEB 5EOQH 2ICEB 4MVBD 5EBMA 3UYRH 4JFFB 4JY4A 2YWZA 4M6NL 5EZIH 1INQA 4JRXD 3NCMA 2BNRB 4ZOEA 2UZIL 3EJYC 1DVFB 4HJ0C 5C0AA 4QF1A 3QEQB 3DV6A 4QHLB 3QUYB 1TDQA 1MAJA 1FZKA 3REWA 2G2RA 4HGKC 4U7MA 4PJBF 4M6OH 1ZLSL 1X4YA 3VRIA 2VR5A 2W9EL 3PGDB 1I8KA 5EG6C 5CJBA 5SV4A 4OZHB 4QRSA 2CKBB 4MXVE 1HHJA 4Y5VC 3L3JA 2B1HL 1JFQH 3QG6B 2J8UB 4RGOH 4A2MA 3G04A 1V7NH 3V6OE 5EWIH 5T1LB 5BQ7B 5DRNA 4DK3A 1FP5A 3KLAB 4OI9A 1IGCL 1QR1A 4O51A 5CP7A 2HMIC 1A6WL 4LOUC 4PJBE 5H37H 4OLXH 3OX8A 4R96B 3UZQA 4K7FB 4OV5B 3GSWA 3O6KL 3RJDA 3TVMB 3FB7A 3IXTB 3O2DL 4OF3A 5E8EA 3FHAA 4YQXL 4KTEH 1LEIA 2WBKA 2VLRE 5E8PB 2Y06L 3FO2B 3KG5A 1MREH 4XVUD 4BKLB 1QBLL 5CGTA 3HZYA 4Y1AD 1B88A 1IGTB 3O3EA 5F96H 3I6LE 4G9FE 1PSKH 1W72A 5CS7A 5IB2B 1HNGA 2K1MA 3HHRB 1EUTA 2A2QT 1BFSA 5FO9B 3ULVL 1OSPL 2A83B 4MDJA 5IEHB 2WINA 2UWEF 1KIRB 5JUEH 4HUWB 3DX9A 5EU5B 3DHJA 2A6KB 1TVHB 4HIJA 8CGTA 2J12B 2JJVA 3NFPB 5E5MB 1NCNA 5KSAB 1M71A 1T7VA 3BHBB 5HPMA 5E9DD 4XC1L 5IQ9A 4JN1L 4LIQH 2UWEE 5ANMA 5EOCJ 3BH9B 5E2TL 4NQCE 5LXGL 5JHDD 2ICWA 5KOMC 5SWQA 1T4KB 4X80L 1FGNH 3CFDB 1YNTB 1DQJB 2LV4A 2X1OA 3FQXA 3QFDB 3K8MA 1A9EB 1P84J 5I30L 4P59H 3U4BL 4NPYA 4PJCA 5ICXB 3W9EA 3E3QC 2DBJA 4KJQC 5CBAB 5GGVH 1M6OA 4RMSA 3VE0A 3NPZB 4Y2DB 3S3PA 2PO6B 3HI6H 4XCEA 2ZOKB 1GOGA 2DS4A 3RPIB 1EHLH 1AD9A 4MDIB 1GOHA 1YUHA 1YEFH 3GZKA 4M7LL 2GT9A 3FFCB 2ZG3A 1X5FA 4GXVH 1A7RL 1U93A 1DCLA 5KSBB 3NFSL 4JVPA 3KPSA 4OLUH 1H3PH 5IP4A 3V52H 1LK3L 3DVGB 3KS0H 1U8NA 1BM3H 1W8NA 5DT1H 3CDFA 3IDGA 5I1EL 4WO4A 3O9WD 4EN3B 2XQYG 5GISH 3WKMH 4WHTA 3FT4B 4P46C 4R4FL 3CIQA 1G6RB 1TZGH 3QUZA 3C8DA 5HYSA 5B22A 1IT9L 1CZ8H 3B3IA 3BW9B 3QRGL 5KN5B 4K8RH 4ZUSA 2CLRA 1QRNA 5GS3A 2DLEA 4QTIH 1CLCA 