2NSQA

Crystal structure of the c2 domain of the human e3 ubiquitin-protein ligase nedd4-like protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
140
Chain Sequence
GEPVYGLSEDEGESRILRVKVVSGIDLAKKASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase NEDD4-like protein
publication title The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 23
structure length 140
sequence length 149
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2nsqA00
2ENPA 4V11A 4QJ4B 2CJSA 2DMHA 1DJWA 4ANWA 2K45A 2X38A 1E8ZA 4IHBA 4DK5A 3L08A 3PYCA 1DJXA 3R7RA 4HLEA 1E90A 3L17A 5T8IA 3GPEA 4A55A 4FHJA 4F1SA 2LHAA 2Q3XA 2FK9A 2WXHA 4LCVA 5JHBA 4J6IA 3F05A 1E7UA 3L4CA 3F00A 2CJTA 3CSTA 4WAFA 2YRBA 3PS6A 3N5AA 1HE8A 4FHKA 4GNKB 2B3RA 1W15A 2Z0UA 1TJMA 1E7VA 3ML8A 4L23A 4KZCA 2WXOA 4OVVA 2WXPA 2WXJA 4IQHA 2CHZA 4MJJA 3M7FB 3MJWA 4XE0A 3OHMB 4BGDA 1DJYA 2CHXA 1E8XA 3ML9A 1UOVA 2BWQA 2CM5A 4PS7A 2K3HA 2A4ZA 2WXLA 3L13A 3DBSA 1CJYA 2Q0ZX 4NPKA 2WXIA 5KJ7E 2CM6A 5CCHE 4HVBA 3HIZA 3PREA 4QJ5B 4KITB 4F93B 2WXGA 3PRZA 4LT7A 4KZ0A 4FJZA 4L1BA 2K4AA 1W16A 1GMIA 2KI6A 3TWYA 3ZW3A 2WXKA 3TJPA 3QR0A 2K8MA 4ICWA 4EZLA 1WFJA 4ICXA 4Y1TA 4L1LA 5H4YA 3HHMA 4JPSA 2NQ3A 2WXFA 2CHDA 3L16A 4PS8A 5G55A 4FJYA 2D8KA 1BDYA 3ENEA 2Y3AA 2FJUB 4TV3A 2ZKMX 1RSYA 3QK0A 3F04A 3KWTA 3QR1A 3KWUA 3S2AA 1BYNA 1DSYA 4BFRA 3FBKA 2UZPA 3LJ3A 3P2BA 4DNLA 1DJZA 3HN8A 3RPBA 1E8YA 4FADA 1BCIA 2ISDA 4WWNA 4TS6A 4G11A 4FLHA 3NSJA 4ANVA 4F91B 1DJIA 1QATA 4WWOA 4WWPA 4NS0A 4L2YA 4NP9A 3R7QA 3TL5A 3RDJA 4WEEA 3W57A 2ENJA 3APCA 4QAMB 3L9BA 2CHWA 3ZVVA 1E8WA 3NZSA 1DQVA 1QASA 2V4LA 3T8MA 3NZUA 3JZYA 5G2NA 4ANUA 2QZQA 2R83A 3IBEA 4EZJA 2NCEA 4QJ3B 3PFQA 4TUUA 4NPJA 5JHAA 4PS3A 2ENQA 2RD0A 2WXRA 5EDSA 2JQZA 4ANXA 3APDA 4AOFA 1RLWA 4GB9A 4URKA 5H4ZA 1RH8A 1UGKA 2EP6A 1K5WA 2A5UA 5CCGE 1DJGA 3IM1A 1YRKA 3OAWA 4LDCA 3W56A 3SD5A 1A25A 3QARA 4XX5A 3FDWA 4F92B 3CSFA 2YOAA 1UOWA 4XZ4A 3ZIMA 2NSQA 1DJHA 2WXQA 1WFMA 4FA6A 4AJWA 1V27A 3DPDA 3B7YA 5CCJA 2DMGA 2QZ5A 2WXMA 4Y1SA 4OVUA 3APFA 3QJZA 3F01A 2N1TE 4EZKA 3L54A 4FULA 3QAQA 2WXNA 1TJXA
chains in the Genus database with same CATH superfamily
4DETA 4KJPC 5AB0A 2BSDA 1A3RL 5I1IL 12E8L 4XMTA 2JKTM 2NUPB 3VFOB 5IK3B 1LHZA 3FYIB 3MYJB 3O41B 4DPCX 2KUTA 4C83B 2ITCA 2W0KA 5DWUH 1EZLA 4AQ8A 3U9PL 2R0KL 4HC1A 1J5OL 1Y1DA 2XPZA 3OC5A 4HS8H 1AH1A 1FDLL 1ACYL 1MCLA 3QB7C 5BNXD 3BQVA 4QLRA 3ELAT 4JQIA 1C12A 4AUUA 4HWZA 3SBQA 2WP3O 4PY7B 3Q8AA 5EUOA 2VLKB 3BISA 4JFHE 4QI3A 1UENA 3WFCH 1IMHC 2A74B 2PYFB 3TT3L 2A4ZA 1UXWA 3CZNA 4HZAA 4A7UA 4KZEL 4RAUB 2QT6A 4JFXA 4NRZA 4A7QA 4HH9B 4AYDC 1B0IA 2LAGB 2AXJA 3MRIB 5EUKB 5I16B 1JF5A 5AW9B 3EF4A 3SN6N 3VD9A 4P23A 2UXFA 1XD0A 4AXWB 4MMZB 2WB1A 1EMTH 3X3GH 2NYYC 5D6DA 5IVOA 3X2QB 1NFDA 5KVGL 2DMKA 3NJKA 4FZ8H 3DO3A 5D6DC 5FYKD 1G6RB 3KPLB 2VIRB 3VG0H 5I1AA 4H8PA 5IIEB 1N5YH 1CFTA 1HOCB 2OI9B 5EIIB 4OCXL 1LWRA 1P7KA 2X9ZA 1HHKB 5TDOB 2DY2A 4Z7NB 3ASOB 3NIDE 4WWID 4GSQA 4ONHB 5DD3L 1FFPA 2AEIT 2DDQL 1H0DB 3CWGA 3Q43A 1FL6A 4XN2A 3ZK0A 7TAAA 1GOHA 4FQIL 4EDWH 1I7TB 1CF8H 2VITB 3HUJE 5IESL 2CRZA 3OM3B 1DLFL 3NESA 1R75A 3D3VB 4U2ZA 4OLEA 4Z5RA 1QASA 4AEIH 1F4YH 5T5NF 4XNQB 5D1QB 4PP2A 4N4YB 2F6AA 2YPLE 3FB8A 3HBQA 1JMXA 4J1UB 3WN5A 4NKDB 4JZJA 3IFOA 5FKAB 4JZJC 3MO1B 4TMPA 3OAZK 3ULVH 3HE6B 4OLXL 2P49B 2NR6C 2P48B 4PRIA 2A4CA 3SDYH 2X53A 1KN2L 3FO9A 1IKFH 5CILH 5D8JH 1SZNA 4Y2DC 4MS8C 4DQOL 5CINL 3GSUA 5DHXB 1UUNA 1RZKC 3MTXA 1NOLA 5CMAB 3WL9B 2GT9A 4PW4A 2AZUA 3X14B 3J2PA 5KBNC 5L7XL 2CLRB 4AV0A 1GYUA 1HCYA 1ZA6B 1ZK9A 3SKJH 3DGDA 3UTTD 2RFXB 3LSOB 4WJ5A 4JRWA 2J3SA 3HHSB 1TYEB 2ZG2A 2VDPB 1ORQB 3PCYA 1EEYB 1Q9LA 3SE6A 3SYPA 1PNCA 3HZYB 3ZJAA 4AL8L 3UADA 4EAEA 3MACL 3RGBA 5HVFB 3T8XB 1TSHA 3GBNL 4FQHB 3HPLA 3LKPB 3NRPA 2DL2A 1NOFA 3IGKA 5F6IB 1FL3A 4ZFOA 1CD1A 1PZ5A 3FN3A 1SMDA 3KLAA 3ZL2A 4IU3B 2BSSA 5EU4B 1BLIA 1A5FL 3NEOA 4IQHA 1JZ4A 4BSVB 4JM4H 1JPST 4GO8A 4Z7OB 2A9NL 4AYSA 4AVHA 5IFAH 1OAKH 4GAYB 5K1VA 4M5TA 3GMLB 4LFHG 1YJDC 3WFBH 4ZS7H 3V0JA 1W0YT 1LD9B 3FUIA 1X5GA 5B1KA 2QMJA 3B2VH 5BCAA 4I1PA 1F1AA 1BFTA 4CW1B 1NGWA 1HHGA 1CICB 4NQXA 4X4MA 2BZ7A 3BP4A 2IH3B 2QKIA 2Z8WC 2Z31B 1MCWW 2H3XC 4JG1L 2QKIC 1AS6A 2HWZL 2HXAA 4LO9A 1P4IH 5DLMH 4L8CA 2VB5A 3ME0A 4Y4KA 4UU9B 4TV3A 4LP8A 4XNBA 5C0CA 4WFGE 4Y4KC 2ADIB 2YMOA 3Q6FA 2ORBH 1HNGA 3U36A 2IDFA 2Q86A 3H54A 1HHJA 4XZUA 5KSAA 1I1YA 3DHPA 4V2CB 5DD1L 3GSQA 5FYLL 2IGTA 4IOIB 1NCDL 1MCNA 2X4NA 4MAYC 1BVZA 1CE1H 1KGCD 1IM9D 4ODWA 1VAHA 5C0DB 2P8PA 3KAAA 4ELMB 2I5YL 3TBWB 1QNIA 3WIAA 5JHDA 2PW1B 3VGAB 3NJVA 4R26H 2F8OA 2QSTA 2J1KA 5KOVC 1K2DB 1GGIL 3UZEA 5IJCC 4NZRL 5JYMA 5DGRA 3OVUB 1U9KA 4FXGB 3SDCB 4BUGA 3SDDB 4RMBA 5ISZE 2DQTL 1VFAB 5I8CA 3U0PB 4PRHE 4GKNA 5FGSA 3AT8A 4J6RL 3FULA 1TQSA 4ZX3A 4OD3L 5DUPL 4RDQF 5KG9A 3RU8L 4X7DC 1FV1A 3CFUA 3NA9H 3EJQA 4BSWB 5CD5D 1SVCP 3M1BA 2W65B 5L8JB 4QRUB 3CSYA 2F7OA 5HY9B 4OCWL 1MAKA 1AE6H 1ZVSA 3BGAA 3Q8FA 1BVLA 5LAXB 2FNBA 1MQKH 3MLTB 2GCYB 1YEGH 4G42A 4GKZA 2FX7L 4XNMA 3JQOB 3MZGB 1FHNA 3ISWA 1NDGB 4GO9A 4TUOB 2I07A 4X4XA 2KLTA 