5C3IA

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
152
structure length
152
Chain Sequence
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 28
structure length 152
sequence length 152
chains with identical sequence E, I, M, Q, U
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5c3iA00
4ZBJA 2HUEA 2Z34A 1WG3A 5C3IA 5BO0D 2CU9A 1TEYA 5EIIG 4EO5A 4RRPM 2IO5A 2YGVA 3AADB 2IIJA 5BNXD 2Z3FA 1ROCA 2IDCA 2DZEA 2I32A
chains in the Genus database with same CATH superfamily
4NC0B 1AYRA 3MBWA 5F9DC 4I85A 4NP4L 3QZPA 1MRFH 1G5AA 3IGAA 5EO9B 2AABL 3L3KB 4LDEB 4U6YA 5KYXA 1D9KD 3JT0A 4AKPA 4IOIA 3HMXL 2V17H 1B3IA 1EEZB 4KX7A 4D9LL 3SD2A 2D73A 5FGBA 3NSXA 1WIPA 4L8SB 1TZ8A 1KEMH 1NC4D 1SBSH 2N4IA 5L9DL 4HK0A 1RFDL 2YD9A 1B2YA 3LS5H 4I77L 3ZSSA 2EDLA 4PGDB 1MHCA 5DUPH 2AV1A 5DZNA 3WY2A 3RZCA 4H4NA 2JJSC 5KS9B 4WWOA 3WXVH 2XFXA 4LCYB 3TA4D 3MTRA 4JRXA 4MLSA 4HKJB 1JGVL 1PDKB 5GXBB 3KR3H 2RD0A 4W9DC 4IRJB 2UXGA 4ZBJA 4JY5L 5A3ID 3QXWA 5D6CA 3QZNA 1KBGL 1T20B 4OI9A 5E1AA 1C5CL 1N6VA 3UC0H 3VFWA 2H6OA 1QMUA 1S7QB 2WXQA 4IGBD 2WB7A 3ZDWA 1NMBL 2ODIA 3ZDYE 2GTWA 5HHPB 5GRVL 1VGEH 5D2NE 1A1NA 1AS8A 2BNRD 1HXYB 4E5XB 2ARJA 1XCTA 3D2UD 4YUEL 5B38A 1G9HA 1IFGA 4GBXA 4C56A 1J5CA 3TU6A 1ROWA 2UZXA 2OQJB 5HHQA 3UZVA 1MQKH 5F7DA 3QUGA 4JFDA 2NY3B 3KLQA 2DS4A 2JXMB 2AEWA 5EBWB 1BD2D 4JM0A 1JZ2A 3KYMB 1TTGA 2EABA 2NY0B 5BZZA 2JJVA 3V5HB 1QI3A 4PRNA 1FDLH 4KK9C 1KXVC 5TE4H 4NT6B 5I28A 1DQLH 4QHNA 4HGWA 1S7TB 2PR4L 4XNQA 2GHWB 4Z3FA 3ECBB 3VFRA 2E9IA 4HYTB 4KI5F 1J86A 3C5SB 4Y16A 5E4EC 2XY2A 1LJMA 3FOMA 4KKBD 5E2WL 5LBSL 3F7YB 4MA7L 4K3EL 3TNMA 5IEHB 1BQKA 1TMQA 4KAQH 4OZIA 3S37H 1FSKB 3SYQA 2KMWA 1BOGA 3P3YA 5T3XE 2WSPA 2WBXA 3PABA 4XC3L 3G5ZB 4FF9A 4LLVA 4ZOEA 3DURA 2C3GA 3ZHLA 1U8QA 4PREA 2UY6B 4TSBH 3LZRA 4APXA 4X8JA 2VDRB 5I1IH 4KOCA 5L4JA 4BH8A 1JBJA 2XQYG 1YN6A 3K46A 4LBAA 3FRUB 1HIMH 5LNGA 2EYTB 2F58L 4FG0A 5DC4B 1YN7A 4RAHA 5E9DE 4PRID 3V4PL 3QDGE 4ODXA 5KZCB 3KPLB 2YD0A 4KDWA 5DVOA 2VXQL 4FD0A 2P5EE 4PV9A 2IAMA 3SQBA 2YD4A 5SX5H 1B0IA 4LQFL 2CKBH 1IAII 3ZKQD 1TQUA 1YEWA 2MPVA 4NJAL 4A2DA 4Z7NF 4N28A 3PGDA 1DJGA 3NACH 3SDAA 4XPAL 4QRRB 3E8UL 1MAML 2WMPA 2APBA 4QI3A 1KBPA 4HV8A 4P48A 3WJMA 5A3IC 4JBSA 3JTTA 2DH2A 4L23A 3U82B 3N9GL 4M5TA 3GRGA 4GI6A 1GAFH 1H5BA 4TL4A 4Y4FB 1EMTL 2CQVA 3FU5A 2Y9RT 3E9TA 4DGIH 4IGBC 3TCXA 4NHUB 3GXIA 4MKMA 1YNTF 3UZQA 4GMTL 4PD4J 1QO3A 2X4QA 3VWJD 4D0BA 1JNLL 1NC2B 2QADB 2WLHA 3SDCB 1AGEA 3B9EA 2BW5A 2EXWD 4OJCA 5HJGA 1KF9B 5KVFE 3S5LG 1RK1B 4QUOA 3QFJA 1B4JH 1JE6A 1R5WB 1YJDL 3IJ8A 4Q9QL 1BZQK 2ZYHA 2CCLA 1U41A 1ICTA 4PJHB 3TLRA 1DLHB 5IR1A 4FQCH 4JN2A 1J1PL 3VFNA 3DIDA 5ERWB 3QWOB 3ALXA 3FCTA 3C2SA 5CP7A 4P23A 3O6KL 5C0DB 3QORA 3MFFB 4QCIB 4XPTL 2VDPB 1R19A 1TQVA 1AOHA 3N55A 3LPOA 3MV9A 4J4PD 3HG2A 4KI5E 4L29A 3GGWA 2E86A 2VQTA 4RFOL 5JHLA 1P5UC 1KBBA 2OXGA 5ANMB 4YHNA 4CNIA 3D48R 3KJ6L 4HVBA 5K39A 4NQCE 1UM4L 2FJFB 3VXPB 5IK3A 4RNRA 5FIEA 4YX2H 1NUGA 5I1AA 2WBWB 3U4BL 1T1ZB 4QLRA 4U4BA 3N2JA 4R90L 1N0XH 4LLWB 5I82A 1TYJA 3EH4B 1KPUA 2N0KA 2JCCE 4L4JA 5D8JH 4EE2A 4PJAF 3VFUA 2AXWA 3SB3A 2XIIA 3EO1A 4OLVL 2DKUA 3UPCA 4F2FA 5TQ0L 5I0WA 3TO2B 3P77B 3JT2A 5I2IB 4MB5A 1UXWB 1TJGH 4H13C 3MRIB 3UP1A 2JKLA 4DP9X 4YFEA 2F5AL 2FD6L 3O6FA 1UZ8A 1VB9A 1ZPLA 4TNFA 3O4LB 3HFML 3I6KA 4O02B 1SM3L 4ZOAA 4MXWL 4N68A 4K71C 2AKRA 3DX9B 4PJCA 5J6HA 1KBVA 1KJ3H 3ROLB 1MCFA 5B4MD 4Z7NE 4U31A 1V8HA 4FQJL 25C8H 4NX0A 3CZJA 2IV9A 2AERT 3RIKA 2FX7L 3QUZD 4CUCA 1A2YA 2J1YA 4F7EB 1F41A 5C9JA 4JMXA 1A3RL 1F4XL 1PIFA 2Z7WA 3VWJC 4FC3E 1I7TA 1MW2A 3EJCA 5HJDA 3CFNA 3H85A 3CFCL 4PWFA 4RETB 1JVLA 3I3BA 2EXWC 3RTLA 4XVUD 5KN5B 4ODTL 1N64H 1OANA 3VRLF 3MBEB 1FJ1A 4MJ4A 4X4XA 3UABA 2SEBB 3D7PA 3AWEA 3DETC 5JW5B 3MDJA 1OAKH 1KN2L 3UO1L 3WEMA 3P73A 2XWBB 3H3PH 3PXLA 4LSRL 3BDYH 5IBUB 1GS6X 2P46B 4RZKA 5FOJA 2HT3D 1EH9A 1NJ9B 5LCVL 5LXGH 2YWZA 4M62L 2Q8BH 2V3EA 4PJEE 5HHMD 2JJTC 4Y2DD 3HG1A 4J4PC 4NZTL 1BQHB 3F6IA 1QQDA 3L48A 3QUXD 4G59C 1WBYB 1YDPB 3ESPA 3DVIA 4HJGB 4N2CA 4F7TA 7CGTA 5JNYA 1USQA 2EDYA 3NBNA 2YA0A 2V2XB 1FVDB 1A7QL 1UKSA 4L1LA 5I9QC 5JHDE 4KK5C 2X7LB 4TNWF 3EAKA 5KWYC 2FSEA 2NY1D 4U2ZA 4FXGA 4OT1H 1JI1A 3AT0A 4NN7C 1JMZA 1FWXA 2VXTL 2WXHA 4PBWD 3W9EA 2HVBA 4JQXA 3RY5A 3OX8A 3QJVB 1T83A 5JPMA 2HN7A 1ILUA 4X5XA 5GHWL 4KMQA 5I8EB 2WCGA 3H54A 4PJGB 2X2UA 4PJAE 1BJ1H 3EDDA 4X6FA 3H42L 5JHLH 4AI7A 3ILEA 4X7DC 3DO4A 4G6ML 3MFGB 2EUWA 4OFKA 1IQWL 4N90D 1QUNB 4MFHA 3D39E 2A77H 3VGAC 4BKLA 2XV3A 2R39A 1U3HA 3QQ3A 2OPCA 1ZLDA 3FO1B 1KFAH 1XIWD 4EI0A 1LDPH 3DUSB 1IRAY 3FFCD 5FW8A 2CDFB 1Z1WA 1FVEA 5HYJE 1M2OA 2PPFA 5B4MC 3NCWA 2PWFA 2H0EA 5CEYB 5GGQH 2OKMA 2P44B 4Y19D 1JZEA 4TXVB 3PWUB 1CLZL 3SQOL 4FLOA 3QUZC 4L4TB 1MREL 2VLJA 2IO5A 2B4CC 5LAPA 4K73A 1T21B 3TCLB 1W2KT 1CLOH 1AXSB 4FQPA 1Y6KR 4JPKL 3PWJA 3S5YA 5JHBA 3IRPX 1FNGB 4J8QA 4OVUA 2HT2D 4M7LT 4QTHA 3NPSB 2O4EA 4IIQC 2J20A 2VLKE 4L5FE 5T1MA 4XVUC 5F93C 5I74C 1RSFA 1NFDF 3OB0H 3HHSB 4PB0H 2B3IA 5T3ZH 5ABZA 3VNYA 4X98A 3D85B 3V8CA 3IN0A 3EYOB 5EG6C 1E4XL 