5C3IA

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
152
structure length
152
Chain Sequence
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Histone chaperone ASF1A
total genus 28
structure length 152
sequence length 152
chains with identical sequence E, I, M, Q, U
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5c3iA00
3AADB 2I32A 4RRPM 5EIIG 2IO5A 2Z3FA 4EO5A 1WG3A 1TEYA 2CU9A 5BO0D 5C3IA 2Z34A 1ROCA 2IDCA 2YGVA 4ZBJA 2DZEA 2IIJA 2HUEA 5BNXD
chains in the Genus database with same CATH superfamily
1NFAA 2R0KH 3T2QA 4XN9A 4Q56A 3LKNB 4ADIA 4XCFL 5D7JC 4E9VA 1PY9A 2QV4A 4PJEF 2Z3FA 4AQ1C 3FSZA 1RK1A 2HRHA 2DM7A 4OD3H 1A4CA 1ZSDB 4PJ9A 2I7OA 2Q8BL 4D9LL 2H47C 2K4AA 4LESA 3ATBA 4LCWD 2VMFA 4XMXA 5D1XE 2CXKA 3JWDH 4ZBJA 5E8PB 4MDRA 5DEZA 1FG2B 1YUHA 2UUDK 4XXDA 4NQSA 2KBGA 4B0MM 1WFOA 1SY6A 4LBAA 4ZMZA 5GS0L 3MJ7B 4WUUB 3I3DA 4L1LA 4RQQA 4WWKD 5J6SA 1NUDA 4QRQB 3KPTA 4RIRA 4NAMA 2V2WB 2BJML 2P44B 3HNTL 3HKZA 2Q10A 4L3EA 4ZFOB 3ZSTA 4ABUA 1AD0A 1PKQE 3RBGA 1JI1A 2MCPH 3OKEA 4LLMB 4HIPA 1QFWL 3CFBB 4KNTA 2OX5B 3BMWA 4OZHB 1MSPA 5DURB 1AGEA 5AVVB 4UB0L 4M7LL 2F8OA 1LMKA 4WO0A 2WIMA 3SQRA 5DR5H 4BRJA 2ROXA 4IDLA 4MGXA 2OW6A 3QZWA 3WD5L 2X1XR 2QV2A 4OD2A 3NIDE 4FFZA 4NB7A 1FVCA 1PG7X 4P2QA 3ZO9A 3QI9A 4YLBA 2LAGB 3MRPA 2EXYC 3HR6A 2WQXA 3RIFF 5JYLA 3HZYA 4Y9GA 1DQJA 2XRAH 3BVUA 3PNWB 1MHPH 2WSDA 5AZ2H 4Z7QE 3EUDA 4GW1B 4GW5B 4J27A 4R7LA 4JZJC 3RU8L 1BW8A 3DVFA 1CLZL 2UZIL 4LOUC 3IETB 3U25A 2P8MB 4J23A 3GJFB 1Q0XH 3D69A 1MQ8A 7PCYA 2J4WL 1LO3L 1RZIB 3FUEA 1X7QB 3PDDA 1WZAA 4HUNB 1MQKL 2VRAA 1CE1L 4N26A 4UTBA 3O6FD 3CFQA 4EVNB 1EERB 4GI9A 1KXVA 5LGHH 2G60L 2WP3T 5AENA 3UIYA 4IKLA 1GGTA 1BIIB 4JFPA 3RVVD 4AEFA 5IG7A 4I5BA 1O5DT 4HS6B 2APFA 1XSKA 4P2RD 5A2JH 4ZUVB 2F74B 1UWEH 3GSUA 3OG6B 2ZG1A 1FPTH 2O61A 3VFOA 3INUH 4ZPVB 4DGYL 3ARSA 2BNRE 1H9DA 2VIRB 4NCC1 5DJ6A 3SZ6A 5D7KD 1T7WA 2LGNA 4IK6A 4LCCA 3J27A 2ETWA 3J2PA 4YE4H 2E9IA 5CBAB 4HWBH 2B39A 3SOBH 4F27A 1A4KB 3FQTA 5F1NB 1RK0A 5AKSA 2AZAA 1NFIB 3RWFB 4Q7DA 5K9QG 4HDIB 4L8DB 1S9WB 2OTWB 3F64A 3VRIA 1U8OB 4Z7QF 1J10A 1MCPL 2WM0A 1JHTA 3CZFB 5D6CA 1UA3A 1F00I 3JV4A 4JQVC 4MA8L 3RWHA 4TVPE 3FUKA 5TQ2H 1UWXH 3I9PA 2YA1A 3BFOA 1GC1H 2VERN 3L3HB 4HWZA 3VXQB 3KCWA 5D1XB 2WQUA 4Z5RA 5JPMA 4P5MA 4PY8I 3ULSB 1I1FA 5I1JH 3DX9A 5EN2B 5E2VL 4P48A 4TOYH 4LAQL 1OCCB 4RRPM 4BFKA 1CTNA 1OWWA 2ZJSL 5AQ0A 3VFNB 2HT4C 5BS0E 3FRPA 3E2HC 3FUJA 3OR7A 2EZ0C 3BAEH 4YPJA 4ONGL 4O00A 2PTTA 5B38B 2CQVA 2BC4B 4NDMA 1T0PB 1GGCH 1K9TA 3N1MC 1YHPA 5IIEB 1NCHA 3QPQD 2BSDA 1JK8B 3RUGB 3PL6D 2F9BT 3HG0A 4DVBB 2CGZA 5DGQA 4ZUWA 1ANUA 4D9LH 3OJ2C 2UVEA 3BQUB 2TSBA 4PWJA 1CXIA 3QR1A 4NZTH 4UDTA 4AQ8C 1WUZA 1BXVA 1J0JA 2DAVA 1JV2B 2ICCA 1MFEL 2R1XB 3WJMB 1P84J 3BZFA 3T0EC 5I73C 1S5IL 4H26B 5FKAB 2Q6WB 3HS0A 1FNAA 3B9DA 1TZOA 4AVKA 1O0VA 4LT7A 5BUGA 1MNNA 5F3HA 5FGSA 5EO1A 5GZNA 2EEXA 1G7MB 3QWNA 4KROD 5IB4A 4TLSA 3GXFA 4H1LG 3QUXB 3EGSB 4JM4H 1CVRA 4MA7H 1IGTA 4LSDA 2MCPL 1JD7A 1IM3D 1AJ7H 3WDHA 4E9RA 5J0BA 4RWHA 4R5VA 4P46B 3I6GB 3JYCA 2NUTA 3SGKC 5LG6A 3FT2A 3ZSSA 1YPZF 3U7WL 2PETA 4JRFA 4J8RB 1U3YA 2E76C 3GJFH 3VQ2C 1SLWA 1WA0X 3WUWB 2QPEB 3VTTA 1YC7A 1YY9C 2QPSA 4JQXC 3ZE0E 4HPHA 2QGEA 3T3PE 2IAMC 3MGTB 2E8YA 1DCLA 1HWWA 1ETZB 1PX4A 2QHLA 1D5ZA 7PAZA 3QWOA 2YARA 1HEZA 2M8XA 3MUGB 5EIIA 2WLLA 1QEWA 3L17A 3MR9A 4BH7A 1M2VB 5BZZA 2XRAL 5C2UB 3MX0A 4ODTL 1TU2A 3NH7L 1F18A 2O30A 3KLSA 1OP5K 3FRUB 2GSIA 2V17L 3JWDC 2H6UA 2QQLH 4JCMA 1WA2X 1Z0MA 1Z1WA 4H1LH 5FCSH 3WV0A 1IGFH 3BWAA 2IBBA 3RVTD 4PFEA 5I76B 2BINA 1Q0XL 4U2ZA 5GPRA 2H8PB 1FZJB 1MQKH 1LL1A 4N2AA 1W0VA 1FL5A 5DFWH 1MKFA 1NANH 4WLCA 4XP9L 1T04A 2OXGA 3D6GA 1L0YA 2G60H 4Y2DA 3UTTB 4ODWB 5IFAL 5E0FA 3DLQR 2IVFC 4UIKL 5DD1H 2XXMB 2D3LA 2LU7A 3D12B 4BM7A 4OCWH 4L5FH 1DQKA 1F1AA 2V33A 5DJZA 4EDWL 3RIAF 3D8MA 2ITDB 3SDAC 3L9EA 3V6FA 3P02A 4FNTA 4O51B 5TD4A 5MENB 5EOCH 1BPLB 4HJJH 1T20A 4RH4A 5D1QE 3UP6A 2E7LA 2FJFB 3T6XA 1YPZE 1T80A 2EEAA 4Q4EA 1OSEA 4U6YA 5IMKA 2LE9A 3QQDB 3WTUA 4GMTH 4K9EH 2O5XL 4FXKB 1JP5A 4ZX5A 4N2OA 2P1YA 5HHPB 4RAUA 4OBRA 5B39B 3S8WA 2AJYL 1OB1A 3FN9A 3TBTB 5IQNA 4M4RB 1AE6L 3MLZH 3SQBB 1A0QH 2AEWA 4FXTA 4D3CH 4AGOA 1A25A 3RY5A 5FECB 2JKLA 3MOAL 3GDCA 4NN5B 4X5LA 5LBSL 2NCMA 1BD2D 1THCA 3V4PA 5B1BB 2A73A 2K70A 1ZJBA 3IFOA 1DTUA 1LQSR 1Q94A 2YD2A 2A9ML 2V4LA 3KVDD 5I1JL 1I1CA 1IL1B 3GTNA 3BN3B 5BRZB 5F1SA 5JIHA 1I7TB 3VM7A 2ZCKL 2Y7LA 2ZJSH 3BCFA 2C7FA 3V7AE 1LO2L 4L8BB 4XP6H 4GP8B 2NZ1A 1ZLWK 1WGOA 5IP4A 5HHOE 5E99L 1M71B 3NCXA 1GS6X 1NBZA 4IBVA 4KO6A 4M7ZC 5TFSL 2V2TB 2VDMH 3WN6A 2GFBA 5FM4A 1QLEL 1UM4L 3D0LA 3CC5A 3OG4B 3H3KA 4G43B 4PV9B 4TN9A 5EU6A 3OJVC 1J1PL 1FG9C 3TH4T 4WRLA 5LQBL 3ZDZF 2I27N 2I60L 5C0NC 5CBEA 3WFBH 3ZUNC 2IG2L 1HINH 4LIQL 1M7XA 2YXWA 3O41B 5TPWH 3REWA 1TZAA 5BXFB 1DQJB 5KSAD 3MRBA 2C34A 1H19A 1U8KA 2DQFA 3R7QA 3FS9A 3ZKMC 5G2NA 1H0DA 4LLQB 1RPKA 4X5XB 5HYJB 3PP4H 3Q2CA 1HHHB 4DKDC 3FCUB 1Z9SB 4JM4L 1HL4A 5I24A 5BO0D 3RWDA 1AJ7L 1GGBH 2DQJL 3TBVB 5KVMC 5DCCA 2P5PA 4M7JH 1MLCB 4X9IA 3DC0A 