2NSQA

Crystal structure of the c2 domain of the human e3 ubiquitin-protein ligase nedd4-like protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
140
Chain Sequence
GEPVYGLSEDEGESRILRVKVVSGIDLAKKASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase NEDD4-like protein
publication title The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
rcsb
source organism Homo sapiens
total genus 23
structure length 140
sequence length 149
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2nsqA00
2K4AA 2QZQA 2B3RA 1BCIA 1QASA 2JQZA 3DPDA 4NS0A 4WWNA 3L9BA 5JHAA 2DMHA 3W56A 3ZW3A 2BWQA 3QARA 2EP6A 2WXOA 4IHBA 4IQHA 1E8YA 1DQVA 5G55A 3RDJA 1RSYA 1TJMA 4PS8A 4LCVA 4XX5A 3APCA 1QATA 2A5UA 3L4CA 2D8KA 3KWTA 4NPKA 3PYCA 5G2NA 5CCGE 4HLEA 3MJWA 3QR0A 5T8IA 2NQ3A 2ISDA 3HHMA 4AJWA 3R7RA 4MJJA 3F04A 2CM5A 3ML8A 2QZ5A 4XZ4A 2K45A 3ZVVA 2Y3AA 3CSFA 3QAQA 3APDA 2WXRA 3M7FB 4V11A 4FADA 1WFJA 4ANUA 4FHJA 4F92B 1W15A 2WXGA 2WXIA 2YRBA 4GNKB 4QJ4B 4WEEA 1BYNA 3TL5A 3ML9A 2WXHA 1DJHA 1DJXA 4QAMB 4FA6A 3OAWA 3N5AA 5KJ7E 2N1TE 3JZYA 4PS7A 1UGKA 4A55A 4ICXA 3T8MA 4KZCA 4L23A 1BDYA 2FK9A 2WXPA 2YOAA 4TUUA 1UOWA 3NZSA 4L2YA 4ANVA 4AOFA 2KI6A 3HN8A 2CJTA 1DJWA 2FJUB 4TV3A 1DJYA 2LHAA 4G11A 1YRKA 1DSYA 3NZUA 4QJ3B 4FULA 4NP9A 4OVUA 3SD5A 4F93B 2WXKA 2ENQA 2WXJA 2Q3XA 2K3HA 4LT7A 4XE0A 4QJ5B 3PREA 4HVBA 1TJXA 2ENJA 1DJIA 2Z0UA 2CHWA 1E7VA 4FJYA 1E8WA 2UZPA 4Y1SA 3F05A 1W16A 4ANWA 4KZ0A 3B7YA 4BGDA 2K8MA 3PFQA 5CCHE 2Q0ZX 3L54A 3DBSA 1K5WA 3CSTA 2V4LA 2WXQA 4LDCA 4EZKA 2A4ZA 5CCJA 3QR1A 1WFMA 1E8XA 4JPSA 4WAFA 3KWUA 4DK5A 3APFA 2DMGA 1DJZA 4F91B 3P2BA 1RH8A 5JHBA 2WXNA 4EZJA 4DNLA 3L17A 4TS6A 4URKA 3ENEA 3L08A 4ANXA 1E90A 2WXLA 4WWOA 4FLHA 1E7UA 3S2AA 3QK0A 2CM6A 4FJZA 2ZKMX 2CJSA 2R83A 4Y1TA 3R7QA 2CHXA 4OVVA 3W57A 3NSJA 3LJ3A 4NPJA 3OHMB 4J6IA 3HIZA 3ZIMA 5EDSA 2CHZA 4FHKA 5H4YA 1RLWA 3FDWA 1V27A 4ICWA 4KITB 1A25A 2RD0A 3F01A 3IBEA 3PRZA 4L1BA 3PS6A 1UOVA 3L16A 1DJGA 4PS3A 3QJZA 2CHDA 3GPEA 3IM1A 4F1SA 4L1LA 3F00A 3RPBA 3TWYA 3TJPA 1HE8A 2NCEA 2NSQA 5H4ZA 3FBKA 1CJYA 2WXMA 2WXFA 2ENPA 4WWPA 4GB9A 4EZLA 4BFRA 1GMIA 1E8ZA 3L13A 2X38A
chains in the Genus database with same CATH superfamily
5AZEH 2JQZA 3M07A 4M5ZL 1NIAA 4XMPL 2NZIA 2AV1A 4LF3B 5EHFA 1CFBA 1YNKH 2RA1A 2WLZA 1TIUA 2BSDA 2UXFA 1WD8A 3GSNA 3TBYA 1QFOA 3DVNB 2GHWB 2WP3T 2X2UA 4NRXB 3EH1A 4P48A 3ZDYB 4WTZA 1CDBA 4ZFZA 2Y2WA 2MIZA 1I8LA 2IAMB 3PUUA 3WY1A 1ZLWH 3P2DA 1EXGA 3HG1D 4X7TB 4L3EE 2NNAA 1RHHA 1AC6A 3CK0L 2G0LA 1T3FB 5F0LB 1WBXB 3WV0A 2FIKB 3F64A 5CIPB 5JPMB 4WU5A 3SOBH 3ZHKA 4AQ1A 5I1AA 1A6ZA 5F3FA 1NMBH 2E0PA 3PHAA 4LQFH 4S0HA 4GIOA 1UJ3B 2ARJA 4N5ED 4O02B 4KMLB 5IK3B 2FYYB 2ZKHH 5DT1H 3WNLA 5EG6C 3Q2NA 3BFOA 4JKNA 1VZHA 4WY7L 2SEBA 3BDBA 3CG8A 4OZHA 1QFWI 3JVGC 5L88H 4U1NB 4MAUH 5IQLA 1WGVA 2YD3A 4PRBA 2V7HA 5F7DA 2FT8A 2WKGA 5G4NA 1IAKB 3ASWA 3BVWA 4M6NL 1XR9A 5EO0B 5LHDA 3UPRA 2HFFB 3S37X 2WQ8A 4ZG1A 5IWLC 2IC2A 4JPKH 1FAIL 4YVUA 1N0LA 1KGCD 5LGKA 4ZDHA 1S5IH 4FS0A 1AIZA 1I7ZB 1CB4A 2FTAA 5EWIL 3AG3B 4FQLH 4UZGA 3KCWA 3MRHB 2YUZA 3FQNB 3A22A 2NY4D 4K3JH 2NY1B 2IFGA 4UUJA 3X1GA 5JHMA 4PJFE 1XH3A 4Y4KC 2FHFA 3US1A 3H9ZA 3EXLA 3FF8A 2ZOTA 5A40E 3MCG1 3WL9A 3QIBA 5J06A 1ROCA 2UUDH 4RGNC 3BGMA 1Q9WA 3P0VL 4MQXD 4WDIA 3U9UB 4FQQB 4HMCA 3MV8B 2IG2H 3DJSA 1C5BH 3BAXA 4OZHE 3EJPA 1RIVL 5J11C 2CHZA 5AG8A 4U6HB 4N2MA 4ZFFA 1TNMA 4S0TD 1U93A 1BZOA 4JO1L 1J9TA 3C6SA 2HKHH 2DKUA 4F9PA 2OMNA 4F1SA 4D9RE 5C9JB 3VXUB 4LPWA 3MCKA 5BQDA 2D3NA 3FN0L 3HAEA 3INUL 2VWEE 3C5ZD 3FSZA 3VWKC 5TH2B 4WK2B 5IB1B 1JGEB 2YJQA 2D2CC 3TNNB 2ICEC 2Y5TB 4RCAA 3S3CB 4GAJH 1NBZA 1OWWA 1TVHA 3T65B 2VTFA 1OAZL 2YPVH 5CBAB 1MW2A 2XJLA 2JKXA 3HZMA 3VG0L 5I5MA 3NIGB 3BAYA 4GRWB 4JN2A 3L9YA 1V7MH 2AERT 1BBDH 4KO9A 4N0CC 3G6AA 2O5ZH 3NCMA 1NWOA 2BJML 1YPZB 4NRZA 2F53B 4M43H 3HG2A 1QA9A 2EIKB 2FT7A 4POZD 3RVXC 2EKSB 1XIWA 4MWFB 3OLEA 4QT5A 3QO1A 4UT7H 4UTBH 3DECA 2GCYA 3EJSA 5CP3A 3ZVVA 3LSOA 3KL5A 4TNWK 1FN4B 4OZFH 3K80A 2G3MA 4RFEA 2QSVA 1YECH 4HGWB 1E9QB 4S1SL 7TAAA 4X9YA 3MOAL 3L3OA 5C08A 3V4PA 3MACH 1WBZA 3TURA 3FOLA 4MMZA 2Y72A 4B95C 4CKVX 5AALA 4N2NA 4O02L 5EO9B 5B3NA 4DF9A 4ZMLA 3TIDB 3S5LG 4DQAA 1YMHB 1EO8L 1XGTB 3MODL 4JZNA 1BJ8A 4TV3A 4AVJA 2YRZA 2WWMD 1AQDA 4HS8L 3BAKA 3IMRA 2WO3B 4WEMB 3D52A 1JGDB 1UXLA 4PJGB 1X5XA 2WAQA 4IGBA 4X7FC 1YAIA 2FEJA 1CGSL 1DQML 1G94A 1ZS2A 3GD1C 4IIQA 5F9AC 5MHSE 4S0SD 3HBPA 2A6IA 3CHSA 2DJMA 4MD4A 4CSSA 4BQ8A 3B2VL 3NFSH 1MCQA 2A77L 1N3NB 3VRJA 5ICZA 2XN9E 3AABA 3GFUA 4MNGB 5GIRA 5IBLD 4L4TB 4EIUA 2DTML 5E8DH 1MEXL 1P4IL 3NJVA 1MCEA 4FGMA 3U6XA 3BFWA 4WJ5B 1QLEH 2OAAA 5K33A 4JDEB 5C08E 4WHYG 4LU5L 3CZFB 1A4CA 4ORGB 5TE7L 2X7LA 3SDXA 1NC4A 2HUEA 5GGRA 3N43B 2PWFA 4LEXH 2OLDA 2LQRA 3DO7B 4OI9A 4B0MB 1PD1A 2IOOA 1CICC 1D5XB 2PWHA 4N0UB 4YFDB 3S3PA 3VAEA 5D2LB 1MQKL 4I18A 3D2UB 2OULB 4ZS7H 2VZTA 2M2DA 3EYSH 4OKVB 1OGAE 3ASOB 2HFGL 4XCNA 1YEJH 3EADA 5EBLB 1P0SE 2HH0H 1BAFH 2NY7H 4HXBL 4HKZA 5MENA 2B2XL 1MW1A 2Z8VC 5FCUH 2YN3A 4AG4L 3LKRA 3OKKB 3QI9D 3ZRCC 1SY6H 1HDMB 5JIKA 4PJ9B 4RDQF 