3RVWD

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
218
Chain Sequence
EVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
total genus 44
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD01
1G7PA 1CE1L 3BDYH 4OCWH 2KQMA 5F72S 2DQDH 3HCVB 2EECA 5IBUG 1C5CL 2BXZA 4HS8H 3KPSE 4KKCC 4L9LA 4RSVA 5F7NC 2JCCE 1ZV5A 2ZNXA 3NIFF 3ARUA 3MLSL 5DHYB 1Z0NA 2RGSA 4U7KA 5HVHB 4U1KB 4F33A 4LSTL 1KT2A 2CQVA 1CE6A 3G6AA 2Z31C 1GYAA 2HT4C 5GGSB 4Z76A 1PG7W 5DEGA 4ODTL 4ZUWA 3U9PH 4UTBH 1RZKL 4UQ3B 3WLBA 4M5ZH 2DI7A 5EORL 2CIKA 2XZAH 4XP4L 5HGAA 2WQ8A 3OHXB 1CFSB 1QLRB 3MBEC 2DI9A 2BVOB 3DYOA 4NP4L 2BHUA 4XBGB 1D5ZA 2RAMA 2PUQT 3VXMA 3MRMA 3VW3H 1VESA 3JTTB 2PO6D 3TZVC 5T5FL 5FOBB 5CZXD 2E6JA 2C3GA 4D94A 3S5LB 2NLJA 4WUUD 3TYGH 2Z92B 1QOKA 4RFNB 2ESVA 1KACB 5FYLD 1CT8B 4XCYA 1RI8A 2K7QA 1DDHA 4MWFB 3T2NL 3QUXA 4JKLA 2BSSA 5FAAA 3F62A 4MZ3A 4HWUA 3TO4D 4PGDA 1FZMB 1V3KA 1A7QL 4GBXC 5BJTA 5DD0H 4G43B 1KV3A 1DL7L 3VXPB 1WTGT 4PLOB 3DO7B 2ITDB 3KHQA 4OQTL 4MS8D 1AO7D 1FVCA 3FT3B 4KGLA 1EO5A 1MWAA 1CWVA 1OARL 3EOTH 3P11L 4POZC 4QCIA 3QQ4A 2OK0L 2R15A 3WLWC 1GAFH 2ZUVA 4JQVA 2YD6A 4PJEB 1HYRC 1QKZL 1AFVL 1A2YA 1J0KA 1NFDE 1XF1A 4PJDA 4Z7QE 2C3VA 1N6VA 2WINB 3G5YA 1IQDA 2OP4L 3EO1B 2ATKA 3R0MA 1ZGLP 4H26B 1TQCB 2A73A 2NY6C 1IEAA 4ZUTB 3BZEB 3OMZA 2AJYH 4NUJB 2W38A 4R26L 5DJZB 2X10A 3JTSA 4KK9C 4P5MB 3HRZA 1XIWA 2CRZA 2WBWB 4BQ9A 25C8L 5ID0A 4YZFE 1S7XA 4M61B 4ZSOA 3VCLA 1L0YA 4KKBD 1HH6B 4XPTH 3MGOB 4O2CA 3RTQD 1I3UA 1RZ7H 4PJXE 5EZJA 4F2MA 1NBVH 3QIWA 3JVGC 2HT3C 3FO0L 3MXWL 5DA4A 1XGRA 2ZNWA 4YDJB 4CVXA 1UKSA 2GITB 3S9DB 4M7ZC 3T0VA 4UUJA 5ADPH 5IHUL 1A1MA 3CFDA 4O58H 2MPAL 2XQYK 5H2BA 2CDFA 3C60D 4GW5A 1BX2A 4HJJH 5D4QA 2BY0A 3GHEL 3BQUC 3MRKA 2R29L 1AJ7H 4AK1A 1AKJB 3MNZA 1W0WA 4GG6F 4FXKB 3QUZB 4P46D 1RD6A 3M8OL 1JN6B 2CO6B 3GKZA 4P2QB 1MI5B 1HDMA 1R5WA 5AAWA 2X1WL 3O2WH 1EJOH 1WSST 4OFKA 2FGWH 3T0ED 2VO5A 3O3AB 4OZIE 1RJYA 1MQKL 5T1LD 3F7VA 2PYFB 2BVTA 2IANE 3SGKC 5IFAL 4HIXL 3S7GA 3DJ9A 4LLYA 4HUUB 3S37H 1R3IL 4OM1H 3BP5B 1D6EA 1MCRA 4HJ0D 1MRFL 1QFWL 2AVGA 3DRTB 3CU7A 5HYSA 5FB8B 2JB5H 1AIFB 1OT2A 1G7QA 4KKNA 1K8IA 1KN2L 2HWZH 5KTEH 1A7NH 1EXUA 3TESA 1E4KA 2XRAH 2GAZA 2R23A 3VD7A 4F37K 4PV9B 5BRZB 1HHIB 3DX8B 3FAXA 4WFGE 4KK8C 3VWKB 2VDPL 3FN0H 3WSQL 3RUGB 1OPGL 2IQ9H 3FFDA 3X3GH 3OKLA 2OS7A 1U3HD 3MJ9L 4W6XB 3CVHA 5EIIB 4N8VG 3B8YA 3WN5B 2COQA 5HHME 3B5GA 5E2JA 4QHMA 5B39B 4MJ6B 3BEVB 1OL0A 3SO5A 5C0BA 2XZCH 2P5WA 1M7XA 1MWAH 2V2XB 1H3GA 4O2FA 5T3XH 5T1KD 1SVCP 5DRXA 3HMXL 4I3SL 4P5TD 4PR5B 3ABZA 1HSBA 2X40A 2BNQE 1GC1L 3NABH 1JGLH 4R96B 2XWTA 3NFPB 5SV3A 4HWNA 1KFAH 5DVNA 5C6TH 5TDOA 2YN3A 4RZCB 3WO4B 5DJ2A 4YHKH 5TE6L 2EYRB 1CL7L 4RMWA 3KPNB 4Y2DA 4AG4L 4XT1C 3V4UH 4D9LH 4APQD 2H6PA 2N7BA 4NQEE 4NQDD 5IMLA 4PIRF 8FABA 2OX5A 5I1DA 4PB0L 1J1PL 1I9EA 1BZ7B 3OXRA 1MHCA 1WT5C 3DTXA 3QFJE 1G9ML 5LBSL 4L1HA 4LKXA 4JG1H 3E6HA 4WI9A 1W2KT 4Y4FB 2F5AH 4Y19D 1G9NH 2OSLB 4XPFL 3O9WB 3QDGA 3A6CL 3TA3D 3CDCA 3LOWA 2JELH 4PJFB 5JDJA 2JIXB 2D0FA 1JGUH 4OLYH 3ZKXB 3I6LD 5C07E 1CG9B 5CD5C 4KQ3L 3KYKH 4X7SH 1SMOA 1P2CB 3MA9L 2JTDA 3LS4H 3P30L 5HHPB 4WHCA 2GJ6D 1DBJH 4IRZL 2Y36H 2Y6SC 2Z31B 3VFNA 5L6YL 2JJTA 3MLYL 6FABL 4FQLH 1DBBH 5JPNA 3QDHA 4NQCE 5E95B 1RK0B 5JZ7D 3CK0H 2OTPA 4PRIE 5CJQL 5CP3H 5FUOL 4OI9A 5EU4A 1CVRA 2AABL 1MHHA 2ZOKB 4X6DA 3BN9D 1YQVH 1VCAA 1J12A 3VE0A 3FQXB 3MBEB 1UQSB 3MV8A 3RWJB 4N5UA 1OTSC 5DRNA 4EUPG 2GYSA 3SDCB 3QUYB 4WO4C 1DFBH 2FLRT 3TVMA 2YBRB 5F89B 5AYQA 4IIQC 2YPLB 3RWEB 5BZDB 3O2DL 1Z9SA 2K7PA 1NAMB 1S78D 4CGTA 4DZ8A 3N9GH 4NRYA 1UFUA 1VPOL 2DQEH 3RI5K 5I8EA 3MRFA 1EEYB 1ES0A 5C09B 2YD3A 5CGTA 3S36H 2ZG2A 4DUXA 4GBXB 2VSDA 4H0GA 2QV2A 3U7WL 3MZGB 3R06A 2DWEB 1FYTB 4HT1H 4DKAA 3QP3A 3CMOH 3GSNL 3HTLX 4HBCL 3WS3B 1H0DA 4Q9QH 4YHPA 1M71B 4TSCH 2Y7QB 3W39B 2J8UF 1DUYA 5DGQA 4OZHF 2AKRB 3HZKA 4MQ7A 5HY9A 1WLHA 1FFRA 3TJEL 4Y16C 5E9DD 4NHCL 3GZKA 4S1DC 4XP1L 2BXYA 5GGUA 5IT2L 3VXNA 3W82A 4LPWA 1FVDA 2NY6B 3LSOA 4W68A 1HN1A 2AJ3B 2N7AA 1MHPH 4RAUA 1E4XH 4L8SB 1I3VA 3PWJA 4WGVB 5KVEL 3QXTA 4JDTH 3CFEB 1I8LA 4UDTB 1IC7H 1BD2A 1X5AA 2ADFH 2LVCA 5DQJA 3T65B 1IGIH 2P24A 2CUMA 2QQLL 2X9WA 4M1CC 1LILA 3H2WA 1KEMH 4QTHA 4U6TA 2R1WA 1E28B 4ONGL 3VXUB 3IDNB 1F58H 4RMQA 1WF5A 5SWZE 5DJ0B 4WWKA 4M1DL 1NLBL 4NKOA 4F7MA 5C0IB 4Z7WE 1CDGA 4M7ZB 5DD6A 4YX2H 4WI8A 3IFOA 1IBGL 4OM0L 4JB9L 3TCLB 4OFDA 1P4IH 3QEGL 5ITBH 2VKXA 2AXGA 4R2GD 3ZHLA 4DW2H 3DXAD 3BQUB 3E8UL 5EU5B 1RU9L 4P9MH 4EVNB 2EIZA 4PS4H 1DUZA 1UKQA 3PP4H 5BS0A 1HQ4B 5IM7B 4XNXL 3W11D 4PUBL 4R8WH 2Q7NA 4GH7B 3VG0H 4DN3L 4ZPTA 5CSGA 1UH2A 32C2A 3ZSSA 5BVPL 2XQBL 3BWAB 1U95B 4OBRA 3ZL4L 4HWBA 2R0LH 1PSKL 4NWTH 1OM3H 2FD6H 1EBPA 1G7JB 3KPRD 4TRPH 3RA7H 2LQRA 4OTXL 4P4RB 3CPLA 4W4NA 4K55A 2C7UA 1AY1L 1R3HB 4JKWA 4NWUH 4JN1H 4YNYA 1G84A 3QCUH 5KAQG 4AIZA 2YMXL 3GM0A 4DKEH 3GSOA 3MRQA 3MLVL 4S2SB 3L5JA 3BPOC 1TJHL 5J89A 3MRPB 4FZEH 4PJ9C 4P2RE 1YNLH 4QOKA 3S97C 1D5BA 4GRLA 4ODBD 5I6XC 4EI5D 4ODVL 3B2VL 2R4SH 4UDUB 1JZ8A 2X9YA 2DB8A 3QXAB 