2NY5H 3HW7A 3O2WH 4ALAL 4GFXA 2P7TB 2X1WL 2W60A 2FNBA 4QOKB 2DYPA 3PWUA 3D3VE 2EXTA 1LEIA 1L6ZA 4Z23A 1Q9LA 1CT8B 1V3KA 4R4NC 2OSLB 3RVXC 2JH2A 3VFWA 1AC6A 2YSSA 1PFCA 4NC2B 4ODTH 1AKPA 3TT1H 1AZNA 1FG2A 3VXMD 2QQLL 2IDQA 2Q5BA 2C1PB 4MZRA 3DMMC 5DC2A 4OLWH 3TBBA 4KBPA 5I6MA 3RPKA 1GOFA 1C8PA 3X1FA 4ENEC 3DMMD 4LFHG 3MROA 3C60C 3K5SA 4AMKL 4OZFG 2WJ5A 4W4OA 1JNLH 3FCBA 5AB1A 4PSPA 4MS8C 2LQRA 2GSIB 1JYXA 4KKRA 3ZKND 2Q7NA 5IFAH 4ZXBB 4GFTB 4ONHA 4U6VH 3RGVB 4MNGE 5EZLA 1DEEB 4ZUTB 4DZ8B 1LLAA 3FONB 4JM2A 3NPSC 4GQZA 1R0AL 1SXZA 5FS5A 5AVXB 4Q6IB 1WCBA 4JR9L 4KOCA 5T5NG 4R3SB 4P2CG 3RTQB 5EOCL 4BQBA 5AYUL 5I0ZA 1PCSA 1D9KA 2NYYD 4Y4HB 2D4DA 2KC0A 3MCLL 4FERA 3SE4A 4W9JC 1J8SA 1SF3A 1X44A 4GMTL 4I0PB 3EZJB 4B41A 3ZTJH 3FT4B 1I4FB 2BNRD 4LCCB 1E43A 3WMSA 2NY7H 4IBYA 1BYOA 2DMGA 4NUQA 4WF7A 3F8UB 3U2SB 1M2OA 4FYTA 4YO0B 4PP2B 5IFHL 3UTOA 3D08A 5C0CD 1BBJA 5CJXC 5IB3A 5J6GB 2XFXA 3MOAH 2R56L 1ETJA 4ZYKB 4NZ8A 1M1XB 3BH8B 4WNQB 2XACC 1BQKA 1FZOA 1YN7A 3MODH 4XZUA 2QQKL 2IANA 3HI5H 1KC5H 5K9KA 3KLHC 2NY2D 5LDUA 2A9MH 4ZUVA 4TLUA 5C07D 1ILSA 3P9WB 4JG1L 2DY2A 3VI3A 5KYYA 2YD3A 2QR0B 5B3JE 4XPFL 1AKJD 3AG3B 3LIZA 4LP5A 5BZDA 4XBEH 2AQRA 3KPPB 2ZCKH 1L9QA 5IJVB 1MHCB 3BEWB 4H25B 3SDDD 7TAAA 5DK2B 3VFNA 4WEEA 3Q2LA 4PIBA 3LDBB 1J0KA 4FXGA 5I6OA 3PAUA 5TGBA 2FZ3B 1NMCC 4S0HA 3QJSB 4BZ2A 4N8VA 3IETA 3IDMB 4AT6B 5ICZA 1SEBA 5HYSB 2V6HA 4HUVB 3WUWA 1RMFH 4AL8H 5HVHC 4XC1L 1A02N 1WITA 5LQBH 1PFOA 1ND0A 5AOJA 3U1QA 3VSUA 4FX5A 3MNZB 1HINL 1M4KA 3GMNA 4LIQH 3HR5A 3VAEA 3NMEA 4R7NB 4OCRL 4X7SL 3TO2B 1BWWA 1OAJA 2ZWSA 1UATA 1RIVH 3FPYA 3MNWA 3QUKA 4OBSA 4Y2NA 5AAWC 2EDBA 5AYQA 1BVOA 1FZMB 2G3NA 4OJYA 3U9UB 5LAPA 1ES0B 1I1FB 2X6BA 5F7MC 2BSED 2VL4A 3HS0B 3PP4L 3ECUA 4PW9A 1PVHA 3WJLC 1NL0H 3X1NA 5AD0A 1TYJA 5BJTA 2F18A 2X1PA 2HJKB 3GZOA 4L4VB 1INDH 5GGVY 2WN3A 2HUHA 1TPXC 3BAKA 4LSSL 3FU8A 3O2WL 2WLZA 3FUIA 4HPYH 4DP0X 4L8DA 5F1OB 1MFAL 2FWSA 3T3MF 4JG9A 2Y6TE 1GZQA 4OGYL 4CC0A 4PJ9D 3T09A 2A2QT 1UA6H 2ICWI 4O51A 3P3RA 3ZZSA 4UQIM 1U93B 1M2VA 3HG2A 1OAZH 3CVHA 3MRFA 4UM8B 1T1WB 2E75C 4OAWB 1NLBL 4XP4H 3QXAA 5IHUH 3V7MA 1ZOXA 1DSYA 3HUJB 4NO5A 4Y19D 4HMCA 1KIRA 3D2UB 4I2XA 5F8RC 2BOLA 3F7KA 4GUOA 3CVCA 2R2BA 3FOLB 5BV7B 4X0NA 1PJ9A 3U2JA 3EH2A 1JNLL 1A7NH 2MTPA 2Y2YA 1XGUB 5SWZB 1LDSA 4ZMYA 2FD6L 1XX9C 4JDZA 5JHMA 4JHWH 4WFED 3D3VD 5DRZB 1T0NB 1G7LB 4PGBB 5LXVA 2EDNA 4E41D 3T1WA 5GRUL 4I1PA 2A73B 1TO5A 3ASNB 5ETUB 4JR9H 1SBBA 2F54A 1EAJA 3BKYL 5IJKA 3FL7A 5AYUH 2OJEA 2VZ3A 1FCCA 1F0LA 2XBTA 2I9TB 4OV5B 4JPWL 2CK2A 3MCLH 1AD0B 1GSKA 3EO9H 2BX5A 5TK4A 3CFBA 4OZHA 4L23A 5SWQA 1QMUA 4ETYA 3UJTL 3V0WL 1COBA 3QPXH 1D6EA 2E8ZA 5KSVB 1A1NB 1RLWA 4Z8FL 3TBSA 4N20A 1Y6MR 1G7MA 3KWVA 4YDVA 5ACLA 4Y4HC 2EACA 3VXNB 5LKNA 4G8IA 4F24A 5CO1A 5I8KH 1OXYA 4MSWB 3X11A 3CFCL 2DYRB 2R56H 3D0LB 4PV9A 4UV7H 9PCYA 5KWYC 1TJMA 1IJNA 2VDLL 3MODL 2QQKH 4ZOEA 4ZAKB 5F7LB 2V3FA 4KKBD 5E08L 2B15A 43CAB 4FAAB 1F1DA 1ZK5A 2CUHA 2Y3NA 1MXGA 4XBEL 4RMBA 4ZRGA 2GHWB 1RVFH 3K1DA 3KLQA 5HYEA 1ZHKA 1I7TA 1Q9WA 1DUZA 4TQ8A 1LYQA 2PW2B 3C6LB 2UWEA 3CSYB 2X9YA 3D3VB 3IKCB 4LSQL 4ZOAA 3UAEA 1JPTH 3FTXA 1L4IA 3IMVA 5GRXG 1IEBA 4ZG1A 1W8OA 2VOTA 1JGDB 1DZ0A 1CDJA 2R1WB 1KB5B 3FQNB 4XC3L 2BRRH 4ZO7A 1AMYA 1NFDA 2QTEA 1RUPL 4S1SH 4AL8L 1FNGB 4XC1H 1MI5D 5IMMA 2XI9A 3IJYA 1T66D 3ULSA 3GS4A 7CGTA 2ZQKA 3LV3B 4PRBB 1E2VA 5BZXA 2WNKA 5FHAL 3G7TA 5K9JH 3R06A 5H37A 3ARGA 3HI6L 3UMTA 4EIUA 3GUFA 5IW6A 3I6LE 2B16A 3J8F7 3KLAA 4NRZB 3S36L 1KCWA 1E5CA 4HH9A 1GZPB 3T0EB 5B7EA 3G5ZB 4BSWA 3VXPB 1F02I 2GSMB 5CN1A 1VFAB 4CC4C 5E2TH 1XF2A 4HDIA 4L3FA 3ME0B 2WWMC 3HZKA 1X9UA 3QCUL 1QAWA 2BCKA 2CRZA 4YL4A 4ABWA 5E6ID 1YEGL 2FYVA 2Y1AA 3GIVB 4LSSH 4GJTB 4XBGA 2PYEA 4KVCH 3ISYA 3QNXA 4G7VL 3B3IA 1FH2A 4HPYL 4PHXA 2FT7A 3N42B 5CEZD 5DYFA 5IEKB 5KSAA 4DPAX 2VE6B 3DHUA 1W72B 4FG0A 4IEFA 4KROB 1JSYA 3Q8FA 2A5UA 2EDWA 2HFEA 4AEIL 1TJIL 2M2DA 4KITB 1ZIAA 2OSLA 3MLWH 2ZOKA 1AIFB 1EXUA 1VAHA 2VLKA 1WT5C 1EFXB 1OP3K 1NLBH 1DQQA 1A8ZA 3QJUB 1K5NA 2G2RB 2XVLA 3CSPA 3LS4H 4DAGL 1Z9LA 4N86A 4N6QA 3SYCA 1THAA 4PJ5A 4RMVA 2XWZA 4YFDB 3B2DC 1JTTA 5K9OA 2DWSA 1A7NL 3P9MB 1R1CA 5I6LA 2FQEA 3MGTA 3ZE1F 2JELL 4EE2A 2M83A 3FU7A 3VFTA 5F7FA 4NZRH 1SHWA 1EJ8A 3WNJA 1KPVB 1RSFA 4DOHB 4JHWL 2FX8H 3MRLA 5CUSL 5FX3A 3QULA 4L37A 5DMKB 2CDFB 3DOSA 1HQRA 4RAHA 2G4GA 2X2UA 4J3XA 3EJZD 5EHFA 1GGIH 2B4CC 3SGEH 1BAGA 2GHZA 1KTKE 3CSGA 3D33A 4S0SD 5FUCE 3VM5A 3WE6A 5MENE 1AO7A 4MMYA 3TIEB 2OULB 3B56A 1T1XA 2AQ1A 4QY8A 2FYYA 2X53A 3EJSA 4YHIB 1NIDA 1JF1B 1FAKT 3MV7E 5FM5M 4NKMB 4NSKB 2LR4A 3IMUA 3CFJA 3CZLA 3V0WH 5IHZB 5I8CB 2BIMA 3FTZA 1JZJA 4ZDHB 3TGXA 1LK3H 1ZGLB 5AVUB 5F9AC 4XMKH 4F2FA 5DZNA 3JBG7 4AZUA 5DD3H 1X4ZA 2ADJA 5I8KL 3DSNA 4FXLA 4PG9A 1N2RA 1UQSB 3CFCH 4LPVA 3LH8A 3ZE1B 4HGWA 4OFVA 2FIKA 4HF5L 4ZO8A 3SDAB 5JOFB 2VDLH 3TASA 1U8LA 1DEDA 4MHHI 1Z0NA 3QUZB 1A7BA 4RCAA 2VABA 1TU2B 4UOW0 1D5IL 1T21B 3WY2A 3HN5A 5DRWB 1DL7L 3RGHA 3UDWC 5KW9H 1DJIA 5KJRH 3EDEA 3P30L 4U3SB 3UGUA 3ULVC 4LKXA 4W9LC 3GMQA 3IGAA 2ENQA 