5C3IA

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
152
structure length
152
Chain Sequence
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 152
sequence length 152
chains with identical sequence E, I, M, Q, U
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5c3iA00
1WG3A 2IDCA 5EIIG 2IIJA 5C3IA 5BO0D 5BNXD 1ROCA 2DZEA 2I32A 3AADB 2YGVA 4ZBJA 2CU9A 4RRPM 2Z3FA 2HUEA 4EO5A 2IO5A 1TEYA 2Z34A
chains in the Genus database with same CATH superfamily
5CJOH 3MLXL 3CQPA 2XWDA 2DPKA 1OAYL 3MCLL 1MCNA 3EH4B 3Q6GH 3KYMB 4QRPE 4ANWA 2FWUA 1U8JA 4H8QA 1WICA 5DA0B 4HHAA 1R3IH 1T7YA 4J3XA 1FO0A 3T08A 4ELMA 3D48R 3GXIA 2HT4C 3MSPA 1AI1L 3PWVB 5E2WH 2FX8H 3IRCA 4FXGC 4E9QA 4F8NA 3QO0B 3WUWA 4V1DA 4PW3A 5BZWB 4UTBH 2HKFL 2DI8A 1XF5A 4WVRA 2DM4A 4AQEA 5IBTL 1OAXL 3MRJA 4MDIB 1QI4A 2X7LA 4X4YA 1JRHI 1G43A 3G6DH 2P8PB 1XH3B 2BW5A 4Q74A 3BN9D 4LSPL 1ZLVH 4N0UE 4ZFFA 3KLDA 4M3KB 1RPKA 2WLIB 1NWOA 4JCMA 3A24A 3MRBA 4J1UB 1QASA 5ITFA 4AQ1A 1BEYL 2UWEB 4M29A 5LDSA 5BJTB 3CPLB 3CZKA 3HZKB 4NIKB 1RLWA 3GM0A 3HN3A 3APMA 2CHZA 5D1ZC 4P4KA 4QKTA 4JEGB 3ROOA 5FO9B 1FSKC 2RGSA 3Q5OA 4AXWA 4QXGH 1KJVB 2V17H 4ZUWB 2PW2A 3TCTA 3CUPB 4UT9L 2JI2A 3P2DA 4NCC2 1AJ7L 1W80A 4WY7H 5FOJA 3LB6C 1G0DA 2WJ5A 4EN3A 3FHEA 1Q4NX 3L81A 1MQKH 4IHOA 3QCVL 2N7BA 4XVJL 3ULVH 1P1ZA 1U8JB 3QNZA 4GMTL 4ADJA 1HHGA 3FUIA 4HHAB 3OR7A 2PW1B 3KPSD 1FO0B 1N19A 4N26A 4HCRA 1JMZA 4KJWC 5I75B 2J55A 3QAZB 2V3FA 1YEEL 2APVA 4RGOH 3QZPA 2VAJA 4JW3A 2E56A 4PJ5A 1CICD 2PYEA 1XF5B 3CDCA 2VXVH 3MRJB 2NZ1A 3DGCR 2X7LB 3T8MA 3DECA 3KVQA 4M3HA 3MLWH 3WGUB 4X4YB 2DQDL 4ZMNA 5IBLD 2OZNA 5D71L 1LE5A 1JZGA 1GPOL 1QSFD 1FWXA 1NMCC 4LK4A 2IOMA 1FZOB 1JZDC 2CGZA 1TJHL 4Z7NF 3SQBA 4MCZA 3MRBB 4TLUA 4IBQA 1BPLB 4JMNA 5ITFB 4AQ1B 1XGYL 2EADA 2W9DL 1NM4A 3VQLA 1OOWA 3S3PA 5BV7L 5FO8B 5HYQA 4XGZA 4HJIA 4LOUC 3KZ8A 3QRGL 2YWYA 1XSJA 4BFEA 5F0PB 5HY9A 5HI4C 3O3EA 4P4KB 3ROOB 3P40A 4AXWB 5D2LA 2AXHA 2VZSA 3ZE2E 2PW2B 2YR3A 3TO4C 4NP4H 1JZ3A 1A25A 1X9UA 4KVPA 4U7KA 4EN3B 1GGIH 4HCIA 4IHOB 3U48A 3ARRA 1P1ZB 3RGBA 3QNZB 5D7JA 1R9FA 1HHGB 4RGNB 3WFDL 3QXVA 5D2NC 32C2A 4KY1H 3RA7H 2EDTA 4KY2A 1M9SA 3VTAA 2PR4H 2V0AA 2VR8A 2HVKA 2PYEB 4ONGL 2DMKA 2CK2A 4Z3EA 2R4RH 1K9TA 2V9TA 4DT2A 1LE5B 2CJ3A 4WCYH 1U21A 2YQ2A 3K46A 4LF3A 3WNIA 4GUCA 5D7IE 3IFPA 3VXNA 3ZR5A 4TPRH 4UQDA 3TJHD 2IO5A 2XWBA 5I8KL 4LP5A 3SQBB 1YPZF 4MCZB 1U3HA 4O2EA 3K7UA 1BWWA 4OFYA 3UROR 1P7BA 1PJ9A 3CXDL 2ADFH 2EDDA 4NGHL 2LTQB 3JSSA 4XGZB 5HYQB 1Q1PA 2DQEH 5B1KA 1BAFH 4PM1A 5DD1L 5HY9B 2BOLA 2ZKYA 3HI5H 1ZHNA 2W81C 3CHPA 3O3EB 4OKVA 2D31A 3CFNA 4Q56A 4PW4A 4PGEA 1HCFX 3CFCH 5D7LB 1KYDA 2EO1A 4FNLH 5GS2D 3WYRA 1LQBC 1PSKH 5FYJD 5KYUA 2ZYSA 3BIKA 1HXMA 3LRHA 2E7CA 4WJKB 2XYBA 4GRLA 4J4PA 4O4YH 2M1KA 4I48A 2FWOA 5D7JB 4Q9RL 1DL7L 1X7QA 1FN4A 2D3LA 4U05A 4H8WL 3VD1A 3WIHA 4I0PC 32C2B 1DUYA 3W5MA 4KVNH 1DN2A 1FFNA 3RB7A 2JQZA 2QLVB 2UVFA 4O9HL 2XZAH 4W9ZA 2AEWA 3WMQA 4ZOCA 2HVKB 4X6FB 4HCFA 2F7QA 4NN7C 4DJMA 1R34A 1QRNA 1OQXA 4BQ8A 1WS8A 3LH9A 3CN0A 4DEPB 1M6OA 5DLLA 3DX4A 4LF3B 3RIAF 4NO0B 3VD9A 4OCNC 2H1XA 4GXUM 3IFPB 1AQDA 3IDXL 3QZMA 5TPWH 3VXNB 4LHQB 4PJBF 2XWBB 3SQRA 5IFAH 4DKTA 1JYNA 1LWJA 4WHYH 2VDQB 1U3HB 1AXTL 1XIWA 3A5VA 4O2EB 3VXRD 4YQXL 5AFAA 4P5RA 1PZSA 1EAQA 5I26A 5C0RL 4QGTA 4HPYL 4E9WA 2P8LA 3AS1A 3KJ4B 1S7QA 4BE5A 2VTFA 3S8WA 1B6DA 2RMNA 5M95B 2MQ3A 3UAJC 3TEUA 5C0CD 4FS0A 3BGFB 1ZHNB 4L2LA 4OKVB 4ZW3A 2D31B 3ASWA 1P4BH 5GGRY 3AITA 4OF3A 3KXFA 4PGEB 4ZXBC 3VE0A 2E4FA 3H1ZA 4BSVA 3BLBA 3M45A 4JL1A 3VFWA 4NHCL 4DKFL 3BIKB 5CFHA 5KYUB 1HXMB 1OWRM 1YECH 3MV9A 3P0VH 4YDKH 3ULSA 5FDYA 1RCYA 3G5VA 1MCDA 3IJSA 1QBLL 4I48B 2FWOB 2RD0A 4GEIA 4O2FA 1X7QB 4OM0L 1KCLA 3UMNA 2P42B 2CO4A 4MNGA 3BN3B 1DUYB 1FNAA 4OCWL 1DCLA 3VG0L 5FYJE 1C5CL 5KBLA 3DGDA 3GXMA 1T2JA 4OTXH 3ZRCC 5DUPL 1YRKA 3QUGA 3UZEC 1L9RA 4GQQA 1QRNB 4U1SA 1NZRA 5I71B 4MVBD 1GY1A 3PP4L 1HEHC 3VYNA 5AOLA 5T33H 1LO0L 1S6NA 4LDLB 1M6OB 2DQHH 1NEPA 4FYSA 4GQZA 3GIZH 4ZQKA 1RERA 2ADIA 2FJGA 1AQDB 4FZEH 4PRIE 4UAOB 3NH7H 4Y4KC 5GRXG 3JZYA 3HNTL 4OZFH 4ZO8A 2Z4TA 3A4EA 2K8QA 5ESAA 5MEND 3DMMD 2HJKA 1KFGA 4E9TA 1EDQA 2WTRA 2P8LB 3FRPG 1F86A 1S7QB 2BVQA 5BUGA 3VDCA 3DVGA 4UQ3A 1EO8H 1XCXA 3CZLA 3VQMA 2F5BH 3TU6A 4WWID 3KXFB 3VE0B 4MJIE 4QLRA 3U82B 2BRRH 4NT6B 3VXRE 4BSVB 3VFWB 1E3ZA 1BVZA 5CJXA 5D1ZI 4BH8A 2F54A 3MV9B 1HKLH 3L3HA 2DKSA 2ZXGA 3G5VB 2GUOA 3IJSB 3WTUA 3LZQA 4G6ML 5B1JC 4PRNA 5C0CE 4O2FB 2YZ1A 1SN5A 3Q9QA 2WP3T 3LXBA 4Y4HC 4HXAL 1Z1WA 2R27A 4MNGB 1NKGA 1C7SA 3QSKB 4KRLB 1B0WA 5J12B 3ZRSA 5A2JH 4G3YL 1N2RA 2Z1KA 3QEGH 1N3NA 4U1SB 2D7OA 2ZG2A 2GK2A 5T3ZL 1ET8A 3LEVL 5IB4B 2C9VA 1CCZA 1OSPH 4QRTA 1ZK9A 2PCYA 3CXHJ 2WLHA 1KJ3H 3A67H 3WKPA 4ZQKB 4LNVA 1M56B 5C0EA 5I5IA 2ADIB 2FJSA 2FJGB 4ZMTA 1FCGA 1ZCRA 3T71A 1ZKAA 2VDOL 4OZGE 1O7VA 4HZLA 4GKOA 3T2OA 3Q0HA 3SGJA 1ACXA 3DETC 4K9EL 4Y9BA 4J39A 3D4ZA 2HZHA 5CZRA 2HJKB 4F33A 5EF1A 2EDNA 1EHLL 2IDFA 5EBWA 1FL6A 2AANA 2KL6A 2WTRB 3H7BA 2BVQB 3DVGB 4UQ3B 4FA7B 4OVVA 4ZNEE 4GRWF 1EJ6A 5AYUH 2FWLB 3ARBC 