3RVWD

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
218
Chain Sequence
EVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD01
4AT6B 1FZJB 4MZ2A 4BK5A 2W65B 1H8OA 1S7UA 2VDOL 3DV4A 1FL6A 5IJVB 5FF6A 3DPBA 5FO8A 5A2IH 3WFEL 5I16B 3MYJB 5A3IC 5HYSA 4MXVF 5DRXB 3DV6A 4XAKD 2Q76B 1RVFL 4KQ3L 1IM3A 4MNQB 3C6LD 5E9DD 3T0BA 5ICZA 4PJXF 3L5HA 1K6QL 2WIIA 1S7TA 3T3PF 2XNAB 5KSAB 3L3IB 1E27A 4L3EE 4K3DL 4NKDA 1GZQA 2NY4D 3T0EE 1EMTL 2BVPA 4H0IA 4OT1H 3C09B 5TH2B 3MCKA 4ZTPH 3NACL 2HP4A 1T2QL 3KJ4B 1RIHL 1U8OB 1YNKH 1U8LB 5DTFB 3MOAL 2FJGB 3VXNA 3EKCA 4GKSA 4IEFB 4L8SB 5IOPA 3JBG7 1I7TA 4FA8A 1DP0A 1BVKB 1ZS8B 2ZOKA 3B9VA 4DTGL 4E0RA 2EDTA 2A1WL 3BPLC 3HC4H 2X9WA 2AJXL 2H2SD 2HT3C 4YK4B 5DS8A 3MLWH 4TRPH 3RDTB 3VWJB 3VXOB 1JPSL 1U92A 3EFDH 3CGTA 1MIMH 1AQDA 3BE1H 1MCQA 1MWAB 1CYGA 5DUBB 1D7FA 5JDSB 3U48A 1ND0B 2VXUL 4MDJB 2GJZB 4BSVA 1CI5A 3V4PL 1OF2B 2CGRL 1KIPA 1JTPA 1QSFA 3GRWH 4PRDB 4WWKC 1Q38A 2EDYA 4TQEH 3V8OA 1OCWL 2AXFB 4PJBB 4QHLA 3QIWD 2R56L 2VKWA 4I18A 5C0EB 4OLVH 3V0WH 4FMKA 5A43C 4JREB 3BW9A 5CEYB 2VMFA 1ZEAH 3O6KH 4WI3A 1OQXA 3N9GH 3DYMA 2OTWB 5FOJA 2B1HH 4DAGL 1NDMA 1T5XB 3X12B 4KKCC 1CGYA 6CGTA 4U6HA 1MAMH 2WUCL 4M1CC 2OK0L 1K2DA 1RUAH 3WIIL 5C0JA 4V1DB 3HNTH 3KDMA 1HILA 4L8CA 1K85A 5BZDB 2A9ML 3QIUA 1JVKA 5IMLB 1WWWX 2F8VA 2XA8L 3R06B 3QUML 4LSQH 3FO2A 4C57C 3FT3B 1EK3A 1AHWB 1IT9L 4U1LA 1KENL 3UC0L 4J6RL 1FLTX 1QHOA 3OXRB 5DYOA 1SM3L 2A9NL 4TUJA 5H37G 3SE8H 2PO6C 3D1MC 2HKHH 5CP3H 2GHWB 2X4QA 2EE6A 3HPLB 5ALBH 1MWAH 3RA7H 3TBWB 1MPAL 1QTYT 1WF5A 4D9QE 1WVZA 2P8MA 1MCNA 5DF0A 3D9AH 2FHCA 5FAAA 2VL5B 5JUEL 4HUKB 5I1EH 4LCIH 5HYFA 1CLYH 5FO7B 1TTFA 1X5ZA 4YR6A 5BOZG 3SEPA 5LGHL 1GAFL 2ORBH 2GCYB 1J8HE 4NZUL 4P2OC 3D2UA 3H9SE 2UZXB 1KLGB 4JN1H 5HHNA 3NZHL 5DZNA 4Q6YA 5J7CC 1K5NA 1UYWH 3P2TA 1YPZE 4HHAA 1VCAA 2CD0A 3NIDF 1GGIH 4FQCH 32C2B 3G5XA 1MEXL 1TTUA 1ODAA 1I85A 3WHXB 2DN7A 4I48B 2A83B 3MTRA 1MNUL 4QHMA 