1T1ZA 1JG9A 1ZT4B 3DUSB 3DYPA 5GGSA 4XWOD 1D7CA 1TQCC 3M8OL 4V1DD 4H0IA 3HZKA 3MQIA 5K9JH 5C0RL 4P2OA 3J07A 3S34L 1CVRA 4KO7A 3VFUB 1U8OA 3WOVA 1BPVA 3SDXE 1NBYB 4NFBA 2JKJA 4XHJD 2FWOB 3VI4F 2XZQL 1S7WB 3SDAB 2GTQA 2C3WA 3BLKA 2LGNA 2EC9U 4RSYA 4G82A 3ZL4H 3V0WL 3APDA 4NKOB 4MA8H 4MA7L 3AM8C 2ZCLH 1H3PL 5CBEA 1HXYA 3WLBB 4FHJA 1SBSH 1CLYH 3QQ9D 4TTGA 1UD6A 3L7EA 3MRPA 5E6IB 2X3BA 4WO0A 2I07A 4ENEC 5CSZB 3V6OA 1N7ML 3ARFA 5JQ6H 2CLVB 5IFJB 3EJZD 3L2NA 3ZTNL 3LEYH 2GG1A 5GRYA 5ITBL 1WEJL 4EI5A 2R2EA 1OSZB 1EXUA 1I4FB 1MCPL 2FEDC 3D3VE 3G04A 1A7RL 4ISVB 3BZFB 4QHLA 4UILL 5JMRA 1MELA 1KFAH 2KPNA 1AS6A 5GJTL 3L4TA 3WTWA 1KC5L 5I23A 1G1KA 5DS2A 3IXTB 4XVOA 3SEPA 4C4BA 5AOMA 5DMIH 1QNZL 1XSJA 1U8LB 1RZGA 2C1PB 1LE9B 2FBJL 1N6UA 1VF5C 5ANMA 3B9KA 1A6WH 2R23A 1GOHA 5A6IA 3ROOA 1JWSA 4L4VD 2VW4A 4N6RB 4C56A 3UO8B 4KHTL 4PWHA 4LLDA 5SWSD 2DMGA 1AGFA 1S7SA 1UADC 3RWGB 2LR4A 1SEBB 3NCXA 4R4BB 4ONFH 5ITFA 2O6PA 5DK0A 5AW2B 2VLKA 3NK4A 1Q90A 3BW9A 1EDHA 4JFHD 4WGWB 4MXVF 4XMXA 1K5NA 5F88B 2CJ3A 4I89A 3P2TA 4FYQA 3V6OE 2XXFA 1CLOH 2QADC 4GSRA 4G9DB 2Q2LA 2FATH 4OZFB 1NFKA 4CVWA 1A47A 1EBAA 4N9GA 3GRWH 5BUAA 3IMSA 1FNSL 3FQXB 3CDGA 2X0VA 3L7FB 1GOFA 3O3DA 1TOXA 4PS3A 1KLGB 3BXNA 2ZAHA 3ASNB 2VDOH 1R46A 4Z9KB 3NZ8A 1D5MA 1IFHH 2A73B 4TVPD 4AIZB 4JMXA 1NMBL 1JWMA 4Q74A 3EBAA 3W9DA 2JKNA 4FMKA 2ZKHL 2OL3B 3KPMA 2B3RA 2VIRA 5DT1L 2E7LC 3KPRD 3Q7JA 3RTQA 3FTUA 5CJ5A 5JUEH 5KW9H 1DO6A 5I1LB 2E75C 4OTXH 4YHYB 2ESVE 4H8PA 2WXOA 5DZPA 3H42L 5DFWH 5DRZA 3I02B 3VFOB 2BNRB 3E3QE 4PY7A 4MAUL 1PG7W 3AG4B 1GAFH 1H6FA 3HC4H 1ZDSA 2EZ0D 4OY9A 1I7RB 2VLKE 1E2WA 1EJ8A 3I6GB 2KH2B 1G0YR 3COOA 5IW6B 1D5ZA 1WTGT 4PIRF 2DQCL 1S5IL 4CAGA 5FEBA 2PPDA 1BECA 3AG1B 2NTFB 1O0VA 4OV5B 4K3JL 1NDMB 1G7HA 4N3TA 4BZ1A 4XMTA 2WXIA 3AFLA 4NJAH 3V0DA 2X4SA 3R0NA 2Y07L 1TTCA 1YEGH 2IO5A 2OX5B 3ZYJA 5D7JB 3KYAA 3U48A 1I1RA 1F3JB 2ZYRA 1PLGL 3HS0C 5DFVC 1EEZB 3K74B 8FABA 3E38A 1UOWA 3SE4C 3BVNA 4DETA 3T6ZA 4YHIA 2IG2L 3SD5A 1JFHA 1C5BL 3REVB 3CZSA 1JI2A 5EUKB 2L3BA 5CN1A 4DP0X 4G8FB 4DP5X 4HLZG 4H0GA 3JVFC 1T0NA 1CFQA 2WYHA 5BRPA 1CYWA 4Z3FA 4K55A 2NX5D 3P9MA 4XZUA 4NC0B 4Q6KA 2HLAB 2NXZC 2R0KH 3N44B 4XO4A 4AM0A 4Z7VA 5C70A 2WTOA 4MJIB 4YC2C 4YDJB 5EH1A 2FDBP 2YK1L 3WEXB 1D2PA 1MFEL 1PCXA 4XNQA 2WC7A 2IH3B 3V6FB 1OAUL 4WAFA 4ZBJA 4BDVB 4FABH 4XVJH 1S7VA 3JV4A 2WUBL 3VGAB 3S88H 1M7UA 2BHUA 2YPVL 5KSVA 5CWSB 1KNOA 1DQLH 5HHMB 4TOYL 1F90H 1I85C 1OOWA 4PEEA 1XMWA 3DVGA 1AD0B 1V7ML 2BDNL 1BBDL 2GITA 2R83A 4HHAA 2VXQL 2J55A 4D3CH 2P8MA 3RGVB 3S3JA 4NC1C 2X41A 2WLLB 4LKCA 1S3RA 4UT7L 5INCA 4UTBL 1KCWA 3DOSA 4UQCA 2HX7A 2OM5A 1UT2A 1PAMA 3MBXH 3V10A 1CXEA 4ONGH 4XBMA 5CMAB 2EIZA 4BFNA 2C9VA 4HLJA 3MACL 4PPTA 2QGBA 1D5RA 4GP5B 1A4JB 3CVIH 1IM9B 1OAJA 5JHAA 3QJFB 4GBXD 4KH9A 4J3OF 4P5KB 1WA2X 3BRGC 1YMME 2OL3L 4PWJA 1M3JA 1IBFA 1HEJC 1Q94A 1H8LA 3DX9A 3NDYE 4PRPA 4MLIA 2IADB 1NEZA 4XP5H 1Q9LA 1SDDB 5JHDA 4NPKA 5I1EH 3BVXA 1E5CA 1N4XH 3BFQG 2YGPA 5EU5A 1U8PA 3QXVA 2YSSA 1RZ7H 3HPJB 4DN3H 1JZ4A 4XGZA 1BJMA 2VL4A 1MFAH 4XCYB 3NFSL 2BW4A 4HV8B 3V4LA 3WUWB 3LXBA 1UFUA 1UHVA 1JGLH 5E8DL 3L1EA 3G6JA 5I8EA 4AV5A 1XAUA 1T21A 3FT3A 4KH2A 3K6SB 1O7VA 2FQFA 2GFBB 4KOCA 1C16B 1A7OH 2GTZA 4LHUA 5CJQL 5IMKA 5C2BH 5IKCA 3RNKB 2PXYD 3OAYK 4M7JL 2X2HA 4WHYH 2BHZA 4MX7A 2QGDA 3C8DA 3QULA 4YL4A 5AKRA 2R2BA 3VWJC 3ZE1F 4FNPA 3CBJB 4L1TA 1X9QA 4UTCA 3F58L 2YAMA 4BELD 3PP3H 4HJTA 3GMPB 3NESA 2BPBA 2XVKA 4RRPM 4YHZH 5HHVH 3MUZ1 2DQEL 3SJVB 3WO3B 4NSKA 4X6EA 4ZS7L 1RJZA 2XX0A 5GRJH 3V4VB 2Z0UA 5DFAA 4FQCH 4F9LA 3Q2LA 1YEJL 4ODTH 1W16A 2HH0L 2YAQA 3STBA 3WS6C 4N5EC 2NY7L 5BS0E 1PJ9A 2CDFB 1W8OA 3DBSA 3L48A 1U8HA 3M17A 4LCCC 4KRPB 4OF5A 5FCUL 3P73A 4FQHB 1OK0A 4JQXC 2D7NA 3RQ3A 2EUWA 3HJEA 4FXGA 2ADGA 1OT4A 1SY6L 1UD2A 1X4YA 2BXZA 3EH2A 5JHBA 1HQRA 2X2JA 5F6IC 3W37A 1CI3M 1BF5A 4J3XA 5DS1A 4K3GA 4N5UA 4CSTA 5K9JL 3QK0A 1ZA6A 4KKBD 3FTGA 4OJFH 4KWUA 5KS9F 5B1KA 4WFHD 5FWQA 1E3FA 1QO3B 1BFSA 2WBJD 4MCZA 3GNMH 1W8NA 3D34A 3MKGA 3K91A 2GB2A 2MNJB 1OD9A 2NY4C 3G6DH 3Q6FB 3ZL4L 3VXRA 5KN5A 2AQNA 1AHWA 4FQXB 4U49A 4ODBD 1VDGA 4MA8L 5H4ZA 4MASA 1CLYL 1YYLH 1Z9PA 3QWQB 3BZ4A 4AGQA 3CE1A 4MQXC 2YPLE 2BIIA 2X4QA 3QEHA 2J1XA 5TF1H 4ZODA 1FFQA 1SOKA 3ALWA 4YWGH 3JT0A 4JFED 4F7MA 5JQ6L 2BWQA 5JORA 3MNVB 1JF1A 4P46D 3LEYL 2J1WA 2EXWD 1VRSA 1JGUH 4G6FD 5KOMC 3ARGB 1TZGH 1R0AH 3KXFD 3W5MA 1XBRA 3ZDZE 3FPYA 1NICA 1I9IH 1CCZA 1J5OH 4ZX4A 2HJLA 4B9ZA 5AKSA 3VDBA 2NY6D 2F7PA 4PJEE 5T1LA 3F12A 4GOSA 5FYLE 3F7VA 3PAYA 4JKKA 5M7QA 4JJ5A 2QHRH 4XZ4A 4XNZB 4MDRA 5E8NB 3C5ZC 1IFGA 2E59A 3IDYC 1IC5H 3GXMA 4OCRH 1YEIH 4F15C 4NGHL 3T8VA 5AWNH 4N25A 4UAOB 3VXRE 2R56L 4L8SA 4RBPH 1MWAB 1EGJH 4NP4L 4WGVB 1KGUA 2J43A 1M53A 4ONFL 1AGBB 1H5BB 3LRSB 2B1HH 4ZUTB 2FR4B 1MJJA 5K9KB 1E5BA 3S36H 1IM3B 1KT2B 2GBTA 2V2WA 5FUOH 3O6LH 3SGKC 4AMKL 1DO5A 2CJTA 2F15A 3OMNB 3KLSA 4POZC 3RPIB 3GBMH 1H8SA 2FATL 1KB5B 5DJAB 4BH8B 1GYWA 1G4MA 2BIPA 2ENQA 3GRWL 1CFMA 2E76C 4ZUWB 1K9TA 2GJ6E 2ZUYA 4NWTL 1QLRA 1SJHA 2X6BA 1HAUA 3ARTA 4PJFF 3CBRA 3GMRA 3DIFA 2GSIB 1NINA 5HDBB 