3JWOL 4OB5H 4UV4L 2NPLX 3HG1A 3KJ4C 3CH1A 3LKNA 2W9DL 2FATH 1SYSB 4RFEB 3G5ZA 1S9WB 3GMNA 4FQ1L 5DO2C 5D1XD 1RZFH 3MUHL 2WWMD 1TETH 3MX0A 2F15A 3O4LA 1IFHL 4PRBB 3K1KC 4RQQA 3O81A 4LFHG 2ARWA 3UO1H 1G7HA 5ISZD 1KPVB 2AK1L 3FN9A 1A7BA 2NR6C 3FRPA 3RL1A 3MLWH 3D0VB 1ADQA 2F8XC 5F7EH 3GMLB 2BNRB 4OF0A 4RGND 5I1GL 1NJ9B 5IKCA 1DN0B 5EBWB 1XMWA 1FGVL 3VMOA 5FO9B 3L3IB 2DQIH 4MQSB 1WEJL 3LY6A 5A43C 2X2YA 2IAMA 1YEFL 2OMBA 4QEGA 4MA8H 3TH2T 4KJWC 1LDPH 5EO1A 2H2SD 5IQ7L 3BIKA 5HPOA 2VLJE 1WJ3A 1TENA 2CSPA 5DD3H 5ALCL 1KCRL 4ZXBD 3FONA 3FN3A 5E8PB 3OHXA 3HE7C 5EUOA 2NY4D 1KN4L 4X7TA 1BEYH 4FQXD 3KPMB 1AQKH 3QPQC 4RGOL 1C16B 2H3NB 3FO9B 3JTTA 2DL9A 4QHKI 3PWPD 4JFHE 1P53A 1UJ3C 2EDXA 2APVA 4M7KH 5D5MF 5GSVB 5GRUL 5DUBB 2Z92A 1FZKB 1CT8A 3W0WD 2NY1C 1NUNB 1CFVH 2UZXB 1UJTA 3MMEB 4MWFA 3K8KA 4RAVB 1QBAA 4PRPA 4HPYL 3ZTJH 2I5YL 3W9DB 1N5YH 1FZMA 4U6XB 1XGQA 3RVWC 4Z7NF 4XB8A 3WJLC 4HC1L 3DO7A 2GUOA 1W0VB 4JFZL 4IDJL 4R4BB 3L3DA 2EYTB 1FZOB 3FJTA 1RMFH 3D2UA 1YEIH 3QNZB 4GS7C 1KELH 1P7KA 4NHUB 4ZFZA 4WFHD 1ZLWH 3PIQB 4TNVK 4PJEA 3QXDA 2A83B 3MCKB 3PJSB 1MLBB 4O4YH 1BQHA 2AJXL 1IGML 2HKHL 3Q48A 4HWBH 4MD5B 5I8OL 3V5DB 1T89A 3SKOB 2WINA 1ETZA 3ULVD 1XCQB 1LO0L 4H26A 5FDWB 3L1OL 3WD5H 3BZEA 3VRJB 1AR1C 2ZJSL 1U8KB 5IB4A 4WO4B 4M4PA 4ZS6D 5GS1C 3V4PL 4X9GA 2J5LC 4P5MA 1N59A 4HZLB 4IIQB 3BAEH 1HEZA 2HVJA 5BV7L 3TGXA 5LGHH 1V7NH 4GAGL 1YMMD 2CPCA 1NAKH 1KPRA 4OUOA 1HH6A 1UKTA 4OZGB 5CILL 1FC2D 4LVHC 3MGOA 3AXLA 3U4BL 1I8MA 5KVDL 3GSQB 3TT1H 2X4SB 3PDGA 4ZMAT 1NUFA 1J8HE 1FCGA 4LSQL 1D6VL 4OZFG 4MAYB 3HHRB 1VEPA 4YDJA 1K6QH 2GITA 3FQWB 3QH3B 4X83A 1MPAH 5DGRA 1HI6B 2DKSA 1Q9KB 2AJUH 1FNHA 1MH5B 3DSFH 3RU8H 5LGJB 3SGJC 1OLZA 2IH3A 3QPXL 1FNEA 4YHIA 1AKJA 2HH0H 2P1YA 2P7TA 3X13B 3QUZA 3MC0A 4Y16B 1S7WA 1ZHBA 3TT3H 4WDIB 1XGUB 1JHLH 1LD9B 3ARWA 3FB8B 3NH7L 1ADQH 3SE4A 4PFEA 4JM2D 4ZAKD 2OTUB 4GQ9H 4R6UA 4K3DL 3O3AA 4UT6H 2ZCHH 2PYFA 5EU7C 1D7FA 4OGXH 3P73A 2JJSC 1FE8L 1S7VB 1HIMH 2QSVA 3WS6C 5FO8B 3QRGL 3O8XC 5KANI 3D3VD 1N4XL 4JY5H 5E94A 4BFEA 4HIIB 2AK4B 5EBLA 2E7LC 4WJ5B 1T2XA 1KC5L 3U0TB 3DRTA 1RVFL 2R4RL 5DQ9B 4X6FB 4HDIB 3HR5B 5CZKA 3EO0B 5B38B 5D1ZB 3O0RL 5EO9B 1N0XL 4KJPC 4KI5E 4M6AA 3LQAL 4MA7L 1FJ1B 5EG6C 3DX8A 3G6DH 4PTUB 1RUKH 3M45A 5GZNC 1CICA 1I8IB 5EBMB 3VWKA 2BVPB 3W2DL 3OKKB 3ARGB 3C6LD 3NIGF 1YEEH 3V9FA 1TVBB 5K9KA 5F7YC 5EIIA 4XNMA 4YXLH 3IDMB 5GRZA 1Q0XH 5I17B 1OAQH 3WN5A 5CEZD 3UZEA 1INDL 1ONQA 4MJ6A 4BZ2H 4HAGA 2VB5A 4Y1AE 5FCUL 2D7NA 5GJTH 1M7IA 4P2RA 3IAQA 1AGEA 4LNVA 4C83A 2RBLA 5JMOC 3QEUA 3OQ3B 4TUOA 3PDOA 5JIIA 4NBXB 4QXWA 4M7LT 3VMPA 1OGAB 4GW4A 3ULVF 4HLJA 4NO0B 3TN0D 3D85A 3KPSB 2IPUG 3R4DA 4PLJC 5IBTH 2JCCB 3BPOB 3KPNA 1YEJL 4PJ9B 1KBGL 3STZB 3IF1A 3T2PA 5JR1L 4NIKB 4WTZA 2AJSL 5CD3B 2DS4A 4G6JH 4AJ0A 4R90L 1T83A 2FO4B 5I6XB 3H9ZA 1CU4L 1A6ZB 2ZSWB 4K3JH 3QDJD 2VN7A 4F58L 2ADJA 2EXWD 3KLHD 1RQ5A 1AGFB 3KJ4B 3G04A 5FYKH 3CSYB 3QAZC 3O9WA 2ZG1A 3IU3A 3LQMA 1XAUA 2GY5A 1JZ3A 4QNPF 1GGCL 1KPUA 5MENB 4PJFA 4AL8H 5CLWA 5ALBH 1KJMA 1JIBA 2NTFB 2MHAB 1C7TA 4H1LG 3BZ4B 4ZTOH 1CG9A 1F8TL 1OAKH 5HI4D 1EVUA 3HN3A 3VFMA 3VMNA 4N9GB 5KSBA 3GMMB 1NCTA 1CGUA 1RAMA 1IARB 3I6GB 4ETQB 3SN6N 5IB2B 4EXPX 4MB4A 3GFUA 4L3EA 3RKDC 4UT9L 2X70A 2BY1A 3UTSD 3QUMA 3QXUA 1K2DB 5IROC 3DHJA 3TCXA 4JM2F 2G75B 5BVJB 3KNBA 4D0CB 3IDXL 1SY6H 2Z31A 4JO1H 5DFTA 5TFSL 5JDSA 1MAMH 1Q94B 4DTGL 5IVXF 3X11A 1UVQB 3T0WA 5EOCH 2CKBB 4ELME 3NBNA 1MIMH 3QEQE 1VGKB 4JO4H 4M4RA 3OKDB 3KPPB 3MRDA 2ZOKA 1OAYH 2J88L 2VZTA 4UILL 1MFDH 4IRJC 5E03A 1QO3A 3HE7B 3BFOA 1LO4L 3FQXA 3MBEA 1AD0A 1UQSA 2B2XL 2R39A 4JVPA 1K3ZA 2QHRL 3RWJA 1KCSH 5SWSB 3TZVA 1U8LB 1UJ3B 4O9HH 5FGRA 3HI1A 5HDQH 2DI8A 2DQFB 1JZ5A 3OGOE 2NY0B 3L95A 3GRWA 4HW6A 3U79A 4I5BB 2MNUA 1NFDB 1ZEAL 1NGPL 2OI9C 2NY1B 3FMGL 3BDXA 3K8LA 1FFNB 2HJLA 2XKNB 3WIIH 1NAMA 4OCYH 5FM8A 4PJCB 1I3RB 4PJ8D 1MLCB 1EEYA 5C09A 2VE6B 3U0WH 1JTOA 4HXAL 1WCBB 1NCCH 1JPGA 2DWEA 1FYTA 4JPVL 4X99A 3H7BA 1YEHH 4K3EL 3HPJB 4KWUA 4ZOEA 1QG3A 5C6PB 1LO3L 4GS7B 2HFTA 1L7TH 1KJ2B 5J13C 1KJ3H 1NANH 4PJXB 4H8WL 2CRMA 1NSNL 5C7XL 3CXHK 1NCAH 3ZE0F 4LSRL 4ZFOA 3OAYH 1U58B 3UYRH 1FLRH 4TUJB 4G8GB 4JY4A 5BXFB 2OCFD 3CLFL 5IBLD 3CFIC 1J8HA 3NCJH 5BW7C 2UWEE 4K8RD 1UB5B 3BPNC 5ENWB 2AJ3A 2PYEE 1XZ0A 2SEBB 1DEEB 1ACYL 2ZSVB 5GS1B 4Z7VB 2J5LB 1B2WH 3DGGA 3VXSE 4UDTA 3GIZL 1JWMB 1CGYA 4JO2L 4ALAL 1PKQE 3DETC 1A6UL 1KLUA 3T4YB 5IGXL 3SDXA 1HK6A 3FT4B 4LVHB 4AY0A 2YSSB 4OZIB 3MUY1 1A9BB 3JVGA 3VRIB 3O6LL 4BQCA 5J57B 2M26A 2GTWA 3LDBC 3F5WB 2F58L 2IANB 1MCHA 3ARBC 2Z0BA 4LSVH 3SKMA 2APXA 1HZHH 3VXMD 1FNSL 2H8PB 4JRYA 1A3RL 4PJAE 4KC3B 3ARFA 4NGHL 4YHLH 3C08H 3UPRB 2ESVD 1IEHA 3SOBL 5IM7A 4WNQB 3RZCC 4WGWB 4PJIF 4N0CC 1HQRA 5CKGA 5JPMA 5HYIA 5IMMB 1NCWL 2W92A 4YFDB 2GK0A 1HHJB 3BWAA 1ZS8B 4X5XB 5AD0B 5C0RH 4F57L 3TBYA 4WU7B 4XTRC 4P4RA 5C0JB 1QNZH 3O8XB 4G6AC 5HHVH 4XNZB 2L0DA 1JHTA 3CCHA 3VFRA 4LLVB 4NT6A 3WFDL 3NZHH 4XB7A 5HHMB 3SJVB 3AMLA 4ZO8A 2DQUL 4XC3L 5AUMA 4NM4H 4PYGA 4XBEH 1PEWA 4S2SA 4GRWB 3E2HC 