3OG4B 4RISL 4Y7MA 5DJ8A 3RWGB 2CPCA 4OCRL 1E4XL 5GRWA 3OHXA 2JB6B 1EJOH 5FXCH 2VNCA 4JZOA 1QPXA 1JNLL 3O6FC 1GZQB 4P2OC 4WU5A 5FYLD 2FJGA 3D39E 4D8PA 3ZTNH 1Q0YH 2VR4A 4BSWB 2P8MB 1HZHH 4LGPB 5IMLB 5ESAA 3U1SL 3V4PH 5J9PA 3LEXA 2CGRL 3TYFB 5BZDA 1EMTL 2QTEA 3MRDA 1CF8H 1BHGA 1DQLL 2QHRL 3GEWB 5DEZA 3LKQB 3HCVA 4L8SB 3C60D 2DWEB 3BGFB 4OJFL 3EKCA 4EBQL 4K2UL 3S37H 4OSUH 4NZUH 4XPBH 2EE2A 1J0IA 2VXTH 1GGCH 1I7RA 5D6DC 5F9WC 1IGJA 2JTDA 1YNKH 2ORBH 3PWUB 2X4PA 4NKMB 4XBGB 3O4LE 2VWEC 2A6DB 1AO7B 5EBWB 2Y23A 4IHOA 3C5ZB 3TPUA 1ZVSB 3DO3A 3EOTH 1JRHL 3RWHA 1IBGL 4X4MA 2VAJA 5GGQL 4KK6C 3C87A 3MACH 5IHUH 1TETL 4HF5H 3FN9A 2Y07L 4AEIL 5M7QA 4P5TC 5DJXA 2X70A 1MHPL 2F9BT 3K4ZA 1RZFL 5HDOA 2JK5A 1RZIB 3RVTC 5ABDE 4UOJA 3VRJA 4A6YL 3OKOA 4MNHA 5DJZA 5T1DL 3H42H 4K3EH 1EJ6A 1CR9L 5AZ2H 5LGJA 1YDPA 3QIWD 4NC0B 5EC2B 4ZNEA 3QDME 1AFVH 2D4DA 1VGKB 4HUUA 4TULL 4KTYA 3L95B 4N68A 4PJGF 3LD8C 1PX4A 3T1FB 4PRPD 2Y7QA 2ID5A 1JHTB 4LAJH 1MHCA 1HDMA 1NBYB 2JJTC 3MRGA 1GC1H 4XP1H 4LMQE 5ALCL 4D9QE 4MA3B 1HYSC 3MNZB 4M1GL 3U7YL 3NH7L 5DHYA 3QPQC 4R26L 1DBAH 3MV7D 4MGXA 2OR9L 5HY9B 2P43B 5BXFB 1D6VL 1EBAA 4ALAH 3ULUF 5I1KL 1IZJA 4Y16B 3SOBL 3IS1X 3BUYB 2B0SL 4BZYA 4UB0L 4UNVA 2MCPH 1IKFH 4PJIA 1MRCH 4LCCA 1J0YA 4WY7H 3MA9H 2YD9A 4M7LT 2IGFH 2NTFA 5BV7H 5I1DA 1P4IH 4X0KA 5AG9A 3LRSA 4XPGH 2W0LA 1TENA 5FDYA 1FFPB 3ULUE 5SV3A 4WHDA 1AH1A 3QFJB 5GGSA 5JXAL 5C0AE 1OGTA 4WCYL 1IFHH 4HPYH 5FK9B 3RWIA 3D3VB 3LKSA 2I5YH 3DBXA 5DJCA 3UTSD 1R3LA 2ZWLT 5D2NB 4JRYA 5C0NC 3HMXL 4CVXA 1J87A 5I15L 2BOBA 4PJ7F 4UQ3A 1EEQA 3MJ9L 4XP9L 1ZT4B 4Y4HB 4HKZB 2CR6A 4P5KB 3JTTA 2VC2L 1QHPA 3R1GH 1OWRM 4X7CC 1B4JH 2C3XA 1PLGH 2AW2A 5C0FB 5F9DC 2DQTL 2IQAA 