5B7MA 2VDOL 1AKJA 1A1MB 1IFHL 1IGFH 4AENA 4IBQA 1HQ4B 43C9A 3KLLA 4WI9A 2CA3A 4NQDB 3KYMA 5DK2A 4Z77A 2X44D 3ESNA 4YHPB 5JLZA 5CGYD 5DMKA 3S5LB 4LLVB 5JUEL 1MCWW 2W9DH 4OTXL 2VH5H 2W0PA 5F70A 4OZHF 1HWWA 3THMH 3VYNA 3WAJA 2WWMC 2YBGA 5IB3A 4KRNA 3GXPA 1GAFL 1AIFA 3IRZA 1CFVH 2CM6A 2FSDA 4QXTA 4QHPA 1G7JB 1KOAA 2YEZB 4NN6B 1L3NA 3T4YB 2CKBB 3ARXA 5KYXB 3UJTH 3FB5B 1RU9H 3NOIA 2CRZA 3SDCB 1BLIA 2CRIA 2IH8A 1WUNT 5DYOA 3SQBA 3K1KC 3LPOA 5IR1A 5IBLC 4DN4H 1EHLH 2ZE0A 3MRMA 5KVMC 3BO8A 1JZ3A 2H1XA 1IUZA 4NZTH 1A6VH 4NJAL 1CQYA 3VFRB 1XGUB 1H8OA 1LO0H 1YEGL 3IGUA 3IVKA 2WZPD 2K4AA 2YPKB 3WE1A 3VXPB 4J6RL 3VGEA 4IKIA 1ND0B 3PQYB 3PWJB 4E41D 5KVDE 1T5WB 1RXLA 2A6DB 5GZNA 1L9PA 2BY3A 3GRGA 5I1GH 1RK0B 2OMVB 1XR8A 2WHVA 1UCTA 4BYHA 1RVFH 2AJUL 3A47A 1O6VA 5IJDC 3MRRA 1F11B 1IGTA 4I0PA 4H0HB 5H94A 3RWHB 3GIVA 4TULH 1MCOL 2VDMB 3MGTB 5CINH 4CBZA 3E6HA 5F3HB 5GGSY 1OWRM 1ZHKA 2Y7SA 4XE5B 3ARVA 5ADPH 1WCBB 2R0KL 4F20A 2EVHA 4LCUA 3MRQB 2DWTA 3EOTH 5AOZA 4AV0A 4PV8B 4EI0A 1QSFA 5AB9A 5DJDA 5B1BB 4CMHC 3NFPA 2YRBA 3DURB 4PGDB 3C6LA 4FABL 4XVJL 4XWOC 5F3BA 3S88L 5ESQA 3D87B 4TSCL 4EMZA 2VN7A 4WFFD 3NJHA 3RPKA 1DQLL 4IDJH 1F90L 1U92B 1N19A 2J7LA 4CC4C 4UQ2B 1LDPH 5IBTH 4XHJC 5EZIH 5DVPA 3SPVB 1GTFA 4D3CL 1NJ9A 2CIKB 3W0WA 1JD9A 1SPDA 4JPIB 3HMXH 5I1IH 3KYNA 1MZYA 4WUKL 3V9EA 4KHXH 3MLUH 1KB5L 2R2HB 1EEQA 4JZJB 3LDBB 4ONGL 1R5IA 4WK0B 2VAAA 4YBLC 4FEIA 5KG9A 1QNIA 2DD8H 1JGVH 4KTGA 4F37F 4JPWL 4JFFA 2FBRA 2H0EA 1BMWA 4LB8A 2J2ZB 3RNQB 4I77L 4D9RD 1MCRA 3EJJX 4Y8AA 1TZAA 5T3XL 1QWUA 4JRXB 1KTLA 2LU5A 4NFCA 4W9IC 4Q9BA 3M6DA 4HS6B 1E7UA 4M00A 2VN3A 4PTUA 1DVFC 3CH1B 1OB0A 1JN6A 2VZOA 2D73A 4YDLB 3L9RB 4XP5L 5JOFA 1UKSA 3LEXB 3P4OA 4F8LA 5I1EL 4UOW1 1N4XL 4WWKB 3POHA 4KKZA 4F8QA 1JPGA 5I0ZA 4XBEL 3QIBD 4NQXB 2AMUA 3ZJAA 5IIEA 4DN3L 1E4XI 2CKBL 4BXVA 5KJ4A 3MV7A 3W0WE 2FX9H 3JT2A 4FXKA 5LG1A 4Q9QL 1JGLL 3VFWB 2ZP8A 5F7NC 2PO6C 3UTZB 3PAZA 3US0A 3BVUA 2ENPA 3F6IA 4EZLA 3MBEB 1XGZA 4Z3HA 1A7OL 2AK4B 4NS0A 4OF0A 3TH3T 1ODUA 2EIBA 4QTIL 1JHLH 2DM7A 2XA8H 1EO7A 4JFFE 4YUEH 5D7KD 3U4KA 4HPOL 5BV7B 3N9GH 5KSUA 4JQIH 2APXA 5E6SB 1ZT1A 5DHYB 6PCYA 4IBUA 2WAHA 5LCVH 2CUAA 4AV4A 3DA0A 2J25A 3ORJA 4NNPH 2EEAA 3I84A 3CHQA 1BOGB 4K7FB 4R0LA 4KXZH 4I2XE 3U1SL 5EU6A 3IFLH 2ED8A 5HHVL 4PGEA 3ULUH 5B7FA 5HYJB 4CILA 4K3DH 1MCCA 4KX8A 3QQ3B 3QUZB 5F9OH 5GRJL 1G9HA 2FL5B 4BA0A 5J6HA 3ES6A 4FQCL 4EDXB 3VG9C 3A6OA 5KYYA 5KZCB 2VDML 5E00A 2OJEA 4V11A 1MCIA 3HMWL 4RQQA 3O2WL 4QXGL 3QEUB 3MV7E 5MHSD 3PWPB 2UUDK 3U9PH 3G7TA 3VCLB 1JZFA 2YKLH 1XIWD 3GSUA 3D69B 1F00I 4XC3H 3QWOB 5JDJA 2UZYA 1BFOA 3QUKB 2J56A 3D2TA 3N42B 4OJFL 3I2CH 3CLWA 4GRLB 3BH4A 4QOKA 1HI6A 1JUFA 3MCYA 2FJFB 4ZXBB 1UYWH 5C08D 1AD9A 4P9MH 5IQMA 4GSDH 3QJUB 3U79A 4GLRI 5EU6E 3QRLA 5AKTA 4UU9B 2V37A 4WV1A 1CXFA 5IW1B 3VXMA 1MUJA 1YYLL 4UOZA 3TBTB 3QORC 1IKFH 1KYUA 3BMWA 5BZZA 4CL7A 3MOQA 4O2FA 2K0RA 4IGBD 4ZPVB 2VDPB 1MJ8H 4MNHB 4EZJA 5BCAA 2MH4A 2J4WH 3QXTA 5CEXB 1XFPA 5D5MB 2W0FA 3A23A 1BLNB 1CF8H 4PVBA 1T03H 4L18A 2X05A 3BDXA 4G7SB 3IU4H 1TZGL 5LBSL 1BX2B 2X4PB 1R0AL 2VL5B 3BUIA 3L4UA 2QMKA 2CHXA 1PD6A 1KLUB 1Q38A 2B5IB 2NR6D 4HCFA 1I9IL 2AXHA 2EYSA 1J5OL 2ZONA 5L2KE 4OLXH 1CFNA 4ZRGA 3D0LA 3IBEA 4KTDH 3TZVA 4QOKE 5JHLH 3IAQA 1C5DA 5T33H 3RWDB 2COQA 2QHRL 3EGSA 3IXAB 1ZT7B 4LSQL 1ZLSL 3ZO9A 3OKDB 4F2EA 1IB5A 1P5UC 1Q9KB 2A74A 3ECBA 3GSOA 1BG1A 1NC4D 1MAJA 4OCRL 2BVOB 3WFEH 1YEIL 1WG3A 3MJ9H 3FSAA 5D9SA 3KYKH 3Q5OA 3HHSA 1F1AA 2AQ2A 1JV5B 2OCFD 5F96H 3DTDA 3O4OB 4U1HB 1CG9A 3RZCB 1ITBB 2M1KA 3GSWB 4LCWB 2B1HL 4Y5XB 1Q0YH 4YQXL 1K4CB 2ZOUA 4LEOB 3S36L 4XOAA 1J9SA 1K2DB 3O6LL 5DCCA 5T5NF 1VIWA 1JK9B 2ADFH 2ATAA 4AUYA 2GKIA 4NIKB 3GBML 4LF3A 5BV7L 3LRHA 5LVEA 5LAXB 2Q1EA 1K6QL 1B6UA 1U30A 5BZWB 4NRXA 1AGDB 1I82A 3D3VD 1NGWB 2BC4A 2QV4A 2A6KB 4HC1A 3L3HB 1IGMH 4PN6A 2IAMA 3PV6B 4DTGL 4G42B 2EINB 1JXKA 3AQXA 4P2OD 4GRMB 5AYTA 4JX0A 4NM4H 3RWIB 2WLIA 1T3FA 5EA0H 1WBXA 4GBXC 3IGKA 3BQUD 2FIKA 3ZKMD 5CIPA 1ZGLM 1NUFA 4QGTA 1NCCH 3THML 5JPMA 2MCAA 2KL6A 4G7VL 3DX7B 3H2WA 1KXVA 4N2BA 4N20A 1IAII 2JJWA 3TTSA 5LGYA 1VFAB 1UJ3A 3SD2A 4OBSA 4PM1A 2YN5A 2FYYA 5IK3A 2FWLB 4GQZA 2BLFA 5F9DC 5KAQF 3LD8C 4Z7UB 4ZOAA 3UJTL 4RA0C 4CADB 4HIIB 1TMCB 1USQA 3GHEH 2WTPA 3PY9A 4U1NA 4AEIH 4AT6A 2CE6A 3F6LA 4BK4A 4K9EH 5DEJA 4DN4L 4KJPD 5BUPA 5FM5O 1KN2H 1E43A 1DLFH 5EO0A 5I24A 3O41A 3D25B 4NZTL 1A6VL 1J0IA 3ZDYE 4CSPA 3HI6L 2EXYC 3MUJA 1LO0L 2PXYC 1GMEA 5D4HA 4ZUUB 1E28B 1W8EA 3MRHA 1PFCA 3FQNA 1F4XL 1FL5B 3QFDB 3QZOA 1IC4H 1SJMA 1YSOA 1ZS8B 5C07B 2FGWH 4HOZA 4HIEA 2VDPL 4P2RB 4WNSA 1R5WB 5GHWL 3B9KD 1CDYA 3FTYA 3U9UA 4C56D 4FQQA 4ONOA 5CINL 2DIAA 3GLEA 4Y4KB 5K9QG 3MV8A 2X89A 2AQ3A 5ADPL 3AWFA 2VLKD 3H6JA 1SEQH 3EOTL 4RGNB 4U6HA 3UP6A 2X1QA 4XN5A 4KUZH 2R0ZL 2Y2TA 3T09A 2X38A 3M86A 3TN0B 4AYSA 5C9JA 4N2EA 3VXUA 3ZUCA 3I74A 4H44C 3VXTB 4IDJL 4HJUA 4IHBA 4NO5B 5GRWA 1DQVA 5G55A 3JWNG 5TH2A 5IB1A 1GJIA 1JGEA 3WHE1 2WBJC 2MPVA 4Z0BH 3T0EE 1FIGL 3TNNA 4ZMWA 3T65A 2H3NB 5IHUH 4W81A 1WTLA 1LP9B 4X8JB 4FMVA 3RKPA 5CBAA 3HMXL 4AZ8B 5TJWK 