2B4CL 3C8KB 1MFVA 4ELDA 4LSQH 2DRUA 4GRLC 5AVYB 1JPTL 1QLFB 4J39A 2NNCA 2J1YA 2Z8VC 5DC4B 1XIWB 2IMNA 4IOIB 4P99A 32C2A 5DVLA 3PL6C 2PTUA 4HT1L 5SX4H 3K4DA 1T7YA 3Q8CA 4XC3H 2BRRL 3F6IA 3M88A 1MJ7L 3LIZH 4JO4L 3DK0A 4MDIB 4W81A 5C6TH 4IGBA 1RUPH 4S1SL 3S2CA 4N0YH 3NIGB 3ZN6A 1M6OA 1Z5YD 4HHAA 4NFCA 5MENA 4U1HA 1MY5A 2YD0A 1OY3B 3MV8B 1ID2A 3S2AA 3WN5A 3MLSH 1IRAY 2F54D 4JE0A 2F2HA 1T66C 5GGUB 5A6LA 5SV4A 1PZSA 3RLSA 2VDQB 5K1JA 4GPVA 3Q44A 5F7AA 3BGAA 1CXEA 3H3PH 4U6XA 4OFPA 1ZAGA 3ENEA 2FUTA 3QCUH 4RZCA 4JW3A 1JRHL 3BPCA 3SQOL 1RAMA 5E5MA 3V0DA 1TVDA 3U9PH 1EO8H 4HLEA 4JJHA 1ZLEA 5DLLA 1CTMA 5I74C 3EBAA 2B3RA 3D85D 5ICZB 3HC4H 1N5AB 5KYUB 2CKBA 2DICA 2VLKE 3FQ4A 3SGJA 4AEIH 4D7BA 3K2MC 4YNYB 4RAVB 3QEQA 4C56D 2CDGA 3MLWL 5FOBA 2VKWA 1B4TA 4M6MH 3ARTA 3RA7H 3SIKA 4NUPA 3R4DA 1ZLVH 3EIFA 3US0A 4A66A 4QGYA 2J8UF 4HPOH 3IMBA 4U31A 3FOMA 3Q48A 3WNNA 3IDXL 4PJXB 3LS4L 4GSDL 4P9MH 4DAGH 1PKOA 4UQCA 3KPMB 1KDIA 3IAPA 5KBLA 2VRQA 4R4FH 2HTKD 1UZ6F 1REIA 1EHNA 4Q4IA 4P57B 5I9QC 3FCGA 4I0CC 1D6EB 2W60B 3PWPB 4N3TA 4BFOA 2JELH 2HT2D 1KPRA 1A6TA 3NCFB 2C1OB 5I2IA 2H2PD 3OZKA 3A6OA 3R18A 5CUSH 1BZ9B 1SY6H 3MV01 4OB5L 4BSJA 1KCUL 5ESVB 2WXNA 4UTAL 2PP8A 4FQ1L 2ITCA 5DZLA 3CHXA 1I9RH 4DGIL 4ZFOA 5EFIB 1B90A 1FUNA 1I3UA 3WUWG 1MAJA 2OTUA 4ZS6D 3WS3B 4TSAH 3NEXA 5SWSD 1J8HE 2OFQA 4JDVA 4LVNC 3WS6A 1FORH 3CSYA 3MBEC 1E9PB 3EYFA 3KGRA 4P05A 2R69H 1RURH 3K1KC 1QSED 3KEDA 4NAQA 1MCOL 4G9DA 1HDMB 4JZNA 2P5WB 2Z31A 4PH8A 1CI5A 3IGKA 3DX7B 4XMKL 3VYPA 1CGSH 4X8XA 1E9QA 4JB9H 3X3FH 4GG6E 2CGRH 1NCJA 3EW3B 4YDLB 5D1QB 2A4CA 4HUUA 2P52A 4W9FC 5C0BB 4ES8A 4M93B 1M9WA 1B4JH 5BRZD 4N22A 4KDTC 4PRIB 2MHAA 4HUCA 2BO0A 3J07A 4R0LA 1F90H 1XQ4A 2B5IC 2CHWA 3QUGA 1KGCE 2BDNL 4JBSA 4XVJL 4LHUD 4KH9A 4K2UH 5TF1H 3AG4B 5E9DB 5KJRL 1CDCA 3DSNB 3P30H 4ZMXA 1B3JA 2PO6D 3UABA 5C0FA 4RGNE 3G5ZA 3ZLQC 2GEQA 3MRKB 5PAZA 1Q4NX 2B4CH 3FUDA 5CEXA 1E28A 2LW3A 3ETBF 4FNPA 3ROOB 3OM3B 1CUOA 5E4IA 1C5BH 2BNQE 2E6PA 4YDMA 4Z0BL 3QCTL 2GI0A 3I85A 1F3JB 5ERWA 3WU1A 4FG2A 5TDNB 5B39G 1WBXB 4AV4A 3ML9A 1TTBA 3T71A 3QXVA 5JR1H 3D9AL 1MJ7H 4G9FD 1KCKA 3NGBC 3ILDA 5EUKA 2WZ0A 2W0FB 4N0YL 1P5UA 2WLHA 1MG2C 2ESVE 3LPGA 1HIML 2ADFL 4AVHA 1XGUA 3NA9H 2JI1A 1M3JA 3ARZA 2XXGA 3LEXB 3PGDA 1LE9B 1JNNH 32C2B 4QXTA 3RY6A 2H2SC 2OCCB 5AAWA 5HHOB 2DQGL 3BWUC 1MCFA 4JN1L 5L0QC 4S2SB 3KH4A 3II2A 2GB2A 4QRPA 4URTB 1I3VA 3KPSD 1NLDL 2DKUA 4YDJA 2QSQA 3GMOB 1TR7A 2F1EA 4MA3A 3SE9H 3SQOH 5HBBA 3MLTA 1KB9K 4EN3B 1P4UA 1IQDB 3U9PL 4YDZA 5GGUA 4FQPA 5E6ZA 5L7XL 3V6ZA 1T5WB 2FSEB 5D93C 5I71B 2PYEB 3TNNA 3ARYA 4BFRA 1TJXA 3L3JA 3MLUL 5FUZL 4JRXB 3LKNA 1MFBH 3BISA 2XQBL 4MA1C 3ARDC 4LP4A 2A1WH 2GCYA 1R46A 1Q9OA 1SJEA 2F58L 3K0WA 3O3DB 5E5MB 4F1ZA 3VWJA 3RA7L 3NACH 3IBOA 3AQYA 1SXBA 1I3RA 3VG0L 4Z7OB 4CL7A 2FBJH 2HJKA 1MWAH 1PZAA 2YIHA 3IDXH 1CDUA 2OI9B 1A6UL 1ZANH 5EZIH 1F6FB 1C08A 2AKRA 3PCYA 4BSVB 4QEGA 2JKJA 3LVEA 4LPTA 5FOJA 4A2MA 4QCIA 1XGPA 4KHXH 2O5ZH 4HC1A 4MYWB 4MAZA 3KW7A 5AL8A 1NCGA 1IKFH 3AUVA 4CVWA 2UV3A 3FQUA 4FJZA 4WJKB 1EAOA 2VLKD 5TE7L 3LZPA 5DHXB 1KCUH 4JO1L 5F9DC 3HE6B 4UYPA 5FW6A 4YS4A 1KBVA 1SHSA 4YX2L 4G7YL 3KPSB 3PWPA 5FYKD 3VFMB 1I9RL 4NHCH 3SKMA 4XZ4A 2XPGB 4Y9EA 1AGBA 3KPLA 5GIRA 1FO0H 4TSAL 3MJGX 3DTDA 1FORL 5JNYA 1ZGLM 1PY0A 2CLVA 5FYLE 1M7UA 1ZHBA 2R69L 1RURL 2IC2A 4JHBA 5C09B 1JZIA 2XETA 5DSCB 3QFJE 3R8QA 4HKXB 1DJHA 3L6FB 4UNIA 2GIYA 3FQXB 1CGSL 1OPGL 3B2MA 5CWSB 5H35B 2BVPA 3VA6A 3WTXA 3DNKA 1X5XA 5I66B 2CGRL 2HYMA 4WJ5B 2GBTA 1UYWH 4OZGF 1A1MA 1A2YA 1HXYB 3BKML 5AG9A 4NN7B 1SN5A 4GRLD 5DQ9A 3VI3E 2PCXA 4BE5A 1LVEA 1KENL 1F90L 2IAND 5IEKA 1QR1B 1KBBA 4PVLA 4K3GA 1A4AA 5ENWA 4POZC 3QO0A 5TF1L 3M1OA 1EHKB 2Y22A 2K6ZA 2GUOA 2HX8A 2EQDA 2J5LC 2VDRB 2Y1YA 1X5AA 4JFDD 4CVUA 4OD2B 1SZNA 1T6VN 3CDYA 2ZUXA 4L2LA 3GBLA 2GITB 4BQ9A 4Z0BH 3QCTH 2EYTB 4FJYA 1DQQB 1OSZA 1RZJL 2QADB 4K73A 2JLPA 2WVUA 5JR1L 3D9AH 5CFHA 1CD8A 3HBPA 5DGRA 2CA4A 2AJVH 4IGBB 2XFGB 5L4MA 2X4OB 3NA9L 2RBLA 4IRJB 3F58H 4OCMC 1ZVNA 3U4BH 3FQ2A 2GABA 4HMDA 5FGCB 1NINA 4KQ4H 5FGRA 1HL8A 1OO2A 2DQGH 2OMZB 3HOGA 3BVNB 2YBGA 3EJZC 4DZBB 3ARBD 5KSUB 2YD1A 3BP5A 4PLJD 4U3SA 4CN4A 1T1ZA 4EPSA 3G6JF 1AR2A 3B9EA 1O7SA 3F05A 3IJ8A 4YHYB 2CO3A 4HEPA 2WIIA 5L7XH 1MFNA 2E3VA 1ADQL 3CQPA 5DJ8A 4UINL 1U2HA 1LO0H 2XZQL 4HU2A 2RQEA 3DDGA 2WAHA 4K55A 3HHRB 4LSTL 1D5XB 4HAGA 4XH2B 5JOEA 3QG6A 3U4AA 5HP5A 1UZ8A 3CNKA 3C5ZC 1WAAA 5DVNA 1ZPLA 1PGRB 5DZAA 5HYQA 5HD8D 1DQML 5FYLD 2CWRA 2A3TA 1J1OL 1BJMA 4FQQB 3D39E 4EUPG 2Z8WC 4CBPA 1AP2B 3HG1A 2YEZA 4F8NA 4Y89A 3KPRD 5C97A 3ARFA 3O9WD 4XBPA 3DBXA 3T08A 1LE5B 3EOBA 1HILA 4U1GB 2EIJB 3CH8A 3SKOB 3C60B 4QRPE 4YAQA 3FXIC 4TSBH 2VXVH 4K8RL 4LHQB 4I7ZC 2AHIA 3X2QB 1C9SA 1QLFA 3PRZA 2O5ZL 1D6VL 3VUAA 3ARDD 3Q2NA 4HXAH 5I75B 4GYBA 2E9JA 3L4CA 4FHBD 5IHLB 1IKFL 2OA9A 1S8DB 3R1GL 3RB5A 3TPKA 2BSCA 1LXMA 3NRQA 4ZODA 4TPRL 3SYAA 4JPIA 4KX9A 1XDTT 2WXJA 4PJHE 1KBWA 4JO1H 4RMUA 5F1NA 1UGNA 2JIXD 4P06A 1D2OA 3G6JE 3OKDB 4NHCL 3H4FA 1YUKB 3P4NB 4BKTC 1T2JA 1CE6B 1QI5A 2FCBA 4LCWB 3ZDXF 