4HUUB 2WVVB 2DI7A 5D7SH 3O45A 3D08A 4GRLA 1LEKB 3VMPA 4BEIA 1IC1A 2FHFA 3B3IB 2E5EA 1P2CA 3SY0B 2PPAA 2Z9TA 1MJUH 3QXAA 4K9EL 1U0QA 3FFCE 4LNRB 3D85A 1OXYA 5IW6A 5EZOH 5T1DH 5CLWA 2FSEB 5E8NB 4A7GA 1J87A 3C6SA 1XDTT 1AMYA 5C6TH 1IAOB 2QHLA 1XWVA 4AQ1C 3BKCL 4JR9H 1BYPA 2GK0A 3EH2A 5E6IC 5FWQA 1R47A 1QHOA 5C97A 5I75B 2WLIB 1QUNA 2EDJA 4ODUB 3U7YH 3HI6L 2XHNA 3FTUA 1IM3B 1KG0A 3RKPA 5E4IA 1IUZA 1ULVA 1UTDA 3MGOA 3DOSA 3ZGIA 2BS9A 2P8LA 1NBYA 2RIKA 4QXTA 1IGJB 1QI5A 4Y1AE 3NIGB 1I1RA 4APQA 4GJTB 2CMRH 5DURB 3DGGB 3KWTA 4H0HB 5I15H 1PZSA 3IFNH 2GSGA 3P2TA 1NMCC 4EJ1C 3WNJA 1YEJH 3A22A 3GDCA 3AG3B 3V0WH 5DJZA 2NQDA 4IJ3B 3E6FB 2V8MA 4OY9A 4WVRA 4F91B 3DVNA 5E5MB 3QUYC 4FQXA 2LU7A 4HIIA 3TF7C 3A3YB 2ENJA 3L3JB 3B83A 5FFLA 4CILA 2HRHA 4J4PA 4M1CD 4PJ5E 1TZIB 1ADQA 1SVZA 4C4KT 1FYTD 3DXAB 5LNGA 5SWSD 4AJVA 2XY1A 3C2SA 4J3XA 1HYRC 1PLGL 4ZYKB 1OGAD 2OTWA 3LEVH 1FJ1B 4JE4B 4ODSL 3VDAA 2HX7A 4AE0A 3DX8A 4R5VA 3ZE1E 5F3HA 1WBZA 3KWVA 3MA9H 1R17A 3Q1EA 3ULUH 1UJTA 3N06B 1KGWA 2OXGB 1KYFA 2DLHA 4P2QE 1S7XB 2V2XB 4AGQA 1KTLA 1T3FB 3CQPA 3EYOB 2G2RB 2X28A 3EUUA 3O3DB 4RESB 2IAMB 1DQLL 5ELIA 1UCBL 1XR9A 4I87A 1KPVA 1QR1B 3ZRSA 3SKOA 2Q5BA 2YZ1A 2EECA 3FFDB 3F65A 2Z35B 4OFIA 4XGZA 3BAEH 4Q97A 1JZ5A 2W9DL 2JKXA 3PG2A 4J3OG 1AO7B 2L3BA 3TPKA 1N3NA 2ZUQC 3CFEA 1XH3A 2FE0A 3OLEA 2OKMA 3RHWF 3PNRB 1J1XL 3SHSA 2YQGA 1G7PB 2JI1A 4LLDB 3RWEB 1PKQB 2QDWA 3S35X 5DMKA 3UTSD 3WNNA 5IB3A 2BX5A 1M6OB 2QVKA 2YR3A 3RWFA 5CJXA 1RI8A 1JWUB 3CDYA 4JHUA 3MRHB 2XYCA 3PDGA 4TPRL 3OJMB 1IKNA 4KTGA 3DV6B 2ZUSA 4AVJA 1TTBA 5JW4R 1JD7A 4Y2NA 1GZPA 5ACZB 1RJZA 3HUJA 3P9MB 5A7EA 1FNHA 4PJEE 5T33L 3ARZA 1JNNH 2P8MA 3VXME 1TJGL 3A4FA 3AB0C 4W9FC 2AXFA 3O2DH 4ACPA 2C3VB 1KY7A 4PJAE 3KLQA 5KOMC 3ZRCC 1OD7A 4JO4L 1P84K 1IGCH 1VERA 2Y7MA 2VN6A 5FV2A 5BZWB 4IRJD 1MVUA 1KTDB 5T1KA 5I1LA 5K9JH 3FU7B 3EFDL 1OZUA 4LLWB 3JVGC 4YPGB 1IC0A 4I8DA 4RGOH 4BE5A 4YQXL 1CMOA 4HKZB 4YAQB 3K2IA 3BRFA 5CLXA 3BSZH 1T7VA 3IU3A 2FX9L 4FJYA 1EZVY 1CL7I 1S4IA 3E8UH 5TK4A 1RSYA 3QK0A 2X7LA 4I3RL 5F88B 5EU5A 2MCG1 4GP5B 4HKBA 4OGAD 2CAKA 3GTVA 4HIJB 4ZUTB 4G8EB 5IP4A 2VZVA 5FDWA 3D0VB 1MHEA 1JFQH 2C9PA 2D7PA 2ZP9A 4JCMA 4X99A 5C07E 4PMEA 4PUBL 3CVHB 1JK9A 2M8XA 4M1DH 1MOEA 3CN0A 4FYTA 3DECA 2VH5L 1LO3L 5IJVA 1PG7H 1RUPL 1GOFA 2WQWA 3PXHA 4O58H 1S7SB 2XV6B 4XCNA 3CH8A 2ICEA 5HTSA 2XFXB 4L1HA 5E1AA 2EIMB 2ICEC 3GSNL 1GZHA 4PS4L 2DKUA 4K94H 2OSXA 5ENWB 2P9RA 5E4AA 1LO2H 1ITBB 2NY3C 3S88H 4I18C 3BUTA 3NIDF 4UUJB 2HPOA 5DHVB 5IBTL 1L7TL 1TVHB 4DZBA 3DX2A 2JQMA 1KBGH 3EHBD 3UAEA 4NENA 4OFPA 3VXUE 5I76A 4W93A 2WPGA 3HUJF 5FB8A 5C6WH 4DPAX 4S2SA 4CNIB 5E6SB 2NT0A 1TJHL 1DE4B 1IL1B 4NBZB 5TDNA 3RURA 3G9VA 3KZ8A 3U46B 1D6EA 4MWFB 1ETB1 4OSUH 2QR0A 2ZONA 4KVCH 2FJHB 1FO0H 3VFTA 1YEKH 3US9A 4H20H 3RL1A 1KIPB 3QDGD 1U92B 1H9VA 4I2XE 4WJG3 1PBYA 5IVXA 3EH3B 4GS7C 4HCRA 4PLKD 4GUOA 2RGSA 3CFJA 2ZXCA 4FP8H 2VLRE 1U42A 4RMWA 1DZ0A 2IOMA 1SXSA 2YO3A 3O9WB 4R7DB 3W39B 1HEZB 1A7PH 3ZT7A 1A7NL 1TZGH 2XDHA 2D3JA 3NABL 4OM1L 4O2CA 3N42F 1SBSL 1I7RB 4KC3B 1A7BA 1RZ8B 3B34A 3AS0A 2NXZB 1S9VA 2CIKB 2RH0A 2A83B 2CO6A 5LG1A 2DIBA 2XA3A 1NINA 4HZLB 3MLYH 1EANA 1IIKA 3ZKQD 3NTCH 3ARRA 2VE6A 4HUVA 1S7UB 4RFOH 1OB0A 3PNWA 3NAAL 4DAGL 3HRZA 5ISZA 2H1XA 4MVBD 4NC2B 1CF1A 3T77B 4GRWH 4MKMA 1IE5A 2Y3NA 2C9QA 3E1F1 1XL4A 3NSDA 1K8DA 2D8KA 4AM0Q 2D2CC 4R4FH 2F53B 4H1LH 4YSPA 3CLFL 3GRWA 2APVA 3LKRB 4DH2A 1PSKH 1XCTA 3SGKC 3OWEA 5B7FA 4Q6YA 1A1OB 4LP4A 5DEFA 4PJBE 3WTVA 3BT2L 5E5RB 4KJWD 4G6JH 2FUTA 3NCCB 5HVHB 5E99L 2NRDA 1H6UA 1A7RL 4NQUA 2E75C 4ZS6C 4UDUB 4NNPH 3DBXA 3D07A 1AYRA 2NQCA 3BVXA 4NYLB 3LVTA 4GXVL 2KYIA 4ANUA 3Q05A 1TJIL 2BPBA 4RRPG 4LOFA 2R8SH 1CFBA 1G7JA 1YNKH 3QJRB 1YEFL 4OZHB 1N4XL 3FFCA 4P2OB 4KKPA 4HIHB 1EO7A 5LN8A 4XRCB 5CJQH 1RH8A 2Q8BL 3F64A 4O5LL 4FXKB 4NP4L 3KNBB 2ODIA 2IH9A 1U8MB 2EC9T 1RZJH 3LZFH 3RTQA 1ZANH 2R0WH 2FJFA 4MBRA 43C9B 1GZQB 4RFEA 3I75B 2LVCA 1CYXA 4YIQB 1PJ9A 1AHWB 4EVNB 2AVGA 2AEWA 4HWUA 1I1AD 4OGYH 1AXTH 4NQDB 1TJXA 1N9PA 2FECI 4Y8DC 1RZFH 2VLJB 4OCLC 4R5XA 5AKVA 4ACTA 4UM9B 3AY2A 1RULH 1YAIA 4JFFB 4Y1AA 4IYKA 3LN5B 5K9QG 2DV6A 5JTWA 4HIEA 3HAEG 3P40A 4G6AC 1LDPH 4GG8B 3BH8B 4V33A 4H88H 5CBAB 3ZT5A 5ALBL 4JLRA 2P7TA 4DW2L 1EAJA 1QSEB 5GSRA 1RUAH 5EO9A 3RIFF 4JFQA 2IFFL 1FZKA 2AJVL 3PU7A 4U6XA 2UZYA 3FCTB 4JDZA 2AXHA 4KJQD 2BSTB 1UACH 4MMYB 5IV2B 4WI8A 3OX8B 2VDKL 2A9DA 3FQYA 4LLYB 3M7FB 4XPAL 4PJ5A 5FKPB 3ZKMC 1BQKA 3KPNA 2DWXA 4AYGA 5C0IB 2VW6A 1G84A 3IKCB 3P4NB 3TBCA 2OMZA 1OL0A 3DHJA 2P1YA 1HSAB 4P2QA 3FHQA 4M62L 4F9LA 1IC5L 2NY4B 1D5RA 4N2FA 4FTVE 4ZRGA 4QAWA 1DANU 3FUKA 3NJGA 5GJSH 1UM6L 2A7BA 1ORSA 1IGIL 3VXSB 3DI3B 5IVZA 2APFA 2VABB 2ESVB 4ZNEA 3INOA 3U6RB 3ECVA 3LV3B 5I28A 2ISDA 4LCYA 1T2QH 3QDME 4I89A 4P3CH 5IKCA 3BUQA 5K1JA 5AKTA 3GXUB 2OMYB 4LKXA 1T04A 1QQDB 4YZWA 3BRDA 4BFFA 3TTSA 2B1OA 2D31B 4ZUSB 1J12A 3D12B 4QUOA 1WAAE 5BOJA 2BWDA 4AKOA 5HHOB 1NC4B 4UIKL 5IB5A 1KJ2H 3G6JE 2AJUL 4PLJD 5GGVY 1ZDSA 4NUGL 5KYYB 2NY7L 1IAKB 4M56A 4YHYC 3OBAA 3OHXA 3SKMA 4WGWB 3VD3A 2A9BA 3VFRA 5DF0A 