2D7TL 4AY0A 2BZDA 1A6TA 3II2A 1DLFL 2Z35B 1XH3B 1DBBH 1G7JA 4YHOL 3VRLE 2WOBA 2PPAA 4PJ8A 3MNZB 4KX9A 3DJ9A 5DJ2B 2VDLH 3DWTA 3ZHDA 3RE0A 5IW3A 4EIZC 4RFEB 2NTSP 1IGCL 1LEGB 5CLXA 1Q8MA 1JF5A 5DUMH 4UIMA 3QO0B 5E1IA 3O3DA 5EIQA 2YAEA 4ZQKA 3RY4A 2YEZA 3QUXC 4BHUA 4LB8A 4MA1C 3MRDB 1IJNA 4X6CF 5MERB 2R83A 4FLSA 5EIIG 1Z3GH 1IAIM 2YFNA 2GIYA 2I07B 2XOTA 3GF8A 5DO8A 4ZUSA 4U1HB 1UD4A 4NI3A 1KLGA 4XVTH 1FGNL 4Q6KA 2NY1C 4AEIH 5CJOL 4PHXA 1E67A 4U1LA 4GXUN 5IVXA 3ZKXC 4MMXC 2EIZB 4PG2C 4WFFE 4H8WL 3BH4A 2Z92A 4AQAA 3BYTA 1IBHA 1U92A 1OT4A 3PHAA 1OWRM 3UP6A 3B6SA 4KNUA 3K71A 4PLNC 3MLXL 4GY4A 3V6OE 2K45A 3CFKB 1G7MA 4HPHA 1X5KA 4IRZA 4QHKJ 4XP9L 5DRWA 1G7LB 4KY2A 1XIWC 2I24N 3WGVB 2ADIA 1PG7L 2CGRL 2WW8A 3QIWD 1W0YT 3W5NA 2NY5H 4I8DA 3H55A 3QQ4A 3IJ7A 3VX0A 3LOWA 3T04D 4R5XA 3V52L 1OCCB 2WXOA 3EYVA 4PGEB 1WTGT 4YDLC 3L17A 2EDRA 3O3UN 2FRGP 5LGHH 3BAEL 3L5JA 2QV2A 2QR0B 4A2GA 5IFHH 4P4RB 2VISA 4LF3B 2AQ3A 4PJ5A 5JR1H 1AG0A 3H4HA 3BEWB 3NVQA 1J5IA 3BMVA 1R3IL 2FEDD 5IMKA 5I8CB 1LEIA 2HT2C 1RPQA 4CL7A 4WFGE 4PS3A 5AOJA 3B2VL 4Y1TA 2GTZA 4D7BA 3F7VA 4K9EC 3CSGA 1TEFA 2HA1A 3CDGB 3UX9B 1AD0B 1O7DC 1TETL 4ZD3L 5HDOA 5C0EB 1G9MC 4RRPA 4UCFA 2ATKA 3NIFB 4MYPA 5LGJA 3BPNC 1H19A 1IBYA 4Z0BL 4ES8A 4XTRD 1WWBX 3PP4L 2C4FU 4N5EC 3RKDD 1XZ0B 5GIRB 1NFDE 2WKLA 4M48H 2OI9C 5EO9A 1QACA 3L3KA 3WOVA 2HFFB 1U2HA 2BNQB 4N2DA 2GIXA 5C09B 3W2DL 3L81A 1ETB1 2H1XA 1K6QL 1EEZA 4JO3H 4GG6F 2H4EA 1REIA 5LB1A 3RVUD 4L8SA 4ZMQA 1AGDB 3RHWF 3SPGA 5KANG 4F8LA 4G6AD 3RIAK 4PGDA 4TVPD 3FZUD 4AZUA 4GW1B 4UOW0 4FYQA 1L5GB 5KS9A 4LCYA 4Q6IC 5AW5B 1FUNA 1CZ8L 3DOHA 4LHUB 4NAJA 4PRHD 4FNSA 3AC0A 1CFVL 4HKJA 4KV5E 5L0QB 2TRYA 1PDKA 2IH3B 3T0XA 4IRJA 2EDWA 4X6CE 3T2NH 4U6TA 4ZMYA 3JWOC 1T20A 3N6YA 1R47A 3FUMA 4LKXB 4HUNB 4U6VH 3PUUA 2YFOA 1S7QA 3K3QA 3LRLA 3O8XB 5KTEL 4G7YL 5GRJL 3FSAA 5HHPA 3ALWA 1OZUA 1QASA 3W0WE 4NBZB 4IQHA 1HXYA 4E5XA 3TXAA 4FTDA 2J12B 1CB4A 3EHBD 1GGYA 3FT9A 4JGUA 2OQJA 3CVHH 3T9WA 3L9RB 3DKHA 3HKZA 5G5DB 2JXMA 5EBWA 3MXWH 3ARBC 2FBJL 3ABKB 3KYMA 1D7CA 1JS4A 3S98A 4EIBA 2EE3A 3V5HA 1NBVH 4GRWH 4FYSA 1KACB 4NT6A 4IJTA 3ZDYB 5GGSB 1S7TA 5CUSL 5D2NB 2FL5B 1CR9H 4DGVH 4GB9A 2NUTB 3ECBA 1NL0L 4ZMNA 4FQ1L 1HH6B 1NCOA 3SCMB 5HHXL 3C5SA 4B9YA 4Z7OF 1JNNH 3F7YA 1IKNA 5IEHA 1K5WA 4AUYA 5I1CL 4ZUTB 3G5ZA 5AL0A 4DGUA 1PZ5B 2EDEA 4JKMA 2ZNXA 1LILA 3D33A 4FG2A 4XAKE 3WN5C 1X7SA 2FEDC 1EUTA 3B2UD 2KT6A 2UY6A 3CHRA 3U30B 2BVQB 4IRZH 1X4YA 2BZ7A 4YDVB 3NT0A 5I1JH 1QEXA 3LNGA 2Q5BA 1L6PA 1QBML 4G7QB 1XF3B 2HMID 3VYNA 4ZX4A 4UNIA 4HWBL 1M05B 3DX6B 3FRUA 4NWUH 4XTRC 2EYTA 1QUPA 3ZDZF 3RKDC 4JRYD 3KWWB 5MHSD 4OD2B 1ZD6A 1ZS8B 1IC4L 2AK4E 3KYKH 4XODA 3S97C 1GGBL 3KPLA 5T5FL 1DR9A 3CK0L 3BLBA 1Q72L 4N3UA 1J87A 4GXVL 1KV3A 3FQXB 4JCLA 3RVUC 1A7RL 4D94A 3HUJB 1GY1A 1NCBH 2UWEF 3CHSA 3GUTB 5F7EL 3W81A 2DQDH 2GT9B 2A9MH 3N0AA 4AV5A 5AQ0A 2QLYA 5CJBA 1P9MC 4BE6A 4J1UB 5E9DB 5SV4A 3FQNB 4QRRA 4N2KA 3HB3D 4L1BA 4ZRGA 4DAGL 3DV6B 1ASPA 4YHIB 3UADA 3JWDH 4ZOBA 1DSFL 1V5JA 4ZNEE 4Y4FA 3D52A 4HLZH 1J05B 1F45A 4R7DB 4WSJA 1SNRA 1PZSA 4ZS7L 3K6SB 4L3CB 4ADJA 5HVHB 4NHUA 3FN0L 1WWAX 2YKKA 4URKA 4JLRB 3C08H 3EHBC 4F57H 1FLRH 1IBZA 4K8RD 4MNQD 2BP8B 3OLIA 4LVOC 5KJ7E 1NC2A 2BFVH 2R0KL 3SDCA 1ZXQA 3MA7B 3BZ4B 4OIFA 3VG0H 1CPUA 2A38A 1RK1A 4I48B 5I19H 2K4AA 3BQUB 4OLZH 1M6OB 2VMFA 5IQLA 3H9ZA 1R5WA 1CXHA 4Y4KB 1CTNA 5FYLH 3MCKB 4PJHA 2P1YA 1DLHA 5FX3A 2ZXAA 1CDGA 1SN5A 5ERWA 3QWOA 3II1A 3QZLA 2OXHB 4HQQH 5EDSA 4XP1L 5C0DA 3MFFA 2FO4B 5JXAL 2ADJB 4PCTA 1KOAA 2FATH 2DQEH 2F0CA 4YGAB 3SGDI 3WFCH 3BZEB 4Z7OE 4Z7UB 3CIQA 3GZKA 5CAYB 4RSYA 5CKAA 4E9SA 5AAWA 5ANMA 3ULUD 1J0JA 3BGAA 3B2UC 2O6EA 3VXPA 2FJFA 3IAPA 5B1JC 1EVUA 3CZLA 3HI6H 5BJTB 5ILTH 5IWLA 4WJ5B 5TPWL 5ACZB 1FYHB 5D1ZD 3BKCL 4IBWA 4WENB 2AZAA 1T1ZA 1KGCD 3DA0A 4LLWA 2Z7UA 4YH6A 1F1DA 1KCRH 3TYFB 1BBJB 4HWZB 2DQJL 3AWFA 3UFIA 4BD4A 5BZXA 3P77A 2WB1A 1ZJAA 3JWDC 3TO2A 3ZDZE 5I2IA 4NQCB 1UXWA 1SUJA 2JKRM 4YLBA 4Z8FH 1V54B 3MRIA 2UUDK 5CMAB 2G9KA 3FTWA 4NC1C 3ZGIA 1W8EA 3O4LA 3C6LD 1C12B 2JCCB 4O02A 1AQMA 3L2MA 2ICEB 4P07A 1H3PL 1O7VA 1SOKA 3DX9A 4E68A 3KS0J 3HB3C 5D71H 3LRKA 3ROLA 5E8DH 5CZKA 3QP3A 1A8JH 2FB4L 3MXVH 4KHXL 4FI8A 1PEZA 1GOGA 3CX5K 1MFDL 3P69A 2EE6A 5DHVB 4BBWA 3CN4A 2QTEA 2XXGA 4KXAA 2QHRH 3HE6D 4MSWB 3IRZA 4NKOB 2AGJL 3N41F 2F7QA 4F7EA 3L3OC 4ICWA 2NX5D 5PAZA 1RP9A 3IRCA 3GHEH 4K8RC 4XWGH 1HU8A 1K4CB 3UCRA 4XCYB 5HJ3B 2WVUA 4Z7NB 5DO2D 2B39A 2JTDA 2IF7A 2V9TA 2YGQA 2AI0H 5KN5A 1HZHH 4P3CL 2BVTA 4K94H 2DW5A 3S2CA 1HQRB 3MBEA 1WO2A 2SEBA 4HS6B 5JW5A 3GXTA 5T1DL 3SBWA 1WZKA 2I32A 2X9ZA 2GUOB 2XWBA 2EE9A 5G55A 3KCWA 2MQGA 4FZ8L 5DD5L 1DQIA 3FO9B 3LIZL 4BZ2A 1GMIA 4M29A 4A6YB 4Z7WB 4TNGA 1NJ9A 1WFNA 4Z3GA 1CE6B 3K2IA 5HI5D 3BD5A 2NNCA 3WD5H 2P52A 2EEXA 1BQHA 4HJGA 1WBYA 1YDPA 2IV8A 2ARJQ 4NHCL 1K8DB 2OSLB 3U7AA 4YL4A 1VSCA 1FVDA 2KUTA 2V2XA 4M7ZC 4W9FC 2VMDA 2L7QA 4DKFH 4H25B 3L3JB 2JIXD 5DR5H 4R0LB 2CJUH 1D5XB 5D1ZC 3GUFA 1MUJB 1T2QH 2X7LA 1N59B 4PJEB 2FQGA 1IQDB 2V7NB 3K0WA 1C1EL 1MCPH 3R06B 2VC2L 