1H3VA 3VFNA 3QWOB 5F7WC 2W60A 3BD3A 3QDME 5IHLB 5LKNA 5IVNA 4UT9L 3MV7D 2NNAA 3ARBD 4WW2F 4J4PC 5CEXB 4I3RH 4RQQB 4KZEH 2YUWA 2CMRL 2HVKA 1K8IA 3EJZC 4MAYC 4JVWA 3VD5A 1VACB 3BGFC 1YDPB 3SJVB 1R3IL 3WD5L 2VXSH 1P7QD 4GW4A 4PS4L 4GG6A 1FZJA 5BS0A 1A6WH 1H3GA 2W65A 3STLB 3FKUS 1U2CA 3BX7C 1JPST 4ZNCD 3CH1B 5E08H 4XHJC 3RVUD 5IESL 1QFWL 1OHQA 2VXQL 3QWQB 5F7EH 4JY4B 4KZDH 5CGYD 1L9MA 3D3VE 2OI9C 1C5CL 1XGTA 1KIUA 2YPVL 3MYJA 5I16A 3GIVB 3MNWB 1T1WB 2BSTA 3MC0A 5KS9E 5JOEA 4DVBB 2Q76A 2WUBL 1D5BA 3BP4A 4LSSL 4MNQA 5J12B 3V4VH 3OGCA 5FB8A 4NQDE 1XGQB 4FQPA 2XNAA 4RDQF 3BJLA 5C08B 3HAEA 3S37X 3O81A 3FMGL 1UWXK 3OHXB 4FXKB 3QNZB 5E2VL 5ISZA 3QCUH 3EYQD 3D25A 4BQBA 1BQHB 1A7OH 3MUGB 3FO1B 3MNZA 3ZL4H 3KPTA 3MLZL 4JFOB 1CFQB 1CK0H 1G9NL 1U8OA 5HHMB 2AEWA 5DTFA 3NIDE 3Q3GB 2CIKB 1N5YH 4FXGB 2IQ9H 4UU9B 2D9QB 1BVKA 4PJ8A 4ELMB 3UTPE 5D5MB 1N59B 4ENED 2APXA 4KKAC 5IB5B 1M6OA 5DQ9B 2XFXA 5BVPL 2VAAB 4AM0A 1R3LB 1T0NB 1DQQB 1A14L 4MDJA 3V7MA 1KB5B 2VL4A 4IRJB 2JELL 1OF2A 3VE0B 1A9EB 3V9FA 3QUYD 3LEVH 4HXBL 5FFLA 3P9MA 3KPMA 2PR4H 4YFEA 3DYOA 4PB9L 2OL3A 4TOYH 5DGQA 2AXFA 4PBVC 1JGVL 5GRUL 4IOIA 1HIMH 5DVKA 4U33A 5D7LA 1MQKH 4K7PH 3WHE0 2DL2A 2LVCA 2Z31A 2YZ8A 3HNSL 1TVHA 5DFVD 4KK5D 2AK4A 3BKYH 3KPQA 3S7GA 4XCCH 4OCYH 1MRCL 3MGTA 2EYRA 5F1SA 3UTZA 4NHUB 4UQ2B 3VXUD 1WWCA 5IVXB 1JHTB 5DMYA 5HI4C 2FR4A 4PJ7E 3T1WA 3PQYE 5IQ9B 1T3FA 1TENA 3BGMB 5B8CC 3R06A 1L0XA 1MY7A 5D71H 3ARSA 1AHWA 4ZPTB 5SX5K 4LASL 2JCCE 3AS0A 1I7RB 2CPCA 2YA1A 3VFTA 5FYKH 5HGGS 2P24B 3A6BH 1M7IA 4G7YH 5MI0B 3UBXB 4NKIL 3G08B 2IH1B 1KBGL 3HPLA 5DK0B 4E42B 3U83A 3C6LA 5JPNA 2E6PA 1RZJH 5D7JB 1BOGB 1G9ML 3DVFA 4OF7A 2W0KA 1S9XB 1BZ7A 1HINH 2CQVA 1OY3B 4UI2A 4PJDE 3LKNB 3SO3C 1YEGL 5DI8A 1S5IH 1IFHL 1VGKB 3LEXB 2FBJH 3ARGA 4L3CA 3RX8A 4WHTA 5KVEH 2Y06L 4XTRC 4M43L 2OQJA 5CD5C 3EDEA 3SDCB 3FB7B 1FFNA 5LGKA 2QKIB 4WUUB 1U3HB 5I1DB 2ADGA 2AEQH 4JFFD 1OPGL 4AEHH 4Q9RH 