2NSQA

Crystal structure of the c2 domain of the human e3 ubiquitin-protein ligase nedd4-like protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
140
Chain Sequence
GEPVYGLSEDEGESRILRVKVVSGIDLAKKASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase NEDD4-like protein
total genus 23
structure length 140
sequence length 149
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2nsqA00
1UGKA 1W16A 2B3RA 2X38A 5JHBA 4ANVA 2WXLA 3TWYA 2LHAA 4EZLA 3OAWA 3HHMA 4KZ0A 1QATA 2WXFA 4IQHA 2D8KA 2CM6A 4TV3A 2WXMA 1HE8A 1WFJA 5CCJA 5H4YA 4KITB 4G11A 2CHXA 3DPDA 2WXKA 3QARA 2Q3XA 5G2NA 1K5WA 4TS6A 4FULA 3APCA 3PREA 3APFA 4LDCA 3F05A 2WXPA 3NSJA 3W57A 4F93B 1E8YA 3CSFA 2ENJA 4ICXA 3JZYA 2NQ3A 3ML8A 4LCVA 2WXNA 5KJ7E 4V11A 1DJHA 2FJUB 4F91B 3NZSA 4OVVA 3L9BA 4WAFA 2V4LA 2Y3AA 3NZUA 1DJXA 1QASA 1E7UA 3L17A 2ENPA 3OHMB 4J6IA 5T8IA 3ENEA 4L1LA 4F92B 4EZKA 1E8WA 4AJWA 2R83A 3MJWA 3ML9A 4TUUA 5G55A 4ANUA 3QK0A 3R7QA 4DK5A 4QJ4B 3DBSA 2Z0UA 3CSTA 2DMHA 3B7YA 3PRZA 4FJYA 2EP6A 3TL5A 4AOFA 2QZQA 4DNLA 3T8MA 4BGDA 2WXRA 2WXGA 1TJXA 4GB9A 1UOVA 2K8MA 1BCIA 4NPKA 3LJ3A 4ANWA 3QR1A 1DQVA 4URKA 4ICWA 1RLWA 4JPSA 4Y1TA 3PS6A 2A5UA 2K4AA 2NCEA 3L54A 4FA6A 2CHDA 2ENQA 1DJYA 2K45A 4EZJA 5CCGE 5CCHE 2CJTA 1RSYA 2QZ5A 5JHAA 2WXJA 1GMIA 3QAQA 3F04A 4L2YA 1DJZA 2BWQA 1E90A 3PFQA 4OVUA 2CM5A 1E8XA 4XZ4A 1YRKA 2WXOA 1CJYA 1DJWA 4XE0A 3F01A 4FADA 4FJZA 1RH8A 3IM1A 3L08A 4WEEA 3KWUA 3F00A 3HN8A 2KI6A 3QR0A 4WWOA 3R7RA 2N1TE 5H4ZA 3L13A 4A55A 3N5AA 2RD0A 4NS0A 3RPBA 3S2AA 4PS7A 2DMGA 2WXHA 2WXQA 3IBEA 1BDYA 2ISDA 4FHKA 3FBKA 3GPEA 3L4CA 4BFRA 2ZKMX 2FK9A 4NP9A 4WWNA 4PS8A 3HIZA 3RDJA 2JQZA 3APDA 4Y1SA 4F1SA 3ZW3A 1A25A 2CJSA 4QJ5B 4HLEA 3ZIMA 3FDWA 4WWPA 1DJGA 2NSQA 4NPJA 3L16A 1TJMA 3ZVVA 2CHWA 1WFMA 2CHZA 3P2BA 2K3HA 4KZCA 4LT7A 3KWTA 3PYCA 4GNKB 4QAMB 1E8ZA 4ANXA 3QJZA 4MJJA 1DJIA 3SD5A 4XX5A 1DSYA 3M7FB 3W56A 4PS3A 2UZPA 5EDSA 1BYNA 2Q0ZX 4L1BA 4HVBA 1UOWA 4FLHA 2YOAA 2WXIA 1W15A 1V27A 4QJ3B 2YRBA 3TJPA 4FHJA 2A4ZA 4L23A 1E7VA 4IHBA
chains in the Genus database with same CATH superfamily
4PGJA 3DDGA 3ZDZE 2O6CA 1EH9A 4QOKD 1IIKA 4OY9A 4Z7UB 1E4JA 1YAIA 1QSFB 4NYLB 4QRFA 3RHWK 4A7GF 1M9WA 2NY3D 1UM4H 4AH2A 1OPGH 1NTDA 2H0JA 4DKTA 1NCJA 2QT6A 2WCSA 3NJVA 4QHPA 5G5DA 4A6YA 2OMYB 3ASOB 2CU9A 2GJJA 4LP8A 3VWJD 5DJAA 3TIEB 1DR9A 4PHZA 3EYFA 3BAKA 4MASA 1XT5A 2BFVL 1Z2KA 1CT8A 4OZFB 3QXAB 4YNYB 3TJEL 3O41A 1NGWA 5AOMA 4FP8L 4XCCL 4QXUL 4P4KC 4FGMA 2ZP8A 4N90E 2WUBH 2Y3AA 3HZ3A 4O2CA 4PRIE 4R90L 4WKZB 4Y9FA 2RFXA 1FNGA 1ACXA 2G2NA 3IRCA 4V2CB 4MZ2A 4Z3EA 1WBZA 2OMNA 1E8WA 1KY6A 2WZ5A 1J05A 4R83A 3VI3B 4LCUB 4XNYL 2OYPA 3HA0A 3DVFA 2UY6A 3C8HA 4QRUA 3OHXB 4J6RH 4MJIA 2FWSA 3B9VA 4JFFB 3VI3F 2AHIA 1K4CA 4HPHA 3KLAB 4QT5B 1FVEA 3PQYE 3PGFL 1UH2A 4J2XA 4U6HB 1WPCA 1A0QL 1NGZB 1WAAE 3IAPA 4P5TC 3HE7A 3AREB 3FN3A 1IFHL 1NGZA 3MLSH 4JCWA 4MCMA 1VFAA 1ZSDA 3MRRA 3QT2A 4Q6IB 4WU5B 4G5AA 2YXFA 4YNYA 1TMQA 1HHHA 4I18A 4M8QA 4GAGL 3RGBA 1DJWA 1RZJH 1PGRB 4XVTH 1E42A 1EVTC 4QLRA 4BZ1L 1S5IL 2OX5B 4WUUA 3K6NA 5F9WB 3FQTA 1OLZA 4BSVA 2N0KA 2W38A 2G4EA 3IBEA 4CVZB 3HMWL 1Q0XL 1X5YA 3GM0A 4GAJH 3EHBB 4NZ8A 3FQUA 1WFNA 3HZKB 3RB5A 1DCEA 2J6EL 1N7MH 2BDNH 3O2VH 1MIEL 2R4SL 1JHTB 1G84A 3TBYA 4PV1C 3I50L 3QO0A 3V0FA 1DYZA 3L3GB 3QCUH 4KO5A 3TF4A 3S8GB 3GNMH 4AQ1A 1JGEB 4JZNB 5E8PA 4ANXA 3TZVA 2D7NA 4ELMB 4Y19E 4HALA 4UB0L 3WFCH 5FGBA 1NKOA 2F7QA 4PJEE 1ITBB 5IVZA 1UJ3B 2YN5A 2V9RA 2YAPA 4QJ3B 1LD9A 3EGXB 2EDYA 3WUWA 4JFVA 1A5FH 3K4AA 4PJBF 3GZQA 3TWCH 1UZ8A 2FT7A 1Q72L 3BEVA 4Y16C 2Q8BL 4YSTA 5ERWA 2MQGA 3FFCB 4YDZA 2WLLA 5F7UA 3QORB 1KLGB 1LO2H 4D9QE 1J8HD 5AAWA 4DP8X 1LDPL 4WO0A 3GGWB 4U1HA 5L8LB 2FIKB 4HS8H 1JYVA 4XOEA 4ATTA 4BFIB 1PY0A 1PQZB 3ARDD 4IGBA 2H2SD 2P8LA 3QHZH 4I7ZC 2BXYA 2B20A 1Q4NX 1L3WA 1IAIH 3MYZA 1D5IL 2H32B 2JTDA 2PW2A 2V9QA 4KQ4L 5D7KE 1IKNC 3UBHA 3WSQL 3BPNC 1W0WA 2HSIA 5GS2D 1DO6A 4H20L 1MG3C 1KACB 1JMXA 5EUOB 4JGNA 1JGUH 4QYOB 1S2EA 3QQDB 4Y89A 5J1SC 2DYPA 3IMSA 4NPYA 2O6DA 2BY3A 3VFRB 4R0LB 2W5PA 4A04A 5E2WL 5LBGA 2AQRA 1OAZL 2V3DA 3D18B 3SGKA 5HY9B 1SBSL 5CD3B 3SE9L 4Q9RL 3VFMB 4GG6A 4OD3L 3HFML 2YQ2A 1H9VA 5JORB 4AM0Q 2HJKB 2KZBA 3B2VL 3RVVC 2EDLA 5ALCH 5E1HB 4OV5B 4FDWA 2IV8A 5FHAH 1CYWA 1JDAA 3BN3B 5FEBA 2NTSP 3UCRA 1BG1A 5F7KC 4J2QA 2ZX9A 4JFHE 1RZIB 2K0RA 5EOCJ 1GJWA 4PJXB 4O5LH 2OSYA 1L3NA 1IGMH 2B2XL 3B7RL 1E28B 2J20A 4X0NA 4R4ND 4OLUH 2WIIB 3ZYZA 4PG2C 4PJDB 4PY8J 2ZWNA 2CLRB 4ZFZA 3JV4A 4IBZA 3ECBA 4MA8H 4KRPB 3TPKA 4ZMPA 3AXLB 2P44B 5FYLH 4XBPB 5BCAA 4NN5C 1HL8A 2ZKMX 5CCKH 4HD5A 5IT2L 1BVKB 1Q1PA 1QEWB 3BPLB 3IPEA 1KZYA 5CJ8A 3F58H 1VKXA 5DJ6A 4MVBD 2VDMH 4A2HA 2OXGB 2UYLA 4XNUH 4QJ5B 3L5IA 1K4CB 4O9HH 4FA8A 1ZVSA 4JCMA 3LD8B 1RHHA 3H53A 1QEXA 3PWUA 3C6SB 4Y9EA 3SE3A 3ZKXC 3DHMA 5F1OB 5TDOB 3KWTA 2DQFB 2NW3A 2DLFH 3HRZB 3AWEA 1NMBH 4PJFF 4YSRA 1NIFA 1FE8H 4K3DH 4M5TA 3CPLB 1E6OH 3V4VA 4KROC 5DWPA 2IFGA 1IZJA 3QIUA 1T0MA 4PW3A 4D0DB 2X6CA 3W0WB 2FYYB 1OY3B 5E5RB 4AQEA 4E5XB 3CN0A 3NJMA 2XKSA 2VDML 2VXTH 3DJSA 4IEFB 1S8DB 4MMYB 3WIHA 