4KY1L 3WO3B 3WUZA 2VLMD 4U1HB 4YDIL 3TV3L 5HXMA 4X9BA 5TDNB 1GZPB 4ENED 3FQUB 1S9XA 3VA6A 2BNQB 3ARTA 1RV6X 3I6KA 1Q9OB 1UACL 4WY7H 3GRWH 2I25N 3IAPA 3QCVH 3QXAA 1ERNA 4LHUB 3VJ6A 1XIWD 2R2BB 1MUJA 1G7LA 1NAMH 1QA9A 4AM0A 1N2RA 3VG9C 4NM8H 2YD4A 4DK3A 5HPMA 1S9WA 4UTAL 5KS9A 4LCWE 4NQEB 2BNUB 1RZJL 2K3TA 2IMMA 4GAJH 1RPQA 3MLZL 3QFJB 5CEZL 2VXUH 2BVUA 5I1HH 2NYYC 2QR0B 3QIWD 3RGHA 3ARQA 4OLXH 2ARJA 5DVKA 3Q1SH 3KYMB 5C0NC 1IGJB 4MB3A 1LEKA 4ZDHB 1S7QA 3BDYL 4OCWL 1KPVA 4XRCB 5F9DC 1HYSD 3OAUL 4X9FA 2YD5A 4HS8L 3EYQC 5C0EB 4NOBA 1OF2B 5HI5C 1A22B 3SBWC 1NJ9A 1DN0A 2OR9H 4L3CB 4NDMB 1DLHB 4DGYH 2BDNL 4C56E 3K80A 5CS7A 3HI5H 3DROB 1A4JB 3FOLB 3WNOA 1BVLA 2M2DA 4FZ8L 4X8JA 5KOMC 1U8MB 4FFVC 1P1ZB 3WBDA 3K0WA 4YO0A 4NSKB 1WT5A 3I3EA 4BQ6A 3IU4H 4HFUH 4PJHF 3TBWB 4MXQC 3U9PL 3ZDZF 4R7NA 2AXHA 4M5ZL 4LSPH 3BP7A 1C16A 4JY6B 4BSJA 5DD1L 2RQ8A 2XZAL 5T1MB 2ZCLH 4NQCB 4J1UB 4JVWA 5IHBA 3VW3L 5GSVA 2BSED 3MRLB 4GAYA 4V1DA 2YD7A 5FM5M 3DMMC 5ESVA 5DJDB 1NMAH 2DTMH 3MMEA 1LO5B 2EZ0C 3TYGL 1QSFE 2HG5B 4EBQH 2YXMA 3U83A 1CFNB 4LCIH 3W9DA 4U6XA 3WHXB 4LIQH 1HWGB 2QTEA 1IGYA 2VLLA 1P6AB 1ZT1B 2B5IC 1X5FA 1W0VA 1YJDC 2VYRE 1GIGH 1Z6JT 3HRPA 3L7FB 4KK5D 4NNXB 3GJFB 3OZ9H 2PW2B 5FECA 1MRDH 1QSEA 1XR8A 4GXUM 3DUSA 4GSDH 4HUWB 1R5IA 3QNYA 2R0KH 3EO9L 1PG7H 1INEL 3PJSA 1MLBA 1UM4H 2I26N 4N0UA 3TEUA 1GAFL 4MD5A 4Z9KB 2OYPA 5L0QB 5C0BD 1X5KA 3OG4B 4IRJB 4TN9A 3SKOA 5H37H 1F6FB 2P5WD 1YN7B 4AT6B 1PYWB 4WHTB 4WUKH 1A64A 3SDDC 5E08H 4PJDF 5SWQA 1OP5K 4Y7MA 3PWVB 2VN4A 1AGBA 4K9EH 4PGEA 3RVUD 2AJYL 1GPOH 2OI9B 1CGSH 4KUZH 5EUKA 1BVKB 1FG9C 2AEPH 1ZXQA 5KJRL 4Y2DD 3L5WA 3HAEG 3HA0A 3ZDXF 4OZGA 4JKPH 4L5FH 4XPHL 1ZHKA 4LKCB 5GGRY 3TFKD 4RCAA 3PABB 4YHNB 3EBAA 1LE9B 5CP7B 4XPTL 1INQB 1V05A 1FL3A 1BLNB 1RZ7L 4FQ2L 3T3PF 3SE9H 1GGIL 3QH3A 2NXZC 5GRVL 1NBVL 1Q9KA 2F74B 2V2WB 35C8H 5ITFB 3QDGD 4NJAH 5MERB 1Z3GH 5J13B 5ADPL 3MACH 4O58L 4AEIH 4PBVC 5SWZB 1MCEA 1P9MA 4GLRH 4XCNA 3V6ZB 3U0PB 4Z7WB 4B53A 1P7QA 3FB8A 3CDGA 5DHVA 1TTFA 3MRHA 3STBA 5J1TC 3L9RB 3OB0K 3VXQA 1M7DB 2DQGH 3MLUH 4CN1A 5I1EH 1G9EA 5EBGA 3E6FA 4K8RL 2XN9A 3WFHB 2F8OA 1EJOL 4ESKA 5E6IC 2YR3A 2CXGA 2FGWL 4ZUVB 5FO8A 4G8EA 3P9WB 5IIEB 1SBBA 1PFCA 3G08A 3KPLA 2HLAB 4JRWA 1JRHH 2J8HA 3NCCB 4HIIA 2AK4A 5L2KB 4Y4HB 3U0TA 4UAOC 1K5NB 3S37L 3IJHA 3RWFB 5DQ9A 4CDHA 4X6FA 5EULV 3DI3B 4MLSA 3UBXG 3EO0A 4M6NH 3LDBB 3QA3A 4K7PY 5EO9A 1KTKE 3W9EB 4HCRH 5BV7C 3ARBB 4O51A 3DX7B 4AEHL 5KSVA 2JB5L 3MV8D 3VFWA 1RUPH 1OW0C 3JV6B 4KV5E 2EEAA 2DWDB 5CEYA 2HWZL 4RWHA 4RMRA 2J6EA 5KTEL 2XRAL 1A9EB 1I8IA 5EBMA 3LV3B 4N0YH 3VFVB 4U1LA 3NN8B 1K85A 1FV1B 3TBVA 3TVMD 2XT1B 1LWRA 1VFAA 1X5HA 1BBJA 4LU5H 2AXFB 1IAIH 1TVBA 2BY3A 4IEFB 4LGSB 3RZCB 2DBLH 5CWSB 5KVFH 1CTOA 2DLTA 2IQ9L 5FHAH 4OF3A 4YJZL 3X3GL 2F19L 5DSCB 5HHOB 5IW1B 1T1XB 4ORGB 1SHMA 1P7HL 2BX5A 3T77A 5ADOH 1PY9A 4NC0B 3RWHB 4OT1H 4LVEA 4HG4K 2P42B 1A6VH 3HB3D 3M07A 3HZVA 2XZCL 2UYLB 1MWAL 4RRPA 2A9MH 2EDEA 5HDBE 4ZYKB 5T3XL 1NFIA 5I75C 1OGAA 4JFPB 3MROB 1UEMA 2P47B 3UJIH 3F6LA 3NFNB 4IM8A 3NABL 1LE5B 3E2HB 2AJZA 4QHLA 1JGLL 3PWNA 5MEQA 4PJ9A 1KFAL 2XZZA 5C6TL 1TVDA 1J9CT 1SQ2N 1MCIA 5CD3A 4YHKL 4BYHA 1CXHA 2IALB 2H32B 4XP5L 5LCVH 1YDPB 2BFVH 2E3VA 3LKPB 1GZQB 4RWYH 3V4UL 4PJBB 5I66A 4HH9B 4Y5VC 4XMLH 4MDIB 5TJWK 4RGMC 3F58H 1BD2D 2Z91A 4JG1L 5DEFB 2QL1A 2NY3D 2F5AL 3RRQA 5JORB 4C56A 2VLJB 5MENA 1G9NL 5DMIL 4EDXB 1RJLB 2MMXA 1MCJA 3LQZB 2A1WH 5C9KA 4WWKD 4BK5A 2JELL 2HYMA 2Z8RA 3GMMA 2D9QB 5DJ8A 4OLYL 3I6GA 5IB2A 1WWAX 5J1AA 3QI9C 4QRUB 3KVQA 3DVGB 1BFOB 4X7SL 1K2DA 4PV8A 5JOEA 1MCPH 3LS4L 5F21B 4F7TB 5BS0D 4X98B 4RDQF 1H15B 4Z0XB 3ZDYE 4JCMA 2DQTH 1DBJL 5I1JH 2Y36L 4W4OC 1CFBA 5MP6H 2ZG3A 5EU3A 3GNML 4WW2C 1BBDH 2VTFA 4FQLL 1DBBL 4KRLB 3KPOA 5FUCC 3HE7A 3PV6A 4IRSA 3CFKB 4JFEE 3ZTNH 2X42A 3G6JE 3LKRB 4OJFH 3WL9B 3ZYIA 1ZLVH 3FTGB 3C2SA 1U8LA 3L5HA 2Y25A 5DJXA 5HDOA 1FL5A 2DIJA 2DQFA 4FN0A 4JJ5B 3S4SA 1R0AH 1I9JH 5GGVH 5IBUB 2G5BB 5IEKB 3DMMB 5BQ7A 1RHHB 1FFNA 2XKNA 1DFBL 1Y6KR 5IB1B 1MLCA 4QOKD 4NC1C 5F9JB 5HYQA 3AB0C 4GRLD 3PHSA 3KHOA 2Q8AH 2J6EH 3ZMRA 1EMTH 4PRHA 3AM8C 4RBPK 1Q9WA 3N9GL 3RBGA 1PBYA 3WJLA 2OQJB 3H9SE 2DQEL 4JDVA 2JJUA 1JI2A 3GJFK 3PQYE 3FQTA 3S36L 4AEEA 5BZWB 5TF0A 4NUGH 4F9LA 3HG1D 5DT1H 4XCCL 1PZ5B 1E27A 3LKOB 1S7SA 2XTJD 4KKLC 3CMOL 1XF2B 3BISA 3RWIA 3GMPB 4Q9QL 1KF9B 4TSCL 5JA9A 2DQCH 4FG6C 3KWWB 4C57C 3O4LD 5HYJA 1SBSH 4G8GA 4LEXH 2OTWB 4L8CB 2EC9U 5IVZA 2ZUSA 4DVRH 4J3WA 1A7RH 4HUXB 4KRNA 3SDDB 1UB5A 2KL6A 5ENWA 3H9HA 4HV8B 1TXKA 3STLA 2SEBA 1DEEA 2CIIB 5GS1A 4OI7A 1UXSA 4J7RA 4Z7VA 5IG7B 3HMWL 1GOGA 3PXHA 4XVJH 5E99H 1JWMA 12E8H 1MHPL 1E4XL 4K2UH 4PY8I 4U31A 4JDTL 5KOVC 1S7TA 1IGFH 1IC7L 4TQEH 1DSFH 2ADFL 3KAAA 4BM7A 4KJQC 2YSSA 3O11B 4QRSB 1IGIL 1A9BA 1UM5H 4P5KB 4WI2A 1JF1B 1QVOB 3ZT5A 1IL1A 3B9VA 1KEML 3F5WA 2W9EH 3N0PB 1F58L 2NXZB 2NMSA 2IWGA 1RUAH 3RWDA 1BJ1H 1AXSA 3PWUA 4YX2L 1WZLA 4OQTA 5CKAA 5ITBL 3UPRA 4DW2L 4HD9A 3Q3GB 4P9ML 4WUUE 4M6OH 1Q8MA 3NCYS 4PS4L 5D1QA 4PRPD 4LLQA 3PP4L 1I1FB 1UA6H 