5J8OA 4JZNA 1ZOXA 5EZIH 2EYSB 4PJ5E 4QXUL 3RKPA 4ZQKB 2XZQH 2J8HA 2IAMD 4KHXH 4NOFA 3FO9B 4LL9A 4NRXB 5ACZA 5ITBL 2B20A 3EYOB 4M1GH 4QRPD 2X05A 5C0NC 3QI9A 4JFYA 2EEAA 4B7LA 4ODWA 1XF4B 3P9LA 5FGCE 5JIIA 3QFJE 5DRWA 1Q1JL 3RZCB 3RWDA 2PNDA 1T7WA 5GS2H 3QDGD 1LE5B 1KN4H 5AG9A 1B0WA 1KTRL 1PEZA 1WWBX 1NBYB 3SJVA 3EYSH 1KTDB 4G7VL 3MLUH 5GGVY 1HNGA 1DQML 2CDGB 4FG6D 4GKZB 1J0YA 5FYLL 3ZE0F 3ZKXB 2G2RA 2IAND 4WI7A 3U9UB 4NIKB 3CH1A 4E41E 5EO0B 2OP4H 1P4IL 4DN3L 3GMOB 1P1ZB 1D5ZB 3MGOA 5GGSB 4HMCA 5I71C 4G6KH 1T1WA 4LVOB 3ZKND 3BN9C 3U4BH 4NQUA 2EH7H 4YJZL 3T77A 1A0QH 3MV9D 5C08A 1F97A 2R0LL 3BPOB 4FXKA 3OHXA 4JZJB 2NY2C 3QNZA 3TWCL 3QEGH 3VWKC 3NIFE 4RCAA 2YKLH 4GMSH 4UDTB 5J4MA 3UX9B 1CGWA 4ZUWA 4HWUA 5MEPA 3MNVB 4WO4A 4L9LB 5HGHB 3B9KB 4Z7VE 5T1DL 2CLZA 1CG9B 4MNGA 2CIKA 3BKCH 4L4TD 4UU9A 1JE6A 1JWUA 3U7YL 3FQNB 3L3KB 4UUJA 3KWWB 1QNZL 1CF8H 1V3JA 4NFBA 1IJ9A 2XXCB 1JWMA 3ZTJH 2GIYA 4KK8C 3DROA 5E8DL 2XQBH 2VAAA 5INCA 4D0BA 3DOSA 1JP5A 4PY8I 4GRLC 4AZ8A 3WUWB 3AMKA 1MRDL 3AXLB 2FX8L 5BCAA 3C60B 3I3BA 3VE0A 1A9EA 4BH7B 1JV5B 4HWZA 5E2TL 2J8UA 4OI7A 1NCWL 3HC3L 3VFVB 1AC0A 4D0CB 3VXTB 2YPLB 5C6TH 2JJSC 1NBVL 3PABB 4NO2B 3QO1B 1FYTB 2EICA 1T04B 3VXMA 3F6LA 2CH8A 4HPOL 1AGEA 2EYTA 1QSEB 1SBSL 1T89C 5EUOA 1T6VN 2ADJB 3SCMC 4RRPA 5DURD 1IC5H 5J0BA 5CLWA 5E4EB 2YK1L 4APQD 1AI1L 5DQJA 3L9RA 4MXQC 3DX8A 5KSBB 5F7DB 4C55A 2DYPB 2BVTA 5F7KC 3G04B 4GAGL 4IRSA 4X80H 1F4YH 4H88L 1A6UL 2KQMA 4QWWC 3RZWA 4NHUA 5DFTA 4UQ2A 4XAWL 1FE8L 2V17L 4YBQD 1JHTA 3CUPB 3MFFB 3HG1E 4LLQA 1QKZH 3W2DH 4P49A 3MRDA 1IM9B 1U3JA 2VN4A 3K4DA 3HE6D 1ZGLM 4AEFA 2BY1A 3ALXA 3G6DL 1NGYA 3P4LA 1YNLL 4TUOA 5EC2B 3UTTE 1QUNA 3A6CH 2G9HA 1LO2H 3OSKA 1LO5B 3OAZK 4OIIL 3WFBH 3RY4A 4OIBA 3HUJB 1IEHA 3BP6B 4BUGA 2LQRA 1UWEL 3IDIA 5D2LA 4RX4D 1A02N 5HHXH 2C3WA 2IH1A 5DK0A 4RBPK 5CJQL 1T1XB 3IRZA 4E42A 2ZSVB 3E2HB 2Y23A 3GSUB 3DX9A 4GS7B 1FVDB 1HQRA 4YHIB 1GC1C 4P4KB 1ZT7B 