4NNPL 4BCZA 4XP5L 3PWLA 3RY4A 5I0YA 4PR5A 4XPHL 3T4AA 2K1MA 3EFDH 2LTQC 4OW6A 1Q9KA 3H6JA 3HRZA 4HIJA 3WTTA 1SJHA 2BSRB 4WW2B 4LSUL 3MLRH 4P23A 5JPNA 4A7QA 1MCJA 1WZ1H 4WKXA 1Q9LB 5C0AA 2QGDA 4MD4A 4MCZB 5E9AA 5I1IH 1I7ZA 3LRSB 2YPLD 3HE7B 4IEFB 2WXHA 3NCMA 4KKZA 5IJBC 1YEJL 2I7SA 1UYWL 3EH4B 1K5WA 1KPRB 4AVIA 4I3GA 3CPLB 1ZDSA 5C86A 1KENH 4N0FA 3T6VA 1X5LA 1QFWH 1CD9B 3H8NA 3L2LA 4YGAB 3GPEA 1S7QA 4G8FA 1ZE3H 1DVSA 3H9SD 4XMZA 3ZDWA 1VZIA 4K8RD 3LNHA 5E9DA 1TEFA 1UD5A 1W15A 3K0YA 3LXBA 5ICYA 2AXGB 3CX5J 1UASA 1OARH 3WD5H 3MRKA 3GXNA 4HV8A 2HKFL 1UEYA 4PJGF 2IDSA 4QRRB 1QA9B 2G75B 4F33B 2WANA 3CXHJ 1G9EA 1KIUB 1ZSHA 5EZLB 1SMDA 3ZYIA 2XY2A 5ENWB 2P47B 2CMRH 1R5VB 1MHPL 4JKPL 5AZ2L 4KOBA 1BGXH 3OZ9L 1EZSA 4LF3B 5ABAA 1E9QB 3OJMB 2N0KA 3RU8H 2ZSVA 1CLZH 1HI6A 2UZIH 2CGYA 1FAIH 5D1QA 2O6FA 3F58L 1GSMA 4UQEA 2J4WH 1LO3H 2QQNL 4WTZG 5F0LB 1XIWD 4NQEE 1MCKA 3T77A 1WIUA 3FT9A 2BSTB 4CN6A 5DD5H 2EYSA 5JIDA 3CFKB 4XMTA 3K6NA 3MJ9L 2P28B 4PG2A 4PP2A 1BQRA 5DHVB 1RZ8B 4ZS6C 4YFLI 3U46A 1XR9B 4B9YA 4D94A 1QEWB 1J1XH 3MR9B 1FPTL 3GMOA 3K2IA 4NKQB 5ID1B 4DGYH 1P1ZA 3D18A 1ADQH 4K7FA 3V8OA 1AR1B 3EGXB 4D8PA 2C3WA 3O3AB 3A4FA 3MUJA 4HWBL 3CMGA 2RAMA 4IKJA 4U05A 2BVOB 3CDZA 5LNEA 3V55A 2ADIB 2XA8H 4P2AA 5DJDB 3S9DB 1DQMH 2KDGA 4JZJB 1J1OH 1FP5A 4PI0A 3TFKD 4K5NA 3NSDA 4GRMA 3C8KA 5L4IA 3TYFA 1MW2A 1MCPH 5I5IA 1AOZA 5C0IB 1MOEA 3MI6A 4MA8H 2BIQA 1SF5A 1WDAA 1UCBL 2HN7A 2YPKB 2VLLB 4LIQE 3CZUB 4C56B 3CFUA 3SDXF 2P45B 4KNQA 5CEXB 2CKBB 2VXVL 4K8RH 2EDMA 2ERJB 1TYEB 3WNPA 1P6AB 1DDHA 4PGEB 4TUOA 2BH0A 1ZD6A 2J44A 1TUPA 4TOYL 4YNYA 1LWRA 3MNZA 1SEQL 5F44A 4IHOA 3R1GH 4K5LA 2PPCA 2PLTA 2CIIB 2BZCA 4D0CB 1LEKB 5DQ9B 3UTSE 4KI1A 2WNXA 2D7TH 1BREA 2R0ZH 1GGCL 1IVTA 3W9EB 2JCCE 1FGVH 3QAQA 4XP5H 3QEQD 5G4MA 2HFFB 1J8HB 1CDHA 5ESQB 1BHGA 2Z31C 3B9AA 4Y2OA 3IXTB 1BM3H 4NZTL 3S3DB 4LSUH 1G4RA 3FZUC 3MLRL 5T1LD 2A4ZA 3QUXC 1WZ1L 1XGZA 3SCMC 4FI7A 1TLMA 4JQXA 3UC0H 1WYJA 1VFMA 5JDSA 5I1IL 4PWKA 5F70A 1TEGA 3EXJA 1S5IH 4AYGA 3SKJL 1WHPA 1QI4A 1WFJA 1K8IA 3FW6A 4F9LA 4BXVA 3HVNA 4I85A 3VXUB 5EUOA 2E7CA 3VG9C 3C75A 3CUPB 5HGGS 1E6OH 3ASOB 4WIQA 4JUSA 1N0XH 1NGZB 4X42A 5I1LB 1VFBB 4QRAA 1QR1A 3U7WH 4HOWA 1CGUA 4UCFA 5JORA 2DZEA 4H26A 5HPMA 1EHAA 3EH5B 1LO4L 2E4FA 4QWWC 2HKFH 2PPFA 3K2UH 5F88B 3PYCA 2WBXA 5JXAH 3O41A 2KI6A 1PS3A 4D2NA 3B6SB 4GXVH 5AALA 2ZF9A 2CMRL 2CK0L 3JVGC 4JKPH 3ZKXB 3AWFA 2J2ZA 3L6FA 2V17H 5HHQB 4XCYA 1YY9D 3EGDB 1QD0A 3PXLA 4NWUH 3UBGA 1J5OH 3FHEA 2QELA 3GGWB 5EBLA 4EJ1C 1FIGL 1HHGA 3H2PA 1JXGA 4E36A 1BEXA 1FAIL 3QXDA 1B2YA 2XWBA 3U7YH 2MQCA 4QHLA 2X38A 1J48A 2P5ED 3NFPA 4KKPA 5GS2D 2XJKA 2VAJA 1J9RA 5LNDA 4UU9A 4MQXD 4YBQD 5ALCH 3ULUD 4U3XA 3N06B 1GZHC 5DD1L 3K6DA 3CGTA 3MJ9H 3LKQA 4Z7IA 1K4DB 4OZ4A 2XVBA 1WWWX 2XYBA 3DX7A 1HILB 4PLKC 5DJYB 4OCWL 2QR0A 3ETTA 2YAOA 5FF6A 3OSKA 2JCCB 3C60A 1J1XL 2MRYA 5HHOD 1MG3C 2XTJB 3QT2A 5C0AE 3P1VA 2YAEA 3BFQG 1ZA3A 1S5HB 3H42L 3QRGH 4JMNA 5HHOA 4J4PD 5FLUA 1HJCA 4K9EL 1PZ3A 1G5GA 3HAEB 4MCNA 4NPKA 3IJHA 4MFHA 4FFWC 4IRZA 1U8IB 5IQLA 4LEEA 2CR6A 3ZL4L 5JW4M 1FFOB 4NCDA 2RALA 3PQYB 4LB8A 1ACCA 2AJYH 4OLUL 4FLSA 1OZUA 3L4YA 5DJXB 1A0QL 3G08B 3RDTD 4CNIA 3IMTA 3VFRA 3E7JA 4CKVX 5LGJA 5BZWB 4GO9A 1DQDL 5IMKB 1NMBL 1KYFA 2LFEA 2E7HA 5E6SB 1J0HA 4PJDF 1KEMH 3O4LE 1UCBH 2NSMA 4FG6C 1CJYA 2Y5TA 2YKLH 5I75C 5KAQF 4GOSA 4X4YB 5B3NA 5E2JA 4QAMB 2G2NA 3KWXA 2ISDA 1S7RB 3CFDB 3RJOA 4L3ED 4A38A 2EICA 4MNQE 3L7FB 4K3EH 4KNUA 2EE3A 1VADA 3HE7A 1SEQH 2ZWKA 5DK2A 2GIMA 5HDBB 3V9EA 1WHOA 4XP6L 4JFEE 4FOMA 3A4AA 3NJXA 4GQQA 4R96A 2J5WA 1PPIA 2IGTA 2D7TL 2R0ZL 1BZOA 4KY1L 3X12A 4F9LC 1VFAA 3C5ZB 2YHGA 3P4MB 3D0VA 5TFSH 5IF0B 1FGVL 2VDML 1SQMA 3MV11 1I1YB 3IRCA 4UOZA 4OT1L 3QI9D 3D51A 3KPRE 4ENZA 4ZYKA 2EILB 4QR7A 1KT2B 3MBXL 5IJCC 1YN7B 4XZUB 4FMFA 1E27A 1F4YH 2A38A 2YEZB 5D7LD 4APQA 2IG2H 3SDXB 3BJLA 1HHJB 1GR7A 3MLYH 3MNWB 3DURB 3N43F 5TPWL 3QIBA 1QO3A 4PRAB 2Z7ZA 1DVXA 2UWEE 2CO2A 3MGAA 1KBPA 2FO4B 1J12A 4UIMA 2ZXDA 4HIHA 5EU4A 3L3IA 3AREC 5IW1A 4JN2A 1NDMB 3GI8H 1TQCB 3ZRSA 1HZKA 2A6KB 2MOVA 4P2RE 1IBYA 4HWEL 3KL0A 3QUHA 4I1RA 1E6OL 3DK2A 4HEPG 1K5NB 2DQJH 3QEGH 6CGTA 2Y5EA 3NIDF 1ZLVK 2Q20A 4UT9A 5JDSB 2NY5L 1P4BH 4HKXA 2YOAA 3QJZA 4ANWA 4HAKA 5IZ7A 4P59H 5D7JB 3ES6B 5HGBA 3PQYE 4JL1A 2VDNB 2VISB 4GI8A 1RPUA 2NXZD 3K2UL 1L9PA 2B8OT 2EYRB 2Z35A 1CG9A 4GXVL 3K6OA 5J57B 3ERXA 4NRYB 3H55A 2CK0H 5ID1A 4HIJB 5IOKA 2VQ1A 3TT1L 1KXTA 1BF5A 1O7DE 4JGNA 1YO4A 2NRDA 4OH2A 4NWUL 1J5OL 1FFPB 1HT6A 3RNKA 1FIGH 5EV7A 2NQDA 4OLWL 4XPGH 4L1HA 3K7UA 3H9HB 4TVPD 1T7XA 3NSFA 5TDOA 3UG5A 5ECGA 3HS0C 4UZGA 1WS8A 4WI3A 3SKMB 5HJ3A 2O93L 4P5KB 3MJ8B 2EEBA 5EF0A 4AMKH 4CJ1A 3MRMB 3W11D 2C4XA 3NIDB 4KKAD 4ZMWA 2OCJA 4OJEH 3TESA 4HZLA 4Y8DC 3R7RA 5D71H 1DN2A 1N26A 3JTSB 3EH1A 5EEUA 3UTTE 2BMKB 4RA3A 2QSCH 5A2LH 5IKCB 4HS3B 1M3IA 1H15A 1PKQB 2JE8A 4KZDL 5KOVC 3WXWH 3P9LB 5EU3B 5AFAA 4EEEA 2YAHA 1UENA 4RBPK 3AAZB 4DO4A 4XNDA 3VXSE 4W9KC 4ONHB 2EVFA 2YUWA 3ZL4H 3FONA 1XO8A 4Q58C 2RFXA 2FO1A 1DANU 2C3GA 5IFHH 4Y5XA 2DI8A 4BUQA 