1OHZA 3LOWA 1Q1JH 4J6RL 3OB0K 5KSAC 5LAXB 1VF5C 4M1CC 1OTTC 1G9EA 3C6LA 5MENE 2NY2B 5KN5A 4BH8B 1IVLA 2F54B 5FYLD 4CN4A 1J0HA 3L3HB 4LSVH 1QD0A 4W9DC 5DO2C 1MRCH 2BWDA 5EH1A 5C0AE 2GUOB 5I18L 1XR8A 4TUOB 4FQXC 4PRNB 2ZYIA 2Y7MA 1OD7A 1Q94A 4EI5C 4PJAE 2L7UA 2R2BA 2R9HC 3MLRH 3WS6C 2A0LC 1KB9K 1RFDL 3ZE0B 4KRPD 5C09E 4Z8FL 4NNYA 1EGJH 2PPFA 1N2RB 3O4OB 3P69A 4TQIA 4OBSA 5EO0A 1N3NB 3TNNA 3M46A 2N59A 5JIIA 2EUVA 2DMCA 1Q90A 4JO1H 3CSGA 4QRTB 4A6YL 1G5AA 2G9HA 4Y16D 3APCA 1EAPA 4Q6YA 5C0EB 4WFGD 3RBSA 6FABL 1L9SA 4HZLB 5EORH 3NDZE 2JCCF 4GG6A 3D85A 3QRBA 5F70A 1RP9A 3N44F 4GS7C 1U95A 4X80H 4KK9D 3QJFA 4F33B 5T1JA 4I3SL 5EBWB 1C1EH 1FL6B 3VI3E 3HNSH 4HLZH 3QJVB 1MCLA 2XOTA 2EXYD 2JJVA 4JQXC 4Y5VA 3VU2A 4C56D 4UIMA 1MWAA 3C6LB 1HSBA 2IH3A 4YXHL 2PXYD 1AOZA 5KN5B 1JGLL 4D9RE 1ZSHA 5FYKH 3QFJA 5KZCD 3VGGA 5HHOA 4FLRA 1XR8B 4ZMZA 4MD5A 4BZYA 2VO8A 1Q94B 4K0OA 4QYOA 1W2KT 4OV5A 5BO0D 1QO3A 2W9EH 2Y07L 1A6TA 1KCUH 3HN8A 3MX0A 4OD2A 1ZLSH 3T0EC 3PE9A 5FYLE 4NNYB 4UYPA 3TV8A 5EO0B 4LEOA 2YAQA 3ZDZE 1A6AA 3TNNB 5EOQH 1NMBL 3ALXA 5L88H 2BFGA 2DMHA 3T6QC 1BIIA 4FX5A 1OB1A 5HI5C 1KGJA 1MY5A 2G9HB 2EDOA 1EAPB 3GLEA 1A6VH 4P5TA 5K59F 4KXBA 3PJSB 1MCCA 1KDJA 2MPAL 2BIPA 2B20A 1JWUA 4GG6B 4U6XA 2KC0A 3RDJA 5KSVA 3BUYA 2Y36H 2OX5A 3X1NA 1GZPB 3A4FA 4NKOB 4AYDC 1U95B 2ZP8A 4G1MA 4L4VD 3QJFB 4M6OL 4ODUA 5AB1A 2HX7A 2UY7A 5EU7C 3WSQL 5E6RB 1MCIA 3CMGA 3V0DA 4EBQH 2KPWA 4WFGE 2FBJL 3SCMC 3REWA 3AT0A 2Q86A 5EA0L 4RSVA 2YD2A 4CSPA 1LK3H 5AYTA 1KB5H 3F6JA 3OVUB 4JFFD 2EXWC 4XE0A 3KYKH 4Y5VB 5C1MB 4UIMB 1MWAB 1HSBB 2IH3B 1I53A 5HVGB 1Y7VA 5DXWA 2ITEA 2LAGB 2G4GA 3FQXA 4RMTA 3UG3A 3US0A 3VFVA 1NLBH 4RISH 4N2GA 5HHOB 2PR9A 4MD5B 1T0NB 2ROYA 4QYOB 5D72H 4OV5B 2QQNH 1QO3B 1GGCH 3DOIA 2NY6B 4HBCH 4C56E 1A6TB 2OM5A 3BZFA 3MX0B 4XN7A 4WO4D 1UJ3C 5AUMA 4OD2B 5C0FA 1OGPA 1IGCH 1MJ8L 4LEOB 3B6SA 2PO6A 1T7WA 1OP3K 3TEYA 1A6AB 5KVEL 3N0PB 3WFHA 2Y24A 4N28A 4XTRD 1TJXA 1DBML 3CVIL 1BIIB 3JVFC 1OB1B 2XDHA 2WBXA 1GOGA 4P5TB 2Z8SA 1UOLA 2KYIA 2ZXWB 2VR6A 1ZLUK 4P59H 5AOMA 1JWUB 2OR9L 2XRAH 4U6XB 4ZUVA 1SUJA 5KSVB 1E27A 3BUYB 3QHZL 2OX5B 2IFFL 2RFXA 2EIDA 4FGMA 4ONHB 4GFXA 4KJQC 3G6JA 1F6AA 3PDGA 3CFIC 1NIEA 2YXFA 4G1MB 4ODUB 1QG3A 2W0FA 3DPDA 4NWTH 3ARGA 3WXWL 2AQ2A 3REWB 4CGUB 1K3ZA 1T89C 4OF5A 1LO2H 3D87B 2Q86B 1IE4A 2OTWA 3AGVA 2Z0UA 1RZJL 4X42A 2NQ3A 5AVRB 3I3EA 3S4SG 1KXQE 3FQXB 3E1ZA 5GXBB 5IK3A 4ZS6D 3VFVB 3IVKA 2YGVA 4G6FD 3B2UD 4M48H 3CMOH 2EKSA 2WLMA 2KLSA 1GS7A 2IPTH 3SDCA 4EAEA 5C0FB 5I73B 1VGEH 2XPYA 1S5IL 2YKLL 1RHFA 5E6IA 4AL8C 1QNZH 4N1CA 2F1EA 5BS0A 4NCC1 5IHLB 2ZUSA 2PO6B 2I85A 3B6SB 3HR5A 5FS5A 1Y6KR 1CIDA 1PF3A 2HRLA 3WFHB 2RB8A 4E9YA 4B41A 1MN4A 5FM5M 3C2AH 5DZJA 5I9QC 3MBEA 3AB0B 1B90A 4LLUA 5C6TH 1SOSA 1G5GA 2VDPL 4JKKA 5DJZA 3TH4T 3TEXA 3FAXA 3NIGF 4TS6A 3KLKA 1E90A 1G84A 1ZJBA 3SO3C 4X7SL 4ZUVB 3ZL4L 4OZFA 1JTTA 5ADPL 1E27B 3L4UA 4N2EA 4OZ4A 1QFWH 1QQDA 2RFXB 3WJMB 4D7PA 3G6JB 3HG1A 5F0LB 5KW9L 2KDYA 3HS9A 1AD9A 1ZGLP 5DD5L 2IVFC 2FO4A 2W0FB 3K91A 5K1JA 3UMTA 3ARGB 4K7PL 2NNFA 5D9SA 3HI1A 5IROC 4UQIM 1SY6H 2OTWB 1YJDC 5J3HD 4WI2A 3RZCA 1JZ7A 3FU6A 2VAAB 5JHBA 5EG6C 5L2JB 1QFWI 1JZIA 1XL4A 5IK3B 3D08A 4WEBL 1KIUA 3IVKB 5B3SB 5JZ7C 1F4XL 4JPVH 1BVNP 3VWKD 3ZMNA 1INEH 3L4ZA 4N2LA 2EDJA 1NEZA 2EKSB 3VWJC 3OC5A 3U4BH 4KO6A 5HHNA 3SDCB 1WWAX 3DVNA 4NZFA 5E6IB 4XN4A 3SBRA 5BS0B 2H2SD 1UCTA 5F7WC 4M8QA 2ZPKL 5C6PB 2R39A 1JNLH 4N2BA 5DWUL 3MBEB 4PY7A 1DJIA 5ACMA 2TRHA 3SDAC 4PRPA 3EJYD 2EIZA 1WFUA 5F1IA 2B1AH 2IBGA 3HMXH 3IE9A 3F3HA 4QPEA 4WW2A 4ZW5A 1IGFH 3AROA 4LRIA 4OZFB 2WCSA 5IW1A 2ZAGA 4OZ4B 1QQDB 3O4LA 3HC3H 3QEQE 3U36A 2VUYA 3HG1B 4CC0A 2BH0A 3ZE1E 3ZDXE 1AD9B 3IDMB 2LGNA 2FO4B 5BRZB 1O7DE 2JKRM 4LP8A 3BAKA 4L4TD 4S1DD 1ZLWH 4R83A 2WB7A 2CXKA 3MRCA 4LCYB 3W0WA 3LS5H 2GIYA 3E3QE 1QUPA 2BW4A 3RZCB 1VJSA 4WHDA 4F7MA 4YH6A 3UP1A 2VRKA 3WHXA 5F7KC 3VRLE 4HXBL 2FH6A 4LPYA 1KXTA 5I1CL 4RDQG 4EKXA 2E75C 2J8OA 3FPXA 4G5ZL 4J12A 4X5XB 2MJWA 2Z34A 4G7YL 1KIUB 1T83A 1WITA 5J56B 1PD1A 1SEQH 3RWEA 5B38G 1UENA 5L0QC 4DAGL 4HS8L 5CAYB 1ZV9A 5CKAA 1NEZB 4M7LL 3LPWA 4FXKC 4CU8A 1DBAH 2PN5A 1INDL 5HHNB 4XNUH 3DVNB 5DVPA 3T04D 1MQ8A 3WNLA 4MXWH 4M8QB 4OIAA 5AW0B 1WK0A 4BKLA 5GGUA 1JFQH 2DM7A 1CU4H 1WIOA 2CGYA 4PY7B 3N2JA 4OR1A 5J5EA 5F8RC 4H40A 4PRPB 2R4SL 3DKHA 2EIZB 3ALPA 1SRDA 1FL5A 1Z5HA 2B1OA 5F1IB 3TVMC 4ETQA 1K4DA 1IMHC 3L2MA 4QGYA 3CN2A 4XC1H 1JTPA 3QHFH 5IW1B 4TULH 4GAGH 3SE4C 5C71A 3O4LB 3QIWC 4QXUH 3U36B 3VXTA 4B96A 4Z7QB 3GQFA 5ABZA 4ZMVA 3UZQA 4A38A 2YRPA 4OZHE 4V1DD 3CFMA 2RQEA 3V6OC 5T1LA 1OP5K 5JW4Q 5DJAB 1SBSH 2LV4A 3MRCB 3SOBL 5HVHB 3W0WB 2JKNA 4YHMH 1BXXA 3FRUB 4F7MB 2ZKWA 5FYKU 3WHXB 4FTDA 5HVFB 4AGPA 4MB1A 1OGAB 1UB5A 2APXA 1JPGB 4BQ6A 5B4MC 3IETA 1VB9A 3RWEB 1TETL 4MAUH 4MJ2A 3MR9B 5EN2A 5BVJA 3SJVB 4FULA 4XCEA 1T22B 2B4CC 4RLDA 2R83A 4P9MH 3OQRA 3NEEA 4LVHB 1G6RL 3W1ZA 4P4KD 3I84A 4BKLB 3BH9A 5GGUB 4PJEA 3VI4F 1A5FL 1WAAF 6TAAA 2D4FA 2IF7A 4F27A 4XVUD 4LSRH 2OZ4H 4LAQH 3K6SA 1FL5B 4ETQB 2PWFA 1K4DB 5KEZA 3GXTA 