4OD1H 4TRPL 2IANA 5D7SH 3WN5B 5L2KB 1NCWH 4ZUUB 5CZXC 1LE5B 5IHZA 2BCKB 3HS0B 3S88L 2R1XB 3UMTA 1U6AH 5C07D 5D9SB 4N8VA 5FYLH 1JP5A 5HHQB 1UADC 3EDDA 4LAQL 5DYOB 1AP2A 2A77L 3TA3D 4MXQC 4F8TA 1FZOA 2Y9RT 5D2LA 4NRZB 3FB5B 4IRSD 4H25A 2X4NA 5HHNB 1WT5C 2H32B 1ETZA 1RUKH 3LN4A 5JO5A 4FQXC 4QWWD 4MSWA 2VZ3A 3F5WB 2FNBA 4OQTH 5A1AA 1E4KC 4HJGA 1FYHB 1G6VK 3UBXA 4OIAA 3VMPA 3UJIH 1CK0L 3SQOH 2FL5B 2FBJH 3CFIC 5TJWK 4LSUH 4LHQB 4NQDB 3WEXB 3KPRB 4H8WH 5DVMA 1BAFH 3KDMB 4FXLA 3QH3B 4N0CD 4NNPH 1FL5B 4PJCF 2VKWA 3WLBA 1DBBL 4P9ML 3RZCC 5JW5B 4DAGL 2IH3B 4N0UB 1KLFA 5ANME 2APVA 3U7AA 3SE4A 4KROB 3MTRA 4J23A 3LB6D 2J88H 4OZFH 1LHZA 3FMGH 2XXMB 4Z5RA 5TH2B 2GCYA 2UY6A 3OSKA 4NKOB 1KJMB 2QKIB 3GJFB 1FPTH 3KHQA 1O5DT 4KVCL 5TE7L 5AZEL 1RMFH 2DIJA 3K81A 2HFEA 1HHGB 3ARGD 5J0BA 4D0DA 1H5BB 3BO8B 4LCUB 1CBVH 5DRXB 5GQBA 1CFSA 4WI9A 2OBGA 3QUMB 4Y4KA 3I9GH 4P9HH 2DM4A 4ISVB 1BVLB 4F2MB 2D31A 1QLFB 4KUZH 3V4VL 4OT1H 3ET9F 1TJIL 4R7DB 2E7CA 2NXZD 5I1CL 4KRLB 3GSRB 1G7QB 4KI5E 1BD2A 1KJ2H 2BP3A 3KPSE 4G43B 4M5ZL 4CN1A 2FJHA 3QUXA 3VFUB 4F15B 2P5EA 2VDQL 5IW6A 4PGEA 1CL7H 3LEVL 1XF1A 5CJ5A 3QNZB 4X6DA 3SDXA 2YPLA 3C08L 5DWUL 3Q6FA 4HH9A 4H5SB 3PIQB 3CDYA 3AY4C 3RGVC 1Y6MR 3FQNB 2Q8BL 3UROR 1PEZA 3LEYL 3V2AR 4X7TB 3IB4A 2VL5A 3ULVC 3LKRB 3QDJB 1XGPB 5HVHB 1TVBB 4DZ8B 3WFCL 5JORA 2F54A 5BRZE 4HIHA 2X9XA 4N0FA 1N2RA 1YYML 2PYEB 4RGND 4LQ1A 1YQVL 2OL3H 3KR3H 3DARA 4G6FB 4E42A 4Z76A 4K3JL 4M6ML 3TT1H 3RDTB 5D70L 1IGIH 35C8L 1TXKA 3QYCA 3VD3A 3L3DB 3O6MH 4OGXL 2HVKB 1YPZA 5DQDL 1QYGH 4XVJL 4FG6C 3VWJD 2D7QA 3PP3H 5BOZG 5E7FA 1VPOH 2XXCB 1KJ3L 4FA8A 5IMMA 1R24A 1BEYH 2J3SA 3K74B 1SM3H 4A6YB 2UZYB 3F7YB 1LDSA 3P77A 3WNPA 4LCWB 4ZOBA 