3ARFD

Ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
235
Chain Sequence
VTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 235
sequence length 241
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfD02
1RJZB 3IXAB 3RFZC 5K9JH 3VW3H 5CUSL 4Z7VB 1KT2A 4KTEH 4AG4H 4UQ2B 5MEOA 3KYMA 4ODVH 3MLTB 3UJIH 2DKSA 4EI5B 4YDVB 2VH5H 1XZ0B 5A2JH 1S7RB 4OGYL 1TZGH 5DJ6A 4RA3A 1BFOB 1A14L 2E3VA 2IPUG 3QNZB 4LSUL 3WNNA 1U8IB 3TBYB 4JKPL 1IC7H 4KDTA 4X83A 4I3RH 3MV7B 1TVDA 4M1GH 3FCTA 5KTEL 5CEXB 2EYRA 2BSTB 4OUUA 4PLKD 3T4YA 2QADC 2DQGL 3LS5H 2H9GB 1J7VR 4P0DA 1FZOA 1MCQA 1I85C 1TLKA 5ID0A 5D2NA 1DQDL 2QKIB 3VXMD 3IFNL 5D5MA 1XIWC 4I48B 4YFLF 3BZEB 3MO1A 3P3YA 1I3GL 1GAFH 1MH5B 3AS1A 3V6OE 3TBSA 3SOBH 1OAKH 5F89A 1N3NB 2Y5TB 1YNLH 4LVHB 4PJCE 2D9QB 2Y9RT 4Z95H 2NXYB 4O00A 5DJZA 3OKOB 3V5KB 3GO1H 1AHWB 1AGFA 3L3HA 5C86A 4IIQC 5EZLB 2J5LB 1YEIL 4ZQKA 1P84J 4MNHA 3T0EC 4JEGB 1EAJA 5AEAA 3CC5B 1JK8A 3CAFA 4P4KD 4DOHB 5CILH 3ZYOA 3MLVH 1HN1A 4XNMB 3I02A 5IMKA 1RUQH 3UTZB 1RUKL 5D72L 3OG6B 5IVXA 3MGAA 4U7KA 3E2HC 2NLJB 3FO9A 4HFWA 2R0KL 3SJVE 3T2PA 1INEH 1MCBA 2BOBA 5SV3A 3TCLB 3BUYA 5GS1C 4G6FB 4PRBA 2VLKA 4TQEH 5C09A 1HCFX 2RCSL 4Z7OF 1NEZB 4K7PH 3TBTB 2Q7NA 2A0LD 3UTOA 4KJPC 4PJ8A 2DLHA 2HYMA 5T1LA 1WVZA 1MI5E 1E4XL 3E6FA 1R3IH 3OZ9H 1OARH 2DTML 3R8QA 3FQWA 5IESH 2WQ8A 4MXWL 4QOKD 3T3MF 4S1QL 4EDWL 1KXTB 3L5WA 4GW5B 4MYWB 2FZ3A 3FB7A 4NO5B 2EDJA 1A5FH 1K3IA 1I1AD 3UJTH 5IHZA 3N85L 4ODTL 2C5DC 1CG9B 3CPLA 1HWHB 4KI5E 1EFXA 1N7ML 5HI5D 2XACC 4KI1A 3BDYH 5DR5H 4Z5RA 3MFFA 2OQJB 4L4TB 1SEQL 4G5ZH 3JV6B 3FT2A 2EICA 4M02A 4OZ4B 1WLHA 5FOJA 3VGBA 3WD5H 4XCFH 4PRNB 2DLFL 2AJXH 3SDDB 4Z6AT 1GZQA 4ENED 3L6FB 4WO4D 4MXQD 1B88A 2EYSA 5DQ9A 4MMZC 2NY6B 4OI7A 5C6PB 1JYNA 3GSOB 5B4MD 4NNPH 1AP2A 4IHOA 4GRWE 4S2SB 5F3HB 4JRWA 4LQ1A 1IGTA 4YHPA 2X4UB 1QHOA 4FFZL 5DHXB 4WEMB 3M1BA 1LK2A 3DX6A 1GC1C 3HC0A 1CXLA 4HCRA 1RJZA 3IXAA 3TA3C 1DVFD 4Z7VA 4L4JA 2BDNH 1P5UA 4UQ2A 5D7KE 2R39A 3CH1A 3MLTA 5I8KH 4JGMA 4MJ2A 4EI5A 4YDVA 1XZ0A 4UTBL 1S7RA 3SKJL 2ID5A 3ZSSA 2YUWA 1UJ3C 5E9DD 4E9LA 1BFOA 2D4DA 3ARFB 4YHLL 2OTWB 3B9KD 3MJ9L 3QNZA 4A2LA 5BRZE 1U8IA 3TBYA 1T7XA 1EX0A 1YEHH 2CJUH 3PDDA 3ARTA 4TNWF 1GGTA 3MV7A 4U1NB 3WUZA 4MQ7B 3MBXH 5GJSL 4HIHB 4HH8A 3X11B 1IRAY 5CEXA 2E9IA 2UVFA 2ESVE 2N4IA 2BSTA 3MRBB 4P2QB 1IKFH 3SE4C 2H9GA 4HHAB 2EEAA 1LGVA 2EH8L 5KAQG 1JTTA 4X80H 5H2BB 1I8LA 5GGQH 1KF9B 4W6YB 3DO7B 2QKIA 4YGAB 4TVPD 3FO2A 3BGFC 1VKXB 4WW2C 2XRAL 5HD8C 4I48A 3BZEA 1XGUB 2YK1L 1N59B 3ULVF 3BQUB 3QI9C 4FFYH 4JG0H 1B0WA 4JKMA 5JZ7D 1V7MH 3ARZA 3ILQC 3QB7C 1MH5A 4WWKA 4R7DB 2Q8AL 3AMKA 4RMVA 3MODL 1NL0H 3K8LA 1DBAH 1N3NA 2Y5TA 4M5ZL 4BQBA 3BT2L 4XVUC 4Q9RH 4XVSL 4LARH 4JO4H 4OQTA 4HBQA 5JW4N 5C0CD 5DD3H 1DBMH 3V5KA 2Z35B 1AHWA 1UWXK 3CFCH 4JPVH 5EZLA 4Y5XC 3NACL 1TTFA 4HUMB 1SMOA 4MB3A 3CC5A 2BNQE 3KJ6H 4HQQH 4EKXA 1OTSC 4XNMA 2NR6D 3UTZA 5BO1L 3F62A 4JRYE 2X1XR 1T66D 4K9EL 4Y16B 1U8MB 2NLJA 5CUSH 2ZWLT 3TCLA 2WBKA 4XNQB 3QJFB 5HY9B 5DRWA 4OGYH 1EXUB 4OF3A 1L9NA 5K93A 5KS9F 2CD0A 1BD2B 1A14H 1NEZA 2GEEA 3UYPA 4LSUH 3TBTA 5IHBA 5B21A 4JKPH 5JDJA 4QTIL 4L8BB 1FC2D 2LTQC 1QFWM 1DTUA 3ALWA 5FGCE 3I3BA 1WCBB 4NOFA 4POYA 4GW5A 5KTEH 1WWCA 3H3PL 4OKVB 4NO5A 3S3SA 3MCLL 3VA2C 3R0NA 4R8WL 2DQGH 2HFEB 5SX5K 3KGRA 2EDYA 3ARGC 4HXAL 1BQHG 2IANB 3GIVB 4WU7B 1CG9A 4NZDA 3BVNB 2CO6B 1OD9A 1DQDH 4F37F 2VERN 3IFNH 1CD9B 5J3HD 3QFJD 5FM8A 4D3CH 1EVUA 2EDFA 3G6JE 3SJVB 4WTZA 3OKLB 2OQJA 1I3GH 4L4TA 2DQIL 3RA7L 3JV6A 4BSVB 5DJCB 4P49A 4OZ4A 1NCDL 1T2JA 4OCWL 3W9DB 1NCAL 4PRNA 3QHTC 4ODUB 3SDDA 3WNPA 3AMLA 4U6XB 1MI5B 2NY5C 4P3WA 1SY6A 2V7NA 3L6FA 5CEZD 3VXME 1CK0L 3HB3C 1G6RA 1YEIH 3WLWD 1QSZA 3F7RA 3GSOA 2DKMA 2F74B 2IAMB 5F7LB 1RUKH 2VZ1A 5D72H 4KXZI 3JUZA 4LIQE 4S2SA 5F3HA 2P5WA 4HF5L 2GTWB 2X4UA 3R8BB 2R0KH 3WN5B 5ELIA 4M43L 1QD0A 4PJ9D 1H8SA 4FXGB 1CGYA 1OAZL 3QH3B 2RCSH 4ODBD 1VERA 4TVSa 4M61B 1TFHA 3FQRB 4I0PC 3UTPD 1E4XH 4OZGE 2DTMH 1NPUA 3ARFA 4MXWH 4EDWH 4S1QH 1D5IL 5K9QG 4NCC2 4RMRA 5GS2D 3UCRA 2YPLD 5FHAL 3DGGB 4U1NA 5ITFA 3MLSL 4MQ7A 3N85H 4HIHA 4ODTH 4QNPF 2AEPL 5JHDD 3REWB 1FL5B 3TZVD 2FH6A 1N7MH 3MRBA 4OFIA 4P2QA 4XNUL 2CKNA 3MRQB 4GRWB 2P8PB 4HHAA 2ERJC 5FHBL 2SEBB 1R3HB 5HI4C 3VH8B 4N0RA 3HMXA 5H2BA 1LVEA 1VEMA 5HYQB 2EC9T 1SEQH 3QO1B 3DO7A 1RZFL 1VDGA 1XGUA 1A21A 1N59A 3BQUA 5F70A 4OLXL 2DLFH 4WFFE 3RVXC 3H7BB 1H9VA 3SPVB 5HHOD 4R7DA 1SVZA 1FG2B 1YUHB 1KELL 2H6PB 4K9EC 2PXYA 4M4RA 5BRZB 2NZIA 1PX4A 2Z35A 3N50A 3TBVB 5JQHC 2D9CA 2MSPA 1A7PL 5KSAD 3F65A 3OBAA 2Y23A 3HC3L 2ESVB 2XTJC 2WUBL 4FFZH 2VWEC 2QHRL 3MV9D 3BESR 2AABL 2XPGB 4YFLI 5MEPB 4Y16A 1U8MA 4G6KL 3VRJA 1A4JB 5I16A 2AXFB 3QJFA 5HY9A 5EDXA 1KIPB 4UTBH 2J7LA 1JHKL 2R4SL 3SKJH 1EXUA 5FYJU 2DM7A 5EO0B 4PPTA 1BD2A 3V6OA 4YHLH 5FUOL 3MJ9H 4BUGA 1JF5A 3FQTB 5D7JC 3SE9L 2AK4B 4PJCA 4L8BA 1EHLL 2EC9U 3S88L 2GW5A 1WCBA 2EEDA 5GJSH 3ULUD 3B83A 3VFSB 5GZND 2F5AL 3BH9B 4OKVA 3ULVE 3LKNB 2W60B 2V9QA 2HFEA 4WI5A 4JFYB 4NQVB 2EH8H 2IANA 3GIVA 4WU7A 4C54A 4JCMA 3BVNA 