2NSQA

Crystal structure of the c2 domain of the human e3 ubiquitin-protein ligase nedd4-like protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
140
Chain Sequence
b'GEPVYGLSEDEGESRILRVKVVSGIDLAKKASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase NEDD4-like protein
publication title The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 23
structure length 140
sequence length 149
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2nsqA00
3S2AA 4OVUA 1UOWA 3QJZA 4NPJA 1E7UA 4FULA 4OVVA 2WXGA 4PS3A 5G2NA 5G55A 2CJSA 3PS6A 3M7FB 1BCIA 4FLHA 4FA6A 2K4AA 3CSTA 4A55A 3FBKA 4KZCA 3ZVVA 2Q3XA 1DSYA 3P2BA 1YRKA 4NS0A 2K8MA 2CM5A 1E7VA 1HE8A 3L9BA 3ZW3A 5CCGE 1TJMA 3IBEA 4F93B 2R83A 1K5WA 1DJZA 3ML9A 1WFJA 2KI6A 2D8KA 1DJGA 3NSJA 3R7RA 5JHAA 2UZPA 4IHBA 4TUUA 1DJHA 3DPDA 3F00A 3NZUA 2K3HA 4J6IA 4LCVA 4PS7A 2CHDA 2LHAA 4FJZA 1W16A 3HN8A 4XZ4A 4LT7A 1UOVA 2N1TE 2NQ3A 2QZ5A 4WWPA 2Q0ZX 1WFMA 3F04A 1RLWA 2RD0A 4PS8A 5CCJA 1RH8A 3DBSA 4BFRA 4L23A 2FK9A 1W15A 4HLEA 4L1BA 3W56A 4QJ3B 3GPEA 3N5AA 1DJWA 1DQVA 1E90A 3IM1A 3HHMA 4ANWA 5KJ7E 2CM6A 2EP6A 3L17A 4TS6A 4KITB 2DMGA 3L54A 3RPBA 5EDSA 1QATA 4LDCA 5H4ZA 3CSFA 3L13A 2NCEA 2WXOA 4TV3A 2YOAA 2Y3AA 4KZ0A 4QJ5B 2CJTA 2WXMA 2WXNA 3F01A 3OAWA 2FJUB 4WEEA 4Y1TA 4FADA 2B3RA 3TL5A 2WXPA 3L4CA 4L2YA 3OHMB 1E8XA 4GB9A 4V11A 3B7YA 3QAQA 2BWQA 3RDJA 1QASA 5CCHE 3QR0A 2WXRA 3ZIMA 2ENJA 4ICXA 2WXHA 4ICWA 4IQHA 2Z0UA 2WXIA 2CHWA 2NSQA 1TJXA 4ANUA 3F05A 3LJ3A 2WXFA 3TJPA 1DJXA 3ENEA 4DK5A 4NPKA 4BGDA 1BYNA 4FJYA 1A25A 2ZKMX 2V4LA 3ML8A 2YRBA 2A4ZA 4QAMB 2K45A 3NZSA 4HVBA 2QZQA 3HIZA 4WAFA 1BDYA 5JHBA 3L08A 3PYCA 3T8MA 4ANVA 3MJWA 3SD5A 3TWYA 3PRZA 4F92B 4GNKB 4ANXA 3QK0A 1UGKA 4NP9A 4WWOA 1V27A 4DNLA 4JPSA 4Y1SA 2DMHA 3R7QA 4XX5A 5H4YA 3KWUA 4FHKA 4XE0A 1DJYA 4QJ4B 1E8WA 3QARA 4EZLA 3QR1A 2CHZA 3FDWA 4WWNA 1GMIA 3JZYA 4F91B 4FHJA 3APFA 4MJJA 3W57A 4L1LA 3L16A 2ISDA 2A5UA 2WXKA 1E8YA 1RSYA 2X38A 2WXQA 4EZKA 4F1SA 3APCA 2WXLA 1DJIA 2CHXA 2ENQA 1E8ZA 3APDA 3PREA 4URKA 4G11A 2ENPA 1CJYA 3PFQA 4AOFA 2JQZA 5T8IA 3KWTA 4AJWA 4EZJA 2WXJA
chains in the Genus database with same CATH superfamily
5FO7B 1JWSA 1WA2X 2EXWC 4M4PA 1V3KA 2FEJA 4OVVA 2IOOA 2O6DA 5K9OB 4NHCH 1UWEL 3ARDB 4RGNE 1CF8H 1FAKT 1ZTXL 3GDBA 2HFTA 5AOZA 4BZ2L 3EGSB 3JV6A 1ZDSA 1L6PA 4DZ8A 3MGOB 1VEOA 1A6VL 1ADQA 3QHFH 1FI8C 1KCLA 4XP1H 2XKNA 3VFPB 4NNYB 1XH0A 3I50H 5JHAA 1S9VA 3BUYA 5I1IL 1PZCA 4OCWL 5E1HB 2N3JA 5HYQA 5G55A 1SXAA 1CT8A 4GG6A 4JHBA 2AK4D 1Z5YD 5CJXA 1JV2A 3V9CA 3LZFH 5BW7A 4LSSL 4WUKH 4RFNC 5CP3H 1JZ4A 3P73B 1MDAA 3FTGB 1NUFA 3HUJE 2CGRL 5HJGA 2EICA 2FHCA 1CL7L 2GBAA 4EOWH 1Q9KA 4PJFF 1HXKA 5E94A 1KJ2L 4JFZL 2HTLD 4Y2DB 2YQ2A 2YUXA 1HFUA 5SWZE 2WLJA 3VFNA 1MFNA 4HJJL 1RFDH 3AJ7A 5D6CA 3LMJL 2EDJA 1WAEA 1JWUA 1X5JA 1JNHA 3VRJB 1KBWA 3P0GB 3GQFA 5L2JB 1JZ3A 1YQ2A 3PGDA 2Y25A 1BXAA 4NPYA 2XIBA 1E8XA 5EC2A 5IW6B 4AQZA 3RZCA 3BPCA 4NB7A 5CLYA 1KTRL 2FRGP 2ARJB 4JDZB 4FAAB 2NXYD 2F5BL 1QLFB 2PTTA 3CZLA 3WHE0 3PP4H 2VITB 4HKXA 4LARH 4BFBD 4F8QA 1UA6L 1FCGA 3H85A 3SE4C 3L2NA 4P5TA 5EHFA 1I82A 2F8IA 4Q97A 5I17B 3T09A 4ZNEE 3F85A 2HYMA 5AWNL 4NPKA 2QSCL 4Y9BA 5BVJB 2XOTA 3UEQA 4YHPA 1MFBH 2DKUA 5I24A 2V2TA 4X8GA 3S5LB 1AC6A 1P4BH 4NT6A 1FHGA 2Z31A 1W0WB 1J9SA 2GJZA 1P5VA 3A4DA 1R0AL 2V8MA 1ZT1B 4NN7C 2OZ4L 3VWKD 4GLRH 5AB1A 4GXUN 4Q9QL 4I1RA 3ETTA 5I5JA 3VYNA 2ADIA 2XG5A 2A74C 4KHXL 1FNSH 4QXTB 4JG1H 1K6QL 1T1WB 1FVEB 1UOKA 2VDLH 2CR0A 3C5JB 4X42A 2C4FU 2X6BA 4I0PB 2BNRB 2DQTH 4MAUL 3GD1C 4X5WA 2VO8A 3BVNA 3D1MC 4IGBB 1UWGL 4BD4A 1AQMA 2JB5L 3THMH 2ZAHA 4FG0A 4HPOL 4GUQA 3CGTA 4HMDA 5AW5B 3IGAA 4BWTA 3CCHA 3VG0H 1EHXA 2QDWA 3ARGD 4R96B 4X5QA 3HG1D 1ACXA 4QXVA 5DMJB 2XBZA 5LGYA 3G6JA 1MJUH 1MCOH 5D7JA 4RGMC 1AD9A 4OBSA 1P5UB 2G2NA 2XVKA 2R39A 5KVDH 1N64H 2UZPA 5F7MC 2WWMD 1D2PA 3LYRA 3U0WL 2UZXB 1CGUA 2YXFA 3BZFA 3ARFD 4LLQA 4K5PA 3RTQB 4PHZA 3CH1B 3L5JA 4GKSA 4CKQA 2I60H 4PV8A 1T20A 3GMMA 2AI0L 4XCNA 4CUCA 4JS7A 3OF6A 2IGTA 4YE0A 5E6ZA 3TNMA 4FTVA 1E90A 1NLBL 4IU2B 2E0PA 4XN4A 1KB9J 3DUSA 4R7NB 4XBEH 2VXUL 2LGNA 3C5ZA 3VA6A 4O02A 4A2EA 5KVFE 4NUPA 1GZQB 4WV1B 1FN4B 1D9KB 5B38B 1DQIA 2FWUA 5JPMB 5JOEA 5D7SL 2JKRM 5A16B 1QNZL 2YQGA 4G1MA 3HFMH 4W9GC 5HGDB 5BO1L 2AQQA 3KPRB 3M7OA 4A7TA 2WYIA 1XMWA 3OAYK 4YSEA 2X87A 4YZWA 4FNQA 5IIEA 4LOUD 4NENA 4N2EA 2RA1A 4QF1B 3NZHL 3DSNB 2IQ9L 1IAIM 3ARTA 3FQTA 4LOFA 4MZ2A 1OIOA 3DJSA 4W70A 5FO7A 1DO6A 4QRSA 3SOBH 3MXVL 1KEGL 4JN2B 3FK3A 2QGCA 1TTFA 2OSWA 3BFOA 3SPCA 1BECA 4P2OD 3L1EA 4KXDA 3ZSTA 3V7AG 3EGSA 4HW6A 1EBAA 4UT9L 4OF7A 3HR5A 4OUOA 3MV7A 1P7BA 5DRXB 1RZQA 4NNYA 1ZA3A 3QDJB 3ZKXC 5KUKA 3BDYH 1IC1A 3D34A 4YSQA 3CSGA 3WNMA 5J06A 3NCWA 3WTSA 3MLYL 4N2OA 1C1EH 4N20A 3RVTC 3GRWA 4ACTA 2J5WA 3D48R 3NOIA 2DQCH 1UJ3B 2WLLB 3P73A 4FFYH 5DZAA 5E00B 5I73C 2EEAA 4OD2B 4C4UA 4HPYH 5JHMA 4WHDA 4KY1H 1IGIH 1PYWB 4Y2DA 3ZDZB 4N9OB 4NKDA 3QJZA 4KXBA 3D51A 3KVDD 3WNJA 3FN3A 4I1NB 4KI5C 3ALWA 2NLJB 2YQBA 3VRJA 1MJ7H 4ODSL 4U6VL 4UOJA 3CZGA 1KLGB 2LE9A 2Y6TE 4HWEL 2K4AA 4LRIC 3RVUD 3FBKA 2F0CA 1WS7A 