1KJ2L 4N0FB 2X9WA 1KIPB 1BBDL 1EZVX 1DQDH 2D3VA 2DLGA 3V2AR 1N10A 1X3DA 3QHFH 4X4KA 2WUCL 2JKRM 4MNGA 2ZP8A 4PY7A 4H8PA 3O0RL 1ZXQA 4PJBE 4S1RH 4JG1H 3US1A 1HWHB 4L8CA 5L8KB 1DUZB 2B3IA 4XNBA 4Z7UB 1G7HB 4MJ5A 3PFQA 4ACPA 4HP5A 4ZNEE 1RJLA 3NAAL 2J88L 4DOHE 4F7TB 2XG5A 4GRWH 4KY1H 1PZDA 3EUUA 4ZMQA 4LOEA 2RCSH 2ZSVB 2IFGA 2GYSA 5FGBC 5DJCA 3FCTA 2C3VA 5BQ7A 2V9UA 5DZOA 1F6LL 1CQYA 5MEOB 1RMFL 2VDNL 3ECVA 3MBXH 4MVBC 1OF0A 4YHPB 1AXTL 1WCQA 2V5SA 4MHHG 3T0XA 2FUQA 1WUNT 2NLJA 1AY1L 2NY1D 1HSBB 4A7VA 1OWRM 2QLVB 4R97C 3MLYL 3W57A 4JM2F 4Z3JA 2E0PA 5B1JA 3T0EA 4X7SH 1U8HB 2BOCA 1XGYL 5A2AA 2E9BA 1OP9A 3KMDA 3UGXA 2DOCA 3KBFA 1XR8A 3TN0D 1SVBA 3SPGA 3FYIB 2W91A 3GI8L 1KT2A 3D4YA 3EYUH 4FHKA 4N8VG 5F9WC 1DJYA 4XB7A 3MCKA 4FYRA 2IGFL 4PRPA 4F7KA 3BIAX 2X9ZA 3R8BB 1M7DA 5JZ7C 1YMHA 2IH1B 3AACA 4PJ7B 4XX1G 5BVJA 2R9HD 1WFUA 1YEEH 5E5LA 4G5ZH 4YLCA 2DJ4A 2ZUWA 5E1AB 4L0PB 4J2QA 4APQD 4OIAA 4FZEL 1H3UA 3MA9L 4ZSOB 1R3JB 3FTWA 4P2QE 4F7MA 1MFAH 2YN5A 1A7QL 1FVEB 4X6BB 3VGGA 2A6DB 2YD5A 3DX6B 4PSRA 1J9CT 2VLJB 5F7YC 4ZX3A 4PTUA 3LEVH 4ODBD 3EHBD 4JKKA 1OAZL 2EC9U 4N8UA 4PD4K 3RURA 1XTMA 3F7QA 3HA0A 4XP4L 3IPBA 1U4EA 3IAQA 5INCB 2ADGA 4Z7VA 4XPGL 2HT3C 2ICWB 5E6IC 5EFIA 2VMEA 2PR9A 4RVBA 2JKXA 4KV5F 4NI6A 1CG9B 3UBXG 3VFPB 3GIVA 3DX3A 3F00A 3P3UA 4Y5YC 1M1SA 5F89A 3BHBB 1WEJH 3VGFA 2PKDA 4LEOB 3ROLA 3Q0HA 1JV5A 4E42A 3Q8EA 3JWNG 4JFQA 3WHE1 5KYWA 3W81A 4NNXA 4J5VA 1BMZA 3QSKB 1NCAH 2Y07L 2QSCL 1WFTA 2NYYC 3B7RL 3ZK0A 5L8JB 2E7LC 1J5IA 3GMQB 2HFTA 4WFGE 4RFNB 4KZDH 1UB5A 1I1AD 4XNQA 4HK3J 5D7IA 1YUHB 3T1FA 3K6SA 2W65A 4JFUA 2Q8AL 4HZAA 4YSQA 5DRZA 2AMUA 2MCAA 4B95C 1DHKA 1FV1A 2GTZA 3QPXL 2AK4D 2JMRA 3LXUX 2BHFA 4M3HA 4MXQD 3APDA 3CFKA 3N1PC 3QXDB 4NQCE 3RILA 1HYSD 3LSOA 3O6FB 3U9WA 5F7WC 4N4YB 3C60D 5DZ9A 5JOFA 1BBDH 2OMWB 4UV7L 4XCEB 2C9PA 1Q9WB 2NY3C 4PYGA 4X9HA 4FEIA 1CBVL 3QHFL 4HLJA 2WUCH 3S5LA 2R4RL 4PJIB 3O0RH 4S1RL 4C55A 1V8HA 3UEZA 3TJPA 3GSUB 4AV5A 2YFOA 4A2GA 1HCFX 5F88A 4UQBA 3G5XA 5A3IC 2VSMB 3KYMA 1RVFL 3KPRA 1KIPA 4U0RC 2WZPA 3KXFD 4NO3A 4XO3A 5FUCC 4MNQD 2Z34A 4TM9A 4XCYB 1L7IL 3KPNB 4XHJC 4FA8A 2RCSL 5AOKA 3SE3A 4BD4A 2SEBA 2ZUUA 5KANI 1GYVA 4CVZB 4U7SA 4UANA 3AREB 5FC9A 5AVRB 3BH9A 4GAYB 3D2TA 3VA2C 2CHZA 1V3LA 5GGRA 2NDFA 2VDNH 3NFNA 4PLOB 1NGQH 3H54A 2OYMA 1AXTH 3PV7A 4B3EA 4GRLA 1IV8A 5K9JL 2AVGA 3ALXA 4YUEH 1D2PA 2OXHA 2QBWA 3Q8BA 4TNGA 1R3HA 1XGYH 3L5HA 2VC2L 2VUOA 2VRKA 1FFRA 3PL6B 3F12A 4Z95L 4X4MA 5C0ND 2Q9OA 3GT6A 1JHLH 4LCIH 3EYUL 3VFOB 4ACTA 1EAQA 5EOTA 2WBJD 3ARFD 3O9WA 2IGFH 4WGWB 2AJZA 2CCWA 4H0LC 1EFXD 2FHBA 4YHOH 3ARXA 4POYA 4PJAA 4YVNA 3K6IA 3RFRA 3V5HA 3IE4A 2XN9A 4H40A 2E7MA 2NNFA 4KVCL 3OKMA 1IIKA 3QZNA 1O75A 4FZEH 5LBGA 3MA9H 5HVWA 2IV9A 5IIEA 1P5VA 3B9VA 2AITA 2CIKA 4OGXH 1A7QH 4IU3B 2Y9RT 2CDGB 3M07A 2BWDA 4QRQA 4RGNB 1WICA 3NZUA 4UNUA 2W9DL 1R4XA 3JVGA 3SPJA 1YMHB 2EYRA 2IH1A 3LEVL 4ZMPA 1RJZB 2J8UB 4AMXA 1VRSA 5DD0L 2OBGA 2GK0B 1AR1C 3DUSB 5E5RB 1E9PA 2K45A 3EYFB 3W5MA 4NENB 3ZT6A 1YPZA 4HSAC 1KBKA 2DMCA 2H5UA 4G9DB 4JZNB 1J8KA 4KHTH 3B8YA 4HJUA 2R2EB 2IPUK 5D96C 1K2DB 2C4FU 4QLWA 3FYEB 4MD5A 2OZNA 3IDJA 3AMKA 1DVFB 3OAZK 3FQRB 4W6YB 2R2HB 2PUQT 4QIRA 5FO7B 5HPMB 1N64L 2L8AA 4P2OD 5IHHA 4JJOA 4ZT1A 3GDBA 5T3ZE 5IEHA 4BWUA 4E9TA 5BW7C 3BPOC 2WLMA 5AAPA 2LLGA 2CDEA 2Z0BA 3ZKXC 2EUZA 3ZRCC 3Q05A 2L3BA 2PYFB 4FFTA 4OZFB 3V7AG 5C9KA 5HD8C 1YY8B 2CAKA 5F7NC 4QDGA 4U1LB 1GW0A 1FC2D 4N2NA 3ZL2A 4MAYD 4TF4A 3LB6D 5A6MA 2WWKT 2YGOA 3TIDA 4S1DD 1MRFL 3QIBB 1C5DA 4PRAA 5JA8B 3C09C 2TSAA 4YR6B 4FNLL 5C8JB 1NCCH 1MCEA 3DO7B 4O02L 2EKSB 5I76A 5IG7B 1LK3L 2YAQA 5H94B 5J1TC 1K4DA 4AITA 5DD3L 2H8PA 1P9MC 3OPUA 5JW4Q 3NN8B 4J3VA 1NGYB 2FBRA 3QUYC 4HJ0C 4MDJB 1ZTXH 2H26B 2CO7A 1VSCA 4QNPF 1CBVH 1JWUA 2O72A 4IHBA 4NKMA 4HFWA 1A3ZA 3SCMB 3E6FA 4ZI8A 5KW9L 1DL7H 5MEND 1P7QA 4C4KT 1F8TH 5B8CC 1IL1A 4KZEH 2BXYA 3KLLA 4BK5C 4F8PA 1XR8B 3BWZA 4DKAA 5BV7L 1H15B 1BXXA 2EDRA 1BDYA 1SDYA 1S9YA 4Y4FC 3VGDA 3G08A 1OGTB 3CZFA 5C9JB 3EADA 2XJLA 2WUBH 4HLZG 4YGVB 5DO8A 3VXME 4AYSA 2XN9E 1PIFA 4HUKB 3SKNA 5EZOL 1PLAA 2HRLA 1PQZA 3A47A 3LIZL 4JO4H 1OB1B 1ZVSA 2CALA 1NGQL 1XCTA 1I7UB 2WZ6A 4MB4A 5F6HJ 3RWJA 3S7GA 2VUKA 3ASWA 1I8MA 5DWUL 5MERA 5HDOA 2X42A 1CIUA 3QIWB 4L4TE 3UTPD 1UKSA 4YUEL 3BZEB 1D9KD 1HXMA 3TJHD 1F41A 4XO4A 3ZOAA 1YNLH 2BIIA 5DC0A 4WI5A 3CVDA 3AREA 4JFDA 5C0FB 3QR2A 1FL6B 3W11C 4Z95H 4OM1L 2ZE0A 1G1OA 3MBWB 1MIEL 3BIKA 4G80B 1JHLL 3V6FB 5D2NB 2FATL 4KY2A 1O6VA 3H3PL 1OGAA 2OMXA 2P49B 3CFTA 1AG0A 4QRUA 3RUGA 1LP9B 4C4UA 2ZOLA 3ARUA 4IBTA 2Z4TA 4KI5E 2VQ4A 1NDGB 2B14A 1F97A 4TTGA 1ZTMA 2AK4A 4RSYA 4UQ2B 4X7DC 4HJGA 3TEZA 3ZHKA 5A7BA 2NW3B 1SM3L 3QDJB 1M71A 3KR3L 1FI8C 4UDTB 2EO9A 5DK0A 2AC0A 4OD1L 5EO0A 5I0DA 4NJ9L 2V2TA 3HC4L 4R7DA 1BVKB 3QDGE 3UYRL 3ZGIA 5D1XA 3AY4C 3ALPA 3QYCA 3HB3D 4I9WD 4R2GD 1Q72H 3V0AC 4AZ8B 1FVEA 2P3YA 2GSGB 1MFUA 4F7CA 1S6NA 5HHVL 2XN9B 1H8LA 3BUIA 3QIUA 3UZQB 4ALAC 3IFOB 2OZ4A 3PJNA 2BOCB 2JKSA 4GSDH 4P9ML 4KHTL 1A9BA 4Z3EA 2PWDA 5H2BA 4CUCA 3IKKA 4G70B 4GBXA 1DBJL 3FAXA 