5HYQA 4OCRL 5JXED 5EOCL 2EXYD 1EFXD 1ZTMA 2UXGA 3GZPA 4WNJA 1GGBL 2XOTA 3WGUB 5JIDA 1N64H 5FFGA 4OZGA 1QYGL 3BAIA 3QARA 4MDIA 5C09A 2PTVA 4A2FA 2G2PA 2Q3XA 5ISZA 3VI4B 1S3KL 4Z77B 4JRYE 4OB5L 2J1ZA 4WVRA 1UC6A 5D72H 3VI4A 3N40F 2RA1A 3PY9A 3EYVB 4WI0A 3RP1A 3AACA 3BVVA 2Y06L 4AYSA 1MCWW 1S7QB 2ALWA 4OLYL 3RY6C 2ZWSA 1HIML 5CJ5A 3QI9D 1I53A 4GT7A 4FL4C 4QGYA 1TZGH 5C2BL 1QRKA 2BVEA 2NY3B 4Y2DC 4HMDA 2OSWA 4R26L 3W0WA 4NQEA 1SXCA 2BH0A 1AKJD 1XH1A 5E70A 3U0TA 2XPYA 4FQCL 2HTLC 5IGXH 2MQCA 4M7ZB 4XO8A 3VMNA 5IKCB 1IILE 1ZHBA 4LU5H 4AZ8A 1GA2A 4MA1B 3BXNA 3MRQB 3TH3T 4BCXA 5KN5B 2KLRA 2HZHA 3X1GA 2DM3A 1Y6MR 2X4OA 1MJ8L 4LF3A 1MI5B 2FNBA 4AEFA 1XCQA 4JO2L 5K69A 3U0PB 1V7NH 3CJJA 4CDHA 4ZMTA 1UYWL 2NT1A 5IFAL 1WT5A 4NOBA 3H6AA 3HR5B 3QZWA 1F3JA 4DUVA 4OSUH 3BVXA 2GUOA 2KKQA 4XN5A 3S34H 3P3RA 4XWOC 3FUJA 3U6XS 5D7JC 5HHME 4PRPA 3ATEA 4JFFD 3VTMA 2WWMD 4XRCA 2J1XA 1F1AA 5DK0A 1OGTB 1QLEL 5I66B 5C7XL 4APXB 1DQMH 1JHKL 4PWJA 3AY4C 4HIXH 4JKNA 3SEPA 5I1HH 3UTQA 3N1PC 4JVPA 1NMAL 3MNWB 4WV1A 5K1JA 5D7HA 2DQCL 2Y36H 2I85A 5GZNA 5IBTL 3ZKMD 2NW2B 3MRFB 3DO7A 1U95B 4M7LH 2WVTA 2A9MH 1CD9B 1RZQA 4NKQB 1IT9H 5AYQA 4CNIA 1ND0A 2ZOWA 3TVMB 1HCYA 1A9VA 4U1NB 1IAKB 2XYCA 3MXWL 5DUBA 5IWLC 1W72B 2H8PB 4NQUA 5A6IA 2FRGP 4QAMB 4QTHA 4XZUB 3V2AR 1FL5B 2ZUQC 4QTHB 3OB8A 4RAUB 1ZMYA 3D39D 3OPUA 1T22B 2VXSH 1NBVL 2H26A 4HUKB 1FLTX 3DOIA 3QUKA 2FX9H 3EHBD 3MV11 3UX9B 3WEXA 3CX5K 1YY8A 3WEXB 2B4CC 3DYMA 3DXAA 4RRPA 1IX2A 4KVNH 4UQDA 3MNWA 3U36B 3V0AC 3H0TB 3WEAA 2FX9L 1UQSB 3K6FA 4G11A 5KZCD 2OI9B 4TS6A 4KTEH 3ZDYB 1ND0B 1JWSA 1CDHA 1EGJH 4WZ9A 5HI4C 2FX7L 1N70A 3NRPA 3K4DA 3VB8A 2ZX7A 1CGSH 3ZHFA 4G9FA 4V11A 3LEXB 3EGSA 4D0CB 1G7LA 4N8CH 1E7UA 3WFZA 3ECVA 3CFCH 4U7SA 5HHVH 2GK2A 1QLRB 4M7LL 2BSSB 4EQ2A 3NCYS 5CHNA 2BC4B 3X3GL 1FORH 3DGCR 4AKOA 4YAQA 2EABA 1GS8A 3BX7C 5DJXB 3UEQA 5HI3D 1RQ5A 4DSYA 2BIIA 3ARDB 4MDJB 1DBML 4N24A 3QQ3A 3M1CA 1FO0A 2APXA 4MNHB 2H3NB 1NBZB 3PV6B 3G6JA 4JY6B 3PHOB 2Y06H 3GXDA 2CPUA 2P24B 4OVUA 3T6WA 5FECB 1B0GA 1MFVA 4F8LA 4I5BB 4L0ZA 4LHQB 4X6FA 2OM5A 4GMTH 1HXKA 1BD2E 1R3JB 5DQJA 3C5ZC 5KVDE 2WQWA 5KANI 1E9QA 1QQDA 5ADOL 1PX8A 3W9EB 1X9RA 3NDZE 3L3DA 3N5AA 3OJ2C 4NQVA 4HS6B 4MWFA 1BX2A 5JPMA 4ECNA 1HHIB 4JKLA 3VH8B 3NJIA 4PBDA 3A22A 3P73A 3QH3A 4JPWL 2BCKB 1F18A 2J55A 4UANA 5IMOA 1F4XH 2AEPH 2BSED 3NK3A 2X4RB 4JREC 2XPZA 4RFEA 3ZZSA 4FTVB 2XY2A 1OM3L 3MCYA 4R7VA 3IJYB 1SLUA 4YHKH 3O3DA 4LAJH 5DZ9A 5JQ6H 1C9SA 3NIFF 2ZT9C 1N3NA 2ZCHL 2QBWA 1G4MA 5CJXC 1FH5H 5EBGA 3BP5A 4BFJA 1V5JA 2IAMA 2WZPD 1AO7E 2AJUL 1O6SB 1ZLDA 2D3NA 4N2EA 2E74C 3O6KH 2AZAA 1D6VH 1XSOA 2BSTB 5D72L 3M7FB 2M8XA 4Z0XA 4PS3A 1L5GB 1OVZA 4OZHF 5HHNB 3TZVC 3AC0A 3RWJB 4UM9B 4Z0BL 3RWEA 4EDWL 3CHPA 1PZ2A 5HJBA 1XEUA 3FQUB 3S3SA 3FMGH 4IHBA 4OCRH 4P2QD 4ZMLA 1MQKH 1FFPA 2AJSH 5IMLB 4R7DB 4FKEA 1XH0A 2J1YA 2R29A 1J1PL 2EILB 1NCGA 1AIFB 1DUZB 4YXLL 3FQWB 3OXSB 1PZSA 2CHXA 3V0VA 1OTSD 2DJUA 2AZUA 5LXGH 4AEHH 1HS6A 2R8SL 1D6VL 3MV7D 4H0GA 5FCUL 5D2NB 1QHQA 4TLUA 1WG3A 3EJTA 5E0FA 3O81A 1T0NA 1D2OA 5CBAA 4ONHB 1W72A 2H8PA 5I6KA 5T3XH 3CZKA 3DRQB 1G7IA 2C34A 4KUZL 2BY0A 4LLAA 1S7XB 3IFNH 2A9BA 4N87A 4NT6B 1HESA 4CN4A 2ENPA 5FF6A 4K8RD 2XN9B 5GJSH 1CFSA 4ZOAA 3Q2LA 1FPTL 1M71B 1T1WB 4N85A 5TQ0H 1X9QA 5ICXB 2IV9A 4RAUA 1IGJB 1WCBA 4G42B 2E9IA 3QQ4B 2EIZB 3HHSB 3BZEB 3VVWA 3MMEB 1JN6B 1AE6L 2F18A 2CHDA 3BWAA 1JE6A 4O2CB 1ORSA 4XMUA 3G08A 1IL1B 3N91A 1PG7L 4MS6A 3CFQA 1G0YR 5EO0A 1IEHA 2DMBA 4CAGA 2K6YA 4UTBL 1F86A 5EUOA 2AI0H 4JDVA 4M1CD 3SPIA 1B88A 3GSNL 3QQDA 3US9A 5KG9B 2VL5B 4YZWA 3CFJB 1BOYA 3CXHK 5DRZA 2IC2A 2AQQA 1A7PH 4BKLB 1FCCA 1X5ZA 3HPLA 4P8QA 3OAYK 4MAZA 3MLTA 4TUJB 1IC7H 2IWFA 4ZTOH 1FZOB 1U8OA 1JZ6A 4J8RB 4Q9RH 3ABKB 1K8IB 3MCLH 5E7BA 2Y5TA 2KERA 1HU8A 3FTSA 3GPEA 3VYNA 4P59H 3QUXC 5CJOL 4YDVB 4IOFD 3ZTNH 5KYWA 4N5ED 2GC4C 4PIRF 5I8KL 4C83B 3QPKA 1VFMA 3FN0H 2BY1A 2XYBA 4KC3B 4N8CL 3FUIA 3T0WA 4ZRGA 1GOGA 1NCUA 4DIXA 4DQOL 2CHWA 5IROA 3ZDXF 2K3HA 5KOMC 1ZLUH 4EVNA 1X5AA 3GI8H 4JDVB 2D0HA 3ERXA 4GO8A 3TT3H 3UPAA 1WFTA 4CW1A 4WQOA 3VXUD 3UTSE 4CVZA 3MUJA 2XC8A 4RGOL 1T5WB 4U4IA 4HEPG 5GS0L 2BRRL 3QZWG 5GRVK 4LKXB 3UGEA 3FQTB 2CMRL 2X0WA 3WIAA 2YPVH 2Q3AA 3QA3A 4Y2OB 3MLTB 3D3VA 5IUCA 1JHTA 2ZOTA 4HJ0C 1XCTB 4B9GA 2K9FB 3DJZA 4EZLA 4ACPA 4X5RA 5KW9H 4C8XA 1KB5A 4PVNA 5DHYB 2J57A 5JR1H 4PJXE 1B0RB 5AW8B 1T1YA 2CNYA 1EHXA 1FIEA 4TL4A 3FT1A 4JZOB 3TBSA 2JLLA 3VDBA 3FUKA 5B39B 2P43B 3L4VA 4AQ8A 2VRQA 1QTYT 3EADA 3HHRB 5C0RH 3O6FC 4IBUA 4KX9A 1ETZA 4JRXE 5E8OA 5C0NC 1BZDA 1T4WA 3BQVA 4KQ0A 1WTGT 2WXNA 3CDGA 3G6JE 4HJTA 1KEGL 4XMWA 1TNMA 2E0PA 5EFIB 2F54A 2FX7H 2CXKA 5LXVA 1B9ZA 4BUQA 3LKPB 2ZD0A 4KTEL 4LCUA 4OJAA 2V5YA 5ICYA 4GPVA 1OSZA 3NK4A 4OH2A 3I3EA 1YPZB 2FGZA 3R1GH 3VI3E 5FUOL 1FO0L 3BD4A 1Z3GL 4Z7VF 2X2HA 5IBLD 3D39E 3HBPA 4WI8A 1OAKH 2VUYA 3ULVD 3WDIA 1TJXA 2VZ3A 2Z6FA 4HUXB 4ZDHB 1SJHB 2TAAA 1V3MA 4ICWA 3DGDA 1FYTE 3QJTB 4QRPE 4R7XA 1FV1A 4KAQL 4NSKA 1BWMA 1TZ8A 1HAWA 1HN1A 1JJUA 3B8YA 1BPVA 4HKBB 2APSA 5CF3A 3QFJD 1ECZA 1ZSDB 3MRRB 4Q6IA 