4N8CH 1GCYA 4NPKA 4LESA 4PI2A 1D5RA 1BQRA 2QKSA 3QIUD 4U6HB 3RBGA 1XCWA 3P11H 5I8EA 1Y07A 1OY3B 4ZG1A 4PJGA 3D05A 2VR3A 3G5XB 3KZ8A 5KVDL 1IARB 4L18A 2E6QA 4FFVD 2R0ZL 3CSFA 4HC1L 4PJIF 1PLGH 5FUOL 1KUMA 2QL1A 4YXLH 1E5AA 1LYQA 1QUNA 3QCUH 3N44F 4ZX5A 1JV5B 3FO1A 3SE3C 4CC1A 4XO9A 4FQXD 3DUSA 5DD6B 2CDFA 2VERN 2GC4C 3POCA 4JRWA 1TPXC 1BM3H 3GMMB 4ELKB 1KIQB 5CEYA 3REWB 4UDUB 1UH4A 1OAYH 3RA7H 1M3IA 2IAND 3HE6C 3PWUA 4OZGE 3GIZH 4OZHE 4O2CB 4YAQB 4L4TA 3MRRB 2RQ8A 3SQBB 1I9IL 3LQAH 1PLAA 4PCSA 1T21A 3MJGX 3QJSB 3TCLA 4ZMOA 4GNKB 1AXSA 1FV1B 1IC0A 3PIQB 4F15C 2IBZX 1YA5A 2X4UB 2OM5A 3UERA 4YDIL 4O02H 3C09B 4ZMZA 2B2XH 3NQIA 2GJ6D 5DO2C 3BRDA 4WAFA 5A43C 2FR4B 1N0LB 5IZ7A 2HRPH 3WY1A 2H3XC 1JHTB 1IBGH 5AW1B 3HHSA 4Q52A 5CHNB 4JHAH 3D85A 2B59B 3EYOA 1I7RB 3VFGL 2XWTB 3Q05A 1UT9A 3ABMB 1BZ9B 2Z35A 5GGRY 1XH3A 1CYWA 1PMYA 5E2UH 4R4ND 1UOWA 3G6AB 4HZ1A 3WELA 4V2BA 2Y23A 3MNZA 5DJ2A 3UIYA 1ZT7B 2YC1B 4RESB 3TH2T 4RFEA 1LEGA 1RZ7H 1A6AB 2VLKB 3TESA 3QO0A 3RILA 1MCWW 1MELA 4RA0C 4TNWK 1GGTA 3PGFL 3RDTD 2XZCH 3JWNE 4MRCA 1E6JL 4BSJA 3IWVA 2DIBA 2OMYB 2WN3A 3MRDA 4NN5B 1ADQA 5MERA 2VRAA 1IAOB 3EGDB 2VR4A 2I07A 4ACPA 3SDXF 3PL6D 3HG3A 4U1HA 4UT6H 3DIFB 2CUAA 5FYJD 4L1HA 1FAIH 1AQ8A 1EAJA 4NI6A 4APQC 4PUBH 1KB5B 4UTBL 3MLWH 3OC5A 4P4KB 1DBAH 2EIZA 2B4CL 2EICA 3S37X 2N3JA 2AW2A 3QIUC 4LPVA 1ES0B 4LSSL 3MGAA 3TVMD 3D3VD 1NPUA 2ZUQC 4QEGA 5E9NA 4QKXB 1RVFH 1SYVB 4IBUA 4FFVC 3V0WH 3ZSTA 3P4OB 3DVFA 1E5BA 2Q10A 3OHXC 1S3KL 1JGLL 1DJIA 3CFKA 4FCAA 3V4VL 4PJIE 4FQXC 1G7LA 3L1EA 2NY4D 5B39G 5CJXC 5SV3A 3FHAA 3U2JA 1JYNA 5AB2A 4EN3D 3Q5YA 1TTRA 1MVYA 1CK0L 1MDAA 2BS9A 1TCRB 4UQ3B 1UM6L 4PGEA 2KPNA 1YAIA 3PPEA 2MKWA 1GYCA 5IB5B 1JPFB 2W9EL 1U6AL 2EO1A 2QR0A 4F9LA 1U4EA 4P4RA 1BPLB 4I3RL 1VZIA 1K9TA 4LF3A 3MLPA 3BKML 4GQRA 4G3YH 3BEWA 1PU0A 4ZW6A 2NDGA 5I8CA 2KQMA 4XVSH 4FHJA 4Y9FA 5I0YA 3HI1B 2WNKA 3S36L 4QXGH 1WWCA 3CDGA 1AD0A 2ZCHH 4UILL 5C0EA 1O75A 2HPTA 5MP6H 2K3HA 4PG9B 2OR9H 1MAJA 2IQ9H 1XZ0A 5GIRA 2EZ0D 4HK3N 4R4NC 5ADPH 2R56L 2H6PB 4BWWA 3SOBL 1JGEB 4EQ3A 2HFFA 2BNQA 4X5RA 5C09A 2CO3A 3QUML 1OGAD 4YHLH 5IHWA 4M6OH 1WUNT 4JPIB 15C8L 1OGTB 3PXJA 5BRQA 2WZPA 3RDTC 3TJEL 2DI9A 1CDHA 3LPPA 1AGDA 3NRPA 5EDXA 3GK8H 3FB8B 3H56A 3HMWL 1GA2A 1U8IB 1HX0A 5EEZA 5C70A 1PD1A 4GW1A 3ZE2F 4P2QB 1L5GA 3CDYA 4N0FB 1V7NH 4PGCB 4BQ8A 5CO1A 2FX8H 4LHUA 4R5VA 5AVRB 3FH8A 4XPGL 2IH3A 2IG2L 3U1SH 4ZO8A 1MFUA 2L8AA 4LKXA 3SJVD 2BIOA 3GS7A 3SDXE 1OO2A 1IBDA 1PKOA 1PD0A 3O8XA 2VDKL 4AK1A 2VRQA 4X5PA 3KGUA 3HC3H 2ZYRA 3QZBA 3VO0A 3F05A 3TVMC 3ZOAA 2YUWA 4BFIB 1LO0H 5DC9B 1MFBL 3WE6B 3RTQB 3FQRB 1MZYA 2HVJB 3L9RA 4PPTA 1A3QA 5G5DA 1Z5HA 3U36B 3DGCR 4HCRL 4K9EL 4H0LC 4ANWA 3TBYB 1TZGL 1MWAL 1WD8A 3MUUA 4FFWC 1G9ML 1OCZB 4LRIA 2NY4C 5BNXD 4AYID 4M5ZL 5GGSA 1HXKA 1HKLH 5D2NA 2FL5A 3VXUD 4AKQA 2OP4L 2NUTA 1WZ1L 4E9RA 4YQXL 1HH6A 3SCMA 3DVNB 4Q74A 1MDTA 1NMAL 2J88L 4ZUVB 1W72B 4HEPG 2ATAA 1W8OA 4LNVA 4QHKI 2QVKA 1A14H 3OAYK 1HJCA 3L54A 3QC6X 4H20H 4PYHA 3PCYA 4U3HA 4ZUTA 1VENA 1PZ5A 1GYWA 1ASQA 2NNXA 4EO5A 4BSWB 1ETJA 3GJFB 1Q0YH 2AEQL 2C9XA 5IBLD 1E4XI 4N8PA 2BVQA 2WPGA 1KYOK 3FCSB 4DVRL 4UZUA 5IQOA 4YDVA 4Q4IA 4RFNB 4ADIA 5L7XL 3TPUB 1SDAB 1XF3A 3JWOL 3QJFB 3APDA 3RHWK 1TENA 1M05A 3DX6A 5IY5B 2H2PD 3E3QE 5DVKA 1ID2A 4LIQE 2EZ0C 3QJRB 4MAZA 3KWWA 2GJPA 4ODHL 4OD2A 1HCFX 4XPHH 1ZS8A 4GP8B 3W37A 5ALBH 2W38A 5GISH 4AEHH 2VABB 1E5ZA 2ED6A 3FQXA 3OAUL 5EZLB 3AY2A 4U3SB 3IU3B 3H9SD 1T0OA 3Q2WA 2PWGA 3HUJA 1PKQE 5DU7A 2APTA 2YD6A 5C0CE 2DJSA 3GUTA 4YLQT 2BJMH 2GT9A 1CDUA 3BH8B 5GS1C 2CXKA 2FUQA 5C0AE 4DP7X 5I1EL 1AQKH 4JKWA 4J1UA 3FU7B 1CBVH 4N8VG 4YXHH 2YPVL 5E9DA 3FQNA 4AC4A 1PX8A 3NJIA 2AQPA 2AK4B 3NCJH 3DV6A 4YHIA 3TEZA 1KN4L 3KWVA 1VESA 1LO4H 3CZEA 6PAZA 4ACTA 2ZF9A 4P46B 3EJZD 2ZOWA 1J05A 4B9CA 5CM1A 4R7DA 4OZFH 5I5JA 3JZYA 3L1GA 3K6SA 4L3CA 4Y1AE 2R23B 3B9AA 4FQ2L 3FTUA 5CGYD 4Q0XL 2IFFH 5TFSH 5B3SB 2F2HA 4EVNB 3S3PA 3J7HA 1DFBH 3E2HC 4A6YH 4JLRA 4LASH 5CILH 4NFBA 2BP8A 2G75B 1IVLA 1X5JA 5FAAA 3MA7A 3BZ4A 3PWVB 5J57B 3WO4B 4I48A 4J3BA 3NAAL 5BV7B 3BQUA 3O45B 1M6OA 4PCKA 4XN2A 1RU9H 2RQEA 4XVOA 1OAJA 4Y4KA 5M7QA 2HH0L 3MCKA 4QMEA 4RMQA 2BS8A 4F2MB 4TQ8A 4HFUH 3U48A 1XSOA 2BOBB 1J5OH 1KDJA 2OXHA 3N42B 3GBNL 1KJ2B 3ILDA 1CGTA 1S7XB 2FO4A 5DJAB 2ADJA 1SJVA 3QCVH 4JDTH 1E3FA 3BZEA 4S1SL 4PRDB 4NBYB 1DJZA 1IFRA 4N0YH 4Z7UA 5D2LF 5FKPB 3IMBA 4JG0L 1MNUL 4A39A 1M2VB 4TVPL 1KCUH 1UADC 4HF5H 1NCAH 4TOYH 5IBLC 3BAXA 2J5LC 2IXQB 1KWGA 5BJTA 1H6EA 4WJ5A 1VFAB 2XXMB 3ATDA 5ACZA 4WW2B 1EANA 3SPVB 2PPCA 3Q2LA 1W91A 1FBIH 1O6VA 5F0LB 4KDTC 2IOMA 3ARUA 2EO9A 2H2PC 3G6JF 3R8BB 3TYFA 4XMZA 4Z7OB 5JOFB 1DN0B 3QDMB 1CVRA 1BBJA 3BSZA 2E27H 3FL7A 2WVSA 3KYOB 4HWZA 3EOBB 1TQBC 2P49B 5PCYA 4N26A 4NQCA 4P2OD 4NCDA 1OHQA 1C9SA 4N6RB 1J10A 4DK5A 4M7LH 3T2PA 5CMAA 4MX7B 1OARL 5I6KA 1XMEB 1WS8A 1Z5YD 3R1GL 4G7RB 4WI0B 4YSSA 5E2JA 2R2HB 3MREB 1C12A 2JCCA 2MTPA 2JKNA 2ICEA 1AZUA 2O72A 2NR6D 1E8ZA 1B6UA 3L5XL 2NZ9C 4AYBA 1PCSA 5D1QD 5AYUL 3WS3B 4WNSA 5DDHB 1OM3L 4B27A 3ZDZB 3KNBB 