2WMPA 4K2UL 4S0SD 1NGWB 4X6FB 4JRYB 2VAJA 3WS3B 1G7HA 2XRAH 3AGVA 5E1HB 2YK1H 4YJZL 3SJVA 2AQ2A 2AEIT 3OKLA 1CVSC 4DZ8B 1MFAL 2Q8AH 5CP3A 3MODH 4BSVA 5DJCA 4M5ZH 3BT2H 2QEJA 3HNVL 4XVSH 3W9DA 2K3TA 4L9LC 4ODUA 5B3NA 4U6XA 1MI5A 5DRXB 5L7XL 3ZL4L 1I3UA 5FGCB 3RZCC 4LGRB 3NACH 4NN5B 4R6UA 5JOFB 4PG9B 1YMHB 1FO0L 5FKAB 2FB4L 1IAOB 2F74A 2ZG1A 2IAMA 5BO1H 5C1MB 1ZA6B 2HLFD 4JY6B 4K9EH 4OFYA 2GTWA 4EXPX 4WI4A 3WN5A 1WC7B 5DZOA 4CBPA 4HIEB 2DMCA 2VAAB 2HJKB 4XPGL 4FXGA 3G6JB 3I3EA 3TVMD 3QH3A 3GMQB 3MX0A 2AJ3B 2GJ6D 2FX8L 4M61A 3FQRA 1MCCA 4QTIH 3OB0H 4TNVF 5IW1B 4KV5F 5A2KH 3H3PH 3T65B 3MCLH 3ARDA 3VXMB 1EK3A 3UBXB 5MI0B 4R8WH 1CU4L 3DGGA 4HXAH 3P11L 7CGTA 3WXVL 2NY7L 1K8DB 4XPTL 3REWA 1FL5A 4HKZB 3MUHL 3IF1B 3PGCB 1MCWW 1AD9B 2SEBA 1F4HA 3STBA 4EIGB 3VH8A 4HK3J 4R4FL 3SGEI 5HYQA 1YMME 1RZKL 2DQIH 3RA7H 1U8QB 1S7WB 3KPRE 3K8KA 4UV7L 1NCDH 2GJZB 3TC9A 4OCWH 2R69L 1NCAH 2CDGB 5EG6C 3H7BA 3SPVA 4P4KB 3S37L 1FG2A 4OZGB 1YUHA 2H6PA 2HVJB 1RZGB 1CK0H 3NMEA 3QFJE 5AUMB 5J7CC 3DGCR 5BRZA 4LGSB 5FA3A 2QSVA 3V6FA 5J0BA 3SCMD 4HWBA 5HVHB 3TBVA 5JW4M 1NH6A 1CDCA 5J9PB 4HF5H 2ZUWA 1RY7B 1KLUB 2ESVA 1FYTD 4K3HA 3IETB 4M43H 2OX5A 3N1GC 4LFHD 2CQVA 5MEPA 2XPGA 2P5ED 1OAZH 3T4AB 2DWDB 2DJSA 1A4JA 4QXGL 2FJGB 2AXFA 5IMOB 5CGYD 1KIPA 4AEIL 5E6ID 1I1AB 4XC1L 3D18B 5JOEA 5EO0A 1MWAL 5GS0L 1LQSR 4X6DF 2B2XL 2AV1B 1D5IH 4Z7WF 3FQTA 1B4RA 3VG9B 2B8OT 3RTQD 1C7SA 5FHAH 5BQ7B 4MGXA 1XMWA 3MLSH 2YUXA 2FHFA 5EOTB 5SX5H 4U1GB 2AEPH 3VFSA 4YFEA 5FYJL 3QUMB 1Y18A 3RY4A 3LKNA 4XNUH 2W60A 3VMNA 4J4PA 4U6VL 4YDLB 4JFYA 4GXUN 5FHBH 4ZYKB 5HYEA 4N0CC 2BNQA 4NQVA 1G7MB 1DQJB 1EBAA 1EVTC 3D39D 3LEVL 3VXPB 4F7MB 4K71B 1NGWA 1U8OB 5SWSD 4X6FA 4JRYA 3ARVA 3D9AL 3LAFA 5GGRY 3WS3A 4WO4B 1RZFH 4KRPC 3G5YB 3H3BC 3W2DL 4OLXH 5B38G 4S1SL 4DZ8A 4QRSB 1W72L 4Y8AA 5DDHB 1GOHA 1P7KB 2DLTA 2G5BB 1KELH 1EJ6A 4RDQF 3G5XB 3MLWL 1VFAB 3GI8L 4IJ3C 8CGTA 4LASL 1MREL 3QISA 2V9RA 3FHAA 1DVFB 2NCMA 5JOFA 1A7PH 3RWEB 1JYXA 4PG9A 1YMHA 3O4OC 3HC3H 3RVWD 5I74C 2WUBH 1IAOA 4YEFA 4IEFB 5EU7E 4D9LL 3EYFB 2QHRH 3QDGD 5F7WC 1MFNA 1ZA6A 4APQD 5HHNB 2AABH 4JY6A 5E9DB 4AM0B 4G6KH 1NFDF 2ICWI 3B9KB 2NXZC 1WC7A 2OR8A 4HIEA 1YY9C 5IW6B 2JJVA 2VAAA 1JHKH 2HJKA 2R4SH 3G6JA 2WWMC 3NOIA 3GMQA 4PJEB 5FUOH 2AJ3A 2X9WA 3SE9H 2WBWB 4NPYB 2G2RB 1T4KB 1EHLH 3S88H 1LILA 5DMGC 1I3RB 3Q3GB 3T77B 3WCYA 2H2PD 5IW1A 4NFBA 5EN2B 1S3KL 2F5AH 3T65A 5AG9A 2GT9B 3VXMA 1NAML 4NQUA 3AVEA 5EOQL 3UBXA 3BEWB 1KGCD 3QCUL 1K8DA 1ZGLB 5DVOA 4HKZA 5E5UB 4K2UH 3PGCA 3IF1A 1AD9A 4F7EB 1OLLA 1XEDA 5C0CB 1MFAH 3DVIA 3K2MC 1U8QA 1S7WA 3SDCD 3OXSA 1T0PB 2GJZA 3QIBB 4HEME 3HNVH 2CDGA 4XI5C 4P4KA 1CWVA 2PKDA 4PLOB 2F15A 1KIQB 5L7XH 5DC0A 4OZGA 3ZL4H 5JW5B 1YZZA 2HVJA 4HAFA 3V6BR 2MMXA 1RZGA 4G6AD 5AUMA 1FO0H 2FB4H 3B5GA 5FYKU 3S35L 4CVZB 3WKML 3NAAL 1EA9C 2OXHA 5GS0C 1L9MA 1RPQA 5J9PA 4NBXB 4LNVA 1KLUA 4Y5VB 1EJOL 2UWEF 3IETA 4UTAL 1CFTB 4XPGH 2DLGA 3TPUB 5DZLA 3VXQB 4B5EA 3T4AA 1YMMB 2DWDA 4Z18A 3KPRB 2FJGA 5IMOA 2FX8H 3SO5A 1N0LA 3D18A 1WTLA 1FAKT 1M05B 1ACYL 4XHJD 3WNMA 2AV1A 4X7TB 4RZCB 1LO0L 4M4PA 3UDWA 5BQ7A 3QFJB 4N8VA 2Z92A 1CU4H 1SJHB 3P11H 1ZANL 3WXVH 2NY7H 3C09C 4JHZA 5EOTA 1IFHL 1IARB 4XPTH 5J12B 5FGBC 4LHJB 2NY1D 3QUMA 3LRSB 2VYRE 4N0YL 4PRDB 4ZYKA 1Q8MA 1TQBC 5E0QA 1G7MA 1DQJA 4R4FH 3VXPA 1H5BC 4F7MA 1RZKH 4RGNE 1U8OA 5J4MA 2B4CC 3O45B 4UV7H 3NH7L 4WO4A 3RY6C 2GK0B 2R69H 3G5YA 4RBPK 2VZTA 4RA0C 2DICA 3FQXB 1UB6B 1T1ZB 4QRSA 5GRWA 3S37H 5DDHA 3PWUA 4D94A 1P7KA 5LBSL 2G5BA 5TFSL 3G5XA 2DQHL 2IPKB 1VFAA 1ZHLB 1NAKL 3B3IB 1S7VB 1X6LA 1FSKC 1BZ9B 4PJ9B 4QHMB 2QV2A 1B2WL 5KZCD 1DVFA 1RK1B 3R06A 4KKBC 3DVNB 1ZS8B 5I6XC 3EYVB 1JMXA 1CZ8L 2A9NL 4X6DE 2KBGA 5C08E 3EYFA 1J10A 2X7LA 4AM0A 5E9DA 3W5MA 1MJ8L 4M6ML 4HUUA 3TN0C 3EJZD 1KPUB 4QXGH 1G9NL 4RRPA 2YPLB 5IW6A 2Y1VA 4OM0L 4AEIH 4XC1H 4TTGA 1HHHB 4ACPA 1GOGA 1MWAH 5GS0H 4PJEA 1WZKA 2H32B 5EB9A 2B2XH 4Q6IC 3TZVB 1T20B 3A67L 4U33A 1FYTE 3GKWL 4NPYA 2BOCB 1T4KA 4FZEL 1E4WL 4JQVC 5KJRL 1I3RA 3Q3GA 3T77A 5I0ZA 2J8UF 1X5GA 5EN2A 5FUZL 3VDCA 5FYJH 4CMMB 2GT9A 4N5EC 4I8DA 1FZJB 1L7IL 1UCBL 2YRLA 1O7SA 4U6VH 3BEWA 5D8JL 2IBZX 5I18L 4F8TA 1ZGLA 3LEVH 5E8NB 4K8RL 4MVBC 2F8VA 1CGXA 3KDMB 4XPBL 5D1QD 3QYCA 4JZJC 3I6LE 1CE6B 3V0WL 3W2DH 4S1SH 5C0CA 1KENL 3RGHA 2DAVA 1W72H 2DIJA 1T7YA 3QIBA 1H3TA 3HS0B 3MLWH 3DYMA 5KSAB 3HE6D 3GI8H 4NC1E 1DQML 4LASH 1MREH 2VUOA 1M1SA 3BMVA 1NFDE 1KIQA 5JW5A 5SWSE 3MV9B 1FGVL 4WGVB 5ADPL 2LVCA 3P4NB 4HGMA 4W4OA 4CVZA 4D9LH 2J2ZA 3MV8D 4Y5VA 2EDLA 1DCLA 3KPOB 3N9GL 3VXQA 1A6AB 5FYKL 4WFED 4YHOL 3U0WL 1YMMA 3IB4A 5K9KB 1LK3L 4PREB 3KPRA 2VDML 4HIXL 2I5YH 3IDYB 4WEUD 1ODAA 5TF0A 4JGJA 1M05A 1C1EL 5CS7A 1D6VL 4X7TA 1S3KH 3EDJA 1MFBL 4RZCA 1NMCC 5DSCB 1TZHB 1LDPL 1NAMH 5EOQH 3QFJA 3QCUH 1SJHA 5JUEL 3JTSB 2C4FU 3QEQD 4LIQL 1A1MB 3LRSA 1EBPA 4M8QB 3FAXA 4PRDA 5CD5D 2WBJC 2VNCA 1S7SB 1NEZG 2IMNA 4MZ3A 4J3OC 1D6EB 4TNWK 2BFVL 3DHJA 2X05A 1Q9LB 3O45A 3QUXC 4YZFF 2APFA 3SDAC 2GK0A 1K8IB 3FQXA 5E4EC 1T1ZA 1IGJB 2DI8A 2UWEE 1NCTA 1EIBA 