5I74B 5I9QB 2OJZH 3PWVB 1KY7A 4S1QL 4DW2H 5A2KH 1T04B 4ZPVA 4PN6A 4M1GH 4ODWA 1SN5A 3RRQA 1RIVL 1TMCB 4CU7A 4X98B 4JBSA 1J10A 3WMQA 4XWOD 4HK0A 5C0CA 3LKSB 5GS2H 1F2XK 3S0PA 2BS8A 3I2CL 1IGCL 1KXTA 2AV1A 4RNRA 2PCPA 1JK8B 4X9BA 3PJSA 4N6RB 4ZBJA 5D93C 4FQJH 4NGHL 5C08D 4DUWA 5C7XH 1Q94B 1HIMH 1WQVT 4NQDD 5ID0A 1S7SA 2BIPA 2H4EA 2IWGA 3IMVA 4OGYH 1YO4A 3KYKL 2QPEB 3TBTA 5FYJD 4UTBH 3A6OA 4KO6A 4MJ6A 3WIFB 4KJYB 1P5UB 2ZG2A 2VB5A 3FFCE 1CICD 4NQQA 2E27H 4MMZB 1K3ZA 3NCEB 3K72B 1JPST 2YKLH 4PTUB 1G9MC 5EG6C 2L04A 3LXCA 2ICWA 4I77H 5GSRA 3FQRB 2BSBA 1FVCA 1M7UA 1RJLA 4LCYB 1NAMA 4XTRC 4NO3A 4FNRA 5CEZD 5B38A 3LZNA 3B2UD 1MHPL 4OJFH 2FJHA 1T7ZA 1KLGA 3PPEA 3SDCD 4R2GB 2Y2WA 5D6CA 3FU3A 1EEZA 3BEVB 4XP5L 1JZFA 4KRPC 4RLDA 2VN6A 1CFTB 4PP1D 4TUJA 1OP5K 1RI8A 2IH9A 2EEBA 1XVSA 4Q0XH 1H5BB 5DQ9B 4YHML 4HWEL 4WV1C 3SE8L 5AW9B 1KXHA 3SKNB 1HFUA 4Y4HA 1CTOA 1FBIH 1TQWA 4P57A 3STLA 4Z5RA 4WEUD 3GIZH 4HKZA 1UCTA 4D8OA 4YXLH 3ZKXB 4K94L 1SXBA 3CDZB 4JUTA 5A2JH 5BS0B 1RY7B 2N7AA 3JYBA 3ENEA 4JFEA 2RCSL 4JPIA 3V4UH 1T4KA 4B50A 1UQSA 3OLEA 4MMZA 3BLPX 2B16A 2XU9A 3IJ9A 4P2QB 4U0QB 5HDLA 5HGDB 1N4XH 4KROB 4YDKL 3I75B 5JPNA 5DJDA 2ZWKA 4JRXB 4ZQKB 4XX1E 2PYEB 3UYRH 1GOHA 5DFWH 5EDXA 5ABDE 5J3HD 1TFHA 4PD4K 4Y16D 3V4UL 3VD4A 5F3FA 5J7CC 4MXQD 3I6GB 5EBWA 1XQ4A 3BRFA 3BYTA 1T1XB 5F0LB 2FBJL 5FO7A 5F1KC 1UB6B 2ENYA 3DARA 4Y8DC 1SHMA 5DD5L 3FS9A 4MA3A 5D1QA 1KPRB 3DI2B 4L2YA 3NAAH 4Q7DA 3DRTA 5E4EB 1U91B 3RUGA 2AJ3B 4WHYG 4FG6D 2XN9D 5CLXA 2UWEF 2DEWX 3D1MC 3BZ4A 3KPMB 3LN4A 4ELMF 4NQSA 5AW3B 5E8OB 1A6WH 4BSVB 2H3KA 2R4RL 4F1ZA 3DYOA 3L5HA 3ZR5A 1P2CA 2DQUL 1HTYA 2ZYHA 5EU3B 4WO4B 3F58L 5AVRB 1JZDC 5CXPA 3RL1A 5HI5C 3EGDB 1L9NA 3QIBA 4EN3C 2W0PA 5ICYB 4ISVB 2CBTA 3VSTA 3V6ZA 3BW9A 5IB1A 5BPPA 3RA7H 2LTQC 1QFUL 5A2BA 2O30A 3GI9L 3L8QA 4FG4A 5A40E 1KENH 5C0DB 2XSKA 3AXIA 3GSNA 3Q5OA 5K33A 1BX2B 1QUPA 1MDAA 5DRWB 5I1LB 4E41A 1D5IH 1C08A 1WEJL 1E9QB 1QQDB 1S5HB 1F6AA 1CL7I 4MA7H 3RILA 2HVJA 4XNDA 5GSVA 2XVGA 5DF0A 5TFSH 4RFEB 5E0QA 1Y18A 4LQFH 4GQPH 1FFQA 1RXLA 1KCLA 3LIZL 1XF5A 3TZVD 1CXEA 1JRHI 2ZPKH 5EZLA 3QH3B 2ZICA 4PRIB 2VM9A 3BH9B 3IGAA 5TJWK 3BZFB 2X89A 5ABAA 4ZFQA 5HDRA 1MG2C 3GMQB 1CL7H 1P7KB 2NY6D 2Q1EA 4M3HA 3D25A 1TOXA 5D7LD 3QE5A 3P02A 5C09B 4E9TA 5EF3A 5KVGL 4GG8A 1G7MB 3IFLH 4P46D 3SDAC 1CF8L 3SKMB 3MNZB 1U4FA 2EDDA 4BV1A 3F7VB 2K4WA 3WY1A 4C56E 5T3ZH 3FW6A 3N41B 2DQMA 3VMOA 4NX0A 4XOAA 3LPOA 1BVOA 1EZVX 4LCVA 2F2HA 4JDEA 5KJRH 1MJ7L 5DMKA 3HN3A 1MWOA 3QI9A 2CO2A 1AAJA 2E7CA 4AL8C 1NH6A 1QPPA 4NQEB 3VXRD 3DGGA 4MZ3A 5IBUB 3JWOC 4UDUB 4K5OA 3SBPA 1TZHB 4OGAC 3DC0A 4ZMOA 4JN2B 4W9DC 1WC7B 4NRZB 2VXSL 4ALAC 3LIUA 2NY5L 2K8QA 4DKFH 3SDXE 3ALWA 3UROR 5JXEC 4M4PA 5IBLC 3HUJB 2EH7L 3QPXH 2DKUA 3FF8A 1CFSB 3O6MH 3T2LA 5E1AB 3NPZB 1DQLL 2ZCKH 4LOUC 5AZ2L 4Z7WB 4NT6A 3KWWA 8CGTA 2NTFA 4H40A 4DO5A 1KB5L 4YAQB 2MPAH 4JJ5A 4G8IA 4KX7A 4F58H 2VSKB 5D96B 3M1BB 1MRCL 2ZWLT 3ECUA 3D9AL 2E56A 4D3CL 2P5WD 2B08A 4IBLT 4C57C 1MRDL 4L8SB 1NCHA 3EJCA 4IW4C 1E65A 4JFUA 2VE6B 4EKJA 1A7RL 1OTUC 3UGXA 1I1AC 5EO0B 2F5AH 2Z9TA 4WHCA 2HX8A 3DIDA 1FYTD 4QRPD 5C1MB 1R3HA 2G2RA 3JV4B 5HYSG 3DO7B 2E5EA 4FQXD 2ZF8A 3QFJB 3A4AA 1DVUA 1HZHH 1IM3A 3OJMB 1B9KA 3RIFF 3QUGA 5DUBB 3QXVA 1TJGH 3U7YL 1DQDH 2ZUSA 4L1TA 4M8RA 4W68A 4Z7VE 2CGRH 3RVUD 3FH5A 1F56A 2ICEC 4U1NA 1T1XA 4JR9H 5I8KH 1AXSB 2LLNA 2MIZA 3E1F1 4UAHA 1AXSA 5DR5H 4B5ZA 4Y5VB 2VOTA 5EEZA 3RVXC 1IGYB 4DN3L 4NC1C 4N2HA 4WI7A 3APNA 2UUDK 3MCLL 2QSVA 4JFEE 4P2OD 2DH3A 2HYMA 3MLVL 4ERSH 3U9PL 4EOWH 1H6TA 1NMCC 4N90D 1QFWI 4Y5XC 1JWMB 1SYVB 3MAWA 2YKKA 3DI3B 4X5XB 1VZHA 4UI2A 2BOBA 3IDMB 4NFCA 4A37A 4YHIA 3T4YB 4NUGH 2PPEA 4E9VA 5DJCB 2A6DA 1AI1L 1QKZH 2FR4A 5E6IB 1UT2A 1HCFX 3C6LB 4HKXB 4LSRL 4UT6A 4WFGD 1U8CB 5JHMA 2Q86A 1VF5C 3KPRB 5DQJB 4HOXA 1XB6A 4LGPB 4W9GC 3WJLA 3DV6B 1THCA 1GGBH 4UM9A 1FIGL 3JBG7 4ELKB 2VDKH 4WW1B 1I1YB 3MLYL 4ODSL 1RZGB 4Q52A 3RUGE 5LG1A 3KAAA 3P3YA 3R0NA 5AL0A 4YN3A 1FG2A 1OQXA 5F6HJ 4BD4A 2ADIB 3H8NA 4KXZI 1E2ZA 3SY0A 3X17A 1H3TA 3FKUS 1J9SA 1X5JA 4XP6H 3U0TB 4QI3A 5BRQA 4JFHD 4GI9A 1HWGB 4GQQA 3FTGA 4BBWA 2VR9A 3BZ5A 3S35L 3VH8G 5E2VL 4K15A 3C9NA 3LHPH 4HGKC 4PRIA 3GXNA 4PJAB 1NMBL 4MJ2A 4Y4KA 4WK0B 5AOJA 4G8FB 1G7MA 1CR9L 1XGTA 2KL6A 2RJMA 1MCIA 5F3HB 4PB0L 5E8EB 4PJ8B 4HGWA 4ZMNA 1CGTA 1F0LA 4R7NB 4TNVF 5E08H 4OCWL 1U8QB 1YMME 5D2NC 4EF3A 5DJCA 4X80L 2QKSA 3KLKA 3NIDF 3QO0B 4U33A 2BLFA 4KKLC 3S5LG 2EVFA 1CLOL 1CF1A 5E9DE 4LL9A 1WAAA 2CO6B 2C9PA 2NNCA 4L8DB 5I1CH 3MVSA 3UAFA 4B60A 5T3XD 1R0AL 4FG6C 2VQUA 3IDXL 4XOCA 1GAFH 3IJ7A 4ETQB 2CKBA 4Z7NE 2P5EA 4A66A 2XWJB 5D2NE 1IBFA 4WSJA 3S5LA 2JJSC 1FUNA 3NCJL 1F8TL 2X1WL 1LVEA 2W65A 2XQ0A 2B5IC 4QRRD 3CFBB 3T6VA 3RDTB 3VJ6A 3I74A 2BSCA 3TM6A 4ANKA 5D7JA 2A2QT 5EC1B 4ZMQA 2PO6A 2R0KL 5IREA 1SPDA 2XV3A 2FX8L 5LNDA 1OXYA 3AQDA 4RMWA 1I1AA 2QADB 1EJOL 3OXRA 4JVUA 4GT0A 1DJIA 1CE1L 2COQA 4KK9C 4N2GA 5IV2B 1ES0A 3QYCA 4JM2A 1EXGA 4Y19B 5EIIB 3DPBB 4ZOCA 2DYSB 4J27A 4C4UA 2YRBA 3STZA 3PL6D 1OAZH 3BDBA 1E7VA 3BSGA 3EJQA 3PWNB 4YDMA 4ZO7A 5AVQB 