3AADB 3U0PB 5IW6A 2Y1ZA 3ZW3A 4B7IA 4JDZA 2ARJA 3O3UN 4NO3B 1OSPL 1ODAA 2QPUA 3S88L 4R8WL 3WFBL 3DSFH 2C3HA 2CRYA 4YO0B 2VITA 4UZSA 5E4OA 4DO4A 2AJVH 4F2EA 1HILA 3KHOA 1AOHA 4XNUL 4KKBC 1KCBA 4X4MA 5I17A 1WEJH 4LK4A 3X1FA 4DERA 1UWFA 1HI6B 1VJSA 2HLEB 3U30C 2C9XA 1FFTB 1UHVA 2ZXBA 1PBYA 5LBVA 4FL4C 5HHPA 1LEGB 3N9GH 2BIQA 5C71A 3S5LA 2FECI 4P23B 5FLVA 1TG8A 3B7TA 4MZIA 4KI5E 4ANKA 1Y1DA 3GLZA 4L8SA 5IHHA 2HJFA 1XCWA 2ZXAA 3US0A 3INUH 4CVZB 1KPUB 1ZT1A 3T6WA 3RL1B 3QQ3B 1JERA 1RUMH 4TRPL 2FBJL 5E2VH 4ZW8A 4X80H 3NJXA 5T1JA 1NLDL 4KV5F 4X0KA 2NTFA 1FVDB 2ZJSH 4QRBA 4QXTA 2GIMA 3SKJH 2KZBA 3DWTA 1T1WA 1FVEA 2EDDA 3C5JA 3G5XB 1ZVYA 3LRMA 4K71B 1RK7A 1CGVA 2XTJB 4J3VA 5BZZA 1E4XI 3LXCA 5F96L 4HT1L 4I0PA 5F0JB 5ITBL 3M45A 3ARED 4ZOBA 3KJ6L 3LSOB 1BXUA 5L2KB 5CLXA 3BQUD 2ENJA 3O0RL 5C6WH 2E5EA 3IPEA 4NJAL 3Q6FB 2WGXA 4ISVB 3LPFA 3NP3A 3QWQB 1GTFA 2UXGA 1K72A 1SVZA 1JPEA 1QFOA 4EDXA 5DZNA 1WSST 1W9XA 5GRWA 5FS5A 4R96A 1KXQA 3UAJA 2ZUWA 3CFCH 3U9PH 1HINL 1NCIA 4PWIA 5EWIH 3TBTB 3TXAA 4NQSB 3RYMA 1GZHA 3N85L 3HI6L 5HYJB 5GS0H 1ZHNA 1IFHL 4KMTL 5K33A 4JY5L 3F7KA 4NNXB 5HI3C 1UGKA 4QRTB 3C08L 1T0MB 2A6JA 2UZXA 2DQ6A 3RTQA 3FTZA 4Y8AA 4LLWB 1O6SB 2DQGH 4AC2A 3O4LD 4KMLB 5DEGB 3CH1A 1U3ZA 5E8NA 3VD5A 1LK3L 4OZIB 4GT0A 4PJ8B 2Z7ZA 3MV8E 3JZYA 4L3EA 5KSAC 3SHSA 2R1YB 4TQEL 3BKCL 3BGFB 2GJJA 2VC2B 2M2DA 5F44A 3PP3K 2D3VA 1CLCA 2VLKB 4IU2A 4UOQA 3TN0B 2JELH 4LL4A 3BEVB 1Z5LB 5K1NA 3MUGB 3OAUL 4R7NA 4Y2LA 4MB4A 4GKNA 3RP1A 4KKRA 1VENA 2WN2A 3EHBD 3LIZL 5E9AA 3MA7B 2A4CA 3PHQB 3PJSB 4OUUB 43C9B 1MAKA 2YD2A 1GZQA 4WV1A 1FN4A 4AM0B 1D9KA 4OI7A 5B38A 1ZPLA 3PHAA 5JPMA 2DQEL 5A16A 3LZOA 5DEZA 3TS8A 1GC1C 3SYOA 1OP4A 1RERA 2AXWA 1KV7A 5BJTA 3QQDA 4B9JA 2CKBB 4QF1A 3WIHL 5FA3B 3SKMB 4RDQF 1ETB1 3SIKA 1A5FH 1CFQB 3M17B 5IHUH 3WTVA 4JNXA 4XZ4A 1TOXA 5IGXL 1J8HA 3FTSA 1CLVA 2O6EA 1UH2A 1AKJD 3NIDE 5JUEL 4QHNB 2BOBB 4PW4A 4XCFL 5L9DL 1SHSA 5C0AA 3CZSA 4U2YA 4PJDA 1GKOA 1FZJA 1Q4NX 2O5ZH 1EXUA 1D7BA 3MOBL 4GLRI 5DRXA 1RP8A 3SGEH 3TT1H 3QDJA 4XNXH 5DEFA 1RULL 5FYKU 2APTA 4YHNB 3U46A 2QKIB 2WXOA 5GRVK 3K5RA 4YEEA 1FC1A 5KVGL 1TZOA 3OPZL 3WIFA 4XX1G 3SBPA 5ISZB 4HUXA 1D7FA 1ULVA 3FAWA 3TIEB 1UJ3A 4Q2ZB 1KN2L 1WTLA 4BQ9A 3G5VB 5E00A 4OD2A 3U4AA 4AG4H 1TZGH 1SY6L 4H5SA 5KOVC 1N2RA 4J6RH 4DN3H 2IWKA 3MREB 4PG2A 2B4CH 2EDWA 2ZOUA 4L29B 3EJSA 3HNTH 1N4XL 2NLJA 1PNCA 4KKPA 4XPFL 5JXAL 1TQSA 1EJ8A 1SDDA 3HE7B 4PHXA 4N5EC 3U0PA 4HALA 3ZQ9A 2VR9A 1X5HA 2F1EA 3UERA 3ZKQD 4EE2A 5E2UL 3D30A 5AAMC 4NO3A 4JJ5B 3V9EA 4JR9H 1RIHL 2FECL 4YO0A 2R29H 4PBDA 2KYIA 1AXTH 5JYLA 3WNOA 5B7EA 3WJMB 3QDGD 3RNKB 4LSQL 4L8CB 1HI6A 1MAMH 5E99L 5E2JA 3VI4E 1FG9C 2MKWA 2RGSA 1LEGA 4WTZA 5DC4B 5DK2B 3TEZA 4JHWH 1DYZA 2WHVA 1BD2D 3GUTB 1P4LB 4ZUTA 4XHJC 3AQDA 5AENA 3UJIH 3RL1A 3QQ3A 1H8LA 3MGTB 3GJFH 3GMPA 5LAPA 4E9QA 3U1SL 5T3XE 3K8KA 2VR8A 3ZKNC 2CLVB 1FVDA 5J57B 2Q3AA 5I6NA 5IJDC 1NCDH 3G5XA 3FUNA 1F42A 4NHCL 5CMAB 4E0RA 5EZLB 1TF4A 5L4IA 2IXQB 5JW4Q 3UO1H 3ZE1B 2AS5M 5L2KA 5EUOB 4N22A 3F83A 5IT2H 1DBKH 1RQ5A 2QADD 2EDHA 4JFFD 3T3PF 3Q6FA 3GO1H 3Q2VA 3I50L 1GPOH 2E8ZA 3HG5A 1EMTH 3BZEB 3V8OA 4HKJB 1N6UA 1W8EA 5C09D 3W3BA 1RU9L 3EF7A 1AO7D 1HWGB 3ZT5A 1IM9B 3AS2A 4NQSA 1CGXA 3WKMH 3FTWA 1Z9OA 3KLHC 5C08A 1WQVT 3DLQR 2G75B 3D39D 3I6LD 3U36B 4UOW1 3DPBA 5KBLA 1H8SA 4LVEA 5EEUA 5I5IA 1Y6NR 3KCWA 4P4KA 4G3YH 5GISH 4EOWL 4XN2A 3KDMA 4NNXA 1MUJB 3DGGA 2CXKA 1T0MA 3WUWA 2CSPA 1L9RA 4U1JB 5C0ND 3QJRB 2XVGA 5I6XB 5DEGA 1YECH 1RFDL 5I30L 4F8PA 5DJDB 5F3BA 4OZIA 5K9JH 2EH8L 5FUZH 3MCG1 4UTAH 2AXFB 2PETA 3LZLA 1A4CA 1N8OE 1V5JA 2J57A 4TOYH 5I18L 3VXNB 2VLKA 4ICXA 4LSRH 1RL1A 1AC0A 4D2NA 2ERJB 4PJGB 2IALB 3SDXB 2DWYA 5A6MA 3PP4L 4ZZKA 1C9SA 4AE0A 2A74B 3MA7A 3PHQA 4OUUA 43C9A 2EVIA 1FFQA 3RVXC 1P7QB 4GSDH 2WCGA 1RZ8B 4Y9FA 3WS6C 4HIHA 2CBMA 7PAZA 3WBDA 1A0QL 1S7VB 2F08A 3LQAH 4XGZB 1FV1B 5CUSL 1Q9LA 5LN4A 1S7XB 2F8VA 2PW2B 4PRIE 5HDBB 3DIDA 2DM4A 5I76A 3Q8BA 4JFEB 1QVOB 1JMZA 4W6XB 3RUGE 3VQLA 1ESOA 3V4PL 3MMEB 4MQXD 1E42A 1EDYA 1YMMD 4WWKB 1L9TA 2VIRB 3DRQB 1TLMA 5F0MB 4QHNA 3CFEA 4UIMA 4JG1L 3KVQA 5IJKA 2VDLL 3JWNH 3MUZ1 3TA3C 3CV5A 5CSZB 3SE9L 3IS1X 1F3DH 1Y6KR 1PCXA 1REIA 1IAOB 1GGIH 2OCCB 4YE4H 4IHOB 4B95C 3WEXA 1HEZB 3CHQA 5CIPB 5IW3A 4DH2A 2WSKA 1IAKB 3BSHA 4M1DH 5AOMA 1T1XA 4F80A 4U7SA 1MFEL 4MTMA 4BQ6A 2PNDA 3L7FB 5FUOH 5ISZA 3G08A 4ZSOB 3ZXAC 2WUBH 2JB6B 2X88A 3EG9A 5CP7A 1GYCA 1OGAE 4U1HB 1B0IA 1KCRH 4ZO8A 3RWFB 3GBML 3E9TA 1MCOL 2VLJB 3TO4C 1EVTC 1IC5H 4H1LB 5GGRA 3HR6A 3GPSA 2F9BT 2FAUA 2JI3A 3MLPA 2P47B 2PCYA 4XCCL 3MREA 1KXTA 1PVHA 4LSTL 2OLDA 1MFCL 1ZRUA 3VFUB 4ZUVA 3DX7A 1TJGL 1DBAL 1CF1A 1RLWA 1DLFH 1XCQB 2I60L 4JW3A 5BUPA 3D3VE 3FQXB 3HE7A 3DKHA 1ONQB 4L37A 2XV6B 1U33A 2IBBA 2C3VA 4JJ5A 2VSKB 4EUPB 4XVSH 1KGCE 3H9ZA 3RPIA 1QSFE 3JVGA 3ET9F 1A7BA 2EO1A 5KVEH 4HCRA 1MDTA 4GBXC 3HUJA 5DZOA 3WJMA 2XPZA 1Z0MA 3O9WC 3RNKA 3UAEA 4L8CA 2WZAA 1FIGH 1JRHL 2CAKA 5FAAA 4MBRA 1S5HA 2D7TH 4XMWA 2R56H 3HC3H 4ONFH 1OAQH 2HTKD 5DK2A 4X99A 2HKAA 3A5VA 3HFML 1KTLB 1CN4A 1UQSB 3S96B 3NIFE 3NCFB 