2WQRA 1DQLL 4MAYC 2IPKA 4K3EL 3B3IA 1S7VA 5E2WL 4P57B 3ARSA 5GGVL 1BZ9A 3S35H 4PJ9A 4OAWB 3NAAH 1BREA 3LH2L 4QHMA 3WKMH 3TVMB 1RK1A 5I1GL 3DVNA 1ZS8A 4MX7B 5EU4B 1KTRL 3EYVA 1U6AL 2Q20A 2GJ6B 5F7EL 4ONOA 5E95B 1PSKL 5ENWB 3VXUE 4I5BB 1LMKA 3PL6D 4RGNB 4XX1G 2KPNA 2YPLA 4P46D 4XB7A 2YD2A 1HHHA 1ACYH 3TF7C 5IVOA 3TZVA 1T20A 3ARPA 4BQCA 1LO0H 4EQ2A 2BOCA 4LSPL 2IH1B 4RMWA 4D0BB 3Q6GL 1ZT7B 3OWEA 1ZANH 3RIAF 1FFRA 5E1AB 1IFHH 5DF0A 2XI9A 4PRAB 4CMMA 1FZJA 5HVFB 5I71C 3F58L 4N0YH 2MCG1 4LVOC 1A02N 2GK2A 1JIBA 1MFCL 3BZ4B 3O6LL 1G9ML 2AERT 5E8NA 5C08B 1L4IA 5E8OB 3KDMA 3NH7H 1MHCB 1CE6A 2YD6A 2WWKO 3QUZC 3SCMB 5LBSH 4BUHA 4HC1A 3MJ7B 1MUJB 1T5WB 3QR2A 4KXZH 5TFSH 5DHVH 3HS0A 2DQHH 1I9JL 2F5BL 5KSAA 1NAKH 3AFLA 1FYTB 3O9WB 4OGAD 4RISL 1UZ6F 3MV9A 1B2WH 1HDMA 3ULVL 1YQVL 2VSDA 5IWLC 3FQUB 5DGQA 4M7ZC 1IE5A 4GJTB 2V5SA 1R5VB 3P4NA 4LRIA 4PB9L 1VFUA 1CZ8H 2A9NH 3IKKA 1R5IB 5E6IB 2FGZA 3WLBA 1QLEL 2C9AA 2D03L 1MJ8H 4M6MH 5CINL 4XPFL 3DOSA 1G9NH 3RTQB 3KPOA 3FN3A 5EWIL 1DLHB 4OZIF 1A64A 4OM0H 1O5DT 1DBJL 3EW3B 2FSEA 1AIFA 4PREA 3A67H 3GKWH 1B6DA 3GSRB 4FZEH 4FZ8L 1X4YA 1E4WH 5T1DL 1S8DB 2O5ZL 3UEZA 5KJRH 4P2OA 4NN6B 3NPSB 2B7DT 5FUZH 5DSCA 5SWSB 1TZHA 4GAFB 1L7IH 1UCBH 1C5BL 4P59L 3IRPX 5D8JH 5I18H 2FBOJ 5GGUB 3JTSA 4K8RH 4K94C 2MKLC 4M8QA 1DBBL 4XPBH 1CXEA 2V7HA 4NKIL 1S7SA 1II4E 3PP4L 2C1OB 4PGCB 4O58L 1X3DA 4YK4C 3V0WH 3ZKMD 1BP3B 1KENH 1Q9LA 1QLFB 1F58L 3GNML 2NY3C 5CWSB 3M8OL 5I75C 1K8IA 1NGZB 1DQMH 4G6JH 5BVPL 1IGJA 3MXWL 3T8XB 3V5DB 1HXYA 1UKTA 3QDGB 5D93B 3QXWA 4APQB 1GOFA 5GJTL 1MAML 4LPYA 4YX2L 4P57A 3FT4B 4X7FC 3W39B 4RGMC 4OZHF 2VJXA 5A43C 4OAWA 3QDMD 3TVMA 3WFCL 4AEFA 4MX7A 1RJYB 5EU4A 1BZ7B 2QBWA 1GH7A 2GJ6A 5JPMB 1YC8A 5ENWA 4I5BA 1I1CA 1TZIB 3N9GH 3E0GA 5BJTB 4KVNL 4YBQC 1YJDC 5FYKH 2BXZA 4YHOH 2XICA 3U0WH 4U0QB 3PF2A 1MLCB 3RL2B 2NY4D 3GBNL 1LK3H 3VWKC 2VDMH 4HIXH 3MBED 3D85B 3BHBB 1Q9WB 3BN9C 1G9MC 1C1EH 2J6EA 1D6VH 1MFBH 5T3ZD 1OVZA 1LDPH 2VR9A 5GQBA 2IH1A 1G7LB 3C5ZC 4D0BA 5LWYL 1ZT7A 3ARYA 3V79C 1V05A 3F7QA 2K7PA 1RI8A 3WFHB 5JUEH 4YZFE 2NX5D 4O02L 5EZOL 1E4KA 4PRAA 4LIQH 3PQYD 3SDCB 1Z2KA 3QEHB 1X5FA 3BZ4A 4N9OB 3EJYC 2BFVH 5C08A 3D1MC 3VXUB 1K2DB 4JG1L 4FQPA 5E8OA 3GSQB 1PY4A 1MHCA 3MRPB 5F7HA 3K46A 1WF5A 2EEBA 3DVGB 1UVQB 3GB7B 1C08B 1MUJA 1T5WA 4JM2D 4ZFOB 3VGAB 3WIHL 3V4UL 1DQLH 2DQCL 4Q0XL 5MERB 1ZV5A 4C58B 4K3EH 3HAEB 1FYTA 5E2WH 3O9WA 5TPWL 3K1DA 5F96L 5GGVH 2GITB 2VDPL 3FB5B 3T09A 3SBWA 4UBDC 3LH2H 5DGRA 2R4RL 4YXLL 5TQ2L 3FQUA 5D7IF 5I1GH 2JB6B 1R5VA 4TSAL 1U6AH 1FNAA 2YWZA 5SWZE 3N1MC 5F7EH 1PSKH 1R5IA 5E6IA 4HG4J 4DQOL 4Z7UE 4Y2DB 5MHSE 2IF7A 5I9QC 3RTQA 2DQEL 1BFTA 1DLHA 5CJXC 1U0QA 4FFWD 3H9YA 1DN2A 1EZVX 4XXCC 2DM3A 2NY1B 2XV6B 4CVUA 4RFNB 5HHPB 1CFVL 3GSRA 4LSPH 3A0OA 4L3ED 3LKRB 3Q6GH 1S8DA 2C26A 3O6FC 4EDXA 3OGCB 3NN8B 3SGEH 5SWSA 3MLPA 4JDTL 2P24B 4X5XB 5T33L 3F58H 2PCPB 2ZSVA 4DJMA 5GGUA 5T1MB 1MFCH 3O6LH 4MQTB 4OFVA 5IBUG 1G9MH 2N56A 4TNVK 2BVPB 5EUOF 2VZUA 2C1OA 4D9QD 1QLFA 3EZJB 3SGDI 4KUZL 5CWSA 4KFZC 3RP1A 3QNYB 5KZCB 4XCNB 3B2UC 3WNKA 1I9JH 2F5BH 1I7TB 1AQKL 1NGZA 2DIBA 3OF6D 3QJHB 4J3SA 3H2WA 4RISH 1R0AL 3T8XA 1I75A 3V5DA 3VE0B 4D8PB 4WUUE 4APQA 3ULVH 1YQVH 1PFCA 4PB0L 1R3LB 4O2FB 4HV8B 2XKNB 3OKKB 3FT4A 4PB9H 3W39A 1C5DB 4P99A 4JRXD 3WDJA 3HA0A 1RUPL 1QLEH 2D03H 2AW2A 4LP4A 2NZ9D 1RJYA 5CINH 4Z7NF 3L5HA 1BZ7A 4LKXA 4XPFH 5JPMA 3S97C 2YC1B 5EWIH 1F4XL 1TZIA 5HYJD 1OOAA 4G9FD 1DBJH 1CGUA 5BJTA 3KJ4B 3RDTC 4TRPL 1MLCA 3RL2A 2E5EA 1KOAA 2R0WL 1ZVYA 2I26N 4FZ8H 4F2MA 2VMFA 5T1DH 5I1DB 3D85A 4WRLA 3BHBA 2JELL 5HDOA 1Q9WA 2CK0L 4KUCF 5E24E 4KK8D 1CXKA 1QYGL 4KRLB 3KPMB 3KG5A 5D1QB 1G7LA 3U2SB 1C5BH 4P59H 1E6JL 2X4PB 4TUOB 2DQUL 3TN0D 3RAJL 2JJTA 1Z9MA 4PY7B 1X9QA 5DD0L 2KL6A 3SDCA 1DBBH 3QEHA 3PXHA 4NKIH 3HE6B 3PP4H 4MHHI 4O58H 4B7LA 4JJHA 3PNWB 2AS5M 2ADIB 3VXUA 2W0FB 1K2DA 1F58H 3GNMH 3GSQA 3M8OH 3MRPA 1BPVA 5J11C 1U42A 3RWHB 5DXWA 3DVGA 3DX7B 1UVQA 5BVPH 3GB7A 1C08A 1D9KC 2ITCB 3MXWH 3UBXG 5GGSB 1QSED 5A40E 4ZFOA 4V2BA 3RWIB 4X8XA 5MERA 4WEBL 5GJTH 3MV8B 5DQDL 1CDJA 1MAMH 3FT3B 3HAEA 1CL7I 4YX2H 5FDWB 2GITA 3FB5A 3WFCH 1JHLL 1PY9A 4NO3B 2JB6A 4QGTA 3MCKB 2VIRB 4KVNH 1PG7W 4PRIE 4Y2DA 5DO2D 1JN6B 3GBNH 3CXDL 2KZ1B 3VD3A 1MHEB 2P8MB 4KDTC 3JWOL 4IRJD 1ZLUK 3QEQB 1MVFA 5HHPA 4NZTL 5CIPB 1A6ZB 2F8OA 4PG2A 3LKRA 5LWYH 3OGCA 5EU6E 3NN8A 1T22A 4O02H 4Q58C 5EZOH 5D2NC 4UMGA 2P24A 4X5XA 2PCPA 5D6DA 2MCPL 5T1MA 1W0WB 1UA6L 5JIHA 5HI3D 5HHQB 2LABA 4JG1H 2BVPA 2E9WA 4Z7UB 3HUJE 3MREB 5LGJB 5C0BE 1BQLL 4BZ2L 4NN7C 4LDEB 3MZTA 5D7IE 3VXRE 2HFGL 1KTLB 5HYSB 4N8VG 3WFBL 3PQYE 3WIHH 4XCNA 3V4UH 1X5AA 5JNYB 2DQCH 2DF3A 4Q0XH 5KW9L 4J23A 4P3DB 2RHEA 3QJHA 4D9RE 1Y6KR 4QXWA 4A6YB 5TPWH 4M6NL 1C16B 1CLCA 5F96H 2OMBA 2VDPH 4D8PA 4R96B 1L0YA 2R4RH 4RWHA 4YXLH 5TQ2H 1EV2E 3U83A 3PL6B 4O2FA 4HV8A 2XKNA 1U95B 3OKKA 4OF7A 4TSAH 1C5DA 1NCUA 2FHBA 4P46B 3SDAD 2CRZA 4PJFB 1FNEB 4DQOH 4GQPH 3KLDA 2YC1A 2DQEH 4MAYD 2P49B 3S4SB 3U9PL 2R1WB 5F6IC 1HNGA 5E7BA 2I60L 4DGVL 1ZHKB 1Q9KB 