2YMXL 3NJJA 4FQLH 4PJEA 5JPNA 4U1HA 2CHNA 3VXMA 5MEQB 3QORA 4A6YL 5F96L 1WF5A 1MCBA 4F8OA 4PJAA 1PKOA 5DS2A 3UGXA 1A7QH 4LSUL 3LKOB 3BN9D 3T3PE 5AEAA 1E27B 3PL6B 4LQ1A 3OF6A 1CCZA 2EAEA 5K5YA 1PW3A 3X17A 1L0YA 1C08A 2QTVA 4DO6A 3GRGA 2ZNWA 4XMVA 5F7BA 2MCMA 4F7PB 5CCKL 1YMHA 4CJ0A 3MLZH 3ZE1F 3MGTB 1JTOA 4X7FC 2H3NB 2VDNL 3WUWA 1O5PA 2JB5H 3BQUA 4JPKL 4W4NA 3MJ8A 4K7PY 3S35L 3BQUC 4I4WB 4L3EB 1XF1A 4QKTA 3WE1A 1DBML 1RY7B 1L9OA 5C07A 1K4DA 4IRZA 2P47B 2EABA 1P5VA 4TM9A 5GS0C 1U8LA 5K1NA 3CHPA 3QC6X 3UROR 2OQJA 4UMSA 3UTQA 4BINA 1T1WA 5DRWA 1F90L 1T6WA 4IKIA 3DO4A 4YSOA 1IQWL 4QJ5B 4YHNB 1ZWIB 3EFFB 3QIBA 1JHLH 3WE6A 4XP4L 2F5BH 4A1RA 5HDBE 1AOHA 3D2TA 3RWCA 4NN5C 1LE5A 4G71B 4HGMA 3ZQ9A 1JHKL 3IRZA 4XO8A 5F2FA 1FF5A 3B9KD 2E8YA 4QHKI 3RIAF 3ZW3A 2IXQA 4NAQA 3LNIA 2YXFA 2Q1EA 3BXNA 3ZL4H 3CNKA 3DUHA 1KGIA 3BPNC 2IBZX 1JK8B 2NY6B 3BUBA 5JHLH 3MRLA 3RQ3A 4NZTL 2OFQA 1SFHA 4P57A 3G5YB 1S8DA 3L5JA 2RACA 4PJEF 1V7NL 3SO3B 3QDJB 2NZ9C 3QO0A 3ARBC 4JPQA 2NY5L 5C09D 1BECA 1FYHB 3OZKA 3VMOA 3V5KA 3WYRA 5I1GH 1E3ZA 1UJ3A 1I7UA 1XGPB 4JUSA 4O51B 1AQ8A 1BF5A 5I1EL 3CFCL 4I2XA 1SHMA 2AJYL 3AREA 3D1MC 4XVUD 2WB7A 4OIIL 4FYSA 3RDTD 2VLRA 1R46A 3KW8A 2WHVA 4JKWA 2RQ8A 5KSUB 4KTDL 2J20A 1V8HA 1RU9L 1Q72H 3DHMA 4F58H 4Z7VA 3AQZA 3GFUA 2H41A 2A38A 5E56A 2A5UA 1NPJA 3F5WB 4BFKA 4I77L 4F15B 3EAKA 4PRNA 5A2FA 1J9TA 3GEFA 1JF1B 2DIAA 3MSPA 2FATL 1R0AH 1A6AA 3T65B 4R90L 2PWEA 2PXYB 4DZ8B 1YYCA 4YS4A 4AC2A 5C0BD 4UQCA 1UGNA 4M5YH 5K39B 5IQ9B 4U7SA 3HLKA 1CVSC 3SE8L 1CXLA 2YBRA 1I1AC 1QKZL 5HYFA 5J3HD 3C6EA 3B8YA 2L0DA 2R0LL 4UF7C 3QW9A 4WI5A 5I74C 4E9RA 4GSDL 3MUUA 3BCFA 1B4JH 4P5TB 1LLAA 3DUUA 2K3TA 2VDOL 3OQRA 3ZZSA 5C9KA 5JIMA 4IOFD 5DQDL 2AITA 1KPRB 5JA9A 2HT4C 2ZJSL 2FT6A 1HN1A 5DJYA 1MQ8A 1U8HA 3MRPB 1N64H 2DQJH 2P5WB 4KK6D 4PJBA 4QXGL 4R7XA 2NMSA 5GPRA 3RLSA 1BEXA 5J8OA 4MGXA 2J8UE 5DC9B 4FG2A 1UKTA 2XWJB 1RV6X 3AM8C 3WUZA 2K7PA 1E8XA 5IMMA 3U0TA 4DT2A 2HJFB 4PTUA 4U1KA 2W1NA 3GBDA 4JFZL 1TMQA 4ABQA 3PREA 4TVUA 5F1OB 5I1HL 1YQVH 1NANI 3FQTA 2YKLH 4CMHB 2MPVA 1TQBC 1J8RA 4CU7A 4WFHE 1N6QH 2F5AH 4LSVL 4Q4IA 1JYNA 3RWJA 3V6BR 2K6YA 1MNUL 2WP3T 3QWRA 1E5UI 4WUUB 5EBLA 3TJPA 2WIMA 3ETBJ 5E0FA 4E5XA 4M5ZH 4HWEL 3KPMA 4JM0A 2Q76A 1IAII 4ILDA 2DWEB 4LRNH 4H5SA 4OZGE 2AEPL 2IGFL 4E0RB 2ZUTA 1DSYA 4J2QA 5FA3A 2XNAA 1BVOA 3TZVA 4LCWA 3F6IA 1LXMA 1P6WA 3G6AA 2ZWKA 2IH1B 2ZOUA 4G1MA 4XPTL 4L8SA 3D50A 4JN1H 5AW2B 5D2LE 1FSKC 1L7IH 4NP9A 4FNSA 1DVFD 2JLLA 3B2XA 5D2NE 4X4KA 3QNXB 1BQLH 5E2JA 3G5VA 5FGCB 4UT6A 4LGRB 1Z66A 2H45A 2XFGB 4PW3A 5JQ6L 3VXQA 2WAHA 2IDUA 4Q9QL 1I75A 3ISRA 2QBWA 3MLWH 3D6GA 1ZA3A 4NT6A 2BVQB 1W0WB 4IMLA 1MJ8L 2WZ5A 1HXYA 2JCCF 3HS9A 4L2LA 4PR5B 2D0FA 3GEWB 4H25A 3H2PA 4F2ME 4PJBF 3OKNA 2X2UA 3DLQR 1LEIB 5TFSH 3PWVB 5DS8A 3IJYB 3BHBB 2VR9A 4BH8B 3BPOB 1BIHA 2ZCKL 3CFBB 5DA4A 3SJVE 4Y4FA 3UZQA 4JS7A 4L3CA 5IVNA 1WT5A 2P43B 3UBGA 4X6CA 4XN5A 3BN9C 4D9RD 3GMRB 4NI6A 2QHRL 3IMRA 4ZAKD 1U3HD 5FPIA 1P9MA 1KC5H 1SJEB 1W6WA 5D7LD 3U4BH 1D5BA 3GMMA 3PWPE 4FTVA 3U0WH 5BV7B 1DO6A 3TNMB 5HVWA 2OYLA 5IFJB 4QT5A 1NC2A 1RFDH 3WTWA 3RUGB 3PS6A 1IGMH 4QGTA 4IS6B 4WWKD 2BP8A 4IHOB 4V2BA 2YBGA 1A6WH 4NXKA 1NM9A 2X4UA 1RUQL 4LEXL 4Z7QB 3R0NA 1IC7H 3KL3A 1IEBA 1AGBB 1U8PB 2AK1H 3NFNB 3EO9L 3MUY1 2QGDA 3TC9A 1WAAA 2J5LB 4CU8A 2K3HA 4N0YL 4U1LA 3VXTB 5C8JA 5I66B 2KBGA 4Z77A 2VMCA 3LOWA 5JMOC 2J88L 2Y36L 4QHLA 1G9NL 4UQ9A 1GC1C 3G6JA 1OCCB 5BZDB 5E4EB 1FO0B 3OMIB 3WY3A 4ZTPH 2QSVA 1BXVA 1YY9D 1B2YA 4WI0A 1GGTA 3QRGL 5HJBA 1XO8A 3STLB 5HXMA 1GMIA 2J1WA 1FG9C 3UJJH 3NJMA 1RZGA 3WJLC 4BQ9A 3H7BA 3O2WH 5ITFB 4R3SA 3DUSB 2CGZA 1BJ1H 2EH7L 3RKDD 5AWNH 5GGUA 1BYNA 2CIIB 4R2GD 1HCFX 5HGDA 2EEFA 4QDGA 5A2KH 3HN8A 1ZTXE 3LNEA 5KYXA 4I48B 4B9IA 1KPUA 3U1PA 4YSSA 3RWIB 2BH0A 3I9PA 3W9EB 5ILTH 5H94A 3BKML 4CKQA 4FABH 1QOKA 2EVHA 2WVTA 4YLQT 3C09C 4EI5B 4TUJA 4KROD 1CDJA 2GSIB 3ZVVA 5B39A 1A3RH 5I1IH 2QMKA 12E8H 4XVUC 5MEPB 3RDTC 1OSEA 3HG1D 4J3OH 4MB3A 3UC2A 4AIEA 1MG3C 3EGXB 4K0OA 4DVRL 2JB6A 4WF7A 2VXUL 2WN3A 1J9QA 4W9CC 5CLYA 3GHEL 4JRXB 4K3GA 1QPKA 3H9HB 1A21A 4JPVL 4DESA 1CT8A 3O4OB 2VZ3A 4H1LB 2ZOTA 4DTGH 2IOOA 3QCTL 4G9DA 3TA3B 4XX5A 1X5XA 1R5VB 1TKWB 1ZT4B 1KIQB 4Y19B 4QR7A 1PVHA 4PIBA 5HI3C 5B8CC 4V1DB 2FGWL 1D7BA 1HQRA 1KB5L 2IOIA 1BOYA 3SDAB 3TT3H 1HZHL 3GMOB 4AVIA 1WAAF 1XTMA 4KZEH 4CADA 2GJPA 5J3HC 2J71A 3AUVA 5CU5A 1QFOA 1TPXB 2YRLA 4ODTL 4IHBA 3X11B 3G6JF 4KTEH 1U21A 1S7WB 5F9WC 2ATKB 1SXBA 3HZKB 3HB3D 3X1FA 3ZO9A 4BK5A 1H8SA 2H32A 3PHOA 5JHMA 3HNSL 4X8JA 5LGJB 1S78D 3QWOA 3RZCD 4AQEA 5GQBA 4OCXH 3VW3L 5CD3A 4UYQA 4PBWD 4UAOB 2YK1L 4XMPH 4ADGA 3E6HB 5DD3H 1UT9A 5AB2A 2YMTA 4HKXA 5D9SA 2CNYA 4P4KA 4FEMA 3T3PF 3Q2VA 2Y1VA 3GLEA 1A6ZA 3GIVB 4P4KC 2V17L 1QWHA 4N90D 5IESH 4FTDA 4CMMB 5LGKA 1DVTA 2CNZA 4ZOCA 4LFHD 4P4RB 3QFJD 3HLAA 4TF4A 2E86A 1L9MA 4I0CC 2AKRB 4M61A 5GGRA 5LN4A 3JYCA 1E0OB 1IILE 4A7SA 2DWTA 1NKOA 1P4BL 4NM8L 1MI5D 4ZXBA 1R4XA 4L1SA 2CLZA 2GI0A 5I1JL 1U8NA 2FR4B 3TEZA 3F7VB 3HBZA 5F1IB 1GSMA 3D5OF 5DFVC 5BMFH 1TQUA 3QZNA 2ZKMX 3MRKB 4ZOBA 