5C7XH 1FNSL 2QQLH 2WVTA 1EEYB 3UMNA 3VGGA 5DHVA 3OQRA 1MW3A 3UTPE 3Q7JA 1YQVL 1TKWB 1E9OB 2CM5A 4MSWA 4NKOA 4TVUA 4WKXA 1KY6A 2NNRA 4R5TA 1PFOA 3GT6A 1XT5A 3V0JA 2DL9A 5CGYC 4M3JA 5HI3D 1UWGH 2EE0A 5E4OA 4BQ9A 4FFZL 5AFAA 1RK7A 4HWEH 4KNQA 2WLIB 3HE7B 1EO8L 5I5RA 5AAMC 1UM5H 1K4CA 4XCYA 1MIEH 1B9ZA 5HJ3A 1TVDA 4M7JL 4K7FB 1D7BA 1HN1A 4PRHE 1JZ4A 1HQRA 4FN0A 2FH6A 4HS6A 1XMWA 1N18A 3LZNA 5HXMA 3M88A 1RURL 1WCQA 5KJ4A 2GUOA 4DESA 2BOLA 3MMEA 3QEQD 1MCHA 4KTYA 1EV2E 3FO9A 1QTYT 4ZO6A 1QYGH 4Z7WA 4WEUD 5CFAA 1CE6A 2XJKA 4OQTL 5TK2A 5SWSD 4GSDL 4PP1C 4XCEB 4CDHA 4YXKL 5CEZE 4AQ1B 4GFXA 3MJ6A 4C57C 1K8DA 2OSLA 1MIMH 3EUUA 4IU2B 3NZ8B 1KTLB 5D2LE 3GQFA 4TPRH 1E3ZA 2BSED 3L3JA 4GAYB 2DQTH 4H25A 3N5AA 2XACC 2RGSA 3KDMB 1MJ7L 1UUSA 1KXTB 4R0LA 1D5XA 4RX4D 3W9DB 1P7QB 1MUJA 1EHKB 4F8NA 4ZMVA 1N59A 1MNNA 4PJEA 1FHNA 1IQDA 2V7NA 4RMUA 3CFQA 4WJG3 3VSVA 2D9CA 2IPTH 3R06A 1NTDA 1FRGH 1CLVA 1YMMD 3ULUF 3TH3T 1RUQH 4K3DL 2OMXB 3VD1A 4U6HA 1DQDH 1LNUB 3G6JE 4R8WL 3QAZC 2A1WH 4L3ED 4P2OC 4HXBH 3G5XA 4K8RL 4BFRA 2R0WL 4PRPE 3V4LA 3QR1A 2OJEB 2GEQA 5IJKA 3TN0B 1KTKE 5JQ6H 3VVVA 4LSPH 4ODVL 2EKSB 4ZS6D 5C7ZA 4R2GD 4I0PB 2V2WB 1JV5A 2HRLA 5FHBL 1J9CT 4RISH 2NR6C 3NFSL 5F96L 5DD6A 4MDIB 4W9HC 5GZNC 3DXAB 3EBIA 4F24A 2UYLB 3GMMA 3NK4A 4I5BB 4JHZA 4NN6B 4PFEA 4ELKA 1KIQA 4V1DE 4BIKA 1DANU 3REWA 3BSZH 4UDUA 3GD1C 2YRPA 3EDEA 4M7KL 3EKCA 2CUIA 3Q3GB 1MAKA 3P3SA 4G7SB 3MRRA 3FU8A 4GT7A 4O2CA 1O9WA 1RV6X 2YXFA 2Z8RA 1FP5A 3QARA 1IE5A 4FXKC 5CP3A 4ZTOL 1FFNB 5HI3C 1FV1A 3PIQA 2YARA 2MOQA 1F18A 5F89B 4UOQA 2X4UA 3MODH 3P4NB 3ULUL 4LPUA 1ILSA 2BDNL 2D03H 4XH2B 3FFDB 2VN7A 5FCSH 2OZ4L 4GT0A 2FR4A 3E6FB 4HLEA 1N0LA 1AI1H 2BY2A 3NA4A 1HTYA 5BO1L 1JHTA 4KXZI 1T7YA 3H53A 3OVUB 4FFTA 2XX1A 2CD0A 4OZGB 4BZ1H 4OZHB 2WCSA 3AQYA 5CHNA 3VW3H 2B59A 2AJSH 3FQWB 3L3GB 4GBXD 4AGPA 1I7RA 4C56D 2M8XA 2XWTA 1MCEA 4DK3A 1T03H 1BZ9A 2BFGA 4JFDD 5E8EB 3P30L 1J5DA 2FAUA 2EDXA 3DO3A 3G6AA 3N41B 4IJ3B 3FTYA 1ZT7A 2YC1A 4YEEA 1ANUA 4UTCA 1A6AA 2VLKA 3IJEB 3UYRH 4MA3B 2YRZA 3IMUA 4MXQC 4NXSA 1JZ3A 3NCMA 3WEXA 1KCVL 3VAEA 4G6JH 3TFBA 3KLHD 2Q9OA 3KPSB 1A7PH 2GK2A 5C0BD 4K4KA 4TULL 4W93A 1WEJH 2OMYA 4X6EB 1DCEA 2NSXA 2D7OA 3U9PH 1IAOA 4XBPB 3B8YA 3EGDA 3N1MC 2R1XB 4ES9A 5BW7A 4N2FA 1OAQH 4BDVB 5DQJB 3VXSE 4GFTB 4IMLB 3BWUF 3DIFA 2E7LC 3SZ6A 2FNBA 3MRCB 3BKJL 4NEHB 3UYPB 4KQ3H 1X7TA 4RMWA 4EUPB 1KB5A 4FQLL 4MXVF 4K5NA 5D1XB 3LKRB 4P4KA 3MYJB 2OR8A 1LDSA 4YSTA 2DD8H 1ES0A 4S0SD 4MDRA 5EU7C 5TF1H 2AQ1A 3O41A 3ESUF 3ULUE 3EXLA 1MJ8L 1SYVA 1BGXH 1TITA 4J3XA 3P4OA 5BRZE 4YS4A 1R0AL 2YAPA 4K5MA 2K70A 1PZUB 2HTKC 1P53A 4ZS6C 4R2GC 1XF5B 3QJUB 3HHMA 1JRHL 1UEYA 5D4IA 2O5ZH 1P4UA 5AEAA 1PZBA 2BP5M 4KQ4L 3EJTA 4BFKA 5E2TL 3IMRA 4P5SA 5DEFB 1TR7A 1TCRA 3OR7B 4UQ3A 5JMOC 3TEWA 1L9OA 1RERA 12E8L 1DCLA 3OSVA 5KW9L 4LO9A 2VXUL 2Y06L 3SDAD 3SE6A 1JP5A 4TS6A 5IB5A 1JPFA 3NGBB 5J12B 4QHUB 2IBZY 5TGBB 4KUZL 4DK6A 3MJ8B 3X3GL 1FNEB 32C2B 2PWDA 2AQNA 5DGRA 2PKDA 1YY8B 2R27A 5EO1B 3CU7A 4HPYH 3HI1A 2IAAC 3B1TA 3FO0L 4DH2A 4L1TA 4YDJB 1F6LL 1S7VB 4G8EB 5KVGL 2ZP8A 1KDIA 1GS7A 3M07A 4PG9A 1U3ZA 4GBXC 5FYKH 2LLNA 2XYBA 1OEZW 2FDBP 5DI8B 4P9HC 3G6DH 3LN5B 2B9BA 4C47A 2H6PA 5LGKA 4MMYB 4N86A 1CXIA 5AW4B 1JGEA 1CCZA 2D3LA 4JDEB 1I9EA 1BVNP 2AQTA 5CP3H 2CUHA 3QFJD 4HJJH 3N91A 4NKIL 5DRXB 1VGKB 5TJWK 4JPIA 3M7FB 3MACL 3S8GB 1OGTA 3JUYA 1GTFA 4CSSA 1UGNA 4GXFA 4WKZB 2AMUA 3KLHC 2OFQA 3FB8A 1XAKA 3ELQA 3WDIA 1U8IA 1E7UA 3QXAB 4P23D 4L8DB 3QG7H 3QORD 4N0FA 4P2QA 4PGCA 4X50A 4XN4A 4MQSB 3V95A 4HU8A 3WTXA 3V9FA 2HPOA 3W39B 1SGKA 1SXBA 1V27A 3MV8E 3OPUA 4IMKA 3SO3C 3OB8A 5MEQB 1QABA 1NLBL 2WWNA 4TNEA 5AOKA 5C2BH 4MJIB 4OY9A 1YY9D 3NEXA 2MRYA 2FJUB 2BP0B 4RIRB 1MXDA 1CLCA 1XGTB 4MXVE 2R29L 4KRPB 4BFIA 4LVEA 4AIXA 2DM3A 4U7SA 3CQPA 3FQRA 3RTQA 3WE6A 4KHTH 5KSUB 2HVJA 5IBTH 3U36A 2WJ7A 3PAZA 2V0AA 3TBYA 4LCWD 2IWGA 4FQIL 5TE6H 5LBVA 1YNKL 2F5BL 4OW6A 4NWTL 3PUCA 1QKZL 1B0RB 1H3WM 2OK0H 3O6FD 2ENYA 1CXKA 2X6MA 3DVNA 1I8MB 1NDMB 2AJUL 2DV6A 3IFLH 1OOAA 1GZQB 4MASA 1E6OH 4ZUVA 3SDAC 3MLTB 4JB9H 5L8JB 3KPPB 4RGOL 2YK1H 2Y5EA 5C0ND 3BFWA 1CICD 2HLFD 3H9HB 4BSWA 4UTAH 5JDJA 4PJ9B 3GJFA 5AD0B 5ICXB 1BP3B 1H5BC 5MI0C 4NUJB 3FCSA 1JZ5A 4KUCD 1EHXA 2VQ4A 2VDML 2H6UA 3FDWA 3TPUA 1HDMB 4HIIB 5FYJL 1MZZA 3QJFA 4X80H 1BV8A 3D8MA 3BVWA 4CW1B 2WQWA 1NOAA 1D6VL 2PCYA 1IEHA 4MVBD 3TWCH 3GSQB 4KFMA 2FCBA 1F4YL 2JTYA 4XNXH 3TJHD 3TFKD 3R4RA 1VRSA 2GC7C 2LABA 2VABA 3CSPA 3OKOB 4TL5A 1UOVA 4XP5L 4ABUA 1QW9A 5EZLA 3TCTA 4U3SA 3IU3A 3QEGH 3S3DB 4OFPA 2X38A 1YNLH 2N56A 4G5ZL 2GG1A 3BH8A 4G9FD 4K7PH 2B0SH 3FU7A 4P23C 3QORC 3NA9L 4UAOB 1PAZA 2AK4A 2Y24A 3EFDL 4GP5B 4NJ9H 2EIDA 4X2UA 5IROA 3MLSL 4RRPG 1ND0B 4P46A 2X9WA 2VTFA 4A2MA 4Y5XB 3WNMA 1YY9C 5C0CB 2YD3A 5F7BA 4RMVA 3WNKA 3V0DA 2R23A 3ETBJ 1Z9SB 4CMHB 3UC2A 4NAMA 4EVNA 3MBXH 4NGHH 1N6QL 5IP4A 5EBGA 1E4KA 4HLZG 2WKGA 2ZKHH 4MZIA 1HI6B 1JDDA 2G75A 3HZMB 3MV7B 2WXLA 4FJZA 1PCXA 2BVYA 2YUXA 1QSFB 1NDGB 3PWVA 2E7MA 2VWEE 4QHLB 1BEYL 4ZNEA 2QSCH 3TC9A 1KULA 2KLTA 3O45A 2GTQA 