3CX5K 4MVBC 4M02A 1N4XL 4ODUB 4ZUSB 4NWTL 4QHNA 2WBJC 4MMZC 4H20H 1UKQA 1WEJH 2I27N 5F21B 2F19L 1VGKA 1MFEL 4HC1A 1BIHA 3DMMB 4WI2A 3NVQA 5IVZA 1TZHB 4FQLH 5FXCH 4GXVH 2D0FA 4R96A 4KHTH 4DFIA 2NY0C 3MRRA 5DMGC 4H8WH 3OKEA 4JB9L 4EN3D 3V52L 1I1FB 1Z5LB 1UJ3C 3T8XB 5K9JL 1YY9D 1H3XA 4BELD 3V8CA 1DQDH 3P0VL 1T0MB 2NTSP 3IDYB 1I7ZA 3EYOA 1B4RA 4WTWA 3V0AC 4PGBB 1XF4A 1I3GH 2B4CL 1CE6B 1YMMB 3CSGA 1QRKA 4OLUH 4ZAKC 2FX9L 4IRZL 4DJMA 2AQ1A 4ZOEA 1KCSL 4IOFC 2JB5L 5IM7A 4Q2ZB 2LU3A 4XVUD 1A3LH 3O9WD 3PGCB 1HCVA 3BN3B 4GAFB 5T5NG 1KTDA 1DBJH 1KPVB 4CN1A 5C71A 4P2QB 3O8XD 3R1GH 1FVEA 3SGDH 3V6OC 2QADD 4FQ2H 2IBGA 5E5RB 4PTTB 4KJYB 3SY0A 3FZUD 4C58B 2EIZA 1MREL 3OKMA 4F37F 5SWZB 4JPIA 4G6MH 5F6HI 2ZUXA 5TDPA 4PIRF 3UZVB 5HYQB 4TUKL 2OTPA 4NKOA 4XB7A 1DUZB 2VDMH 1JF6A 1OT2A 3UZQA 2PF6A 2NY6C 3P11H 4OT1L 4PP1D 4UT6H 2R15A 4ZTPL 2BSRB 4RFOL 3MRGA 4LCWE 3U2SA 3WNNA 4UDTA 1FSKC 2E6QA 4KJQC 3PHSA 2JJVA 5C07E 1U3YA 3TVMA 3NAAL 4LHJB 3WHE1 2MHAB 3B9KA 4U1JB 2R29H 5LCVL 1WBZA 2PYEE 4XI5D 5IROA 4YHNB 4OGYH 1NGPH 4N0YL 3QNXA 3FRPG 3FQNA 1KTLA 5MEQA 3MLWL 1NC4A 2DQTH 3EFDL 1SJEB 1MIML 4WCYL 2OLDA 2CSPA 3IXAB 1MCOH 4LEOB 1Q9OB 4PR5A 1GRWA 1CD0A 1U41A 2AI0H 1BP3B 2FDBP 2FECI 3ELAT 5ANMB 3KNBB 1I9IL 1Z9OA 4OM1H 3WUWA 4HUXB 3EAKA 2AV7B 1R3KB 1U8PB 3GRWL 4QOKE 2X9YA 4YPGA 3FONA 3AREA 4Z7UB 3BAEH 2R2EB 3VXTA 5MHSE 3TH4T 3L7FB 4JFFA 1KGCE 4ONFL 1MCFA 4NO2A 3QO1A 1FYTA 3DXAD 4OLVL 3NN8A 3AM8C 1T04A 5GZNC 1ZEAL 4DN4L 3O6KL 4HQQH 2Y6SC 1V3KA 3N9GL 1QSEA 1FIGL 1V7ML 3D39A 1BFVH 3DECA 3OAYK 1GOFA 2P5EE 3LKOA 3QUZA 1UZ6E 4QRPA 3RHWF 5GSVA 3EIFA 3LY6A 5C3TA 1MAML 2J6EA 1RUAL 3OZ9H 3MRBA 2DYPA 3QDGA 3HNTL 2R0WH 1IAKA 5C9JB 3V6FA 3FFCA 2XIDA 3GHEL 3IAQA 3S8WA 5GGRY 5C0FB 4M8QB 4M3KB 4ZMAT 2R23A 4Y4KA 4OM0H 3TNNB 4UOW0 3O2WH 4FQIH 1I1AA 5MENE 1CICC 3MODL 1A7PH 2N4IA 3PGFH 1FCGA 5D7SH 1CXKA 1RHHB 5FIEA 4R2GD 4XBPB 3QEQE 1LO5A 2DM2A 3MV8B 2HKHL 1MFBL 5I8CA 3HZYB 