1U2CA 3QFDA 4B50A 4OBRA 4OCSL 4XOEA 2R1WA 4RGND 3LAFA 4JG0L 2V5MA 4JHWL 5CF3A 1BMGA 3UBFA 2W94A 1CGXA 3VXTB 4M6NH 1A7OH 3N1GC 1IBYA 3MU3A 3EZ8A 1UCBL 4U0RB 5DMKA 4PJ5D 5LGHH 3UZQB 5J11B 2FH8A 2Z31A 2X10A 3P02A 5DFVD 2AAAA 3O3BA 5FIEA 1ZTXH 1UZ8A 1OM9A 1BZOA 1A7PL 5J1AA 1T4KA 1KB5A 2DL2A 2OW7A 3BVDB 3HI6L 3LIZL 4IJ3C 4OGXH 4NQDB 4UNTA 1AZNA 2AJUL 4OJFL 3T0BA 4ELME 2AEPH 2W0PA 3BDYH 5FO2A 4OLUL 1AIFA 1J5HA 3FO2A 4GXFA 1J18A 4PLJD 3G04B 3PHQA 5AENA 2I27N 3IETB 4JB9L 3CK0L 1ZK5A 5EN2B 5BVJB 2OK0L 3U46A 4R4ND 5DD0H 4XCEB 5IQ7H 1FAIH 5F1NA 1GGBH 4HKXB 4AEHH 3E2HC 3TYGL 1OT2A 2YOCA 2R29L 2LVCA 1NCAL 4XCYA 4YHYB 1BREA 3BH9B 2HH0H 4PJEB 5E9NA 3NRFA 2H0JA 2WSPA 5DRNA 3LZOA 5I8OL 4NP9A 4ZFOL 1C8PA 3O3AA 5I2IA 3K6SB 1CL7H 1I1YB 4ACPA 3MODH 4J6IA 4KMTL 3WEAA 1W6WA 3GJFH 3QFDB 5D6CA 4D2NA 5FM4A 1VIWA 4H88L 1JHLH 1YJDH 3DJ9A 3UG5A 3MLPA 1RIUL 1ECYA 1NINA 3DVIA 2DBLL 3BD5A 3OKLA 3LHAA 5DMKB 5M94B 2IAMC 2CMRH 2Z31B 2DIEA 1QBML 4G9FA 5EWIH 3ZYOA 1J1XL 5JQIB 3P4LA 3O3BB 2YK1L 1OCCB 2COVD 1UZ8B 4L0ZA 2V8MA 3H4FA 4LCCA 4RGNE 1T4KB 5J1AB 3LYRA 1KB5B 1YC7A 3KPPA 3MCYA 1DUZA 3HHMA 4QTIL 2DZEA 4R7VA 2ADJA 1X5IA 3B9VA 3ETBJ 2NUTA 3UO8B 1Q9WA 1PAMA 1JNJA 4PJ5E 3FO2B 4YVNA 3GZPA 4DQAA 3H42L 3KWWB 2PYEE 1XL6A 1YMMA 4H7VA 3TFKC 1K6QH 3V4UL 5IV2B 1U3HD 5F7LB 3QBTB 5FYJL 2MRYA 3BQUC 1XT5A 3EJSA 43C9B 2P5EA 3U46B 4BWTA 1G9MC 1OD9A 2VDRH 1RK7A 5EZIL 4Z23A 4QJ3B 1KCRL 5EZPA 3VSUA 1R3JA 2WWKO 4M7JL 1F58L 1MSPA 2ROXA 3ZDYF 3BAWA 3CN3A 4XCYB 1TJIH 2FCBA 4JANB 2H0PA 4ISVA 1F3DH 5IHZA 2GTWA 5DRNB 2WBWB 2QHLA 1Q72L 3B3IA 4G6AC 3O3AB 5I2IB 4ZTPL 4GRLD 4J4PD 4XXWC 1Q0EA 3ARDA 5D6CB 3UXFA 5JDJA 2X6VA 3W81A 4KDTA 1IGIH 3LZRA 4F9PA 12E8H 5D2LE 4TVSa 2KT6A 3W9DA 3OKEB 1QKZL 3OKLB 1E5AA 2C34A 4YSUA 1L9QA 3NIDF 5C8JB 2W38A 1GH7A 1T20A 5EZLA 3UJJH 1IQWH 3KWTA 1QTYT 3ESNA 3NQKA 2DQ6A 4NZRH 3KLLA 4YE4L 1SY6A 2I9LA 4LCCB 1DFXA 1Z6JT 4W9KC 3VXOA 3KPPB 2LHAA 1DUZB 2Y2YA 4TQEL 4AQ8C 2ADJB 3VX1A 5DYFA 1DSFH 3ZKXB 1J8SA 3FOMA 2NUTB 3NG5A 1Q9WB 4X0NA 3P30H 1ODUA 2V3EA 3MJ7A 4QY8A 3U9PL 4K3EH 2AK4A 3O2DH 3O6FA 1YMMB 1BIHA 5SX5H 2NCMA 4G8FA 2FHFA 4H8HA 4OFIA 3GXDA 1XIWD 3FMGH 4FHBD 3FW6A 4N2CA 3GK8H 3GS4A 5DC2A 2DI9A 2P5EB 4FKKA 3QFGA 4HUCA 2XTSA 4MJ6A 1KWGA 3PAYA 3FBKA 3GMMA 4MDRA 2ZCKL 1ZT4A 5D96B 1EIBA 3DX2A 4ISVB 4IU2A 1VHPA 2JB6A 3D0LA 2GTWB 1HL4A 3TM6A 3MV9D 3QCTH 1A22B 5DFWH 2JI1A 2A9MH 1A47A 3ARDB 2X0VA 5DEJA 5PCYA 5FUZL 1RUQH 2OPCA 4Z0BH 2EE2A 3QDMD 1E0OB 4ZOEA 1MEXL 3W9DB 1MFAL 3F7PC 2NOYA 2Z7UA 3HFFA 3DOHA 1T20B 5EZLB 4B9FA 5JOPE 1JBJA 4ATTA 4JPIA 3HZMA 3I2CH 2NYKA 2HLFD 3M88A 1ZLEA 2G5BA 1L0YA 2I9LB 3PJLA 3VXOB 4DWHA 5JIMA 3QZWG 1FL3B 4RX4D 4ZAKA 3C6SA 2CHXA 3ZT5A 1EXHA 1AYRA 3FOMB 4FZ8L 5TD4A 2ICEA 4B5EA 3MJ7B 4QY8B 1X5MA 1ADWA 4MRCA 2AK4B 4UV4H 2FHBA 1J8RA 5D8JL 3O6FB 4MZ3A 1QRNE 4G8FB 3D25A 4W6XB 1IM3A 5E70A 3GXPA 5DMIH 5A2LH 5TE7H 5C3LD 2EYSA 2CJUL 2PTVA 3T9WA 4CADA 4O58L 2Q8BL 4P46A 5EC1B 4MJ6B 3QG7L 3CCHA 5FW6A 3GMMB 4UAHA 3X1FA 3U0WH 3CDFA 1ZT4B 4RWYH 4AI7A 2ZKMX 4M5YL 4PMEA 1E9QA 3US9A 2A38A 4I8DA 4OGYH 4BD4A 4E9VA 4IU2B 3BKML 2JB6B 1CIUA 3D0LB 5D70L 4YK4C 3U0TA 3ZGHA 2NY2D 2IG2L 3JWDH 4JGMA 5C0IA 3RNQA 2CJSA 3H3BC 7FABH 1E43A 2Z8RA 4XB3A 3DC0A 1YEHL 2ZOLB 1T80A 2QGEA 1N70A 1A7QH 4ZBJA 3KXFE 4DP8X 1GOFA 5DT1L 4J2XA 5EUKA 4J3TA 2P26A 5EULV 3MV9E 1YYCA 1U8QA 4JPIB 3HZMB 1R33A 3CZJA 5E5LA 3RYMA 5JUEH 1U4FA 1SHXA 4L1HA 1KYUA 1WG3A 3P9LA 5D93C 5JQ6L 1KEGL 1NANI 2Y1VA 3BP7A 3DURA 5J0BA 4L9LC 4PJDA 5DVOA 1BA9A 4MNGE 3V4VL 4YWGL 2FD6H 1OXYA 1DVFA 4PCTA 1FYHB 2ICEB 2JTYA 4TOYH 1VFOA 1N12A 3RX9A 4ZMYA 1ROWA 5EC2A 1IKNA 1IBGH 4NC1C 3V9FA 2MNWA 3IRZA 1W0VB 3D25B 2WUCL 1IM3B 2GTZA 4OM1H 1XDTT 4ECNA 2EYSB 4CADB 2WUBH 4NCDA 5FYLL 3TV3L 4P46B 4WI3A 3MFGB 3ARQA 2C9UA 5DJ2A 3CCHB 4M6AA 5E2VL 4JCLA 3S0PA 4AEIL 2OV0A 3RKPA 1GOHA 4UYQA 4NKMA 2IQAA 1E9QB 4UU9B 3VXQA 2DJMA 1MFCL 2DYRB 4LLMA 4LNRA 1ET5A 4H0IA 5BVPL 4PJ9D 1I85A 1YA5A 4TV3A 3E7JA 3U0TB 4IKJA 3N40P 3Q43A 5C0IB 3RNQB 3UO1L 3FN3A 5CN3A 1PPIA 4W9CC 2FRGP 4ZJ9A 1BQUA 5I0XA 3ULVD 5DQJA 1I1CA 1K72A 4KUCD 1KSRA 2EO7A 5LBSA 3H3KA 5I1DA 1D2PA 3O0RH 5D7SL 5EUKB 3ULUH 4X9IA 2F54E 4AK2A 4YS4A 2WWMC 2VDLL 1U8QB 2VLJA 4HW6A 1HQRB 1L7TL 2GJPA 2JF1A 4Q8BA 4XNXH 2PCPA 3VXMD 4F24A 3P9LB 3BP7B 1OM3L 3DURB 4PJDB 1P0SE 3D0VA 3K8LA 3QIBC 4ZW6A 5CNHA 4IJTA 5T8IA 1FIGL 3VA6A 3U1QA 1DVFB 3ZE0E 1FQ9C 1OW0A 2ZJSL 4EOWL 3D85D 1CDGA 2CHDA 4KZDL 1V3KA 2GTZB 2OJZL 4R90H 1TQVA 3A47A 5B22A 3M86A 4ODHH 2F8IA 2R8SL 1QTPA 3K3QA 4OQTA 1OCWL 1T7ZA 3GPSA 5DJ2B 1QLRA 2VXQH 5ERWA 5GS1A 3HHRB 1XCTA 1MIMH 3LRMA 4Y9EA 5IVXA 5DJYA 1IAKA 3LPOA 1IBZA 3K6OA 1UA6L 4NKMB 2QKIA 2IQAB 3H2WA 4LLMB 1LQSR 1NBZA 5FOBB 3TBSA 4LNRB 1KXHA 4OGAD 2ZQKA 3IJHA 4YE0A 1G7LA 2R1XA 1DVQA 3E9TA 4U2ZA 2NY0C 3FQRB 3SZ6A 4FD0A 3QFJD 2AMUA 4RAUA 4PS4H 4AJ0A 4J3OF 1XR9A 3GJFA 3K0WA 3RVUD 3L5IA 3UTPE 2QQKL 4ZMLA 2JQMA 4JO3H 1BFTA 2HN7A 3QQNA 5I1DB 3U1SH 5EF0A 2J43A 2K6YA 4JHUA 5HYSG 3HW7A 2X1QA 1QEWB 4FNPA 5CEXA 4OD1L 2VLJB 4YXKH 5GGRA 5DD3L 1F3DJ 4GRMB 3ULVE 2PCPB 4EI6B 