1FIEA 2WW8A 5FYLE 3S96A 3ME0A 4H8WC 2ITCA 2KPNA 4R8WL 4YR6A 3VG0L 2CLVA 1ZS8A 4X5XA 1A1NA 2OM5A 1OCWH 4WU7A 3IVKA 1H3VA 2GSGB 3UX9B 3WS6A 2FJFA 3V4VH 3O8XA 3D2UD 2R0LL 1B0RA 4NWTL 2CKBH 4H5SB 2FD6L 3S35X 1RFDL 1AO7E 4I2XE 4TRPL 3RA7L 4UAOB 3GBNH 4JRXB 4J3SA 3VFSB 2EE9A 1ZSDA 2DLIA 5DYOA 2GSIB 4NWUL 4JN1L 1F6AB 3QCUL 3ZKNC 3H3PH 3GMQA 2GHWB 2J12B 1ED3A 5KVMC 4DKEL 4U3XA 3FB5B 1ZT7B 1GZPA 2B1AL 1RUQH 2EDRA 3MNVA 3FQUA 1T04B 5EC1A 3MUGB 3DURA 4FZEL 1Q9OA 1IM3B 4K23H 1EO8H 1YNLL 4Z0BL 3L3JB 1OP5H 3CX5J 3FO1A 2D7MA 3MV9A 4U1NB 5TGBA 2R4SL 4NO5B 4PB9H 2FEDD 1CL7I 2WIIA 5DJAB 4HMCA 3WUWB 2X5PA 3KGRA 4NKMB 5L7XH 2FATL 2V5MA 3QCTL 2RFXB 2IBGA 2QR0A 2IQAB 3MLXH 5GGRB 1RZFL 3JV4B 5D7JC 4G8IB 4KRPC 2CDEB 2EDHA 3LVEA 3RNKB 3C09C 1KJ2H 1R3LB 3WNKA 1P6FA 5I1LA 3EAKA 3UO1L 3GSXB 4NDMA 4Z7UE 5I75B 3MLWL 1DLHA 1AKJD 4M5YH 3PGDA 4WI3A 1PQZA 1YNTA 2HJFB 3QUZD 5F7EL 4QXTA 5KZCB 1I75A 3THMH 1IE5A 3UPCA 4TUKH 4P9HC 2R0ZH 2DQIL 4YBQC 3FRUB 2O5ZH 2Z35A 2XIDA 3EYSH 1TVHA 4G7YL 5IEHA 4OD3H 3OB0H 4UB0H 4MA8L 3CC5B 1VFBB 3IXAB 1LDPL 5EB9A 1MOEA 5F7DB 4M93C 1X7QA 3C5ZB 3MJ6A 4F15C 5DD3L 4LVOB 5HYFA 2ZUQC 1MFEL 1FN4B 4WTWA 4RGMB 3T0EE 4LBEA 4N8VB 4H0IA 5EUOF 4J1UA 1AQKL 4HK3N 3QG6A 1F2QA 1D5XB 4JANB 3VFOB 3B9KC 2DKUA 5B3JE 4ZD3H 2D7QA 5GRJH 2BSTB 3WXVH 1PW3A 4M7KL 1LO5A 3MJ9A 2BCKB 3QQ9C 5CGMA 5JW4R 3QI9B 1CFVL 1QLEH 2NW2B 3MLTA 1ZT1A 1CICD 4M62H 5J3HC 3VWKD 4X7EC 1N5YL 3T0XA 1HILA 3S6CA 4NNXA 3GJFA 4E0RA 4L4VB 2WP3O 4XZUB 2PW2A 2R0WH 3EYVB 1M05A 5DHXB 2YD9A 4FFWC 1OSPH 1S9YB 4QXUH 3ULUC 5CBAB 1P5VA 4WW2B 4MD4B 1RMFL 1YEIL 2A0LD 1A7PH 1I8KA 5IMKB 3SY0B 3LEYH 2V5YA 4PJEF 4M00A 2IH1A 4P2RD 4AT6A 1PYWA 4ZOAA 4O4YL 1IGCH 1EHNA 4HWBL 5F7LB 4JFYA 5C92A 2J8UE 3I2CH 4NRZB 2C3WA 1EFXB 2VISA 4FA8A 4OZHE 3P9MA 4LLDB 4JPIA 2NX5B 3WD5L 4GRWH 1Z5LA 3D85D 4B5EA 2BERA 5J12C 1FFQA 2H1PL 2P46B 3BH8B 5F7KC 4N90D 3BAEL 4OD2A 2EH7H 4LKCA 3SCMC 4NQSA 1T0NB 5BMFH 5ICZA 2QHLA 3PABA 5LGHL 1V7NL 3LRSB 4R4ND 4LRIA 1QFOA 5JXAH 4ZFGH 3CJJA 1F90H 3TT1L 1BLNA 4NQDE 3VXSB 4BFIB 4OUUB 3U2SB 5HBBA 2ZUYA 1CXKA 2V2WA 2F74A 3LPWA 5ITFA 1K4CB 3O9WD 3QIUC 5T1DH 4EDWH 5MERA 1K6QL 1QLFB 3OKMB 4RNRB 1MPAL 1TNMA 4GG6A 4Y19E 2AJUL 3HNTL 3DSFL 2D3VA 4B41A 4U3HA 3AFLA 2LV4A 5DD5H 2VXSL 4ONFL 3V6ZA 2HH0L 4KKCD 4E42B 4MMZC 3PP3K 5DI8A 4HIJB 3L9RA 4EUPB 5BW7A 1M7DA 3I6LE 4L3ED 4E41A 1ADQL 4PJAB 3IFPA 4Q6YA 3SKNB 3R0NA 4HS6B 4GQ9L 3V8CA 2Z31D 5IIEA 4UT6L 2HT4D 4LVNB 2HLAA 2ZCHL 1HNFA 4LMQE 2GJ6E 4OGXL 5L2KA 4WU5A 4H88H 3DX6B 2DM2A 3NPZB 4NO3A 1NPUA 3IKCA 1MCBA 4JY5L 3ULSB 2AQ2A 2GQHA 1TJGH 4A2MA 3GJEB 3DX7A 3EJZC 4TYUA 3MBED 2FZ3B 3JV6A 2DWDA 2X4OB 2XFXB 1EVTC 1KYOJ 1UH4A 3TZVD 1OAXH 3LV3A 5D9SB 3CDFA 4KDTC 3UPAA 3VFVA 3NN8A 1T22B 1YY8B 4FNLL 1FV1A 4U33A 2AXFA 1F2XK 3G6DL 3IS1X 1RUKL 3GSNA 3S34L 4R97C 3RZCA 5CWSA 1AO7A 3D69B 3P4OB 3MRJA 4N8CL 3RUGF 1IAKB 4NC2B 4JVUA 5C09D 1KJVB 2Q76A 4IS6A 5DSCA 3AS2A 4BJLA 3LN5A 4ORGA 1Q0XL 4RBPH 1G1CA 1WIUA 5EN2B 2VDNH 4DAGH 1FYTD 3GJFH 2YHGA 3RWHA 3VI3F 4BZ2L 2J3SA 1EBAA 5DJYB 2X4PB 2CRIA 2HFFB 3WLWD 3KXFB 3NOIA 4PG2A 1EAPB 3ZLQC 4ZYKA 4DOHE 4KQ4H 4XWOC 5LG1A 4QT5B 3MROA 3TPUB 4FXGB 4ERSH 3ILPB 5LXGH 3NFNA 5MEOB 5E8OB 1GRWA 1JGVH 3QG7H 1YECH 2KZ1B 4LK4A 4BH7A 1LE5A 1WIPA 2Q6WB 1LP9A 2GJJA 3RIFF 3REVA 4HH8A 4P3WA 3DX9A 5E9DE 3VXRA 1D5IH 5IBTL 1J8HD 2IALA 1GZQA 3X12B 2EE6A 3BN3B 5FGSA 3ECBB 5BOZG 3SO3C 1PX4A 4G6JL 4XHJC 5FDYA 4KK9D 5GISH 4G80B 4HLZG 4XPBH 2FX8L 3SQBA 2DAVA 3BGAA 2P8PB 3D25B 4K3JL 4J6RL 1GGBH 5DEFA 1FDLH 3IDJB 3EYOB 5EU6A 1UZ8A 5IK3B 5FV1L 1MELA 5JO5A 5E70A 1BQSA 4LEOA 2HT3D 4GG8A 2GTZA 4AL8L 4PJFF 2Y5TA 3DUUB 1RSFA 5DWUH 3A67H 5D7JB 4X4ZA 2XV6B 5FO7B 3MJ8B 4ZTOL 5F6HI 5DEZA 3MFFB 4JRYD 4OBSA 5KSBF 5AEAA 4U1JB 1TMCB 4X7DC 1NGWB 5D5ME 1H8SA 3ARFD 3BP6A 5JIPA 3X14A 5DVMA 3DXAE 1QSFB 3N1QC 1QR1B 1T2JA 4JO1L 1SY6L 4NN7B 5HTSA 1RULH 5D70H 1WFOA 1MAML 4P57A 3MA7A 1VEMA 4K7FB 4Z7NE 4M48H 5EOCL 4M93B 3EFFB 5IOPB 4NNYB 4F15B 1WAAA 4P3DB 4JO4L 2ZUQB 1OAYL 1CDJA 4Z78A 4TNVF 3D39A 5CJBA 4FFZH 3ILQC 1MFDL 4LMQI 2XICA 3WL9A 4KUCD 5F1NA 2NZ9D 1A14H 1IC4H 3HNSH 1H3WM 3B9KB 3KPRE 5IEKA 4G9FB 5I8CB 4O9HL 5A3IC 1JPTL 3IJYB 4TTDC 3TP4A 1B3JA 2IPTL 5HYSG 5F9JA 1T4KA 2IC2A 3WIIL 1F4WH 2ZUTA 1CF8H 4KK8D 2OQJA 1A3LH 2V5TA 3L3KA 2W0LA 3AUVA 3LN9A 4Y4KB 3U0WL 5IW6A 5CAYB 3QO0B 1PZ5A 1NCCL 3BH9A 1KNOB 2ZP0T 1LDSA 4G8FB 1B90A 1YEHL 3QWOB 8CGTA 1IM9B 3FQRB 3E1F1 2YWZA 3VWJC 1WBXA 1NCAL 5GSRA 5B8CA 1RIHH 3BKYH 1XGTB 3UYRL 3HFMH 4HUXA 3SDDA 1FLRL 1W72B 1DJSA 1MJ8H 1SM3H 4MCYA 1A7OL 2CIIA 5ISZE 4YAQB 3NCJL 4L29B 3HI6H 5K9OB 2A74A 2ICWA 3VI4F 1SMAA 1C1EH 3JZ7A 4RGNE 1G0XA 2A77L 4MJIB 2D03H 1TCRA 1B2WL 4YEEA 2DTSA 1JNHA 1II4E 2H32H 4PJ5B 1JUFB 4X5WA 2C1PB 5E8NA 3SCMB 1JF1A 3MLRH 5F88A 3SDXF 4AIOA 2YA2A 4FQCH 4X6EA 5J9PB 3TO4C 2IEPA 1J87A 2HKFH 2BRQA 2YKLH 2YPKB 5A2LH 3AC0A 2R56H 1HZHL 1J1XH 1MCFA 3NFSH 3UBXI 4HC1A 2YEZA 4DGIH 4V1DD 4XCEA 3PWPE 4HJGA 2W91A 4ZG1A 3ARSA 5CD5D 4N1HB 4J12A 2ERJC 3WMSA 4IMKC 4HFWB 1YZZA 4JFFB 3WV0A 3C08L 4YHLL 1I1FA 3MJ7B 