1HNGA 3KPQB 4NRYB 1XD0A 4J3OC 2C3VB 4HK3J 3RTQD 3LS5H 4KHXL 4XX1G 4A7VA 1W9XA 2ICEB 1YPZA 5IBUG 2F53A 3BE1H 1TETH 2F19L 5LO7A 2DD8L 3I50L 3MV8E 4C4KT 2EKSA 1K4DB 4PJBB 2EIJB 1O6TA 4M7KH 4YSEA 4HHWA 4M5YL 1FN4A 4P46C 1BQUA 3S97C 2EXWC 3H3PH 3WIAA 1WZKA 4HGWA 4L9LB 4G1EB 2BERA 1E9QA 4RVBA 4XNXL 4FFZL 1M57B 4TVUA 2N7AA 4XO8A 4QXWA 2NY6C 4AZUA 1KENL 4LESA 4YHML 3D30A 4NQUA 2FECL 4HJGB 5EO9A 1Q0EA 3OHXC 4AQ8C 3WTVA 3UGEA 1YMHA 1XGTA 5CU9A 4JPVL 5JW4N 2FX9L 1JGDA 5FGRA 2IWEA 2NT1A 3FTWA 4KX7A 1GS6X 4W4OC 3NIGE 2UZIL 4GRWE 2C8NA 4EI6B 1TJGH 1I7TB 1V7NH 4JQVC 1YPZE 4OCSL 2F53E 3VTMA 2RALA 5FC9A 5IJKC 3APFA 5IEHA 3UFIA 1MN4A 2XA8L 2I24N 1N3NA 2DJ4A 4BQ9A 2XCMC 5EDXA 1AS8A 2VDNB 2VITB 3D12B 4L4TA 4PMFA 3FTSA 3GMMB 4NT6A 4NX0A 3VGGA 3VYOA 5LCVL 2WUCL 4NCDA 4NNPL 4JFQB 2WNGA 4ABUA 1SLUA 4WJ5A 1X5LA 2WKOF 3IFLL 4X6FB 3BD3A 4DEWA 1IAOB 5AYQA 1CE6B 1RLWA 1YMMD 3CZFA 3QFJA 4ICWA 2HTLC 4K3DL 4ORGA 5F9OL 2RAMA 3MYZA 4OZIB 2I26N 3NCBB 4JFDB 1HXKA 1RULH 3V8CA 3DO7A 4KKAD 2AJYH 3DXAE 3FUKA 4HAGA 4KVNL 4N0UA 4N68A 4Z3IA 5D2LA 1MCBA 5CGYC 5HPMB 3D2UA 2Y5EA 1H3XA 3N91A 2YWYA 1EO5A 4OKVA 4PJGE 3U9PL 3GM8A 2RJMA 2YKLL 2AF2A 5EBLA 1CICB 2FX7H 4EBQH 1DR9A 2Q3AA 3NABL 2V0AA 3ZDZF 2X3CA 3LH2H 3QCTL 2AEOA 5KVEH 3VFVB 2CU9A 5A1AA 4PWEA 5DDHB 4PI0A 4PJEF 5D7SH 1ET5A 1X6NA 3BUBA 4MNGE 4N8CH 5IM7B 3MUHL 1HDMA 4L4TE 1UYWL 4HOMA 1ZT4A 1FC1A 3DUSA 4HIQA 4Q58C 4GSDL 3C12A 4CN6A 3M1CA 3OQRA 4FKHA 3ULUD 4NUPA 1RZKH 3EOYG 4R7DB 3WMSA 4MNQE 5EOQL 4EJ1C 2CCLA 2ZXAA 3VFUA 3APMA 1YJDC 1M05B 2FWOA 1VPOH 2CKNA 5FO8B 1S7WA 1BGXH 4FQIH 1KIRB 1WRFA 4DGYH 1U21A 5JQHC 4PHZA 4ZT1A 4M5TA 1T7XA 4JG1H 4NKOA 2J4WL 1X4XA 3DJTA 5CJOH 3VGHA 1BDYA 2FO1A 1X44A 3JWDL 3WLBA 5J9PB 3UXFA 5DUML 1CF8L 1T03L 1GZHA 2ZIDA 3BYYA 2WQXA 5E6IA 4YMPA 4NYLA 4ABVA 3LIZH 3LVTA 2QQLL 4ZMTA 3MLWL 5DZJA 3BZDA 2VC2H 1N6VA 3RWEB 4QY8B 5IFJA 3ABZA 3MJ6A 1LTXA 4KTDL 5JHLL 1A6PA 3PREA 4C54A 4W9FC 1OSZA 1I4FA 1U6AH 5T33L 5EV7A 4ISVA 3WFHB 2BP5M 3BZFA 4NPYB 1NL0H 3VFNB 1AKPA 1PU0A 2P26A 1I8LC 1RZJL 4AX3A 4OGXH 4HSQA 3KYKL 1EUUA 3IXTA 4MD0B 2X1WL 5F96L 1ZSDB 1U8LA 2C1PA 1LE9A 4YSPA 3X1BA 1Q0YL 3H3BC 1SLXA 1LJMA 2YWZA 4OFKA 3ZL1A 4PV1C 4AQ1C 1XO8A 3KLQA 3ESVF 1G9NL 4N6RA 5J7CC 5L0QC 2PTTB 4W4NA 2ADFL 3ZTJG 2DMCA 2CJSA 2EDLA 3VRIB 2A38A 1SEBA 2VDNL 2XRAL 4R4BA 3IMBA 1LILA 4YDVB 3T2QA 4B3EA 3ZIMA 2VXQA 1M2OA 4PW3A 1OQXA 4KNTA 4MHHG 3QEGH 2DLEA 3X12B 1FZMB 2DQ6A 1IGML 3NJMA 5FA4B 4AYID 1UQSA 2X9WA 4G9DA 3STZB 5J89A 3TF4A 5T3ZH 4L1LA 4IHOB 3TVMB 1MDAA 3FQXA 1HHKB 2CGRH 5EA0L 5FYLD 4BFRA 5D2NA 1ZOXA 1AP2B 1W2KT 2VWEC 5H35B 4XN4A 1FGVH 1NCCL 3UABA 5FFLA 4PLJC 1HJCA 2A73A 4AIZA 3SYCA 4KKRA 1HC1A 1UWXK 1XVSA 3VXRD 2BK8A 1GYUA 1NIEA 2OL3A 1Q8MA 1XF4B 3Q05A 3GSXB 1H9DA 5I1LA 3MRJA 3GS0A 3TWCH 3QJQB 3VW3L 3VFOA 2BNRA 5A43C 4GSUA 1U33A 3OWEA 5I9QB 4U1LB 2N7BA 4LGRB 5ACLA 3P40A 1PCSA 4XTRD 1I7RA 1KN2L 2QZ5A 2XUWA 3ZSTA 2Y3AA 5I5IA 4KO5A 3BGAA 5EF0A 1H3GA 4GW1A 5IW6A 2GJ6D 3EFDH 4H8WH 3RIKA 1CFTB 4MZIA 2CRMA 4URTB 3ZQ9A 4OI7A 2QVKA 3AREC 5DD6B 2OXHB 2FQGA 1LL1A 4F9PC 1RK7A 4XBPB 1WT5A 3U1QA 2NTFA 4CU6A 4IOFD 1H6EA 3NQKA 5T1LD 1NDMA 3PNWB 5TDNB 2J57A 2FGWL 1MW3A 3WIHL 3PDOB 1OAYH 3UTPE 3QFGA 2OX5A 4XNMB 1EDYA 1F3JA 2LHAA 1OF2A 1MFMA 2VLJB 1EXHA 3JUYA 1EEZA 3HNTL 4MMXA 3ZRSA 2GYSA 4OFVA 4QKTA 4MJ2A 3DWTA 4OUUB 4OGQC 2BZ7A 4OUOA 3LAFA 3REVA 5EUKA 1SEQL 2O6DA 2BNRE 4HWBH 5C6TH 3K8MA 2ERJC 4KUZL 5BOZG 2Y6SC 1XSIA 1S78D 1XIWC 2BSEA 2Y5QA 2MCG1 3GDBA 4HKXB 2PWGA 1N12A 1BMGA 4AC4A 3A4DA 1HK6A 3UERA 4MJIA 3RL2B 2CXKA 4YDJA 5CUSH 5DURB 5I1HH 1SVBA 3FK3A 2IH3A 1AKJD 1BJ1H 3ZLQC 2N7SA 4BDVA 5D55A 1L3WA 3FH8A 2IWFA 1HL5A 2PP7A 2HLFD 3L45A 4FE9A 5IHUL 2NXZB 3QXUA 5JYMA 2WYTA 4MMZC 2E4TA 2J8OA 3QWRA 5CWSA 1CR9H 1I3UA 4B96A 2BVEA 2VXSH 1AD0A 1XL4A 4MS8D 3FO2B 3BE1L 1KUMA 1TETL 2X2YA 5DD1L 4PJXB 5GISL 1NAMH 3RGVA 2D7PA 2DLGA 2WLLA 2XTJD 3ETBJ 3HG0A 2VDRH 1PZ5B 3GB7B 1BG9A 1MHPL 2V33A 1BSIA 3CHXA 2I9LB 3H3PL 4JHWH 3B1UA 3F7YB 2ZSWB 4KY1H 4XPBH 3RRQA 1IFRA 1J0JA 4QTHB 2VC2B 2HWZH 2NR6C 3U7AA 2VLMD 2VM9A 2CLZB 4X8CA 4LCVA 4QO1B 4MJIE 1PZAA 3CCHB 1A4JA 1BOYA 3PWUB 1IM9A 4UV4H 4BWTA 3QJFA 4EVNB 4P5KA 1NCGA 1B9KA 5GJSH 4GS7B 1AYOA 1INDL 1FNAA 2ZUUA 3UAAA 4JPQA 4KY2A 1X4ZA 1SXZA 3I3EA 7FABH 2IADA 3V5KB 3MBWB 4XB3A 2IALB 4GP4B 4Z0XB 4I18C 2IEPA 3WXWL 1TJGL 1IT9H 2E27H 4ADIA 3HPJA 4ODSH 5C3IA 4I0PD 4D8PA 3SPHA 5F7EL 4XCYA 4M8RA 1UB6B 2CQVA 4HV8A 1NDGB 3DO4A 3LQAC 3KVPA 4TUKL 3VB8A 3WUWA 1RPKA 3N1PC 4L0PB 5KYWA 3WIFB 4TUUA 1GR7A 3VSVA 3NZSA 3K6SA 4BFBD 3CZKA 1P6WA 2GFBA 1C16A 4FNTA 5TE4H 1QSFD 2BS9A 2AEPH 3RNKA 3IJYB 4W9GC 3T2OA 3C6LD 5G4OA 5C0ND 4GUQA 5ISZB 1F3RB 1RULL 2AJYL 1WLHA 1SDAB 1I9JL 4CMMB 2IGLA 3GS7A 3CZEA 3GMPA 5G4MA 3F05A 4YDKH 1IMHC 1EHNA 4NDMB 3LZPA 3SJVA 1A1NB 3BQUC 3PJSA 3IDJB 3L54A 3ZKMC 1O7DE 2OYLA 3V6ZA 3VWJB 3CFQA 5AEAA 2GVYA 2B15A 3V4VA 1E42A 2Q7NA 3W0WD 2E4FA 1TZIB 2FX7L 4EBQL 3HVNA 4YZWA 3AY2A 1FVDB 2CDFA 5I0DA 2XU9A 3QUMH 1G1YA 1A3RH 5EU4B 2X88A 1IAIL 4FQHA 4EN2A 4H0LC 3EJQA 5E5RB 5FDWB 4AGOA 4N8CL 3W57A 2XBZA 4HKBB 4JFFD 3G9VA 4NN5C 