2OMVB 4TUJA 3MLYL 3PP3H 5LN8A 4M1GH 3D0VB 1LMKA 2E9GA 3UYRH 4P2RA 1EEUA 4AG4L 3P11H 1OIOA 3WJLA 3QDGA 2MKLC 1UUSA 2FNBA 4HK3N 2FDBP 3IGUA 1U8LA 4OT1H 4DUVA 4H8WC 1B4TA 3DYPA 1ZANH 3E9UA 3MXVH 1ITBB 1JVKA 5K9JL 5KVFH 4G8AC 4CSSA 2EDEA 5JYMA 2DQCL 1QLRB 3BWZA 3OGCA 4XT1C 4Y1SA 5ERWB 1XCTB 3LIUA 4AUUA 1WA0X 2X4NB 5DJYB 1IAKB 2NCEA 2ZUUA 1JCVA 2ZSWA 1RQ5A 1ZVSA 2F1BA 4IMLA 4IMKA 2QKIB 4GG6E 2CRYA 3S97C 1NBZB 3TBSB 3UL4A 4XO4A 3GSOA 3TJEH 1X9RA 2JJTA 1T6VN 1G7LB 2R1XB 3IJHB 3APFA 1B88A 3G5XA 1B2WH 1I7TA 2HKAA 4RAUB 4HGKC 3IYLW 3JWNH 1O5PA 2FX7L 2H7WA 3GSVA 1XR9B 3AG1B 3GJFB 2GTQA 4BEIA 2VDMH 1W8NA 4QHKI 3H9HA 3RDTB 2HN7B 3O6LH 4KHTL 3V7AE 4GO6B 4YHKL 4MJHA 1TMCB 2WCGA 3DPBA 1F3JA 3CFDA 2I69A 5CEXB 1AO7A 4GNKB 1URZA 1UXLA 5FA4B 3QFJE 5ANMB 4ZMXA 3O2VL 5HHOE 1DQKA 1DANU 1XTMA 3PF2A 5K33A 4TUJB 4HJJH 3MRIA 3GINA 2E8ZA 4UNUA 2ICES 4P2RB 5C2BL 3CU1A 2P46B 3FUDA 4YSOA 4HH8A 4ORGA 3QDGB 4XPAL 2ESVA 1MCHA 2HKFH 1EAJA 1FLRL 2XKUA 3O2DA 3P54A 4R2GB 1U8LB 1FZKA 5IBTH 3TA4D 4IRJD 4Q58C 2JH2A 2FL5A 1NUNB 2NR6A 3TP4A 5EMYA 1UWXK 3C12A 2X4RA 2EUZA 4WFHD 3ZW3A 1UTDA 1NL0H 4CW1A 3H9YA 3OGCB 1J48A 5MEQA 4JM4L 4DPBX 1ZVSB 4IMLB 1F56A 1UASA 4OUUA 2CRIA 2VNCA 2UXVA 1PJWA 3GSOB 2PMZA 2HFGH 2YIHA 3G5XB 4XN9A 4NBXB 1I7TB 1SLXA 4FG2A 4F8QA 3BKCL 3ZL2A 5L2KA 3GDBA 2XVKA 4HWEH 5F7UA 2EDKA 5C07A 2OS7A 5JHDA 2QQLL 1TQWA 2X28A 3H9HB 2VJXA 3TIDA 4HS3A 4UT9H 5IFHH 3GZOA 3PWLA 1WZLA 5CLTA 2ITFA 3SDCD 3DPBB 3ME0A 5IQLA 3CFDB 3QCVH 3BLKA 2X2HA 4OCYL 3BSZL 4GMTH 5E00B 3OKMA 4PJXF 2VLMD 4M8RA 3MBED 3HE6C 1A1MA 1NCCH 1X4XA 1G7IA 1SHSA 4QF1A 1QATA 3GPEA 3HC4H 3LY6A 2CNYA 3WY1A 3IAQA 2BO0A 4ORGB 2ESVB 2PNDA 3C5ZB 1NGYA 3GXUB 1SZNA 2BHYA 1QBAA 3QQ9C 4PQXA 4FFWC 4H2AA 3ZMRA 4BUQA 3GMLA 4PLKD 4XVSL 3RWFA 4FFVD 5D71H 1X5HA 2WGXA 3HG1D 1GPOH 4A67A 4KKZA 2X4RB 4TL5A 2YAEA 3RGVD 5I6XB 3W11D 1PG7X 5AL0A 4JM2A 3BP6A 4CW1B 1T7VA 3BMVA 1TJHH 3MUJA 4MTMA 1CWVA 4OUUB 2H6OA 5MEOA 3L3IA 5DQ9A 2DQUH 3FQWA 5BV7H 3G6JE 1KBPA 1X6LA 3G3LA 1CZ8L 5EO9A 4LZKA 4AYMC 4WFHE 2NTSP 5FXCH 7TAAA 5L2KB 1HX0A 4MJ5A 4C55A 5C07B 5C70A 3JUYA 1S7WA 1XCQA 2WBJA 1ZLDA 2CO3A 2O30A 4PJFF 4YZWA 1G6VK 1X4YA 1WZ1L 1U8CA 1Q9OA 4HS3B 4Z3TA 2EVJA 4X9YA 3PWLB 2QADB 1IEBA 1VRSA 2J8UF 5JQHC 3ME0B 4LPUA 4N24A 4CKQA 4FI8A 4P9HH 2JXMA 3S34L 1B9ZA 4WK2B 4L23A 1ZVHA 3KH4A 3TZVD 3FN9A 4YOKA 1LDPL 3OKMB 5SWSD 3QUZC 1FFQA 3DLQR 4PJGF 4N8UA 1S7SB 3J8F7 1HEJC 2LOEA 5ACZA 1A1MB 3T4AC 1EBAA 1G7IB 4QF1B 3MLZL 2BOBA 3L4WA 4PRPD 1P69B 3EJPA 1EHKB 5DZVA 1BXVA 5FGBA 1NGYB 4KTEL 5BS0E 3EO1B 1NBCA 5DRXA 3VD7A 3D4YA 1SLWA 3GMLB 3O4LD 3BH4A 1OSEA 2WHVA 4KKBC 3RWFB 3WO4B 1MIEH 2VLME 2X6CA 4GI9A 2IDCA 1L5GA 1XGUB 3BVVA 4HJGA 5AAMA 3TONA 5LCVL 4D9QD 4BXSV 15C8L 4JM2B 3BP6B 3H6JA 3FSAA 3X1GA 3F7RA 4B9ZA 3W0WD 4PHXA 1VA9A 1AZBA 5MEOB 3L3IB 5DQ9B 4J3OC 1IKOP 4JFHD 4L0PB 2MNJB 1K2DA 3CXDH 2GT9A 3HG1E 4OCRL 2YD0A 4NGHH 4K8RD 5EO9B 5EUOB 1TZGL 1OQOA 5BRZE 4MJ5B 35C8H 1D9KA 2EH8H 1E8WA 2ED9A 3V6ZA 1E5BA 5DD1H 2W0KA 4LRNH 3VD0A 2AJVL 4XMPL 1EUTA 1S7WB 1TCRA 1HOEA 1SJVA 1XCQB 2WBJB 4U3XA 1U8CB 5HI3C 3ILPA 4JFWA 2P9RA 3A6BL 2HTLD 1IEBB 4Y2DC 3N41F 2VB5A 1IT9H 1VCAA 2JXMB 4KTYA 1KCSL 3Q6FA 4BFNA 1P5UA 4AIZA 1DL7H 3DX3A 1FO0L 4Z7VF 5DEZA 3HB3B 5ACZB 1UD8A 3NJXA 1TQBB 2IANA 1I3VA 5DK2A 2BOBB 1KCBA 3GHPA 5JHLA 4O9HH 5DYOA 5J6SA 4I18C 4YEFA 3TA3D 4PS3A 1QFUL 2NUPA 5DRXB 3HE7A 3E38A 3Q13A 3CZGA 3AUVA 1CK0H 1L5GB 4HJGB 4HX1A 3UZVA 5I1AB 2WNGA 1TNMA 3WXVL 1KOAA 4PRPE 3GMPA 3IMVA 5T1LD 2ZUWA 3I3DA 2VXQA 2IPUK 3ABMB 4BK5A 3CPUA 3M7OA 4TSCH 2Y0SA 3MLUH 3EFFA 4PRAA 1AXTH 3O4LE 3FQ1A 4Z7QE 1K2DB 1FHGA 2GT9B 1EQWA 4HPYH 1N26A 2FQFA 2WKOF 3EKCA 3GMRA 4XXCA 1RV6X 5GZOC 1LYQA 1D9KB 1PYWB 3V6ZB 5PAZA 3EOTH 2EZ0C 1I1AA 1MJUL 1ZGLM 1TCRB 1V7NL 3W0WE 2J6WA 4YSEA 3ILPB 3AY2A 4KO5A 2IDUA 3LXAA 3TNMA 4JFHE 4NHCH 5HDBF 1NDGA 1ID2A 5CSBA 2A83A 1GRWA 3I50H 4P07A 4UDUA 5TFSH 3TH2T 4QAWA 4FABH 4A2DA 3BH8A 2WVUA 4H26A 5I1JL 2NX5D 3Q6FB 1U2HA 3KPRA 1P5UB 1HH6B 2WLYA 5E6UB 4OM0H 1L9TA 1C08A 4KKAC 4OCWH 2IANB 2D2OA 5DK2B 1C5CH 4WI6A 3VG0H 3ZE2F 1MCJA 5C6WH 4NN6B 4J3OG 1VENA 5DYOB 1ACZA 2P52A 2ICWI 2AXFA 3RNKA 4LHUA 3HE7B 1LO0H 1HNGA 2Q3ZA 3ESPA 3KHQA 5SWZB 2CDGB 4KZEL 1ZAGA 4BQBA 1JNNL 4HX1B 3VM5A 4X5QA 4GAAA 2OMZA 3GMPB 4X8CA 4UILL 1MWOA 3S96A 3HNTH 2CLRA 1GC1H 2CZNA 3D18A 3FF7A 3UCQA 1OKEA 1JK8A 3EFFB 4PRAB 1YNTA 4QHMA 3ZZQA 4MAYC 1TQUA 1BAGA 4F8OA 3GMRB 4WU5A 4YBLC 1Y18A 2N1KA 3C87A 4X8JA 3UBGA 4EZKA 4ENED 1M3IA 5D7IF 4QXVA 1B3JA 3GHEL 3DX0A 3U30C 4NZUH 1BJMA 3TNMB 2BMKA 3DGGA 1AZCA 1NDGB 3Q1EA 2UZYA 2XACC 4LMQE 2A83B 1F90L 4MGXA 4UDUB 3UBXI 3VD5A 2A6DA 4K5OA 1NGQL 4J3BA 5FYKE 3BH8B 4TRPH 4G6MH 4H26B 3KPRB 1AY1H 3EO9L 1J9SA 4F7CA 1NGZA 1RZJC 5DJ8A 1JL8A 1J8HA 2NY1B 4X50A 4FQLL 4HXAH 4NZTL 4MA8L 1OPGL 1C08B 4ES8A 2ZKXA 5TK2A 2X6BA 5HYJA 1RUAL 2YEZA 4G3YH 5E0QA 1N6VA 1I8KA 4X83A 5GRUL 2K0RA 2FGZA 2VQTA 4I2XA 1T2XA 5IJBC 4IRSA 2AXFB 3RNKB 3DX9A 3PAVA 4LHUB 5T3ZH 3TPKA 4WI0B 2ZG1A 3TT3H 3VM7A 1XMEB 4XMWA 4PJEE 5CGBA 4F15B 5GGQH 4X4KA 5ESVA 4AGMA 5AAPA 