1NLBL 5D7LD 1MFCH 1I9RH 4JHWL 4F7CB 5EU4B 4ZSOB 1U8KA 4H88H 1UZ6F 1RJZA 5C0CD 1CFTA 4G8IB 4X4ME 3V6FA 3HLAB 3A6CL 3CVHA 4KWUA 1VGEL 2W0PA 3DROA 1IAMA 3DGGA 4MHHG 3RWJB 2BNRD 2ADJB 4I4WB 1DVFD 2R0WL 4NN5C 2YS4A 1OW0C 3WV0A 3QUYD 1CDUA 1CI5A 1TQCB 3GMLB 3TH2T 2I07B 3WXWH 4Q9RL 4FQHB 4Z7WF 2ESVA 4MAYA 1PY4A 2YEZA 4U1MA 3BPNC 4ZFOA 3BZFB 2VTFA 2EH8H 4ZNEE 4IS6B 4JO1H 5KSUB 5ILTL 3C2AL 3KXFA 5I75B 3I75A 3KPNA 1NBZB 4U6YA 1NEZA 4P49A 3NN8B 2BVYA 3ZHLA 4KMTL 5T1LD 4ZNCD 3OAUH 1DUZA 4XI5C 3GUTA 3GNMH 1K8DB 4OCSH 4R2GB 3A6BL 1XF2A 3FTGA 3EYOB 2QLVB 5ITBL 1KIQA 2A9NL 3WS3A 4MCZB 4LKXA 2V17L 4OGAC 4PJIF 4TTGA 4GW1A 3GK8L 3QIBC 3ZHDA 4YBQC 4L29A 2Z93A 1C1EL 5GGTA 3QXVA 1U8LB 4UV4H 1OAYL 3MA7B 2BHUA 2QJDA 3HRZA 4OTXL 3ZE0F 4EXPX 2FO4B 1FNGA 1PKQB 1WBZA 4ZTPH 2CMRH 3O0RL 3SO3C 2AK4B 5IM7A 4AL8L 1NGXB 1G0XA 1Y18B 3LPGA 4TYUA 2ERJB 4Z7OF 1KXVC 1FVDA 1BOYA 1PG7W 4BA8A 2V5MA 3UTPE 2VISB 4U6VL 3GI8H 4FQQB 2O26U 1BWMA 2W60B 2DLHA 3G08B 3WLWC 3T1WA 1Z9LA 5K9QI 3A67H 5BZWB 1FZMA 5HDBE 4EVNA 2R69L 5DRWB 4DGIH 1BJ8A 3GIVA 1F4XH 4Z7OE 5KSAD 4J3UA 2ZSVA 4W68A 5DMJB 2P24B 2KPNA 2G60L 2XN9B 3JV4B 2EE3A 3L7FB 4HEME 4KH2A 4NRXB 4XHJD 1KG0A 2FEDD 2PXYC 4JRYE 4KKBC 1Y6KR 1MUJB 3PP3K 5GRZA 5MI0B 1JE6A 5AWNH 4YC2C 3PWVA 2Y36L 4FQIH 1KTRL 2I9LA 4KRNA 2DQGL 2FJFA 1BREA 2GEEA 1SY6A 3S5LG 3I50H 3PHOB 5IMOA 1JTOA 4JJHA 5AYQA 1N4XH 1AD0A 3BT2L 2EXYD 1CDJA 4NZJA 3T65A 1R0AL 5IR1A 1AGBA 2IANE 5D2LF 1XGQA 2IBZY 4QCIA 3R8QA 2ADFL 5T5NG 2KZWA 3PWPA 4HUMB 4HWBL 2ZP0T 1G1YA 4Y2DD 4HS6A 2PO6D 4YR6B 3RAJL 2FH6A 2Y5TA 3MUHL 2YRLA 1K2DA 4OM0H 3HR5A 2MQ0A 1L7IH 3V7AE 1I9JH 3FFCD 1AGCB 3U46B 4HWEL 1NGQH 3B9AA 4Y5XB 3HC4L 5E08L 2D9CA 5KG9A 4R8WL 5C70A 5CSZ