4J6IA 2D9CA 2R69H 2HPTA 5D6CB 2AEQH 2OJZH 3V6OC 3EJUA 4E5XG 3IDGB 1PX8A 2Z34A 4X9FA 4LSDA 1ZHNB 4TPRL 2A4CA 3MRGB 1QO3A 4LLAA 3EYVB 1RKRA 5AAMA 3WKNA 2G2NA 4TQHA 1GZPB 4G59C 3D6GA 4OLVH 1TVBA 1NCBH 4ZSOE 2PPFA 4AEHL 4MZ2A 4DGYL 3K71A 3Q6FA 1JP5A 2DIBA 2JNZA 2YD1A 2Y22A 4XPHH 4FQXA 3QJXA 4I1RA 3G5ZA 1NGZB 4X5PA 3B9KC 2NZ9D 2Y4SA 3MV7D 4YHLH 1A0QL 2AZUA 4YL9A 5D72H 1U8KB 4ZMNA 4A2EA 3O11B 3E3QC 5EN3A 3LIZL 2NLJB 4ZX5A 1EZUA 3S8FB 2IV9A 3KPLB 1X5KA 2VC2L 1HEZB 1I1AC 3DTUB 2XZCH 3M1BB 4QHKI 2HX8A 4TQPA 4AGNA 2HAZA 2K78A 2Y0SA 3EO9H 1KSRA 1UCBH 3CAFA 5EUOB 5A16B 4LSUH 1BXVA 3ARGA 1NL0L 3O0LA 4U0RB 5I6XC 3HCVB 3LN4B 3P0GB 3MV9E 4OGXL 3K6IA 4PW9A 3LMJL 2PCXA 3O0RH 1WFJA 4J12A 2W9LA 4IRJA 3O9WC 5EU6D 3BH9B 4WEEA 1KELH 5E8NA 3ULAB 1MCSA 2KUTA 3H7LA 5KOVC 3K2UH 4YGVB 4PG9B 5AW9B 1AZNA 4AK2A 1MXGA 1OAKH 3ZTJH 1L0QA 2WCSA 3WFDH 1GCFA 3WN5B 1ZLVH 1MWAA 5CN3A 3DV6B 2JJUA 1AGBA 1H5BA 2E46A 4Z8FL 3IDYB 3QXDB 4JHAH 3TEXA 5K9KA 4LLQB 1BPLB 1IM3A 1KT2A 3OBAA 2ZKXA 3E8VA 2DQIH 1ADWA 2X4OB 3WD5H 2VDRB 3RPIA 4U1SB 4HVBA 1F0LA 2IVFC 3CZUB 2AV7B 5T3ZL 4WW2F 1KB5A 4LCIH 3CFEB 4BH8A 4BSJA 1ZLUH 1JMZA 5L2KD 4HJIA 4ZUWA 1F4WH 3BAJA 2CGRL 3GZKA 4Y9EA 3SYPA 4QOKD 4TYUA 5LQBH 2O30A 4OQTH 1HYSD 4BK5C 2DKMA 2CO6B 1FGVL 4K3EH 4NWUH 1A1MA 1NCNA 2ZWNA 1HQ4A 3PV7A 5TGBB 5C0BE 1ZVSB 4NQDA 2XT1B 4YHPA 4EQ3A 4TMPA 3S5LA 4LLVA 2PYFB 3II2A 3TO4C 2D3JA 3H0TB 5AKVA 2XICA 4HJSA 3OX8B 3EGXB 3TWCL 2VR3A 4WI0B 3EFOB 4J4PA 1M56B 2KERA 4LSPH 2DMKA 5F7YC 1PSKH 1G7JA 3T4YA 4GO6B 3O8XB 2Z7UA 2CKBA 4IU2B 1FZJB 3RIAF 4WEUD 3QG6B 3SDCA 4P0DA 2F5BL 2Z6FA 4H8WL 3SE3A 3ROLB 2F0CA 4UDTB 5LGJA 2A9BA 5E9NA 4CDGC 1DANU 2VISB 1FL6B 1NGXB 3EH5B 4U3XA 2LT9A 1TEYA 3DX3A 3QPQD 3TZVD 5JR1L 4X5LA 5T5FH 5HDBE 2UYLA 1SQ2N 2BP0B 2Z92B 1OAYL 1G7MB 3OKNB 4APQC 2XVLA 3VXPA 5T3XE 1ND0A 2XC8A 4NQDE 3PQYA 1X5GA 2F18A 3PWJA 1T5WA 4KKAC 1W0WB 1DFXA 4GI8A 2OMVA 2GTWB 5MERB 4OIIH 3HZYB 2QSCH 4HWBL 1F11A 4CW1B 1OCCB 1YQ2A 2XPYA 3KPNB 4NENB 3RWHA 4CNIA 5ADOH 3V5DB 1UOKA 3MGTA 2FD6H 3ARBB 5F3HA 4ZFOB 3TL5A 1WCBA 3MRQA 4V2CB 5JIQA 2MOVA 5IMOA 5CUSL 4PV8A 2DWDA 5DS8B 1UA6H 3Q13A 5I1HL 3ME0B 3DURA 3CLEH 2IAMD 4PGDA 4YJZL 2GC7C 2NNFA 3BYTA 1RZ8B 4M5SA 5HGAA 1N68A 1CR9L 1ZV2A 3B37A 4GUOA 3KWVA 1U92A 2APWA 3WJMA 1TENA 1OTTC 1YN7A 2VXSL 4GRWF 2WWNA 4CMHB 5KUKA 5K93A 3R06B 4OFPA 3PQYE 3SPVA 4QRQA 2D4FA 3F7QA 4K94H 1NAML 2CIKA 3WNOA 1WF5A 4JPIA 4BGDA 4KMTL 2VDRL 2O6EA 5M94B 4R90H 2VERN 3V0HA 1ZSHA 2R2HA 2BHFA 4WJKB 4JHWL 1I3GH 4JZJA 4KY1L 2DQGL 4UWQB 1JPTH 4HWZB 1S7QB 3RNQA 4WWOA 4BFFA 3EO0B 1FCCA 2F6AA 3NACH 2Q3ZA 1Q1JH 4UV4L 5LBSA 2XLLA 1F8TH 4UMSA 4JRXA 2DBJA 3OHMB 2X70B 3DPBA 4NAQA 3UBHA 1SFDA 3SE8H 1ZGLP 4I48B 1MFVA 1OPGH 2DMBA 1P7QA 4HS6A 4AYGA 5C92A 2ZCKH 3CH1A 7FABL 2G3XA 2Z4QB 4K5LA 4FJ6A 1NGQH 3L9RA 4JRYE 2NY1D 3QS2A 2DIJA 4L48A 4PJGF 3LEXA 1NGYA 4LRNH 3KVDD 3ELQA 5I15H 2OMTB 1E5AA 4RMUA 4WWKA 2JK5A 3BJ91 4NQXA 2E27L 5GGUA 4CRPA 4NNXA 1OK8A 3IGAB 4NQEB 4WWPA 4YDNA 1DVFB 5DRXB 2V2TB 2PCFB 2A0LD 2QZQA 1CGYA 4TNGA 4I4WB 3VFWA 3MV8D 4YXHH 2X89D 2VZSA 2MCPH 3UTZA 3FUMA 2VUOA 4UTAA 2VXTL 3MBEA 5DVNA 1BVLB 1TJMA 2AK4A 3D50A 1KV3A 4JGMA 3CPLB 5TE4L 1OGTB 4QHNB 3S96B 4BSVB 4L4VB 3BI9X 5TQ2H 3ZMNA 3EUDA 3LRLA 4G6KH 4OSUH 4JB9H 1BBJB 4O58H 3K3QA 2YSTA 2PO6B 4UANA 5C0CB 3KGSA 4L1SA 1JF5A 2XA3A 1T0PB 3VXUD 3UP1A 1NPUA 5I1CL 3ML8A 1BOGA 4K7FA 4RX4A 5K9OB 5E08H 3R8BB 4AMXA 1IGIL 5HYJA 4FYRA 3JWOL 2NY3C 4G9FB 5L8LB 4WSJA 2FZ3B 3U2IA 3QQ3A 3QUZA 2FL5A 4IDLA 1D6EB 5GS2D 4EDXA 1WCQA 1KGJA 1EMTH 2F5AH 1AHWC 5AUMB 2JVUA 2I9TB 3QUML 4AWJC 3SY0B 4ZFOL 3H7BB 3QEUA 3FT9A 3K4DA 2F53D 2X6AA 3PWPA 5I6LA 4F1ZA 2CGZA 2G60H 1XGPB 1RUAH 2HLEB 3VCLA 1J87A 2R69L 2DLFH 3CMOH 3SGJC 4EN3B 4P5MA 2AGJL 2R0LH 3KPRB 3QWOA 1EANA 1GKEA 2AK4E 3LOWA 2DBLH 4OW6A 3QUKA 1LLAA 1YY8B 2J6WA 3VI4B 4NKDB 2KDGA 2FJFA 4ZXBA 1A8JH 4M6OL 4OLVL 1NCBL 1JERA 4IOFC 5HHOE 4G3YL 4PHXA 4K5NA 4UU9A 3FQTB 4XPHL 4A68A 2BIMA 5EIIB 1DLHB 5IW1A 4KDWA 4IBSA 1DSWA 1XTMA 2YRLA 1USZA 3TBTA 4M3HA 2Q87A 1WYJA 2Y3NA 2QVIA 4YHLL 1FDLL 1SVZA 5D72L 5I82A 4QGYA 5IVZB 4K2UH 4ZPVA 4B41A 4EOWH 3FU6A 1IL1A 1SJVA 4E9YA 1GY1A 3PP4H 5CEXA 1CDGA 4GQPH 4XXDA 4XBGA 5HTSA 3PWPE 3WUZA 1BLNA 3QORB 3MRDB 3Q01A 2XPZA 3VE0B 1BX2A 2X4PA 4ATTA 2B0SH 1WS7A 4L4TD 4U6TA 5E1IA 3WTYA 3S3BB 1MCNA 4X4MA 5F6HJ 4UYQA 2O26U 3KPPB 3O0RL 5GGQH 1UXSB 3N3EA 3C75A 5D7LA 3RWDA 2L0DA 1KELL 3KPSB 1U2HA 2LTQC 2EVFA 3OKDA 3VNZA 1X9LA 2BVOA 4MQTB 5DMJB 3TU6A 3ZBMA 1F58H 2AJSH 2ZP9A 2HLFC 1OAKL 4XNAA 5HHPB 4DPBX 1FBIH 5HXMA 1JV5A 2B8OT 5IG7B 5KJRL 5L4JA 4NHUB 3D2UD 2XV3A 4KKCC 4RISH 3L5XH 3GSWA 1R75A 2Q2EB 5LKNA 4Y5XA 1NANH 3NCYP 3ZDXB 2BSSB 4CJ0A 4ZO7A 1K4CA 4LVNC 4LEOA 4MS8C 2V17H 2DQIL 3LRMA 4G8IB 3WD5L 1DVSA 1JK9A 2IBZX 5HHNB 2APVA 3BT2H 4RGOH 5D5ME 5LAXA 4AI7A 4R2GC 1F4WL 4LHQB 5BZWA 4OQTL 4CJ1A 1NGWA 4PJ9D 2VNCA 1UWEH 2A6KA 5C2UB 4NWUL 4JRLA 3PV6A 2VR5A 4G42A 2V3DA 2BRRL 3KBPA 5DZNA 3BEVB 3F8UB 3Q1SL 4PRNB 2XACC 3WTUA 2IGTA 4GRMA 4RFNB 5DC9B 4JE0A 1OCOB 3RWIA 1MVUB 2WBKA 3POCA 3QDJE 5SWZB 4FFZA 4Z3JA 3PU7A 2IANE 5F8RC 1R6VA 