3S2AA 1JAEA 4PD4K 1IGTB 4AI7A 1DQQB 4ZUVB 1KN2H 3W2DL 2YAOA 5FK9A 2DLFL 4PP1C 4X5LA 4DQOH 3DJSA 5F6HI 4WHCA 4H8WL 1KELL 2AJZA 2X6BA 5E1GA 2Q6WA 1CN4A 1U4EA 3DPBB 3NCJH 4I9WE 2OR9L 4WKZA 3K3QA 1B0GA 2WLLB 4TQ8A 3RVXD 3MV8A 4P9ML 1BAWA 2DH3A 2PN5A 1BPLB 3ZDZB 5K33A 1EO8H 3MBXH 3LQZB 4AL8H 1E9QA 3O2VH 3P11L 3MACH 2YWYA 3HI1B 1ID5I 1WGVA 3GBNH 3GJEA 3DROB 1T5WB 3MBEA 5SX4I 1HEHC 4DGVL 1Z9OA 5F89A 3R4RA 2XVKA 4WHYH 2BNQB 3NCXA 5F8QC 3SGEH 1GIGL 3D4GA 4XZ4A 4KZDH 2ITFA 2AV1A 4EUPG 3EJZC 1Q94B 1JRHL 2OL3L 5DRZA 2A9NH 3MRJB 3EJJX 1CI5A 1Y18B 4N0RA 1UA3A 2ZWSA 1FIGL 3HS8A 3SY6A 2L8AA 2YA0A 1BZ7B 5L9DL 1AFVH 4QNPE 4ZAKC 1U3HC 2VR5A 5HHQA 1KJ2B 1U8KA 4DEUA 3GSWA 1CIUA 1N12A 1JVLA 4GFXA 2XJLA 1TT6A 3L7FA 4YN3A 4JANB 5EN3A 2JJTA 4TTDC 2HWZH 4OZGA 4LNVA 1YUHA 2JJTC 1ZLWH 5CEZD 2MEJB 3T0EB 1ZVNA 3HVDA 3WD5L 2BFVH 5HDQL 2O93L 5JMRA 3TNNA 5EU6B 1VZHA 2QTEA 3NRQA 4KUCD 5DJ2B 3ZDYB 1YNTA 2BVEA 2PW2B 2X3CA 3C6LB 1GHFL 4UZGA 3EYSL 3BVDB 3QJTB 4K71C 2CDGB 4WUKH 5D72H 2UYLB 4P46D 1CL7L 1XF2B 5DD1H 1XXFC 2VAAA 5FYLH 5IR1A 2HT3C 1NCDH 3MV01 4NQVA 5CCHE 1N70A 4AW7A 4UQBA 1QLEH 4P2RD 4KZ0A 5A16B 1YY9C 5FYKE 1A4JB 3OAYH 1QZNA 2OTUA 4ZO6A 4IDLA 5JDSA 4F2MA 2D4FA 3JTTA 2GJ6D 1TDQA 4XH2B 3QQ9D 4WI6A 5J5EA 1BBJB 4LBAA 2EH8H 1RJLB 1A8ZA 4JGMA 3VXRB 2OMUB 4TLKA 1FFNB 2DQTH 3PP3K 2J8UF 3FCBA 3RKDC 4NC1C 4K5PA 3SGDI 4OD3H 5DUPH 3DX9B 3SD2A 3IFLH 4QWWC 2BM3A 2P5ED 3VFOA 5DC4B 1OP9A 4X7SL 4D2NA 2GIYA 4PV8B 1OK0A 2EO1A 4Z3EA 4C83A 2E9WA 3DIFA 3QHFH 4WI4A 3DXAE 5C7ZA 4KROC 1XGUB 1CLZL 3CZSA 1D6VH 4H44C 3IAGC 4LVHC 3QDHA 2IMNA 3T71A 3KGSA 1CFVH 1M2VB 1AI1L 5TQ0H 4PY7A 4IBWA 5EDSA 1XIWA 2VLKA 4YDLC 3S5LG 1BX2B 3ETBF 3VACA 1GW6A 3HAEH 1OQXA 1E40A 2A74A 2VDLL 4JG5A 2JSFA 4OZGF 4B7LA 1AQHA 1JZ2A 4K9EH 2A74C 5IW1B 2PETA 4RAUA 2X09A 3KEHA 1T4KB 1RUML 1KULA 4HH9A 3L1OL 3T1WA 4KI5E 3UTTE 5EUKA 2BK8A 2JTDA 5D2LF 4U1MB 5D7KD 4ADIA 4ZOEA 2JNZA 4L37B 2EDEA 3CFTA 2X0VA 3AZUA 4AXWA 4MMZA 4UQIM 1J1OL 5AAMC 4CSPA 1AQDB 4DGUA 3W9DA 3CDGB 2VIRA 3WLWD 1NIFA 4RLDA 2F74B 1HQ4A 4OR1A 5IIEA 1HOCA 1PIGA 4NO0D 5EIIA 4YFDB 2ZG1A 4X4YB 5AW6B 4UDTB 2OI9C 1HHKA 4FYRA 4J3OD 3GRBA 1ZPLA 4QRPD 2NY2B 3A6CL 4ONHA 3QNZB 4FZEL 4KNSA 3F05A 1HAUA 1H0DA 3RZCB 2FEJA 4WSGA 3I74A 4AJYV 3PXJA 3NCWA 2VZOA 3KYAA 3OPZL 1MFUA 2Z0UA 4N6QA 2NUTB 1K5NB 2VITA 2O1AA 2E76C 2CO4A 4BM7A 1KCBA 1T0NA 3HE7C 5GIRB 3D3VA 4M8RA 1LYQA 2KPNA 2X6CA 4XNQA 2AQRA 4L8BB 4Y16B 3F7RA 4B9ZA 1CWVA 1HNYA 4XNUL 4Y89A 5D1QC 3U2IA 2VMDA 3LZOA 2R27A 1CFQA 5G5DB 1TQWA 5C2BH 2J55A 3ARFD 2E7BA 3MO1A 4NQED 3HE6A 4DERA 4PJIE 2VQUA 3V4UH 3D69B 4HG4J 4GBXD 4X6DB 4BZ1A 5AL8A 3Q01A 3KWWB 1C5CH 5IWLA 4ODSH 4HKJB 4OJEH 5KANI 1IX2A 3P54A 5IJKA 5CMAA 4GW5B 3VFUA 2CLRA 3WTSA 3Q8EA 1ZA6A 2DEXX 2RFXA 5GGRY 1XH0A 2XU9A 5GGSB 5DRXB 4LPWA 4MKTA 1C7TA 3SBWA 3BE1L 2WY3B 3K46A 1EEYA 1UCBH 2F0CA 4L18A 3PQYB 3UAAA 3FHEA 4PGDA 1ASOA 3HRPA 4EQ2A 4FQHA 5C0JB 3ETSA 3UACA 3LKPA 3EW3B 1SQMA 2J6EA 2W9DH 4ZFFA 3FQXB 2FIKB 5J12B 2H0FA 2WMPB 5KVFL 1X5JA 1WWWX 1NUDA 4IGBB 4KX7A 3OAUL 4HJSA 1G7QB 1J1XH 4IU3A 4LDEB 5DSCB 1UB5B 2CWRA 1G0XA 5EU4A 3B2PA 3UGUA 4BSVA 5JIPA 3QUML 4ERSH 1MCFA 4FF9A 2FECL 3FQ4A 4U1JB 5HGHB 4GAYA 1DBKL 4JG0H 4XNYL 1CXKA 1KB9K 3NZ8B 4TPRH 1LD9A 4Z23A 4FNPA 1KGYE 2UZXB 3QUGA 4PH8A 4MLSA 4F37F 4QXUL 4CW1A 3GZQA 5L6YH 1CICA 3OKKB 1TCRB 2ICES 1TJGH 1PU0A 2Z31A 3ZUNC 2YQBA 3QAQA 1F8TL 3VI4F 5DJ8B 5T3ZL 1SMOA 5GRJH 2BY2A 4Y9EA 3GSRB 4DK5A 4UU9A 1MAML 3L08A 5DVMA 3ARGB 3R7RA 2ADIA 3MJ9L 4NZUL 3BD4A 2WUBL 5CU9A 1WUZA 3S8GB 1CU4L 5GISL 3Q8CA 4YQXH 3NEXA 3PHQB 4MNHB 5TDPB 5DD0L 1GCFA 1KCLA 3JWNE 2FX9H 2BIIA 3K2UL 3OAYK 5J11C 3BFWA 4ODVL 1NGYB 3NCYS 2K8QA 1HILA 4YHOL 1OIOA 1IBYA 1NMAH 2HYMA 3TBWA 2PW1A 3D7PA 3D87B 2WLJA 2ZNXA 4A68A 3ETTA 4EN3A 4MX7B 3ZYZA 2IF7A 4LPUA 1K2DA 4YBLB 5LAPA 3SDCA 2VH5H 3WLBB 1XVSA 4BELD 3SDDA 3C5ZB 1LO3H 5BQ7B 2P44B 1RUPH 4FXGC 1VFAA 3SDDC 3U0PA 1ZV5A 3FCSB 1XGYL 2GJ6B 2DQUH 3RNQB 3TCLA 1ZEAL 4JHAL 3OJVC 5DZOA 4PS4H 3QQ9C 3SCMB 4BSWA 5H4YA 3O0LA 4JCLA 2EDXA 2FLMA 2FHCA 4QRUA 5HY9A 2GBTA 1AOZA 1T22B 3OC8A 3QQXA 3NPZB 3QR1A 3GZPA 4NQTA 5LAXA 1LO4L 3ZDXE 5IBTH 1N6UA 3MLTA 2GCYA 4KX9A 2P5EB 1OARH 1VIWA 3NRFA 1U6AH 4NQQA 4R4ND 1MAJA 1NDGA 4TUOA 2BIMA 3JWDC 1FZMA 5DWPA 4IIQB 4HUUA 1KCUH 1KENL 2DQFA 2PCFB 2WVVA 4LKCA 2I24N 1FYTE 3VFSA 5SWSE 1A6UL 5FYLD 1TJHH 1LEKA 2MCPL 3CC5B 1OGAE 3Q2NA 3B3IA 3FT1A 4N2DA 3SY0A 3OB0K 3OKOB 3K91A 4OZHE 2CUMA 3M07A 4LNRA 4J3BA 4X5WB 4XX1G 4MDIB 3U9WA 5ADOL 1IQDB 4OFDA 3V6ZB 1DTUA 3KJ6L 4YBQC 1D2OA 2FSEA 2GUOB 2AC0A 2XWCA 3JTSA 5JHAA 5E8NA 2X2YA 4GI8A 2HRPH 1G7LB 4AOFA 5H4ZA 1I85A 1RCYA 4F7EB 1VFOA 3FH8A 4KO5A 3KXFD 1IAOA 2EDBA 3QFGA 1A2YB 1A7NH 5IQLA 4QRRB 1TUPA 1BQHG 1YQ2A 2E6PA 2KZWA 2WGNB 2WLIA 3NABH 4JRYD 4ODUA 4TNEA 4N2NA 2JKNA 5E8EA 1SBSH 5F7MC 1IM3A 2YD6A 4PJ8D 3ROOB 4PJHF 2Y7OA 3Q06A 4XAKD 3WIHH 2JMRA 4XAWL 2E74C 1P7QB 1IGJA 3OSVA 1R33A 3LNDA 3ARTA 2JI2A 3QG7L 3TO4D 4NNYB 3WLWC 3DGGA 3UTSE 4HF5L 3ZLQC 3QEGL 4Z3FA 2JJSC 1DBAL 2UV3A 3NAAH 4XMUA 4J3TA 2EYTB 1QSEE 2XG5B 4UT7L 5MP6L 3ULVE 3CAFA 4NPYB 1UD8A 