5ICZA 1LGVA 1BWMA 1MHPL 3NCBB 1A3RL 1D5XA 4PW9A 4ZODA 4A68A 1I1RA 2OMZB 2ZX6A 2HUHA 3GTVA 4G9FD 1HOCA 4LPTA 3Q2NA 3B9EA 2C4FT 5ALCH 3S96B 2VDQL 2CLRB 4S1RH 3QXUA 4K9EH 1E4JA 3D18B 3WHE1 1BFSA 1SMDA 1JK8B 2XVLA 1YNTB 4QHMB 1QHQA 3N6YA 4TTGA 2Q20A 2QTEA 4L8SA 3K5RA 1JGVL 5GJSH 4WU5B 1YMMD 3ARWA 1Y18B 4Z7WA 2N3JA 3ARFA 4X8JB 4AYEC 4GYBA 3RJOA 4J6RH 3DHMA 2NTFA 2ZT9C 1MELA 4MXQC 2BMKB 2I5YL 3DGGB 4NQCA 5TF1L 2UZYB 3L1EA 2FX9H 3V0WL 1A64A 2A6DB 5IBUB 4ONFL 1EX0A 3LNFA 4OF0A 3WIHL 4LU5L 4UWQB 3SQOL 4W4NA 4JFDA 1HZHL 1J8HB 1NBVL 1S78C 4HIJA 4PD4K 4YGAB 5DJ8B 2GC7C 3MV8D 3VFRB 3EGXA 4HISA 5HYJB 2TSAA 4UQAA 3FO0L 4Z8FH 2YEZB 3K2UL 1I8KB 2H0EA 2YZ8A 3CSPA 1F2QA 2YSSA 4XP5L 4I2XB 3CX5K 6PAZA 3FQTA 4IRSB 3DX9B 4ERSL 2UZPA 5B7FA 4K73A 9CGTA 1I8MA 4Y19A 5HDWA 2JJSC 5ESVB 3Q2CA 5ICZB 1QFPA 4A6YH 4YFDB 5D1QA 3VA2C 4N85A 4H1LH 5ICXA 3UIYA 3GMNA 1D5XB 2DAVA 3UEQA 3KLHD 1VFAA 1M1SA 6FABH 4UOQA 5TDOA 1E4KC 2IWFA 3V0JA 4FFYL 1RHHA 3QULA 4XPTL 1AR1C 1HE8A 4Z77A 5IJKC 2LVEA 3QUKB 3OX8A 4XPBH 4WTZG 5DZ9A 3AT9A 4L8SB 4LESA 1LE9A 4K23L 2VQUA 2WPGA 1EZLA 1W15A 2XXFA 4G9FE 3WENA 4Z7WB 1U93A 4OW6A 3CHQA 1BFVL 4BHUI 2M2DA 2NTFB 3PWNA 5CLYA 1CGUA 1JGLH 2H6PA 4NBZB 1ZA6A 2VYRE 3DBXA 3KVDD 1EEYA 4JDTL 2V2WA 4IGBA 1YMME 1GYUA 3AWFA 3GTTA 3RVXD 1OOAA 4G6JL 2YQBA 5IY5B 4HIXH 4HIJB 2ERJC 1ZT7A 3EGXB 4IQHA 2P5EE 2ZXBA 3WFCH 3PXHA 3UPCA 2A9AA 3OAYH 1XZWA 2DIJA 2YSSB 1MG2C 2J1KA 3FQTB 6CGTA 2YAMA 2GW5A 5LHDA 2PABA 4Y19B 1PCXA 5AB0A 1N6QL 2ENPA 2VM3A 1VERA 3RFRA 5D1QB 4DP6X 5ICXB 3GMNB 3TOPA 5GRWA 5BQ7A 4I85A 1HYSD 1VFAB 4FNUA 2MPAH 2WXQA 4HF5L 3IJ8A 5CO1A 5TDOB 2Y7LA 4ZNCD 4G9DA 4L9DA 1RHHB 3QULB 2X4SA 1U3ZA 4N3TA 1WO2A 1MZZA 4XI5D 4ZAKD 4Z77B 3FPYA 3V5DA 1YNLL 3NTCH 4JQVC 5BMFL 3OX8B 4M6OH 5BV7B 1LE9B 3ZLQC 4P49A 2KI6A 5KBPA 3P9WB 1AFVL 2WAQA 2WLKA 5D5MA 1U93B 3NFSH 5EA0H 1IM3D 1CR9L 4OZGF 4IS6A 3SEPA 4OIFA 2Q8AH 3PU7A 3PWNB 1C7TA 4P46D 2YUWA 3V5HA 3BO8A 2BVTA 4CC4A 2H6PB 1P9MA 4DNLA 4DH2A 1VDGA 1ZA6B 3DBXB 2AK4E 1EEYB 3Q01A 4IGBB 4YZFF 3RFZA 5LNEA 5HHVL 2A9BA 1S2EA 1R3IL 3LV3A 3WJJC 3CZEA 1JSYA 4C4KO 2WIIA 4LSUL 4YHNA 1DBKH 3A23A 3UTZB 1ZT7B 5E2WL 2FX8L 3QUHA 4RMQA 3I6LD 3LD8C 3UGXA 3L2LA 4IBLT 3OL2A 2ICWJ 4EXKA 2XWEA 3GD1C 1WGOA 2Z7WA 1MUJA 4NC0B 1TZ8A 2O5NA 3FTGA 3QJXA 3GSWA 5C0BA 4DP2X 5BW7A 1DVTA 2DL9A 2WINA 3HZ3A 2WD0A 4ZYKA 5BQ7B 4HPOH 3KBEA 4K3HA 4TNFA 2F7PA 2QFRA 4G9DB 3HKFA 2Q5BA 2X4SB 4P8QA 4PJ8C 3K5SA 4JZOA 4TNVK 3V5DB 4PWKA 4XPFL 3VSQA 2VXTL 2GHZA 3TC9A 2FEEL 3CC5A 5F88A 4NXSA 2H32H 2APSA 3M1CA 2YGOA 3R4RA 5D5MB 5GSRA 4QXGL 3DI2B 2MOQA 4Z3FA 5IBLC 4XCNA 3T1FA 3P73A 4IS6B 4Z0XA 2CAKA 3JV0A 3MNVA 4WY7L 3V5HB 5TE4H 1IFRA 4C58B 4OLZH 1REIA 2C9PA 5JPNB 1KIQA 2BFVH 4IKNA 4NC2B 3ULVL 3V79C 1RAMA 1EV2E 1H5BA 1RU9H 2GITA 3B37A 5LN4A 3RFZB 3VI3F 3LV3B 4KQ0A 2OYLA 1LDSA 2WIIB 4YHNB 4OI9A 5J13C 3K2KA 4RGOL 4Q6IA 5FCUH 3QCUH 1GR7A 2VJ8A 3B34A 1J9TA 2HPTA 3M17A 4YMPA 1S5IH 2YKLH 1SJMA 4M03A 1V7MH 2WXRA 5FV1L 2DB8A 3PYCA 3MLWL 5ICYB 4RRPM 2RACA 1MUJB 1IIIA 1EJOH 3FTGB 3GSWB 5C0BB 2WINB 3DDFA 1F4YH 1NUFA 3FSOA 5CD3B 1WGVA 4ZYKB 4PS7A 4MASA 4K2UL 4X7SH 3ZL4H 1LWHA 3TO4A 2Z1PA 2YPLB 2EICA 2GVYA 4JZOB 3ZDZF 2B1HH 3NA9L 5KW9H 5DD5H 1DLFL 1V3JA 1X4ZA 3CC5B 5F88B 1JDCA 4K7PH 1UB6A 4N22A 4N0YH 3FFCD 1CD8A 2J1XA 5GSRB 3G6AA 1FBIH 1MWAL 3TS8A 2E0PA 4XCNB 5E8DH 4RFNB 3T1FB 3P73B 3ZKQD 4PJDE 5ESQA 5KWYC 3MNVB 1E4WL 4WFED 3Q8EA 4GBXA 1GGIL 3SO5A 1IE5A 4A2GA 3UDWA 1KIQB 1WRFA 1A1OA 3TJHC 2E74C 3RI5F 3L3OC 1H5BB 3TESA 2GITB 1F4XH 4P57A 1GSKA 1DQTA 4PI0A 4JFYA 4ZK8A 4OF8A 3T3PF 2R1YA 3VGEA 4MYWB 1G1YA 5DSCA 2PR4L 3FUKA 4GKZA 4Q6IB 3HTLX 3M17B 1IO4C 4G6KL 5F9WB 4KI5D 2XNAA 4FA8A 5KJRL 4U7MA 1NCBH 4KC3B 5E9DD 4R4BA 1E30A 4MS6A 4R5TA 4WCYL 4IM8A 2GK0A 5DWUH 4F93B 2MFNA 5E4EC 2OYKA 4WUKH 2JVUA 4A2MA 3BZ5A 3MJ9A 4TPRL 3I9IA 5K1NA 4MJ4A 1LWRA 4GPVA 3B3BA 3KAAA 1N68A 3ATFA 2D7NA 1S5HA 4P2RD 4WV1A 2ADFL 4RA3A 3UJIL 1R6VA 1JOIA 3EBIA 2EE3A 1AHWA 3GZQA 4W6WB 4WAFA 4F92B 3QDGD 1WAEA 5EBGA 1UB6B 3B9AA 4YR6A 3HI5L 4OJAA 2C3VA 2VLJE 4QI3A 5KVGH 4PSPA 3QHTC 3FRPA 1IGJB 4I0PA 1XF1A 4FNLL 1U3JA 2XBZA 4JQIH 4M9OA 5ESQB 4YHLL 2VMCA 3DHUA 4HXBH 1CLZL 4G8EA 3VRIA 4GBXB 2W91A 4G5ZH 4JRLA 4O4YL 4DF9A 4BFOA 1A1OB 1HL8A 2VN6A 2G9KA 1F4WH 3WDJA 4M93C 4P57B 2VZ1A 5EF3A 3C8KA 2DLHA 4PCYA 4JFYB 4MMZC 5D7HA 4KVNL 2R1YB 4HS8H 5DK0A 5DSCB 2XLLA 4OAWA 4GKZB 3B2VH 3BUTA 1R5WA 4LDCA 4XPGL 1INDH 3BAEL 3UTQA 5FEBA 3U9UA 5MERA 4PY8I 3VXSA 2EVGA 3DOSA 1S9YA 2O5YH 5IVXE 4R4BB 3P4OA 4LFHD 2GK0B 1UH4A 3X3GL 3P3RA 4Y7OC 2WSKA 3QXDA 1CD1A 1AO7D 2R4SH 1S9VB 1WT5A 1ZRUA 4KI5E 1SVZA 5F96H 3S3JA 5DZPA 4PP1D 2E7MA 5KOMC 4AIEA 1S5HB 4WV1B 5F21B 3TBCA 3LNIA 5B39G 1AHWB 3NOIA 2ZUQC 2ESVD 2XZCH 4YR6B 2VR4A 4HAKA 2C3VB 2H3NA 4MVBC 4D0CA 1P4BL 1R24A 2EJ1A 3AACA 5BNXD 2WWNA 1OCOB 3FRPB 3SOBH 1MCWM 1QFOA 2EILB 2NR6D 2ZAHA 5LXGL 2GHWB 2Y5QA 4P2RE 4YHPA 3RX5A 4G8EB 4N8VG 3P0VL 3NJJA 3SE3A 3AGWA 5A43C 3QDGE 3Q8FA 5GQBA 1JERA 3GFUA 3B2PA 2C4XA 3GKZA 1V3LA 3TWYA 3BX7C 3C8KB 3OC8A 4EXPX 1TEYA 3EDKA 2WZPA 5DK0B 2MCG1 