3QO1B 3GUTA 1FCCA 1GL4B 3IJHB 5J1AA 4Q56A 2WVSA 3MGTA 5LDUA 1F4AA 3QEGH 2CLVA 5T3ZL 1TO5A 4S1SH 3SOBL 3BX7C 4YMPA 1NL0L 2ZKMX 5CMAA 4FFZA 2AITA 5I73B 2FWOB 1SOXA 1YEHL 5KTEH 3UX9B 4CVWA 3JTBA 1N0XH 5EUOA 5TPWH 3S5LG 3JV4A 3LEVL 5CSBA 1FAIH 5F71A 5L6YH 3FN9A 4CGTA 1BEXA 2BJMH 3BP7B 1E0OB 1ZGLM 4DT2A 1C1EL 4ZK8A 4ALAL 5JNYB 2WLIB 1HKFA 5J89A 5C6TH 4D8PB 2YKKA 1A6WH 2D2OA 2G75A 3SGEI 2NXZD 1ITCA 5D7IF 3EYFB 4GQ9H 5HTSA 1C8PA 2DI9A 1E8ZA 2ZX8A 1TCRA 4C59B 3NGBC 2B14A 4R5TA 4KY1L 1XSKA 1IGIL 2XN9D 2WXJA 1HQRB 4X6DE 3LKSA 4U1JA 4JGNA 3AW5A 1WT5A 4JHAL 2AC0A 2J6EH 2C34A 3ZUCA 2YD9A 5I0XA 4HA1A 3Q2WA 4XWGH 4LGRB 2AXFA 5GGTA 2VMCA 1I8UA 5GRJL 3VXNA 3QCUH 1A3LH 1J86A 3W9DA 3FTYA 2K6YA 5JIMA 1RSFA 2X4QA 3RA7L 1OAXH 2XX1A 5L8KB 4PJGA 3BAWA 1EO7A 4P06A 4KZEH 2IALA 4I48B 5F7AA 4DPCX 2BC4B 4EF3A 2VOTA 4TPRH 1EZUA 2I07A 4AM0Q 2A74A 4KUCF 5B8CB 1UOVA 2CO7B 4U1GC 1RZ8A 3L3GB 1WEJL 4FA7B 1A6UL 4LPXA 4TSBL 3UYOD 2WY3B 3UZQB 1SHWA 3H9SB 3ABGA 1KYOK 3N1GC 1FV1A 3DX2A 1S7XA 3N9GL 2PW2A 5AW3B 2EABA 3D25B 4PCTA 2J20A 3V0VB 5E9DB 2UVFA 1X7QB 4JFEA 2HN7A 4ADJA 3V9FA 2XWRA 2OTPA 3QS3A 1TO4A 3NACH 5E2VL 4BFIA 1WFOA 2VIRA 3BH8B 3DRQA 5I6PA 1BSIA 3SQBB 3I74A 3NIGE 2KMWA 5B38G 4BFOA 5CSZA 1E27A 1E4WL 1M53A 4UV4H 5E4EC 5CCHE 1NJ9B 3GGWA 4IHOA 4LL9A 4XN7A 5J6GB 2B1AL 1F3DJ 2YRZA 3H8NA 1S9KC 4HWBH 5CIPA 2DQHL 2JKTM 1MLCB 3QULB 4NRZB 1IAKA 2R51A 1FO0H 2WVVA 35C8L 1MZYA 3M6DA 3T0VA 5C7XL 2XRAL 1JZEA 2C1OA 1TCMA 4ZSOA 2YGOA 3U9PL 4ZFOL 2JB6A 5EWIL 4LCUA 2OMZB 4U1HA 1HQ4B 2IMMA 3CHXA 2MQ0A 3RWFA 1CLOH 2EEXA 5GS0L 1NFAA 4PRHD 1PD6A 4XWOC 5E5MA 2YEZA 2AABL 4Q0XL 3CN2A 3V6ZB 2BSDA 3WXVH 4ZYKB 4I0KA 5I6OA 3FU5A 4GI9A 4GEIA 3TJHC 3T0WA 1XCQA 2VR5A 4H8VA 3FQXA 3FQRB 1RJLB 2GBUA 2EQDA 4G7YH 4RBPK 3D0VB 4RISL 5BS0B 3WV0A 4MD0A 2W80C 1JZGA 2PPDA 1T5XB 5I8EB 4EUPA 4LCYA 5AB0A 1IUZA 1X6NA 2JELL 3QNYB 4KUZH 1A4BA 15C8L 1JDCA 1HS6A 4QYOB 4AYFB 1J5OL 1NMBL 5DF0A 5AZ2H 3DXAD 1AR1D 1T6WA 1WCBA 3MTXA 2K78A 2O5YH 2VJ8A 2XTSA 3ZDXB 3QUMH 1UQSA 2ZWLT 4BE6A 4Z7IA 3BVVA 2Y2YA 4NLAA 1BV8A 3BFWA 3TP4A 3UBXI 1WFNA 4O5LH 1NA8A 3O6KH 1Z5HA 1H8NA 2X1PA 3WO4C 3QFJB 1JXKA 5A7EA 1YEIL 4KFMA 5D2LF 3ZL1A 1DQQB 1OAKH 1XR9B 4KROD 2V7NA 2R8SH 1ZS8B 3W2DH 1LTXA 1I85C 3ZDYF 1KGUA 1IV8A 5DHEA 1EZLA 4N3TA 4F15B 5I8KH 4HIXH 4S2SA 3H3PL 1FFOB 4WTZG 1IM3B 1P1VA 5AZEH 3HS0C 2DQIH 2JKLA 2PPAA 4QOKE 4WGVB 3TT1L 1OL0A 2FSDA 4WHYH 1E9PB 1HVXA 4RESB 2WLYA 3SDDC 4FQXD 4K5OA 3BP7A 2QLVB 5E2TH 4XP4H 1UM5H 4M5YL 1R34A 4LRIA 4XMPL 1LE9B 4WO4D 3B8YA 4M48H 3T9WA 3R0NA 5PCYA 5T1LD 5IVZA 4PJCF 2HT3C 1MRFH 1ET7A 2VMDA 1A7RL 3KLQA 4KHTH 4LCWB 4M4RB 1U92B 3VI3E 4AG4L 3FL7A 3QQ4A 1IJ9A 4L4TA 1QLEH 3POCA 4XMKH 5INCB 4JRXB 4G8AC 2YARA 3WNKA 3I75B 1PF3A 5I1KL 2VDPB 3MLVL 2CMRL 4IDLA 4RMVA 3JWOH 3MGAA 1XCXA 4AGQA 4XMZA 3GSXB 5LCVA 1KBGL 4NCC2 2FDBP 2IDFA 3OKLA 4RFOL 5DJCB 5ETUB 3W5MA 1PZUB 3QDMD 5IB3B 5FX3A 3OKNB 1YVLA 2WV3A 4TTDC 4DP1X 1FORL 5T5FL 3QWNA 2BC4A 1DSFL 4JPSA 5KS9E 3DVFA 3SDYH 3HI5L 4LGSB 5B8CA 3KWVA 1OB1B 3IS0X 2ZQKA 4MMXB 1AXTL 2CO7A 3WUWG 4PJ9C 1DVXA 2FT8A 1BEYH 4LSDA 1MAML 5GGSY 3UZQA 3AABA 4XMTA 1ZGLP 3H9SA 1F4XL 5CN2A 2X2YA 4EN3D 3GNML 4JHWL 4ECNA 5EZOH 3GXFA 3O2WH 5E9DA 4PY7B 2QGEA 4AITA 3MV8A 1HC1A 5DK3A 5F7EH 1OCRB 2XZQL 5LXVA 3QIUD 1WVZA 4PFEA 3S34H 3AU0A 1DUYB 4LBAA 5D93B 3A22A 2DJ4A 4PS3A 1VZIA 3AMLA 3BH8A 4JFPB 3MRNA 3SQBA 4DKFH 2ZOKB 3WFZA 1R75A 1HZKA 4HOXA 4R7VA 4GRWE 5DHDA 2QR0B 3CVCA 4GPVA 4UYPA 4YBLB 2DZEA 1KG0A 2R2BB 1GJWA 2VZSA 2UWEF 3KPSA 5J6GA 4IMKC 2ORBL 3GKWL 3QXDB 4JRYD 1GSMA 1P84J 2BS9A 3QULA 4NRZA 4Q9RL 4JFUA 1KC5L 2O6PA 2B15A 1ZSDB 1EMTL 2PCPA 4WFFD 4JY6B 5KSAA 4G6JL 4HIJB 4P9HC 4XP9L 2OMZA 4V1DE 1HQ4A 4GO8A 1M57B 2IFGA 5L7XH 2GTZB 3UZEC 3SJVD 4Z7NE 4GAYB 4BBWA 5DXWA 3OMNB 5ESVB 1EV2E 4ZYKA 5AD0B 3M8OL 5FB8A 1EX0A 2X09A 1G43A 4WDIA 1A64A 4OJEH 5IHLB 1OAYH 1YECL 3ARBC 1NAMA 1JPFB 1YJDL 2R2HA 2X1OA 1ZLSH 3HMXH 3FQRA 1RJLA 2DEYX 5FUZL 3HE6C 3S3DB 2V5TA 3V5DB 2GY5A 4NQVB 1T5XA 3KPNA 3M88A 5DZVA 3FO2B 5I8EA 3RWEB 5CBAA 3L3KA 2ZXGA 2PR4L 4HMCA 3BHBB 4XOEA 2HFEB 2M83A 5JIPA 4QYOA 3PDOA 4L1DA 1HXYA 3P11H 1ZWIA 3VSVA 4MWFB 3FPXA 1X44A 2VDRL 5BMFL 3Q8FA 4GSDL 5L4JA 1ZE3H 1ZVSA 2M26A 1JGVH 5CNHA 1M71B 1INEH 1YPZE 2BY3A 1M2VA 2D03L 1IFRA 4X5XB 3QK0A 4MCNA 4IRJD 4Y16C 5HDRA 2PXYC 3ESOA 1V27A 3H42H 1ZLVH 5LAXB 2PABA 4J3OG 4QHLA 1SXSA 4S1DD 1CO1A 1E9OB 2TSBA 4CSSA 2MMXA 1WTGT 1L9PA 5DMGC 1WHOA 1DQQA 1AGEB 2N0MA 3MYJB 5HI5C 4G6AD 3VRIB 2FNBA 4UCFA 2HLFD 4YX2H 1JPTL 1U8OA 4O2CA 5JIKA 4ENED 1IM3A 3S37H 1I3RA 3MNWA 2R2EB 2B8OT 1GGIL 3VH8B 6FABL 4OZFB 4JFYA 4ZW7A 1E9PA 2QL1A 5ECGA 5G2NA 1X9RA 1TTCA 1BVLB 4WUUB 3SBWC 2ITFA 1ZEAL 2Y36H 5HYFA 1UD5A 4LMQI 5BRZE 5AKTA 5HHMB 5ANMB 2WUBL 2X4TA 3QUXB 4H8WL 4MJ4A 3Q2NA 4M4RA 4QYAA 5EO1A 4NAJA 1U92A 4U0QB 1JF6A 4AV5A 4CN6A 1BIHA 2YA2A 5ABDE 1N0LB 3QPXH 3MR9A 3C2SA 1WFIA 5INCA 4GBXB 2AJSH 2Y22A 4JRXA 3TBCA 4D0CB 1N19A 1CLYL 3I75A 2F7IA 4AYMC 1PW3A 4JLRA 2A1WH 1MHHB 1MFAL 1MWAA 2IFFL 5D5ME 3BGAA 5DJCA 5ETUA 1HL9A 3FMGL 4XP5L 3VSQA 3T3MB 1AQDA 1JMXA 2WAHA 1I8LA 1GR7A 