4LRNL 1FVEB 2IBZX 2CK0H 1PDKA 5SX4I 1IRAY 5FA4A 1H8OA 3FOMA 4S1SH 5E6IA 1DQTA 2IPKB 2VZOA 2Y6SD 3NIGE 4CNIB 1B0WA 2V17H 3GI8L 5E2VH 2O26U 3HZYB 5C0RL 1QSED 4GKZB 2D7PA 1X5YA 5FGBA 1DR9A 5ICXA 1NGQH 4JRXA 1QNZL 3HZMA 3H3BC 4OZFB 1C12B 5KBNC 5HHVL 2D0HA 1T20B 4R7DB 5GXBB 1TITA 4KKBC 4GXUN 4BK4A 3MRRA 4MJ4A 3S3SA 1CI5A 1RURH 1DVFC 3QNXB 4HF5H 4NN6C 4NM4L 4XBEL 4XAKD 1OW0A 3CSBA 1O7SA 3MUGA 3L3GA 3QDMB 3IDGA 1OTSD 1KUMA 1MJUL 4WO4D 3FO2B 5INDB 1VDGA 1Y0LB 2W60A 3ULVE 3B6SB 4U1NA 1E4WL 4R97B 4WY7L 1D9KB 3GRWL 2ENSA 4W6WB 1CYGA 2FHBA 1KIUA 3WUWA 4NRXB 1NAML 5FKAB 3PV7A 4NKMA 1OAZH 3ZYOA 2BVQB 2C4FT 4HWZA 4NM8L 1WZMA 1YMME 4QRQB 1YJDH 1YNKH 4GAJL 4QRTA 1MQ8A 5KN5B 5E9DA 2X41A 4G8IA 3F12B 2CDEA 2VXUL 5I1HL 4MA3A 2X7LB 4OLXL 3D87B 1CR9H 4QRPB 1F3JA 4NYLB 5CSZA 3Q1SL 3KPTA 1CD1B 3GKWH 3RNKA 2WSKA 1BFVH 3GSXA 3RKPA 1F45A 2PR4H 4F7PA 1L6ZA 1NMCB 5C0GA 2P8MA 5D7SH 5MEPB 1AQDB 1P84K 2FGZA 3K74B 2OR9L 3BW9A 2BMKB 4I48A 4DGYL 1P7QD 3ARDC 4CJ1A 3HI5L 3NZ8A 3FRUA 3PP3H 4OLVH 4CJ0A 3VDCA 5E5UB 1OT1A 3RPIB 4OGYH 4Y5VA 3SO3B 2F5BH 4NFCA 2XN9D 4ACPA 3IU4L 3K1DA 4HKBA 1FPTH 5FGCB 4X4MA 5EPMA 4GT7A 1F11A 5IVXE 2A6KB 2AK4D 4M1CD 5E1AA 1TTGA 3C8KB 4GJTB 1R3KB 1U3HC 4BH8A 1G6RB 2LU3A 2ZCLL 1W8OA 4S10A 3D3VE 3F7YA 4O2EB 2BCKA 5KG9B 3TM6A 4JFEB 4DQOH 3G6JB 4L8BB 1F4XH 4NQXA 4I9WD 4RMUA 1NMAL 3QI9A 2DTML 3N1FC 2NW2A 2VAJA 1MCWW 4EBQL 2VQUA 4LCIL 3T3MF 5SX5K 4ODSH 1TZIB 1NL0H 1KSRA 2OJZH 1UM6H 4QYOA 4QF1B 1HKLL 4LIQL 2VL5A 1ND0A 1EV2E 4L4VA 3EYVA 3VXTA 5IB3A 1S9YA 4W4OA 1TZHB 1J7VR 2D31A 5JW4N 3EHBC 2P43B 3KYOB 4HUVB 2HVKA 3H9SB 5IMKA 4L8DB 4BKLB 4GSDL 3INUH 2DRUA 3OKOA 1PG7L 5CEZE 1RUMH 1UM4L 1ZWIA 5GS3A 3IAGC 2BOBB 4RMSA 3U30B 4FHBD 2VH5H 1NCUA 2FYYB 2ATPB 4U0QB 4M7LH 1OAUH 5HGHB 1CXLA 3OX8B 1QACA 5A1AA 2G60H 4WUKL 4H1LB 1OGAD 2WBJA 3WFCH 4M43H 3BRFA 5E08L 3TA3C 2NX5A 1DE4A 3AREC 4U1IB 4X0KA 4XNYH 3GGWB 1FFPA 1DQMH 4PJ9D 3O41A 5C08A 1OB1A 4N9OB 2XKUA 1XF4B 2BVYA 3UTPD 1GPOL 4KUZL 2W65A 3QB7C 4ZQKB 2ADIB 2AEPL 3GMRA 4FABH 4JPKL 2R2EB 1U8IB 4OZGF 3RGVC 3U2SA 2Q7YB 1LEGA 1T5XB 1G7IA 1Z0MA 3QDJE 1QLFA 2HN7A 4QY8B 4Q9BA 4BSWB 3D48R 4X80L 3Q6FA 1CDIA 1NCDH 5MEND 3HUJB 35C8L 1BREA 5DO2D 4LF3B 4NJAL 5F97E 3BRGC 1DLFH 2DQHH 2B1HL 3QYCA 1XT5A 1Z3GL 3AROA 3FL7A 1G0YR 5IB5B 4I18C 1J05B 2PNDA 1KIPB 2ICEB 3BVNB 2QQKH 3VWJB 4AEIL 4E42A 3UYOD 5GHWL 3T2OA 2EO9A 3TYFB 4HIJA 1MCOH 2NR6D 4QWWC 1CLZH 4AEFA 2FSEB 5JW3H 2AI0L 5J6HA 4HMEA 1JGEB 5F93C 4Z7OF 4OAWA 2O61A 1QSZA 2DQGL 1JPST 3FRPG 3MLUL 2PO6B 5C0CA 1U8OB 1U91B 1T03H 2YRLA 3UTSE 2Y9RT 4PD4J 4WUUB 1WWWX 1DQJB 4UINH 4FQXA 4KJWD 2EDKA 4PJIE 5T3ZH 2DQJH 3EYFA 3FFCA 5J0BA 1TJIH 3GSUB 4PREA 3T09A 4F7EB 5HHXH 1KOAA 1EEQA 4JGJA 3ULSA 1EHLH 4YGVA 1CXEA 1V7MH 4NKIH 4ZOCA 5M7QA 3HE7D 3TO4B 3DHMA 5E5MB 2FZ3A 5I8KL 2O5YH 2W0FB 3QPQD 3CUPB 4M6NL 1D3CA 4UV7H 4HCRL 2HTLC 1DANU 5SWSD 4OKDA 1NBZB 4I2XB 1FO0B 1RUPL 4A6YB 5HI3C 3T1FB 2VXTH 3MO1B 2X4QB 5IWLC 3CZFB 1S8DB 2NY1D 2VZ3A 4N0YL 2D7TL 2ZUXA 4YIQB 2OBGA 3T1WA 2ERJB 1I1YA 4LU5L 5CCKH 1IAKA 3B2UC 4CKVX 1KJVA 1ZGLM 1MIEH 2X4NA 4BSVA 1CQKA 4PRHD 5FHAL 2X1XR 1MCWM 1ROWA 5B4MC 4MD0A 4HK0B 5EN2A 2R69H 5E2UH 5JOFA 4HKXB 2X4PA 2GEEA 2OL3B 4MNGA 3KXFA 5ADOL 1WQVT 1KIQB 3LZFH 4PGZA 1A6VL 3P0YH 2GT9B 3GBMH 5HVHC 3LH2H 3V0VB 2A9ML 1LEIB 4NPYB 3OAZK 2Q6WA 5HYJD 3RTQB 4G8GD 43CAB 4LQFH 3UJIL 3LEVH 2G9HA 4PRNB 1X5IA 3OJDB 1EH9A 2YUWA 2W59A 5B3NA 3PL6C 1BQHG 4J8RB 1GOFA 1KTDB 4M9PA 3X12A 1AR1D 4Z7UB 3PXJA 4FQPA 4D0DA 4EIZC 1MEXH 3C60B 5DVOA 5LCVL 2Z8SA 4WEUD 4NNPH 2BFVL 4U05A 4RWYL 5ELIA 4R2GC 3D25A 5DJCB 2QLVB 3MYJB 1KG0A 1A4KA 4TVPH 4AENA 4NKDA 4EN3A 4OFYA 3IDJA 5C0FB 4P46B 5DMYA 3EYOA 3F58L 4L4TA 2VIRB 3MOAH 3W11C 2JJWA 5JHLH 1T0MA 3GSRB 1FHGA 2I9LA 1AGDA 3QJHA 2PF6A 3FT2B 5FFLA 4YFLI 4RFNC 3T0EB 1KB9K 4WEBH 2A1WL 1A6WH 3KYAA 5E4IA 2EDQA 5F7UA 4WEMB 3CNKA 1JK8B 2DN7A 4X4YB 2A9NH 3PWLA 3BEWB 4TOYL 1NGWA 5BCAA 4YHYC 5FOJA 3FKUS 5JTWA 1A21A 3K2UH 3VXME 5JMRA 4GKSB 1T1YB 3CDYA 3MRNA 5JQHC 1EO7A 3ARDB 1QR1A 5D1QD 4EUPH 1MCPL 2E7MA 4QRRB 2ESVE 3EDKA 4N0FB 4N68A 2LTQC 4K7FA 2DQTL 3H6JA 3LKSB 4NZTH 5I1JL 3NPSC 3OR6A 5CFHA 5MP6L 5D7KD 5F7FA 1BBDL 1NDMA 3O3EB 4EI5C 4OLUH 2E9IA 3T0DA 2Y06L 4PRAB 1EZVY 3O8XD 2AW2A 3C87A 2B7DT 5HGGS 4LSDA 3WDIA 3ROLB 4EOWH 1U41A 2CDGA 3TIEB 3VH8A 5IFJB 3ZTNL 5FK9A 4V2CB 5IF0A 1U3HB 2YN5A 1TQCC 4OJFL 3QXWA 1JWSB 1U3JA 4XXDA 3UEZA 3IJYA 5JW5A 1BIIB 3HS0B 1R0AL 4OQ1A 1I9JL 4KJPD 5GGVL 3C6LA 2NW3B 1NFDF 4XWGH 2Y72A 4UIMB 1X6LA 4U49A 2J8UB 5LKNA 3OPZH 2IPUK 3PGFH 3DV4A 4PJDE 4OZHB 4OF8A 4PJCF 5L8LB 1JVKA 2VLME 5T1KB 3ZKQD 1AI1L 2ZOLA 3S88H 2Q8AL 2J6EL 1EMTL 4P5TB 3QO0A 4GRMA 5FXCH 3MV9D 3GB7B 2RHEA 1S5IH 1KNOA 4PRDB 1CGXA 2GFBA 3ARPA 5AWNH 4CBPA 1T1ZB 3VDBA 4NUGL 1P5UA 5TF1H 5I2IB 4LLUB 2EDDA 3QWOA 3ZDXE 5DT1L 1T80A 1VHPA 4MCZB 1T5WB 2H2SC 4ZSOE 1IKFH 4MNQA 4L3AA 2X4RA 3T3PE 2DQCL 2EDWA 4ZXBC 4DGVH 1XGTA 3KYNB 3C6SB 3NA9H 1W72A 2GCYB 1SBSL 5A16B 4GKNA 1WFNA 2I9TA 1EERB 4U1SB 4Y19B 3TO2A 1N6QL 5E5RB 4DVRL 3C9NB 1A7RL 2WLYA 1CFQA 5CMAB 