3WHE1 4JVWA 3DX1A 1MFVA 3HBZA 3D06A 4AGOA 4DVBB 1RZ8B 5DK0B 2E8YA 3HNVL 2FWUA 3FTVA 4S0TD 4F2MA 4F5CA 2BOBA 4KTEH 3X12B 2VO8A 3VGFA 1KJ2A 1U3HD 4YFDB 1S7XA 3QRLA 4WZ9A 4TQEH 2GITB 5DJAA 3CLFH 4QKTA 2WQVA 4NLHA 2DQMA 3MRPB 1SBBA 3ARRA 1PJ9A 4PRDA 4UT7L 5FKPA 5C0NC 3AREB 1CICC 2HLFC 1TJXA 4DNLA 2JV6A 3NYKA 1M2VA 3VACA 3HS9A 2LU4A 3FH7A 4JKPL 4E5XG 3RL2B 1I8IB 2IXQA 1UWXK 4JN1L 5EC1B 2WYTA 5E94B 3RGHA 3HS0C 4YK4B 1NAMB 4A2HA 2EUXA 5DJ8B 1BYPA 1VFAA 1AJ7H 4FYTA 3QQ9D 4WQOA 4WW2A 1MCOL 3SPVA 2DI7A 3HLKA 3MZGB 1QBLH 1SY6H 1N68A 4MTMA 2WCPA 1V7MH 2WAHA 3UACA 4B60A 2XKNB 5JOFA 1DN0A 3QCTL 3QDMA 4KKLC 4KJYB 4R26H 2WZ0A 1KENL 4LVHB 2KZKA 3KYOA 3O0RL 3KL3A 2BH0A 1ZTMA 4FI6A 1ESOA 3EOBA 3TJHC 2VDNH 3TFKC 1GMEA 4I89A 4AIOA 3BO8B 4Z7IA 3OKKB 4N6RA 5GS0D 5FHAH 5KVMC 1GC1H 3GJFH 4MX7A 5ICZB 3D4YA 4DKAA 2YR3A 2W9DH 4WI0A 3A21A 2R2HA 3EGXB 4PJ8D 3MREA 3FCGA 1HEJC 1HINL 4YWGL 3UTTE 1Q94B 4NCC2 2VJXA 3ZL4L 4TM9A 1YEDB 2YD1A 1N3NB 5DD3L 2CNYA 2Z31B 4MRBA 3WS3A 5DDHA 3KNBA 2CKNA 4W4OC 5BPPA 1JYVA 1EEYA 1K3ZA 1IZJA 3L5IA 1I3GL 5F71A 2EYRB 3S5ZA 5KVEH 1TKWA 1E9OA 2HJLB 3Q48A 5F6HJ 1EXUB 1BX2B 4U1IB 4RGNE 1L4IA 3SYPA 2DQFB 2QTVA 5I66B 1Z0MA 1MVFA 1IT9H 1DZBA 2VGLM 2WLIA 3HE7A 1KB9K 3IWUA 3HZVB 3V5KB 5ITFB 1JWMB 3VRIB 2C9VA 3KGTA 5EZOL 3LZFL 4JFOB 4K7FA 4H8QA 3GXDA 1T83C 3MLZH 3DX4A 5GJSL 1YVLA 1H8LA 1N6UA 2VB5A 1NWOA 5GRZA 1G84A 3WIHL 3L9EA 3TA3B 3PQYE 2DH3A 1II4E 3PY9A 1QWHA 1KLFA 4DP4X 4YLCA 1FO0L 2CA4A 2YXWA 4TLSA 3UTSB 1AGBB 1UJ3C 4U1JB 2V2TB 2P4AB 4KO7A 1U3HC 4XZUB 3BHBB 4FXLA 1SXSA 3CZUB 1BQLH 1NUDA 4UT9L 3WS6A 4XCEA 1MG2C 1FORH 1A3LL 3TH4T 4HIPA 4AQ1A 2XTJB 2DTMH 2MEJB 4GIOA 4YE4L 4POYA 4F9PA 2AFNA 4IU2A 3NZ8A 3VXQB 2EUZA 1KTLA 1NCDL 4B53A 3BPOB 7FABL 2OJZH 4MLIA 1XB8A 3FQ1A 1NCWL 4GAYA 2NDFA 4JM2D 1GC1C 1CF8L 3KDMA 2B5IB 1YUHB 4FNLL 1KXTA 3W9DA 3INUH 1YO4A 1P7QA 3QQ9C 1OE1A 2ZG2A 4N9GB 4PJ5D 3VWKB 5F9WC 1QFOA 2BMKB 3BT0A 2R69H 1ETA1 1ZLUK 3LVTA 3FBKA 5CLTA 3B7YA 5FV1L 5C6WH 3QZWB 4JM4L 2OMXA 1C8PA 1LNUA 4X7SH 1NCUA 2WIMA 4ZFOL 5CIPB 5IREA 5D2LB 1MPAH 3V6BR 4TTDD 1UFGA 4X5QA 4FFYL 1YEHL 5GS0C 2QSVA 1WAEA 2OJEA 1CGSL 3TN0A 1KEGH 4ODUB 4XR8C 5JA9A 1YEGL 2EKSA 4FHBD 3O6MH 4I0PA 2V2WA 3MOQA 1CU4H 3GPEA 1QLEH 4KZCA 4M1CC 3CZFB 2J2ZB 4MDIA 2XCMC 4Q7DA 3LKSB 1TQCC 3DXAA 4WTXA 1DBML 2E7CA 2G2RB 1U33A 2UYLA 4I5BA 3T65B 4ZMLA 2RTTA 4PRPB 4YL9A 4NKDB 2OULB 3LSOB 4WCYL 3Q3GA 3NJNA 2PR9A 3VD5A 3K6DA 4ZODA 1IX2A 4WF7A 3EH1A 1FFNA 1JTTA 3FSZA 5C3IA 4QO1B 4ZXBD 4M5YL 3A6OA 1BFVH 3GSWB 5F89A 2DMKA 3P4NA 1SMOA 3SPCA 4XH2A 3T4YB 2IH1B 3FFDA 1IAIH 3FB5B 3E6FA 2IDFA 4JGMA 3G08B 5C07D 5ESQB 3IDXH 5E0FA 1UOKA 3S0PA 3IYLW 4XPBH 4OZGA 2XTSA 4OZHA 1KG0B 1KELH 3L3GA 3FQWA 4UV7H 4GKSB 4LHJB 1EHLH 2DLTA 1SBSL 2CUMA 2PCXA 3TIDB 2PYED 3LNIA 2HUEA 5E8EA 1ZIAA 2OYKA 3RQ3A 4LCCC 5CJQL 5GGRB 1JK9B 3WXVL 1UD5A 2NY0D 1MCSA 3IJEA 4MA3A 3C2AL 4QHMB 2QDVA 1UACL 4RZCB 4ZW8A 2JELH 4Z78B 1OAUL 1PSKH 4Q9CA 1I9JH 2ICWB 2FGZA 3KPSA 2CLVB 5AZ2L 2NY6B 2E7HA 2EUVA 4X6EA 1J0KA 2MMXA 3B8SA 3HVNA 4WUUB 5LG6A 2DJMA 5DA4A 4XBPA 3MU3A 4CC4C 2R1XA 3U2SB 1YECL 4JM2C 5DS2A 2YUVA 1Z66A 4BDVA 1PY0A 4FERA 5DQJA 2YWYA 2PO6B 2FWOB 1Q9OB 2CG9X 2F18A 5D7EA 3MRCA 1ODUA 3UYPA 3JXAA 3K74B 1MCKA 5FUZH 3A22A 4EUPA 5D1XA 3LKRA 4FLHA 2D9QB 4UM9B 5AW9B 3MYJA 2NPLX 3CXDL 2WQUA 4YIQB 3UJTL 3LD8C 2EDQA 2YD2A 5IBUG 8PAZA 3EOAB 5JOPD 4TUJB 4TTDC 1QTPA 3DX3A 1DQLL 4LVNB 1W80A 4GQPH 2VJ0A 4FKKA 4YSRA 3PV7A 3US0A 1FNAA 1BQHG 5IF0B 2X89A 4ESKA 4G70B 5KZCD 1XF5A 1RLWA 5HGBB 3HBGA 5GS2H 5JXEA 4EOWH 1WFJA 1ZHKB 3WTVA 2VLRE 4OM1H 3O2DH 1R3JB 3CH8A 3ULSB 5DEFA 3OR7A 3B9KB 5BRZB 4PS8A 5IV2B 4HW6A 2Z8VC 4A38A 1KGWA 2L4OA 2MQ3A 4QHUA 5TGBA 4ZXBC 3MJ8A 1FNEA 32C2A 4O51B 1HIML 1F8TH 4FP8L 4OF5A 2ESVE 1BWMA 1YY8A 4PI0A 5EO1A 1L3NA 3S8WA 4HK3J 2DKMA 4D9RE 4YDJA 1ASOA 1S7VA 4G80B 4G8EA 1QTSA 5ICYB 5IESH 2RJMA 5FW7A 4M93B 5FFOA 4HSQA 1NC2D 2QADD 4GUPB 4QHPA 5DI8A 2CKBL 3VFPB 3VTTA 3LN5A 5I0DA 2C8NA 3B7TA 2ZWLT 4MMYA 1YEFL 4MMZC 4JDEA 2FQEA 5HHVH 2NY0C 2DLEA 5IQMA 3KLDA 5DRXA 1VGKA 3LEVH 5DQDH 2HVKB 1FGVL 2I5YH 3AM8A 3NTCL 2TAAA 4JFPB 4WKZA 4XE0A 4YN3A 1RUAH 1U8OB 2QSTA 5CINL 2G60H 4F91B 3QXAA 4L8DA 2VKWA 4Z3EA 3MRNB 2D0FA 1JOIA 3QC5X 3W39A 2OMUB 2XRAL 3X11B 3KL5A 5F0MB 1J9TA 3U1PA 5MEQA 4YHYB 1A5FH 3L3DB 2OL3H 3QNFA 4ONGL 3HHRB 4IW4C 4MJIA 2QQQA 1LE9B 3FULA 3KMDA 3HCVB 3K6NA 1IFHL 2IOIA 5AL8A 5LNEA 2R0LL 4JFEE 4XMLL 4ONFL 2CU9A 1UYWL 3QPXL 1TJMA 2BP0A 5BVPH 4RIRA 2OMWB 1XGTA 2G9HB 1ZV5A 2XG5B 3MKGA 4WFEE 3QG6B 4NO0B 4QGYA 4XO8A 4P59H 1RIHH 5KSUA 2KL6A 1AHMA 5BOPA 5J1TC 1WWWX 2BHUA 5AW7B 2X9YA 3IMSA 2O5XH 4G82A 3U2IA 5MENE 2NQDA 5EOQL 1B0RA 4K3HA 1AO7B 1IGIH 4GEJA 4P9HL 3KW7A 4EUPH 3HC4L 3ULVH 5I17B 2EACA 3O4LD 4D9QE 3N50A 4W68A 1I8MA 2Y7OA 4G43B 1NDMA 1WFUA 1P4BL 1XGQB 1GZQA 4LSTH 1NKGA 2WK2A 3MLTA 1HXMB 3KPPA 2Y0SA 3BE1H 3U1QA 1JPSL 1EFXB 1BXAA 3FUIA 3H9HA 5D1ZI 1OP3H 5KANI 1ZGLM 5B21A 1U8LB 4PJ9A 1UHVA 5AD0A 5ICXA 1B88A 1E5CA 1NANI 3TZVB 3D12B 3AU0A 3ARYA 2AITA 4NUJA 4XMPH 3CWGA 1WAAE 3NJVA 1HDMA 1TJGL 3QUKB 