3ABGA 3WKPA 3ARDA 4L8SC 4AH2B 3QJVB 1JNJA 4ZUUA 2D7MA 2NXYB 2XWEA 3KYNA 4PJDA 1CXKA 2DBJA 4G6MH 3V6OE 3N2JA 1M05B 2UX7A 1E27B 3WKYA 1B9ZA 3STLB 1IFGA 3KAAA 2BM3A 2BY3A 3IXAB 1TIUA 2ILLA 1F4AA 5DJ2A 2YEQA 4JG0L 3VMPA 4PCKA 1R24B 1GTNA 4KXBA 4QO1A 1I8LA 4FQ1H 5D7IE 1OQOA 1ED3A 2DM2A 5F0MB 4EXPX 3HUJE 4LOVA 4Q9QL 1MCDA 4MJ6A 4ZO6A 5CCJA 3PPSA 1MRFH 2VR8A 3FB5B 4FQXB 4GAAA 2A4EA 2VLRD 2X6MA 3REWB 4QJ3B 4JHVA 1CLYH 5B38A 2XWCA 2EVIA 4FNLH 4P2YA 1NCCL 1BEYH 2Q76A 3EHBC 4O02H 1A47A 1MCOH 2K78A 3AWEA 4LLAA 5D2LB 3IU3B 3L08A 5JW3H 2O6CA 3LKOB 4NIKB 4C4BA 4PRPD 3VRJA 3GZPA 4ZFOL 5DJ0A 3X3FL 5D7JA 5CXPA 2DL9A 4Y4FA 4FABL 3TIDB 2AW2A 2BHUA 2Z91B 1EXHA 5IMOA 5I0XA 3ZMRA 5J6GA 5A2BA 3C5JB 1B4JL 1GL4B 3LQAC 4FG6D 4LHUB 3TV8A 2EXWD 5KZCB 1SFDA 2CRIA 1HTYA 3O3UN 1O6SA 3LNFA 3T4AC 1NMAL 2BDNH 2H2SD 4IGBD 4XVJH 5EG6C 4ELME 1QPPA 1CT8A 3BWAB 4K2UL 1F8TL 3MNVB 4JFFD 2GKIA 1FNSL 4KZEL 2ZAIA 3CTTA 3FDWA 4BFEA 3Q6FA 5TH2B 1B0WA 4Z77A 1GYUA 2KLTA 5D1ZI 1C5BL 4M1CD 1XBRA 2W65B 4BZ1L 2WLIA 5FFOA 5JTWA 1JZ7A 1O9ZA 3AS2A 5G5DA 4QRSB 3Q06A 4WSKA 5GJSH 1MCIA 3S4SA 2WUBL 5H4YA 2NTFA 3GRWA 1U91B 3B9KC 4MRCA 5EZOH 1IBHA 3G6DH 1HZHL 4X6CA 1ET7A 3VD0A 3H9ZA 3D39B 3QNYB 4HKJA 4AYBA 1GKOA 5KVDH 2ZXEB 3FKUS 3QG6B 4F5CE 2KERA 4O4YH 2TRHA 2ADFH 3PIQB 2BCMA 2FBOJ 2PO6C 4FMVA 5E1IA 3UBXA 1ODUA 5CHNB 1T22B 4G59C 1XGQA 3I50L 1YNLL 2UYLB 5J6HB 1PYWA 3IT8D 4R4ND 1HK6A 4L2YA 4JN1H 3APCA 4OM1H 1LWHA 2FJGA 4L1BA 1MIEH 4NOFA 3NBNA 5F96L 4TL5A 3CSFA 3NJMA 3L7EA 1TZ8A 2JWYA 4AYDC 3TYGL 4Y2LA 2IF7A 3OWEA 4LSPL 4HCRA 4MZIA 3QIUC 4J1UB 4BKLB 1FL5B 1NLDH 3L3OB 3SE9L 3TA3C 2QZ5A 1YEIL 3V0GA 2WOYA 4PGCA 4Z7VF 2X12A 2X2JA 1GW6A 1R3KB 4GBXC 4NCC2 5IBLC 4C56A 4OD1H 2GJ6B 1IX2A 2H1PH 5KJ4A 3WKQA 5JQHC 4NBXB 4M5TA 2NY0D 3WO3B 3MLUH 5FUZH 3UYRH 4YO0A 5FPIA 5EO9B 2YUZA 3QPKA 4FQIL 1MFBL 4IRJA 4AQAB 5I5RA 1EPFA 4JANB 3SO5A 4U1MA 2A1WL 5AG8A 4BH8A 2G9KA 4RWYL 3VXRD 1IAKB 2GJPA 3PY9A 5HHVH 1PLCA 4PG2C 3NACL 3VG0H 3QDGA 1NUFA 1KGJA 3HR5B 1Q1PA 1R19A 5I71C 4R97B 3L1OL 4PRDA 1MWAL 3WJJA 3BIBX 3QUKB 2G3XA 2YSTA 4QUOA 4YK4B 5ISZA 2G2PA 1KLUB 3X1GA 5EZIL 3U2IA 3I2CH 3K8KA 1T5XA 2Q7YA 2R2EA 4JZOB 5F7BA 2J6EL 3N41B 3GBEA 3MOQA 3RUGE 2R2BB 3FOLA 3WIAA 2KUTA 2Q2EB 4YHLH 1Q9OB 4GXUM 4G6ML 2MOGA 3MRCB 4KHXL 2VZVA 4YHPA 2A6JA 3LVTA 4AX3A 1OZTG 4GUPA 4U6TA 3ZE0F 4F1SA 3N1QC 3OMNB 1S9VA 4PGJA 5TE7H 3IMRA 3QG7H 2X87A 4FG4A 5CGBA 5C2BH 3CZJA 4JG0H 3TF4A 4M02A 1CDGA 1ESOA 5AW4B 2N1TE 3VD3A 2C1PA 2CIKB 4PM1A 4JO2L 4QI3A 3WTSA 5EZJB 3BEVB 4KFZC 4I88A 1FNLA 1G1YA 2E6JA 4WK4B 4DCQB 3K8LA 3O3BB 1T1YB 4F9PA 2XC8A 5DDHB 1D3CA 3RP1A 1GPOH 4K0OA 4I0PC 2GTWB 4MJ2A 3EOTL 4OAWA 1SJHB 2BSRA 1KPUB 3HMXA 4EF3A 3IMSA 5AOIA 3US9A 3W2DL 1QABA 4NO5B 2J55A 5C0CE 1E6JH 4FD0A 3RTQC 3UZEC 2HT4D 5ADPH 1R3JA 4M7LT 3UZVB 2D7OA 4UMGA 4FABH 5SWZD 1W91A 1JN6A 1OHZA 2NY1B 1S8DA 4K94L 4J3OC 2BP5M 4ONOA 5GRVK 2AABL 4L4VE 2VWEC 4JDTH 2R27A 2BS9A 1NCIA 1FZKB 3VFUA 5CCHE 1YEHH 3PV6A 4QXWA 1EHXA 2F5AL 4GMSL 3F5WB 1DUYB 1P84K 3QFJA 4HG4J 3JYBA 1E67A 3L3DB 5I15H 1ZWIB 5T3ZH 1MHHA 3WMQA 1FNSH 4K3HA 2VN4A 2AXGA 1J8RA 2X4RA 1IM3B 1FO0B 2P8LB 2V8LA 4XPAH 1XCQA 4Y88A 1SN0A 2QSTA 1S9XB 4HVBA 3K8MA 4G6FD 3BUBA 3F84A 4KXZH 4B5ZA 4DKEL 3AXHA 2OSYA 2WVTA 5F89B 5CAYB 3QBTB 3BHBA 3LKQB 1LD9B 1XF3B 2CSPA 3L3OC 1JGDA 3QGVA 1YN6B 3S5LB 2TRYA 1X7SA 1YNTF 2PP9A 3PWJA 2GUOB 5K59F 5KVDL 4XOAA 4N2IA 3VXRE 2AJVL 1U3HC 5F7EL 3BX7C 2DF3A 3I75A 2UZXA 1MUJA 4RMWA 4ZMAT 1MHEB 1EVTC 4X4XA 1YNKH 3N0AA 5CFAA 3I50H 4M03A 3QFGA 4MQSB 3ZE0B 4FEMA 4FE9A 5H8DA 1QPXA 4OGQC 3VI4B 4ERSL 2X4QB 1WE5A 3EG9B 3BSHA 2NX5E 3RE0A 4B5EA 4Y5YA 2VZOA 5TGBB 1BP3B 5F96H 2Q87A 5C3IA 4KV5E 1FYTB 4KPHH 4FFYA 4WWPA 3T65A 2WYIA 1BXAA 3TYGH 4XPBL 5AVZB 4FADA 4LSPH 4TUKH 3UBXI 5CIPB 5DJXA 4PCSA 2NQ3A 4CNIB 3V0FA 5CN2A 4KI5C 3KPOB 3UTSB 2NY4C 1YEIH 3HZKB 4I89A 2ZYSA 3VXUE 3FSVA 4LOUD 1OF2A 3HG4A 1NDGA 2XY1A 1IKNC 1JF5A 4HBQA 3O2VL 1YQ2A 2X6CA 3UOAB 4WQOA 1A1NA 1LO0L 2OXHB 2XZQH 5JHBA 1MJUH 3DBXB 2W38A 1FCGA 2DQ6A 1MCNA 4G8IB 4UM9D 1S7UA 2VDOB 4LSTH 1I1AB 1BQSA 1P5UC 1JDCA 1NAMB 3ECWA 3GTTA 1F3DH 4HIXL 4RWYH 1NC2D 4G8AC 2H32A 2PWHA 1XH0A 3O9WB 2OI9C 1EUUA 5DEJA 4NO3B 3L1OH 4UT7H 1L7TH 4NZFA 2LU4A 2J1XA 3IXTA 3QH3A 5KOMC 3CD4A 5T33L 1PZ5B 4BQCA 1J7VR 1NBYA 4HX1A 1A9BB 1GHFL 4K3JL 4PJAE 1OK8A 1USZA 3QS2A 4JVWA 3LPWA 3NCEB 4MXWL 1PZ2A 1HFUA 4TSBL 1CB4A 3OXSA 3D4ZA 4XPTH 3TEWA 3I84A 1N0LB 4L8SB 3AROA 1ITBB 2IWGA 4MJ4A 5D72L 1TCRB 4FQ2L 2ATPA 3CFEB 4TPRH 3QIUD 5C1MB 2XU9A 3SBPA 4P23D 2P4AB 5JO5A 3O3EB 3HUJA 1L6XA 2JI3A 4NNPH 2F53E 3BDXA 4LK4A 5EORH 5IHWA 2PCPA 3MBEA 4IS6A 3MRGA 4XPHH 3VWJC 1T1XB 1TNNA 3AT9A 2NW2A 3EFDL 3EOTH 4PREB 3LZOA 3GLZA 4R26H 2C4FT 2XX1A 3SEPA 4A37A 4M3KB 4WI0A 3B83A 1FYHB 2L7UA 2JTYA 1SOSA 3B5GA 4EUPB 1NCDH 2DQHL 3MBWA 4YK4C 1E6JL 3BDBA 4MJID 2Z8RA 2NTFB 5GS3A 5INDA 4MAYB 4KXCA 3VD4A 2VXSL 1MFDL 4X6CB 3VXUA 1QPKA 1YEJH 4JDTL 3KYOA 3N9GH 1PEZA 3O8XD 1OCOB 3FU7B 2P80A 4YL9A 1GJIA 3WIHH 4B9IA 2HVKB 4GMSH 4XVSL 1URLA 4LMQE 5D2NC 1VFBA 1IILE 1RZKL 2XKNA 4NENA 2XTJC 