1V3JA 1QW9A 4JDVB 3Q43A 3B9VA 2F8IA 3EJRA 1QVOB 5HI3D 3HC2A 3SDAD 2RFXB 4LSPL 4ZUSB 4ZUVB 3H9HA 4YOKA 2VJXA 1VFAA 3BWZA 3NFNB 4XE0A 2WOYA 4A7GF 4LCWE 5DD5L 3V9FA 3PPEA 1WK0A 4HISA 1HIMH 1SOQA 2OTUB 2UZPA 1XX9C 4CADA 2W5PA 2AXGB 3OLIA 5E6ID 2YAOA 2EUZA 1MSPA 2N0MA 5I5JA 4YHKH 4L8BB 4I0KA 5SX5H 1F86A 3LD8B 4QRUB 3II1A 32C2A 3D25A 3OKYA 4FFYA 5T5FL 2XBTA 3JVGA 3RUGF 4ZUUA 2WXLA 3PWVA 3TTYA 1PQZB 3C6LC 1E28A 1T4WA 2DQMA 5C0NC 2BS8A 4M03A 4JVUA 4N0FA 5GS0H 4HALA 2EDFA 3QFDA 4QEGA 4QHMB 5IWLA 3A3YB 1E3ZA 1ZS8A 5C07A 3QISA 4QRSB 1X9RA 5DVOA 3QNYA 4BJLA 4CN1A 4P2RA 4OIIL 2P1YA 1R5WA 2D03H 4OFYA 4FA8A 4OZ4B 4B7LA 5ADOL 1E4WH 4KVCL 3QE5A 1I8UA 4FZ8H 4Z7IA 2W91A 4Y4KA 3KE0A 4Z7UE 3WTTA 1M9WA 1RZIB 3QUHA 1YUHB 1W91A 4D9LL 3U0WL 1CIDA 3O4LA 4F2MB 2NY5C 2WGNB 1VEOA 2D31B 4OAWB 2QV2A 1N5AB 3CLEL 3U0TB 3NQIA 4MB1A 4YDMA 5HYSG 1BJ1J 3V4UL 4W93A 3GDCA 4LXFA 2IQAB 3VXTA 1YG9A 4WRLA 2VXUH 2Z8WC 4JUTA 4YSDA 3IGLA 1Z7JA 4ZTOL 4ZO9A 4PRAB 1ESOA 4N0RA 1CS6A 1L9MA 3UTPD 5ICXB 4WW1B 4Q97A 2H3NA 4HOXA 4K94L 5C07E 4X8JA 1LP9A 2IBZY 1XHHA 4OF6A 4AZ8A 4P2RE 5D71H 4R90L 3R18A 3U30C 3Q5YA 3EDJA 4YSTA 1JF6A 5JXAH 2IPUK 2ICEA 2DYPB 2NZ9C 2BNRD 4LSVH 4M3KB 1R24B 4FXKC 5T1KB 1K4DA 4OZGB 4PJBA 2LVEA 3D06A 5A2IH 2FRGP 3UTSB 1AANA 5I17B 3NACL 4XMKH 3DDGA 1AZUA 1LYQA 3KPTA 1F8TL 1ERNA 3VFSB 4HFWB 2X9YA 4L9LA 4G1EA 1XF5B 3SE8L 1FLTX 3U6RB 1GH7A 1OPGL 2WWKO 1NMCC 2G3NA 5IOKA 2ZCKL 2WD0A 3B3IB 3MZTA 3PGDB 4P46B 2CMRH 4R0LC 4G6FB 4NUJB 1DTUA 5IB4B 1T2QH 4HJGA 5INDB 1OV8A 5D7JD 4N9OB 3OMIB 4B0MM 4C58B 3WAKA 2CR3A 2KZ1B 2HT4D 3FUHA 4GT0A 3UTTB 1HKLL 4FP8H 4YXHL 4M7ZB 4HF5L 2MCPL 5CGBA 1Z9SB 3I9PA 4EI6A 1RZPA 1I7TA 3EBIA 2KKQA 4H2CA 3TPKA 4BQ6A 2YEVB 3VD1A 1WPCA 3ZE1B 1TZHB 2JJSC 3CFUA 3VGBA 4Y1TA 1P6FA 1DBJH 4OSUL 2HMID 1C08B 4HUCA 2BSED 2W0KA 4PJBE 2VITA 5LG6A 2ALAA 3SGDI 1YUKB 4OCXH 4BD4A 1QI3A 5H4YA 3BKJH 4JAMB 4OCYH 5IQOA 5ECGA 2CG9X 1WH0A 4JFQA 4MJID 3QHTC 4YO0B 2EVIA 2CHNA 5JOPE 1LE5B 4X6FA 1VKXB 2VR4A 4G8GE 1HYSC 2AQ1A 3WNPA 1CE6A 4MYPA 1NGPH 4KDTC 3QXWA 5C9KA 5IMLB 3PGFH 4WEBL 4OZIA 4JFDA 3BPNB 1A9EB 3QWRD 5CR8A 3DTXB 3SKNB 3UJIL 3ZIYA 5A2FA 2VQ1A 5BOJA 5IFAL 5HHMD 2APTA 1B9ZA 3B7TA 1EMTL 3FU3A 1EZVX 1R3KA 1TQBC 5EORL 4BFEA 4MBOA 3J7HA 5HPMA 4I85A 3V5HB 5DUPL 2YHGA 4GAAA 5AAWC 4ZMQA 1IBGH 1J0KA 2DI7A 4G8EB 3D18B 2I85A 4ERSH 1QSEE 1BWMA 2G60L 4LMQE 3FYIB 1RUAL 3RGVD 2ZG1A 3MRIB 5EOTB 1CICA 3CMOL 2YO3A 4WJG3 2R0LL 5DJCB 1TEGA 2AQTA 1BAWA 3VFVA 5K1JA 3MFFB 3CXDH 4S1DD 2QSQA 5DDHA 1Z32X 5TK4A 4LAQH 2ZSVA 4Z7NB 4J5VA 2C7FA 2CM5A 5TDPB 1OP5H 5IM7A 5JW4M 1EEYB 1M1XB 1WBYB 4TSAL 5KVFH 2Z1KA 2RACA 4HAKA 4KFMA 4HDIB 1DP0A 2W07B 3H9SA 1TTUA 4CVUA 1IM9D 4R7DA 3LTVA 3QPQC 3TZVC 1JYVA 2ZYSA 3K1DA 4G6ML 4Q2ZB 2XWDA 2NXYB 3OQ3B 4YEEA 1SOXA 4JE4B 4FG0A 4JHUA 1YLBB 3CXHJ 2X09A 3F83A 4Z95H 3IMWA 4JFDE 1M05A 2MNWA 4Z23A 1RURH 4RAVB 2X1PA 5FO8A 3B2MA 3CC1A 3QPXH 4L3EB 2VZUA 1FG9C 3NIDB 3WIHA 4YHOH 4N2OA 4ZFQA 1XF1A 1IEBB 3MO1B 5J9PA 3AWEA 5DQJB 2E7BA 2K6WA 4P06A 2B0SL 4HEPA 4DP6X 1NEPA 4XHQA 5E5LA 2M26A 3BLPX 4QY8A 3RWEA 3WNIA 3AM8A 3CV5A 3H2QA 1IBBA 2AMGA 2HG0A 5GGQL 3UIYA 3U2SB 1DHKA 3LRKA 4XWGH 4YSAA 1DQQA 4J2QA 3NCJH 1QPXA 4ZZKA 4NPYA 3N1MC 3VFNA 5HJBA 3LNFA 4HOWA 4L8DB 4DKAA 2H2PC 3GI8H 1S9VB 1F58L 2AJSL 2JKSA 4JGUA 1WAAE 3IAGC 4KO6A 1BZ7B 1FBIL 1KYOK 3L08A 3QAZB 4MD0A 1CD8A 5IFHH 1ZSDA 2AJ3B 5KVGH 2DY2A 4RISL 4N28A 3SJVD 3L5XL 2FHCA 4WKZB 4QR7A 1LO4H 3QB7C 1HZHH 4QF1B 5JPMC 6CGTA 4ODWB 4IJTA 3Q3GB 3WY3A 2PTTA 3CC5A 1UJ3C 2QDWA 1BFVL 1QUNB 4KTEH 4PJFB 3BT2L 4GAYB 2MSPA 3GJFB 4KRPD 2QFRA 4YDVA 3BPLC 1SHXA 3OJDB 1SMDA 1OP3K 2F7QA 2HVBA 5HDBF 1FZMA 3X12A 2P4AB 3CBKB 3WYRA 1FVEB 2H47C 4R7VA 5D6DC 4FRWA 3STZA 5J56B 3JSSA 3LH9A 2VSCA 4HX1B 4IHOA 3TVMA 1IQWL 2PYEE 3OAZK 4AQZA 3QEQE 1EZVY 4KVPA 4P4KB 3TA3B 3WELA 4YE4H 1E4XH 1AP2A 3LZFL 5E9AA 3JV0A 3KJ4B 1YDPB 1AY1H 4I5BA 4PAZA 4PJCA 1BQLH 3T0EC 1QABA 1AGCB 2NY1C 4H8HA 4NNYA 2BIOA 1NOFA 1ZHBB 4FQXD 1XF4A 1QTPA 3GSXA 1HIML 2MKLC 5DD0L 5I30H 5D1ZB 3FCGA 2A0LC 4U1LA 1RFDH 1SJEB 3U7WL 4PCYA 4YHKL 2GHZA 1ICTA 1TZOA 3AG2B 3ECQA 5FOBB 3FRPG 2GIMA 3BQVA 2E7LA 4QRPB 3UC0L 4W1TA 4UZUA 3CFIC 4Z76B 4FNUA 4AW7A 1LNUB 3IU3B 3ARGD 3E80A 1CFTA 5DD6A 2OXHA 4XBPA 5AW1B 1UWGL 1YY9D 1Z5YD 2C3XA 5GS0L 4NB7A 5K1NA 4N2DA 5TDNA 1VENA 3B2UC 4PJHB 1QFWM 1CGVA 1R4XA 3BP6B 3FT4A 2LFEA 1F6FB 3AREB 2E74C 5FLUA 4EZMA 1SVCP 3QVAA 2D03L 4XNMA 3OZ9H 2RQEA 2Y24A 2A1WL 3E7JA 3ZHLA 3CVBA 1SYVB 3QR2A 4WENB 2VLJA 4LARH 1E4WL 4FZ8L 2EADA 1B3IA 3S35H 2IH1B 2CR0A 4IIZA 2ZF9A 5E2VH 5J5EA 2YJLA 4UNIA 5CCJA 1E8XA 1IM3D 1W72B 5F1NB 2WLNA 3QQDB 2JWYA 1H3VA 4GUCA 3SE4A 5HYIA 4OT1H 3LVEA 2JFCA 3LKNB 4EE2A 4Y4HC 3R7QA 4OVVA 5A2LH 3RL2A 5EEWA 1KB9J 4M1DH 2XN9B 1A25A 3FCTB 3L5IA 2OR9H 1MG2C 1VAHA 3QUYC 5T3XD 1JAEA 4NQDD 1AHKA 5KTEH 3D85B 2ZWYA 3S5YA 2QQNL 5AENA 4TQEH 2PCYA 5JXAL 2WQAA 2VLJE 2WVVB 1ZV5A 4J4PD 4LSVL 3FO2A 4D9QD 4P59L 1VFUA 2VR7A 3HTLX 4P9HH 1JHTB 3OLDA 4M7LT 1CURA 4XNDA 1EHXA 1MVFA 2H3XC 1PZ5A 3GB7A 3QT2A 2J5LC 4K3HA 2CR6A 1FO0H 1CGTA 3SDCD 5DD3H 1FCGA 2APBA 3F7YA 2ZSWA 