3JSSA 4X4XB 3RVVD 5DFTA 1CFVH 4F15B 5I1DA 2ICEB 4LF3B 5EUOE 5FM5O 3HMWL 2XKSA 3WEXB 3KPMA 2VL4A 5C0FB 4JDTH 4WV1A 5T33H 5C6WH 2X4PA 4TUOA 1ITBB 4YQXL 2MQ0A 4RRPG 3P2TA 3IDIB 3HE6A 4L3EE 3EHBC 2ZCKL 3PNWA 2M8XA 1WCQA 2ADIA 2V5TA 2XFXB 1MF2L 2W0FA 3U46B 2R9HC 2VN7A 3REVB 2OJEB 3FO1B 3NZHL 4KUZH 4FN0A 3RWHA 1AQKH 2IADB 5GGTA 3DX7A 1R0AH 2ITCA 5GGSA 4Z7NE 3N0PB 3QA3B 3RWIA 1F4WL 2XXMB 4PB0H 3FMGL 3FT3A 4M9OA 4CW1B 3OAZK 5FDWA 1FFOB 3FRPA 1QPXA 3IU3B 1RUPH 3QG6B 3CIQA 4NO3A 5DC4B 4WFHE 3OJ2C 1ADQA 3WO3B 2WWKT 4EI5C 1Z5LB 2GKIA 3MCKA 4H25B 1F4XH 2VIRA 4NUGL 3VDBA 1M71B 4TRPH 4HLJA 5D7LD 1JN6A 3TYGL 1MHEA 2P8MA 2R0WH 1TCRB 2VTFA 4LAQL 2JELH 2CK0H 5F9DC 4HIIB 1QYGH 2J4WL 2CUMA 4OFPA 5J89A 5CIPA 1A6ZA 1E6JH 1B0GB 5LVEA 2DQUH 4FQXD 2JJSA 1RHHA 1T6WA 1WK0A 4GS7B 3RAJH 2F19L 2NY2B 1I8LC 1MIEL 5DD0H 3OB8A 4RMSA 1JNLL 4XAKD 1FNGB 2HH0L 5HSFA 1W0WA 5F88B 4PP1C 5HHQA 2OL3B 2VLRE 1NDGB 2VZ3A 4LVHC 4Z7UA 1BBDL 2EZ0D 3CFKA 3WJJA 3MREA 3B6SB 5LGJA 2NXYC 1MQKL 4OBRA 2EKSB 2H3NB 3BE1L 5HYSA 1KTLA 1AHWC 3QDMB 1A6TB 2C1PB 4OLZL 2J5LC 5JNYA 4K7FB 4KVCL 4WEBH 4P3DA 5DQDH 2ZJSL 4A6YA 5KSBE 3PGDB 4ZO8A 3SGJA 1C16A 4WIQA 4R96A 5EU6B 3CX5K 5C0JB 4ZO9A 1JHLH 3I6GB 3PL6A 1U95A 5DVKA 2XY1A 3ZHKA 5FEBA 2D7QA 3VMOA 4P46A 4PJFA 3MBEB 1FNEA 1BOYA 1YY8B 1HHGB 4UB0L 3TIDB 3DI3B 3CXDH 4JY4B 1IGIL 3LEYL 4XNXL 3HUJB 3JWOH 3S4SA 2BVYA 2R1WA 3LVEA 5C0EB 1HKFA 1ZHKA 3VXRB 1Q9KA 1U3ZA 2WINB 4X4XA 4FQHB 4CMHB 1FGNL 3PQYB 4NZTH 1J9CT 4FG6D 2ICEA 4MS8D 3O0RL 4LF3A 1MNUL 3WEXA 5FK9B 4LEXL 4FQQA 4LCWD 4PV8B 4J3TA 4TN9A 4MA3B 1CICD 2OJZL 3EYQC 2MCPH 3P4MB 2VXVL 2D7TL 3GSNB 1UA6H 2A74B 1JPTL 3RX5A 5LQBL 4OF0A 1YPZF 5J13B 3WV0A 2ZG3A 4JM2B 2YOCA 2Q3AA 4ORZC 3IDIA 3PWLB 2G5RA 3PE9A 1BQLH 4BZ2H 3SDDC 4EUPH 4XTRC 1J1XL 2XFXA 3SE3A 2VE6B 2HFGH 3U46A 5IBTL 3WFBH 1T0MB 1L6XA 3FO1A 1F11B 4KTYA 5TE7L 3HRZB 5KW9H 3NCJL 1FCCA 2IADA 2Z4QB 3O3BB 4F7PB 2NY6C 3RVUD 4M6NH 3LPFA 4YHNB 3QA3A 1G0XA 3TT3L 2LFGA 3VA6A 2OXGA 4FP8L 2EDBA 1WBYB 3LB6D 4P5KB 4CW1A 1U8PB 5F1SA 1FFOA 3BX7C 4MNQE 2V2XB 3IU3A 3QG6A 4NQDE 1S5IL 4ELKB 5JR1L 2EXYD 1XF5B 3PWNB 2R2EB 1UM4L 1GGBL 4I13B 1Z5LA 4H25A 2X1OA 3K74B 4L3EB 3U9PH 2ARWA 4AT6B 3BKYL 3LQAC 4Y4HD 4ZFGL 5B3JE 2I60H 4DGVH 2EECA 3SKNA 4ZD3L 1E27B 4MXVF 1MJJB 1TCRA 3ZE1F 4HIIA 3KYKL 3QXVA 3HMWH 1A3RL 2EDDA 4YFDB 4DTGL 2NW3B 3PIQB 5TDNB 3NCYS 4H0IA 1B0GA 4YQXH 4X7SL 4WNQB 5A3IC 2AK1L 4YNYB 5CSZA 1FCGA 3QZWG 3BRFA 1FHGA 3MJ6A 4F7TB 1FNGA 3OSKA 1JPGB 5EU5A 3IDGB 1JE6A 3BQUC 5IJKC 2B5IC 1U8LB 2CKBB 2ZCKH 1IGCL 5F88A 3WO4B 5A2IH 2OL3A 1MF2H 1NDGA 1X5JA 4U2YA 3NZHH 4WW2F 3CLEL 4YDJB 4CU6A 4PRIA 4RMQA 4U3HA 3B6SA 3BJLA 2EKSA 2H3NA 4QT5B 1FORL 3QDMA 4JRXB 2C1PA 3GJFK 1EEZB 1F4WH 4K7FA 2V17H 5JDSB 5F8RC 3FMGH 5CJOL 2X4SB 3SO3B 3FOLB 4OV5B 1L0QA 3OJMB 5HYJB 5EU6A 1KTDA 5C0JA 2VL5B 4Y16C 4MD0B 3I6GA 3I6KB 4KROB 4NSKB 4DAGL 4PJ7E 4X6EB 3ARBD 3MBEA 1K85A 1OQOA 1QR4A 4NUGH 1YY8A 3QQ3B 1HHGA 3IRZA 3TIDA 3UP1A 3TV3L 4K7PX 4B0MM 2VLRB 4JY4A 3TYGH 1RK0B 5E6ZA 3HUJA 4LAQH 1JRHI 5D1ZB 1J0KA 3BP7A 5C0BA 3VFRB 5C0EA 5D7IA 3WXWL 5GRVK 5INCB 4CDGC 3VXRA 2WINA 2J4WH 4FQHA 1A3LL 3PQYA 3S9DB 2NMSA 4W70A 2ARJB 2EYTB 4OLUL 4ZO7A 2PR4L 5CSBA 4NRZB 3RI5F 4NKMB 3B2VL 5KSBB 4XPHL 2F19H 4E0RB 4XWOD 2YZ1A 2Z8VC 1ITCA 1MIEH 5D7LE 5F1IB 5FK9A 1SHMA 2W65B 4PV8A 1JNLH 3CFJB 3RDTD 1EGJA 1FIEA 2HH0H 4MA3A 2R0LL 3IVKB 2DLIA 5A16B 3P4MA 3GSNA 2A74A 1A7RL 1U8NB 5ISZE 4F3FB 4Y4KA 2I9LA 1P9MA 4JM2A 1CXIA 3TFKD 1BBDH 5TJWK 4DKDC 3WBDA 4AH2B 1FFNB 5HGHB 3PWLA 1CL7L 1MQKH 5CSGA 3BE1H 3QXTA 2VE6A 3U1SL 1NGYB 1T0MA 4X9BA 4OLZH 1F11A 3HRZA 4KVCH 1H15B 1NMBL 2ZJSH 3O3BA 4P9HC 4F7PA 1BX2B 4YHNA 4G3YL 2IAMC 2V5RA 1ND0B 2CO7B 1WBYA 4OGZA 3OHXB 1MIML 4KI5C 1U8PA 4P5KA 3CU7A 3EYOB 3WN5C 5KVGL 4YBHA 3OKMB 3EZ8A 4P2YA 2V2XA 1KJ2B 4NYLB 2D7NA 4IRJB 4UB0H 1GYAA 4Q9CA 1D9KD 1XF5A 3PWNA 3S5LG 2R2EA 4Z76B 4K07A 2F53E 4C56D 4EUPG 3NCMA 4XNZB 1IGIH 3LEYH 4XNXH 5DK3A 5CJBA 5FO7B 4L3EA 4HXBL 2Z31D 4AT6A 2A6JB 4NWTL 1MLBB 5EO9B 4RAUB 3V95A 3O8XD 1OW0A 4ZDHB 1E27A 1MJJA 1FGNH 4IMKA 5GRVL 3QPQC 3BYTA 2D2OA 3NA9L 4BM7A 1CCZA 3O0RH 1MNUH 4DUWA 3X3FL 3BPLC 2Z9TA 5BZDB 4LEXH 3JVGC 2BERA 3PIQA 2NW3A 5TDNA 3C9NA 2QLVB 2YD8A 1EO5A 3DX8B 4G43B 2OJZH 4KKCD 2VXVH 2D7TH 4WNQA 5LQBH 3VI4F 1JPTH 3WL9B 2IWGA 3DUSB 4YNYA 3CZJA 4LCUB 4HGKC 4NQDB 4F7TA 2ZZUT 1JPGA 1S7XB 2AJVL 3IDGA 4X0KB 5HVWA 3H9SE 1U8LA 2CKBA 3OF6A 1NUNB 3IT8D 1J1XH 4Y5YB 5IBTH 4LCWE 1D5BB 4U3XA 4NHCL 4YDJA 3BZDA 5TE7H 3S6CA 3NCJH 1Z3GL 4ORGB 4R4NC 2P47B 1MOEA 2VDLL 4KMQA 4JAMA 4Y7MA 4QT5A 3RVTD 1IAII 5DJXB 5F1OB 3TT3H 1EEZA 4FP8H 2W07A 1PEZA 1TVHB 5JDSA 2FRGP 2X4SA 3FOLA 3LDBB 4ZUTA 1U3HB 4XGZB 2D7MA 2NNAB 2PF6A 5HYJA 1MCOL 3MMEB 1WITA 4MXVE 1S5IH 2R15A 4MD0A 3T2OA 3I6KA 5JR1H 3ZE1E 4NSKA 4I9WD 4X6EA 1UM4H 1GGBH 4HJ0D 5IBLC 4LCIL 1ZE3C 3K4AA 1OQXA 4P2CG 1UJTA 3E3QE 3P4LA 4ZS6C 3BKYH 3O6ML 1QZ1A 4ZFGH 1BQHB 4CDHA 2XG4A 3M17B 2VLRA 1CTOA 1H3XA 1KCVL 4ZD3H 1RK0A 5D1ZA 3VFRA 3L7EB 1V7NL 3KYKH 5INCA 5JMRA 1RURL 1A3RH 3MRJB 4DTGH 3FRUB 2ARJA 