3FFCD 4NXKA 3RWGA 5T3ZL 3FB7B 2X4SA 2IGLA 1RD6A 3SPVB 1CGYA 5C0AB 3II1A 5ISZD 3QZWB 3WEXB 4IMLB 4JY6A 3VFSA 3WLBA 4XPAL 4P49A 3HC3L 1QRNA 5GS1C 1OARL 3DVIA 3IDJB 3IGAB 3QIUB 3BT2L 2DWDB 3VSQA 4DKEH 3DHJA 3BQVA 4NQCA 4OCLC 1G1KA 4XT1C 3S8GB 1NC2B 2GEEA 1E4KA 5CJ8A 3MU3A 2B1OA 3IRPX 3LMJH 2AXFB 3TN0C 1BGXL 3OZ9H 2V2WA 3L1GA 1PBYA 3MGOA 3E8VA 3HAEH 5FO8A 4DSYA 1Z9NA 3T0AA 1L9SA 1XSJA 2B1HL 1A1OA 4MNQA 4XNYH 5T3XL 2XCMC 4Y4FB 5IGXH 2ZWNA 1MF2H 3ZIMA 3ESOA 3I6LD 1G6RB 1XR9A 4R7VA 2QQNH 5CSZA 3JTTA 4HKZA 5AAMA 5I17B 1PMYA 2CM6A 3O4LA 1IIIA 3PHQB 3KWUA 4KX8A 3BFWA 1XF3A 3U82B 4BHUA 1WBYB 2JNZA 4LKCA 3H9SE 3KS0J 1Y1DA 4QHNA 5DD5L 1JF6A 4KJWD 1YVLA 4L4TA 4WFHE 4FLHA 1TVHB 4KPHL 4F15C 3LQZB 2ZAHA 2L0DA 4NQXB 4XPBH 4TUKL 3SE6A 5H94A 5T8IA 4WU5B 2ZX8A 4HUXA 1FVDA 2HLFC 3ELAT 3HZYB 2ADIA 5J13C 5EOCJ 2CLZB 4XRCB 1TF4A 3MVSA 2DKSA 1LHZA 4MXVE 4OLXL 5MERB 4B27A 3O2VH 4RESB 3BZEA 4JFSA 1G7LA 4BQ6A 1BVZA 1MJUL 2EDOA 4MNHB 4ZOBA 4AXWB 3RFZA 4FNRA 5DS8B 4P3DB 1T03L 2AQ2A 4HIXH 4PB9L 3QHZL 2YBRA 3V5KB 5A16A 3ULUH 4U1MB 2HRPL 2XA8L 3GHPA 1EVUA 1IGCL 5GS2H 2UWEB 3MV9B 4WHCA 43C9A 4W9HC 4N2KA 4LFHD 4GRWF 3TVMD 4D8PB 1YDPB 2ZOOA 4K3JH 1KLUA 2UZYA 2RTTA 2W0LA 2EIBA 2K3HA 1BZ8A 3LN5B 5IV2A 3GD1C 4F7EB 2AQ3A 2ESVB 3QA3A 3UPAA 4CMHB 2Y7OA 1VEPA 3MPCA 2YQ3A 3PDOA 1EGJA 1B0GA 4U3CA 1H9VA 3GSQB 5EA0L 2G5RA 4CMMA 1NFKA 1X5HA 3ULVH 2HFFA 4U1NB 3C2AL 3RL2A 1R47A 4FQ2H 4AW7A 4R96B 4WHYH 5F97E 3N91A 5ESQA 3JWNH 3P73B 5DXWA 3RL1A 2X40A 2BRQA 2WNWA 4ZPTB 1FL6A 1F4HA 2BFGA 2YXFA 3UAAA 2P42B 3HC2A 2ERJC 3T6WA 3VXSD 3EJYD 4M62H 4R5XA 3KG5A 3PIQA 1VGEL 4IBWA 4KTDL 4GSQA 4PJ9C 5EORL 1TQBC 1HSAB 4PJFA 2E9WA 2WYZA 1XCQB 1SXCA 3RWHB 2FDBP 4R26L 1N19A 4UQ9A 2F7RA 3SDDA 4B53A 1BM3L 1CDBA 5E1AA 5EU5B 3CV5A 2DQHH 5A3ID 1TG8A 1Z66A 2UXTA 3ABLB 2VYRE 4HCIA 1BZEA 4IBQA 3FCSA 2LFGA 3UC0L 4Y8AA 2VZTA 3HE6D 2VXSH 3VWKD 1MFDH 4RGOH 3W0WD 3SKJH 4P9HC 4MTMA 4KRNA 4PRBA 2EUXA 1E65A 3ML8A 2CKNA 1TQBB 2IH8A 1FYTE 3CVIL 3TIEA 5I2IB 2XV3A 3DYOA 4DGWC 2VM4A 4PJBA 4XVSH 2GJ6A 1HXKA 5A43C 4JY4B 3KYKL 5CEZE 5EU6D 1N0XL 1FH5H 3EO0B 1DJZA 2LU3A 3MA7A 1JFQL 1I1YA 1RKRA 4WEUD 1ZWIA 2YD9A 3HC3H 4X9YA 2X2IA 1P7BA 3GKZA 3CN2A 3W39B 1AHWC 1LO4H 1QW9A 3CLEH 2H2PC 3KJ4B 5HHNA 2OL3L 1FJ1A 3KNBA 5DZPA 1EQWA 2OMVA 3UTSA 2WKOF 5JXAL 1QFWI 3B9KA 3MMEA 2YJQA 2V5MA 1ML0A 3FTUA 4B9CA 2A83B 2B1HH 3FO2A 5T3XH 4E9WA 4QO1B 1OW0C 4Z76A 3BD3A 4JFYA 5JHLL 1MF2L 1XGRA 3FTGB 3GSXB 5JW4N 1KLGB 1ED3B 3SSGA 5F93C 3U7YL 4UNTA 1IM9D 5KBPA 2OXGB 1MHEA 3QQNA 4XN7A 5IREA 1G9MH 3VYOA 2R1YB 3ZMEA 1KXHA 1V3MA 4OI8A 5ALCL 3MREA 4O2CA 1ORQA 7FABL 3L9YA 2YRLA 5T1MB 4YXKL 2E47A 4PQXA 4N2CA 4WTQA 5IHZA 1VA9A 2FGZA 4UWQB 3BJ91 2NT1A 5KBKA 3LXCA 5AW0B 4QJ4B 1C7TA 3V0VB 5I8OH 1UUNA 4NNYB 4QGTA 1MZYA 3ZTNL 5DLMH 1HHIB 1CS6A 2IOIA 3BAYA 4KQ0A 5G4OA 4OLXH 4IRJD 3BP7B 1XCWA 3IK2A 5EH1A 3T04D 3DXAD 5FA3A 5C08B 5E8OA 3H42H 3QRGL 4CVXA 5CLWA 3MRIB 1FWXA 3V52L 5AB0A 1BV8A 4RX4A 5JXED 1V7NH 4PB9H 3QHZH 1P53A 4HALA 5DJYA 3HE7C 3ULUL 2WQSA 1OLZA 4G71B 5LG1A 5C0BA 4OLUH 5MEOA 1JI2A 1IGCH 2BSSB 5CGTA 1XB3A 2IADB 2X4TB 1DUYA 4BK4A 1QLRB 4GT7A 2SEBB 1R3LB 3GC3A 4NKOA 1NMBH 1XIWA 2BS8A 3DX2A 4IOIA 1QSFD 1KEML 1J9QA 1XZWA 4LASH 2QKSA 3PP3K 2J1WA 2YKLL 4OKVA 4IRZL 4RRPG 4AQEB 1IE4A 3V6OA 3VSTA 4UQ3A 1A4BA 4K3EL 2VW7A 5KZCD 3SDAA 1MAKA 2VDKB 3ULVL 4DVBA 3C2AH 4IIQA 5AW6B 3UG4A 5A2FA 1H8OA 5BZWA 1B0IA 2IXQA 2BVTA 4O2EB 5DUMH 2ENPA 4NJAH 5F6HI 3BO8A 3ECBA 5JHLH 5EULV 3VH8A 4X50A 3VD7A 1RULL 4M62L 4RLDA 2PCFB 2NSXA 1MUJB 5FECA 4HIHB 5EU4B 1RIUH 4OT1H 1PX3A 4P5SA 3ULUC 3FB8B 5BO1L 4UTCA 2WBWB 3Q5YA 1F4YL 4XB8A 1KFAH 3HZMB 4N85A 4EUPH 2C1OA 4DQAA 1PD0A 5LB1A 1CVSC 3QFDA 3T8MA 3IDIA 4PP1D 2J25A 1N70A 1AHWA 4DK5A 1I3GL 2OJ1A 3QR0A 3ZVVA 4I87A 5INDB 3GRBA 3Q3GB 2A74A 1JCKA 1ZA6A 2NSQA 4EZJA 5FOBB 3FUHA 1WWCA 4HWEH 1BF8A 3T0ED 4W6WB 1U30A 4TNVK 1WP6A 2WVVA 3KYKH 1QACA 3P3TA 3PHQA 3QEGL 4G7QB 4QWWD 5EBWA 2V7HB 3MC0A 4A7GF 5D2LE 2X0VA 1MFCH 3QWRD 4LKCB 1KXTB 4FRWA 3GSWB 2JQMA 1P4BL 2YQBA 3BZFB 4GB9A 2IAMA 2FEEI 4P59L 4WI2A 5GGSB 1MJJA 3CLEL 3QO1A 1KYOJ 3G6JA 2OL3H 1WA1X 3WIHA 2VAAB 4PTUB 3B7SA 3MRMA 5J3HC 2EDJA 2DQEL 3BP6A 2D9CA 3TNMB 4WO4C 4BFIA 4QTHB 5KS9A 3MV7D 2BVPB 3VJ6B 1RP8A 1XXDC 3BE1H 4M9OA 4LL9A 1Y7VA 3BXNB 1RP9A 4Q6IC 3U83A 5HHNB 2YD4A 2MH4A 3SJVB 4P5TD 1RZJC 4DCQA 3ARQA 1PG7H 1MW3A 1UJ3B 4XO8A 1EEZB 1IBFA 3NIFE 4XB3A 5KYXA 3EAKA 2HVKA 1VPOH 5LCVA 2HX9A 4J3OD 3MX0B 7FABH 2XLLA 5I28A 5HDRA 2ED8A 2EKSA 4YXKH 5LN4A 5BRPA 4BFGA 1BLNB 2XXCB 4JFTA 4U1JA 5D71L 1CYXA 2MKWA 2D73A 2ROYA 3ZQ9A 5DLML 3IE9A 4Y4KC 2DWDA 4G8EB 1ZVYA 3HPLB 1EAPB 4WI0B 3TC9A 1OEZW 3DROA 4HK3N 3WXWL 4HFWB 5KSBE 2CA3A 2IIJA 3KXFA 4PRIA 3QNFA 4L05A 4ZNEA 1VENA 3SDCD 1IU1A 1GOHA 4NQEB 4K3DL 3DHMA 3RG1C 3E3QC 1V7NL 3EZ8A 4YXHH 1R17A 3FPXA 4R90H 4NNYA 5DJZB 4IIQC 4GS7B 4JQVA 3RNQA 1KBGH 4A55A 2ATAA 4QYOB 2IOMA 5FV2A 3LNEA 3GK8H 1KJ2H 3RI5K 1A9VA 5AKTA 3TV3L 4LASL 1LO5A 3FO9A 2JB6A 4AL8C 5D5MF 5EF2A 3S34L 4N68A 3F12B 2FLBT 1NAMH 4HUUB 1GYCA 3T2PA 5EOTB 3POHA 4AY0A 4KJYB 4U1NA 