3FFOA 1OGAB 4A37A 3FUEA 4H1LG 4DK6A 4QTHA 3TJHD 1SN5A 2F7OA 2OBGA 1LO3H 4OLUH 2BINA 3ZDWA 3E6FB 3OGOE 3CCHA 3L3IA 2JJTC 3PWUA 1Y18B 2WMPB 4EVNA 4WTQA 2IDCA 3DX8B 5IVXB 4QXVA 1MAKA 1W6LA 3V0EA 1IIIA 2LFGA 1WD9A 1ET7A 3N04A 2B77A 2P24B 2Z8RA 2WIIB 5D7IB 3PQYD 2CD0A 2C3HA 3LXAA 1QHQA 2R51A 3MBWA 2RMNA 4FP8L 4QAMB 3MNWB 5FYJD 4GAGH 4DEPC 2IALA 4Z0XA 3ECVA 4A55A 4FEMA 3ATBA 4NKMB 2YOAA 5FKAB 5ILTH 1UACH 1KULA 4PJXE 2KI6A 1N5YH 1OLLA 1NDGA 1DBJL 3LS4L 1KJVB 3RI5F 1T80A 4OCXL 3CU1A 1JZ5A 3WIFA 2WQRA 4RGMC 3NGBC 5KBDA 3B7UX 5A6LA 2BNUA 3T4AB 1V54B 4L5FL 4PJ9C 1J5CA 1FFNB 5I1DB 3TO2B 1NGPL 3U1PA 3CX5J 3AQYA 2WJ5A 5ISZA 2H2SD 1MNUH 5AL8A 1EDQA 4NN7C 4CMMA 3LKQB 1UJTA 5J57B 4AJ0A 2K9FB 1A1NA 3ESOA 3IDJA 4EQ2A 1L6XA 2FWSA 3OVUB 1IBGL 3VWJA 1HHIA 3CFBB 3E1ZA 4HH8A 4W9ZA 5HI3C 4ERSL 5BO0D 5HVFB 3SDAC 3FAXA 1W72L 3BMVA 3FUFA 5JO5B 4CSZA 4MQ7A 2BX5A 1FVDA 5EU4A 2AITA 4PTTB 5GRVL 1T89C 4MYWB 4U7MA 3CSGA 5FDWA 5A2JH 3B56A 1BF8A 5C0AE 4HKBA 3WS6A 4GKNB 1CDUA 3EOAA 2P46B 4TNVF 3KPOA 3TBSB 2WLKA 2CUIA 4W9JC 3IDGA 4LE8A 4YIQB 5AFAA 4JG0H 4JRXD 2UY6B 1ZHNA 2L7UA 3PXLA 4B6ZA 5T3ZE 5IQ7H 4NN5B 3MRGA 3TH4T 3T6WA 3EYVA 5ISZE 3CZNA 1GZPA 4YSQA 2NNXA 5IHBA 1QRKA 3EJCA 1KCRL 1B2YA 3QPXL 3MUGB 4OIFA 1U4EA 4WWKD 5EZJB 2ATKB 4ETQB 1KDIA 1NGZA 5D5MF 3CLFL 4FG6D 4KNSA 4AY0A 1DBAH 4GYBA 3WMPA 1U8KA 4WFEE 2ZUWA 3VH8G 1XCQB 2PTUA 2NLJA 4L0YA 4WSGA 2YD7A 1AACA 3ISWA 1HEZA 4XMLH 3G3LA 3M1BA 5I66B 3UPCA 3MBED 4YEFA 2AK4D 2WXRA 4TNFA 3O2DH 3MLTB 4FADA 3BLBA 4HT1H 4OFQA 5EUOA 3DNKA 2WWOA 2ESVB 5A16A 3NCJL 1OP4A 4NUMA 1W15A 3RDTB 4BBWA 2V9RA 3SO5A 3RHWK 3HCVA 3LN4A 3GI8L 3GMNB 3GSRB 3R4DA 1I1AB 4JFPB 1IEHA 2P8PB 2ZAGA 5D1QC 2KMWA 2ZD0A 2XWJB 1XBDA 5IFHL 4RX4D 5CILL 5KVGL 1CZ8H 4A6YH 1CK0H 2P28B 1EFXB 5HYJD 1LO4L 1Q72L 5I6XB 2X28A 3QUZD 4LZKA 4Y16B 5E56A 2IPTL 4PP1D 5JIDA 1H9VA 3QYMA 4PG9A 1ZANH 1QI5A 4F5CA 5KZCD 2XKUA 1CTOA 2Y1VA 3O9WB 3WN5A 3RIFK 1DL7H 3C5ZA 3D39B 4P05A 4H25B 4YHYC 4K4KA 1U2YA 3QXDA 2NNCA 1N26A 2WCPA 3PWPD 4LLQA 1KWGA 4DP4X 1X5ZA 5C86A 1EAJA 2X4OA 2YGVA 2AVFA 1U8QB 4G6AC 1ASPA 2B1AH 2AV7A 2VN5A 3K5RA 4GKLA 3S8GB 4FCAA 3CFEA 1FH5H 5FHBH 5EUOE 4KQ4H 4FF9A 4R4FH 4RRPG 5BRZE 3CIQA 3T9WA 2R1WB 2O6CA 4GRLD 4HGMA 2DDQH 4ZXBD 4YE4L 2CO6A 1U8IB 1WT5C 2LAAA 1AY1L 1RUQH 4M61B 5TE6L 5TGBA 3RWCB 2VM3A 4YVNA 3QZBA 1T0MB 1D5IH 3ZMRA 3JWNE 5G5DB 4G5AA 4C59B 2X1OA 2FUTA 3AUWB 1DVYA 2XOTA 2AABL 3MRLB 4Z7UF 3H0TA 2BIHA 5DVMA 5HJDA 1ACXA 3OX8A 5DHVB 4U3SB 5D7JC 5H8DA 1MCKA 3SQOH 5EOCJ 4F5CE 1KEML 4NJ9L 1RFDL 4XX1E 3BEWB 1E9OB 4JFOB 4FNRA 1TNNA 3TF7C 3TO4B 3O8XA 5MI0C 5CHNB 1JOIA 1NUNB 5FYKH 1FZJA 1T7YA 3QG6A 1XH2A 1SXCA 3B9DA 3KWWB 4BZ2A 2B39A 3FCSB 1KXHA 5L8KB 1IGCH 3ROLA 4UDTA 3K2MC 5J1AA 2HMIC 3IWUA 3NCWA 5EU7E 2OMWA 3QG7H 1FL6A 1NGXA 3CGTA 4RWYH 4FQPA 2XWBB 1B4LA 1BXAA 1Z2KA 2XI9A 4HXAH 3KWTA 2HVKB 3RWJB 4R7XA 3JZ7A 2BP0A 1ONQB 2Z92A 1WS8A 5CZXC 4IRSC 3OKNA 1QSZA 2IAND 2X42A 3BUYA 3VGAC 1YYML 3NTCH 4UMGA 2VOTA 3HC3H 1LGVA 3PHQB 3S4SG 1QEXA 3QHZH 3S35L 3MLPA 4JVWA 1W0WA 5E2VL 3CN4A 3RZCD 4LCWD 2GTWA 2F7RA 5MERA 3MX0B 2QHLA 3IF1B 4APQB 3PAUA 2VZ3A 5CLYA 5DLMH 3KPNA 4NENA 1FHNA 3V5DA 2R1YB 2AQPA 3ARBA 3FO1B 3VRLF 4ZFOA 3T1WA 1SYSB 2F08A 4CDHA 3TT1H 3C6EA 1RMFH 4J7RA 1MH5B 4DGVH 3FKUS 4S1DC 4MVBC 3GWJA 5DS8A 5LAPA 2G5BB 5DEZA 1NAKH 2F1EA 4KJQC 4M1DL 4ZAKC 1N64H 1PD0A 3TBWA 1F3DH 1RZ8A 2DQHH 2VRAA 1Z9OA 4ALAH 1E3XA 1KGWA 1S9YB 1ULVA 4F3FB 1HH6A 3LRGA 1JTPA 5KTEL 4ADJA 3P9LB 1Z3RA 3QJHB 2X0UA 4TQEL 1I1YB 3IDIB 2IDUA 5LWYH 3MZGB 1TO5A 3R06A 2Q8AL 2VAJA 2W95A 1O7DC 1SDYA 3IPBA 2V5MA 1UXMA 3EZ8A 2LV4A 4P9HL 4Q0XH 5E1AB 3V0VB 4PRIE 2WXNA 1LK3H 5FV1L 3WFCH 4AYFB 3I3DA 3FH5A 4I3SH 3ARRA 5ICYB 3K46A 4CC4A 2DL9A 5DD3L 3UBXG 4HFUL 1BEYH 3PABB 1KJ2B 5IV2B 1DQJB 1DJSA 4HWZA 1S7QA 3OAUH 1MCLA 4OLUL 3CHOA 5BS0B 4QYOB 1B4RA 1TITA 3EO0A 4FQ1H 3WEAA 4AXWB 1KMGA 4MXWH 2P7TA 2X70A 2ZXEB 3L1OH 3MYJB 3QNXB 1GZQB 2CO1A 4I48A 5CD3B 5PCYA 3FBKA 4N1CA 1BZQK 2Z4QA 3ARSA 1DSFL 2A7BA 2DIEA 3L3KB 3QZLA 5C07D 2OMTA 3B7RL 2ZXCA 5KYUB 4JM0A 4KXCA 2A9NL 2FWUA 4YX2L 1G1CA 4P2RD 1FNGB 2JKWA 4OFYD 4NQEA 6TAAA 5ILTL 1DVFA 5DRXA 3PL6C 1FRGH 4Y4KD 4NI6A 3K6DA 2F8XC 2V8LA 1KBGH 3NA4A 2VRQA 4B9YA 1UH3A 1MI5B 4NBYB 2XWEA 1BVLA 4RGND 5F93C 3CPLA 1RSFA 1OGTA 4QHNA 1MKFA 3S96A 4BSVA 4L4VA 1JWUB 3VXSB 2YPLB 4EUPG 2D7TH 4HULB 2Z4TA 3LHPL 4EDWH 2I27N 2PO6A 2A9AA 2VLRB 3TN0D 5C0CA 2JMRA 1GA2A 3QC5X 4MCYA 1BQKA 2FB4H 4MRCA 2AI0L 1X5JA 2O93L 2BFVL 5IP4A 5K9OA 1F45A 4V33A 1JRHH 2EIDA 2P5EB 4UQ9A 2B08A 4G9FA 5AAMC 2AJVH 2FZ3A 2BCKB 5TFSH 1RUMH 1D6EA 3WCYA 4PD4J 4PJEB 4TQIA 5IUCA 5AUMA 2I9TA 4NQEE 3SY0A 2NY3B 2OSLB 2IOIA 3H7BA 2WXKA 3GM0A 3VD4A 4BM7A 2Q6WA 2QDVA 1JNNL 2BIQA 1XGPA 1NM4A 3JBG7 2AK1H 2ILLA 4X5WA 1ZA3A 3KPRA 4RMRA 4YPGB 1WAAF 1YEEH 1YY8A 4CC0A 3VI4A 3FU5A 4Z78B 4NKDA 3ARGC 5GGTH 1S7UA 3QR1A 5JOPD 3BZEB 4UM9B 4M6MH 5C0CE 2NMSA 4DCQB 5E1HB 4M7LH 1UM6H 4PJDF 1UOLA 2B20A 3C60B 4GY4A 4AGMA 4UIMB 1OKEA 2APFA 3FQTA 1DUYB 4JZOB 4G9FE 4XNZC 3QZMA 1QHOA 5EIIA 4DW2H 4JDZB 3FSVA 3NSJA 2VXVH 5HDOA 4UAOC 1VGEH 4PP2B 1QTYT 3B8YA 