3E6FA 1ZTMA 3VXOB 3LIZA 4DPRA 1DEEA 3MUGA 4IOSA 4RGNB 5E5MA 5E8PB 3QH3B 1PMYA 5E8OB 3CLFH 1R5IA 3L3JA 3BP6A 1NJ9B 3MZTA 3GGWB 4G7VL 2EO7A 3VGHA 3BT2H 3DXAA 2YAQA 4KNUA 5DCCA 3BUYB 1HESA 1T5KA 2C9UA 2NW2B 4ZYKA 1A7RH 1FJ1A 2PWDA 3P4MB 1WAPA 4QEGA 2CM6A 5EU7E 2VL5B 3RRQA 3IGFA 3MLRL 3WDJA 4C4UA 4WEMB 1IFHL 2OXGA 2MPAL 4M7JH 3S48A 1TJIH 4Y7OC 1S7XA 2ZX6A 1T3FA 3V6OA 4MXQD 4TL5A 1YEFH 2G2RA 5FM8A 5FECB 1N4XH 2BCKB 3NGBB 3U2SB 1TOXA 2IAMA 3ET9F 4M02A 3V6OC 1JG9A 2IAMC 4KK9D 3WO3B 3UTTA 2Q8BH 4DEPC 4L5FH 2XZAH 1QEXA 2J8HA 1J9RA 1T4WA 4JFTA 2MTAA 2JIXB 3HI5H 1AO7A 3KG5A 1N8ZA 1TVBB 5EU3B 3RI5F 1PCXA 3LS4L 3MI6A 3CU7A 3ZUCA 1E9OB 1G7PA 3RWEA 4LLDA 4HU8A 4GP4B 4WRLA 1PKQA 1ZT7B 2IFGA 5E7BA 4JDVB 1MFNA 2W59A 4FMFA 3IDYB 1EFXB 1JWUA 1FAIL 3MRHA 3WEOA 2B5IB 4ELKA 4JFOA 3DV6A 4DHLA 3ROLB 2V5RA 1AGCB 3ZR6A 5ACZA 5AG9A 1E4XI 1FHGA 2DYSB 3P9MA 5ALBH 4ELDA 4KXAA 4QD2E 5D7IE 1DQDL 3VFWA 2X4OB 5FCSH 1DJGA 2ED9A 3I2CH 1DLHB 3UIZA 3N1QC 3QXUA 5F9JB 2AJVH 3KCPB 2EO9A 2C3VA 2VDML 3CLWA 2FYYB 2GJZB 4LDLB 4HC1L 4M9OA 1BZQK 2VDKH 2Y06L 3BZ4A 3C2AL 4XPAH 4FA6A 5KJRH 5BZWA 4HJJH 1KTDA 3FU7A 4ZD3H 4NN6C 5FV1L 1LO5B 3MX0B 2CPCA 2ZSWA 3EJYD 4NZDA 2WUCH 5AZEL 4AM0B 5JIIA 1E30A 3QDGE 3HS0B 4IMKA 3P4OB 3VWKB 4IMKC 1NGZB 3SPCA 5F88A 4AX3A 3ELQA 1F56A 1JNLL 1E4KA 3GM0A 3OKLA 3X12B 4L3EE 4ZX5A 4HIJA 4ZUTA 3FTXA 4G8EA 1WFIA 4YSCA 2VW4A 1X6NA 4M62H 2BERA 2BW4A 1WTGT 4CA4A 3D0VA 5EBWB 1C16B 4LQFL 4M6NL 5FO7B 3QCUH 3CVHA 4FQCL 4LGPB 4Z76B 2LFEA 4P59H 1IM9A 2X6MA 5EA0L 1UWGL 5JNYB 1O9VA 1QRNB 5IQ7H 2UX7A 1RZIB 1S7SA 3N2JA 1TEFA 1F6AA 2XFXA 3FT4B 3IJEA 1VCAA 2PLTA 5F93C 5ENWA 5AZUA 2BNUB 3BVWA 1DBJL 5LGHL 1UZ6E 3BOVA 3CFNA 1UEMA 4FFYL 4UUJA 2V3FA 1Z3RA 5DHVA 2AJUH 3EDDA 3ZDWA 2LLLA 1A14L 1D3CA 5LBSA 3WFEL 3BT0A 3ZE0B 2NY7H 2WXKA 4LSSH 5B4MD 3I50H 5LCVA 3VCLB 3ILEA 1MWAL 4G5ZL 4LOUD 1HI6B 5JW4M 2N4IA 5E2UH 3DGCR 4CNIA 5DZNA 1E5ZA 4YXHL 3HMXA 1U3YA 1XBDA 1E4WH 5ANMB 1DE4A 1CE6B 1IL1A 4FI6A 3S4SB 1YN7B 3KLDA 1DVUA 3MODL 5KVEE 3LRSA 1NEZG 5DEGB 3V6FB 2FJHA 4WI9A 4RMVA 4R4NC 2IPUG 3RY4A 1KIPA 1U92A 2GITA 1RZKL 1WISA 3O6FB 4QRAA 4BZYA 5IF0A 2CHWA 1QLEB 4PJIF 3W39A 3O9WA 3W5MA 1FZOB 2DL9A 2AANA 1OE3A 4HBQA 3O9WC 3KM1A 5H2BB 3MC0A 1VESA 2Z7ZA 4AIOA 1NAML 5ERWB 2VZUA 5AALA 1FGVH 1H8NA 1N10A 2O72A 4WTXA 4AV5A 3V2AR 2CBMA 1F4HA 2ENQA 4HHWA 1F41A 1RZ8A 2CIKA 3S35H 5AW8B 3WN6A 2A83A 4JFSA 4NFDA 4A39A 4HZLA 1EH9A 2XQYG 3W56A 1BFVL 2XQBH 2BW5A 3BWUF 1CUOA 2F19L 1EJ8A 3DX6A 4ZFOL 1NSNH 2VUKA 4UANA 1S7UA 3UYOD 4MLIA 5I8EB 2Y5QA 1SOSA 2F54B 2WBKA 3GS0A 4JQVA 4OFYA 4UTAL 2HKFH 4KHXH 2DTML 4MAUH 3BAXA 3TFKD 3HZ3A 4JEGB 3BFOA 3T77A 4KRLB 3QIWD 4Y9CA 1IQWH 4G43B 3T4AB 2DN7A 3TO4C 3H55A 4A63A 4XP4H 1T5XB 3LKRA 5TE6L 1JHKH 3ULUE 1J7VR 4HJ1A 4OI9A 4TSBL 4YUEH 1A1OA 3U83A 4BUHA 4AZUA 1ETA1 2YPKB 2VL4A 5EOQL 4BHUA 4XOBA 2Z1KA 4PBXA 1WRFA 4DP5X 3SQOL 3UAJD 2UVEA 3MR9A 1A4KA 4U05A 4NZTH 1T6VN 4N8UA 4NN7C 3T8VA 4UDUA 3FSWA 4X98B 2WXOA 1JPTL 4NYLA 5DT1L 4H8QA 1FYTA 4DKFL 3O6LL 2ZCHL 1Z9NA 2X41A 3O6KL 4D3CH 1Z9LA 4BV1A 3LZLA 4HUNB 5GRXG 4FHBD 3LXCA 2P4AB 1OB1B 4JN2B 4OZHA 3ULSB 4P2OA 3RG1C 2EKSB 4HIHA 4XRCA 4P2OC 3CFCH 5I1EH 5HHVL 2NW3B 5DUMH 3NPSB 4OIIH 4FXKA 1RVFH 3VFGH 3KNBA 2W5PA 4FXKC 4FS0A 5FYJU 1U8MA 3KPRD 4ZUUA 3RY6A 3IAQA 3QXWA 1RU9H 43C9A 2N3JA 1FORH 1GZQA 3I75A 4UILL 4KK9C 1AHWA 1TTRA 4ORGB 4TNGA 5D1ZD 4EVNA 4I77H 4JUTA 1V7MH 2A4EA 2IWEA 3ARQA 1H19A 3F04A 1S5HB 2F7PA 1KIRB 2DS4A 2VLJA 2FATH 3KL5A 4R90H 1TZOA 2VRAA 5ESVB 1A6VL 2N7AA 1E8YA 3SKUD 1ZT1B 2GTWA 4G11A 3LN5A 1INEH 4K7FA 4F3FB 4JL2A 3RNKB 4EUPH 4UQ2B 3BH8A 2EXYD 3OZ9L 4EDXB 3LXBA 1QSEA 3AQXA 1KTKE 2WZ6A 1ZHNB 5C0ND 5D7HA 3NJHA 4GSDH 5E03A 4XNAA 3AT0A 3FCTA 1TSRA 4JPIB 1KDJA 1GOGA 2BSTA 4MMYA 4PYHA 5IV2A 3HZMB 1GY2A 1PZ2A 1OGTB 3EGDB 4LLYA 4OIFA 1DUYB 3B8SA 4FNLH 2QQNL 3BP7A 3ZDXF 1AZCA 3MN8A 5ID0B 2FEDD 4QXGH 5HDRA 4R7VA 2L04A 5BPPA 5JLZB 2ADFH 2FVNA 5D7JD 2FAUA 3ILQC 4NZ8A 4LSRL 1CGXA 3PJLA 3O6ML 4IRJA 5AVVB 4ZBJA 5AW7B 2CBTA 5LBVA 1VKXB 4N0UE 5C0IA 2YC1B 4D9QD 3P4NA 3FO0L 2OV0A 2Z93B 4W6WB 4PQXA 4DGWC 4DGIH 2NLJA 3JV5A 3UYRL 1LK2B 1MFCH 3QRLA 4OZHF 5AVZB 5CLTA 3HZVA 2G9HA 4C56B 5F9OL 1E8ZA 2BNRD 2CD0A 4JJ5B 4G1EA 5CGYD 5KN5B 2VABA 2YIHA 2ESVA 4LSVH 3RUGE 4M29A 2R1YB 3U6RA 3LV3A 2FK9A 8FABA 1KXTB 2EQDA 1BIIB 5DJAB 4HWEH 2APTA 3KPSB 3FAXA 1W15A 3Q1SL 4NQCB 1GA2A 1QQDA 3GXPA 2N0KA 2IGFH 4RAHA 1YPZB 4ZUSA 3WXVH 3TIEA 4UOW0 5F3BB 1NC4A 2BC4B 3FOLB 3FU3A 3W82A 3B7TA 3FB6B 1SN2A 3EUDA 1XF5A 4OM0H 5T1LD 3FRPG 1IAMA 1QBAA 5A2JH 5L2KD 5I19L 3CD4A 1IAKA 1SJXA 3CXDL 4Y4HD 1T0MB 2CUHA 4L4TB 3MOQA 4XWOD 5CR1A 4ZMTA 1RIUH 4GP8B 3E2HC 2Z8RA 2ZUVA 2FTAA 2MJWA 3KYNA 1LO0L 5MEQA 4PCTA 1NIBA 4X0KB 4EO5A 2EVJA 5DO8A 1C12B 1OVZA 1J11A 4Q9QH 1J8SA 4ICWA 2WLYA 1ADQL 5IEHB 1QSZA 5E5UB 4LOUC 1NZRA 2GBUA 2DTSA 3CPUA 3GK8L 1UXWB 1MJ8H 3LKOA 1BVNT 2LTQB 5C09E 2X89D 1E27A 1EDHA 2XG4A 4NRZB 3TA4D 4PRPB 5EEZA 3GIZL 5HYSG 1SUHA 3IDMB 1UH4A 3PL6C 3B1UA 3QNFA 5J6HA 3QDGA 1MDAA 4F7PA 3MGTA 2EDMA 4PJFB 1FP5A 3MKKA 2H3NA 4RIRB 5D1XB 5KSBE 4IBVA 1XB6A 4L3EA 1MLBB 