3LIZH 5ACLA 1JGVH 2Q3ZA 4HX1A 3OQRA 4H8HA 1P53A 1LP9E 2J21A 4PJ7B 5ELIA 3M6DA 1MRFL 3SY6A 1BREA 2DMKA 4G80B 1GYAA 1G94A 4FERA 1XH3B 3A3YB 3A21A 1U33A 2VISB 4KDVA 4G8GA 3U9UA 4F24A 4HIQA 4F37K 1J5DA 2OXHB 5FO8B 2J1KA 1RURH 4DAGH 2HRGA 2ZKHL 3PDOB 4JDZB 2EYTB 4FXGC 2VKWA 2J5LC 4LKXA 2J44A 4OV5A 1DVSA 2E9WA 4I88A 3GKZA 3U9WA 4D9LL 1WBYA 3T3PE 1URZA 4GINA 5DHYA 1V3JA 4HFWB 5MERA 4OZFG 4JKMA 1D7BA 1JZ7A 4RGNC 2Q8BH 2EXSA 5EEYA 2I07A 5F7EL 2NY6B 3FRPB 1KIUB 1OK0A 1KLFA 2VWEC 4P3CL 4TF4A 2IEPA 3EOBB 1AR1D 2DS4A 4P46B 5J3HC 5HHQB 1ZT7A 1WA0X 3L9RB 4MXQC 1ZLWH 2XTJB 2XQBH 4W9FC 3GO1H 3S4SA 5A2FA 3IJSA 2XKNA 5FPIA 1VFBB 4ONGH 1FNSH 1EGJL 2R1XB 2VKXA 3VD9A 4G6KL 1ZHNA 1NGQH 4YXKL 5ANMA 1G6RH 1ZT1B 5I30L 1OWRM 1OGAD 3HZMA 4RMSA 1C5CL 4P04A 1YYMH 2V5TA 3AY2A 1J0HA 1ASPA 2QFPA 3CSPA 3TA3C 2JKWA 1P4LA 3ISRA 1RJYA 1QWUA 1TJHL 1X5XA 2QVMA 1PJWA 5F88A 2VDNL 4AMXA 1KTKE 2WXHA 2NR6D 1E43A 4ZSOA 1DVZA 2C3WA 4AIZB 1OO2A 3QUYD 4H0HB 3RNKB 3MBWA 3GJEA 1KJ3L 4H8WH 5I1CL 1BDYA 1KELL 4BK4A 1U8LA 4EN3D 3WELA 4NRYB 4P23D 4OZHB 2YS4A 5E99L 2LFGA 2XVLA 4N0UB 4PJAA 3GIZL 4BINA 4L29B 1OTUD 3F85A 3I3BA 3AWFA 2C7FA 2KBGA 1D5RA 5HHQA 5L88H 4JM2F 3GUTA 2O4EA 2YGNA 5DS1A 5DWUL 1LO5A 1RU9L 4Y5YB 1ZD6A 4Q2ZA 5ERWB 4A2MA 5FOBB 3NDYE 1NANI 4Z7QF 3SGDI 4RQQA 1JK8A 5I9QC 1FC2D 2VXUL 3KGUA 1PD0A 1Z0NA 1WISA 3WHE0 2W59A 2AV1B 3GXUB 4BRJA 1GXEA 1UFUA 5CFHA 1IAMA 3C2AH 5GRJL 4JB9L 5AW4B 5J5EA 3DROB 5EPMB 1PLGH 2K70A 4YS4A 1E6JH 2Z91A 3BUYA 4JG0L 4OM0L 5CKGA 1TO5A 3B34A 4IQHA 3O9WD 5F7BA 1LXMA 3KM1A 1WFJA 3NJLA 2OULB 4IOFC 4D2NA 1XF5B 1AR2A 4LRIA 5GGSY 5EO9B 1I8MA 2HVJB 1BXXA 3VFVB 3HW7A 4HQQH 2VDQL 2Y1AA 4ZYKA 3IKKA 3GBLA 4AYDC 2O5NA 1MJ8H 3H56A 1WZKA 5KJ7E 3KGTA 1Z9NA 4JB9H 2BS9A 4MMZC 4DH2A 1I1RA 2WYTA 4LSDA 1YJDC 3LKNB 3MO1B 4YX2L 3WIIL 2GYSA 1NIAA 3MYJB 4LBAA 1NCNA 4HFUH 1Z1WA 3OX8B 3FHQA 2AERT 2GK0B 1QW9A 1XGPB 2DD8L 2OMWB 3BVNB 3DIFA 2BIOA 3L7EB 3SGEH 2JCWA 1F00I 2YQ3A 2DICA 2OCJA 3MRCA 2DQIL 4JL1A 4E9XA 4S1QH 2JTYA 2K4AA 4C55A 3S7GA 4HH9B 4YDJA 3ZYJA 3ZLQC 5I75B 5IQ9B 3EYSL 1UFGA 2QKIA 3ECBB 4DKAA 3LX9A 1CMOA 2QGDA 3GK8H 5KAQF 3VFVA 3ROLB 4LOUD 5C0ND 2WTOA 3O4LD 5ETUB 4FJZA 3BGMB 1KCSH 4XHJD 2CIIB 5D55A 3T65B 2XBTA 3ARBD 1Q9WB 1KBGL 4R4NC 3GBNL 1LLAA 3R0MA 4ZUUB 3BUDA 2XTLA 4YPGB 2HP4A 1EEZB 3CLWA 3RGVA 4DETA 5LG6A 2QQNL 3NIDE 4LEEA 4DHLA 3GB7A 4FOMA 5C6WH 3WE1A 3CN2A 5IESH 1IKFL 3QXAA 1AD9A 4Q6YA 4QWWC 4R96A 4JFYA 1LE9B 1DQJB 5AWNH 4HIPA 3VWJC 3ZTJH 1T20B 5CS7A 2ZOLA 4DWHA 4QRRA 2E47A 2EDOA 1HZKA 2KQMA 3CN3A 1YN6B 2W9EH 1E5YA 3CDZA 3EAKA 3T2NH 2DIBA 2X5PA 2XT1B 3EBAA 4JQIA 4Y1AB 1IC1A 2YXVA 4N2IA 4N2OA 1OHQA 2Z7ZA 3WU1A 3WAJA 3KL3A 3FUFA 4GXFA 3UIZA 3RKDD 5B38B 3ARQA 3IFOA 2XVKA 3TV3H 3F6IA 2AK1H 2EIDA 4XPGL 5EMYA 4H88H 5EB9A 3KEDA 2PWGA 4I9WD 4XN2A 5T1KD 4WY7L 1ZGLM 2PP7A 2IVFC 2EECA 4I2XA 2EZ0D 4S1DC 3KYNB 1O6TA 3OZLA 3BP4A 5IQNA 4ANVA 5A3ID 3PGDB 4DVBA 5I30H 5B8CB 3OF6D 5EF1A 1ZLSL 1TSRA 3AU1A 3BT2H 3MGOA 4O5LL 3VXOA 1NBCA 1D9KB 4X8JB 3K6SB 3EG9A 2LTQB 1GCYA 5CEZE 1PPIA 4LLVB 3DETD 3IFLL 5FYJH 5CBAB 3HJEA 1EEYA 4WIQA 5ALCL 2VDPL 1AYOA 4G8GE 4KMTH 5C7ZA 4P3CH 4U6VL 1IV8A 2ZAIA 3PL6B 4BH7B 3WY4A 3MV9A 3E3QC 2ARJB 1T1WA 4CSTA 3TBBA 1A1MA 3DX1A 1SY6A 5EU6A 1CDBA 4AOFA 5GISH 5KS9A 1PU0A 4PRHD 2WQ8A 3QZNA 4PHXA 3MV7A 1IFGA 1AQKL 4M02A 1FVDA 2Z65C 3GSRA 4QF1A 4MMXB 4TTGA 2X3BA 4QXGL 1I8LC 4JJOA 1E3ZA 4E9WA 1OGTA 5I66A 4P0DA 3V7AG 5C86A 3BWUC 2ILLA 3HCVA 3SDAB 2YAOA 1YMHB 1E90A 5BNXD 4E0RA 2DKSA 3I84A 4UWQB 4P2OA 4ILDA 4KKNA 1OAQL 5AD0B 5IMMB 1I85C 1VRSA 3SD2A 5DK3A 5EOQH 1BZ9A 4WCYH 3LZFH 1SJEA 5KYXA 1ZA3B 5L2KA 4HOWA 3KPMA 5EO9A 2XN2A 1I8MB 3LQMA 4ZYKB 5C0GB 2A74B 5H4ZA 1M6OA 4ZOEA 1M6OB 2QSCH 5E6YA 4BJLA 1VFOA 1KBBA 4XXWA 5G5DB 1KXVC 3WUWG 4A6YB 2IO5A 4U6YB 4OTXH 3KBHE 5E1AA 1AZBA 5I17A 1QNIA 1OZUA 4TVPH 1CFNB 2R69L 3P0VH 2JQZA 3LZOA 5F3BA 1MLBB 3Q13A 1CLZL 2JSFA 4WLCA 3HZYB 4AEHL 4BFKA 1RD6A 1PY4A 1ZEAL 4HCRA 3U6RB 2LLLA 1ED3B 4JHVA 2CA4A 1HEJC 4L8DA 3FT2A 2FJGA 5F1IB 3HOGA 4XCEB 4LMQI 4XMPL 5D4HA 3U48A 2ICCA 3C8KA 3LSOB 1V3LA 4N4YB 2V2WA 3WDHA 3V4LA 4ZX3A 4X4ME 2F5BL 2C4FU 2CBPA 4AZUA 1N6QH 1BLNA 2Z92A 2OP4H 4UAOB 1KCRH 1H6EA 2E4TA 1X6NA 3LKQB 2BNRD 4PJFB 5TE6H 4U1IA 3MRDA 4NI6A 4LPVA 4YDNA 3MQIA 2ZXAA 3HZVA 3D33A 4X80H 1L9TA 2I9LB 2OL3A 7PAZA 2AXWA 4L48A 4X4YB 4BZ1H 5EU5A 1XCXA 1QLRA 4P23A 3VFTB 4HULB 3WE6B 3NTCL 1JDCA 3QG6B 3SJVB 3WCYA 2WBXA 4RVBA 4ZW6A 2KZKA 2X05A 4H8WC 4JFTA 4PS4L 5AQ0A 3G08B 1YNKH 2M1KA 1QSEE 3ASWA 2ADJB 5DUJA 3FT2B 2WVVA 1NJ9A 3DX6A 2YBGA 1JWMA 1KCBA 1CFQA 1BXVA 5GZOC 3VXTA 3MV8A 4JM2C 3UYPB 4XC1L 1ZXKA 4W6XB 1XB8A 1XGUA 2CH8A 1RZFH 5D7IE 4AJVA 5J4MA 1EJ8A 3GDBA 4I77L 5HI3C 3QR2A 2JB5L 1KGCD 4J8RA 1MHCA 2ZOUA 4Y5XB 1WV7T 4YHNA 5EUOF 4NO0D 1EZUA 5F6HI 1R4XA 2UY7A 4NUGL 1YEWA 3UO8B 4L3EE 1OSPH 2E75C 3GMOA 4FFZL 2I07B 3LB6C 1YY9C 4NC2B 5CJXA 4EAEA 1GYVA 3U2JA 1JNHB 4WGWB 4LP4A 1IGYA 4FADA 2R9HD 3TTYA 1H19A 2HFGL 1IKNA 4PJ7E 4LXFA 5KAQG 1YY8B 3FQ1A 4X98A 2QGBA 2KLTA 2ZXCA 3AMKA 3AS2A 4FQ2L 3MRBB 5HHOE 3BZ4B 1FORL 3U79A 3L1OH 4PCKA 