3TA3B 4CADB 2FHCA 3QJFB 1HHGA 3BWUC 2FJGB 4ONHA 2DLHA 4PJGA 4PLJD 4MJIA 4ZPVB 4M7JH 5JQ6H 2MQCA 4Z7VF 1HCFX 1S5HA 4XVJL 5E99L 12E8L 1NGZB 1JMXA 1I7UB 2VDLH 1I3GH 4K2UL 4TSBH 3LKQB 3MUZ1 5ILTH 4O02L 1IGFL 5I73B 1UWEH 3V7AG 2FO1A 4GMSL 4TQEL 1DSFL 1HNGA 4UNVA 5D8JH 3RGVB 5KSAC 3OKEB 4OZIF 4WTZG 1UM5L 1FNGA 1L0XA 3QIUA 5DMJB 3G5VB 2W9EL 4PP1C 5F96H 1I85C 2YPKA 4IMLA 4J3VA 3RHWF 1RUAL 3G9AB 5C9JA 1U3ZA 4OI8A 4FTVA 2F53E 3VFPA 5D7LB 3O6KH 1K4DB 3UZVB 3O6FC 4UIKH 5HJ3B 4I18B 2C1OA 3GSVB 4HFWA 1A1OA 4JFFA 2CLRB 3MJ7A 4M3JA 4DKDC 4OZ4A 3TBSB 3MR9A 1HHKB 4B0MM 4JFXB 3V6FA 5I30H 3ULVC 3E3QE 4MJ2A 5SX5H 3EOYG 2WUCH 5JHDB 5DJ6B 4P9HH 3CX5K 4GKZA 2IADB 2VDML 3V4VL 3R1GH 3PHQA 2F54A 1C12A 4U6HB 5DTFB 4JR9H 1T20A 4R7DA 1FP5A 4LASH 1J0ZA 2VAAA 4IRJD 3GBNL 4AH2A 1NC4A 3UDWC 3QNXA 1MREH 2DDQH 3CFBA 3LIZH 4Q6IA 1YY9C 4GRWF 3QDMA 4XP9H 5C0BE 5J4MA 4DOHB 3J7HA 2P5WE 1WZKA 4KDTA 5H35B 1ZGLB 5INDA 3NACH 1Y0LA 1RUQL 1CE1H 4G5ZH 1UWXK 2EDLA 2FH6A 3GMOB 2PN5A 4ZS7H 2A6JA 5L8KB 4K23L 2NXYD 4PLKC 1JTPA 4Y4FC 1S9VB 1KTLA 3N85H 1SVZA 1S7RA 4NRXA 5FKAA 2CGRH 1OTTC 4JQIH 3I3DA 4PB9L 4PGBA 4LLMA 5KN5A 5L7XL 4OIAA 5IV2B 1Q72H 3ZKXC 4EI6A 1HH9A 4KVNH 4QRPA 5HHQA 1HXMA 1RZGB 3MLXL 3IGAA 3KDMA 3ULUH 3CGTA 5ACZA 3HE6C 3EGSB 2WWKT 3TJHC 5DQDH 1KJ2L 3ZYJA 3QDGE 1LMKA 2V7NB 4Z77B 4M5YL 3IT8D 5TE4L 5LJYH 1MJJA 2XPGA 5IMOA 3G5XA 1W72H 2QQNH 3THML 3PL6B 2VSCA 4JZJC 2OZ4H 4TUKL 4E41D 1ORSB 3VFUA 4EKXA 4PJHA 2FX7H 2R0ZL 4MX7A 2V2TA 1B6DA 5D5MB 4ODWA 5EZOH 2O5ZL 4F7CB 1C5DA 3EYSL 5DR5L 4OD3L 3RVVC 4DUWA 4KHTL 1VADA 1H3UA 4AZ8A 4OV5A 4R2GB 2XNAA 3DXAB 4JZOB 3DETD 4OCMC 3VD3A 3QEHA 5EOTB 5L2KD 4QGYA 3O45A 3C8KA 5HSFA 5FA3B 1EK3A 1AGCB 5ESAB 5C0AB 4JJHA 4K3GA 1RZIB 2FL5A 4HS3B 3O3BB 3SDCC 1DL7H 3QUYC 3BOVA 1LK3H 1VERA 5CBEB 3GO1H 4L8BA 5GRJL 3MXVL 4XVTL 4ZUUB 3WXVL 3D5OF 4MXWH 4X6DE 4D2NA 2OK0H 1NGYB 1YYLH 2DIAA 4Y5YC 4LDEB 3RNQA 3VGGA 3KPRB 3QULB 4XI5C 4NN5C 3MV8E 3REWA 4YHYB 3KLAB 3ES6B 1AFVH 1BZQK 1QLEL 4X7FC 1LQSR 2V7HB 3OGCA 4D8PB 4C4KT 3RZCD 1HXYB 3RDTC 1TZHA 2OP4H 1E6OH 1N7MH 1R5VA 3BHBB 2QSCH 3B8SA 4EQ2A 1FNLA 2LTQB 4K3HA 3OKYA 3EW3B 3NPSB 1AHWB 4R26H 2VZUA 1HHHA 4EI5B 5IHZA 1F3DH 2K9UA 1A7PL 5F1IB 1FG2B 2WIMA 4XTRD 4PY7A 2A6DB 3EOAB 2FYYA 4G6AD 3KPQB 4ODHL 3OX8A 3M17B 4M1GH 4OZFH 4AYFA 2X4UA 3SEPA 5H37G 4Y0GA 3U36B 4Q2ZB 1DBAH 1UCTA 1B6UA 5F3BA 4L8SC 1A8JH 4MNHA 5D1XB 3U7YH 2FECL 3OAZH 1MNUH 3VRLF 3HC0A 1XF4A 3AU1B 3VXRD 4ZQKA 5D96C 3NIDF 3GHEH 3OR7B 1U8IA 4NO2A 2EH7L 2VLRA 5E8EA 2UV3A 5BMFL 4MJ5B 2Q7YA 1T5XA 5DMGC 3UTTA 1MVUA 4FMKA 3WEXB 2R1XA 5JXAL 5D2LA 2LAAA 4QY8A 1P69B 3H0TB 5EU6D 3LEXB 2VITB 4FQHA 1BD2E 5T1DL 1VACA 3RJDA 2NYYD 3LAFA 3ZKMC 4D3CH 1KIPA 3BVNA 3VWJA 4ZXBB 2ED9A 3BKCH 5D7IB 5DD5L 3U46A 3EYQD 1FBIH 2NY4B 3MV01 4DCQA 3FB6A 5CEXA 1KCKA 1MRFH 4IJ3C 4WRLA 4XNQB 5FUZH 1KYOK 3C5SB 5CP3A 4G6FB 3PWPB 1OHQA 1XH3B 3DRQA 3QUKA 5JLZA 2H26A 3CVIL 3WDHA 4GUPB 4OCSL 5GGQL 3SPVB 2OMNA 3W0WB 2F53A 5BS0E 4FQQA 4JAMB 2FB4H 3H7LA 4H88L 1WC7B 1NEZA 4G6MH 1T7WA 4MXQD 5KSAB 1P4LB 4K9EC 3D39D 4JN2B 1TJGL 3BUYB 5ID1A 4C55A 5IJKC 3EDJA 1X6NA 5E56A 5HGDA 1G6RH 5ETUB 1L9MA 5JNYB 1AD9B 4XXCC 1F4YH 3MO1A 2QKIB 1S8DA 1OAXL 1AH1A 5D2NC 2DMBA 3O6FB 5I15H 3T0BA 1XEDA 4IOSD 5L88H 4IMKA 1N0LA 3F7PC 5ANMB 1MFNA 2X09A 1NGXB 3IXTB 1SEBA 1XCTA 2DL2A 3SDAA 5IBLC 4QOKE 2B4CC 4JFQB 4HKXA 3QWQB 1NMBH 3IDIB 4HIEB 4MQXD 4HKZA 3VXOB 2UVFA 2D4DA 2VDNL 4E5XA 4DAGL 4NQVA 1U42A 5INCB 2HAZA 2X89A 3HG1E 1Q0YL 3RAJL 1S7UA 3SGDH 2GT9A 1YMMB 3V0VA 5E00A 2XTJE 5GS2H 4KQ4L 4S1RL 3UTQA 2VABB 1IAOB 4KMTH 2EE2A 2JK5B 1DVFA 3ZHDA 5K93A 3BT2L 4TNWF 1SJHB 3SDYH 4ERSL 5LXGL 1IMHC 3DYMA 3ET9F 1XGYH 4XPFH 1I1RA 1YECL 2KBGA 3QG7L 3FZUC 3QHTC 3O4LE 4J8RA 3SDDD 4NJ9H 1LP9F 4UU9B 4CVZB 1V3JA 4H1LH 4RFOH 3OL2A 4WTXA 1D5IL 3MQIA 2BC4B 3MNWB 4XAWH 5EZLB 1U6AH 4PJBF 1KGCD 3IB4A 3W5MA 2Z4QB 5F3HB 3V5KB 1TIUA 1TLKA 2P8LB 1X4ZA 4XPBL 4P23C 4JFDA 5TH2A 4XPGH 1GGBL 5DK0B 2FIRT 1FDLL 3QUXC 3V8OA 1LO2L 3K4DA 2GJZB 1GXEA 5CJOL 3GSRA 3L7EA 5H94B 4G42B 4JM2B 3ZKSD 4ZAKB 3ALPA 4X6BB 2NXZD 1E0OB 2X1QA 2XOTA 5IVXB 4LOUC 2CLZA 3BEWA 5EUOE 3HE6B 3CSGA 4LAQH 1X5ZA 1FORH 2YD8A 2Y07H 4HIHB 3D3VB 5DFWH 4JQVC 4ODXB 3UTZB 4GKSA 1BPVA 3O3DA 1Y18A 5GIRB 3BZDA 3PDDA 1IAIM 3ARDA 2N4IA 1OQXA 4DFHA 4QRRA 4JZJB 4LQ1A 2VLKB 3LKSA 1YC7A 3MV7A 3CZJA 3EZJB 2PCPB 4PRPE 1CFTA 4U1MA 1RULL 5D70L 5DURD 4MDJB 5J06A 3DVIA 5E6ID 2EDNA 4PRAA 5EC2B 4BQ8A 2NY7L 4M48L 3BPLB 1VA9A 5GRXG 3TIEA 3C5JA 5FYLH 1WAAF 2VNCA 4XBPB 3S8WA 4JRXD 4FFZL 1YN6B 4MA1C 1A14L 3QBTB 2AV7B 1IC4L 3X3FH 2XY2A 3HNSL 3BP4A 3HS0A 1OSZB 4PJEE 4YHZH 3B9DA 4X4XB 1F13A 2PXYC 2MCG1 3MRBB 1I7ZA 1A6TB 1FO0H 4I4WA 5HD8C 4Y5YB 1JV5B 4A6YH 4NN5B 2YC1B 1L4IA 4LHJB 1CF8L 3L3HA 5DK3A 4NHCH 1A3LL 4MAYC 1UWXH 1NKOA 3GB7A 3RDTB 2FIKB 1RK1B 4HAFA 3TN0B 5CHNA 3AMKA 4Y8AA 1RY7B 4GXVH 2DJSA 2EH8H 5F9WC 4LCCC 1YPZB 2ZCKH 2OL3H 3DVNA 3KYNA 1FSKC 3QDJB 3DBXA 3GEWB 5C8JB 2HMID 2GCYA 4P2OA 4EXKA 4IOIB 2QQLH 1IGTA 3IS0X 2HLFC 1RIHL 3BKYL 2JF1A 3HFML 2YPVH 4ONGH 5CMAA 4CADA 1KEGH 