1SOKA 1XCQA 2CGYA 5CUSL 3GSXA 1Q38A 4W6YB 4GRWE 1YYML 1AQKH 1A8JH 1PTZA 4JRXE 3BJLA 5TTRA 3IYLW 5DDHA 3IT8D 2EVFA 1HZLA 2ED7A 3LZPA 4Y19E 4H8HA 4V1DE 4G2AA 4QOKD 4NHCL 2WWKT 4YHNA 3O3AB 3MLSL 3EFFA 1ODUA 3LZQA 4NOBA 4KXDA 5CJOL 1PCSA 3QA3A 1HEJC 4LSDA 3S7GA 2ZWZA 1J1PL 2AJSL 3QUZD 4BDVB 4CGUB 1G1KA 3ZTNH 1QTSA 3S5ZA 3CG8A 3QIWB 1J0ZA 2X3AA 4FKEA 5AW4B 2FEEI 4CN4A 2J88H 2Y36H 3KBEA 1G9NH 1HL8A 2QGCA 4U0RB 4V11A 5IHHA 3GYRA 1JK8A 2D7TL 1AXSB 2JELH 3BDYL 4WW2C 4RFNB 2GJRA 4FERA 2NY6C 3QRGH 1KOAA 3G5YA 4FHJA 5B38A 5D7IF 2Q3XA 2V2TB 3QDJA 3Q48A 2H7WA 1Z5HA 2HKHH 3CFQA 2GT9B 1NCIA 2YSTA 3FZUD 5PAZA 5IHZA 5HP5A 2XZQL 3ATFA 3UAJC 2L7UA 1XGPA 4O51A 5EF3A 4WFED 3GUTA 4HETA 3ZXAC 4JM2D 3MXVL 4WJ5B 5LG6A 4OVVA 3KVQA 4AT6B 3CVBA 1FC2D 4ABUA 1Q9LB 3LH9A 3W5NA 1EX0A 3UJIL 1AAJA 2D03H 2L4OA 5KSUA 2CRYA 3OV6A 7FABL 7PAZA 1HHIB 2Q7NA 2E56A 2V2WB 2PWFA 5KJ7E 3EYFA 1M71B 4JCWA 2Z0BA 3MRQB 2DM7A 1SUJA 2NDGA 1FL3B 1CD1B 1UZGA 3F5WA 3KLAB 3S8WA 1LK3H 3H9SB 1VZGA 4F15C 5ICXB 1JF1A 3VSQA 1A65A 1M9SA 5GGVL 2BSSB 3T65A 1I8LC 4DVRH 2KI6A 2VXUH 5DD5H 4FYQA 2PXYC 1DFBL 4YDIH 4XN8A 5IQ9A 5K39A 3JWOL 1EBAA 4J28A 4OJDH 3QCTH 2BZCA 1GPOL 3EFOB 1UFGA 3ZHLA 3NVQA 5ECGA 1KTRL 2FGWH 1NGWB 4XMWA 5IM7B 1KB5H 4IRSB 4NQXB 4P5TC 5TPWL 4FC3E 2MNUA 4JY4A 3ZDZE 3ARDD 3S97C 2E4FA 3GZKA 2X1XR 1QI3A 1KPRA 2UWEB 3MOAL 1UZ6F 1IC4H 4KMTL 3TOPA 5C0NC 1SF5A 3L2NA 3ME0B 4ODTH 3TJEL 1F6FB 4ZZKA 2A73A 1MCHA 2OTPA 3S37X 1S7RA 2QZQA 1NCCH 1FAKT 2XWJA 2YN3A 4K7PL 2HH0L 2DQEL 5I26A 2KPWA 4XZUB 2BNQE 3HNSH 2YRZA 5CJ5A 2FEDC 4XBGA 5GSVA 3B5TA 2GC4C 4YDZA 5BXFB 3VW3H 3W11D 2DJMA 1UOWA 4ODWB 2P8PB 3O3EB 1BZ8A 2DYPD 2EE2A 1WSST 5TK2A 2XX1A 4CMHC 2R2HB 3K7UA 2O5XL 3A6OA 2BS71 2V17H 3QULA 3TBTB 3DJTA 4OZFG 1DQJB 2VR6A 3QIUD 3GWJA 5F7HA 2AMGA 4XTRD 1QSFD 1MCSA 2DWEA 2QFRA 4RVBA 5CGYC 4E0RA 5E6YA 4G9FD 2LU3A 3RIFK 2IH1A 2QVMA 4F7MB 5TQ2H 1P4BH 5HD8C 5I1KL 3HPJB 4JHWH 1KJ3L 3M1BB 5E6RB 5EU6E 4OB5L 3O2DA 3N5AA 2XTJD 2KQMA 4XBEH 1KBKA 2ZXBA 3MA7B 4UQEA 3QNXA 3GXDA 4A2EA 5MEND 3W2DH 1CFNB 3PABB 1WC7B 3QZPA 3GRWL 4YOKA 2Y69B 3PGCB 3TVMB 1XGTA 3IXTB 3EBAA 2DB8A 5HJ3B 3BSZA 4DWHA 4K07A 1IB5A 4P9MH 1CDBA 2W9EH 2BVQA 1G7MB 1W0WA 3OXSB 1J9SA 1JVOA 5E7FA 4ZUWB 3QXAB 4XWOC 5GGTH 3CHSA 3D85B 3MMEB 4E9SA 4ZTOH 1LEIA 4HK0A 3IJYA 1KBBA 4BH8A 1UWYA 4RISL 3TWYA 3C6SB 4K23H 4AWJC 1EDYA 1NLBL 1OALA 5CSGA 3CFBA 2AMUA 1CGUA 5E23A 4RA0C 1IBHA 3WAJA 4Q14A 3A4AA 3W0WD 1NGPH 4NX0A 4N0UA 4DGVH 2GK0B 4LB8A 1UD5A 1WEJH 3GMRA 4PWJA 3U7WL 3RL2A 1KZQA 1JRHH 3IDXL 3MGOB 2DZEA 1SJEA 1NIEA 2HTKD 3FSVA 5GZOD 2DLEA 1CR9L 2P8LB 3HTLX 5BV7C 3DX1A 3Q3GB 4M8UA 1M2OA 4HQQL 1S7VB 1KYAA 3RUGA 4APQB 1UXSA 5L9DH 3MUHL 4IS6A 4AZ8B 4IHOA 3N1PC 2GSGB 2LT9A 3LQAH 1VCBC 3ZL1A 1NUNB 1C5DB 4JG9A 4NAJA 1U8PA 3NFNA 1C9SA 3RTLA 5E6ZA 2EADA 2Y4SA 3A4EA 1I1FA 1TEGA 2D73A 1MCKA 2WBWB 3DVNB 4FXLA 5AVUB 3TYFB 5CCGE 3WD5H 5I66A 4HIIB 1R3KB 4I0PB 1A25A 1I31A 2Y22A 4YSDA 3OGCA 5BZDA 1FO0A 3EYSH 5CF3A 1IGYB 2D4DA 3B9KA 2O6FA 4ENZA 3STLA 4CL7A 4JFDD 3BMWA 2CRIA 5F3HB 1WBZB 4M48L 5ITFA 5FW6A 2VNCA 3ZKXB 4XCYB 4CC4A 1SHWA 2K45A 4XHJC 4Z8FL 2VJ8A 1M42A 3KYMB 4WIQA 3DETD 2CIIA 3V7AG 1U3JA 5D71L 5C09A 3NACL 4I48A 2F58L 1BD2B 4CVWA 1P7HL 1XT5A 2RTTA 3FZUC 2B2XL 1QTPA 1EUTA 4XGZB 4HEMA 3AWFA 3LS5H 5HHMB 1F11A 1Y6NR 4RQQB 5AOKA 2GSIA 4JM2C 43CAB 4EI5C 1B3JA 1I1CA 1U8CB 1V3KA 1N3NB 1K72A 2WTOA 4N90E 5GGQH 4Y9GA 4R9HA 3CFEB 1XH3B 4E9WA 5IT2L 3NCBB 2GIXA 2J43A 3VWJD 3QFJE 5GJTH 4K5NA 5E9DD 3DRQB 4JRXA 3H9HA 3MCKB 4UV7H 5FUCC 4G6MH 3NIDB 4X6DE 2FHBA 4EXPX 4H1LA 1MI5E 2GQHA 1X5AA 5IB4B 3BZDA 4PVBA 1L6XA 1TKWA 3TA3C 2JE8A 1KIQA 3F62A 4Y19A 4NDMB 2EIZA 1RZQA 2ZQKA 4V1DA 3HUJB 5FYJL 5I5JA 3WXWL 4A38A 5KBKA 3SDAA 1W72H 1T7XA 2P8MB 3GMOA 1AD9A 5KZCB 1RUMH 2YXWA 2EYRB 3L1OH 3VE0A 3ZKND 4EI6B 2YPLB 3PQYE 3II2A 3IMUA 3X11A 5J13B 1TPXC 5JW4N 3GI8L 1FZJB 1Q9WB 2OP4L 3ARDB 1ET8A 4OV5B 3LD8B 3WIIL 1S7WA 5EZIH 4K5LA 2ATKA 4D8PA 3AG4B 1J1OH 4LEOB 3DO7B 3OMZA 1IE4A 3DSNB 3IU3B 4G8GD 1NFKA 4BKSC 3HFML 5LGJA 1L9TA 2X7LB 2I85A 3N42B 4X4ZA 5G2NA 3D9AL 4MMXB 5C0AD 4UI2A 4EBQL 3E6HA 4X6EB 4Z3HA 2R9HC 4XPGL 1D5IL 2XWRA 3S3BB 1MHEB 4LCCB 5LWYL 2NX5D 3OPZH 3C08H 3GIVA 3LZRA 5DVOA 4JKLA 5BRPA 5I17A 3IRCA 4CMMA 3W11C 4WCYL 3EIFA 4P4RA 2NSQA 3L9YA 4LMQE 2APWA 2CJ3A 5KSBF 2AKRA 3NQIA 1SM3H 4IRZL 4BFNA 5GS0L 3ESVF 1KN4L 1TEYA 1JGUH 2FR4A 4A2FA 5BOZG 4GRWF 3MGAA 4CGTA 1QFPA 3F7VA 2BIPA 5F1IA 3D0AA 1M3IA 1MFDL 4HUXB 3MRKA 5CEZE 2ZE0A 3RVWD 15C8L 5BQDA 3VRJA 1IGTA 4M7KH 3IGLA 4MNQD 4ZUVA 4DZBB 2YEVB 3GS7A 1S46A 4NENB 3DWTA 2MKLC 4TVPL 5FIEA 1FVDA 2YRBA 1DVFA 1DBBH 4NOFA 3C8DA 2XTJC 3QPQC 4LARL 4S2SB 3DPBA 2EDKA 4B95C 1I3VA 1HYSD 2WLLA 3FS9A 4MCZB 3FF8A 1D6EB 1T89A 5JPMB 2QR0B 3LQZA 4OD2B 1C5BL 5EEUA 1HH9A 1HWGB 2ZX5A 4LBEB 2CM5A 3HI1A 3I9GH 3RL1B 4XXDA 4OUUB 1U8JA 3DROA 5J6SA 1OAUL 1T5WA 2X2IA 1AP2B 2GJ6E 5KVFH 2F1AA 3OG6B 1Q0YH 2MQCA 5A2AA 2BS8A 5L88L 4X9GA 2BNQA 2OX5B 3CXHK 4L9DA 1EO5A 3Q13A 4XC3L 3STZB 1VFMA 2D9QB 1HL4A 2TSAA 1JZ3A 3MRJA 5BVPH 3WAKA 2VN4A 4ZTEA 1S9VB 2CO6B 1YECL 4KO7A 4XNYH 