3PF2A 2GIYA 4A67A 3B1UA 4XP9L 2BIQA 1NQBA 3QUYC 2Q5BA 3SODB 5T1JA 1ZSHA 4JG5A 2DIAA 3WEOA 3D4YA 2AK4B 4HBQA 3IDGA 3EH4B 2ZYIA 3CFEB 3L9YA 2GI7A 3GSOB 5I15L 5L2JA 3SQRA 1BLIA 2JK5A 3QDHA 2EIKB 4K8RL 4U49A 3FZUC 2Y24A 1M57B 4QYOA 2MRYA 1U0QA 2OL3H 3SO3C 1Q9KA 5IW6A 2XN0A 1W0VA 5DMIH 2R15A 5JIPA 4F8TA 4K3EL 1PZUB 5GQBA 4BWTA 1BXUA 2X4RA 5HY9A 4OZ4A 1W15A 4G7RB 4UTCA 1SN2A 1ZHBB 1FO0H 3RDTA 1CE6B 1K4DA 4LBEB 1Z9PA 5DC9B 3ULSB 4M8VA 2FQGA 3D09A 5HGAA 5AB9A 4MDRA 4TV3A 3N42B 3MUHL 4TVPE 1IEAB 4NNPL 2ZAHA 1G9NH 2AP2A 5EN2B 4LF3B 2EH7H 3WO3B 2JQMA 3BAEH 4X8XA 1Z5HA 2LU7A 2QVKA 1S9YA 2X2UA 4UDTB 4PJ5E 5K9QG 3ZY7A 1KELH 3EBHA 3V5HA 4L37B 4P5MA 2RIKA 2YARA 2TRYA 3LZFL 4XB7A 4NCDA 3MROB 4WW2C 2R7EB 3O45B 3KS0H 3UC0L 4EZKA 1AZZC 3SE6A 5A43C 1S7UA 1OARL 3SBRA 4FABH 4WFED 3Q5YA 4NRZA 2Y69B 3TEXA 4F7EB 5KJRL 1E4KA 4JAMB 3Q8AA 4UYPA 1Y1DA 2Y07H 3IN0A 4PVBA 1D9KD 4HJSA 5ICZB 2C5DC 1QLFB 1F2QA 3D0LA 4ONGL 1NUGA 1P7BA 5KSVB 2EE9A 4LOEA 4WHTA 3FU7B 4LPUA 3TBWA 3O3EA 3OMNB 5FA3A 5BVPH 1PNCA 2A77L 2MOGA 4GXUM 4XVSL 2HT2D 4XVOA 4FTVD 5F3HA 3FN0L 1KV3A 1SVCP 3KPTA 3X13B 1E8XA 1MAKA 1S9YB 2HFTA 2XETA 2WWNA 2PYEE 3MCKA 3DX9A 4Y7MA 2AQTA 1QOKA 5T1MA 1GOFA 3K5SA 5I2IB 1HJCA 3VSUA 3N85L 3CCHA 2CCVA 5FKPB 2C9RA 3RVTC 2JWYA 3ZIYA 5F7MC 1CICA 4RGNB 3FU5A 3BPCB 4XBPA 1MAJA 1L4IA 4MCYB 2NXYC 2VDNB 2FGWL 3UTTB 4YBLC 4AQ8C 4P9HH 1HILA 4KH2A 4K23H 1ZVSB 2I7OA 4PTTA 2XTJC 4KHTL 5DI8A 4E9RA 1QBML 2NQDA 3GXIA 4M56A 3UC2A 3C09C 2OSXA 4D9RE 3OMIB 1M7DA 4KI5D 4U1LA 2NY0D 4FQ1L 5IHHA 4GEIA 4KY2A 1AC0A 3DMMA 5KOVC 4FNLL 3W11D 1PLCA 3D48R 4U6XB 3H42L 2IGTA 2NNAA 3NCXA 4HV8A 5G4OA 1QFPA 2YD2A 1SF5A 1U3JA 1O7SA 1SM3L 3GZKA 3L6FB 1ET7A 2BMKA 4QEGA 4R6UA 4V1DE 2FWOA 3KLLA 1MAMH 5EH1A 2ATPB 2HMIC 1RIUL 3BPCA 4XAWH 3PDOA 3LZQA 4GRWB 3Q3GA 4ZODA 4F9PA 3U9UB 4UBDD 3MSPA 4BFGA 2IAMD 4C59B 1A6ZA 1TO4A 2F7IA 4U0RC 4RDBA 4KKAD 4MNGB 3GUFA 3ISYA 5EHFA 4YVNA 3LXAA 3PDGA 4PGBB 1W72H 2BNRB 2W81C 4DCQB 3T4AC 5GGRY 3ME0A 4DN4L 1YEIH 3K2UL 1P1ZB 1S4IA 1EBAA 2GUYA 3JTSA 3QIBC 1ID2A 5GIRA 3V6BR 4YE4H 4YSQA 3IJYA 1GZPB 3MRNA 2VLJE 1MFDL 1AZRA 2VCOA 1JG9A 2LFEA 1K85A 4JM2D 2WK2A 3EGXA 3C12A 3O6KL 3QXWA 2AVFA 3PV7A 4JGJA 3O3BB 5FK9B 5IB4B 5LLIC 2X2JA 3AROA 1RUML 5A6LA 3VXUA 1G0DA 4EPSA 5JNYA 1MWAL 3H9SE 5J13B 1CN4A 1I8LA 1PZ5A 2GY7B 4HSAC 4PJHE 5MEOA 1UKQA 1SLVA 2LW3A 1EV2E 1UGNA 1CJYA 5C09E 3V5DA 4GRLB 5ISZB 5JW4N 3V5HB 3AQZA 4R7NA 3FXIC 3DMMC 1OE1A 4OJYA 1AY1L 4UQIM 2D7PA 4NC0B 5D5MA 4JPWH 3R7RA 2NYZA 5AYUH 1M1XB 1BJMA 1RK7A 3E6FA 4PJGF 5CMAA 4DO6A 5JLZB 1Q9LA 2NUPA 4J23A 4PJ7F 4NWTL 4X6CB 2BM3A 3NGBC 4OGZA 3CU1A 5C0FA 1YEDB 5E2UL 1IMHC 3L95B 2J71A 2EE6A 5E6SB 1KT2A 5IEHB 1OWWA 5EBMB 1ECYA 1TETL 1QG3A 4ZPVB 5HVHC 1VEPA 1FVCB 1RZKL 3GS0A 4OM0H 4GS7B 4P5SA 1A3LL 4PWEA 4ZTPL 2B9BA 4N1CA 3S5YA 5DHMC 4O58L 1B2WL 2OR9L 4LDEB 3WUWB 4G9FD 2E3VA 1UA6H 3SDDA 4XO5A 3O3BA 5I75C 1WWWX 3BFQG 2P46B 4D94A 4OF0A 1H3WM 2GAZB 1QBBA 1RULH 4FMFA 4ALAH 3RZWA 5DK2B 4TNFA 4YHLL 5JPNC 1UCBL 3GJFB 3GB7B 1T2JA 3MR9A 4KZDL 3GRWL 2AMUA 3LV3A 2BHUA 4GKSA 3ZL2A 5I6PA 2YRLA 2XICA 5T1LA 2AK4D 5LKNA 1CYXA 4JG1L 2EVJA 2H1LM 1PZ3A 3KR3L 1QATA 5IM7B 2D8KA 1ET8A 3AU0A 3HZYA 3KLQA 1CGSL 4JFDB 3EYUH 4CRPA 3QCUL 2G3NA 3QZBA 3KD4A 3FPXA 5F96L 2UVEA 5GGSA 1AP2B 4TL5A 3HNTH 4L1DA 4OIAA 1HT6A 1VEOA 5C70A 1L0PA 1ETA1 2CRMA 3QXTA 4JRLA 1LGVA 4CC0A 1NIDA 3QDJE 2EH8H 3RWDB 3UO1L 4AYBA 3U4AA 1OARH 4P2RD 4Y4FD 2APTA 4KI5E 3HAEH 1IAOA 2JFCA 2VN3A 4GP8B 3H7LA 2JV6A 1TEYA 1KPRA 4J3UA 1DDHA 2JCCA 4ZMZA 1JPFA 1KGYE 3OKLB 4NXSA 1LO0L 5F0JB 4RMBA 3LN4B 4KX8A 5B8CC 4OBSA 2CK2A 4OZFA 4Y0GA 3DVNB 3L1GA 2VE6A 2NOYA 4GQ9H 2CJUL 4L9LB 3HC4L 1EEYB 3MV8B 4EEEA 2UZIH 4OZFH 1D9KC 4X99B 1HYRC 4P2QA 2IQ9L 4NQDB 3LB6D 3LXUX 3QEHA 2O93L 3R4DA 3DX6B 3NSCA 3IFOB 1LHZA 1T6VN 5EU6B 4UF7C 3V4PL 3VGBA 3BJLA 2IALB 2GSMB 4KK9D 3MZGB 4HG4J 3FUNA 2VM4A 1NMAH 3CHXA 2CALA 4NO0A 5DMJB 3N9GH 3HI1A 4N2NA 3HAEA 4G9DA 2Y5EA 2ZKHH 1I7UB 2I7SA 2QSQA 5AVXB 3TBVB 4HCIA 5LAXB 1T20A 4AIZA 3ETBJ 5E4AA 4IDLA 3K71B 4O2EA 3HJ0A 5GS3A 3DBXA 4G72B 2P5WA 1KV7A 3RVTD 3EXLA 1YC7A 4HKZB 3U46A 1NDGB 3CH8A 4WFHE 2AAVA 3U46B 5LJYH 2WBJA 4HJJH 5D2LF 4OF3A 1PZ5B 5E8NA 3T0EA 1X44A 2MNJB 3BGFB 4DGYH 3ARVA 4PJGB 3TO2A 3TYGH 5IB4A 1A6PA 3PIQA 2OTPA 3OSKA 5HHXH 5TQ0L 1SJXA 5DLML 3IF1A 4O2FB 3TONA 3OKKA 2Q0ZX 1KCWA 3ZMRA 3WIHL 2WSKA 1FZJA 3KMDA 1V54B 4YSEA 2PXYA 3RWIA 4NDMB 1IGFL 1RUMH 2Q7AA 3RWGB 3NCCB 1JZ3A 3WFEH 1CLYH 3K6IA 4RWYH 4JDEB 2AJXL 5I5MA 2VC2B 1RHFA 2XUWA 5FUCE 2FJGB 5F1IA 1KENL 4FYSA 4HC1A 5E7FA 1KGCE 3VFOB 5IVZB 1HI6A 3FQ2A 3QFGA 4HUWB 1LEGA 6FABL 4ZS7H 4JCLA 3GM8A 4AGNA 4EI5B 4ZFFA 1KTBA 1QYGH 3AMLA 3M17A 3STBA 2HMID 5T5NF 2MWCA 4G8EA 3QEGL 4HBCL 4WGVB 2C3XA 4JFOB 1VA9A 3HG2A 3SSGA 2WKGA 3FONB 1AO7D 3ZR6A 2DQHH 4M03A 2KHAA 1K4DB 4LBEA 3VXMB 5BUGA 3BVTA 1U8IA 1GW6A 2I27N 2XZZA 3MXVL 2ZJSH 3RE0A 4WW2A 2H32H 4KVPA 1AFVL 3BP6A 4UAOC 2X1OA 3BP6B 3QG7H 1SOSA 2WXRA 3MFGB 1A6UH 4L18A 4NM8L 2J3SA 3LJ3A 5C0JA 2UX7A 4D8PB 3UIYA 2XBDA 4PWGA 3ZSTA 2XRAH 4LK4A 2UZYA 5TTRA 3R8BB 4WEBH 4RAHA 3T2OA 