4HIIA 1F11B 5J13B 2O6DA 3S3BB 1UKQA 4J39A 4S1DD 4CW1A 4PWGA 4AMXA 1XXDC 2EDOA 4JRXE 3GSQA 4FA7B 5AB0A 1V05A 3I9GH 3SEPA 4E9XA 3BFQG 3MBED 2QMJA 4NM8H 3OKOA 3ET9F 3MLUL 1QD0A 3DPDA 1OLZA 1XCQB 4OCSH 3MTXA 5KOVC 3WAKA 2QVTA 2OMTB 1THAA 5K9JL 3QWNA 3V4UH 1XEUA 1EZSA 4YC2B 5DJZB 3CZGA 3C60B 5IUCA 1EGJA 4C56E 3GKWL 2WGNB 2I26N 3FUJA 4BK4A 2HKAA 5DMIH 1SPDA 2C9AA 3WKML 3ARFD 5AAWC 2QGDA 1ND0A 2EEBA 4ZFZB 2WXPA 4Y5XA 3UG4A 1K72A 5C0CA 4LDLB 5DCCA 3WCYA 4GRLD 5JZ7D 2A4ZA 5K9QG 1Z9SA 5FO2A 5IWLC 5JA8B 4HZAA 1BSIA 4NQED 3AT9A 4ZZKA 3RWGB 2GJRA 5EF2A 1HI6A 4OF6A 4OZFG 1JRHI 2ID5A 4LXFA 1AP2B 5GGTA 3HZMA 3MV7A 5FV2A 3QFGA 1QSFA 1NDGA 4G6KH 4KMTH 4QHLA 3WIIL 3CBKB 5GS3A 2R4SL 5MEPB 4KK6D 2Q8BL 1IILE 1IGMH 5D7SL 2CPCA 1QRKA 1X5XA 3CSTA 3T0EE 4KU1A 4DVBA 1FZJB 1RZ8A 4UU9B 4AV4A 1S3RA 5DK0A 4JPVH 1H3VA 4HAGA 2BPBA 1JFQL 2HTLD 2QZQA 3ZXAC 2JFCA 3ZYOA 5I30L 3LXCA 3BRFA 2CZNA 3LS4L 3X12A 5H37A 3DTXB 1AACA 3AQDA 4DQAA 2FX9L 2GITA 2CO1A 1Z9LA 1IEAB 3MRPA 3SYCA 3AREA 3D0AA 4LGPB 4Y5YB 1F3JB 3F65A 3RL2A 1I8IA 2VDQL 4MJ6B 4H0HB 1MJUL 3NFPB 2XWJB 4HIJB 4L4TD 4LSVH 5E94A 5EC1A 3OMNB 5EBLB 1FNHA 1NAMA 3GRWH 2X1WL 3DBSA 5DJ8A 3U7YL 4D0CB 4PJCF 5JHLL 4Z7QF 1MG3C 5D70H 4IHBA 4G8FB 2XKNA 1BZ7B 4S1DC 2ZWKA 1J5HA 5IW6B 4KJYA 4FGMA 3RYMA 1L7IL 1AS6A 3RGBA 3P0YH 3UBHA 3QRGH 3MBEC 3BO8A 3OV6A 4KJQD 4R7NB 3D85D 3OKKA 4TSCL 2QFRA 4HA1A 2XG4B 2VKXA 1ZLWK 1J7VR 1EZUA 2EVGA 5EA0H 4E2OA 4OQ1A 5B8CC 2E5EA 5J9PB 1WD9A 5ICZA 3GBEA 1NFAA 5J11B 1DVUA 2Y6SD 3EGXA 4EBQH 2FT6A 1Q94A 1R3HB 1YEDA 5TTRA 1N3NA 3PREA 4U1NB 2Z31A 1ACYL 1CLOL 1XF4B 3ARFC 2C1PB 3KGRA 5F6IB 4JQIA 5IQ9B 1M3JA 2YOCA 2EYRA 1RZQA 3QFJE 3D0LB 2HJLA 3OQ3B 2FJSA 4JZJB 4GRLC 1EXUA 1BX2A 4U1IA 4ZDHB 3RU8L 5E7BA 3ZQ9A 5IT2H 1E9QB 2C9RA 3PRZA 1WTLA 2DQFA 5I66A 1E3XA 3UTTB 3O2VH 3WO3B 3FSWA 3FTSA 5B22A 3ARWA 3HZVA 3M8OL 2XHNA 1JWMA 4I13B 3V5KA 3VRIA 5ITFA 1PBYA 3NH7L 4JFOA 2Z34A 3TBTB 2LVCA 4OLXL 1EGJH 4IKJA 3MV9E 5JPNC 1JI2A 5CFHA 4KK6C 3ZTDC 4FCHA 5EU6D 2EH8H 3EH5B 4U6XB 1CLYH 2XC8A 4DZ8B 1F90L 4RGNB 4XNYH 3TA3A 3IE9A 4X8CA 3OAWA 2O6CA 2HTLC 3UTSA 1DSYA 1AGBA 2HKFL 1FYTD 4U1JA 3VH8G 2V2TA 3LAFA 2AK1H 1PZDA 4XZUA 5KUKA 3BHBA 4TLUA 5F44A 4YHKH 1Z3GL 1NFKA 3U6XS 1YYLL 1SXNA 3A67H 4FS0A 4Z95L 4N2BA 5GGTH 2NYYC 3PQYB 4XB7A 1WCBB 4AQEB 3VXQA 3F58L 3FTXA 3VNZA 3AUWB 3QWQB 5CZVH 1NEZB 4X4ZA 4RGMC 3VU1A 2Q8AL 1YUHA 1GOFA 2XT1B 1LM8V 3CFBB 3K6FA 3OZKA 4N9GA 3WBDA 2J21A 2PTVA 3VWKA 2BMKA 1CQKA 1ZTXH 3HMXA 5H37H 4EZLA 3QZWA 4PJCE 1EQWA 1PY4A 4JHUA 2X70B 1OIOA 1EZVX 1WZLA 1BG1A 3GSNB 5T3ZE 4IU3B 2DBJA 5CIPA 5D2LA 4KJQC 5D7IB 4FZEH 5TE7H 4GXUM 3UCQA 4QRAA 4WFHE 1AC6A 4NZUH 1IKFH 3N04A 4ODUA 4FRWA 3CMOH 1PAMA 2MCAA 4XB3A 3EXJA 1JIBA 3EW3B 5IKCB 2BNQD 2VAJA 4P06A 5C09D 7PCYA 5E1HB 1EWHA 4WY7L 1G9NH 4W6XB 2D0GA 3CZFA 2J2ZA 5HDQH 4MJ5B 3LKSA 4A1RA 1FH2A 2WZPD 2G2RA 1J1OH 1JXFA 3T65A 3N1GC 4M6MH 3I9IA 3SSGA 2J6EH 2UXVA 4PRPA 4WGKA 4F58H 4NKDA 4HFWB 3LSOA 3GWJA 4XO3A 2HG0A 3PYCA 3TIEB 5F9JB 2N7AA 4LHUD 3Q8FA 4OH2A 3K2MC 2DQHH 2FHCA 5LHDA 4QO1A 1ET5A 2LTQB 5SX4I 2ZP9A 1Q0XL 3G04B 3GSWA 4PRAB 5CF3A 1F3RB 5E99H 2MTAA 3DSFH 35C8H 3RBSA 4TQHA 2CPUA 3IKKA 3T4YA 2IH1A 4OGYH 3FB5A 3O8XD 4KI1A 3F8UB 3HG1E 3G08A 5F6HI 1TQWA 4LSQL 5ESQA 2XQBL 5DRNB 1NGQH 1KG0A 2KZBA 4GKSA 4GRWF 5A40E 1HK6A 3H7LA 4GW4B 3TIDA 3HC0B 1TTCA 2ADGB 4O9HH 4PS4L 3F7KA 5E5UB 1T22B 4NOBA 3AAZB 3WKQA 5IVXF 5DJXB 5GGRA 1JK9A 2G0LA 2LGNA 4MNHB 3V79C 4W6YB 4HBCL 1P69B 1H3XA 3GBDA 3KWUA 2VJ8A 5M95B 5GS0L 2JB6B 4QHMA 2CK0L 4RZCA 2ZYIA 5I5MA 4Z78A 2ICWA 4M6NL 2CLVA 1RUKL 5HDLA 1G6RH 2YMXH 3ZK0A 4WUUA 5G2NA 4JREC 3VQ1C 4UIKH 4UV4H 3QH3B 1UKTA 3K8LA 1D3CA 3F00A 4W9ZA 3DMMB 3U2SA 4G83A 4XHJD 1ID5I 2X9XA 2BWDA 3DJTA 2PO6A 1Q9OA 4OLUH 5J7CC 1U2CA 4OV5B 2X3CA 2LW3A 1ZLSH 2P80D 4UM9A 5BXFB 2YN3A 2QKIC 2ZKWA 3E38A 4YIQA 2X0WA 1FF5A 1OAXH 2DYPD 4K5LA 4AX3A 3EOAA 4TUJA 2RCSH 2VZVA 4RDBA 3SGDH 2PCPB 3DARA 5T3XD 2A99A 3T2QA 2F7RA 5FA3B 3UJJH 1U58B 2VLJE 4G8GE 3GYRA 3RWHB 1I1RA 5IF0A 4KC3B 1S9YB 2IVFC 1EA9C 2X4NB 4XO4A 5DD1H 5HGBA 2VE6B 3B7UX 3L4TA 5TDPB 3VD4A 1F58L 4HUCA 1KB3A 1NBYB 1ZHKA 2AABH 3EYUL 1QFWL 1F3DJ 4OF3A 3WSQL 4E41A 1OSPL 1R3JA 5ECJE 4MBRA 3ULSA 3HMXH 1JN6B 4D9LH 3B9KA 4M5SA 3P4MB 4OGXL 5BRZA 4NKMB 1S6NA 4DPRA 5L9DH 4U7KA 1RFDH 3NCEB 5CIPH 4I77H 4LFHD 5E9DD 1MOEA 5IV2A 5L0QC 1T1XB 4LU5L 3GHBL 4O51A 2P5ED 1XVSA 2GFBB 1W6LA 2ZAGA 2VLRB 4URTB 3SDDB 1JGVH 3LPFA 4WEBL 5DZJA 2CO2A 4E9QA 3O8XC 4K7PX 4YSOA 4JY5H 1KBGH 4XOCA 5KS9F 4G80A 1C5CH 2JKXA 2J4WL 3M45A 3WYRA 5ICYA 1N2RB 1EXHA 2MNJB 4GQ9L 2BY3A 1NCBL 2AJ3B 4WGWB 1Z9OA 3D4ZA 4GUPA 4P2RA 3VFPA 3HTLX 2AMGA 4YUEH 5DMKB 2K9FB 1WICA 1NC4B 2ESVB 3OLDA 4GRWE 5IGXL 5DSCB 2WC7A 1WFOA 3I02B 4P3WA 2B1OA 4UNUA 1KNOB 1NEUA 4PVBA 4N1HB 1CFBA 2HVKA 2H9GB 4Y4KD 4JFPA 5D2NC 1FAKT 5LWYL 5K69A 1ZT4B 3MC0A 4IBSA 1U8OA 1AS7A 4WO0A 5BS0E 5FLUA 4IBQA 4TQIA 3ZJAA 1HNFA 2PR4H 4BXSV 1MEXL 4IHOB 3VGDA 3MRNA 2DQGL 1FVCB 2DIJA 2OMUA 3X11A 4ODWB 2IMNA 3G7TA 5E2WH 5LBSH 4IGBB 4MA7H 2VR5A 3AG2B 4G71B 4K3EH 1FLRL 1GGIL 3L3DA 2PW2B 