1EXUA 1Y18A 2R0ZL 5TF1H 2P5EE 2A6KB 3S3CB 4OLYL 3T0VA 1INDH 3LNFA 4PTTB 1BZ7A 4BZ2H 1MFAH 4KY1H 3QJSB 4PI0A 5L0QC 1BCIA 1KJ2A 1I7ZB 2X4QB 2R7EB 4OLUL 1J05B 3TXAA 3BAWA 1HCVA 3HRZB 5ISZB 2ZXAA 1MUJB 5GZOC 4JANA 4PRHB 3ARYA 1A6PA 4UT9H 1F8TH 5T3ZH 1H9DA 4MJIB 5C0RH 1U4FA 3T0EA 2R1XA 4HPOL 1DVYA 1K8DB 4DKEH 1BJ1J 3FH7A 5ITBL 4NZUH 5EU6A 2H1LM 1DQKA 2VKXA 2PW2A 4F9PA 2VXTL 1MIEL 4F9PC 3C6LC 2MOGA 2XN0A 4QRRE 3BYYA 2AQ3A 2UYLA 2G75B 5I9QB 1FFOB 4NKIH 5D7KE 4AK2A 1JSYA 5DZJA 1XF2A 4C58B 2HJKB 2XXGA 3I9IA 3GHBL 1LE9A 1EGJL 3P9LA 1C8PA 1GGBL 2XN9B 1AG6A 4I13B 4Z3IA 3RWDA 3BP5A 1QD0A 5A16A 3SE9L 5E08L 1A4JA 3QYCA 2YQ2A 1G7JB 1OSPL 1S7QB 2N1TE 4WI2A 4Y5XC 4UWQB 3FFCB 4XH2A 4U1NB 4O2FA 3EBGA 4FFWD 3FUEA 4QHMB 2E27L 2ZF9A 2PO6D 4LASH 1RJLA 4G7RB 2I27N 3VXRA 2OMUA 1FFNA 1XGYH 1Y6KR 3DETC 3KM2A 3DX9A 2WOBA 1ZEAH 2PWGA 2WCGA 2FJFB 3T08A 4EIGB 4KDTA 4H0IA 5EWIH 1A66A 5ALCL 2B3RA 4PV8A 4WGVB 5CWSB 1JGLH 1U91B 1HH6B 4W9GC 2BHYA 1M9WA 4WENB 1E42A 3DYMA 4G8FB 1XGUA 2KT6A 4HBCH 1KCWA 4GQ9L 4Y1AB 2B1AL 2G60H 2H1PL 3BLPX 2VWEC 3QHZL 4BCZA 1KENH 1H5BA 3DMMD 4KOBA 1G9MC 1U8QB 1MZYA 1YY8A 4JLRB 1BX2A 1IBFA 5GSRB 1L6PA 5I6OA 5JHLA 4ZZFA 2P3YA 3HG4A 4OLWH 3IFPB 1FZKB 5IW1A 4YHMH 4PB9L 5KVGE 1NBVL 4LHUB 1VSCA 2IQAB 3KJ6H 6PAZA 2AQQA 3OXRB 2VM4A 4U1MA 4O4YL 4L37A 3L3GB 4ICXA 4JJHA 4TQIA 2EDWA 1ZLDA 3P4LA 3NFPB 2Y6SD 5BRZB 2MNWA 4CN1A 2AEQL 2CJUL 2Z65C 4NBXB 1JFHA 1TTFA 2OMWA 4K9JA 1AQDA 3A4DA 1EVUA 3K4AA 1F5WA 3ZKNC 3IMBA 2GC7C 2F74A 1H6EA 4FADA 4TS6A 3ZE1B 2FLRT 2OMZB 2AXGB 2JKJA 1SN0A 4UDTA 4KKLD 3K71B 1D5MA 4N0FB 4XAWH 1T83C 2M83A 3FT9A 1PZCA 4G8GB 2NY2C 5KBPA 2GPZA 3RZCA 2HKAA 3WEXA 4P2YA 2B59B 4JFEB 3QEGH 2NUTA 1X7TA 3ABLB 2VMJA 5MP6H 3P0YH 5GIRA 4AYID 3MV7D 3WFDL 1CLYL 3D52A 4LCYB 5IHUH 1NTDA 2JKRM 1JE6A 1OTTD 5IKCB 2VSKB 4OV6F 3LH2L 3MRBA 1MCCA 3Q6GL 4Y16A 3ZGHA 1CFMA 4AY0A 3QUXB 3H2WA 4LKXB 1T04B 2X70A 5FAAA 2KDYA 1KTCA 2WJ5A 5G5DA 5I8KL 4ATWA 4G6KL 3VDCA 4F7TB 1KB5B 1I8KA 1MLCB 3K8MA 3D69A 1EJOL 4X6DA 1NCAL 1CG9B 1N7MH 1AR1B 1K3IA 2XBZA 4LIQH 1SEBB 4HKJA 2W95A 3HNVL 4FKHA 3NUKA 1JTPA 3TEWA 3MLRH 3OHXB 3D2UD 3VFRB 3NFSH 4AGLA 1IFHH 1HZKA 2YLKA 5GGSA 4PJEB 5JPNB 2IPUK 2DLGA 2ZWLT 5DRXA 3VXMB 4A2DA 1SLXA 4O02L 4BHUI 3QORB 4PGJA 3PQYA 3WMSA 1Q9KA 5CP3H 5C0JA 1MRDL 1OCOB 5DUJA 1Z6JT 1QRNE 4DCQB 1OAJA 3FQXA 2FIKA 2NY1D 3K81A 1AKJD 3FCGA 4Y2LA 5T5FL 4G8IB 3LS4H 4IGBC 1G7QA 5DSCA 4S1DC 1UB5A 1YMHB 5I6NA 2A0LD 1KB9J 3OTTA 3IJ7A 2XQYK 4UZSA 1MCPL 1U8OA 4U1JA 5HGHA 1CURA 3MJ8B 2B4CL 2ADJB 4YE4L 2AK4B 3C5SA 3ARXA 3ZE0E 1FAIH 3L95A 1USZA 2CKBL 1EVTC 1K4DB 2UZXA 5C07B 4DJMA 1N8OE 2LLNA 1CTNA 1P5VB 1NEPA 1T03L 3SZ6A 5EORL 3OKKA 4JPSA 5HI4C 5JORB 4Y5YB 3W3BA 5DRWB 5LNEA 4GUQA 3A24A 2OMBA 3OKEA 1JI2A 4YSQA 5BO1H 1ETZB 3L5IA 4Q74A 3QIBB 4E68A 5FYLE 3GSRA 3RB7A 4OGZA 3HNTL 3N85H 4JO1L 3LZNA 3ARGC 3GNML 5F7YC 5D96B 1N0XL 4H8WC 2WLNA 5AZEH 3VNZA 3EBHA 3LNHA 1DCEA 2VR4A 3N1FC 4KOCA 3PHQA 3KH4A 1JXJA 4PGBB 1D9KD 5JZ7C 3NZSA 4WTZG 2W07A 4HS3A 4ETQA 1CDGA 3MRLB 4OCNC 3CBRA 2IQ9H 1NGYA 3VXUB 1JNLH 2A6DB 3DRTB 3KXFE 1NWPA 1IVTA 1KB3A 3IETA 1QW8A 5JXED 3CFDB 1BM7A 3IPBA 2CSPA 4P46A 4NUQA 4FDWA 1YC8A 1MFBH 2D9CA 3V5KB 3WUWG 2PP9A 4LQFH 2NTSP 4M6NH 3WMQA 1UJ3B 4MX7A 1WP6A 1TIUA 5SV4A 1OTUC 2UXGA 2ZAGA 4XAKE 5EA0H 4I2XB 3WLBA 3CSFA 5HHNB 4P9HH 3C5ZA 5BQ7A 3L45A 3L4UA 3C5ZC 4J5VA 2VLRB 2DEYX 2BXZA 3FCSA 4EN2A 4U31A 2GJ6A 3IN0A 3RNQA 4N2AA 1ZPUA 2PO6B 2HFFB 5T3ZD 1HKLL 2JJWA 3SCMC 1DBJH 5LGHH 3DTXB 2OMTB 3QZBA 2ZWYA 1T22A 4PRNB 1OTSC 3RGHA 3ERXA 3M86A 2OMXB 4L8DB 4FFYH 2Y9RT 3WKML 4KDWA 1ZCRA 2VC2B 1A14H 2P5EA 2UY7B 3OQ3B 4J6IA 2Y24A 3DX4A 2UX6A 1MWAH 1QFWH 1MF2H 1YEHL 3O4LD 3ZYJA 3NJNA 5I71B 2CR3A 4G7SB 1G7IA 4IIQC 5AW1B 3AABA 1NCHA 2WBJD 3CC5A 3IS0X 3KBPA 3U1SL 4LE8A 3O8XB 3OKOA 3SB3A 4S0HA 4BKTC 1CBVL 3V6ZA 3WOVA 2XRAH 3K80A 3DMMC 2XXFA 1RZKH 1G7LA 5KBDA 2GKIA 5ICZB 1U8HB 2ALAA 2JCCB 5CFAA 1OO2A 2X9WA 1IV8A 4JDTL 3FN0L 3S3SA 2CCLA 4NSKB 4PJBB 4KRPB 2FJGB 4QRRA 4AYBA 1NAMH 3CMOL 1X9RA 1X9QA 5F8RC 5LXGL 5JOPD 3L5WB 2R59A 2GBAA 1PFOA 4B7IA 3ROOA 4X0NA 5K9KB 4KKNA 2HTLD 3LRMA 3QPXH 1HWHB 4PTUB 4YDNA 5JO5B 4JB9L 1OGPA 1ONQB 4RBPH 2J72A 1UA6L 3VFMA 4NNYA 3IJ9A 1YC7A 4ODXA 2WV3A 3FU9A 4KKBD 2X0WA 4GT0A 3RWHB 4S0TD 4W6XB 4M43L 4UTAH 3GMNB 1EHLL 4NPYA 2BJML 3TN0D 1DEDA 3RGVD 1CXIA 3EYQD 3VXOA 2FL5B 4M1GL 3B7UX 1B4LA 1GYWA 1YJDH 5E00A 1E5BA 2LAAA 1VJSA 4M03A 5E8PA 4OZFH 3QH3A 4RGNC 4H5SB 5E8OA 2JV6A 3NH7L 5DYOB 4MZRA 5TE6H 5FA3B 1RP8A 3SPIA 3GGWA 4MA7L 4TOYL 4G1MB 3V52H 2FEEL 1W72B 3Q0HA 1QX1A 4PG2C 3BUYA 4L4VD 2QSCL 4JNXA 4H8VA 3TBVB 2QEJA 3P4MA 2Q2EB 3ARFA 4MRBA 1OF2A 2ZP8A 5DT1H 2VL5A 2VW7A 3VYPA 4DKFH 1A22B 4PBVC 4RMUA 4GBXA 1KZYA 3O6KH 4N5ED 4HFUL 4OGXH 5DD6A 3WNKA 1YMMD 2NY0B 3QI9B 5FECA 1RIHH 2BCKA 3ES6B 3U2SA 3VXQB 4L3AA 3LN9A 3AY4A 4NT6B 5HHPB 5F1SA 3KPOA 5HHVH 2DMHA 3POHA 3E3QC 4LEBA 4IMLB 4CRPA 1HXYB 5AAWC 1DJXA 2G5UA 4P48A 4TYUA 3OKNB 4L0YA 2Z64C 1VEOA 2JIXA 2YOCA 5F7DB 4NRYB 4HJGA 2YAHA 4F1SA 1TVBA 3KPSE 3T6WA 3F12A 4NQCE 1I3RB 1OE1A 1OAQL 4UB0L 4Y4FB 5AOMA 4E2OA 1YPZE 