4OAWB 5FPIA 1R5WB 5FFLA 3E1F1 3UTQB 3U9UB 5L2KD 1CUOA 1BD2A 3VXSB 3DOSB 4IIZA 3S37X 5JHDD 1I9RL 1CG9A 5I5MA 5LDUA 1AZUA 3P4OB 3IGFA 4FQQA 4G5AA 4H8PA 2DQHL 2B39A 1A5FH 3UAFA 5AB9A 4TMPA 3ZKMD 4AYSA 2GQHA 1BLNA 5BOZG 2BXZA 4TXVB 1OO2A 3QXDB 1CD1B 4A6YB 3DO4A 3EYSL 1CI3M 1I9JL 4WI8A 1ZHKA 3TF7C 4PHZA 2NSQA 4JG0H 1ZLVK 4B3VA 1KT2A 1A2YA 3GMOA 3RU8L 4DERA 3WLBA 3KGSA 5CCGE 1KGWA 1SUHA 1EO8L 1UM5L 1I9EA 1AO7E 4PJIA 3LKRA 2H3NB 4D0CB 1R24B 3PPEA 1AXSA 3HPLA 1FRGL 2DDQL 3V0FA 2FLMA 4MCNA 4PIBA 3LHPL 1QFHA 2BRRL 3QZBA 4F1ZA 3I6GA 3ZK0A 1E5UI 2AJUH 4OJFH 3WTVA 4YHPB 3S88L 1HKLL 4OLUH 2XG5A 4G80B 4A2HA 4DK3A 4W9EC 1P6WA 1T5WB 1F2XK 1QABA 2ESVE 2VRAA 3MLVL 1OV8A 1ULVA 3IK2A 5H4YA 4B9IA 3CK0H 3OMNB 2I07A 5D6DA 2OK0H 4GMSL 2GBUA 3LVTA 4PJCA 2EIBA 1A9EA 3N55A 3QEHA 4Y88A 1BD2B 4L48A 2MH4A 3QEGL 3VRLF 4KROC 1L9PA 2TRYA 1CG9B 3N40F 2R29H 4A55A 4MCYB 1KNOA 5E8PA 3B4NA 4FQQB 1PG7L 3L5WA 3BESR 5INDB 4DZBA 4WENB 1BLNB 4KZ0A 5ILTH 1MVYA 3ML8A 4XMLH 1GSMA 5L2KE 3ELQA 1U30A 2IIJA 4KMTH 1MFUA 1ZHKB 4NJAL 1GIGH 5C07E 2RJMA 5JHDE 2DH2A 3HB3D 1TIUA 3F7QA 1KT2B 3NACH 1RIUH 1A2YB 5L4IA 2EVHA 2RCSH 1L6PA 3TEWA 3QPXL 1XQ4A 3GMOB 3WLBB 2Q7YA 1I1FA 4PJIB 3JYCA 1QBMH 1TENA 1G9NH 5AYUL 3LKRB 3ZT6A 1CQKA 1J1XH 4X4XA 2YK1H 3RY4A 5GZNC 1AXSB 1O9WA 3HPLB 4XAKD 3O8XA 3S6CA 2FTAA 5E2JA 3F8UB 2NY7L 3MROB 4QTIH 3ZOAA 3EFDL 3I6GB 3L5JA 4K8RL 5JPMA 3KLQA 2BY1A 2X09A 4MQXD 2K45A 2UY6A 2XG5B 1DLHA 1NUDA 1T3FA 2WBKA 3S3DB 3H42H 2NY3C 2ZCZA 4S11A 3ZKSD 2AEQL 3UACA 5C9KA 2I07B 3LPPA 3MLRL 3OG6B 5E23A 2CIKB 4HLJA 1NPJA 1GYCA 2RHEA 3HMWH 4KAQH 4PJCB 1E9OA 3CE1A 1A9EB 3QEHB 3LKPA 4HEPG 2DWSA 5FB8A 3NIFF 4JN1H 4F7EA 5K9OA 4Y5XC 2K9UA 2WXPA 1RD6A 3W2DL 2XXCB 1GJUA 1H3WM 2D8KA 4N6RA 5E8PB 3QIUD 4QAMB 3T6VA 1CDCA 1OTUD 1BW8A 2WO2B 5CKGA 5T5FH 3W39A 4DZBB 2PXYC 1GA2A 4FLQA 5DHVA 3VH8G 2FB4L 4WFFD 4NQEB 4ZTPH 5GSVA 5EORL 1TR7A 4EQ2A 4N6QA 2JELL 2ZTBA 2VCOA 4JQXA 1CD0A 3N1FC 3RJQB 1YVLA 4WW2B 4Q9CA 3S5LG 2IAND 4J2QA 1QKZH 4XNZB 1C1EL 4L18A 3L3DA 3SODB 3WE6B 3HNSL 5CSGA 4UNVA 2Q7YB 1I1FB 5K9QI 2UWEF 4JKWA 4IOSD 4IYKA 2WXKA 4PV9A 5DQDL 3HE7D 3O8XB 4YE4H 4XBEH 4TQEH 3WY4A 1ETB1 5JPMB 2AC0A 3WNJA 3MTXA 1N59A 1DLHB 2AVGA 5FYKL 1T3FB 1U42A 1RY7B 1R75A 3IBEA 3KM2A 3QWNA 3RIFK 5B21A 3S4SA 3UPRA 4FHJA 2BERA 4XAKE 2PWGA 2W9EL 1KCUL 3BVTA 1ZLSL 2GSIA 1A7NH 1E9OB 3LKPB 5FB8B 4F7EB 4X9GA 5K9OB 1B0GB 1BJ8A 3M07A 3ZO0A 3QNYA 4HSQA 1S9WA 1I1AD 2IBBA 2Y25A 2ZCKH 5EOQL 4CSTA 3NPZB 4KNUA 4P4RA 5F1OB 5IHHA 3QS2A 4N6RB 2JB5L 4XWOD 4CILA 5L88L 1X44A 2BY3A 5J1TC 1HXYA 1KIRA 4U1GB 2A9DA 3RPIA 3W39B 1C5DA 1NPUA 3S3SA 1IBBA 5DCCA 3LN9A 5AQ0A 2BS9A 2HXAA 5IMKB 2Y22A 4M62L 5GSVB 2YGNA 3PWPA 4KUZH 3DIVA 5AD0A 2FECL 4ZX5A 3KPRD 4B3EA 2Y36L 5FUZH 4JG1L 2B77A 3VMPA 1FNEA 2BSEA 3IMWA 2EXSA 2WQXA 1MEXH 4G7QB 3LSOA 3QVAA 1P2CA 3L3DB 4EBQL 3RUGF 2W60A 4HEMA 2PCXA 2JE8A 1B6UA 3ULUE 4WFFE 2D03L 1JXDA 3CD4A 3T0WA 4F57H 3D1MC 3C5SA 5L8LB 1A4BA 2R0KH 1Q8MA 3MXWL 1KB5L 4R6UA 5DJ6A 3ZZ1A 4JQIA 1PX3A 2ZXAA 2IANE 1N59B 4FZ8H 2NPLX 4WEUD 5DVMA 1NLBL 4MXVE 3QO1A 4RISL 3VFTA 3S4SB 3UPRB 2LU4A 5D72L 1H3GA 3GI9L 3ZKND 2ZP9A 1OCZB 2XCMC 3MJWA 2NY4B 5DJ0A 3OSKA 2LR4A 4HBCL 1EHNA 2Q7NA 2CJUH 5ENWA 3WNOA 5JW5A 1UD5A 3P4MA 4O58H 2GSIB 2Q8BH 4AV4A 1FVDA 3QG7H 3FU0A 2HT2D 1W8EA 4F37K 4HLEA 3BRFA 1TTGA 1ZMYA 4Z6AT 3AFLA 3QYMA 1KXVA 3RY5A 3QNYB 3O41A 1S9WB 3L5XL 1N0XH 2FLRT 4P4RB 4M5YH 3QRLA 1A0QL 1HXYB 3BKMH 4EZJA 1KIRB 3RPIB 5D70H 2IGLA 4GUPB 1I75A 2IG2H 3IJEB 1SN0A 1NAMA 3PWUA 4J8RA 4P59L 1L0PA 1T89A 2ARJA 3PWPB 2UXFA 5TF0A 4RRPG 5AD0B 4Z18A 3B2UC 2WC7A 1YEHH 3ES6B 1FFTB 1RL1A 1PNDA 2N56A 1FNEB 1L0QA 2OTUA 1VZHA 1RVFH 1MXDA 3LSOB 1P2CB 4OLXL 2UXGA 1G4MA 5DT1H 4JZJA 2W60B 3T5WA 1IAOA 1LL1A 4ANUA 1TYRA 3IDNA 1LO2L 4QT5A 4IRSD 2Y4SA 3C5SB 4TSAL 1CYXA 4KMLB 5JQ6H 2N7SA 3KPRE 4F58L 5DJ6B 4NQUA 1MAMH 1H6FA 2RR3A 4YWGH 5JW4N 1O7DC 1MNNA 1P84J 4AKQA 1HEZA 2IPUG 2DJUA 3TBBA 3QO1B 3BUQA 1VSCA 4M7ZB 3ROLA 3VFTB 1KGYE 1G94A 3E3QC 3JYBA 4UOW1 5IW6A 3BCDA 4PEEA 5DJ0B 2QPFA 3PL6D 4P2OC 2Y06L 1KCKA 4IOIA 4EVNA 4N1EA 2GEQA 5ENWB 4ZFZA 5FYLH 5JW5B 2IPTL 1DVYA 3P4MB 5B38A 1HC1A 1EA9C 1I8LA 2V6HA 1VGEL 1FVDB 1HCYA 1ONQA 1QNZL 1W0WA 4IHBA 5DRWA 4WKZA 4YGVA 5E2VH 3ARFD 4KHXL 2FT6A 1CMOA 5J3HC 1OE1A 3MCG1 3RQ3A 2MCAA 1GKEA 2JJUA 3LEXA 2I60L 2P28B 3C2AL 1UZ6E 3KPSA 5C0DA 5BVPH 4A1RA 5C6TL 4NQCD 4WHCA 2OTPA 3ILDA 2X1XR 1XGTA 3B7SA 1YSOA 2BPBA 3PWUB 4J8RB 1CICA 2K78A 5F7AA 4XMKL 4XCFL 3TASA 1QPKA 4YSCA 3VWKC 2CLVA 2XN1A 4M8UA 3MNMA 2DKUA 2BSBA 4JFDD 4RMUA 2MEJB 2OTUB 4GIPD 4GXVL 5KTEH 4W93A 1FA4A 3CWGA 3WTYA 5D7SH 1QSFA 3KW7A 1OLLA 4JZJB 2WWKT 4I89A 1IAOB 3KW8A 2IDSA 2H2SC 1BZDA 3ESUF 2VDLH 2YMOA 3IDNB 4QT5B 1SY6L 4U6YA 2AEOA 1TLMA 1OM3H 4Y19D 1J8HE 2P5WA 1SHMA 1KPRB 3SKOA 2H2PD 1EDYA 1FIGH 5D1QD 4N2KA 4TLKA 1T5XA 1HEZB 3VX0A 5HYJE 1MJJA 3UYOD 1JZ2A 3CJJA 3EH5B 3C60D 2ZJSH 3ZZSA 4EOWH 1PW3A 3AU1A 1FFPA 3QXAA 4GW1A 4I2XE 3WV0A 1CLCA 5IW6B 4NBYB 4KQ3L 1XBDA 1YNKL 2JCCA 1LO4H 2OJZH 4JBSA 4IOIB 3TBWA 4EVNB 1IAMA 4FFZH 5KAQF 4HZ1A 2R8SH 3U4BL 