1B4JL 1PIGA 5IB3A 1L4IA 2VW4A 3WG7B 2WNWA 3L54A 2FUQA 5F93C 2I26N 1QATA 2FHBA 5BUAA 4XPBH 2NNAB 4Z7OE 4LVNC 1DVFD 1G5AA 3GT6A 25C8L 1UCBH 1H3XA 3VM5A 3DJTA 1FFPA 4CKVX 5ENWB 1JUFB 4JG0H 4X9GA 1E2ZA 1TTGA 1DTUA 1KELH 3VXSD 4R7XA 2EIEA 5DSCB 1UURA 3K72B 1Q9OB 4MA8H 2C5DC 3FCSB 4CC1A 4JO4L 5BXFB 2DQUL 2JCWA 5FHAH 3JYCA 4KDWA 3PHSA 2LOEA 2G3MA 2ZOKA 1VZGA 3DX1A 2N7SA 2NY3D 2G9HB 2OMBA 2FX9L 2QR0A 3EO0B 2R2BA 3IDYB 1IVLA 3FB7B 5KANI 1DBBH 3A4AA 3S35L 4BRJA 5K59E 2VAAB 2FX8L 5EU4B 3Q8CA 2J88H 1FNLA 1AZUA 4OSUH 4RA3A 3F7RA 5D1QD 5F7BA 3AU1A 1QFWM 4PRIA 4ZS6C 1J0IA 4PBXA 4UQAA 2EXSA 1YUHA 4GO6B 4UQ9A 3NK4A 1BF2A 2LT9A 2BSEA 3BAEH 1S3KL 4HIJA 3K8LA 4Y4HD 4PQXA 4A63A 1TJIH 1M56B 3VSUA 3HPLA 1VERA 4I8DA 4GAYA 2VISB 5ESVA 3G5YB 2F54B 4KI1A 2WWKT 2PYED 1KSRA 2Y7SA 3AY2A 1PEWA 3F8UB 3WS6A 2QFPA 3VXRB 4LLMA 4KAQL 4N87A 5AVSB 1DSYA 4JGMA 4KO5A 1Z3GH 2YOCA 4XWGL 3TT3H 3LNHA 3QAZC 3V5DA 3O6FB 3O8XB 3PWJB 1PY9A 4L0ZA 2I9LB 4NO0B 2H6PA 2IO5A 1NDMA 3QCUL 4PLKD 2DICA 4AKQA 3BHBA 2OS7A 4XAWH 1TYJA 1A3RH 3DO4A 1WAPA 5MEQA 4MWFA 4IKKA 4AL8C 3L4UA 1AQ8A 5DD3H 2YN3A 1MCQA 1RH8A 2VR3A 4YBQC 2GY7B 2YGVA 1M71A 3GINA 3S35X 7TAAA 3L3OC 5FHBL 1TSHA 3B2UC 1UFGA 4ANWA 4H8UA 2MOVA 3MRFB 5A40E 2HKHH 1BMZA 4PJEE 1NUNB 5C97A 1DQJB 3L4VA 1P4IH 2B1HH 4JY4B 4JM2F 3D3VA 4F7TB 5LAXA 4EUPG 1CDBA 4UT6A 3RAJH 2R0ZH 2V3FA 1INDH 1F41A 4IMLB 5AL0A 1ECZA 1N59A 1AGEA 3MYJA 1XIWB 4YIQA 1CXLA 4HWUA 3VRIA 5CR1A 3P0YL 1JGDB 4TNWK 1A1MB 2Y69B 2GITB 1F4WL 3FO9B 3LRSB 4UV4L 4N1HB 3BUTA 1IAMA 3FB5B 3FFDA 5JW4M 3BN3B 5DHVH 4KK8C 1QPPA 4WGWB 4FXKC 2FJHB 3BD5A 1YEDA 3QB7C 3RZCD 2DYSB 2F58H 3OLGA 4WUUA 4CAGA 1G5GA 4QXUL 4ZUUB 1IGJB 4NFBA 5IHZB 4TVPE 3EZ8A 3FPYA 2QZQA 4AENB 1O0VA 4K07A 4GO9A 4LSPH 5ANMA 5DVMA 5C86A 3NTCH 3OGOE 3QUXA 1FZKB 1RZJH 2DWTA 4HXBL 1N0LA 5AKSA 1H3UA 3UAAA 2DMHA 4GBXA 4XX5A 1HZHH 5GQBA 2G3NA 2WB1A 3TFBA 2NT0A 43CAB 4NJ9L 3WGUB 3A4EA 1PEZA 1DE4A 1HAWA 2Z31D 1Z9PA 3HJ0A 1MHHA 4FQLH 4M5TA 1XXDC 1RSYA 1HZLA 1RLBA 3BKYL 3X1EA 2AQSA 1DVSA 2WBJC 2BIPA 5I74B 2H32H 4Q89A 5HGHB 5EF1A 1TU2B 4FS0A 5DC0A 1GW6A 2C1PB 4M7ZC 4ELMF 3ULUC 2KDGA 4Z3GA 5AOLA 4P57A 2NNAA 2YD0A 4FNSA 2QKSA 3K6FA 3O6LH 2R1WB 3FU3A 1RZIB 5AZ2L 1YN7B 5EU3B 2OAAA 2H2PD 4JO1L 4YSCA 1L0PA 3LEYL 2XA8H 4IU3B 5ENWA 3OKKB 2FEDD 1D2OA 1X5KA 3MJ6A 4R0LC 3QUML 3EGDB 4Y5XB 3R7RA 4CJ1A 3K72A 1Q9OA 4JN1L 5FM8A 2D3JA 4O5LL 1G6RA 3WMQA 5BXFA 4AC4A 5D7JD 4NC1E 5E1AA 4XVUD 1J05B 1VESA 3Q44A 3ULUE 3F3HA 4G5AA 4RA0C 2VAJA 3L95A 4P46C 3IBOA 4H0IA 4QRPE 1XF3B 2QQNL 4X7EC 3W2DL 2ZPKH 3EFDH 1CICD 1OT1A 2DYPB 2OJZH 1E3FA 1MIML 3FB7A 4HIXL 4PJ5B 3S5YA 2XYCA 3SE6A 2QQQA 2R4SH 2DQIL 3FOLB 1NCNA 3OF6D 5EBWA 2ZCZA 5IW1B 5KSVA 1ZTMA 4ZMTA 1DANT 1X9QA 2CLZA 3K2UH 3QJVB 5KYUA 4DKEH 1FYTD 3DO3A 2B5IC 3VTTA 4NQCB 2KZ1B 1U93B 3LQZA 4AJYV 1CXKA 4GINA 4UDUB 1H6FA 5LGHL 3DX3A 3POHA 4WEUD 1NBVL 1WC7A 4BH8A 1HL8A 1QBAA 2H1PH 2HTLC 4FJ6A 4HJTA 4ONHB 3G5YA 3GSQA 3GHEH 2F54A 1YYLH 5GS1C 3Q0HA 4ZTOH 3UGUA 1H3WM 5T5NG 4XCEB 3JWOL 3ZZSA 1KTBA 2AK4E 1TZHA 2ZSVA 1QHQA 3FN0H 5CXPA 2DJUA 1EEZA 2I9LA 2X42A 4NO0A 2BRQA 2NXYC 5FYJH 3BMVA 3C2AL 3PXHA 4YSAA 5IBLD 4NOBA 4PJ7B 4UBDD 1G9NH 4Z8FL 5G5DB 3ARDD 3S6CA 4FG4A 3ILDA 5EB9A 3QXUA 1SJMA 5AW4B 4BWWA 5EOCL 1ZV2A 5IFAH 4JREC 2X41A 3SDYL 3L1FA 1KJ2B 2H0FA 4JFTA 3FUJA 2IF7A 1HDMB 5F9WB 3CFBB 4G42B 5AW2B 4DKTA 3MBXH 3V95A 1TQBC 2FR4B 1T0PB 1JF1B 2XFXA 4FLRA 3WE6B 2FIKB 1YZZA 2JCCE 2WNXA 5DZJA 1DQJA 1WHPA 2ID5A 3VWKC 4F7TA 1G9MH 5J56B 3M46A 3GSOA 3IFPA 3S34L 2NYZA 4OGAD 3HNSL 4RMBA 2ZONA 2WN3A 5DS1A 4FLHA 3ZY7A 3AY4C 4Q9CA 3EUDA 1RUPH 2K8MA 4FEMA 2GVYA 4Y2DD 1JGDA 4Z7WB 4LLVB 2IV9A 2P8LB 2GITA 4NRXA 4HF5L 2E8YA 1Y6MR 5ALCH 3AXLA 2F8XC 3LAFA 5FK9A 3IFLH 4MCZB 3GSNL 4HOZA 1WWAX 2FJHA 4UV7H 5I1AA 3S4SA 1PLGL 4OLZH 3V6OC 4K9EL 1ET5A 2MRYA 3ARGC 2AGJH 1NH6A 2CD0A 4ZUUA 3IDIA 1GS7A 2W0FB 5JQ6H 2YD6A 3HB3D 4WNSA 5FYJD 1DFBH 2DLGA 2A9AA 3QUZC 4N8VB 4N8CH 4AENA 5A6LA 2XFGB 4ZTPH 1OVZA 5IHWA 1GGCL 3GZOA 1FZKA 2HVJA 1QRNB 2YFNA 5L7XL 1FA4A 4W4NA 3K2IA 3VDAA 1FNHA 1PSKH 2WWMC 1G94A 1MFUA 2A9BA 3ARFC 3B7RL 2BVEA 5DR5H 4MNGB 2W07B 4FMKA 4R4FL 5G4NA 1TDQA 2X9YA 43CAA 4FHBD 4O58H 3KPLB 1BYPA 1S9YB 4XBPB 5A2AA 3L4CA 1PU0A 2ZF9A 1RZ7H 1TITA 1TLKA 4QOKA 3RDJA 3C6LB 3HMXL 2K70A 3KYOB 3V6OE 4YGVB 2RH0A 1BFVL 3HG1E 4XNDA 4DZBB 5LDSA 4RAUB 5CINL 5HGHA 2IH1B 1TU2A 1QTYT 2C1PA 1F3JB 4UM9B 2D0HA 4PJAF 3S8GB 4P48A 4XNZC 3TJPA 4I0PD 2BNRD 5LXGL 1HK6A 5D96B 1KZQA 2R1WA 1RZIA 1OP3K 3VI3A 4GQRA 4IGBD 3ZYOA 1E5CA 2LU4A 3MRPA 5KZCB 1I85A 3LHPH 4OQTA 2E75C 2B39A 1T22A 2XSKA 4ZI8A 3OKKA 2ARWA 3SD5A 2X6UA 2EC9U 1F1GA 2KZWA 4FQ1L 4UZUA 2V37A 4LLAA 5E08L 4Y5XA 2DY2A 5JOFB 3WKQA 3ZO9A 3MXWH 4LVOC 1PNDA 2Z8RA 3C5XA 4OFPA 5D7EA 1Z9SB 3JT0A 1HOEA 3H42L 1MVYA 1GGTA 4HWZA 4EI0A 1J05A 1GMIA 1B6DA 3VSTA 3EOAB 4Y7MA 5KSBB 3W57A 4QWWD 3VO0A 4P2OC 5BO0D 2ALWA 2W9LA 5KS9A 2HUEA 3G9AB 2DYPA 3RTQD 4DGVL 1ZHBB 3GIZH 1WF5A 2GSMB 3WAKA 3EOYG 1QWNA 1CD1B 1MW2A 1PKQB 3QE5A 4L3ED 4I5BB 3NPZB 3U2JA 5D70L 1G9HA 1R24B 5IW1A 1NEZB 2ZWYA 1EHKB 3NN8B 2YZ8A 1U93A 3RZWA 5IOPB 