1A3ZA 1THAA 2FYVA 1AP2A 1IBDA 2LAAA 2OCCB 2VC2L 4P5KB 4YHOL 4ZK8A 1QWHA 1NCAH 5C0AE 1BM7A 2AFNA 3S97C 5D4QA 1DBJL 1MCNA 3T9WA 1O5PA 3C5JB 4KTGA 1E2VA 1HI6B 5CGYD 1F1DA 1ZV5A 2JKSA 4XO3A 4MJ4A 1QHPA 3C5ZD 4AE1A 2EC8A 1NCDH 4JFWA 3ABLB 3O4OB 4N0YH 2DIEA 3NFNA 2HXAA 1NM9A 3NACL 4PJHA 5FA3B 2YEZB 4UTBA 1I1AD 2GG1A 3K1DA 4RAVA 4JM2B 4M3KB 3BCFA 1M9SA 4P9HL 1OGSA 5IMKA 5FGRA 5D6DA 4M5SA 1IGIL 4S1RL 1CXLA 4XPBL 4MZIA 5BW7A 2XG4B 4KQ3L 1KC5L 4QRBA 1JNHA 2N56A 4WGKA 2HRLA 3MV9D 5T5FL 2NXYD 1QUNB 3ZKSD 4FZ8H 1BFSA 3UPRB 4GRLD 1HKFA 1LP9B 4J3BA 1MCSA 4FI7A 5DGRA 2P5ED 3WIHH 1DVTA 5EZOH 2J12B 2BY2A 3ARDA 4IGBD 2IG2L 5C92A 4JUSA 1E4XH 2VR5A 2F1BA 1EDYA 3PWPE 5I73B 3PXJA 1FYHB 4NRXA 4AQAA 2FNWA 1ORQB 2YMOA 4QUOA 4DGYL 2WXIA 3L4YA 5EIQA 3MLUL 2EIJB 5DDHB 1HH9A 2JB6A 4N8UA 5GRZA 3VXUE 4BKLA 3US1A 1AS6A 3U2SA 5A2CA 2Q10A 4NQED 5I19H 2WOBA 4N2BA 6FABH 1A7QH 3U4BH 1VPOL 2P5PA 1WLHA 4NQVB 2FSEA 2E59A 4NUQA 3ILPA 3NUKA 2YA0A 1N6UA 2DLEA 3D85A 2V17L 4O02L 3WFEL 3GMPA 4JO1H 2SEBA 4OZ4B 3K71A 1L0XA 2GHZA 4KVNL 4BK5C 1TLMA 1BFTA 5D4JA 2ZG3A 4AT6A 1TTAA 4C83A 5HBBA 3T08A 5MENE 1G1OA 1F4AA 2BNQE 2O72A 5F44A 4WUUD 5BZDB 2NYYC 4WRLA 3QIUB 3SO3B 3X3GH 5E8NB 1IBBA 4OM1H 1F11A 2A73A 4XN4A 4WWKA 1Q72H 4PGEA 3T3PB 3Q9PA 1BIHA 3V7AE 1RK1B 3CIQA 4L4VD 2W9DH 4HK3J 1MFEH 2R0LH 4LLYA 1JZIA 3BKML 4KMTL 1KMGA 3QIBD 3O6ML 1BJ1J 1CDCA 4KFZC 4ONFL 1CURA 3DUUA 2VDQB 1XMWA 1CBVL 4OKVA 4XN9A 3GS4A 5DJ8A 3MNVA 4V2BA 2X7LB 2LVEA 4KJYA 1EA9C 4XGZA 1H0DB 3PNWB 4OI7A 2YPKA 2CUAA 4HT1L 2B4CH 1D2PA 4UOJA 3UBXG 5EEXA 1R3IL 2Z8SA 3ZTEA 3SZKC 1J5OL 3QEQA 4B97A 4Y4FB 3FO0L 1GIGL 4Q6KA 2NX5B 3NRQA 5EORH 5EWIH 4GBXC 4I1RA 3HN8A 1Q0XH 4JANA 4JQIH 4F2MB 2RQEA 5J11B 2VNCA 3G5WA 3IE9A 4JFFE 1R3KA 4AWJC 4LCWA 2AKRA 4XN7A 2Y7OA 4OF6A 4M7JH 1BQLL 4HAKA 2Z7YA 1UATA 3Q9QA 4E42B 5HYFA 1WHOA 5JYMA 3CZUB 3IMRA 3ZZLA 2YPLB 3MV8D 4JKPH 1ZHLA 4XGZB 1SDDA 4XP9H 2AXFA 3AUVA 4BCYA 3MNVB 1LNUB 3P40A 2JJWA 5IESL 5I0YA 1UXSA 1DBAH 1MDTA 5KSAA 2IGLA 1KTLA 5D7IF 2D73A 3C6LD 4IRSA 4MJHA 5C3TA 3S5ZA 3VFRA 3QUML 4K71B 4BDVB 1MVUB 2EH8L 4R8WH 3MRFA 4DOHB 2EXTA 1CS6A 4HW6A 1G0XA 3O3DB 4YHYC 3SDCA 4PGCA 3OKNB 4GW5A 5DZOA 4B9JA 4LSTH 1CFTA 4R7LA 2X6BA 3NSYA 5JUEL 1T5KA 3RA7L 4H8PA 2RBLA 1UYWH 5D5ME 4NQTA 2FIKA 3ZQWA 3O2DA 3KWWB 3C5SA 2BVYA 4AH2B 3H9HB 4PWKA 4U3XA 4NOFA 4L5FH 5BVJB 4LU5L 3WNLA 2VGLM 5DK2A 1KG0B 2VMEA 5AYUL 5K9JL 4XO9A 4I0PC 5T1MB 1U8HA 3T0ED 2VXQL 2XCMC 5AFAA 2HLEB 1ML0A 5HD8C 4P5TA 5FHBL 1RIHH 3A67H 2BERA 4X4MA 3VAEA 4FZ8L 2ICEA 5JW5B 4Z3TA 1GSKA 1T21A 1WD9A 2XN9E 1A7PL 3LEYH 3PFUA 1HXYA 5I8OH 4OLZL 5DD5H 1Y07A 1AR1C 1E4WH 2FEJA 2R29H 1J9TA 1F4WH 3PQYA 2VERA 4Z7VB 4QHNA 1JPSH 3GSQA 1F6FB 3RUGF 1MCCA 4GG6E 2J88H 3I9GH 4ZZKA 3PWUB 3B6SA 4KI5F 1A4BA 1GMIA 1TTUA 1FH2A 43C9B 2ZOLB 4JG0H 4QRRB 5ACZB 3EH5B 3J7HA 3VRIA 4QXWA 2IXQA 3L5JA 3SGDH 4I3RL 4CADB 4E9SA 4OI9A 4U1SB 3KCPA 3OGOE 4YHOH 1JF5A 2IF7A 3IXAB 5EIVA 2DMCA 3RURA 1L7TH 4ZFZB 1ZS2A 1E6OL 3T4AB 2B3IA 4UIMB 1J8KA 1VAHA 4HWBL 1TYRA 2BWDA 4Q58C 5ADPH 1VZIA 1PKOA 3TF7C 3HG1E 5E56A 4N2FA 3ZK0A 1MFNA 4FHKA 1NFAA 4NWUH 3HE6D 1L9SA 1E27B 5AOZA 3ARPA 3G5YA 2W94A 1AFVH 3QFJE 4JFQA 5KUKA 5FO7B 2DWTA 3T4YA 2RTTA 3KLDA 2X87A 1PAMA 2BVQA 5C0DA 2IIJA 3WY3A 4Z8FH 2EVGA 3GBDA 4HDIA 2LQRA 2QL1A 4U1LB 4QT5A 1KLUB 1XB3A 3O2DH 4NPJA 4ODTL 5CCKL 5IT2H 1SBSH 2WJ5A 4PVLA 5HYIA 4HUUB 3PUUA 2APBA 4HMEA 4K2UH 3UTQB 3Q01A 2FHFA 1TJHH 3B7UX 1XAUA 3GMMA 2E9JA 3C5ZA 4W1TA 3L7FA 5I8EA 2NY1B 3CZFA 1OE2A 1D7CA 4H20H 4KGLA 2H6PB 3KCPB 3SQOL 1U2CA 4F27A 1KTCA 3MV9B 3ARGC 1X5HA 4IHOB 2E7LA 2BOCA 1E4WL 1KJMA 2Y1ZA 5FYJE 3FRUB 4W81A 2R23B 1MCEA 4HCRH 4XZUA 3LDBB 4FFWD 2JVUA 1F13A 4V33A 2IGFH 3RWJA 1GR7A 4N0CC 2UXVA 3QA3B 4K9JA 4ADIA 1DUYB 2CBQA 2JQAA 3EFFA 3AZUA 6CGTA 3QYMA 3NSJA 1U6AL 1F4YH 3TV8A 5DLMH 3MJ9L 2BVQB 2AEPL 5E4OA 3B3IA 1G9MH 4F57L 3MR9B 4WJ5A 1A1NB 1FZJB 2LGNA 5GGRA 5DJ0A 3Q0HA 1U9KA 4LHUB 3KVDD 3KH3A 4L5FL 3UZEA 3WD5H 4EKXA 5J9PA 5IQMA 3QJHB 1TQTA 2H2SC 3D2UA 4KNUA 3HBQA 3ZE0E 4ZUTA 5JOPD 3VQ2C 5FV1L 3WKMH 3WYRA 4J39A 5BVPL 4WFGE 5DFVC 5EZIL 5FYKD 5IKCA 2VLJB 3SDXA 4URKA 1DQQA 5EC2B 3MJGX 4MSWA 2IQAA 4GW1B 5CR1A 2W65B 5BO1H 2X4SA 3K2MC 5DHEA 3VXNB 5IOPA 1WZ1L 2FO8A 3CXDL 3MUY1 4X8GA 3A6BL 4XNMB 1YJDL 4J4PA 5AVSB 2GJ6E 1KCKA 4OAWB 2ZXGA 2BNRE 2EDTA 3W9DB 3PXLA 4DP0X 1JGVL 2WSPA 3MNZA 2PCYA 3N85H 5KVFL 4OGXH 3X13A 3OG6B 2IQ9H 1NPUA 3E9UA 5EO1B 4LASL 1N5AA 4NNYB 3X1BA 2HH0L 2K78A 4A55A 2HJFB 4M61B 1VLXA 3V4PB 4MDJA 3SZ6A 3QI9B 1FQ9C 2V2WB 4ATWA 3BAEL 4PBWD 4LVEA 1N8OE 1U42A 1JN6A 4CL7A 4BQ6A 3C60A 2OYKA 1PLAA 5IQLA 1Q8MA 3ROOA 5C0CD 1NL0L 1WAAF 3FOMA 5KVDL 2ERJC 2FLMA 2VMJA 3KPSA 3ETSA 4XMKL 4Z7OB 2X70A 3V6OC 4RA0C 2Z4QB 2A6KB 2E6QA 4P49A 4Y1SA 5IJVA 2DQJH 3L2LA 4LVOC 5K59E 3SKUD 2Y07L 5LCVA 2Q8AH 5DJ6B 4XNXL 1CGWA 2AANA 3QHFH 4MYWB 1MI5D 3EJSA 4L9LC 1P4IH 1XGQA 2DQEL 3N06B 4U1KA 1F42A 1CU4L 3J2PA 3AY4A 2XVBA 3HLKA 2IBGA 1FCGA 4Z9KB 3KPNB 4A38A 4K9EL 5CD5C 4J3WA 1RZJC 1MREH 3NN8A 3DRTB 5F9JB 3EYSH 5FDYA 2PCFB 4JHWH 3NJNA 3L3JA 5CLZA 5SWZD 2YPLD 4B41A 2C26A 