2EYTA 2VLKD 3H3KA 4J4PC 1FRGL 3FL7A 4NRZA 4LQFL 4NKMA 5FECB 5KSBA 5I8EB 4IOFC 4X7SH 4E0RA 2AK1H 4PJ8D 5F1IA 5T1LD 3HZYB 5F9WB 1CIDA 2W65A 4XHQA 3O3AB 3SGDH 3CFJA 3EGSB 4PY8I 3IVKA 2Y5EA 1WJ3A 4NNYB 4PJ7B 1UGNA 4HUKB 4PIRF 1IGCH 4M1CC 1U8NA 2OS7A 2B0SL 5F93C 4YBLB 5BS0E 1NGXB 5GRZA 3KPPB 3A6BL 1PDKA 3CLEH 2YR3A 4AH2A 1J0HA 1FFNA 5HGHA 3RNQB 2R2CA 1P69B 2ZG2A 4PRPE 4CAGA 1FORH 1NGYA 2YA2A 4H8WL 4NNXB 4FABL 3S8WA 1BOGA 2Y25A 3J7HA 4KKNA 4NN5C 1H15A 3EYSL 4GUPB 4OZFH 4PJXF 3VJ6B 3FZUD 4JFHD 4DUXA 2DS4A 3F6LA 5JA9A 1ND0A 4XRCB 2WK2A 3OHXA 5D7LB 4KTDL 3V4PL 3EYOA 4DAGH 1UC6A 2R9HD 3OKMA 3KPNA 1JNHA 2FBJL 3MLRL 1A7NL 4NYLA 4Y4FB 2DLEA 4IRJA 4PJBB 3ZDXE 4E41D 3TV3H 4Z76A 4UT9L 4QWWD 4PLKC 2GYSA 3JBG7 5FO7A 5JA8B 1U41A 4XWGL 2A6JA 3NCBB 3CNKA 1P7QD 3HAEG 1MLBA 4FQXB 3MV11 4IIQB 5EO9A 3CMGA 3WXWH 4RAUA 4JANB 4ZDHA 3GKZA 1A3LH 4G80B 5MI0C 5HDLA 4MA1B 4OLUH 3FOMB 2PR4H 2E7LA 3ARWA 3BMWA 2D31B 3B2VH 2P46B 2WNGA 3C2AL 4XPHH 2F58L 5BZDA 1DR9A 4LKCA 1GZPB 3CD4A 1JCKA 1W0YT 4Z0XB 2E9JA 2HKHL 4FQIL 3RZWA 1WQVT 2R0LH 4XVTL 4P23B 3VCLB 3NA4A 4B53A 3IDJB 1A7RH 3WL9A 3DUSA 4GMSL 1IVLA 4LCUA 3MV7D 2HT4C 4NQDA 4PD4K 2AXJA 2X4TB 2H2SD 1S7XA 4TVPL 4X0KA 1IC4L 1CL7H 2F53B 2WLYA 1JPST 9CGTA 4P4KC 2ZCLL 4NZUL 4Y5YA 2R56L 2IJ0C 3U1SH 1D5BA 4WJ5B 4TUKL 5C07D 2ZOLB 1QRNE 4ORGA 5C6TL 1NMBH 2F9BT 3DPBA 3WNOA 5I17B 1RIUL 2LQRA 3SKMB 1T5XB 1VGKA 5DJXA 4G3YH 5HVHC 1HCVA 4U1MB 4YO0A 1LO5B 3TBWB 1TVHA 3C08L 1Y0LB 4WWKD 1MIMH 4NRYB 4ONFL 5DA4A 1U3HA 2A0LC 4XGZA 2OR7A 2NNAA 2MKWA 5F6HJ 3WUWG 2VSCA 3MMEA 4OIAA 3PV7A 4F57L 4NQEE 5C0AE 4O5LL 3FN0L 1UKQA 4ETQB 1I1AC 4HXBH 3H9SB 5C0RL 2PW1B 4NWTH 1BQHA 3LPGA 3N1QC 2ZOKA 3M17A 1OT2A 4LCWB 1ZTXL 3UDWC 3ZKXB 3VI4E 5FYLD 1K4CB 4JFDD 1CICB 3L7EA 3AXLA 2BY3A 3NA9H 2W92A 4U1GC 3X3FH 3MRJA 3FRUA 2W9DL 4JQXA 5FECA 1NANH 1OTTD 5I8EA 2XZQL 1UG9A 3UZVB 2FO1A 1T04B 3HZYA 3RKPA 2VLLA 2L7UA 4M3JA 3O3AA 5F6HI 3CDYA 4ENEC 2HTKD 1NLBL 3EGSA 4WO4C 4MXQC 2AJVH 3X13B 2EDEA 4NNYA 4PJ7A 1U93B 1R6VA 4WCYL 4YE4L 4HMEA 5EBGA 1VGEL 1NGXA 5BMFL 5KVDL 3KPPA 2I25N 4NHCH 4N8CL 4LLAA 3SEPA 1Z3GH 3RNQA 2VDLH 4GO6B 5C8JB 5KSUB 4L1HA 2FEEI 4NNXA 5CEZL 3CX5J 4NM8L 1DVFC 3O2DL 2EKJA 3RUGE 4P3CL 4GKSB 4GUPA 3VJ6A 5D71L 4RMUA 1MCOH 2FNBA 4KKLD 4UIMB 4XRCA 4Y4HB 4IRZL 3BEVB 2BNRE 5D7LA 3B9KC 4XTRD 3NCEB 3STZB 4L1DA 4LCIH 1A8JH 4Y4FA 1MAKA 1OP5K 3O6MH 4PJBA 2NY6D 5ISZA 5BS0B 2PYEE 1KCVH 4DK3A 2P5WD 3ZT6A 4IIQA 4FQXA 1V7NH 3P73B 1RURH 4JANA 4PRPB 2XQBL 4G80A 3AM8C 2EDXA 1FRGH 5DFVC 2D31A 5JZ7C 1BLNB 4ERSL 4KMTL 5IMMB 1F6FB 3T3PF 1GZPA 2QQKL 3CJJA 3VXSE 5SWQB 4H1LH 4Z0XA 1DQQB 3ARFD 1F13A 4P23A 3VCLA 3MRIB 1NGQL 3ILPB 3IDJA 2P48B 4AK1A 5C92A 4QHUB 2B0SH 1MELA 5FGSA 4UNVA 3A6BH 4R97B 2X4TA 5HBBA 1BJ1H 3QIBC 1F4AA 4QY8B 1HQ4B 2F53A 1MCFA 5FYJD 5D7SL 3GGWB 2NR6C 1JP5A 4WJ5A 2BY0A 5GSVB 1R5WB 4ELMF 4AENB 4H8WH 2ZOLA 4FABH 5FA4B 4MHHG 1G0YR 4JPKL 4HIJB 5E2VL 5I17A 3ARBB 3SKMA 5JW4R 4U1MA 3BFOA 4OFDA 2YD5A 1TNMA 5HPMB 1LO5A 1TJHL 2Y06L 3TBWA 2AXHA 1Y0LA 4GG8B 1PW3A 4NRYA 1CFBA 4KTDH 4Y5VC 3V4PH 1FJ1B 3CGTA 1CLZL 1FFPA 3MRDB 2DYPB 2HKFL 2AVGA 4LLVB 1JRHL 2PXYD 3RKDD 2FBJH 3MLRH 3QQ4B 1A7NH 2UVEA 1F3DJ 3CFBB 4GT7A 3GHEL 1IQDB 2EIEA 4C4KO 4S10A 3EJJX 5HYSG 4UT9H 1E0OB 3HTLX 1NEUA 2ARJQ 4LHUG 4ETQA 1AGCB 3H9SA 4XWGH 2PW1A 2QQNL 4PJGF 1FG9C 5JPNA 4LCWA 3MLZL 5J3HC 1ZT4B 1K4CA 1QRNB 1Z6JT 3LOWA 1CICA 1QKZL 3C2AH 4QTHB 5B38B 2M2DA 1EO8L 2IALB 5J12C 2F58H 3ULUL 4E41E 1JWUB 2H26B 1MCPL 2HKHH 4FQIH 4LVNB 4XVTH 5IKCA 4M3KB 2HT3D 4GMSH 2BSSB 4TVPH 4I0PB 4LSQL 3WLWC 3BPCB 1JVKA 1IC4H 1U93A 5C0AB 4C57C 2ZCLH 3D69B 4NZUH 2R56H 2NY0D 4U2ZA 1F2XK 4TUKH 4WHYH 2X70A 2GY5A 3AROA 5C6TH 4Y0GA 5C8JA 2D7PA 1RIUH 1MCWM 4MMXC 1S9KC 5EIVA 1FL6B 1H3VA 4X5LA 2ZSWB 4PJ9C 5KSUA 3C6SB 4NC0B 1N6VA 4JO3L 4RCAA 1CE1L 4GKSA 3TO2B 4PBWD 3KVQA 4S1DD 1QEWB 3WE6B 4UIMA 2Z31B 1AGBB 3BEVA 5C07E 4F57H 1HINL 3UROR 1AQDA 3P9MB 5CGTA 1P5VA 3O8XB 3STZA 4O5LH 3FN0H 1WAAF 4OSUL 4B50A 5C0RH 2QTEA 3TZVC 5BS0A 1ZTXH 3K7UA 4DFHA 2FGWL 2FWOB 4J2XA 4K7PL 3BD4A 5ILTL 1IJ9A 1ZLWK 5M95B 2QHLA 3EOBB 3P73A 4PRPA 2CR6A 3V7AE 5EIQA 1QRKA 1H3UA 4M62L 3QDAA 3RUGB 3C2SA 2DBJA 2W9DH 3MRRB 2CDFB 2E6QA 5DD6B 3M45A 2XZQH 2AJUL 1BLNA 3QEGL 1NBVL 5EU7C 5FV2A 5IMMA 3H42L 2W91A 2YN3A 5SWQA 1NLBH 1FZOB 2BNRB 2EDOA 2X9YA 3MRIA 4NKOB 4LGPB 3ZHDA 2EE3A 4KK5C 4WCYH 4YE4H 3ARDD 4QHUA 1IAIL 1HILB 1VGEH 5BMFH 3RWGB 5KVDH 2LAAA 3OJDB 4N8CH 4QY8A 3VG0L 5KSAC 1HQ4A 2PYEB 4QF1B 5F89B 2RJMA 4XPAL 2XZCL 5GSVA 1R5WA 2DWEB 4AENA 5CEZH 4GRLB 3E8UL 4NM8H 5FA4A 3O2DH 2AQ3A 4P3CH 4HIJA 3ARBA 4LRIC 5D71H 3GK8L 5E6YA 5D7KD 5HPMA 2VLME 4IRZH 5D9SB 4FRWA 4YDKL 1QSVA 1G1CA 3I02B 1FJ1A 3U36B 3MRDA 2DYPA 4LLVA 3QQ4A 5BRZD 3CFBA 1PG7L 1IQDA 2X6MA 3ULUC 5GZNC 4U31A 1DL7L 5CLTA 4PRBB 3AY4A 4RNRB 2IPTL 3DUUB 2VLKB 4OLYL 1PKQE 4FS0A 3IDYC 4YHZL 2VQ1B 1AGCA 5E94B 3T3PE 3T2QA 1QBML 2ESVD 1P7HL 5F1NB 6CGTA 2VDQL 5HTSA 4G6ML 4PJ8B 2XQBH 3VGFA 2W9LA 4LPTA 2AKRB 3UO1L 1ZT4A 1QRNA 4MLSA 4PBVC 1C5CL 4FQJL 1WTGT 4Q6YA 4QTHA 2EC8A 2IALA 