3MOAL 3NCBB 5CGBA 4ENED 4UNTA 1LE9A 5SX5K 1CG9B 1RHFA 2WO4A 3HCVA 1A7OL 3QEUB 3QO1B 4XC3H 3U30C 4Y8DC 7TAAA 2D31B 4UUJB 1UWEH 2KI6A 5I19L 4IIZA 3OJ2C 4HG4J 4YBHA 3Q9PA 2OMWA 2NCMA 3LH8A 2G9HA 1I8AA 4QNPF 1N10A 2XG5A 4X7TB 3QG6A 4NO0A 3OSKA 4BINA 3EYQD 2DYSB 3BUTA 4KI5D 4OFYD 4JPQA 4TVSa 3ZYIA 3JVFC 3FH5A 4HQQL 4NQTA 4ZTPL 3ZR6A 2X5PA 1Y6NR 2F58H 2W8CA 4NQCD 1LK3L 4JFEB 1SLXA 4DETA 3V4PH 5F7LB 1AO7A 1MCCA 1OE2A 2FLMA 1VAHA 3UTQB 1TEGA 5I17A 2YXMA 4G43A 2VUYA 1XGQA 3WKPA 4LQFH 4BSVB 1HXMA 3H1ZA 4CBZA 5ILTL 5J56B 2I7OA 2A4CA 4NJAH 4F8QA 1X9QA 1EFXA 4R9HA 4LT7A 4FNRA 4XPAH 1TO4A 2UX6A 1U8LA 5MENB 1KCRL 3E8UH 1MAMH 2BOCB 3CQFA 3O9WB 2Q1EA 2BXYA 2W0KA 4KROB 1BVOA 3BZFB 3TZVA 3MLYL 3UAJD 3N9GH 5JLZB 1MF2L 1QRNE 1FN4B 3ROOB 2WWMD 1EMTH 5LUMA 3QUKA 4PRIB 2H47C 1F11A 5D4HA 3B2DC 2VOTA 4MKTA 2Y1VA 3GHPA 4Q56A 4H5SB 1GW6A 1BAFL 1JZJA 1XGYL 5FR3A 1WGVA 2WUBL 2NQCA 3AY4C 2MCPL 5GZOD 1TYEB 5DTFB 3S6CA 5JQHC 5FW6A 2HWZL 1KGIA 2VDRL 4DEPB 1JNLH 4LGRB 1H3TA 5FYLE 1SHWA 2DOCA 5E8DL 5IOPB 3CPUA 4Y4KC 1IC5L 4YZFF 1XCQA 1P7HL 4K71B 3I6SA 3O3EB 2MCG1 2OMTA 1QNZL 4B5ZA 3HRZB 5DJZA 4Q9QH 1L9PA 1XR9B 3C60A 1BZOA 1J9SA 4FXTA 2X4SB 4BCYA 2XWCA 1J1PH 2C9QA 1P84K 1RJCA 3QXUA 1ETZB 3TO4B 1DL7L 4NERA 1UD3A 1YEJL 4PJHF 4XPTH 4ENEC 4HUVB 4ZFZA 3HIZA 2H3KA 4RFOH 1VFMA 2OMVB 3ZZSA 4ZZFA 2CHDA 4OF8A 5EZPA 1E8YA 2AXJA 5IB3B 3KJ6H 3RWGA 3VA6A 5L2KE 1EEUA 1UM4H 4G8IB 5F21B 1O6TA 2A9AA 2YHGA 1AP2A 5I6LA 4UZGA 4BK5A 3EYQC 4KI5C 3U4BH 4B0MM 5DC0A 4R90H 4L8BB 4PJXE 4QNPE 3ABLB 5MEPA 4XGZB 5FF6B 4KWUA 4PRNB 2E6JA 4U7MA 4YSDA 2VXSL 4OLVH 3FN3A 4P5MB 4QHNB 5LDSA 4YO0B 1FZJA 2L7EA 4UU9A 2QQKL 4NCC1 5JHDD 3Q1SL 4IS6B 3KLLA 1XZWA 3F2LA 4B5EA 2F5AH 3DTXA 2FD6H 3QPQD 3GI8L 1IEAA 3HFMH 2YQ2A 2A74B 1P7BA 2WUCL 1U8CB 4I4WB 4PQXA 1SM3H 4MXWH 5DHMC 5E8NB 5I9QB 5JO5B 4Y5YA 3S96B 1F3JA 5TD4A 3T0EB 2Z4QB 3FUHA 4MJ6A 1XL4A 3MCG1 4Y7MA 3NFPA 4IKKA 2XWJA 4FQJH 4HIJA 2VDPL 5HHOE 3UAJC 3QULB 5EBLA 3MJ9A 3DTDA 3BKYL 2WWMC 2VL4A 3B2XA 3D30A 4D0CA 1CGYA 1AGFB 2FX7H 5JIDA 2WLYA 1YJDC 1I1AB 1QPXA 2WKOA 4NUGL 5LG1A 1F1AA 2NUPB 4G8FA 3FW6A 3EFFB 1ZHNB 1BZ7A 3CFEB 5HYJD 3GLAA 1WQVT 1A3RH 4XXWA 1F4XH 5IW6A 4QRRE 1RL1A 5D72H 3C5JB 4W9IC 5GZOC 1EJOH 5KBPA 5CS7A 3SZKC 4MS8D 5C1MB 3QR0A 4UWQB 3CHOA 2HX8A 3CFCH 5F7FA 4R7NA 4OI7A 3VGAB 2XG4A 4Y5VB 3T6VA 2Y07L 4JFFB 1NKRA 3D69B 5J9PA 3MUHL 3SOTA 1J8KA 1KN2H 3UO1H 1R3HA 4YZFE 4HLJA 2VLKD 4LSRH 43CAB 3GRBA 4JX0A 4YR6B 4U1NA 1XF4A 4Z7VB 1OP5H 4AT6B 4KZDL 2A9CA 5LCVH 2C1PA 3L3IB 4M62H 2G3XA 5C71A 2YZ8A 4X9FA 5IQ9A 5C97A 3HG0A 1W9XA 3F7LA 4NZTH 3D0LA 1L9SA 1K2DB 4ZDHA 4JZJA 3GNML 4OJDH 1R5VB 4GI8A 3ZUCA 4ZTEA 4EI5B 1E9QA 1QP1A 1KIPB 4PJHE 2YAQA 4JRLA 4R0LC 2QGBA 3UTTA 4Z5RB 4IIQB 4JY6B 1JHLL 4WJKB 1A7QH 2XV0A 5I74B 1OF0A 2H26B 5F1KC 4P4KD 3TBTA 1YSOA 5K59F 1DHKA 1ERNA 2FSDA 3BAYA 4KBPA 3V6FB 2CR6A 3FPYA 4U6XA 4YFLF 4ABQA 2VXTH 4BE5A 4DZ8A 4F2EA 1ZWIB 5ANME 3P1VA 3CTTA 2HCZX 2A4EA 4K5PA 2K4WA 3DC0A 5GHWH 1TSHA 3BZDA 1F4AA 4L9DA 4XVJL 4HUMB 5KSBF 4LEOB 4F8OA 4AE0A 3H42H 2N59A 5IVZB 2Y1ZA 2X4RB 4OGAC 3ATEA 1P2CB 4G6MH 3QPQC 4QY8B 2WQXA 4N20A 3ZTJH 5HGHB 4WFFD 4EPSA 4JE0A 4PJGF 3OB0K 3R7QA 4LPWA 1FZMB 4BZ2L 3PQYA 4NNPL 2NCEA 1WCBA 4AQEA 2J72A 4TRPL 2CRZA 2VM9A 5LO7A 5F7MC 2FT7A 1NEZA 3RI5F 1AZBA 2BCMA 1ZE3H 3NMEA 5EN2B 3CFBA 1GPOL 4JQVC 1CLZH 5ALCL 3SQOH 1MREH 4H1LH 4RH4A 3TBSB 4F3FB 2FNWA 5DJDB 5F8QC 2X70A 4PSRA 3GSNA 5FLVA 4MS8C 4IU3A 4L9LB 5D7IA 5E7FA 4R97B 3V9EA 4I87A 2JKTM 2GCYB 2ZPKL 1XFPA 3B3IB 1KIRB 1XIWB 3FFCB 3HS8A 3X1EA 2WINB 4QRPB 1E4XH 2D7TH 4ORGB 3ARPA 5IKCA 1DLFH 5DYOB 4WFGD 4YHOH 5FWRA 1TTUA 4WV1C 2LR4A 2WAQA 1CIDA 2NSMA 1BIIB 1L9MA 4MJ5A 4YDLB 3BGFC 3IMTA 1IGCH 2WWKO 4OM0L 3QHZL 4LPTA 4XN9A 1NOFA 4HFWA 4NN5C 4P2QD 4WHTA 5BW7C 5AVWB 2C3XA 2VDLB 3TIEA 5F9JA 1OCRB 2EINB 2IWFA 4EXPX 4BUHA 4PRAA 3G04A 3GTTA 3LN4B 3TONA 1I82A 3Q8BA 5LXVA 2I60L 1ECZA 2WLNA 4PBXA 4JPSA 1QSEE 1X6NA 3RNQB 2H8PB 4P4KC 1YAZA 4LGSB 4OJAA 5DJCB 3FT3B 1WG3A 1BVLB 3EO9L 2XN9B 5DRNA 4OLYL 2Q3XA 2OI9B 1LWHA 3DHJA 4H8WH 2BSTB 2KLRA 3PWPE 4GW4A 1AHWC 3HC0A 1FFOB 2ADGA 5K59E 1J0YA 3HN3A 1T22A 1RK0B 3ZW3A 1VEPA 4ECNA 3AAZA 1ZE3C 3MCYA 5DJXA 3DROB 3VFTB 4MNHA 1XGPB 3DLQR 2VSCA 4Q97A 3NZSA 1RZFL 2J8UF 2JB6A 3MLXH 5KSBE 4UQBA 5LQBL 3VXME 3W0WD 4Q6IB 5AYQA 4N2MA 4X7CC 2R8SL 1LO3L 1PG7H 5TQ2H 4Q9RL 3MLVH 2OTWB 2W91A 4PJGE 4HU2A 2ZWZA 3APCA 3QH3A 3UXFA 4CJ0A 1CIUA 1P5VB 1D2OA 3V52H 2FIKB 3DMMA 4JMNA 3IKCB 2D3VA 3V6OC 3ZTEA 3W1ZA 2LT9A 1O9ZA 1LO0L 4DUXA 2ZXCA 3CHXA 5EOCL 4DQOL 4OV5A 1OSEA 4DP0X 2FZ3B 5BOJA 3BAEH 2LOEA 1ADQL 4N85A 3RX8A 3SPIA 1EZVY 4PVMA 1VF5C 5BXFA 3Q01A 3VMPA 5I6OA 5DK3A 1HL5A 1R3IH 1TJIL 1JPTL 4KRNA 3E6HB 2C9UA 1N8ZB 3ARBB 3B2VH 1FCGA 3TT3L 5FFLA 2PCPA 3QR2A 3TV3L 1DEEB 1CS6A 3BUQA 5FA3A 3K6IA 1TETH 4ZD3H 1U58A 2EXYC 3ARDD 3BAJA 3QQNA 1ZVHA 1KXVA 3RWHA 3SE4A 3TF4A 1S9YA 4Z0BH 3LQZB 2YGVA 3JV0A 4XAKD 1H6UA 3PP4H 1BMZA 1LO2L 2X4NA 2VE6A 3AGWA 1A14L 3ML9A 5TDPA 1HSAB 1M7DB 1NBYA 3MRJB 1PZAA 4HS8L 3WFBL 3U0WL 8CGTA 2XZZA 2K6YA 4L4VE 3W2DH 3WENA 3PDGA 