4LSUH 4OZIB 1I4FB 1T0MB 4D0DA 4NB7A 4XPFL 3FT4B 1OQOA 3ARUA 3M8OL 3TJEH 2ADYA 3FT4A 2F9BT 1OALA 4POZC 2P7TA 4ZFGH 4OZGE 4QCIA 2CLRA 3ILQC 1TVDA 2FWOB 3ARRA 1IFHH 5BW7C 2QEJA 4J4PC 4DGIL 5INDB 4KXZH 4X6BB 1L0QA 5DJDB 3CC5A 3PGFH 4M6NH 2XA3A 5FAAA 3VFMA 4GG6B 1IM3B 5CZVH 1KFGA 3BUBA 5JZ7C 1T7XA 4PJEF 4HIXL 5I1HL 1NLBH 4YSUA 1HHGB 2E7HA 4LE8A 1BECA 5DVPA 3CFDB 4UT6H 3ARBB 2D3JA 1NGXB 1JGDA 1XV8A 1LEGB 2WUBL 3LRHA 3PWPD 4FTVA 4ES8A 2DTMH 4KK6D 2DDQH 1KPVA 2VIRA 2Y7LA 1BCIA 4TLTA 2GBTA 1E28A 5ACMA 1B4LA 3G5XB 5T1DL 3HG1A 4LGRB 4P99A 5FOBA 5BS0A 3TO2B 1SOKA 1WAPA 1YUHA 2HLAA 3EO9H 1UWEL 3GUTB 3RKPA 3AADB 5HVWA 4A6YL 4KOCA 1OPGL 3SDDD 4MRBA 5GJSL 3F01A 2Z3FA 4U1GB 1QRNB 5E4IA 3ATFA 3AGVA 1GYCA 2F7RA 3KYOA 4I5BA 5DUMH 5J57B 4I2XB 3LY6A 4IKIA 4HKJA 3PNRB 1S78C 1CBJA 1AMXA 4GBXD 2FO1A 1NFDB 1OGPA 3ZT5A 1E3FA 1ZRUA 3RU8L 2R8SH 1SMDA 3I6LD 3MBXL 5EUKB 4JZNA 5E8PB 3MRIA 4HOZA 1ACCA 2ADFL 2EADA 1DQDL 2VLJA 5T1KB 3SDXB 1NSNL 2FK9A 2VLKB 1UZ8B 5IFJB 2QHRH 4TUOB 3LNGA 1CD1B 1EHNA 2DQDH 2GFBA 5F7WC 1NEUA 4HC1H 3TCLA 3IGLA 1CD1A 3RTQB 3AREC 3PIQB 3H54A 3RVUC 1OPOA 4UCFA 1EEUA 4ZJ9A 4AZ8B 5AAMA 4Q6IC 5D1XE 1MFAH 5AOKA 3U6XA 2LLGA 3PWLB 4GBXA 3QWOB 1TDQA 4P5MB 3WE6A 5LGHL 5C0BA 2OQJB 1ZGLB 4JZJB 1U8JA 4XBEH 2MNWA 1HL9A 2A4ZA 3OR6A 1XGPA 1XIWA 2CJ3A 3CVHH 3BVWA 1X5KA 1SJVA 3MGAA 2WXFA 1OF2A 3V0VB 1NEPA 1AXTH 3EHBC 4FNPA 3A4DA 2OMZA 5DZAA 4MS8C 1KYUA 3VXSE 3MLPA 4NBYB 4M7KH 4GQZA 5SX5H 2EC9T 3PP4H 1VCBC 4JDZA 5T33H 2D3LA 1FNHA 5KTEH 2WXPA 1GL4B 4E41D 4ZUUA 3ZX1A 3FCBA 1T6WA 4JFPA 2NY1D 1YJDH 2CIIA 2ZOOA 4CBPA 4WWKC 2AK4E 3LZLA 5AUMB 2O6EA 2VW4A 3VGFA 1EXUB 1GZQA 1X3DA 1NPJA 4IS6A 5I6LA 5BO1L 4LRNL 5I1KH 4NZUL 3RY6A 4WU5A 4YFLF 3TXAA 4W9LC 2B2XH 3QUZA 4KXBA 1MCKA 4N2LA 4OFVA 1D7FA 4F8OA 1W8EA 2AJXH 4NQCB 4WENB 2UZYB 3EUUA 2FTAA 4UQBA 4M43H 3OKMB 5C0JB 2XA8H 5T3ZE 1IJ9A 1UACL 4PY7B 3RL2A 1OOAA 5EFIA 3RNQA 3X3FL 4ZW5A 4AQ1C 1ZT4A 4PJAF 4HHWA 5AW5B 4WU7A 4EI6A 1VSCA 4RZKA 2QSCL 2XWEA 2R59A 1XD1A 2EO1A 2NZ1A 5DC0A 1EEQA 1MCHA 1J9QA 1WF5A 2RB8A 3FFDA 3IM1A 3KWUA 3VW3L 4HHAA 4XAKE 3BPNB 2R2HB 1ZLVK 1EANA 3MRHB 4HEPA 2W91A 4OGAD 3QIUC 4N8VG 2FT6A 2PYEA 1KB5B 3PNWA 4LGSB 3SYOA 2QLVB 4AYID 3KYMA 3K7UA 3NH7H 4UM8B 1F4HA 1LK2B 4PJAE 2JKJA 4QTIL 3TEZA 4FABL 4GRWH 3LPGA 1EMTH 5TF1H 2VUKA 4X8JA 3K6SA 3FSOA 3LPPA 4AXWA 2OJEA 3PJNA 3DETC 3HRPA 3KPLA 4XPTL 5C07B 3GXTA 4PJDF 5AVYB 1YPZE 2HCZX 3P9LA 4Y4KB 1WIOA 3V5KB 1SXSA 3LMJL 4Y4FC 5E9DB 1VFBA 5CU9A 5SWSD 4MNHA 2F61A 4RFNC 4YQXL 1QP1A 3EYVA 4WI0B 4Y2OA 2ZXWB 2Z8WC 4PW4A 5JDJA 4CILA 3AAZB 3CFMA 2PYFA 5J11C 3MGTA 3SBWA 1JD9A 4HXAL 2VXQA 2XIIA 4JM4H 4PVMA 3K74B 2DLTA 4PJCF 1P5VB 2IDQA 5CGTA 5DYFA 2BNRA 2NDFA 5AWNL 1LK2A 2Q76B 3GMRA 4P2YA 3QPQD 5KBMA 4BIKA 3KYMB 4NN5B 1IBGL 3BMVA 2H47C 4TUOA 1HHJA 2ZIDA 5ETUA 5GIRB 4OLEA 4PJXF 3KPLB 5GGQH 4ZFOL 1IQDB 5I76B 3EUDA 3P2TA 4PI0A 2YEQA 3O0RL 3FTWA 2MQ0A 3L3OB 5CINL 3IRPX 3Q05A 3AABA 3CVIH 3IEAA 3Q06A 3QJXA 1T83A 3L2MA 1N4XL 4WFFD 1KCVH 3VXUB 5L2KD 4AC2A 3DRQA 3F7PC 1J8HA 1XH2A 3QVAA 1BIIA 1HK6A 2JJSA 2F74A 3QRBA 2BOCB 2BP8A 1A1OB 3DX7B 5D70L 1M71A 4F7KA 2JE8A 3ZU8A 2MFNA 1HE7A 5ICXA 3X11A 4YHYB 3VYOA 4LVHB 1Z32X 2VH5L 4BZ1A 1DQVA 3R06B 3SE8H 4TQHA 2NNFA 5JW4Q 2DD8H 1SJMA 2NY7L 4HH9A 1DHKA 4P3DB 5BZWB 4H44C 3H7BA 1RPQA 5CWSB 3TJHD 1J0JA 3U9PH 4EOWL 4Z7NB 5JW4M 2YZ8A 4AG4H 1UCBH 2OR8A 1ODAA 1UTDA 1NAMH 3NP4A 2G5UA 4Y4HC 4K7PH 4UQCA 3TGXA 1NKGA 3TVMA 4I0PB 5CKAA 1DVFB 3UADA 1Z5LA 2J56A 1QRNE 2DEXX 4NNXA 2KI6A 5IW3A 3IDUA 4HU2A 5C6TH 4MB5A 1GTNA 1YNLL 4ZNEE 3ZN6A 3A24A 4ZTPH 1JCKA 2H7WA 5I5JA 3FB7B 3JTTA 1MJUL 2DTML 4Y2DB 3OXRB 3ZTDC 4HUMB 1EXUA 1GZQB 2G3XA 4QXUH 4JHZA 2X4TB 5GS0D 5MI0C 2DI8A 3CVIL 4NO2B 4TPRL 4DFHA 3L3KA 3ATDA 5CBEB 3SPVA 5L8JB 4ZUSB 1JZ5A 2J72A 1N68A 2AW2A 5T1LB 3QUMH 4IKKA 3LN5A 1S9WA 4BM7A 2YJQA 1RSFA 3QJQB 1TTRA 5DD3H 1N8ZA 2NY0C 3OR7B 4FZEL 5DJYB 1BBJA 2ARJA 1A4JA 4JFDA 4PS4H 4PR5B 1LJMA 1U3ZA 4F9LA 3CLFH 1G43A 2EYRA 4JGUA 5E5MB 3N0AA 4K3HA 1FNEA 3D6GA 4ZFGL 1RJZB 1UH3A 3ROOB 5D7JB 3V0EA 5EU7E 2VLKD 5FLVA 1IZKA 4O4YL 3O3EB 3LQAL 4Q8BA 1FNFA 3ZHNA 5TGBA 2V5SA 4AJ0A 1MY7A 1KIRA 3MGOB 2ZKXA 4POZD 32C2A 3I9AA 4PGDA 3JYCA 2OLDA 3K80A 2W0KA 5DJXA 4KAQH 4AVKA 4NN6C 1SY6H 4OF7A 1OP3K 4AV0A 1S7TB 3EO1A 1RP8A 4UOQA 3V0IA 3W57A 4FQIH 4WDIA 1R5WB 3TVMC 5J8OA 4BZ2H 1SRDA 1T2XA 2WBWB 3PV6A 4KKBD 4MD0A 4AKPA 1A4JB 3NZSA 3ETTA 4KUCD 2BHZA 4RDQF 4ZUWA 5LQBH 3ULUE 2G5RA 1UENA 3FNKA 1AG6A 1Z0MA 2ZUQB 4RETB 5BRZD 5CEZL 3I02A 2BNQD 4YE0A 1R3JA 2Y4SA 1ITCA 3QK0A 1RJZA 4X5XA 2OZ4L 1UG9A 3PG2A 4XNQA 3AITA 5ANMB 5L88L 2P9RA 3B2VH 3QO1B 3DV6A 1I7UA 1WCQA 3IKCA 3ESNA 4JRYA 2WNGA 2ZNWA 5L9DL 1A1NA 1U8CA 4AGPA 4E41B 4LHUA 1DO5A 4LASH 4C54A 4Z7WE 3X12A 2JK5B 4XHQA 1WYJA 4OGXL 5DRNB 1VESA 4XZ4A 3TT1H 4X9IA 2O61B 4JY5H 2DI7A 1RZGA 1N2RB 4FQ1H 4OFYA 4RMRA 5LCVL 2VN5A 3H9YA 1GTFA 4D9LH 4U3CA 1P4BH 3F00A 4TKWA 4HUVA 3RHWF 3AW5A 4IHOA 4ENEC 3RPBA 1NUNB 1KBPA 4B27A 5SWQB 2X4PB 2H45A 1KGXA 4MJID 3DTXB 2DAVA 4M5YL 2I9TB 3L4CA 1E40A 5FGBC 3QQXA 3DSFH 4NJAH 4G6ML 5E2TH 4JY5L 4RX4A 