4ZUWB 32C2B 4UDUA 1WJ3A 1UM6H 5K9QI 1D9KD 2Y5EA 4ONHA 4J3WA 4L3AA 4KTDL 1NGZB 4BZ2A 3TBVB 3KPRD 1ZY9A 2CIKB 3O3BA 4BCYA 2AJSL 4PJ9A 2EVGA 2Y6SD 3FHEA 4ZBJA 3NP4A 3RVUC 1NINA 3C8KB 3CXHJ 1OOAA 3WFDL 1RP9A 4GXFA 1AACA 4XCEA 2F1BA 3AGVA 3F7PC 3R1GH 2LABA 5TK4A 3S3PA 4KQ4L 4GW1A 2YD4A 5DFAA 5E8OB 4PJ7A 3RWIA 5HYEA 3L2LA 2Y7LA 2QLYA 1BOGA 4ZX6A 2YBRB 2P45B 2EUVA 4FLSA 1MVFA 1XH2A 5C0AD 2NY0C 4HU2A 2WXPA 4OF5A 3FFOA 4G42A 1QW9A 3QDJD 1BWWA 4IEFB 3PV6B 4B6ZA 1HHIB 1KV3A 2X89D 1FDLH 4IMKA 4ZMLA 4ERSH 3WE6A 4HHWA 4OFIA 2WSDA 1DN2A 1EDQA 4X4KA 2YPKB 2HT2D 3PL6B 5ELIA 2BHFA 4PSPA 5KVMC 5L4FA 5FM5O 5IVXF 4GKZA 3F6LA 1NEUA 1A6PA 4WENB 5IREA 2X7LA 3D0LA 4LPCA 2P5EB 3ZT7A 4PVLA 4Z7WA 4LLVA 1M6OB 1L0QA 3BQUC 4J27A 4WNJA 5C6PB 4AQAB 4X6BA 1H5BB 1DBBL 4BCXA 4MCZA 1X7TA 1G7JB 2RIKA 1NUGA 2YPLB 5CJOH 4YQXH 1QSEB 1PX8A 1JHLH 2QVFB 4O4YH 1FE8L 3L5IA 2P24A 3F84A 1UC6A 2W0FA 4IOSD 3RWJB 4MMZB 4CA4A 1GHFH 2MNWA 2OZ4A 4L1LA 5F1OB 4AY0A 3BSZL 3QAZB 1KB9K 4M7JL 4N8VA 3KYNA 4AIZB 2WXQA 5JHDB 3QHZH 4YXKL 5KUMA 2BRRL 4TQPA 1TJIL 1IBFA 3KWTA 3FH8A 3OKDB 4CSZA 3LX9A 4E9YA 4LHQB 1P1ZB 2OMTA 4JPKL 4MNGA 2W07A 4P23D 5EO9A 3RHWF 4KNSA 2QPEB 3KPLA 4LQ1A 4N0YH 4XBPA 1JSYA 3ZVVA 2H3KA 4OCNC 1YRKA 3IMWA 3UACA 5C2BL 1B3JA 3IAPA 3KYOA 4YGVA 2YLKA 4JDEB 2YLHA 1S46A 4UYQA 1MI5B 1TUPA 2IH1A 2NCMA 4UDTA 4TUUA 5AVXB 2PXYA 1R3LB 5EZIL 1F3JA 1AYRA 4UM9A 1M7DA 2YAHA 2I27N 3EHBC 2XTJD 2FATH 3KL0A 2VERA 4IRZL 4XCYB 4XAWL 2N1TE 5L2KD 2W1NA 4TXVB 1KB5H 3PWNB 3VXTA 3ETSA 2KBGA 1YYMH 3O4LE 4X50A 5EU7C 2CKBH 3S0PA 1WD8A 5JO5B 2JTDA 5KW9H 4JFDB 2UZIH 1ETZB 4UAOC 2HKHL 1Z3RA 4FP8H 4GAJH 1Z9SA 1P4IL 2B1HL 3RE0A 2YK1H 5I1HH 1QOKA 3SBWA 4GKLA 1S7WB 4TNVF 3QEQB 2VR6A 3TIDA 4BSWA 2R0ZL 2AJUL 2I7OA 1MJ8L 3EOAA 3V0GA 5LNEA 3UCQA 4QR7A 1EUUA 4JO3H 4PYHA 4UNUA 4BUQA 3V6FA 2WNGA 4HZ1A 4Z76A 4KKQA 1AG0A 5IBTH 2H7WA 5BOZG 5C0RL 4RDBA 4I88A 1KDIA 1GCYA 2WXIA 4JFXA 1AFVL 1CD1A 2PWFA 3QJFB 3TH3T 4PJ8D 1PKQA 5DUJA 4I5BA 5EU7E 5CJQL 1ASPA 4J8QA 1R24A 3BD3A 5I8CB 1T7YA 2H8PA 4Z78B 3LH2H 3JWDL 2VLKD 2EE0A 3TN0D 4R26H 3SPJA 2EH7L 4OLYH 3GK8L 5F1IB 5FUCE 4DN4H 1S7UB 4PJFB 1XD0A 2P26A 3NTCL 4LNRB 1RZJL 1GAFL 2OI9B 5ACZB 1NGZA 3TBVA 4TM9A 4UT9A 1DQDH 4AJVA 3FDWA 1G0DA 3ZTNL 4CGUB 2NTSP 3BKJH 3SD2A 1X3DA 2WQWA 3QJUB 5AG8A 2X3BA 3R4DA 1UKSA 4G6ML 5EU6B 2QPFA 4HJIA 2VNCA 2Z1KA 2Q1EA 2GJRA 3QNXB 2WZPA 1OAZH 3VVWA 1SHXA 2D7OA 3VXQB 5E8OA 5JMOC 4R4ND 3H53A 3HMWL 3QEHA 2CQVA 3C12A 2YBRA 5LWYL 1XB3A 3BZ4B 1A7QL 2VN4A 1R3IH 1UENA 3VFOA 1ZJAA 4KC3B 5AVWB 4E9LA 1BCIA 3ASOB 4U6XA 2ZG1A 2YAFA 4P46B 1KJMB 3SPHA 4Z3EA 2XG4B 4XBGA 4DVRH 3RFRA 3V4UH 3VGAC 1Q0YH 3MJ7A 1YNLH 1ZLUH 1TEFA 3RX9A 2FGWH 1WWCA 2VXTL 2KQNA 4FG6D 5ISZD 4I3GA 1ZT4B 5HVGB 2QVKA 4AT6B 1R17A 4WSKA 1VKXB 3LXAA 4BUGA 3QC5X 2BP3A 1UT1A 2E9JA 3CSYA 1NCAH 1R5VA 2KS0A 4OFQA 4WEBH 2VZ3A 5A3ID 2P43B 2P5EA 3QDGE 3WEBA 5FW6A 3HHSB 2YXVA 2ZOOA 3NA9L 3TV3L 3IM1A 4U6YA 5J11B 1SJEA 2ZPKL 2B4CC 2QADC 2OJZL 4KKAC 5DI8A 1H5BA 1QHOA 1N7MH 3QW9A 1VFUA 1BD2E 2YD1A 1QSEA 3HE7D 2V17H 1UG9A 4L8DB 4PAZA 3FKUS 3BPLB 4KBPA 2WVTA 4BHUI 2LQRA 4AQ1B 4NSKB 3RWJA 1UWXH 4MMZA 4YJZL 3NSDA 2J8UE 3H7BB 5JHDA 4OFDA 3MLUH 3B9KB 2BX5A 5C0IB 3GSVA 3FU7B 1T2JA 4AVJA 4GFXA 1UD6A 2AMGA 3OKDA 3GMQB 1P1ZA 3QT2A 3TWCH 1F90L 5C0NC 2JFCA 3GHEL 2FUTA 2ZUQB 2O4EA 4JFFE 3VACA 2H0EA 5JYMA 2N1KA 5I16B 1YYLL 4PJIF 2DTML 3S4SG 2NR6A 4F24A 2ZP9A 2X53A 2VMFA 4ZTOL 3LVEA 5E23A 5C09E 4S0HA 3AZUA 1AO7E 4Y4FB 3W11C 2BMKB 3JUYA 3FN0L 4JDEA 4IKLA 1MI5A 4FQIH 4K3EH 5L88H 3H3BC 1R3LA 4JZOB 2D3LA 4QRUB 5DHMC 1ZV5A 1MNUH 3D39E 3I6LE 4JMNA 3DX9B 5KBDA 4XCYA 4B9CA 3LNFA 3LS4L 4U0RC 4DTGL 2A6IA 1BZ8A 3H4HA 4OLWH 1EAQA 3HAEA 4A7GF 4F91B 1UWYA 1LO4H 5IFAL 3VXMB 1DHKA 3DTUB 4ZFGH 3IJSB 1JAEA 4GUPB 4BSJA 2X05A 4K4KA 5CEZD 1GZPB 5DD1H 3BFQG 1FRGL 4JZJC 4QXGL 3HHRB 1KCUH 5E2WH 5JO5A 3WI9A 3X13B 1KIRB 3ZE0F 3GXUB 4IS6A 4MQXC 3QQNA 1XBRA 1G9ML 4MKMA 4JQIH 4UTCA 3QZOA 3GSUB 3FF7A 3HEIB 1CU4H 4X6EA 3QUZB 2QFRA 4KJPD 4D9LL 3LIZA 3K4DA 5C0CB 4R4BA 4W9LC 3NPSC 1YA5A 4W4OC 3FCGA 1FSKC 3IVKB 1KIUB 4Y8DC 3QJFA 4QNPF 5ALCL 3NZUA 1QPXA 5JR1L 4UM8A 1W16A 2NZ1A 4FQCH 3P0VL 1DFXA 3RGBA 3CFNA 1XMEB 5I8CA 1WFMA 4Z78A 3WIHA 3CZFB 4XP6H 3BAXA 1QHPA 3RI5K 3GZPA 4ODUA 1D5BB 3U7AA 3V4PB 1YMME 5JQ6L 1ACZA 1KLUB 1C5DB 3HJEA 1S78C 4H1LH 3KLSA 4HUUB 3KYKH 4ORGA 2K9FB 4IYKA 5E4AA 1S7UA 3W82A 4PJFA 1P7QD 1BQHA 5BZWB 4JVPA 4LNRA 2G4GA 2X4PA 2VDLB 4XNZB 3L13A 4OCXL 4AW7A 2J21A 1PSKL 3O2DH 5ITFA 1IE4A 3LQAC 1PIFA 1I3UA 2X2HA 1YY8B 2BIOA 2N01B 2E4FA 4JFED 2WVUA 3RWHB 1JK8A 3CN3A 5EU6A 5HBBA 2JMRA 3MROA 4AUYA 3QNXA 2XC8A 1ZMYA 4I77H 3NG5A 4WWKD 3V0WH 3VXQA 4MAYB 4AEIH 3L3DB 2B7DT 5BOPA 2EIDA 4CADB 3C6SA 4LCCC 2VN7A 3BZ4A 3IRZA 3JUZA 2E59A 3JWNC 4FI8A 2SODB 4BGDA 2KKQA 4NM4H 2UY7B 3D4YA 4AUJA 2AV1A 5KYYB 2I69A 3MBWA 4P46A 2HTKC 4AGOA 3D8MA 4WK4B 4N90D 3LHPL 1IIKA 3JV0A 2ZD0A 1JYWA 4ZW5A 1T83C 3MV11 3BVXA 4X6CF 3K4AA 4G8GB 1WWBX 3L5WA 3NFSH 2GTWB 4OIIL 3N2JA 3P9MA 2DJMA 2OMWB 4GRMA 1AHKA 4OLVH 2E7LA 2FYVA 4DCQB 1ZT4A 3T8VA 3L6FB 4AT6A 3MXWL 4XN9A 1FH2A 5TGBA 