1MJ8L 1GHFH 3AREA 2FJGA 5I9QB 3U9UA 3VA2C 2CJUH 4RRPG 4UBDC 4IHOB 3HI6L 4KTDH 4PTTA 5F8QC 1IBGH 4PG9A 4JB9H 1I7UA 1C1EL 2E6PA 5T3ZD 1G7MB 1XF3A 2YWYA 2D03L 3L3OA 5D96B 5DK2A 5FF6A 1N3NB 3E8UH 3RGVA 4J3OC 1RU9H 3WXWH 2AV1B 3QQ3A 3NVQA 2YRZA 2UVEA 3MLRL 5D1ZC 2DYPA 4FQCL 3G5VA 4HKJA 1FNAA 4XNXH 4MAUH 1VKXB 5GGTH 5ERWB 5C6WH 2PW1B 4EQ3A 1DQDH 1N8ZB 2YKLL 5D7LA 4R0LA 5BVPH 2R56L 2AS5M 1J1XL 1U8HB 3NFSL 4JZNA 3ARGC 2CLRA 4KTYA 5HYEA 5IQ9B 1HHKA 1JPFB 3G9VA 3QI9D 4OKVB 2DJUA 4I3GA 4IJ3B 4JLRB 4KMQA 1JTTA 2VXVL 5JHDA 1HOCA 2YMXH 3BYTA 5K33A 5DJ6A 3VFTA 2CK0L 4L4VD 4MSWB 2HJKB 3GUTB 2NNAA 1SYVB 1TJHH 4S1SL 2IADA 3MLPA 3FHQA 4NFBA 2DICA 5FKPA 5D93B 5EOCJ 2V17L 1KLGB 4U6HA 5E2VL 1ZA6A 2P5EA 1SJEB 5EFIB 3TBTB 4ODVH 4PJ8B 1LVEA 1Z9OA 3QHFH 2VR9A 5D71H 3TFKC 4Z5RB 3IDYB 3VI3E 4KXZI 2W9LA 1A5FH 1PVHA 1RURL 2ID5A 4HF5L 5LAXB 2A38A 4PJ7B 5H35A 1ZGLA 4FQ1H 4H20H 1X5XA 2WBJD 1LK2A 1FZJB 3RWCB 2NX5D 3GMOA 2ENYA 5IWLA 2ZKHL 5D2NB 4U6YB 3NA4A 3VGHA 1G7PB 4TVPD 1E4JA 5C08D 3L6FB 3S4SG 4NCC2 5J6GA 2DM3A 4L9LB 4YXHH 3S35H 3V7AE 4BELD 4N90E 4TULH 3HCVA 1QP1A 4JE4B 1YJDL 1YNKL 4TPRH 1KT2B 1PLGH 5CJXA 1CE6B 4KKLD 5M95B 3G6AB 1T21B 1CR9L 2JJTC 5DHYA 3CH8A 3GKWL 4Q0XH 4FG6D 4Z76B 1BFVL 3NCBB 4U1KA 1XFPA 2V7NA 3H42H 4OIBA 5DEGB 2PR4L 2Q86B 1KN4H 4PJFE 1WWCA 5GS0C 4ZOBA 5IUSA 5GGSA 1CDYA 2CIKB 2AQ3A 4JHAL 4OLZH 1HWHB 1D5ZB 4OLVL 5KSBE 1X44A 4R9HA 4UQ3A 5C0CD 4L3EE 4OGYL 1CFSA 1QLRA 2NLJB 2ORBH 5EOTA 2BVOA 3TVMC 3WHE0 4XBGA 1T6VN 4P23B 1BIHA 2I5YH 3FFCD 1AGCA 5C0AA 4XCYB 1TZGL 5F1SA 1DDHB 1FPTL 4KJQD 4HS3A 2CR6A 5FOBA 3QUXB 2CD0A 2BSSB 2IF7A 3S5LA 3P40A 4K71C 2NY0C 4PGDB 5I1IH 4YPJA 1EGJA 3EDDA 3VD5A 5I71C 3WFBH 4DQOL 3QIBC 1F4XL 3V6BR 3SE8H 3AGVA 4QCIB 3QQ4B 3ES6A 4GOSA 5TQ0H 4G43A 1IGMH 3VXPA 1QRNB 4D8PA 2ITDA 4ODSL 4LSSH 4S1QL 3FT3A 3B83A 3ELAT 5D6DC 4JPWH 1NH6A 1DEDA 1UYWH 1A2YB 5FYJH 5FM5O 4U3CA 2C3VB 3G5YB 2FBOJ 1IQDB 1EX0A 2MQ0A 2A73B 5C09E 3V6OA 1C8PA 2A6DA 3INUL 3EOAA 4CU8A 2FH8A 3KXFD 1RUML 3JTSB 3EO1A 1JNLH 1I8LC 1FYTE 1XIWB 2UUDK 3HRZB 2VH5L 4R4FH 3NCMA 5CLTA 5ID0B 2LU7A 4ZUTA 4MA1B 4M7LL 1S7XB 1OAUL 2GIYA 4NUJA 4ZSOB 3VCLB 1H8NA 1L7IH 2HA1A 2G60L 1S3KH 5DJZA 4O2CB 1SJXA 3WFCL 3WNNA 4M43L 4LGPB 3ZKND 3C8HA 1I1CA 2PXYB 3LS5L 4P99A 4XNYL 4M61A 4CVXB 2N1KA 1DQML 4NKQB 3TNNB 5LQBH 1A1MB 5D72H 2CDFB 2J1KA 4GW5B 1BX2B 4FABL 4NZJA 3UP1A 3BD5A 2WK2A 3MRKB 2L4OA 5GGSY 1ZTXL 1W0WB 1CIDA 4EN3D 4OFYD 3H0TA 4L4TD 4WHDA 3WIHA 2MCPH 1HDMB 4K3DH 5K9QG 1WBYB 5JW4Q 1X5LA 4KK6C 3TH4T 2HTKC 1NCDL 3SDXE 5F9WB 4LCCB 4FXKA 1DLFL 5D7JD 4KRPD 5BO1H 1JN6A 1FSKB 1SY6A 4P2QA 1MI5A 5D7IA 1T1WB 3H8NA 3F7VB 1Q1JL 2QQKL 4OGAC 2XTLA 4XNQA 4LLYB 4X5LA 3NAAH 2KH2B 5JW3L 1I9RH 4JRYE 1ZE3C 4PJAF 1G6VK 1J1OH 3EFDH 3MPCA 4LIQE 5HYSB 4GUPA 1IVLA 4EIGB 4P0DA 4HUUA 4K7PX 4YBQD 4MA7H 1T03L 3BP5A 4XNZC 4JAMA 4M6MH 3EOBB 5SX4H 1ITBB 4UINL 4Y5XC 1EXUB 3GI9H 5T3ZL 4IOFC 2KDGA 2DQJL 2R23B 1TJIL 4GRLC 5FB8A 1UWGH 1AIFA 4U6VH 5TE7L 1P4LA 5HHXL 5DFVC 3QISA 4DWHA 3RX5A 1EHLL 2NTSP 1V7ML 4NKIL 3BUYA 3NGBC 1I85A 3FFDB 2O5YL 3OKLB 1AD9A 3B9KD 4PV9A 3SGEI 5BRZA 2WM0A 1HHIA 1WISA 4UV7L 3CVHB 1E6JH 4G9FD 4ZNEA 2E5EA 5FCUH 1CGVA 3O6FA 4X6CB 4I0PC 3RUGA 1UZ6F 2VXTL 2E7HA 2AGJH 1EGJH 4N1CA 4YUEH 3SKJH 3MOQA 3DV6B 2P5WB 4J3XA 4O2FB 5CCKL 5J3HD 2HRPH 1JYWA 1MIEL 2GW5A 3BKML 2FX9L 5B39A 3BEVA 4JFQA 4AMKL 3LRHA 3EDEA 3MFGB 2V2XA 4O5LH 4DK6A 2R69L 5TDOB 5E2UL 3ULUD 1NC2B 5DC4B 2N56A 2IAMC 3MCLL 3BIBX 4LP5A 4PR5A 2H6PB 5KS9E 4R96A 3NFPA 8FABB 5I1DB 4I77H 4MNQD 3P0YL 4RZCA 3GBML 3OXRB 5E8DH 3LH2L 5F1KC 1MHCB 2EYRA 3DTXB 5EWIH 1J5OH 4LKXB 4UU9A 4LQFL 2YUVA 4XC1L 3V7MA 4JCLA 2VKWA 3SHSA 3MTRA 1BZ7A 3QDGB 2G5RA 1I4FB 2VQ1B 2UZIH 4NFDA 2MKWA 4MJID 4Y4FA 3V5KA 1MEXL 1NDGB 3GSWB 2IG2L 4NNPL 2OSLA 4RIRB 3T0AA 4CRPA 4HEME 4TVPL 3C8DA 4UT9H 2GJZA 1U2HA 2E6QA 1XR9B 2JIXA 4UNTA 3QIUD 1ZLSH 4P2YA 3HE6A 3WIHH 4WEBL 4MHHG 1A6WL 1P2CA 4LARH 1OGTB 1QFUH 3NTCH 4FTVD 4KROC 2A9NL 5HHPA 1MCQA 1G1YA 3OTTA 1MCNA 2BOCB 4ZUSB 1LO4H 3K2UL 2VERN 4JFFD 1MHHB 4V1DE 4X6DB 1CXFA 3HR6A 4JZJA 2VLKA 2FCBA 1RK0A 3VE0B 4BQBA 3RVXC 3T3ME 4U1GC 2I27N 5TPWH 2ZUUA 4CL7A 5L0QC 4NZTL 5DRNB 1B4JH 1IC5H 4OLUL 3TVMB 1U2CA 3UJTH 2F54D 3DLQR 4EOWL 2AV7A 1QSEE 3SDCA 3QUYA 3MODH 4NRYB 2YD2A 4URTB 3MRFB 4K71B 1NCNA 2YBRA 1NC4D 5F89A 1T6WA 3EJZD 5TDPB 4N0UE 4WV1C 2YPLA 3RWEA 1NBYB 4IBLT 4K3EH 5BZDA 3QDMD 5I71B 3QIBB 4EZMA 4XWGL 1H0DB 2YC1A 4YHPB 4GBXA 4XAKE 5C7XH 3OPZL 3PGFL 1DUYB 1I1AC 3S88L 4XCFH 3HZKB 3RDTA 4MQ7B 2FIKA 3WS3A 5HY9B 3CLFH 3RY5A 1M71A 2Y7QA 3W39A 5GGUB 1S5IL 4GMTH 4OFIA 3U4EB 3ULVH 2AKRA 5TF1L 3K2MC 3ULUF 1MFBH 3BMVA 4OZGE 3AS3A 3P4NB 3GIZH 4Q9CA 3EDFA 4JO2H 5C8JA 4QRPD 1U0QA 3PWJB 4BFGA 3OJMB 1AC6A 1FNFA 4DGVL 2IFGA 4XWOD 3SQOH 1BD2B 2KUTA 3NA9L 5JIHA 1QEWB 5DQJB 2P24B 2E8ZA 2NY3B 2AQ1A 3CXHJ 3O6LH 4XVUC 4L8SA 2F58H 1FL6B 4QTHB 2R1WB 3CFEA 1CDHA 2NY2D 4UQ2B 3VFGH 3T65A 4PJGF 4UZGA 4M7JL 4NKOB 4F7MB 5JQ6L 4GLRI 2H2PC 4Y4HC 3TH3T 5DD6B 5AZ2H 1N3NA 1E28A 2EC9T 3IFOB 3WDJA 3VXUA 3IDNA 1I3GL 4TSBL 4YHOH 