4DKFL 3MJ9A 4ERSH 1N6UA 4KMTH 4UAOB 2H32H 1JWUA 2H26A 1JI2A 2QQKH 2RAMA 5TH2B 1T7VA 1NGQH 4ELME 4FMFA 2FIRT 3RNKB 2CXKA 3LKOB 3I84A 2BSSA 1JWMB 4I0PA 1EEYB 4LLQB 3S37X 2DM2A 5C0AA 5D7SH 2I07B 4PJDE 3D69A 3LPWA 4J7RA 3ZE0F 2BNQD 2HLFC 4IOFD 3UXFA 1T1YB 4JFPB 3BRDA 4JPKH 1QO3B 5GGSY 1RVFL 5E2VH 4RGOL 4JRYD 3BUTA 2DDQL 1FL6A 2ZSWA 3C6SA 4Z78B 4ESKA 2P4AB 3TVMC 1TJHH 2C4XA 2Y06H 4LEOA 2Y07L 4E41B 3TO2A 4K23L 4PJGE 5B8CB 1QEWA 3WE6A 1CLZH 1X5KA 5FYJE 2APWA 2HKFH 2VR4A 3BW9B 5ESVB 3T0WA 1AR1C 4YHPB 2Z31A 1P7QB 4OLVL 5CP7B 1CT8B 3GHEH 3HCVB 2WW8A 4RGNC 3P9MA 3O8XA 3DX6B 4LLMB 3WIIL 1W2KT 3BPOC 4GG6B 1OAUL 3DROB 1CBVL 2QQNH 4WHYG 4LDLB 2FH8A 2OR9L 3CH1B 4HT1L 1F2QA 1W8NA 5F7DB 2UUDK 3MLZH 4PLNC 2FWOA 3EOYG 1QKZH 4UNUA 1EO8H 3EOBA 3ULUH 1E4KC 4WFGE 1GC1L 1MCPH 2BVEA 4JFFD 3RUGA 1A9BB 2CDFA 3MRRA 5HDBF 5DD6A 5FYKD 4WI9A 1EHNA 3C5JB 5I30L 2HFFA 2FX7L 5C07B 2BNRA 2HTLD 1EPFA 5HDQL 4LSQH 4NKOA 3U4EB 1NFKA 1HILA 3SCMC 3FO2B 4D3CL 5IR1A 2CRMA 5D7JA 3RWGA 5B39B 3SKOB 3OJDA 4J12A 4N68A 1MAJA 5CBAB 4WWKB 2PYEA 4QF1A 3MRFA 3O9WC 3CXHJ 4MDIB 1TMCB 3SGKA 3WJLA 1I1FB 2DWEA 4NGHL 4GLRI 4JO3H 4GRLA 1CE1H 1WAAE 4M8VA 2Q1EA 3QDHA 1BEYL 1F8TL 4ONHB 2HT4D 1OWWA 3C8HA 2KDGA 5CGYC 2W9EL 5E6IC 3BIBX 1XCQB 3ISWA 3DTXB 5D9SA 3SDXF 3ZYIA 5CHNB 1HINH 5DRZB 1FO0B 3U36A 5IB4B 3P9LB 1JGVL 3RTQC 1Q0YL 4AL8L 4X7CC 2VKWA 3TGXA 4JFDB 4OSUH 3DETD 5ACZB 1NCBL 2A9ML 5GXBB 1KCLA 1G7QB 4IJ3B 5DRWB 1AO7D 4RNRA 3DUUA 4I2XE 2VQ1A 2FGWH 5E94A 4X4MA 4IRSD 5ILTH 3OR6B 5F1NA 4NN6C 3NPSC 1INQB 4JO1L 2AEWA 4POZD 4NBYB 4NP4L 3QUYB 3VRLF 2AKRA 3UTTE 4RSVA 3T0AA 4M62H 2AJUH 3RGVD 3QEGH 1NBVH 3BSZL 3H42H 1NC4D 4GW4B 4WFFD 3IJSB 5D2LF 4M6AA 5TH2A 4MJ5B 5GS3A 1VPOL 5C3TA 2HA1A 2EIBA 1IAIH 4FQ2H 3RNKA 3HNSL 2FEEL 3LKOA 5IF0B 1JWMA 3V4VL 3HZMB 3U82B 3VG0H 3RBSA 4HS6B 1EEYA 2PN5A 4LLQA 3RVWC 1RD6A 5DA0B 2DTSA 2ADJB 4TSBL 5ID1B 2I07A 1PKQB 4XPAH 2AEQL 2XZCH 3IJYB 2H1PL 4APQC 2E7BA 3RRQA 1H8NA 1T1YA 4X7EC 3E8UH 4JFPA 3MYJB 1QO3A 2YEZB 1U8JB 5C0ND 2OK0L 2V7NB 3IAQA 5IB2B 3GK8H 4NWUL 3S35X 1G6RB 4Z78A 4FMKA 4E41A 1TIUA 4WU5B 4YDKH 1B0RB 4MWFB 5B8CA 1JJUA 3BW9A 5ESVA 43C9B 2I24N 2P5WB 1P7QA 5CP7A 5CZXD 1CT8A 3HCVA 4ELMB 1PG7H 2H2PC 3W11D 1KIRB 3CVHL 4MCZB 1DL7H 1T83A 2NY5L 4LLMA 5I1KL 2IPTH 4WTWA 4YHZH 4OLYH 4GG6A 3DROA 2GHWB 5T3XL 2LU4A 3ULVD 1QBMH 5D6CB 5A2FA 1GGYA 4PJDB 4QRRD 2VDQH 4G6MH 5F7DA 1ZLWH 5DMIL 1WZLA 3DUHA 3UO1H 3L5XL 4XXDB 2V2TB 1C5CH 4FQJH 1MWAB 5BZWB 2JJTC 4DKFH 5JIPA 3OB0K 1G1YA 1D7FA 1BF2A 2ORBL 3SDCC 1I9RL 5ITFB 1BGXL 4GH7B 4N0FB 1SMAA 1FE8L 1A9BA 4PJIE 4PGJA 4G8GD 3NIDE 3UPRB 3C5JA 2FD6L 4PGDA 3ZMRA 1CD8A 2A6KB 4G6AC 2IQAB 5C07A 2XWJB 3RWCB 3U4EA 2E27L 5J06A 4CN1A 4PJ5D 5IIEB 5J56B 4J3XA 2CGRL 5DFVD 3C5SA 4R90L 3SKOA 5B39A 1K4DB 3VGAC 4HWEL 1QP1A 5CBAA 1RVFH 4JKKA 4G9DB 4MDIA 1W72B 4RGOH 4QCIB 3AS3A 2DDQH 1I1FA 1OGTB 2PXYB 2DOCA 2ZUUA 2W1NA 2Y07H 1YA5A 2OM5A 1WWAX 4K23H 4ONHA 3KLAB 5JOPE 3BD5A 5EFIB 5IB1B 4LOUD 1AJ7L 3QIBD 4ZUUB 2B1AL 1XCQA 1HIML 4OLVH 3DTXA 2J3SA 5CHNA 4XHJC 5CLWA 3QFDB 1FO0A 5DRZA 1P2CB 1CFNB 4L5FL 1MCRA 5IB4A 3P9LA 3WIIH 4FQLL 4JFDA 1OAUH 5ACZA 1IM9D 3VRJB 3D2UD 1CBVH 1CR9L 4MD4B 4OFKA 2YPKB 1SJXA 2OR9H 4BQ9A 4YHKL 1MCIA 4HT1H 1G7QA 2XIDA 5I16B 1A6VL 2NY1C 5HDBE 4RFNC 5AG8A 1HZHL 3KLHD 1ORQB 5DEZA 4O2EB 3OR6A 5J8OA 1OAQL 3MRGB 4DFIA 1INQA 4PJCB 3OX8B 3QUYA 1GC1H 1SM3L 4MQXD 4N0UE 1LP9F 3PHOB 5EBMB 4R9HA 1YMMD 5D1XD 5D6DC 3KPRD 4FTVE 2OSLB 3F7VB 3RU8L 1ZVHA 2NY0B 4CU7A 4C4KT 1NAMB 4GW4A 5I30H 2FX7H 3IJSA 4XP5L 2VUYA 1X5LA 4OGXL 3GUTB 5HDQH 4MJ5A 1J0JA 1D5ZB 1X44A 3BN3B 4WI7A 5I1JL 2BC4B 1G7HB 1CDIA 5IF0A 3HZMA 4JFFE 1RV6X 3FFCE 4ETYA 1PQZB 3KXFE 3TEUA 5IJVB 3MYZA 3VU2A 5FO8B 4HS6A 3KHOA 5FYKE 2ADJA 5ID1A 3SDXE 1PKQA 2Y36L 2OZ4L 3IJYA 3QO0B 1OP5H 2VITB 4NGHH 4WHCA 3IDMA 3PUCA 3MYJA 2YEZA 1BEYH 3EJZC 2P42B 1U8JA 1F8TH 3UTTB 5IB2A 1UXSA 2YZ8A 2W9EH 1I1YB 4DN3L 4WU5A 1B0RA 4MWFA 4Z7OE 4DN4L 1JGVH 4I18B 3DRTB 1Q0YH 43C9A 4AL8H 4BYHA 1KB5L 25C8H 1NCBH 3KJ4C 2A9MH 4ELMA 3KS0J 1KIRA 4MCZA 3T3ME 4F9PA 3GHBL 3PDGA 2UUDH 2BY2A 5L0QB 1J12A 4LPXA 5D6CA 2BVTA 1TDQA 4PJDA 3IGAB 5D2LE 4X98B 4JO1H 5JMOC 4YR6B 4GAGL 4NP4H 1PZUB 5D1QC 2OYPA 3QXUA 4XXDA 2V2TA 1MWAA 5BZWA 5I1AB 2W38A 2GJJA 3ARDB 3BSZH 1AO7E 3TNNB 5IFJB 1ZHNB 4N0FA 3HE6C 1ROWA 1AY1L 2JJWA 4GSDL 4PJGA 4OKDA 3UPRA 3LD8B 1VPOH 4IOIB 3MR9B 3HNSH 1JWSA 2A6KA 2IQAA 2HN7B 2LAGB 3V4VH 4OI8A 2FO4B 1ETZB 2XWJA 3RWCA 1LHZA 4NKDB 3F7PC 2ZNWA 4TSBH 5IIEA 1BIHA 2AEQH 1JGEB 3HI6L 5E2TL 1FAIL 2H1PH 1S7UB 1K4DA 4R2GB 3IDNB 1BJ8A 1L0XA 4G9DA 1R24B 1W72A 1LDSA 4QCIA 2OK0H 4NQCE 5FGBA 4I0KA 4NWUH 3THML 1OGTA 2GSGB 5DHVB 1BBJB 4KK5D 3CSPA 5FA3B 1H3GA 3V6FB 1ZXQA 2XG5A 4KKAD 3KLAA 2FCBA 4KQ3L 4JN2B 3L1OL 5EFIA 5IB1A 2RFXB 1JNJA 4ZUUA 4PJIB 1TXKA 1UYWL 5DZNA 1GXEA 1MY5A 3QFDA 3CVHH 4KH2A 1P2CA 1CFNA 2Q8BL 3IXTB 5DRNB 2NY5H 2NTSP 4YGVB 5I1KH 2J8OA 3PP3K 3HE7D 3MSPA 5T3XH 3DV4B 4MD4A 2YPKA 5IBUB 1IAMA 1NC2D 1IM3B 5I73B 3I9GL 3HG1E 4UU9B 5DMIH 3O2WL 1ORQA 5AYUL 1NKOA 3L5XH 5CD5C 5TGBB 4O2EA 5T5NF 