2BWQA 4ZFZB 5IFJA 5B38B 4AIZB 4C8XA 1AR2A 3QT2A 1W0WB 1BHGA 1OCWH 1PBYA 1RMFH 2ATAA 1MLBB 3EDEA 4S1DC 4WKZB 5EFIA 3DX6A 2QHRL 3N1MC 1ZJAA 3KS0H 5FFGA 4XVTL 4IOFD 5LGYA 1DE4A 1ZY9A 2W07B 1JNLL 3MYZA 2Y7QA 3LEXB 3FH5A 2R2CA 1IC5L 1S7XA 3KPSB 5C0DB 4RAHA 1MNUH 1K5NA 4FQJL 1WLHA 4RMSA 4JO2H 1XGTB 1U8OA 1CICB 4U4BA 4IGBD 5E5MA 3ZSSA 4Z7WE 5KG9A 2CLVB 3FUHA 3RTQA 3KG5A 1KLUA 2B3IA 3HC3L 4DP4X 2RALA 4YPJA 2VR3A 5LBGA 4I77L 1QSFB 1CC3A 4NQCE 3OPZL 3S98A 3C09B 1RUKL 2BX5A 3GI8H 4QRRA 3HVDA 6PCYA 5DD3H 4DQOH 4YXLL 1MJ7L 1P7KA 4IDJL 1O0VA 2J44A 4N2FA 4Y1AD 3UX9B 5I24A 2VZOA 4JFDE 2P5WB 4K4KA 2PLTA 3SKOB 4AG4H 1D5IH 4GT0A 3B2XA 1T5XB 1AQKH 2C3WA 2N0MA 2A74B 2EC8A 2WW8A 2VN3A 1BVKA 5FYJU 3AU1B 1FFPB 1ZV2A 3QXAB 1WEJH 4GW1B 3RBGA 2AAVA 2JCCB 4Z95L 5I75C 5EHFA 5IIEA 2YD5A 3TBWB 3QAZC 1FPTH 1WHOA 2QPEB 4Y19E 3T3MB 2DQFB 5IFJB 3H9SA 4XNUL 2BNQA 2AJZA 4FG6D 1OSYA 5D1QE 5CD5D 5K9JH 2ALAA 2OL3H 4NO2A 5KS9F 1GTFA 2DQCH 4KOBA 2R23A 5EFIB 4DP1X 1HYRC 3DX6B 1HS6A 4ANXA 4MLIA 2CO7A 3S35X 4POYA 3VNYA 1DE4B 2Y7QB 1CU4L 3GWJA 2CWRA 4FNSA 1UXMA 2HT4D 4FP8H 1S7XB 5T5FA 4K94H 3RKDD 1K5NB 1BZQK 4U33A 1U8OB 4CJ1A 2QZ5A 4N2NA 3RZWA 2E5EA 2SEBA 5KG9B 2FX7H 4GAGL 3MUUA 3RTQB 4AQ1C 1KLUB 5GGVY 3LJ3A 3WAJA 1E2VA 3DI3B 4LOEA 4KHTH 4P48A 1A6UL 1AQMA 4B27A 3RIKA 1RIHH 3B9KA 1OWWA 2KERA 4P4KC 5I23A 3O2VH 4N9GA 4JFXA 2IEPA 1P7KB 5I5RA 4CMHB 4LVNB 2FT8A 3QNXA 4NZDA 4XVUC 1E8ZA 5FM8A 5ID0A 2DJ4A 4L5FH 4EN3C 2YFOA 4NAMA 3FCSA 3F7KA 3S8GB 2HX8A 5F9DC 1M2OA 4UMSA 3IAGC 4XPAH 2B16A 4ODXA 3MUGA 1BVKB 4RGNC 4PVMA 4KNTA 2P43B 3K1DA 1Y0LA 3PS6A 5KYNA 1EAOA 2YN5A 4PR5A 4ZQTA 5IIEB 5IMOA 3H9SB 2BNQB 3HS0A 3D39D 4Y4FA 4NO2B 2R23B 4KX9A 4HG4K 5FW7A 5JORA 3IN2A 3N43B 2CO7B 2QMJA 3V6BR 1P7QA 4K5MA 4L2YA 5I8CA 1X5AA 1ITCA 1D5ZA 2CM6A 5CCHE 4OV6F 2VZTA 1KYAA 2HTKD 4PCSA 1WAPA 4LAQL 1KGIA 1DQLL 3ESVF 2AXGA 3JTTA 4PLJC 5IR1A 4P2QA 3EIFA 2CHNA 3BKCH 1SDYA 3RX7A 3DXAA 2E9IA 1EVUA 5LBSL 1J88A 4DK6A 2QQLH 5D5ME 4UI2A 3C08L 3PAZA 4FN0A 4M6NL 2LTQC 2XJKA 4YO0A 1JTOA 1AYOA 1PDKA 3ENEA 3B9KB 3LH2H 4OZIA 2OI9B 3EJJX 4H8UA 4BFGA 4N9GB 3CSBA 2H8PB 3OM3B 4B9YA 2Y7OA 3BSZH 4JFXB 3FT4B 5A2BA 4J3VA 3OMAB 4AYFA 5A3IC 3DRTA 5D1XA 4OGXL 1M1XA 5E1GA 3VXRB 3QNXB 1NIDA 1HAUA 2AEPL 3DMMA 3BDYL 5ID0B 4LOUD 1UM6H 3FCSB 5GRVK 2Z35A 4DO5A 1TZHA 2FIRT 3CZFA 2V4LA 5D7JC 5F93C 4ODXB 5C0CB 3MUGB 4DUWA 3CFKA 1UA7A 4Z7OB 3TO4D 1Y0LB 1T1ZA 4XVSH 4D8PA 2N1TE 3WFEL 4PR5B 2BWIA 4OQTL 1BQKA 3WEXB 4RGMB 1A14L 3ULVF 5C0BE 5IMOB 4AEHL 2QELA 3HS0B 4Y4FB 4IBYA 1IZKA 1MF2L 2CJTA 2DQTL 1HJBC 4IBSA 2APWA 3PV6B 4M02A 4DEPC 4XMZA 4I9WD 2RQ8A 1RKRA 5AB2A 5I8CB 3INUL 1D5ZB 1I9IH 5I1KH 1AAJA 4GBXD 5IR1B 1CL7L 2D2CC 2AXGB 3JTTB 4P2QB 2X1PA 3MODL 1Z5LA 4DSYA 4OIBA 3LVEA 3DXAB 4B53A 2ITDA 5C9JA 1O9ZA 3CVHA 1QAWA 3N1QC 1U3HC 1MCFA 5F6IB 1XV8A 4YBQD 2FR4A 1WZ1H 3TTYA 4M3JA 3KJ4C 4YO0B 2V5TA 2VL5A 3JVGC 1PDKB 1WWCA 4H0HB 3HJ0A 4OZIB 4DGIL 1JGUL 1KTKE 5EWIL 3BGFC 4KKCD 2X40A 3OBAA 3CSFA 1LDPH 1U8IA 3T77A 4AYFB 4YX2H 3DRTB 5D1XB 1KEML 4XHQA 3DMMB 1NC2A 4HSAC 2YD6A 5AVTB 3MLZH 1WV7T 3LS4L 2Z4QA 4J4PC 5B8CA 1TQSA 4Q2ZA 1TZHB 3CZFB 2CUMA 2QMKA 2XWJA 3FN0H 1YDPA 3QZWA 5H37G 3CFKB 3QR0A 4R4FH 1T1ZB 2XV6B 5K9KA 2VSMB 4DEUA 1OVZA 4HUKB 3T2NH 2LQRA 5DF0A 2QT6A 2VR7A 5I71C 4FMVA 4R97B 1TJIL 1SEBA 2HKHH 4I0PD 1SYSB 1E8YA 1JG9A 2WZ5A 3IKCA 3DTDA 1ZE3C 1ZXQA 3IWUA 1CD9B 4UAOC 4JO4H 1FE8H 3LPFA 1TZGH 1Z5LB 5E1IA 5C9JB 2ITDB 1G0YR 4XMPH 2M83A 1HILB 4I9WE 2FR4B 1ICTA 1SOXA 4DETA 4ZDHA 4Y16A 5GRJH 3A6BH 2VL5B 3VXSD 3KS0J 5I74B 2CO1A 3FB7B 1E5YA 1NCTA 4NZRL 1QOKA 5IEKB 1KCSH 1OP3H 3QDHA 1RPUA 1PZ3A 1U3NA 1U8IB 4U7SA 1K8IA 4G7SB 1W72A 2WLZA 4ODWA 1DSFL 4FCHA 1HZLA 1HU8A 1NC2B 4Y2OA 3P30L 4L1BA 1OSZA 1R4XA 1UGKA 2Z4QB 3O2DL 4K3EL 3UAJD 5B8CB 4Q2ZB 5HXMA 3MUY1 3OZ9H 1YDPB 3QZWB 1QFUH 5CXPA 5F8QC 3CVDA 4W9GC 3QJOA 3SKMB 4FG0A 4M1DL 1WFNA 1CDUA 4EEEA 4N2MA 5K9KB 2XWTA 5J12C 4NN5B 4DP5X 4Z3JA 4FFZA 4UANA 4RNRA 4J3UA 2NY5L 3K4DA 3IU4L 5CJQH 3R8QA 4JFVA 3HR6A 1NFKA 3NPSB 2HLFC 2NLJA 4XNAA 1T66C 3D2UA 4LPVA 5IOPA 2FEJA 3DDGA 1FGVL 3IKCB 5EZJA 1T2QH 2O26U 3JQOB 3M6DA 2G2NA 1PS3A 4KRPB 3QCTL 4ZI8A 3SDXA 4KO9A 3WBDA 3FZUC 5JYLA 1FP5A 3QJTB 5AVVB 1A4JA 2XIBA 1IBFA 1MJUH 1NCDH 4DZ8A 2E47A 2HRPL 1KIPA 3EGDA 5CGTA 1HCVA 4ZDHB 4Y16B 3V4PA 1I3RA 1H15A 1HIMH 4JDZA 2BIOA 5I0DA 1X6NA 4Y4KD 3Q1SL 2B9BA 1TLKA 1Q0YH 3E6FA 4HIIA 2VDLB 2Q3AA 3R4DA 5I1JH 4GH7B 2MWCA 1OAUH 4HH9A 1K8IB 4UV7L 5EEXA 5MEPA 3K2MC 1TZOA 1W72B 2NY2C 5CJXC 4ODWB 4JFUA 1RSFA 2HA1A 1VKXA 4L4VA 3II2A 4Y2OB 4R7DA 2ORBL 5FGSA 3LXCA 4CMMA 1OSZB 3VXSE 3ALWA 5EEYA 4S2SA 1V3MA 1MLCA 1PZDA 9PCYA 1PX8A 5HYEA 1S3RA 2RTTA 1WC7A 4JFFA 2DN7A 3QDAA 4JDEB 1T04A 2XWTB 3CSYA 1Z0MA 1JNNH 2PP8A 4RNRB 4MRBA 3O4OC 4LLWA 5KZCB 1PMYA 1U4EA 3QRFM 2OL3A 4UILH 1XEDA 1T5KA 2NLJB 2XA3A 3F58L 4RWYL 1QPXA 3D2UB 4Y4HD 4WTQA 1J86A 1R1CA 4AENA 1BQLL 5IOPB 4AGQA 5I19H 5E6YA 4K71B 2AEIT 5EZJB 4EIZC 5EOTA 1UADC 3D34A 3C6EA 4B0MB 4BYHA 2XKSA 4TKWA 3SDXB 3SGJC 1EHXA 2XPZA 5FGRA 4OFPA 1A4JB 4DZ8B 4MBOA 3ZYZA 5ISZA 4P2YA 