4Z7OE 5DJ0A 2AXGB 5ILTL 2R2CA 1EUTA 1CICC 1UWEL 5C0IA 5D8JL 1VKXA 2XN9E 3BJLA 1OTUD 4OLEA 3TCLA 1OP9A 1RIVL 2APWA 4CN6A 1AXTH 5F96L 3BQUA 5EU5A 4ZPTB 2AK4E 4EVNA 3N06B 5DF0A 1R6VA 32C2B 2YD1A 3OBAA 5JOPD 4PBWD 1HQ4A 3O6KL 4YHMH 4KDVA 2MOVA 4UIKL 1U3YA 4OKVA 2Y5EA 3OXSB 5DLMH 3CPLB 4I9WE 1ACZA 1U95A 4MSWA 4YNYB 1SYVA 5I30L 4KY1H 3SGKA 2W07A 4AIZB 1G7JA 2WUCL 4UOW0 4YDIH 3LD8C 3MRQB 5T3XD 4P9HL 1NLDH 1SJEA 1R3HA 5EFIA 4Y5XB 4QOKB 5D6CB 3R1GL 5GS2D 4GRLB 3V0WH 4JR9L 4LASL 1TCMA 4JDZB 3MRPA 1DQLL 4W81A 3NGBB 3VGDA 4UTAH 5IJKA 1Q38A 1MREL 1RZ8B 3JWDC 3HG1B 1RZJH 3CH1B 3LKNB 5E6YA 3LIZL 4XXCA 1FZJA 4GKOA 2XTJB 4QHNB 3G5ZB 5ACMA 1GL4B 4ZNCD 3ISWA 3GMNB 4UDUA 4TTDD 4I0PB 3NACL 1FFOB 3TF7C 1OGAE 3L6FA 4G5ZL 3GDBA 4ZS7L 4B7LA 3O4LB 3OAUH 1SYSA 5ACLA 1ULVA 2VQTA 4RFEA 3N85L 2CO7B 3DGCR 4JQXC 4RQQB 1G7HB 1CBVH 4YDKH 2VLRD 3JWNC 2CGRL 3RL1B 2BDNH 3UTPE 5I19H 4JQIL 3UTTD 1CGWA 2FBJH 5IKCB 4PRBA 5E24E 1BMGA 4FZ8H 2DQDL 1Q72L 1BVZA 1T21A 3D0VA 2IGFH 4G6KH 1YYMH 4KVNL 2AJVH 2IAMB 2BNRA 3GMLA 3ULUL 2RIKA 5EBWA 5EO1B 2Q86A 2WUBH 5FO9A 4FMFA 3BIKB 5KW9H 5DQDL 3L3IA 3VWJD 5MENE 4LPTA 3BJ91 5C71A 5C07B 1BJ8A 5DD1H 3FONB 4ONOA 1Y6NR 1VGEH 4X7TB 5EUOB 4YK4B 3EYUH 1W72L 2QQNL 1JPSH 1JMZA 1UCBH 1HKFA 3QZWB 2OZ4L 4BZ1H 2FX7L 5E8PA 5EZOL 5I16B 4DKFH 3HPLB 4UTBL 5IR1B 3KPMA 2BRRH 4HCRA 1MCCA 1WBZB 4P23A 4K94C 4MMXC 3QRFM 3D1MC 2H3NA 3FO9A 3ZDYF 2F53D 3ZE1F 4OF6A 4WHYG 4PRPB 4PRIB 3X17A 2ICCA 5DUBA 4YPGB 1FZKA 1XGQB 5DZNA 1Q9LB 1FH5H 2Y1VA 2ZWLT 1UEYA 1CTNA 2M1KA 2GUOB 4RAVA 5ESQB 1LK3L 1BJ1J 3GO1L 3G6JF 2C4XA 3L3DB 3EO9H 1INEH 3CMGA 4MXWL 1YYLL 3D2UB 5E7BA 3VGAC 1P7KB 2PTUA 4KROB 4ZFZB 5SWSE 1QRNA 3CX2A 2F9BT 1BWWA 3MOBH 3QXDB 1GJIA 2X1PA 4R4BA 5DD0L 1BQHB 2EYTA 1FZOA 2QADC 3QNZA 4YXKH 4NHUA 2I60H 3PIQA 3SDAD 2A83A 3BYYA 4PJCE 1E6OL 3EOTL 1ETZB 1N7ML 2EEDA 2VDRH 3MCKA 4WFFD 4U1GB 2QSCL 1C5BH 2G2RB 4PRHE 3V5DA 4P59H 5IB4B 5KJRH 1S9KC 1N59B 2FHFA 2RB8A 1XCQA 4XPHH 1HEZB 5FDWA 6CGTA 2HVJB 2X89D 2KQNA 1JCKA 4KZDH 3AY4C 3VRJA 1KPRB 1U8KA 3LMJH 4M1GL 4WO4A 1I8MB 3AXLB 4CAGA 4FQ2H 4HZLA 1GGIH 1DVFD 4IIQA 2PXYA 1DBAL 4WV1B 1BECA 3U7YL 5HYJE 4MVBD 4G8GE 1MNUL 3TNNA 3GSQA 2X4SA 4L1DA 1ZHNB 2IH3B 4POYA 2C26A 1GSMA 4MAYA 1FNEB 4YHIB 1I1AB 3FQWA 3PGCB 3ARFC 4Q9RH 2P7TB 3KS0H 4Z7VE 1HI6A 2P45B 2MSPA 5A2KH 1S7WB 1MH5A 4JFDD 5LGJA 4ORZC 1ZHBB 4N1EA 5D2LF 1WBYA 2Z8VC 2B4CH 4K8RH 9CGTA 3HUJF 2X9XA 4LCCA 3X13A 4HJJL 1P4BH 4Y16A 3WUWG 1CXIA 4P3CH 1T1WA 4WDIA 2R1YB 1AJ7L 4KI5C 1BOYA 4D3CL 1XGUA 4PGJA 1LD9A 2L7JA 2VZ1A 3P73B 1T3FB 3BKCL 2OTUA 1FBIL 2NZ9C 3ZSTA 5E94B 3O2WL 3S3JA 5EBLB 3QWRA 5FUZL 3P77B 4QHUB 3Q0HA 4AEHH 3ARDD 3ORJA 1S7VA 2HT2D 1UH3A 4QRRD 3EJYC 3EOBA 1URLA 3M1BB 3MV7D 4WJ5A 4LHQB 4OM1L 4HDIA 2FB4L 3HR5A 1YC8A 5B38A 5D1ZA 1CICB 4G6ML 5D7KE 43C9B 5EU7E 3MRCB 1FJ1A 2HFEB 2F19H 3ARZA 1ZLWK 5K9KB 4PTUA 1A7NL 4XNMB 2BVPA 1G6RL 4G7VH 4X6CA 5MHSD 5JW4M 2R9HC 3OKKA 3SJVE 4U7SA 1ONQB 3ARGA 1F4YL 1J18A 1QBBA 1J0YA 4NBYB 1BGXH 5C3TA 3FN0L 1M7IB 5I15L 3DV6A 4P2RB 3IDMA 4GRWE 4HXBH 5I17A 4U4BA 5L88L 4X8XA 1AGEB 4C83B 1CLYH 4YWGH 3QEUB 1ZANH 4UOJA 3A6BH 2FWOB 4TUOB 3PDOB 4HK3J 4KZEH 4GQPH 4GW4B 5I0DA 3VDAA 1NMBL 1NC2A 3LD8B 3D85B 3EHBD 3MV9E 4XP5H 4HLZH 3IF1B 2O5XH 4NO0A 5GPRA 2MFNA 5DXWA 3KPSA 4KMLB 3KLDA 2JCCA 2ADJB 4KMTL 4P2OD 4HG4J 3STZA 4MLIA 1MRCH 3SDYL 3NIFE 3OWEA 5DMIH 3G04B 1XGYL 2FO4A 1I4FA 1A6ZA 3CFJB 3IU3B 4NJ9L 1RJCA 2VQ1A 2ZSWA 4D9LL 2VL4A 3ARED 3C5ZC 4RFOL 4Z7UF 3FHAA 1KPUB 5ECJE 1KCVH 4LVOC 1KJMB 1AGFA 1NDGA 3GSWA 4XAWL 4RIRA 3CSYA 1U6AL 3OJ2C 1GVIA 3VFMB 5KSBB 1V5JA 3IJSB 1XR9A 3MCG1 3RGVD 4XPGL 3P0VH 2NZIA 2NTFA 2MHAA 4L3EB 3BZ4A 2X70B 3RVTD 4OGZA 2DYPD 3QUMB 4N9GA 2VUYA 4W70A 1IAMA 3KNBB 1JGUL 5IP4A 4ETQA 3GNMH 2O93L 4MXVF 1GOHA 1RHFA 5JDSB 1OGTA 3K46A 1F42A 5DUPH 3X11B 5D7LD 5GGVY 3KYKL 2BOCA 4ZUSA 4LAQL 5B3JF 2G75A 1FORL 4NCC1 5BVJA 2Y07L 4D0CA 1QBMH 1M6OB 3MRDB 4QWWD 1Q94A 1QO3B 1UVQA 5FYJD 3H3KA 1AD0B 2CKBA 4X7CC 2XWBB 1VGKA 3Q6GH 3KJ6H 4D9RD 3OKDA 5DRZB 3KPPA 1JZ7A 5JHDD 2JKXA 2J4WH 3TZVB 1WICA 3CK0L 3HI1B 5A2IH 3L95B 7FABH 1K3IA 3R8BB 5SWSA 2HJLB 1YQVL 2P5ED 2MWCA 5FYLL 1UJ3A 1CK0H 4FFYH 3HC3H 4HQQH 4I5BA 3PHOB 2NCMA 5EA0H 5TDPA 1NFDA 4JG0H 3RJQB 3X3FL 3HC4H 1NBYA 5C70A 4XCCH 4ETYA 2K1MA 3RX8A 4PJCA 1JPGB 2HTLD 4YHZL 1I3RA 3ARXA 4X99B 3QIBA 3RZWA 4KKAC 3H7BB 3TWCH 3CVHH 2VE6A 2MTPA 1FO0L 5HI3D 3ESVF 3VGAB 1WCBA 4A6YL 3Q5TA 5D6DA 3CXDH 4ZFOB 3B2UD 2FECI 3HPJA 3VRLE 1P9MC 2AERT 2QADB 3IFNH 2ED8A 1QBLH 3LPGA 4HT1L 4JY4B 1KJ2A 3U4EA 4TVSa 4LGRB 1WITA 3NIDE 5B4MD 3LRGA 4PJXA 4D9QD 1J8HB 3HMWH 4GXVL 4FS0A 1U58A 3P4NA 1L0QA 1XZ0B 4YDVB 4TUJA 4HGMA 5EO0B 2EH8L 1ZVHA 2ZCKL 5BXFA 3IETB 3DGGB 2OL3L 5T33H 3TC9A 1MFAH 4HGKC 5K9QI 1QEWA 3UXFA 5IJVB 1KLUB 1PD6A 3SDXB 3BIAX 2ZSVA 1FL6A 2NY5C 2YPVL 3CSPA 5CGYC 4GG6E 2W0PA 1KEGL 4UQ2A 1GHFL 5L8JB 2UZYB 3KR3H 1X4XA 3NCYP 4LVNC 3PL6D 2GTWB 2CJUL 3T4YA 3FT4A 3SKMB 4KTDL 2YS4A 3BRDA 3PE9A 4OZIA 1ZA3B 2DM4A 3VRIA 4JRYB 4AQOA 4E41E 1DBKH 1OWRM 2IANA 4LSUH 3WXWL 3ARFB 1KENH 3MUJA 3BZFB