2JJSC 3FKUS 3MRGA 1IAKB 3D6GA 3OX8A 3KPSD 2ORBH 3ESVF 1I9RH 4NQXB 3PHOA 5EBMA 1BGXH 1WAAA 1FE8H 1Y18B 2OSLA 1T03L 3F7VA 2R2HB 2FD6H 3DRQB 4QRRE 1UT9A 1NAMA 2DI9A 5D5MF 3QAZB 2BNQB 4P2OD 1YYML 3GUTA 4PRHD 3WJJC 5FAAA 1D5ZA 2E27H 2K9UA 1GSMA 2BC4A 3C6LD 4QGYA 2FLRT 4JM4L 2CGRH 3NIFF 4R90H 4MD5B 4U1JB 1PQZA 4HWEH 5LKNA 5IJVA 5FO8A 1ZLSL 4G8GE 3ABZA 1HYSD 1K5NB 3QO0A 3W0WE 2VITA 2VLJE 1RUML 4OCRL 2C3XA 3PL6C 5LG1A 4IDJL 2QJDA 3UTTA 3MNVB 1Z0NA 5FCUL 4PJ5E 1AJ7H 1I1YA 4P46C 3TWCL 5ECJE 2B1AH 3CSGA 4UIKL 5E8EB 1HIMH 5FM5M 5KS9E 2VDOL 5CBEB 4L5FH 3BP4B 5GHWL 4JKLA 4I18A 3DRTA 5ITBL 4FQLH 2X4QB 1CD0A 3D25B 1AC0A 4PLJD 4ZNEE 1CR9H 3ALPA 4YHKH 4GKNB 2J12B 4ZS7L 1A6VH 3OR7B 1K9TA 1HZHH 4KZDL 4JFFB 4F15C 3RJDA 1D5MB 1X5HA 1OAQH 1P84K 3IGAA 4X98A 2VRAA 5T3ZL 1AR1D 1OCWL 4YR6A 1SM3H 3PHQB 4NOBA 5CD3B 1F3DH 4YDIL 2GY7B 3UYOD 1YEGL 2PUQT 4RGND 5I1AA 3QRFM 4OF5A 3LS4L 3RU8H 1NLDL 4LPUA 4KHTL 3TNNA 3UAJD 5IFJA 1ZHNA 4XP5H 4ZMAT 4OGXH 3QDJE 4ZNCD 1SBSL 2YMXL 2D0FA 4OGAC 5I1JH 3S3JA 2PTVA 3KPQB 4IOIA 3SE3C 3MR9A 5D96B 4BSJA 4BH7B 2HN7A 3ARED 2YS4A 2FO4A 1ETZA 2DQJL 4NKDA 1A0QL 3RJQB 3OXSB 2Y36H 3Q2CA 2OZ4H 1JGEA 4OD1L 3VGGA 1S7UA 3UJJL 1FFQA 1ZT1B 1Q72L 3UTQB 4QEGA 3IDNA 5C08D 2R0ZL 1DJSA 5F7UA 1WT5A 1R24A 2DBLL 4U0RB 2GSGA 5F9JB 4KU1A 5CAYB 4DN3H 5DHVA 4DKAA 2YXMA 1BBJA 1P6FA 1R3KB 1MCNA 1UXWB 2CPCA 2WBJA 1P6AB 1XFPA 5FUCE 1AO7B 4DN4H 4JN2A 3EO9L 2RFXA 4PJIA 1KB5H 5IGXL 4IRSB 3O9WD 4M03A 4LBEB 2X4NB 3IXTA 4YGVA 5DRNA 3CK0L 3GHBH 4RQQB 3DV4A 4BFIB 3RGVB 4HWZB 4QNPE 3ZKSD 1IM3A 4UU9A 5I66B 1NC4B 4GAGH 1UADC 5TGBA 1G6VK 2D3VA 3D48R 1XT5A 4GS7C 4XBGB 3ZKMC 1IAKA 1YNKL 2NY2C 4BK4A 3I6LD 4XH2B 4V1DD 3NFNB 4N8VB 2Z92B 3HN3A 3PWPD 4HZLB 4NQXA 3R1GL 2BNUA 1J1OL 6FABL 3CFDB 5BXFB 1VA9A 1AY1H 2ADFL 4GSDH 1MCDA 4PJHF 3ZDYF 1DEEB 2R2HA 4LLUB 3DRQA 4L8SB 3VWKB 3F8UB 4MB5A 1WWWX 2CRIA 2ATKB 2MHAB 1T1WB 5I8OL 3GJEB 4DVRL 3HI6H 4U1JA 1FAIH 4MD5A 5E2TH 5IROC 1KXQE 5DK2B 3PWUB 2ZUYA 2ZUTA 3RIFF 4JFOB 3THMH 3KHQA 1K5NA 4TYUA 4NT6B 1W0VB 4RWYL 1IAIM 2NY4C 1U58B 4NO0A 2B4CL 4R0LB 4KQ3H 3MNVA 4HUNB 5C2UB 3L1OH 1CD1A 3R06B 3MBEC 5E8EA 4R26L 5TDPA 4FTVA 1UYWH 1HSBB 3M07A 5CBEA 4QRRB 3GI9L 3BP4A 2Q8BH 5HGBB 2X7LB 1WUNT 5EPMA 4LVEA 2X4QA 3D25A 4HUUB 3U0PB 5TDOB 3GSWB 4GKNA 4XT1C 3I9GH 3OR7A 2YXFA 4CMHC 4U6YB 4LSSL 3O2WH 2GTZB 4JFFA 2W0KA 1RZJL 5AYUH 1D5MA 3PABA 4G8GB 1V3JA 2I5YL 2JJUA 3BRGC 3QHFL 1AI1L 3PHQA 5CD3A 2VLJB 4ZOEA 3JV4B 3NIFE 3I2CL 5ALCL 1T03H 1U9KA 4PJ5B 5J13C 3D85D 4L3AA 1P9MC 4JM2C 3MOBL 1YYMH 5KS9B 3AB0B 4QHKJ 3OKEA 2KQMA 3MJGX 4HJGB 4N1CA 3KPQA 1FNLA 4FFVD 4JM4H 1BIIB 4D0CB 1MPAL 3KPSE 3CFEB 4BH7A 5DK0B 5CFHA 2RQ8A 3O6FB 3B8YA 2X41A 3EDDA 3JUYA 1ZLSH 3GM8A 1XAUA 3ZKND 2E6JA 1ZT1A 4QRPE 3VMPA 5C70A 1RUMH 4OCRH 3UTQA 4PRHE 3VXUD 4ZTOL 4IDJH 1FIGL 4LMQI 5F9JA 5FCUH 1AE6L 5FB8B 4JPWL 3TWCH 1IM9B 3BD3A 3D2UB 4UIKH 4FFWC 1R3KA 3GRWL 1RHFA 2ICWB 1UXWA 4TPRL 4UDTB 5IOPB 5AAWA 2VDOH 5E00B 4HKBB 3O11B 1AO7A 5GHWH 3VFTB 1OAXL 5ITBH 4IRSA 3PP3H 5F9OL 1J11A 4C83B 4LBEA 4ZS7H 2X4NA 4KV5E 1BJMA 1OW0C 3NGBB 3O3EB 4KZDH 3ZDZF 4IMKC 2GUOB 4RQQA 4MZ2A 1UM5L 1CGTA 3B43A 4QO1A 4NJ9L 5D1XB 1KJ2L 4BFIA 1RU9L 3RGVA 4HWZA 1BAFL 4GKOA 2WIIB 2L0DA 4H88L 1OCWH 5T3ZH 5I66A 1NC4A 3IFOB 4YDIH 1WISA 1VFBB 4Y2DD 1YEGH 4XBGA 5C71A 4TTDD 3LS4H 4PBXA 4XP6L 3CDGB 5J57B 4XH2A 1NLDH 3NFNA 4HZLA 4KHTH 4KDVA 1LE5B 1CGSL 4JFXB 4DGIL 3CFDA 5BXFA 2N1KA 1SBSH 2YMXH 3QIUD 1DEEA 3WO4C 1KBGL 4LLUA 2YN5A 1FVCB 1Z9SA 1KC5L 4JGUA 4L8SA 5F7KC 1IMHC 3VWKA 2WZPD 2AJYL 4PGBB 4GLRH 1VCAA 3MFGB 4U1HB 1JGUL 3RBGA 2ATKA 1HNFA 2MHAA 1T1WA 2DQJH 4EOWL 1EUUA 1A0QH 2OTUB 3GJEA 1QVOB 3LN4B 4OD1H 4L29B 3UJJH 3QIWD 1Q72H 3VFVB 3JV0A 2NZ9C 2MNUA 1LEIB 3NZ8B 5DK2A 2R0ZH 3HG1A 4M7JL 2DBLH 4G8FB 2OP4L 4JFOA 5GRUL 4NT6A 2YA0A 4QRUB 1W0VA 4BZ1L 2ATPB 4U1IB 5ACMA 1U58A 4UZGA 2E7CA 4R0LA 5JO5B 3EO9H 1RZJC 2BHZA 2BRRL 5IGXH 1HSBA 3BO8B 4UT7L 4JQIL 4AEHL 4KK8C 4QRRA 4Z7WE 4B7IA 5HGBA 3CK0H 4J3UA 1XR8B 4IS6B 3U0PA 5TDOA 1H8OA 3GSWA 2VABB 4WVRA 4TUJB 5FO9B 2YRZA 4U6YA 3C87A 2GTZA 4PJHE 3ZDYE 2QSQA 4HDIB 3U6RB 3UPCA 1DN0B 4G8GA 3GMRB 2BY1A 1YNKH 4JZNB 5ICZB 2O93L 3W0WA 2GAZB 5DC9B 4BFBD 2VLJA 3R1GH 4WHDA 3JV4A 1J1OH 5E7FA 5F8QC 4PUBL 3MOQA 6FABH 1KN2L 1ZKAA 2ADFH 5E4IA 4PJ5A 4AIXA 4DKEL 3CZFB 3SE8L 2WUCL 1KPVB 5CJXA 1RZ8B 5J6GB 3D0LB 5KS9A 3FTGB 3ALXA 4HJGA 4YXHL 5I8OH 3GZKA 3BWAB 4V1DE 1BIIA 4DVRH 4ZNEA 4D0CA 3PWPE 3CFEA 5SV4A 4PTTB 5DK0A 1TTUA 3O6FA 5JXED 4U7MA 3BOVA 1UZ8B 5DD1L 3PWJB 4QYOB 1LO2L 3LQMA 3V0AC 4G6JL 2FJHB 4RWYH 5DO2C 4N9GA 2B4CH 1N64L 1S5HB 1HDMB 3HE7B 3VFOB 5FB8A 2FYYB 1IM9A 3D2UA 1XF2B 4R26H 1ES0B 3OMZA 1TJGL 2ICWA 3L9RA 4HMCA 4IRJC 4UDTA 3G5ZB 5BOPA 4KI5F 5IOPA 1NC2B 5E00A 4HKBA 1N4XL 3GI9H 3O11A 3VFTA 5B39G 3ELAT 2XWTB 4XNZC 1J18A 1JF6A 3WLBB 3P0VL 1DFBL 1NGPL 4YXKL 1KJ3L 4C83A 3O3EA 3QZWB 3KPSB 4LSSH 2GUOA 1RZJH 1UH2A 2FSEB 5D1XA 4Y1AE 1AIFB 2E7LC 3V7AG 5BV7L 5F72S 4KRMB 4KJYB 2WIIA 4LSTL 5HI3C 3QHFH 4DVBB 1AI1H 1U36A 2ENYA 4QRPB 3IFOA 4HUXB 4X9IA 1VFBA 4P2OB 4O2CB 