3HI1B 3N41F 5DUML 1NKOA 1YQVL 3SKUD 4NJAL 4IJ3C 4DP7X 5L2JA 5CU5A 4PJ6A 3NAAH 3UC2A 2R51A 2J88H 3T2LA 1ZHLB 5I1DA 3QH3B 3BOVA 4X8JA 1DE4A 4PWHA 1VCAA 3IS1X 2JTDA 3P3YA 2IPKB 4XNMB 2BNUB 1Z5LA 1DJGA 1U8PB 3E6HA 3DPBA 3HRPA 4HIIB 4QHKI 1RIUL 2G5BA 5ICUA 4WEBH 3N55A 2X3BA 1DYZA 1N68A 3HEIB 1AO7D 3OHXA 1BA9A 4IBUA 2A7BA 43C9B 1ZVHA 5CJXA 1WBZA 1AY1H 5ELIA 1JCVA 3DSFL 4I18A 4JO8A 2VH5H 1P4LB 5KVFL 1AAJA 1TVHA 3UX9B 1Y6NR 4X80L 2E27H 2GTQA 2PCFA 2M1KA 4XNZC 4FLRA 4P07A 3FCSB 4D0DB 2FQDA 4U6HB 2ZUVA 3F7YA 3OBAA 3OKOB 3FB8A 2CLZA 2AQQA 3P4LA 3QQ9C 4KVNL 3STBA 2R2HA 1QTYT 2NY6C 1I31A 2FECL 4Z0XB 4EDXB 1CQKA 3W0WE 3C8DA 3VQLA 3LDBC 4QXGH 4A2HA 4PJ5D 5HDWA 1MFCL 1YEEL 3CSBA 3ESVF 2XQYA 2WNGA 2PTTB 4G5ZL 2OV0A 4O2CB 3NIFB 5HY9B 3ABKB 4PGDB 4S11A 4IW4C 4WK2B 4WWID 5H35A 3QWQB 1UWXK 2N7BA 5I1CH 3PWPE 3BDYH 3LRHA 5MEQB 4AI7A 3QEHB 1DVFD 1QA9A 2DQEH 2G75A 1E0OB 3SYOA 1M7DB 1D5BA 2E46A 1KTJA 1RZPA 5AW9B 1DSWA 4Y9CA 2DIBA 3GMRA 4WI6A 5FYKU 3FK3A 2J7LA 2W8CA 4P2RA 4JREC 4NNXB 2ZOTA 3GXTA 2PTVA 3I6KB 2D8KA 4DP9X 1PG7L 3HNVH 5I26A 4ZUSB 4PMEA 3MLXL 4YBQC 1BCIA 4ISVB 4HWNA 2H0EA 4JFHE 4PJBB 4QOKE 5I16B 1QEXA 2HH0L 4Y9BA 4PWIA 3TZVC 2EYTA 2AXWA 3CVHH 1WEJL 1JMXA 2DWEB 2OMUB 3LTVA 4RISL 4PJAF 2VXUH 3MZGB 3FT4A 4V11A 1RJYA 2KQNA 3L3KB 2A9BA 2OMNA 1C16B 5KBDA 1NCAL 2Y07H 2LHAA 5IBUG 4U0QB 1YLBB 2Y5QA 4QCIB 1RZ8A 2IDTA 5D1XD 2GT9B 5ICXB 1VKXB 3TA3B 4XR8C 3C5JA 3QHTC 4N8CL 4G42A 5GSRB 5DHEA 4BIKA 2UVFA 4P23B 4AG4H 2CNZA 2K3TA 3FHQA 2AXHA 3WFZA 2Q8AH 2NX5B 4N28A 1I8IA 3TF7C 4U1JB 4XOEA 4ZUTA 1KJ3L 3JV6B 4YXHL 4ANVA 4PJIA 4R90L 4DO6A 3QJFA 3EBHA 4L4TB 4Y4KD 4YDNA 1QWHA 2AJ3A 4LLDA 1KBGL 2R15A 4MD0B 3F7VB 3GJFK 1VGKB 5AKRA 1RY7B 3GK8L 3KYMB 5C09A 4KKBC 4NLHA 3GSNB 1PZBA 2XZCH 3TV3H 3RIKA 4U1IB 4W9IC 2RD0A 2R4RH 1WZKA 3TVMA 3LS5H 4EIZC 3PWNB 2A77H 2UY7A 3S34H 3SE8L 2MMXA 1QATA 3D87B 2IOOA 3W39A 1EDQA 5D2NA 1A1OB 4LAJH 4MNQB 3QDJE 2EP6A 1KGXA 4HJSA 4BA8A 3EBGA 3TBCA 1YQVH 2M26A 1YEKH 5C7XL 3CH1A 2I9LB 2VZ1A 4PJGE 3RDTB 3SYPA 1FZOB 2WW8A 4W6XB 1L7IH 2PO6B 3IVKA 1KNOB 4WUUE 3VD5A 3QQDA 3LKSB 4Q9CA 2XVGA 3F65A 1WG3A 4ZFGL 1GJWA 4PW3A 2W59A 2YAFA 4P4KA 5IMMB 2VC2B 3GMPB 1TQSA 5IY5B 1CFTA 2X1OA 1K85A 25C8H 4LVNB 5ALBH 4BK5A 1EJOL 4Y4HA 3ZXAC 3AB0B 4Y5XC 1WISA 1OHQA 1Z5HA 2NQCA 3DSFH 1RHHA 1EEUA 1DDTA 2IQAA 2VH5L 3OC8A 4FKKA 3NK4A 2YPLE 3K91A 5DHDA 1KEGH 4CW1B 2E27L 4MNHA 4Y1SA 3VWKA 3B7YA 4PJHA 1P7QB 2VC2H 4NUJA 4N9GA 3KYAA 3E6HB 4BEIA 1KSRA 1JOIA 3CIQA 3KBHE 1R5WB 4LCIL 1KGCD 4GBXD 2G0KA 5LGYA 4XAKE 2OMYB 4X0KB 2CBMA 3D18B 4DETA 1WWAX 3UTTD 3V10A 1GGYA 1EEQA 5CZRA 4YHOL 5IQMA 3FFOA 3TA3D 2JIXB 4N6RA 2ZUQC 2NW3A 1TQUA 1GCFA 3GPSA 1MNUH 3FB6B 4IQHA 2C9AA 4IU2A 1RJZA 2J8UA 4N2MA 4X5WB 2V7HA 1OAXL 4KJPC 1MEXL 1I9JL 6TAAA 3HG1E 1TSHA 4DP6X 4POZD 5CP7A 2IH3B 4KJPD 4QRTB 4XMVA 4OGXL 3QZLA 2WQAA 4UUJB 4YAQB 3NJIA 5I1CL 2V7NB 3BDYL 2VN3A 3L5IA 2AEPL 2W9DH 3NK3A 4JLRB 2J6EA 5T1LB 1QRND 4HH9B 1BQHA 3NVQA 4L3CB 2WXPA 3CXHK 2AV1A 2Y0SA 3QFDB 2UXGA 2YN3A 1GCYA 5J06A 4W4OC 1W72L 1AHWB 1T83C 1UZ8B 3VI3F 2EO1A 1BLIA 1VZGA 4G2AA 4UOW1 2H3NB 3SZKC 2JFCA 1MWOA 5ICYB 4QAWA 5D8JL 1N64H 1UJ3A 5E70A 1QVOA 3IDGA 4H8WH 4JCLA 2HH0H 2CLRB 4GO6B 3MLPA 5GGSY 3SDDB 4RISH 3MRQB 2VXUL 1NOAA 5IB2B 3TJHC 3MV7A 3QAZB 3CZNA 3OLEA 2O5NA 2BZ7A 4F37F 2FE0A 1SUJA 2JCCA 3QDGD 2Z7UA 4QXVA 4V2BA 3FF8A 4G5AA 1UACH 4KKCD 4N8CH 2Z93B 2BY1A 4XXDB 1KTLA 4AG4L 4F7PA 4J6RH 1ILUA 2WCPA 2W81C 4TXVB 2EDFA 1KJ3H 1WC7B 4X6DF 1XWVA 3UCQA 5JW5B 1AI1L 1O7VA 3GJFA 1U95B 1GZQB 3DDFA 1P7QD 4GG8A 1QHQA 3UPRB 1X7QA 2VSDA 1Y07A 2GBUA 1KG0A 3FN0H 4H5SA 3STLA 4P9HL 3I9IA 3L4WA 1KTRL 1ZTXL 2KQMA 3L9BA 3QARA 4O58L 4OFKA 2XZCL 4FQLL 2XDHA 1BIIA 2BVUA 5LAXA 1BVNP 1L5GA 3OMAB 5IT2L 4YE0A 4HAFA 3BPNC 2A77L 5DRXA 3SE8H 2IAMB 1D5MA 5BVPH 3QUZC 4FXGC 3RX8A 1UXLA 5BV7H 1AR1D 1ADWA 1FNGA 4ZXBD 3RTQA 5EDXA 1JF1A 1IC0A 1YEKL 3DROB 3FUFA 1HH6B 5C7XH 3X1EA 4H1LB 4GW5A 2X4TA 5FGBA 1XB6A 3CU7A 1ORQB 4R7XA 4ZFGH 3QJQB 4DWHA 5L6YH 2FL5B 1M7IB 3MYZA 3D0VB 1M53A 2HJFB 3B34A 3FFCA 4JX0A 25C8L 4HHAB 4DHLA 3TURA 3KW8A 4IRSB 5K69A 1EJOH 3LNIA 5D7LE 2DLFH 1IJ9A 1FHNA 2CO1A 3PS6A 5DWUH 4GKSA 5K39B 5IOPA 1IT9L 2JJWA 3S88H 2CR0A 3WELA 3BP7A 4OI9A 2BLFA 3V0EA 2H45A 1SLVA 2YAPA 2DLIA 3NJJA 1D5BB 4N2BA 4DNLA 1KB5A 3BO8B 3FQNA 5HGAB 3HAEG 1ET5A 2I24N 1JZ8A 3OKKB 4XGZB 5DUBA 4LPXA 2FATH 1N3NA 4MSWA 2JSFA 3L3OA 1RK1B 1A6AB 1J0ZA 4IKIA 1JPGA 4TVSa 4LCUA 4QHKJ 2X05A 3TO4A 2PR4H 3VNZA 1MNUL 1HXMB 1TETL 1JYNA 3AXIA 3GMLB 2EYSB 2ENYA 1DVTA 1JNHA 1MEXH 1SM3H 3A23A 3KR3H 1I9JH 5E8PA 3X13A 3KHQA 3V6BR 1E9OB 2VLLA 3LPPA 4NJ9H 1AO7E 4OZHF 2VLRE 4NIYE 4MQTB 2LTQB 3TT3L 1Q72L 1E8YA 3MV8A 2OW7A 3G5WA 2ZPKH 3ZHLA 2JIXA 3FU0A 3TA3A 1MCRA 2BWIA 4F2ME 3REVA 3T8XB 3SGEI 1Z9PA 2NNAB 3UG3A 4MB5A 4XNAA 5D4JA 5DQDL 2R4SH 2Y69B 4HHWA 2MSPA 3L3HA 4TQEL 5IROA 1AGEB 1I8LC 1SXSA 2LABA 5E94B 3GQFA 3IXAA 5EBGA 2NXYD 3EDKA 3BC9A 3LN9A 4Y19E 1DBJH 3PNRB 3BUTA 3F85A 4AC4A 4JLRA 4ELKB 4LNRB 3CFIC 5FFGA 1S46A 3TXAA 4N2DA 3BPOB 4H8WL 3ARPA 4TUJA 1K8DA 3D09A 3VGAC 2RB8A 2VZSA