1K6QH 1JN6A 4Z23A 2PETA 3P4MA 1WIOA 2ODHA 4NKMA 4G8GB 1V3JA 2A9BA 2XZQH 1ZK9A 2AK4D 3FMGL 2QLVB 2RA1A 4IMKC 3WN5B 1QWNA 3OZ9L 1T1XA 2A6DB 4OLWL 1Z0NA 3T0VA 2DLGA 2Z93B 2GFBA 3FRPB 1CZ8H 2F1BA 4P46D 2VLRA 3SDDA 1N4XL 4UMGA 3KH3A 3WJJC 5I1LB 2D2CC 1IE4A 3EFOB 1EBPA 1N2RA 3RVWD 1GTNA 4WUKL 3PJNA 1XD0A 2CK2A 4JW3A 2YA1A 3IEAA 5KTEH 4G7YH 4OCLC 3HNTL 5GRJH 3U83A 4P5KB 2AJ3A 2KERA 3H8NA 4FTVE 3QDHA 2BJML 1PPIA 2QEJA 3IDMB 4N0CD 5T1KB 1TEYA 5DMKA 4QLWA 5EOCJ 1ET8A 5AVUB 1NC4A 1UZGA 2ESVA 3QE5A 1G7HB 4YXHL 1YHPA 2LFEA 1I8KB 3I02A 1KNOA 4L2LA 2HYMA 1D5MB 4FJ6A 3A4AA 3RFZC 3EDKA 2H9GA 2FBJH 2GJJA 4QOKE 5IIEB 1ZT4A 2W07B 5E6ZA 3CVHB 1XH0A 2BLFA 1P7KB 3B5HA 2J8UE 3T71A 2CDEB 5CUSH 4IHOA 1VFBB 3EG9B 4OD3L 1NL0H 4FQ1H 4ZO7A 1FVCA 2YD7A 5HHXH 4ODWA 4WU7B 4IGBA 5HHNB 1VLXA 1MRDL 1RUML 2PW2A 2BO0A 4XNBA 3S4SB 3SKJL 4I9WE 3FF8A 1CG9A 4XOBA 5I1CH 2Q76B 3QEUA 3QO1A 4LBEB 3A6BL 3S34L 3X2QB 3EHBB 2D31A 1A1OB 4UUJA 5DVPA 4LVOB 5BS0B 4RFNC 1RU9L 3LV3B 4C54A 3BPLC 5D7JB 4X7TA 2BP3A 2YMTA 3FU9A 2X2JA 3V7AE 4ZUWB 1BJ8A 3KW8A 2LE9A 3ARDC 2CCVA 1QBMH 4HWBH 4WRLA 1NGWB 3V5DB 4JFEA 4TLKA 2R59A 3LH2L 2Y25A 2QQNL 3B9DA 2JJUA 4LAQH 1J0ZA 2Q7NA 4JG9A 3BAIA 1GGBH 2AXFB 3CN1A 4WHYG 5D93C 3UTQA 5C0JB 1NCAL 3WTSA 1A7RH 4OBSA 4KK8D 1L0PA 3LNHA 4BSVA 3RKPA 1XHHA 4EUPG 5FO8B 1JJUA 2CHNA 3BC9A 5IW1B 3Q43A 2CJSA 3OXRB 3L4VA 4JGJA 2QVMA 5JIQA 3HUJF 3JBG7 2NYKA 3LB6D 5MENA 2C1OB 3RAJL 2BOCA 3O9WA 4K7PY 4P46C 1I3VA 4UQ2B 4DAGH 3BZFA 5T33L 4OCMC 5JLZA 1DSFH 1GL4B 3ROOA 1FN4A 2C3VB 3RVWC 1ACCA 1OVZA 1U30A 1E4KC 5LGJB 4PRIA 4M7LL 5FYKU 2CBQA 3C5ZD 3HE7D 3QNZB 1RUPL 4ZS7H 5A7BA 4H5SA 3MNMA 2NMSA 3FN0H 3L45A 4J3OG 4N0CC 5HGGS 5DTFA 1WF5A 3WO4C 5KBKA 3NDYE 1I85A 3GDCA 5BV7C 2R0KH 1SFHA 1INQB 5JHMA 4P3DB 5T3XL 5IOPA 1D5IL 1WAAA 3EYSL 1QRNB 4X9YA 5JW3L 1X5LA 3O3EA 2QQLL 5ANHA 5GGVY 3WKYA 1UT1A 4B95C 1XH2A 3HB3B 2OMNA 3HRZA 5FECB 4BHUI 9PCYA 1XR9A 4Y9EA 4X0KA 1SJXA 2X4SA 3PNRB 2AC0A 2EVHA 3IGKA 1ADWA 4KXZH 1NCHA 5DEJA 1ETZA 2NXZD 3TO4A 1I9RL 1HVXA 4XP1H 3AXLB 5JXAH 4HUVA 2Y36H 2EC9T 2P45B 2X6UA 2AXGB 3QEHB 1A8ZA 1QI5A 2EVJA 1HFUA 3NDZE 4MNQB 2OMVA 5SWZE 3ZHNA 5EF0A 2NRDA 4CN6A 3UGUA 5FB8B 1P7QD 4WW2C 1DQTA 5IB3A 1DZ0A 1LMKA 3LRMA 4G8IA 4DKEL 2G4EA 4Z7UF 1L0QA 1JSYA 3ME0B 5T1LD 5TPWH 5ABAA 1QFWI 2K9UA 3BKCH 1M1XB 4X5WB 2DLIA 2Y4SA 1QPPA 4L8BA 2CDGB 3VI4F 1RZKC 3BLKA 2Y69B 1BM7A 4XGZA 5FF6A 1CDYA 3LKPB 2P8PB 4WI5A 4JKLA 1E5UI 4UOW1 2FWSA 3CHQA 3BDXA 1OF2B 2DQJH 2EDNA 4P5MA 4YO0A 3CU1A 3GPSA 1X4XA 3LRGA 3ZDXB 1U95B 5ENWB 2JNZA 5L2KB 2YEVB 3TN0D 2B1AL 1ET7A 2JJTA 5IMOA 4IS6A 4J4PA 5HYEA 1I1CA 1WUZA 4I0PD 5E4IA 2E46A 5FO9B 2HXAA 4KK8C 4R4FL 2JB5L 3H2QA 2A74A 2H0JA 4I4WA 1U8CA 4M7ZB 4PJXB 3STZB 5KSVB 4AG4H 1JK8B 5E8NA 5JO5A 2Q6WB 3LB6C 3S96A 3WE1A 1H3PH 3T0EA 2Z4QA 5IHUL 1QVOB 1OB0A 1HE8A 5ETUB 4Z3TA 2FB4H 2JCCF 2XWZA 4KHXH 5B1KA 2DLFL 3QULA 3HUJE 4H2CA 5KVFL 2IH8A 2AJZB 1F4WL 5F3FA 4IOFD 3ARVA 2BSSB 4DN3L 1AGFA 1SJEB 2AGJH 1I1AA 3C5ZC 3HE7C 4KMLB 2NUPA 3EFFA 2CLZB 1IIKA 1ZHNA 3CFEA 1T2XA 5CBAB 4LSPL 3C5JA 4IBZA 1OL0A 1D9KC 2B1HL 3T0WA 1IB5A 4UM8B 2VZUA 4LDCA 5E5LA 5J1SC 1EIBA 5HHOB 2EXSA 5J6GB 3S35X 1QFPA 4X7FC 4Y5VA 4CC0A 4JFFA 3D69A 4M43H 4P3CH 2AHIA 2V33A 4AGNA 3BSZL 3RP1A 2F15A 5T1DH 1TPXB 3OLGA 2Z65C 3L2LA 4LEBA 5DA0B 1I3RB 4DGYL 2JI3A 5KAQG 4FZ8H 5DD5H 43CAA 4YR6A 3MOBL 4TF4A 3LIZH 5BVJB 2NXZC 4AT6A 4Z7VA 1T0NB 3HE6B 4AQ1C 1MCBA 4EZJA 5EU3B 3ZTNL 3L3IA 4J2XA 1QX1A 3LMJL 3RJDA 5C92A 4F9PC 1A9EB 2XJLA 4M03A 2V8LA 4YSQA 3S8FB 1K2DA 2ZD0A 5L88L 3OPZL 4Z7WF 1NAKL 1BW8A 1R5VA 3P54A 4NHCH 3VE0B 4X0NA 3ZIYA 4EI5A 4F1SA 1KIPA 4PIRF 5ELIA 4Z5RA 4IIQA 4JY6A 4N2GA 5GRUL 2AJSL 2XIBA 4X4YB 5CJ5A 3PJLA 1FFQA 1OQOA 3FF7A 3FQ2A 1E2VA 3CVCA 3IFOB 2H26A 4DSYA 4B3EA 4OGZA 4XP6H 4NSKB 1GY2A 2IH9A 2V3DA 1C1EH 2ZAHA 1FIGL 4M9PA 4Z7UE 2X1PA 3KLSA 3LZQA 3DOSB 1DE4B 3V6FA 3M7OA 1ZHBB 2VC2H 1ZWIA 4PGJA 1A9BB 2B9AA 4PJEF 3FUNA 2O26U 5JHAA 4G6JL 3VI4E 3GXMA 3TN0C 2W60B 4UOZA 2MWCA 4LEOA 2X89D 3BEVB 5KVDH 5IVZA 4KKBC 2X4RA 2R0ZH 4HC1H 4I0PC 4X4KA 1P2CA 2VCOA 1QEWB 3K7UA 5FUOH 3OGCB 4QY8A 2CJ3A 3JWNH 5HGHA 3CN0A 1JWUB 4JFUA 4J3OD 3T6XA 4ZMPA 1A6UL 4NN6C 1FZMA 1CO1A 5IHLB 2OA9A 2DQIH 3BD4A 1OOWA 4WNQB 1NIBA 4GG8B 2VLME 3M17B 3T08A 1DP0A 3G9VA 1H3UA 1GKOA 1CFSB 1SQ2N 4M00A 2EDBA 4BV1A 2P8LB 4APQB 5J3HD 1AE6L 5EN2A 4IOFC 1F0LA 2G5BB 3VI3E 4PG2A 4C4KO 4UQIM 3LNEA 2IGTA 4PM1A 4KY1L 1M9SA 2K1MA 1RMFL 2BSCA 3TBSA 4F3FA 1S46A 2FHBA 2ZUQB 5DJDA 5IJBC 3DTUB 1E8XA 1LTXA 2FHFA 4G11A 1ONQB 2AP2A 4YDIH 3KPRE 3LZPA 4L9LA 5H37G 4FEIA 3L1OL 4K3JL 2GCYA 3ARSA 2M83A 3QHTC 3B3IA 2DBLL 2WBKA 2J1XA 1KIRA 1XIWA 2O61B 3FFCA 4IJ3C 2WINA 4QRPA 2ZTBA 1BZ8A 4ORGA 3VFGH 3RURA 2G5UA 4NIYE 2K7QA 5DYOA 4NPJA 3OKNB 1B6DA 5E0QA 1Z9NA 5F1NB 1T89A 1BIIA 4B9KC 1X44A 1HE7A 2F54E 1BCIA 1QATA 2ZKXA 3PGFH 5JW4M 4HPYL 4J3SA 3A6CL 1E6JH 1HC1A 4UANA 1ODAA 5I8KL 2GJ6B 3UBGA 4GUQA 2WM0A 4L48A 1H9DA 2BWQA 4NFDA 4XT1C 3LN4A 4Z7WE 1UD8A 4JFHE 2EEDA 3A24A 3RNQA 4R4BB 2XPYA 4LMQE 2H8PA 3B2PA 3JWNC 4LCUB 5DJYB 4BCXA 3C12A 1Z9MA 2Y2TA