4PRHB 4KJQD 1RFDL 4JY5L 3I2CH 5ALCH 3C6LB 3CDGA 1SYVB 2G60L 3OXRA 4I1NB 1LE5A 4GRWF 3WNLA 3MOBH 4JFXA 2ITDB 1DANT 1QBLH 4G8EB 1J87A 1FVCA 4Y5YC 4HFUL 4PGBA 2V7HB 3X17A 4WI6A 4M00A 1MPAH 4U1HA 3DO3A 1AC6A 5JXAL 3K1KC 4M7KL 4V2CB 5E56A 2OTUA 1QQDB 1QVOA 3LN4A 5F21B 4L29A 4LLDB 3GBML 1TITA 2OI9B 3VFVA 5SWZD 4H20L 1LEIA 3NZ8A 1HXYB 3IKCB 4JR9L 3LDBC 4K94L 4ZTOH 1U3HC 4G8FA 1FIGH 4ZG1A 2Q86B 1AE6H 5EUKB 5MHSD 4JPWH 3B5HA 1MEXL 3WIHA 4QRUA 1MCKA 3ZDZE 3GRWH 2VXUL 4TPRH 1L6ZA 2ATPA 4U1IA 1N26A 3RVVC 5JO5A 1YN6B 3DIFA 1OAXH 4N1EA 3H9HB 4LHUD 4NIKB 1E6OL 3C60D 3BO8A 5F9OH 1U91B 5DLML 2BHYA 2RBLA 2YD9A 1XR8A 2VDKL 4IS6A 1UM5H 4NJ9H 1KJ2H 2VABA 1RU9H 1BAFH 4TUJA 5FO9A 4H88H 1DANU 5K59F 5HXMA 4HDIA 3U6RA 1DN0A 3KPTA 4JQXC 3GMRA 4JZNA 3TJHD 4XP6H 2PO6D 5ICZA 5HHVL 5F9WC 2GAZA 3EFFB 5CJ8A 1IEAB 4NQSB 2EDWA 1YJDL 3AREB 2DL2A 1CGSH 4DGIH 3L5JA 1JGLL 2CH8A 2VXQL 5GSRB 1FLRL 1V3LA 1KBGH 2DJUA 3MUJA 3CZFA 1KC5H 4YBLC 4N5UA 2AJYH 1KPVA 1MVUA 1RZ8A 5J6GA 3D0LA 3FTGA 1JGUH 1C12B 4RIRB 4X6DB 2UY7A 1KEGL 1QFUL 3MROB 4PYHA 3U7AA 4Z7WB 3LQZB 4EOWH 4WUUD 3VD5A 2UV3A 1KXVC 3BWAA 2AJZB 3U79A 1CFSB 1N2RB 4OLEA 4PTTA 5ICXB 1ZMYA 3S36L 3S5LB 4YHYB 4ZUVB 1XF3B 1UZ8A 5DFWH 4M7JH 4PJHB 4EUPB 2OP4H 3PWJA 4QYOA 4F37K 5DWUL 2EXWD 2JKXA 5DMYA 3MRLB 5GRUH 1IL1B 2FJHA 4BZ1H 3DJ9A 2A6IB 1S5HA 1BD2E 3GMNB 3HE7A 3VFOA 2FYYA 2BRRH 1XF2A 4Y4FC 1ES0A 5BV7C 4UT7H 4EIZC 3G5ZA 4JQIH 1MCSA 1NC2A 4AEHH 1X5ZA 4XP9L 1XGQB 2XWTA 1Q1JL 1UCTA 5CJ5A 3G6JF 5I2IB 4FQXC 4LNRB 2J8UE 1WFNA 4V1DB 3QZWA 3KPSA 3PWPB 2ZCHL 4QLRA 2IANE 1I8MB 3UZQA 4EVNB 4MA1C 4XCEB 1F45A 2I27N 1QFHA 3EIFA 5ESQB 4JVUA 1KUMA 4KJYA 4DVBA 2BX5A 5E08L 4QRPA 5HHME 4HUXA 5DVNA 3K4DA 4EDXB 3RPKA 2EZ0C 3KS0H 4O2CA 4PRHA 1FVEB 1NFDB 4P23C 4PUBH 5DUML 1WEJL 1KN2H 2R8SL 2WM0A 3OPZH 3C6LA 3DXAE 1SYVA 1T2XA 4DKEH 4FXKB 3SE8H 4XCYB 2WUCH 1EHAA 2ZSVB 2XOTA 2DRUA 1BVKB 2E6PA 2ITDA 3X12B 4YXHH 4G8EA 1KB9K 4EN3D 4UNTA 1QBBA 2NY2D 2AP2A 2APVA 3OG4B 1CIUA 1CDGA 5DD5L 5DD1H 2EDHA 1QQDA 4OZGF 1OP9A 1UWGL 1LO2H 4MJID 4Y1AB 4LLDA 2W0LA 1OGAD 4K3DL 3LMJL 3H8NA 4BH8B 1KV3A 3IKCA 1Z9LA 1N64H 1OT1A 8FABB 2Q86A 5INDB 5EUKA 4PRID 1TJGH 5JHLL 1IC5L 4PTUB 1N4XH 1YN6A 2APTA 3H0TB 4U05A 1KJVB 3H9HA 3P0VH 1DFBH 1PEWA 4FG6C 1FZMB 1HHIB 4MS8C 1NGPH 4NUJA 3UMTA 4YXKH 4LKXB 4MDJB 4U6HB 3ROLB 1KJ3H 1ZSDA 1U91A 1RZ7L 5HGDB 1KNOB 5EU6D 3ZKXC 1KPRB 2X40A 2BVUA 2YBRB 1Q0XL 2LU7A 1CICC 1MFEL 2ZNXA 3LZFL 1BZQK 5BV7H 2PYFB 3UTSD 3WFDL 4LSTH 4RAHA 4F2MB 4GBXD 2WAHA 1RFDH 2UWEB 4JY5H 1A2YB 4XMLL 5IK3B 2JTDA 2G60H 4YC2B 4I0CC 3EFFA 2R1XB 1IEAA 5C0BD 4NQSA 4EJ1C 4EI6B 1U3JA 3AREA 3G9VA 5IHUL 3VXRD 4PFEA 1RJCA 1V5JA 4I77H 4ODHL 5GSRA 1XF4B 3RVUC 1GL4B 3E3QC 4ZFFB 4HFUH 1MRCL 3L5IA 4D9RD 1QG3A 5L2KE 4RIRA 1C12A 4X6DA 5GRXG 3LB6C 3G6DL 5JXAH 5BOZG 3MROA 4Z7WA 3LQZA 5ADOL 1J5OL 4M7KH 1TJIL 3DNKA 4Q7DA 2AJZA 1CFSA 1PBYA 1N2RA 3GBMH 5ICXA 4H20H 2EXYC 3S5LA 3PJSB 2D0HA 4ZUVA 4BFGA 4CL7A 2AQ1A 3I3DA 1XF3A 2ZUQB 4JR9H 4K94H 4PJHA 4U49A 4Y4KD 4S11A 4EUPA 2UY6A 2BCKB 5EOCJ 1MEXH 3MRLA 1IL1A 1OTUD 1Y6MR 4Y4HC 2VXUH 3L7FB 5ABDE 7FABL 2B5IB 2A6IA 1G9EA 3GMNA 3FB8B 1E6OH 2AK4E 4M48L 3MLYL 5K59E 4X6BB 1KJMB 1X6NA 2CLRB 1PGRB 5DLMH 1XGQA 3OKOA 5FFLA 2VDKH 5I2IA 4PJEF 4LNRA 5GRYA 4HWUA 1RJLB 3NCFB 4K3JL 1A4KB 4V1DA 3PG2A 3PWPA 2DN7A 1I8MA 3TYFB 4EVNA 1VADB 4XCEA 3S3PA 5FXCH 3SKUD 1FV1B 4OIIL 3WDHA 2ZUVA 5ESQA 2HMID 3QIUB 5HHVH 1AH1A 3HHRB 3P9WB 1Q94B 1YJDH 4W81A 1EEUA 1FVEA 2C3VB 1NFDA 1T22B 1JGLH 3IFLL 2VXQH 5KANI 2BP3A 1T89A 1FLRH 4FXKA 2Y7QB 2HAZA 4XCYA 3QIWB 4R97C 1BVKA 4ZAKD 3X12A 1VEPA 1U2HA 2EDKA 1KEGH 1QFUH 5JTWA 4BZYA 4F7CB 4NFDA 4HJJL 1A6UL 3WUWB 3JV5A 1UZ6E 3WHXB 1J8HD 2BSED 4CN6A 1F02I 2J8UB 4L8DB 3S36H 1KFAL 1IQWL 3ARBC 4GXVL 1NDMB 4UDUB 4Y1AA 4WFHD 5DWUH 4PJAF 1QUNA 4KUCD 3A6CL 4JHWL 4BH8A 1OM3L 2X09A 2PETA 5HHMB 1JYWA 3MUGB 5DHYB 8FABA 4WTXA 5INDA 3EO0B 4OZIE 2FLBT 5E03A 3DXAB 4CJ0A 4PTUA 4XP9H 4OJFL 3MOAL 2IMMA 3H0TA 1KLFA 1GIGL 1N8ZB 3AY4C 1KJVA 3DMMD 3FFDB 4C55A 2H45A 1Q1JH 3O2VL 1FZMA 1OLZA 1HHIA 4URTB 2O26U 4MDJA 4U6HA 3ROLA 4XWOC 4AIOA 3SQOL 3V2AR 5HGDA 4DW2L 4F9LA 1KNOA 4YEEA 2ZCHH 1U8HB 1KPRA 4GMTL 2YBRA 4KROD 2FL5B 5IUSA 3TO4D 1ZLVH 1T7ZA 2PYFA 1P1ZB 1I7ZB 3O4LD 3Q0HA 2N7BA 5E08H 2HLAB 5DQJB 4YWGL 3TFKC 5EBLB 4LVNC 5DUMH 1WEJH 2VLRD 2UWEA 4ZXBB 2R8SH 1A2YA 5IK3A 4AY0A 4WV1B 1I7UB 2MTPA 2R1XA 5D1ZD 4EI6A 4J1UB 4DEPB 3QULB 1TCMA 1XF4A 3D87B 2IQ9L 4PYGA 2OTWA 4P5TD 1MCJA 4ZFFA 5E99L 1X5IA 1AGEB 3BH8B 4H26B 1CFQB 2HT2C 4Z7QF 5DD5H 1NBQA 3BPLB 3X11A 4OZHE 3OL2A 1UWGH 5IQ9B 4K3DH 2BVOB 3LMJH 3VD9A 3PJSA 2L7JA 4E42B 1E28B 4QOKE 2IFFL 3O6KL 1I1RA 1NBZB 1S7TB 2BCKA 2Z31C 5TQ0L 3SN6N 2YSSB 1VKXA 2BZDA 4OB5L 1I8KB 3L7FA 1EHXA 5JHLH 1IC5H 4OZFB 5IJKA 2EO1A 3O8XC 2FEDC 4IMLB 4HULB 3NBNA 4O4YL 3FB8A 4ODXB 4MJIE 3RIFK 1OGAE 4X6BA 1U8KB 1KJMA 2CLRA 5LGKA 4UI2A 1CTNA 1RZ7H 3TJEL 3MNZB 4ZOAA 5L2KB 3HC4L 1Q0XH 1L7TL 1GHFL 1MFEH 3LZFH 5H37H 1UEMA 4KKCC 2NQCA 1PVHA 1RJLA 3WFDH 1A4KA 3TYFA 3FONB 1VADA 4HCRL 1FP5A 3MQIA 1FV1A 1I8IB