2J73A 2WHVA 1R9FA 2OMWA 3BVNA 3DIFB 4TM9A 3N50A 4PSPA 2ATAA 2NSQA 1HEZB 4AIXA 2X1QA 4IMLB 3ES6A 3H55A 2JELL 1KLUA 4OCXL 2GB2A 3MUGA 4OGQC 1JV2B 3UBFA 1U6AH 1YYLH 1AANA 3ULVL 3HG4A 4M43L 3CZFB 1VERA 2ZSWB 3FU8A 2NT0A 4KJQC 5GGSB 2PR4L 1EX0A 1XF4A 2YUWA 2XWJA 1DP0A 2X28A 3QGVA 4PUBL 3TFKC 2YAQA 1I7RB 4FN0A 2WMPA 3IAGC 4U1JA 3TA3A 3O3UN 5CD3A 2X4OB 1OF0A 5E23A 3WGVB 4QKXB 4MXWH 1SHWA 5D6CB 3S98A 4AJYV 5K9KB 3D85B 1KN4H 3NIDB 1AE6H 3QUMA 4JREB 3KBEA 2HT2C 2PABA 1QVOA 4UOZA 2Z93B 3KVPA 4FULA 2DOCA 2J1WA 1CDIA 2WYIA 3KEHA 4LVOB 4E9QA 1JYWA 4NNYA 1V8HA 4ONOA 1HHKB 2P8LB 4N25A 3NN8B 4X4ZA 1M42A 1UT9A 1FPTH 2XWDA 1I9EA 3OJDB 4WWKD 1S9KC 4IU2A 1L9OA 4QO1A 3LNDA 3WTTA 4OCWH 4G6JL 4HJ1A 2XRAL 4HEME 3TZVB 4ELMA 3SB3A 2CKNA 5C07E 2DB8A 2DYPB 4XPHH 4IK6A 3FB6B 4YBQD 5AW2B 3TNMA 1CR9H 1K72A 4F37F 5M94B 3Q48A 4UV4H 1YPZF 4DGWC 4L9DA 5AG8A 5FO9A 1GZHA 3H9SB 4Y1TA 4KRMB 1EK3A 4H25B 1DJYA 25C8H 4LPTA 3HAEB 1OGAA 4FQIL 1W80A 2BSRB 1OSEA 5KYWB 3QWRA 1UUNA 3F12A 2XPGB 4PGDB 3NSDA 3OM3B 1R3LA 4UUJA 2X89D 3ULAB 5IJDC 1H3PH 2CE6A 1OAYL 2QQQA 1QFWL 3RWCB 4KTYA 4R90H 1FN4A 1CE6A 5CZKA 3GTVA 3MLZL 2W0FB 2V3FA 5E9AA 1OP4A 2WLIB 3VXRB 4DESA 3HC0B 3WOVA 2HRHA 4Q97A 5MENB 2DQIH 3NCBB 2EEXA 2IPKB 3ARBC 2H3NA 1ACZA 3VM5A 1L0YA 4TNVK 1SEBB 3CWGA 1OZTG 2WSDA 4XNBA 5FYKH 5E6IA 3TNMB 5B7MA 4U4BA 3WY2A 5FA4A 1KSRA 3HNVL 3SKOB 4I9XA 4OZGB 5EF0A 2OYMA 4WU7B 1GGUA 3ZIMA 1FVEB 3FDWA 3NFSL 5C9KA 1BF2A 4BFOA 1DBKH 4A6YH 1J8RA 3OC5A 4QHKI 3A0OA 4ZOBA 5KSBF 3QJOA 4M8QB 2BSSA 2FSDA 1NC4B 1G7HB 2VWEE 2I60H 3P4MB 1I7TA 4GQRA 4MA3B 2EDNA 2HA1A 4GUPA 4K7FB 5LGJB 4FFZH 4OJEH 1OCWH 5DD6A 3SCMC 1ETZB 1NINA 2VZTA 1J48A 1P1ZA 2DJSA 3MRBA 3VA6A 5KVEE 2G60H 3BN9C 2JKXA 3TASA 3ULSA 5A7BA 1GZHC 2X4PA 4FXLA 4KI1A 1OSZB 4Q4EA 4H1LH 1ZGLP 1AI1H 1PAZA 1QKZL 3RFZA 3ZDXB 1G7IB 2ZYSA 5C6TL 4PJDA 1BA9A 5B3SB 1IM9B 3RLSA 1HEHC 2VXVH 4X7DC 4IU3B 4KFMA 2IOOA 5E8DH 3FCUB 1PYWA 1XBDA 2A3TA 1MFBH 3UJTL 2FL5A 4ZXBA 3GSOA 2YUZA 3QEUA 3RTQC 4X6DF 3HR5A 4IMKA 4YSOA 1XGYH 3SKJL 3BWZA 4J6IA 4GUPB 5D6DC 4I48B 4F8NA 1UM6L 4TULH 1OCOB 2AJZB 5HYJE 4BH8A 2CXGA 1U93A 2FATL 3D05A 1YEFL 2Q76A 3D69A 3GMRB 4LCCC 4OFKA 4JZJC 2X1PA 3U1SH 4OQTL 3MCG1 3O11A 4H8WL 2VO5A 4APXA 2A6IA 4K7PY 1QSEB 3FQXA 2NW2A 4R84A 3W37A 3BLBA 2XY1A 3P30L 1IQDA 1B90A 2NXZD 4G9FE 4IRZA 4BH7A 2PR9A 5I76A 2VLRB 5AKVA 2BCMA 5E9NA 1AGFA 1S9XB 2DLHA 4MAYC 1MI5A 5FM8A 1GHFL 3DX9B 3IYLW 4H8QA 4NAJA 3WXVH 4KXDA 3SKMA 4FHBD 1TPXB 2W0LA 4HZ1A 4MJ6B 4Z7WA 3WIFA 3TT3L 4GYBA 4WJKB 2NX5E 4APQB 2VUOA 4PJ5A 1BZ7A 5EZIH 1F3JB 4XVJL 4RBPK 1PD1A 2MPAL 3K0WA 3TS8A 2K7QA 3BRDA 4N0FA 5DFTA 1CVRA 4QGTA 5IHUL 3BWAB 5DMKB 2VLLA 2YGQA 4LCYA 1AKJA 4ZS6D 1XZ0B 3IDYC 2AC0A 3K72A 2AABH 2DBLH 1UH4A 3DXAE 5IIEA 1LD9B 2BZDA 2EUXA 1OP5H 3GKWH 4OCXH 2R2BB 2X6UA 4LLMB 3BGMA 3B5TA 3IMWA 3OKNA 1WZLA 4X42A 1CL7L 2VN4A 1MLCB 4NRXB 4UDUA 4AQAB 5FO9B 3LMJH 3NCFB 3TH4T 1A8ZA 1II4E 4N28A 3KPSD 1A3RL 2Y9RT 4AE0A 4S1SH 3GMNB 3PLYA 2B0SL 1KN2H 3GRWA 1ILUA 2WQXA 3L16A 2VR6A 5DVKA 2F53B 4PJ8D 2BVOB 4CVXB 2NR6A 1UACH 1OAQH 2MOQA 3CUPA 4U6YA 5I74C 4AK2A 5KBLA 3C5SB 2C9SA 3QJZA 1KPUA 4NLHA 3SD5A 4O58H 2WINA 1NC2A 2ZAGA 4MX7B 1P7HL 5I1EL 3CLEH 1COBA 4F7MB 3N43B 1INDH 3DURB 4OCMC 1HQ4B 3EKCA 2OMBA 5CGBA 3VU1A 4IKJA 1Z6JT 4L3FA 3HS8A 5I1KL 2X4NB 4EQ3A 5IFAH 1UD5A 2P7TB 3MLXL 3OR7A 3GLEA 2R2CA 3QS2A 2MHAB 5SWZA 3OKDB 5GGVL 4KZ0A 1H8NA 2I32A 5IJCC 5CSZA 2AJVH 2HPOA 5FO8A 3LN5B 3G5VA 4EIUA 5D93B 3BUTA 4DT2A 1TEFA 4G80A 3IMTA 3AB0C 3TTSA 2C9VA 1HOCB 2A6JA 1NDMB 4BSJA 5L9DH 3CDFA 1HOCA 2A6JB 2XWXA 2BNUB 2X4UA 1WZAA 3MRHA 4HUXA 1BV8A 4RBPH 2D0FA 1BBDL 5FUZH 1BAFL 3H3PL 3V0HA 3OHMB 3HE7B 3A5VA 4NC1E 4NJ9H 1T2QH 3MBEB 4GG6F 3TBSB 1G5GA 2E8YA 5T5FH 1M7IA 1HQ4A 1TCMA 4J3OD 5IJKC 1CT8B 3M1OA 5JXAL 1UXWB 3QR1A 3BKJH 1F1GA 4OB5H 3BFWA 3UJJH 5JMRA 1FRGL 1JWUA 4WKZA 5EU3A 1VHPA 4Q2ZB 3TO4A 4MS8D 2XKUA 3RFRA 1A1MB 3O2DL 1H5BC 3NQIA 1OAXH 4OFPA 3T04D 3ZDZB 2MCAA 2YQBA 4I89A 4AI7A 1A1OA 2R4RH 1VGEH 4KKQA 4J3XA 1NCAL 4LARL 4K94H 1TTCA 2V9TA 3L3OC 2VRKA 2BFGA 5DJ8B 2WLKA 4FMVA 4IGBB 5T5FA 3NEXA 5DK0B 1HDMB 3KLSA 2Y6SC 3GHEL 2Z8RA 5DRNA 5I26A 3RWGA 9CGTA 2YGVA 4XPAL 1MELA 2ZUTA 4DP1X 3V95A 3H3KA 3O4LE 4W4OA 4XWGL 1JPGA 3BQUA 5B1AB 1N0XH 4BKSC 4XP6L 2P49B 1Q90A 3BDYL 4LVHC 2QQNH 2XXGA 1MFAL 5FK9A 2CJSA 3MDJA 4LEXH 3UOAB 3UYRL 3LEVL 4Z7QE 3BXNB 3MRQA 1W2KT 4H1LG 4B3VA 4RGNE 5C07A 3DSNA 5KVEH 2J8OA 5J6SA 2VAAB 4TSAH 3FB5B 5MEOB 5E4EC 4I4WB 1CUOA 3P4LA 2YRZA 1QBLH 4F7TA 3DVGB 5D2LA 4KY1H 1DVFC 2P47B 1XGZA 3NIGE 4OT1H 4TQEL 1I85A 5AKRA 3GIVB 1OD9A 4FA7B 3ALXA 1DBMH 3CZEA 3JV6A 5DA0B 4B6ZA 3KZ8A 4L4VB 3HG3A 5ESVB 2LOEA 3ARFA 3U36A 2EACA 2XBZA 4H0IA 2DV6A 3VNYA 4EN3B 2QKIB 3WJJA 2ZP9A 5CZVL 3WXWH 1A6VH 5K9QI 1FGVH 1MOEA 1MNNA 5GSRB 1N0LA 4YX2H 2C3GA 4G8GB 5HHXL 2Y2TA 1Q9WA 5FYKL 3L3IB 4FQHB 3W5MA 4NHUB 4XP1L 2DZEA 1KJ2A 2E6PA 3CFJA 1AC6A 1DSWA 1PX4A 4L4TB 1S78D 2ZOKA 5LBSA 1BQLH 3TCXA 1X5FA 2CUHA 3BSHA 3KXFB 2FO4A 3FUDA 5I0WA 3CFDA 1JZ4A 1QR1B 2EAEA 4NP4L 1EZVY 4HCGA 4G83A 3P69A 3SOBL 1T80A 4QHKJ 4M93B 2EDJA 3B7YA