2AK4A 3KWXA 4K8RL 3QORC 5F7FA 4AVKA 3IE9A 3WS3B 3APFA 5MEPA 2NY1B 4Z3TA 1CZ8H 2BFVH 3A6CL 1NGYB 1CD0A 2W5PA 3JWNE 3HHSA 4YHOL 3OVUB 5AW8B 3W39B 5EEXA 4K7PY 4QRAA 3UTZA 4NIKB 5CF3A 3SKNB 4PV9B 3K0WA 3QRLA 4TN9A 3K6SB 5D7HA 4CDGC 3BP6B 2MWCA 5I28A 1CXIA 4KXZI 5ADOH 3CFTA 1LP9E 2B20A 2YXMA 2JCCA 3NJVA 5EV7A 4NSKA 4F9PC 1U30A 2EVJA 4C58B 3LQMA 3D9AH 3I6GB 2GFBA 2NXZC 5LLIC 3B9KA 5DVKA 4JRWA 5AB2A 4RIRB 3TNNB 2JVUA 3TYGH 3QZPA 4M3JA 5I1LB 4BFEA 5C0JB 4BQCA 1LVEA 3BJLA 2OK0L 2NY0B 5K9KB 1U8NB 4MA1B 5I16A 1KGYE 1WBXB 3BEWA 5AVZB 5HGBB 3OC8A 1NSNL 1ACYH 2AERT 3MTRA 2F6AA 2LU3A 4BQBA 2UY6B 2EZ0D 2X0UA 3HCVB 4EIZC 4Z7QF 2BMKA 4N8VG 4NC2B 2OQJB 1VFOA 3VWKA 5HHXL 4JZOA 4QRUA 4BZYA 1DCEA 2JLPA 4HHGA 1URLA 3DX9A 2UXFA 2CCLA 5CP3A 1GGBL 1W8OA 4Y5VC 5HYIA 2C3WA 1TVBA 3AY4A 2XN9E 4JL2A 4KVNL 5H94B 3J7HA 4OZHE 3IJSA 4GUPA 4B96A 2DLIA 1GZPA 1I1CA 1MFVA 2XQYK 4OJAA 4PRDB 1IQWH 4WI8A 1JFQH 3QA3B 2XNAB 2YN5A 4NX0A 1U8KB 5EBLB 2F7PA 3H6AA 3OKEA 4MDIB 2NSQA 2RALA 3LKNB 3X13A 1T2QL 1MCBA 5DUBB 3WD5H 4AZUA 5IWLC 1PG7H 4ZPTB 3WY3A 2GB2A 2LVCA 3X2QB 3EJUA 1DCLA 3AQZA 1JK9A 1A25A 4YK4C 3QUZA 3WENA 1NKOA 4HCFA 2D73A 1CFVH 4L4TD 2XQBL 2DV6A 1LO3H 4H8PA 4PWKA 4TKWA 4NUMA 4GNKB 1KIUA 2WB7A 1XZ0B 4YOKA 3JTSB 2TRHA 4JANA 3W37A 2CXGA 2WCPA 2ROYA 5B4MD 2E9BA 4OCMC 3ARFA 2UYLA 2WYZA 2OW6A 3CU7A 1AGCB 1F58L 3LPGA 1FH5L 3QARA 4M6MH 5JIQA 1F11B 3IFNH 4KNTA 3O3EB 4N0UB 1D5BA 2E86A 4RSYA 1KLUA 4ZD3H 1C5DA 2A73B 5DURB 2XX0A 3ZRSA 3VW3H 1E28B 3GEWB 3QHZL 3MLZH 4EAEA 1ZJBA 2KQMA 1D6VH 3GBNL 3I9GL 1HKLH 5IY5B 3H9SD 3T8XB 3P3SA 1SEBB 1YY8A 5LO7A 4AUUA 5E9DD 4JFOA 1OAUH 3CPLA 4KRPC 2BIMA 1CQKA 3RWHA 3QHTC 3MV9B 3HA0A 3KPMA 2XWTA 1RUQH 3UJTH 4DP9X 1ZD6A 3GJFK 5K39A 4P2RB 4Y19B 1HN1A 3FOMA 4OIBA 3L3DA 3ZYJA 1U36A 1LMKA 1U3HB 3LDBC 4TYUA 5DT1L 3SEPA 4OZGE 5HYSB 1VADA 4AV0A 4DKDC 2R4RL 3O11B 5T1MB 4X7TB 2K4WA 1MY5A 3KPSD 4K3DL 1M3IA 3IXAA 3QGVA 4NDMB 3DMMB 2G30A 1KB5L 4AXWB 5A2CA 1JWMA 5EORH 5F2FA 3PWLB 2KL6A 2NW2B 1JVKA 1PLAA 1RZGB 3TEUA 5A2JH 1U3JA 2GTWA 1U8IA 2OMWA 2PN5A 3ARSA 1P6FA 2HJLA 3T77B 4DCQA 5KAQF 5LGJA 1PTZA 3VGBA 5TQ2L 4YHZH 1NGWA 3UG3A 4PJXE 4OFVA 1C12A 1CWVA 3F6IA 3MYZA 3WS3A 3TFKD 4KROC 2FJFB 3OAZH 3P3UA 2BK8A 4R90H 4ZW6A 3WSQH 3VFTB 3D18A 3DXAE 4YDIL 3EDKA 1AD0B 1BHGA 1G7HB 1OCWH 2ATPB 2AW2A 3EBAA 3PLYA 4UQ3B 5CFHA 1D5IL 3NMEA 4LMQE 2X9WA 4V2BA 2VJXA 4UIKH 4XVTH 2ZNXA 2H45A 3X12A 4PV9A 3T3PB 2A9MH 3K6SA 1TMCB 3O6MH 2VLRB 2FO8A 1DVYA 2FO4A 4R7DB 5ABAA 4HAGA 5BS0D 3PGCA 2V5YA 4GS7C 1EDHA 1T1ZB 1JI1A 3D52A 1PY4A 3BE1H 1KYAA 3BH4A 4D0BA 3RIAK 2A4ZA 3DBXB 4L0PB 4NYLB 4WO4C 4DUWA 4WTWA 6PCYA 4XPGH 3GWJA 5BVPL 3I6GA 3GKZA 4OLYL 3RDTB 2NZ9C 4RIRA 2A6DB 2LAGB 3TNNA 3NJJA 3TH2T 4DN4L 2IWFA 1YY9C 1QPKA 4YHKH 3X11A 4L1SA 5CN1A 3SGJC 3UMNA 1V05A 1VCBC 3GLAA 5K9KA 3ZGHA 1SBBA 1U8NA 2BOCB 1G7MA 1KIQB 3T2NL 1E9QB 1YYCA 2OP4H 5HGBA 1MRCH 2WQSA 5EEZA 1E8YA 3E1ZA 5J9PA 4FQJH 4OFYA 1HXMB 4X6FB 2IWGA 1Y18A 3HCVA 3FQNB 4NKOB 4BJLA 1A1NB 1DQTA 2OQJA 1HT6A 4AZ8B 3EIFA 3X14A 4F7CA 4QTIH 2BDNL 1UATA 5IF0A 3CXDL 5FYKD 4FFYA 1R3IL 1DLHA 4QT5B 3WMPA 2PWDA 4RZCB 5H94A 1XGZA 3QH3B 1IM3D 3FCBA 3ZRFC 4DQOL 2BHUA 4PRDA 5IMOA 2PW1B 4MKTA 4L48A 3QA3A 2XNAA 4EN3C 1U8KA 2PLTA 5EBLA 3RGVB 4DVRL 4HGMA 2A77H 1ZHLA 1JFHA 1UZ6E 3LKNA 5CHNB 5DUBA 3V7MA 2PCFB 4A6YL 4ODWB 2IJ0C 2FGWL 3MUUA 2LHAA 3Q6GL 3QIUC 4KXAA 2VXQH 3B2VH 3FB8B 4CMMB 5C92A 3QDME 1PY0A 5JDSB 5F7DB 5HHVL 3DOIA 2PUQT 3MRRA 1NCAL 3HAEG 3D85B 1ORQA 4YFDB 4B9IA 4JRXD 2YAEA 4YFLF 1XZ0A 2D0FA 3CQQA 3JTSA 1UH3A 1JTTA 3ES6B 2QEJA 3MKKA 4OB5L 3JT2A 4P49A 4U4IA 4DGIH 2VE6A 5AUMB 4GSRA 4PP1D 1AGCA 4HLZG 5DD5H 3O4LA 4W9HC 2L0DA 1M7IB 2WKOF 4ETQB 1SRDA 3IJYB 2V17L 4NQDB 5I75B 3CFJB 3O3EA 5J1TC 2ILLA 3ATEA 4U3HA 4GP8B 3AVEA 4N0UA 3WHXB 5FW8A 1CIDA 4TNGA 4MZ3A 1A22B 2VDML 3LKOB 5ICYA 1KENL 3SYQA 2XWDA 3PNWB 3OC5A 5TDOA 3ZL4L 3ULVF 1BPLB 3VFGH 2WQXA 4U0RB 4UI2A 3S7GA 1GJUA 1N6QL 4L3FA 1MCRA 2C9VA 3ZJAA 4ZQTA 5IFHH 3N40F 1E4HA 1SEBA 4UMGA 3EH3B 1ZAGA 4JRYE 2VCOA 3P2DA 3F58H 5IJVB 1NFDF 3MV9A 4WFFE 1HNGA 1HNYA 4J1UB 4AIOA 4P2RA 3WLWD 3IRCA 3L5HA 4X98A 3IKCB 4PBVC 2FWLB 1I75A 3BUIA 3HC4L 3I9IA 1MIEH 3KLHD 3P9WB 1F86A 3B37A 1BQHG 4PTUB 1AKJA 3PNRB 3SJVE 4E41B 3UJJL 2L04A 3O11A 5T1MA 4X7TA 5FOJA 3V7AE 1X5YA 2J4WH 4M1CC 4NDMA 3SN6N 1SGKA 1ASOA 4PLJD 4ZFGL 2C9SA 5D72L 3PWLA 1DSWA 5F97E 3TZVB 4D8OA 1RZGA 1BJ8A 3LD8C 3MRIB 5E2WL 5E95B 3KPQB 4IRJC 4X7DC 3IEAA 3BP5B 2WGNB 4UT6H 2BSED 3NYKA 3T77A 1WZ1H 2ZX7A 2ZSWB 3FONA 1E4KA 1TENA 4S1DC 2QMKA 5T1KB 3SPVA 3T4YB 4NM8H 4POUB 4YDLC 4AIEA 5DS8B 4M43H 3P30H 2FJFA 1GRWA 5LN8A 3VFTA 2HLFC 1CU4L 4ZMXA 1UA7A 1AD0A 1G7HA 2ATPA 2JJSC 5JW5B 1CI5A 4UQ3A 5C07B 3UBXB 4ENEC 2VDRB 4KDVA 4XNYL 4OZFH 1KJ3L 4CL7A 1G4MA 3BXNB 4KX9A 3DPDA 4C8XA 1AZBA 1AHWB 2NY2B 5ICUA 4HGWA 1J5IA 2BP8B 2IH3A 3JYBA 4DP5X 3CX5J 1P0SE 2G2RB 2OL3H 3JSSA 2IOMA 3DBXA 2V9QA 5T33L 2HKFL 4GSQA 3BRDA 2ITDB 1E5ZA 1EBPA 4LESA 3TONA 5DU7A 1OP5H 2CR6A 3FB6B 4YPGA 5D7IB 2HMID 2A6DA 2E9WA 4FABH 3BZ5A 4R2GB 3TVMB 2VLMD 3KMDA 4Z9KB 1NCWL 3U6RB 1MCIA 5JZ7D 7FABH 