5I73C 1QBLH 3SZ6A 1NPNA 3O2DL 3QORA 4AYBA 3J27A 2HP4A 3MRDA 4XOCA 5J1SC 1YHPA 3VE0A 1Z6JT 1HHJB 3ZOAA 1R3LA 1CL7H 4PMEA 1SNRA 4A63A 4WFGE 4EKJA 1JZHA 3VX0A 5F7UA 2PN5A 4M1CD 1HILB 1UXSA 3HPLB 5E2JA 4OGZA 1SGKA 3KPSA 4A6YL 5I2IB 1XGRB 1SJXA 1WIUA 4P49A 1OP9A 4JFDD 3QYNA 2B4CL 4HSAC 5HHPA 1BIHA 1VERA 1BIIA 1PG7H 4GG8B 2HFEB 5DJ0B 3VI3B 3PGCB 1JMXA 1F6AA 2X4NA 3R4RA 3RY4A 2BY1A 4NHUA 4MDIB 3U36B 2YUWA 1JZ7A 3W2DL 4N8UA 5J12C 5DR5L 1VFOA 2BSSA 1JGIA 3L3DB 3QCVH 3FT0A 5K5YA 4U31A 2K7PA 5D1XB 3WG7B 4G8IA 3LKPB 1XGYH 4X4YB 5HHNA 2ICWJ 2VN4A 2B1AL 3PIQB 2JELH 3GMLA 4NN6C 1LEIB 1NCTA 4BUHA 3S98A 5CS7A 1PW3A 5FHBL 4KQ4L 3LKOB 4R4FL 1NCJA 4LVNB 4RMWA 3L4WA 4H1LB 2DDQL 2FHBA 2WXPA 4X4XA 3MROA 5J0BA 3TJHC 3CFJA 3X17A 1A3LH 1RUQL 2FJUB 2HYMA 3BEVA 1DJYA 4PRNA 4XCEB 3SY6A 4R2GB 3L8QA 4OVUA 4K8RL 3X1EA 1MVUA 1XH0A 4EIBA 5SWZA 3IPFA 2QLVB 3SQOL 3ZTCC 4JDVA 5DRWB 1QVOA 4D8OA 4ESKA 5FO7A 2RFXA 2X4UB 4ZUSA 1RI8A 4NO2A 2UWEF 4DVBA 2AZAA 4GBXA 5HI4D 1FNEB 3LCYA 3ZDXE 1ITCA 1LDSA 5FYKL 2DH3A 3U6XS 2OTUA 3V52H 2FJSA 2OSXA 2IH9A 2AXGA 2KYIA 2DLIA 1CFSB 1UM5H 1KF9B 4PD4K 1OALA 3ENEA 4L8BA 2J6EL 3QG7L 1WZAA 4QRUA 3UADA 1PVHA 3OMAB 4GEIA 1OLZA 3D4ZA 5FF6B 4JK0D 3IKKA 4HXAL 3ZMEA 2VN6A 1QWNA 1M7DB 5L4IA 3U4EB 3BP7A 3IBOA 1XB3A 5BZDA 1PQZA 4JDTH 4UV7L 4S2SB 4DJMA 2MTAA 3HC3L 2J1ZA 2AVGA 4FLQA 3UAEA 3NCYS 1ID2A 4QHMA 4MJHA 3MC0A 1FYTB 4NHCL 2FEDD 3FHEA 4QRSA 4X0KB 3UZVB 2ORBH 2PXYA 4PWKA 1TVDA 3B5GA 1MRFL 1OAQH 5DLML 3TP4A 4I9WE 1OY3B 2UXGA 4TXVB 5J4MA 2CIIA 1P7BA 3IETB 5ESVB 2B9AA 5CJBA 1RZIA 3IJSA 1YUHA 2EDYA 3ZE2B 3TT1L 1PBYA 1RMFL 2DQUH 4F2MA 2EEDA 1PZBA 4OAWA 1OGSA 4JZJC 2ZUVA 2EH7H 1NAKL 4BCZA 5I19L 4UT6H 2WLHA 1GJUA 3UIZA 4LSRH 4N3UA 3CN0A 5IHHA 4AMWA 3O2VH 3QBTB 3TVMD 3DYOA 4ALAL 2KC0A 2IQAA 2V3EA 3HS9A 4M56A 3ARZA 3MRFB 3JTSB 4LEBA 1CF1A 4DQOH 5ICXA 4WW1A 4OKDA 1TQTA 3X3GH 5C0GB 2AS5M 4PJXF 4L0ZA 2ZOKB 4N2KA 1MLCA 1R3JA 4ZK8A 1LK3L 1L7TL 4Y5YC 3WFCL 2QQQA 3BKYH 4JEGB 2ZXGA 3EJTA 4KZCA 5F1IB 3P77B 2QSTA 2XTLA 2FJHB 2HPOA 2B1OA 3VH8B 2DYPA 2QJDA 3L5HA 4FL4C 1R24A 2N59A 4LDLB 4IMLB 5T1KA 5D93C 3I75B 2DQFB 1OT1A 3LX9A 3GK8L 3OAUL 3S5ZA 2QBWA 2W65B 5IJVB 3U30B 3EHBC 4OD3L 5I17A 3CVHA 4FQ1L 4H20H 1JXDA 4A2GA 5IQNA 3VFSA 4HFWA 3MAWA 2Z35A 3U6RA 1XF5A 4WQOA 5HPOA 1P2CB 2EXSA 5BV7C 2OS7A 3B3IA 4WKXA 3HB3C 5DJ2B 2DQTL 4P46A 1TTAA 4XPGH 4NUJA 2F74B 3CZGA 1G87A 5INDA 4OM0L 4HJJH 4NBZB 1WHOA 1NMCB 2H32H 3IE4A 4FZEH 3QUZC 3EH4B 3WDHA 3NZHH 1W0VB 2VLJD 5FAAA 3SE9H 1N6QL 2IGFH 4FLHA 1S9KC 1FRGL 1J05B 2HKFH 3OKOB 4P5TB 4UT9H 1Z9SA 4L37B 3QNZB 3OHXA 1NCHA 1GC1L 4MAZA 4ANKA 4TLSA 5LJYH 2J3SA 1LO5A 3NCEB 4EUPH 1TZHA 3V0IA 2VSMB 2D7TL 1G5AA 1C08A 4OZGE 4W4OA 4EDWL 3L3JA 5E8OB 3HAEG 3NJXA 3QYCA 3UTSE 4N26A 2Y7LA 3F00A 4JAMA 1NCWH 2GSGB 2QPDB 2VUKA 4JQVA 2FGZA 1IARB 4YO0A 4BEIA 5IJKA 3SKUD 4LLYB 4GRLC 5DURD 4LBAA 3MLSH 1LE5A 4J3UA 1JRHL 5T1MB 1VKXA 1CPUA 2GJRA 3B9AA 5I6OA 2YZ8A 5TFSL 5IMLA 1U8NB 2NXZD 3FW6A 3X2QB 1A9EA 2GK0B 1NCOA 1UEYA 3DTXA 1SN2A 3SKNA 5L2KB 4PQXA 2X9ZA 4P3CH 2HG5B 1A02N 5TPWH 3AZUA 2YUVA 3V5HA 4ELMB 1J8HE 2YMXL 3A67L 4G8EA 2R29H 3D18A 4HEMA 1EAQA 3UTTE 5JDSB 5DJYB 1UWFA 2R59A 3MRIA 5EOTA 4Y2OB 5KS9A 2HN7B 1UASA 2XJKA 5DJCA 1AZVA 4FMFA 2C4XA 2NYYC 2ZXDA 3GT6A 3ZK0A 4AIEA 4PB0L 3MFFA 3WXVL 1YEEL 3GBDA 4U1KB 3NBNA 1WWBX 2QT6A 1JFQL 1GIGL 1BVKB 5GGTL 4GNKB 5TDPA 3OB0K 4M1GL 4KNQA 3DRQB 3JQOB 4ZOEA 1WBYA 3B34A 5DC0A 3F5WB 1UM6L 4HDIA 2W07A 4X6BB 4ZNEE 1BM3H 5DZLA 3LN5A 3MV11 4Q2ZA 3BSZL 4DW2L 3QIWB 3V55A 1I8IB 1WFTA 4PY8J 2VXVL 2OA9A 4XCCH 1F4HA 3S4SB 4RAVA 1FE8H 3K81A 4OU3A 4AL8H 1VGEL 4L3EA 5BUGA 2ZPKH 3O4OC 3TYFB 1QBLL 2CPUA 3RZCC 3NA9H 1UVQB 1IEBA 4Y5XC 3T5WA 3QRFM 2ADIB 5DQJA 3L4VA 1AR2A 3FUJA 1IJNA 1ID5I 4ODVL 2I69A 3AT9A 2XIBA 3ZT6A 3EOBB 2OCCB 3DX0A 4U33A 4U1JB 5F2FA 3U2SA 1NFDF 2C34A 4Z7NE 3UBGA 3LQMA 4AIOA 3DX6B 2UY7A 1HSAB 5T3ZD 2EUXA 4GO8A 4L8DA 1G6RA 3HUJE 5ISZD 5ALCH 1S9VA 4LEEA 2KZKA 4MJ4A 1L9TA 1OTUD 4LKXB 1PG7L 1BZ7A 3HNVH 4IEFB 1KN4L 4PJ8B 1PYWB 3AADB 3GO1H 4WKZA 2HZHA 3K2KA 4XN1A 3VWJD 3QCVL 1Q0XH 4WW2B 1X5IA 5FS5A 2ITCB 3Q3GA 3NIDE 1XGYL 4WFED 2OZ4H 3QJVB 4PJAE 3KLHC 1QUNA 3IWVA 4PJFA 3WKMH 3GJFA 3QQXA 3UBXB 2MPAH 3FC8A 4YDIL 3SYQA 1N9PA 1XAKA 4GUPB 2KS0A 2XV2A 3Q6GH 3S8WA 3ARDC 5B3SB 4UOJA 1JZ2A 2BW5A 5B39G 1TLKA 1A3LL 4Q9CA 3EUUA 3BPLB 4DOHB 3H56A 3GI9H 4HX1A 3LPWA 2YGQA 2YLKA 4MD5A 1F6LL 1P1VA 2ZUTA 3TA3A 4YR6B 5ES4B 2LU4A 3O3BB 3CDYA 3ECWA 3WTSA 1YDPA 2O4EA 4HPHA 2OMZA 2XYBA 3DC0A 1AGCA 4DVRH 5I26A 1ZHBA 3S9DB 1FFOB 2G2RB 3VVWA 2CALA 2BWIA 5K69A 2FE0A 4I8DA 3V52L 1TJIL 3T0EB 5J6GB 1UM5L 1XMEB 1UGKA 1IIKA 1R3HB 3KZ8A 3NK3A 2MEJB 2WVTA 5FOBA 1E27A 3O6FB 4QRPA 3UEQA 4IBWA 2EACA 1O5PA 1YJDH 4JRFA 4WHDA 4EUPB 1DJWA 4GXUM 4Z76A 1LNUA 3IU3A 5BRZD 4FFVD 3N1FC 4H26B 4OB5H 4B3VA 1IBZA 2CH8A 3BGFC 3AS1A 4JDTL 5GS1B 2J1KA 1WAPA 3TN0C 3MRKA 4B97A 5I6KA 3VU1A 2R4RH 3MLYH 1L0XA 3Q8BA 2WB1A 1KY7A 3HBQA 4PJHA 4ACPA 4NKIH 1VFBB 3BP6A 2ORBL 4ZW6A 3AREA 2JKLA 5IF0B 3QRGL 1QRNB 3S37L 1G43A 1SYVA 2NW2B 3CZJA 5C0JB 3ILQC 1RJLB 2JQAA 1AZRA 3GSNH 1LEGA 2CK2A