1HE8A 4E5XG 1PQZA 1ZT7A 4HJTA 1TJMA 5GGSY 5BJTB 2HT2C 3AC0A 3AUWB 1F58H 1OV8A 4JDVA 3RAJL 2NZ1A 3QT2A 3WEMA 1BQUA 1FPTL 2Y7QB 5D4QA 1JZ8A 1WA1X 5AUMB 3WJJC 4FNQA 1FVCA 5FS5A 4BQ6A 5DQ9B 3SQBA 32C2B 1D5BB 3H6JA 3B6SA 3F6JA 2A0LC 3JV6B 3MTRA 4J3OF 1AGCA 4L4TE 4HHGA 1ID2A 5F44A 3UJTH 1VADB 2H6PA 2AERT 1PYWB 5DMIL 4F7CA 1ZGLP 4PVMA 2X4OA 1QFUL 2OZ4H 1M1XB 1Z32X 3C60D 5F9JA 3QDMB 4GAJL 3KCPA 4A2GA 2Y1AA 5KYNA 4NWTH 3CTTA 2FYYA 2GJZA 1W16A 4TULL 1RIVL 5KAQG 5KTEL 1KFAL 4P0DA 4PRPE 4U1LB 1LO5A 1VGKB 1L9QA 4LXFA 5BS0D 2CU9A 3DKHA 1NCWH 4QHLB 4WO4B 1NUGA 5GS2D 3HS0A 3G6JB 2FH6A 1RHHB 5KBMA 4LSRH 5D7EA 3O6MH 1JNHB 3P4OA 3VWKA 4N87A 4PBDA 1N19A 3EOAB 4PJFE 2ZKHH 3FO0H 2X87A 2J4WL 3L3KA 3V4LA 4R97B 4BWUA 2OS7A 3X12A 2AJXL 1KXQE 5DRNB 5KVDL 5HPOA 5AW0B 1RZGB 3UYRH 3H7BB 4U6TA 3CZLA 4GFTB 3W57A 3PY9A 5EBWA 1D9KC 2VO8A 4UTBL 1C16A 1MHHB 2AAVA 1R34A 5F9OH 5FO7A 3W37A 3CBKB 4ZW5A 1S7TB 4KJPD 1MCRA 4KH2A 5JNYA 2AI0L 5MERB 1G6RL 1G4RA 5JXEC 1QRNA 3ABGA 1RZIA 4GG6E 2YD0A 1CXHA 3L4WA 2A3TA 1HL5A 3Q1SH 2X4SA 3FT4A 4PIRF 5H94B 5LDUA 3T3ME 2BOCB 5IHBA 3TJHC 5GRUH 4I3SL 1PGRB 4JY6B 2J57A 1AR2A 1SY6L 1ZTXL 1KIUB 4LLAA 5AZ2H 3TEXA 3APFA 3SQRA 5L4IA 1XMEB 2P46B 3HC3H 2WAQA 4HXAL 5AKRA 4LESA 3VCLA 1XR8B 3CXDH 1HI6A 3JT0A 2EUWA 3WS6C 3MUZ1 1CE6A 3S4SA 4FFZH 1YN7A 3SEPA 2E7LC 4ZI8A 3EH1A 5DEGA 1WBXB 3V6FA 3BZ5A 2Z1PA 3EJCA 3OKYA 3CVIH 1VENA 3CSPA 4YDKL 3GK8H 4BZ1L 4P23D 2NYYD 1W0VB 3ALPA 3VUAA 4HWNA 2MCAA 3O6FA 4U6YA 4K73A 1BV8A 2ZKYA 3GIZH 2ZXGA 3TBBA 1FH2A 1Z2KA 3FRUB 2VUYA 4HLZH 5H2BA 3AXIA 1IT9L 2AVFA 3K0WA 2PPEA 4X5XB 4GAGH 5ERWA 5GRWA 3T0BA 2YA1A 3MCLL 2VDPL 3NZHL 4RRPA 1T1YB 3QEUB 1XQ4A 5SWZD 2W80C 2H6OA 4NWUL 2P52A 3FCUB 3GO1L 3KPRE 4X8JB 2OK0L 1ZIBA 5B39G 4CU6A 3EF7A 2N1KA 4PFEA 2FZ3A 1YYMH 4RWYL 4EOWH 4DIXA 3V0GA 4LDOB 5ABDE 5IOKA 3FK3A 4NUPA 3DV4B 5I5RA 5DLLA 4HKXB 5D9SB 1AC0A 4LVOB 2F54A 2HTLC 2NNCA 4H2CA 4FLOA 2HB0A 1UVQB 1TQCB 2O5YL 4N25A 4KU1A 4GUCA 5C0FB 4WU7B 2K1MA 4G43A 3INUL 4NHCH 4XVJH 1GAFL 5DZLA 4U1GC 3PE9A 3ZRFC 3T4AC 5M7QA 2ZOOA 1T5XA 2UWEE 4B97A 3WTYA 4LRIA 1ZJAA 1J1PH 2AJSH 3GHPA 4JE0A 4M61B 3OMNB 4PRID 5GGRB 3UPCA 1NA8A 5CXPA 4Y2DD 4UNVA 1IU1A 4MS8D 2DH2A 2QPUA 1FFRA 3GXIA 4HK3N 4ZXBB 2YPKA 3EYQC 3F58L 3HAEA 1B88A 3ZE0F 4PJCE 2D7TH 4YHZH 1A3LH 1BYOA 3BDYH 5M94B 4WSKA 4AGMA 5HI5D 2X4TB 1KXHA 1T1ZA 3TGXA 4L5FE 2WXRA 3UDWC 4B9JA 4HJIA 2XXCB 5C1MB 4ZMQA 1X44A 1KDIA 1OB1A 3A67L 3PGFH 4JN2A 4D9QE 2PPCA 3K6IA 2EKSA 3VQ2C 4AIZA 3OR7A 3RA7L 1XF3B 2KZBA 5EN2B 5I6LA 2G5BA 1E9QB 4LAQL 3NPSC 4MNGB 2J1YA 3PHSA 2BNRE 4GEIA 5DK0B 3GJEB 3IMWA 3FO1B 4N22A 2IO5A 4ZQKA 2J8UB 4KJYA 1N6VA 4ORGA 1FNAA 3UP1A 2ARJB 4N24A 2XWDA 3HC2A 4N9GB 3L9EA 1UCTA 4LLVA 5F89B 1S5HA 2YARA 2WLKA 4YSEA 5MI0B 1HTYA 4QRFA 4G59C 3BSHA 3V0VB 2YUXA 4GLRH 2IWFA 4K8RC 3VB8A 3VG9B 2JKWA 1ZT1A 1VACB 4DOHE 1DFBH 1RP9A 3HC4H 1FVEA 4F3FA 3RNKA 1L0QA 5EMYA 5GS1B 4EDXA 3RJQB 4ALAH 1MKFA 1DSFH 1ZHNA 5L2KE 5HHQB 3EO0A 5DI8A 2D7QA 4H26B 4NCDA 4Y4KD 4JPIA 5AB1A 5C0CD 3CV5A 3HZMA 4OU3A 1A1MB 1NPNA 1OGTA 3EGDA 2DLTA 4OZGB 1DUYA 5LO7A 2Q87A 4Z9KB 1BOGA 3I6LD 1ZY9A 2EUXA 1RLBA 3C60B 2Y5EA 1A7OL 5KSAD 2WXGA 3TJEH 4WEBL 4QTIL 1I9RL 5JLZA 1X5ZA 1MRFL 1MXDA 3LKSB 5DJ0B 4YWGL 4WNQB 5D2LB 4KK8C 4O9HL 4PJ9B 5FO2A 3IU4H 6CGTA 5I0XA 4WTQA 1VKXA 4NRXA 2V9QA 5D2NB 2Y2TA 2DJ4A 2DQEH 3M1CA 4KBPA 3SPGA 5LQBH 2A9ML 5JHDD 2VLMD 5G55A 2Z93A 3QQDB 3FW6A 3L6FA 2VDQH 4N0CC 2V5SA 3K4DA 2WZAA 4NQVB 1LK2A 3IDGB 4HMDA 3RBSA 4OTXH 5B22A 4Y5VB 4FAAB 4C56A 2GY5A 3HR6A 1PLCA 4M6OH 6PCYA 1KV3A 1BEYL 2BP5M 3JWNH 4HYTB 2R1YA 5I73B 1MW3A 1KXTA 1EZUA 5TGBB 3ABKB 3TH3T 5DJAA 3GMPB 5D6CB 3SGJC 3KPSA 4NQCA 2CCVA 2K6WA 2VZSA 3UYPA 3SJVB 1YPZA 3PFQA 5F3BA 2BC4A 3FOLA 2HZHA 2ADGB 2J7LA 4QOKE 1SEQL 3FB6A 2DWDA 4XO3A 5ICYB 2QGEA 4OB5H 3QJXA 4FQJL 1A64A 2ZCLL 2XWEA 2FYVA 2RB8A 3DIFB 4QMEA 3ZZQA 3EDJA 3PWPB 4XC1L 4GRLD 1T0MA 4L4TA 4AQ8C 4JO3H 4F24A 4M7ZC 1IJNA 5IQNA 5JOFB 4X0KA 4B3VA 4FG6C 1JPFB 4GXFA 1XIWB 1BXAA 4K3JH 1AZNA 1DJSA 5IEHA 5KS9E 4IKLA 1CQYA 1U8IB 5E6ID 4HCGA 3MRMA 1E3FA 4HLEA 4JFYA 3O0RL 1BD2E 1TFHA 2VN5A 4MJ5B 4PRPA 3IDMA 1KY6A 5DHYA 3ATBA 4DKAA 4WFEE 3LHPL 5FGBA 1ITCA 5IFHL 2F7QA 2NXYD 1W91A 5HHME 5KW9L 2EDOA 3JSSA 4J8RA 3MNMA 4YSAA 1SHSA 2I60H 4P23C 4PJFA 3FONB 4RIRA 2XZCL 5D1XA 4G6FD 4KQ3H 3W9DB 3NCMA 3KYKL 1MLBA 1KXQA 1T20B 4XP1H 1HQ4B 5GHWL 3LXAA 5DFAA 3IDXH 1PPIA 1RURL 1GY1A 5HJGA 2HG5B 3K6NA 3LH8A 3N9GL 4QHNA 5CZKA 1WA2X 1YG9A 1CR9H 3VO0A 4NJAH 1RQ5A 1QBLH 4Z7WE 1F2XK 4CJ1A 3EXLA 5HYJD 3QUYD 1XFPA 2WTRB 2VMFA 4GG6A 1UOKA 3HN5A 1MW0A 2OCJA 3FJTA 4MA8H 5IG7B 1T0NB 4X8XA 3O3AA 1QLFA 3D4YA 4J4PD 1YPZF 5E2VL 1MWAB 2XYBA 2J1XA 2R15A 4JPWL 3OJ2C 1TENA 4BDVA 3VI4B 2MIZA 3IVKB 5CBEA 4JL1A 3QIWA 5FFOA 2XKUA 3P0VL 1QPXA 2FD6L 3WN5C 1CFQB 3UZVB 2EUVA 4K3EL 2Q2LA 1Q9OB 1IZKA 3P2BA 2QV2A 4U0RC 1AXSA 4OFKA 2VXVL 4OH2A 5TD4A 3BIAX 2Y7LA 2WCPA 2JVUA 5I1CH 2V2TA 1UA7A 1SDDB 2HLEB 4CAGA 4M48H 3ZZLA 4HG4K 3Q2LA 2BSCA 1HHHB 3VFUB 1WZLA 1BSIA 2R23B 5I18L 4Z8FH 4J23A 2BP3A 4I3GA 5HI5C 4FQ2L 1K8IA 5EIIG 4ISVB 4AT6A 2OJ1A 3QEHB 2WZPA