1FZMB 3ROOB 1SM3H 2F53B 3ME0B 1VFAA 1QW8A 4F33B 2AZAA 1E9QA 4EI6B 3LZRA 4HIEB 5BQ7B 1HXMA 4KH2A 1BD2A 4H40A 3V5KB 3ZRCC 1JP5A 4KKNA 3HBPA 2IDSA 1F6AA 1A1NA 2APXA 1J48A 4AZ8A 3MLXH 3H2QA 3QCVH 5CO1A 5BV7C 3FRUA 1PS3A 3SE8L 4N2NA 1DVFC 4GJTB 4RZCA 3ML8A 4BE5A 3WTUA 4QAMB 2PWGA 3WELA 5E6IC 3T2OA 3PJNA 2NY5L 5HVFB 2H0JA 1ZT7B 2ZWSA 1P84K 3FSZA 2VL5B 3V4VL 3RGVA 2ZYHA 4DK6A 3KBHE 1XH1A 5CHNA 4WUUD 5DQJB 4NFCA 1OOWA 2PCFA 5DJ6B 4YFLI 3NFSL 4ODWA 4OD1L 3DYPA 5HHMD 4CMMA 3FB8A 2O5XH 2BINA 1IL1A 4PRAA 5JDSA 2X2UA 5F7DA 3EKCA 4MRCA 4W9EC 4NP4L 3QUXD 3JTTA 4O2FB 4NERA 2NY3C 1QACA 2IC2A 2WUCH 1WG3A 5JHLL 3UC0L 2BFVL 2HG0A 2Q20A 2OZNA 4G5ZH 1KYFA 4GBXD 4PREB 5HSFA 4N1EA 1CJYA 3FU0A 2Y7QB 3ES6A 4M1GH 1XR8B 4OF8A 5I1CH 2GAZA 2I9TB 5AUMA 5HGAA 3U4EB 5D1QC 5IFJB 2GT9B 4HBCH 5DFVC 1S2EA 1ZVHA 5AW1B 1M7IA 3CSBA 3VXSE 4CNIA 2IV8A 3IJYA 4NQDA 5FFGA 4OZ4A 3QG7H 4PJHE 4X7SL 5FYLD 5F88B 4M7LT 4XT1C 4G7VL 1URZA 4UINH 3WHXA 4F5CE 2GHZA 4QHMB 4Y4HC 4PPTA 3GJFA 5IB1B 1EGJL 3LKOA 3EH2A 1ZXQA 2J1KA 3PNWA 3DJZA 2YC1B 2E76C 2K7PA 3CPUA 2JKSA 1I1FB 4J6IA 5A2KH 2F18A 3MCLL 5SWQA 2WMPB 1E6OL 2K9UA 4HFWA 4UUJB 2CLRB 4C83A 5FO2A 1QTPA 1CBVL 4H8HA 4Z0BH 1SYSA 1MLBB 5D1QE 1UJTA 5AL8A 3KPTA 4JZJA 3QUYB 1ACYL 1BBDH 1P2CA 4J1UA 4Q8BA 3NDZE 4Y0GA 3GB7B 3NCJH 3RWDA 4AEFA 3IFOB 4PLKC 5MP6H 2VN3A 4FGMA 4HUVA 1PKOA 3IKCA 1YMMA 1FNGA 4JKPH 4GY4A 4PTUA 4WW1B 1NQBA 1EAPB 3ROLA 3ZYIA 1G0YR 1A9EA 4MXWH 4E41A 1I3GL 3TBYB 2XUWA 5GRUH 4YK4B 3FSVA 3C6EA 2ZICA 2RTTA 3NJIA 2PYEE 1LE5B 1QEWB 4W4OA 3ETBF 4YHLL 5IG7B 2FH8A 3ILQD 3SGKC 1IQWL 5CFAA 3TZVA 3MRIA 1MCLA 4ANUA 4I2XB 3KPQA 1JGUH 3BP5A 4GYBA 1FYHB 1QR4A 1WZKA 4U3XA 3WD5L 2ENYA 1RVFL 4XX1E 4UTAA 5T1KA 2VM9A 1T7VA 4RMUA 1I8KB 1FL5B 4ZOAA 5DJ0B 2WCSA 5DS8A 3L3JB 1BAFL 3IDGB 5D2LB 1LILA 3HC0B 5DVPA 4CVUA 5AALA 5DYOA 4EIUA 4EDWL 5TDNB 4KVCH 5JW5A 2F54D 5C07A 3UBXA 1UXSA 1G7LB 3EJCA 4ZX3A 1VA9A 3X1BA 1T0NB 3D50A 3VXRD 1AHWA 5I8OL 4QHUB 4HIIB 4HAFA 2XDHA 3CZEA 2CCVA 4GG6E 4XODA 3O6FD 3O8XD 4WFED 4DPRA 2C9AA 2FSEB 2G2RA 3ABZA 4M6ML 2X3CA 3CU1A 4NO0D 5IOKA 3BIBX 2C4XA 5DUPH 4KRPB 3U9WA 1EHNA 1YNKH 5IEHB 1AXIB 3MQIA 3DDFA 3EDDA 5D7IA 4PJCB 1ZA6B 4NBXB 2JQZA 1CCZA 3H7LA 1KNOA 3LDBB 2QPDB 3K6DA 3MLZL 1UOWA 3QZBA 1J0JA 1VZHA 1E7UA 1I8AA 4JFVA 3U6RA 1CR9H 4RCAA 1FZMA 1WAAF 3MRKB 4NUGH 3ROOA 2YMXH 2F53A 3ME0A 3ETBJ 3Q01A 4ODTH 1H0DA 2Z31C 4JBSA 5D7LB 4J3UA 2NMSA 4EI6A 3QO0B 2XT1B 1NKGA 1NM9A 5BQ7A 1MEXH 5E51A 2MQGA 1OAUL 3AWGA 3V5KA 1T83A 4AH2B 5AZUA 3DUUB 4IHBA 5L0QB 3JBG7 1H3VA 4WTQA 1UB5B 4FNLH 1XIWD 2L8AA 1PPIA 4HH8A 4FKEA 2N7BA 1H3PH 2Q0ZX 3QORA 1LLAA 2IGFH 2WC7A 2H2PC 2Z65C 3VUAA 3UAFA 1EANA 2ZF8A 5KYWB 1S9XB 2FEDC 4NHUB 1KULA 5GGRY 2H5UA 5AAPA 4GG8B 1T4WA 3ZX1A 5TE7L 5E7FA 1FVCB 2VXVH 1ASQA 3TJHD 4LDCA 1T03H 5DJ6A 3IDNB 1KEML 1QA9A 2FLBT 4MHHI 3TOPA 1W72L 3RY4A 5SWSB 4QJ5B 2BPBA 5IESL 4GS7B 5D7JC 2NDFA 4E9XA 4XVUC 4IOFD 3OJDA 3ULVL 2FZ3B 1U8QB 3F2LA 2F5AL 4ZFOA 2VDQH 2O5NA 1YEEL 5T1DH 1E5BA 1NPJA 3NCCB 1CICC 2VABB 4DETA 1TKWB 1OCWL 3LKRB 2OCFD 4UTBL 1OM3L 4Z5RB 2UWEB 1B3IA 4JPIB 5I23A 4OM0H 2X2JA 1XR8A 2LLLA 1OCOB 4OZHA 2QT6A 2J2ZB 3T2PA 5IFJA 4K5NA 5DUMH 2A9ML 1UD4A 3Q7JA 4QCIB 5LG1A 3O6ML 3QUMB 2X6AA 4HISA 4M9PA 2ATAA 4X9IA 5F88A 1JNJA 3M1BA 3FO1B 4DO6A 4JAMB 1BX2B 4G8EB 3G6JE 4F7PB 2LV4A 5IB1A 1UWEH 4DGWC 1ZTXH 1MHEB 3UTPD 4CU8A 2YC1A 2CU9A 1A8ZA 3FQ4A 4MS8D 1G7IB 4ADGA 2ROXA 4Z7UE 3QZLA 2FJSA 4DIXA 3L81A 2WMPA 4Y5VA 3D7PA 3UPCA 4JFQB 1LD9B 2DN7A 4UUJA 3OHXB 5I1IH 4MXVE 3ECBB 1MLBA 1OK0A 1RPQA 4PG9B 5IMLB 1YNTA 2XWCA 4O51A 3J2PA 3L9EA 5DMIH 1BWMA 3QUYA 5DMKB 2D31B 2ENQA 4G83A 1FYTE 2N4IA 5IBLC 3IFOA 4R9HA 4LSSH 1ZLVK 5D8JH 4UBDC 5IWLA 2ZIDA 3ARDC 5KG9B 2OMNA 1JI2A 4EJ1C 3CH8A 4Y88A 2AJ3B 2R0WL 5HY9A 2A9CA 1KJ2H 2NNCA 2YJLA 3QJOA 4WZ9A 3FU6A 5I9QB 1DL7H 1KGXA 1PCSA 2DYPD 3TBYA 1M3JA 4CSPA 4PJ5D 2B77A 2UV3A 1CDUA 2HXAA 4HJJH 1BW8A 5FOBB 3LMJH 1LE5A 1QEWA 1WFJA 3GDCA 1QLEB 4BELD 5EF2A 4DSYA 3ZHNA 2ZP0T 2EYSB 2J6EA 4I2XA 2CIIB 4Z6AT 2A77L 1OD9A 1UEMA 1T21B 3D6GA 2H6OA 1JCVA 3AAZB 4OGAC 1FL5A 5DJ0A 3L3JA 1UA6H 3HC0A 1IC4L 5D2LA 5AVTB 1T04A 2F7OA 2AEPL 4TTDD 4XXCA 1VGKB 4Y2DC 5TDNA 3HZYB 1WISA 4OZGA 5AWNH 3K5SA 2QSCH 4PRHA 1F5WA 1SDAB 2UZYA 3EJZC 3ZE2E 5ES4B 1L3NA 1T0NA 4XE5B 3DA0A 5HVHB 4N6QA 3NSCA 4Z0XA 4QTHB 5DD5L 5MENB 3EW3B 1R0AH 4G9FB 1XH3A 2FSEA 2IAMB 3FFCB 4P2QB 1DQML 4Q9QH 4D9RD 1G9NC 5IEHA 5CWSA 3R0MA 4YH6A 4JPVL 5IQLA 1JN6B 3MBEB 1CG9B 4LF3A 1ZA6A 4PJXA 3VM7A 1BVZA 5CZXD 1BQKA 4LLDA 2XWJB 4MAUH 3ZR5A 1O9ZA 1AXSA 3DXAA 2D7NA 2PKDA 5FKAB 3RU8H 2RJMA 1UWGH 5D71L 4JM4L 1CGYA 1DDHA 1PZ5B 2JB5H 4HPOH 3QO0A 3GSNB 2V2XA 2ZAIA 3NCYP 1T7WA 2ZOLB 2IPTH 2O26U 1D6EB 1FO0A 4PGJA 5FYJE 4DOHB 2VUKA 2VLLB 1I7UA 3R7QA 4QRRB 4I0PC 4X4ME 2N0KA 1R3HB 4IGBC 5FCSH 3IWVA 1RPKA 4J28A 2ZCHL 3KBEA 2J4WL 3W1ZA 4K7PL 1QLRB 1S9XA 2CDEA 4NHUA 3GBDA 4HH9A 5CBEA 4X83A 3EFFA 4M00A 5T8IA 2P8PA 4QMEA 2AI0H 1FVCA 4ANVA 3F65A 3EGXB 3IDNA 4YL9A 2YKLL 5DQDH 5SWSA 4OF0A 1WZ1L 3CZJA 3DIFA 2XV3A 4L5FL 4PCKA 2FB4L 5BRQA 1P5UC 1I9IH 4K3HA 4WO4A 1HL5A 2FZ3A 1U8QA 2VXUH 