5SX4H 3GHEH 2FNWA 4P99A 1KIPB 3EGDB 2QKSA 3AMLA 3V4PB 1I3RB 1H15B 4JDZB 3MACH 5JUEL 4L29A 1F11A 3E6FB 1XEUA 4U4IA 4BA0A 5HYSA 1MW3A 4I4WA 3UEZA 4HH9B 4AKPA 4QWWC 2EE0A 3C6LC 3L95A 1J12A 2X88A 5LUMA 4FQLH 1OPGH 2VUOA 4L4VB 5HTSA 1AZVA 1VKXB 2VUKA 4R7DB 3GSXA 3KWXA 5DLMH 4CMMB 3FSWA 4KVCH 3IBOA 1TU2A 1BD2E 3SN6N 3ULVC 5HHMB 1SHWA 4AUJA 1MLCB 4OF6A 3B5GA 5CCKH 4QCIA 1X7SA 5F3BA 4M1CD 3ZY7A 4JFFB 3QXWA 2FJUB 4XP9H 5FV2A 1KB9J 1T04B 1TTRA 2M8XA 2ZNWA 3CSYB 3L9YA 3LZNA 4JPQA 4OFQA 4EZLA 2PP9A 2DQGL 2Y3NA 1A3RH 3CH1A 2JSFA 2WNWA 3BAIA 4LLWB 4DW2L 2J73A 4EI5D 2OL3B 4UF7C 2VLLA 1BEXA 4JJ5A 3BEVA 2VDQH 5F0MB 3O8XD 4AENB 4Y5YA 2HFFA 2R9HD 5CR1A 4I9XA 3TF4A 5F9OH 2NYZA 1GKOA 5EOTB 3KPNA 4WO4B 4B9JA 2VLKA 3AQXA 3VGHA 3EFOA 3U4AA 4PJIE 2WYZA 4AC2A 4O2CA 4JRWA 3BKYH 1E2WA 1OAJA 4GO9A 3CHXA 4D8OA 1N7ML 2GY7B 4CBPA 5JO5A 3VSVA 1FH5H 2X1OA 4Y1TA 5TF1H 3VU1A 1TQCB 3V0WH 5ELIA 1UYWL 2R0LL 4ONFH 4Z7QF 1F11B 3K71A 4PBWD 1EFXA 5HYSB 1GCYA 2E4TA 4YDVB 4Y5VC 5GIRA 4I4WB 3EGSA 4HAGA 3BSZA 1TQTA 4X7TA 3SQOH 1JP5A 3SYAA 4Z7NE 1IFGA 1NIBA 2Q2EB 5JHLL 2OA9A 4F2FA 3FB8A 3A0OA 1MH5A 1ASQA 1SPDA 1ZV5A 3GBML 3DUSA 3FO0H 3GSXB 4PJCE 4Z3HA 3F7LA 3K2UH 1TU2B 5E4AA 2VERN 1JWSA 3KVPA 4POUB 2C3HA 4DVRH 4QCIB 5F3BB 3HBGA 2NY6C 4ERSH 5IGXL 5MI0B 4ODHL 1ZE3H 1FNLA 1SJHA 5DI8A 4B9GA 3LKQA 2UVEA 4FQCH 4GKNA 5JHAA 3CH1B 2VXQL 5B3JE 1MIML 1SVBA 3FFDB 1J0YA 1WF5A 2JCWA 2VLLB 4JJ5B 3BEVB 2KZ1B 2YFNA 4Y5YB 4PB9H 4FFYH 2HFFB 3NK4A 5FUCE 5GGSY 4WEMB 4LB8A 4P5TC 3KPNB 2OXGA 1XB3A 4DKDC 1CB4A 2VLKB 3HBPA 3KYNB 3EAKA 2XN0A 5L9DH 3EFOB 3NFNA 4K23H 4PS4L 2W88A 4MA7L 1ID5I 4O2CB 1DR9A 4JO3L 2Z8WC 1BFVH 1FC1A 1E4XI 1MCSA 5HI5D 3U1SL 2OMTA 4QLWA 5JO5B 1MG3C 2IFGA 2AJXL 4PREA 3VAEA 5AVWB 3K71B 4JDTH 3DX8A 4TN9A 2OMYA 5GIRB 3SPVA 4X7TB 2X4QA 4G6JH 4OD3H 1UG9A 1OAKH 3F12B 3P11L 1TYJA 4WO0A 1MH5B 1M05A 4LCUA 3VFSA 3DUSB 1J8KA 1NWPA 3PWPD 4L4TA 3VACA 4M56A 4HKZA 1JWSB 2DM2A 4BH7A 1X5KA 4O5LH 4OT1L 1T0PB 5FO7A 2BCKA 2AXWA 2NNRA 1ZANL 3MXVL 5FUOL 1SJHB 2O5ZH 5DI8B 3LKQB 1IC7L 5I73C 3V0VA 4F5CA 4GKNB 4UT6A 5SX5K 4EUPG 2XHNA 4JFEA 2PO6C 5C0JA 3SY0A 4MZIA 5C86A 4HF5H 1BYNA 3VG9B 2WN3A 4ZD3L 1NA8A 5JNYA 4L0YA 4F20A 2O5XL 1XD1A 2ZWLT 3AB0C 3T4YA 2L4OA 3ETTA 4AVKA 3DUHA 3ILEA 1YNLH 3F01A 1B2WL 3MRMA 3V7AG 4Q0XL 2OXGB 3F5WA 4L1TA 1NCIA 3EDDA 4JLRA 4MS8C 2GEEA 1HAWA 4XO3A 1AFVH 4LARL 3MLTA 1SXAA 3WTSA 1TDQA 1RZ7L 2PKDA 8PAZA 1CR9H 4K07A 4Z7UA 5C3TA 2OMTB 3WIAA 4N8PA 3KNBA 4FLSA 1MI5A 4OZHB 3ARGC 2DWXA 2K7PA 5IWLA 2K8MA 3HC2A 4PREB 1NICA 5CZXD 3UBHA 2UX7A 4HA1A 1A66A 2UUDK 3DX8B 1R5IA 1UM4H 2ADGA 1CFQA 3LDBB 3Q2LA 3O11A 2X4QB 4HJJL 5HHVH 2NSXA 3SPVB 3Q06A 4KJQD 5CN1A 4LSUH 4ZUTA 1OE3A 1GVIA 1FDLH 3AG3B 4AVJA 1M05B 3QK0A 4LCUB 4XO8A 3VFSB 3WKML 2NYYD 1QFWM 3R19A 4L4TB 4TSBH 2N01B 4HKZB 4BH7B 5FO7B 3JTSB 1CS6A 2KKQA 1UQSA 3JT0A 4RBPH 4V33A 1DBJL 3SDCC 4BFFA 5ITBH 3V0VB 1XGPA 5E6IC 1NL0L 4JFEB 1WZKA 3SY0B 4O51A 3BSHA 3PGDA 3PWPE 4UOZA 2XA8H 1SFHA 5JNYB 2HT3D 3MBEC 5AVSB 2HFGL 4WNQB 3T4YB 4HUVA 1CLYL 1I4FA 4CJ0A 1ZA3A 3MRMB 4XPFH 4NRXA 1J11A 2FSDA 2VXTH 2X2YA 3F5WB 4PGBA 1J5OL 4YSSA 4HEME 1HI6A 4HWEL 2EDFA 4JLRB 1R0AH 4WWKA 5LLIC 1W16A 2J88L 3A6CH 3MLTB 3QQ4A 5KVGE 2BNRA 3C5XA 4FFVC 5IFHL 4Z7UB 4ALAL 1JVLA 2WV3A 5DHYB 4L1SA 4NHUA 4QD2E 1I82A 3V0IA 5LWYL 4I1NB 3NAAH 3SE6A 2I9TA 1ETA1 5I1EL 5TQ2H 3MRNA 3ISWA 1EPFA 4OFDA 2ADGB 1CFQB 3O6ML 3RZCC 3O11B 2FEEI 4FE9A 2JKLA 1UOWA 1NCCL 3GRBA 4ELMB 4ZUTB 3CFBA 3IDJA 3HC4L 4WNSA 5IB1A 2IMMA 4PFEA 2YLKA 3WUWB 4V1DB 4AZUA 4HOXA 5IROD 4YSRA 4MNQA 1D7CA 2AJYH 5KYYA 1CDYA 4AQEB 3TXAA 2O1AA 4LLQA 1PY4A 3WO3B 3L5HA 2WLJA 2JWYA 1BBDL 2CIIA 4UQ2A 1UQSB 3S2CA 3FCUB 3EHBB 4AX3A 4WHYG 1XGPB 4ZFFB 2WYHA 1S9XA 2V5SA 3MBXL 2QTVA 4O51B 5E08H 2YEQA 4K2UH 1NJ9A 1FFOA 3MC0A 2XETA 3LCYA 5DZOA 2DQUL 2P5WD 3VWJD 4B60A 2E86A 3B56A 4G7VH 4HUVB 1I4FB 1ZA3B 2K7QA 2GIXA 3CDYA 4NRXB 3NA9H 4PGBB 1DJGA 1DLFH 3F84A 1CDBA 1QTSA 4LRIC 1V5JA 4WWKB 5IJCC 2VXSL 3QQ4B 3GHBL 1B9KA 1MWAH 2BNRB 4NLHA 1DEDA 4F8LA 5LQBL 1BECA 4KX7A 3ETBF 5EBLA 1XXFC 2AQPA 3GTNA 3I75A 4NHUB 1E4WH 4YIQA 3SDAD 4P9HL 3R0NA 2XWRA 2APBA 2I9TB 1ML0A 2HJLA 5HVHC 3MRNB 2EEDA 3DHJA 4OKDA 4EMZA 3OR7B 5EF2A 4AWJC 4Z7IA 3CFBB 3IDJB 4XNQA 4K8RC 1JHTA 3HG5A 5IB1B 4PJ5B 4X99A 4JGUA 2C9XA 1T83C 4MNQB 4ZW8A 4G6KH 1OPOA 5FHAH 5KYYB 3AWEA 1EERB 1SQMA 5KJRH 4E41A 2ZF8A 4M5TA 3RTQD 1JF5A 1UACH 3L16A 3IDYB 4KJPC 1MIEL 4B95C 4GRWE 2CIIB 2DWTA 3M7FB 4UQ2B 2MOGA 1TO4A 3K1KC 5IOKA 3KPSE 2Y5TA 3EDJA 2BHUA 2R69A 5AG9A 3KR3H 5HDLA 4FLOA 4LVHC 4S0TD 1VFUA 1GYAA 1S9XB 4QRRD 5DS2A 1KYOK 5IREA 4HUMB 2A73A 3S48A 1NJ9B 1FFOB 2ILLA 1D5MA 1OT1A 2YXVA 3FAWA 4HK3J 3T0AA 3T6XA 4FEIA 4L1DA 2FSEA 2ID5A 1RPQA 3UJIH 2CR6A 1QSFE 35C8L 2EH8L 4RZCA 4MSWA 4LRNL 3IGKA 2EIKB 2WVVA 3PGCA 4HWNA 3EXLA 5D2LB 2B15A 2P8MA 1EUUA 4UQBA 1YC8A 2DLIA 2P5WE 4YHLH 4OU3A 4U0RC 5J11C 3H9SD 4YIQB 2BNQD 3I75B 1CLZH 3TVMD 3IXAA 1IT9L 1BQHA 3NCFB 2DWDA 4NRYA 1CFTA 2XBTA 1NIAA 2HJLB 2G3NA 4K3JH 2JCCE 4HJ0D 5A2FA 1BXUA 4XNQB 2OCFD 3T3ME 1JHTB 3U79A 3QR1A 4G83A 1FIEA