4NM8L 1QRND 2IMNA 4QWWC 1X4ZA 2BNRE 4MB3A 1ROWA 4HK3N 3KGRA 3RTQC 1TKWA 5JPNB 3LKRA 5GJSH 5D7SH 4Z5RA 1QNZH 2UWEA 4JPIA 2DRUA 4F8NA 2J2ZA 1ZCRA 4LKCA 1A66A 4G43B 5D9SB 4QCIA 3IMRA 4J8RA 3C6LD 3NZHH 3QUMA 2IQ9H 1AYOA 1NGQL 1KXQE 4LAQL 1XAKA 4Y4KB 4FYQA 1I8IB 5IQNA 3K74B 4JAMA 4G8EA 4MNQB 3KGUA 3KWWB 2OL3L 4G8IA 4UM9D 3MXVH 4F7PA 1KEGH 2ICEB 3ELQA 1AH1A 1MHEA 1OW0C 4WV1C 1D9KC 5EH1A 4IRSB 4Z7VF 3MODL 5BOJA 5JPMC 1JXFA 5KZCD 3WTYA 3HI1B 1SFDA 3MRGB 4JO8A 3STZB 3UH8A 5DJAA 2Y6SC 1LD9A 4K7PX 3BN9D 3GFUA 3NSFA 3OHXA 4HSCX 4MX7B 5E03A 5E6IB 1DR9A 4L3EE 3H4FA 3ECBA 2VQ1B 4PG9A 4V11A 2X70A 2Z4TA 3LKQA 4WU7B 4JEGB 3N42F 2D31A 2VW6A 2OX5B 2PYFA 4ODHL 4PJDF 1ZGLA 5AKRA 5JW3L 2BZCA 1ORSB 4JUTA 5KG9A 2NUTA 2MTPA 3DVGA 3QCVL 2AJ3A 5KSUB 2YA0A 3BGMB 2ADGA 4YHYB 1I4FA 1A6ZB 5MI0B 3KPRE 3QRFM 5FOBA 1JV5A 4I87A 5CZKA 5FDYA 3UZVA 4NRYB 4BKTC 1A3QA 2DWDA 4RMTA 4U6VH 4HWEH 2EYSA 2A83B 4WTXA 1J8SA 3C09B 3G5ZA 1T21A 4JM2B 4A66A 3FQWA 5E9NA 1OSPH 4HFUL 4NXSA 4YDJA 4YC2C 3TGXA 3S88H 2LLGA 2CHZA 4MXQD 3QJHB 4R8WH 5F6IB 4ACPA 2ZX9A 1E3ZA 4PWFA 4XNUH 1VGKA 2X38A 1B2WL 1JGIA 2VXSL 3BQVA 5C0AE 1HSBB 2MHAB 2WUCL 2CNYA 3PABA 4G11A 1K4DB 1BGXL 3QP3A 3QDJE 5FO8B 3S2AA 2GI0A 3WNNA 2O61B 1TMQA 3KM2A 1T6VN 4H25B 5MENA 4XR8C 3K80A 2WZPD 4IIZA 4TRPH 3FFCA 2P7TB 2ZUSA 3QG7L 1HE8A 3QYNA 2Q76B 1NLDH 3HC2A 1D5MA 4NO2A 1Q94B 1BIIA 2I32A 4GAFB 3NSJA 1U95B 1MF2L 2A9NL 1SJHB 4P4RB 4LOEA 1TEYA 3ZDZE 2XWJA 3UBXG 3D69A 4LEOB 4PRNA 4J39A 4JDVB 3KJ6H 3TEYA 3V5HB 1A4JB 3GS7A 4P23C 3O0RH 4NJAH 2ZE0A 1PZ5A 3RB5A 1MXDA 4L23A 2DWXA 4ZS7H 5TK2A 1MW0A 5DQ9B 1X5ZA 4Z3FA 3HNVL 4NGHL 2WIIB 3ASNB 4XO4A 4Q4EA 2HP4A 3VX1A 2CO2A 3PL6D 5EF0A 2TAAA 3DVNB 4U3SB 1D6EA 1I1AB 1HINH 4JPQA 3D07A 3PWUB 4MA7H 4QHKJ 1B6UA 4PI2A 3VJ6B 1OZUA 3N85H 1CLZL 1LDPL 2HLAA 2VLLA 2ZXQA 3HKZA 3HI6H 1D7CA 4K71C 2F74B 1V7ML 2DIAA 2XTJC 5F3HA 2BW5A 4ELMB 4QRRA 5HDQL 4XO9A 2P5ED 4WHTA 4JKPL 4P07A 3T6ZA 3C08H 3JWNG 3UADA 3P3YA 1A4AA 1RJCA 2OTWB 1IGML 3GXDA 2HFGL 4BQ8A 1NGXB 4NUJB 2JJSA 4KGLA 2V0AA 2YPLD 1QSED 4MYPA 5CLZA 4KX8A 1RK1B 4TQEH 3DX6B 3BKCH 1UD2A 5CZVL 2G2PA 5F7UA 1RMFH 2WXFA 3HMXA 4W81A 4BRVA 5CJ5A 5JQHC 5JHDD 3MO1B 1DANU 3OAUH 5LBGA 3NZSA 2XTJE 2NQDA 2BLFA 2PPFA 3CZNA 4U3CA 5L2KE 4KNQA 1RD6A 3WYRA 3SQRA 1KIPB 1U8MB 3CLEH 3LNIA 4PJ8C 1YQVL 4YBQD 3CXHK 2EXYD 2NR6D 2MCG1 2JK5A 1H6UA 1SUJA 2G5RA 3BGFC 3MNVB 5D9SA 5LGKA 2E27H 3F7LA 4K0OA 3MFFB 4JUSA 3K81A 2RQ8A 3S36H 4Y4KA 1MAJA 1IRAY 3L16A 4RMQA 3TN0C 2RAMA 1MI5D 1PZAA 2YAQA 1DJIA 1UZ8B 4LBEA 5JUEH 3BT0A 1W2KT 4OM1H 2JQMA 5EZJB 5GGVH 1SLWA 3FU9A 4FQPA 4FCAA 4XCFH 3WY4A 5KEZA 3GRWL 3MUHL 5L9DH 2DH2A 3QQXA 1OK8A 4MCMA 3MOBH 3A3YB 1CYWA 4OZIE 4NUGL 4OGYL 5LBSH 5E6IA 4JFDD 1UH4A 3QEUA 1N10A 1T3FA 3FUFA 5KVGH 2OX5A 4KNUA 3OPZH 3UYRL 1UYWH 5CILL 2VLKE 2ZCLH 4PJHA 2WD0A 4R4NC 4TLSA 3QEQD 1KGWA 3KGSA 2K3HA 3UTSB 12E8L 4FNLL 5KSUA 4RAVA 4OTXL 1SY6H 4HC1H 3SBRA 4XMLL 1UXLA 5FWQA 1H3PL 1PZSA 3K71B 4PJBF 5KBPA 1A6ZA 3H3KA 4KPHL 2Z8VC 3IU3A 4NBYB 4NRYA 3INOA 3G6DL 3IDMA 2QKIC 5GGSB 1OARL 1E2WA 3MRJB 3T65B 4XPFH 5JXAH 4MSWA 4W68A 1XO8A 2IANB 4LPUA 5D1QA 1SXCA 3VD1A 5E2UH 2WXNA 2B1OA 4S0TD 2FJUB 3U6XS 2BXZA 2R2CA 5C3IA 5H8DA 4HIPA 1GW0A 5CD3A 5A3IC 1KZYA 4Y4HA 4HUWB 2ED7A 2VDQL 4W6WB 2K6WA 3E8UL 3L48A 3MA9L 4UQDA 5B7MA 2CHWA 3EO9L 4J3OF 5E99H 4BK4A 1BM7A 4X2UA 1TNNA 5FO8A 1NZRA 2O61A 1GY2A 5CLWA 1QFHA 2PYEA 3HE7C 3RILA 3HUJF 1F97A 5EU6D 2XWEA 1BBJB 3IWUA 3AB0B 4XRCB 5DUML 3ZR6A 4LEXL 1V10A 3U25A 5ISZE 1WD9A 3ECVA 4TNFA 1A9BA 4Y1AB 2Q76A 1YEKH 1UGNA 4WHCA 2X0VA 3U4KA 4LHUB 4P4RA 1XGYH 4NKMA 5I19L 2CGYA 5H4YA 1HOCB 4LEOA 4P46D 3V5HA 4HS6B 2YAMA 4U1LB 1HE7A 4JZNB 1EERB 4CC0A 1CFTA 3BH9B 5TH2A 5DQ9A 3NH7L 3NJFA 2IPUK 3APCA 4GAAA 3R06B 1C08B 1Q0XH 2E4TA 2WANA 4TSAL 5DMIL 1RU9H 3SGKA 3ZO0A 3DVNA 4U3SA 2ADFL 3Q8AA 2DQFA 3II3A 4TMPA 4YWGL 3VJ6A 4K7FA 4HXAL 5INDA 5D8JL 5FDWA 4PJAB 4FA8A 4I13B 5AYTA 3HVNA 4L3CB 3UXFA 1YAIA 4Q52A 4XAKD 1WZLA 2E7CA 5E1IA 5I2IA 1MQKH 1DL7L 4WKXA 2HRPL 3KBPA 3RURA 1TJMA 2ZUTA 2GG1A 4UQ2B 4D9QD 4H8QA 5I30H 3WO3B 4LDLB 2EH8H 5J8OA 4ZJ9A 1M05B 1RK1A 4RNRB 1HH9B 2DAVA 3DX6A 4P59L 5I18H 4EEEA 4MNHB 5FWRA 1AI1L 4I18B 3CHOA 1IMHC 3MO1A 3B9KD 4KTGA 1X4YA 1IBGL 5TQ0L 4KJPC 3L4XA 4HX1B 5CGMA 3ZE1E 5FCUL 1WT5C 5EUOE 5CD5D 1KIPA 5A2FA 5I6XC 1FQ9C 3U9UB 5EDSA 1BMWA 1U8MA 1A0QH 5CEZE 3ERXA 5CUSH 3KLAB 3C60B 4I9WD 2Q8BH 3B2XA 4NWUL 3L3IA 5K1VA 1HSAB 1XGQB 4BKSC 1KTKE 3V4PH 3AT0A 3KLKA 3S9DB 4RETB 2ERJC 4AGMA 1U2CA 4ONOA 3MRMA 2WQVA 4J7RA 1UZ8A 1W91A 4HJSA 2J1WA 5EZJA 2UVEA 4FNRA 1NANH 2P8MB 3VXMD 3SE9H 1Y7VA 5FA4B 1CTOA 4X5RA 1JD7A 3VVVA 2P5WB 5IKCA 3RU8L 1AGBA 1WZMA 4EIBA 3K91A 5KBMA 3WHE1 2LAAA 5DHVA 4M7LL 3I02B 3B9VA 3N43F 2EJ1A 1MFEH 2GJ6A 4WWKC 4TQ8A 3CQFA 4BH7A 4JKWA 2IPTL 5KANG 4PJGE 3VFRA 3L1GA 1A4KB 4NUQA 2ENSA 2X12A 3SDXE 5I1DA 3NJNA 1JF5A 1JDDA 3QUZD 3GBMH 4X7FC 5DGQA 2ZUUA 3BI9X 2Z9TA 5C0CD 1NIDA 4P5MB 3ULSB 4G82A 4XCCH 2ITEA 2Y07L 1RJYB 4GP4B 4LSTH 4O2EB 4Z7UA 5EPMA 1MFCH 1TTAA 1CICA 1MFMA 2BVUA 2AAAA 1XL4A 2D3NA 4JDTH 3NZ8A 2UUDH 1YUKB 4FFTA 1OGPA 1TJGH