5ALBL 5DRZB 1MWAL 3RA7L 5F8QC 3V6ZA 1JI1A 3DGGB 2ARJB 5IV2B 2AKRB 1WTLA 3D9AL 4D9LH 4U1HB 2JIXA 4O51A 3V79C 3GSNB 1TVDA 3DI3B 3QDJE 5I1EL 2AK1H 2Y5TB 4LCIL 1CLYL 5EIIB 4LVNB 5J1TC 3LQAH 5F1IA 4XXCC 3GSWA 3IDGB 3OGOE 1ZK9A 2ORBL 1WAAA 3SDXE 3DMMA 5FOBA 1TFHA 1TZHA 35C8L 2NLJB 1EXUB 1UYWL 3SGKA 1YEJH 4LKCA 2AQ3A 1GGIL 3FT4B 3VXRE 4FQCL 5JR1H 1TQCC 3F6IA 2A6DB 4RGNB 2P47B 1Z5LA 4P5TD 1F00I 1X5IA 5A16A 4KVNH 5HHOB 2BC4B 4S1RH 1T0MA 3M45A 4JKPH 2EZ0C 4PJ9B 1JJUA 4W6WB 4WHDA 1A6VH 1ZGLP 1CE6A 3LRSB 4I3RL 2YBRB 3AB0C 4S11A 2P49B 1MLCA 1T7XA 2EE9A 5CWSB 4K8RC 4MGXA 1FZOB 4Q2ZA 4ZXBC 4HKBB 3QUXD 5EPMA 3VXQB 2VXSL 4OZGE 4Q6IC 3UEZA 1GGTA 4CVWA 1KPVA 2ZNXA 3KLDA 2QJDA 4JHZA 4MYWB 4HDIB 1C5DB 3T4AB 2NXZC 1CGSH 1S78D 4G6FB 1ROWA 3EOAB 4KJYA 5F7EL 3GKWH 1Q9LB 2BVQB 4APQA 3GSNH 3JZ7A 1T7VA 1MCPH 2GYSA 4GUPB 1HCFX 2HYMA 3D5OF 5D1XB 4JG0L 1DUZA 4WI8A 4YHYC 1S9YA 2FECL 3BXNA 4OZFA 3ZMRA 3QCUL 5TPWH 1I1CA 1OGTA 4L3EB 3T0EB 1A7OL 4JM2B 4PG9B 5F7UA 3L3JB 1UXSB 1KELH 5T3ZE 5IW3A 3UBXI 2QQLL 1QYGH 4NQCD 1JGDA 3QXAA 3ZYZA 5HGAA 1VADB 1CFNA 1GGCH 3HI1B 1N5YL 2DMKA 4U1JA 2NR6C 4WGWB 3H0TA 4RX4A 4LFHD 1DDHA 1C8PA 3H7BB 4XC3L 4X7EC 5IB1A 1UACH 3C2AH 3BOVA 2W0PA 2WINB 3EYFB 2VWEC 3A67L 1JF1A 2EXYD 3EFFA 2FATH 1JZ8A 4LEOA 1Q9OA 4OD2A 1ZHKA 3DUHA 1BVLA 2R69H 4XB8A 3KNBA 3LMJH 3GI8H 3GMPA 4YIQA 1AFVL 5DJYA 4K94H 1R3KA 3LEVL 1U8PA 4OD1H 4LDEB 4DZ8B 2PR4L 1IGTA 4FQQB 5C0AE 2PTVA 5A2JH 5J13C 4HK0A 4TOYL 4YX2H 4QF1B 4OF5A 2AXGA 5FUOL 3PUCA 3RPIA 3BUYB 3WFCL 3LKPB 5K9OA 4MA3A 2OMBA 2GJ6A 1URLA 2R1XA 2IPUK 4PY8J 4LIQE 3K2MC 3BKYL 4XCCL 2VR4A 1P84K 2BNUA 4I4WA 3BPLB 4U1MB 1CFVH 2FHFA 2A6JB 2ICWA 3MRHB 4NNXA 2EDRA 5BW7A 3P4OA 4J1UB 5IG7A 1IEAA 1P9MA 2YR3A 3B6SB 2YD5A 1JGEB 5AUMA 1PY9A 3O9WA 2C4FU 5I1IH 2HJFB 3ARZA 5GSRA 5C0FA 1IKNC 3I6KA 4M8QA 1F6FB 1S7SB 5AG8A 3I2CL 5D71L 2G60H 3OQ3B 4OLEA 4WWKB 5FDYA 4TSBH 4DK6A 5FYKL 1RHHA 4X6FB 2WV3A 3A6BL 2XY2A 4X6CE 5KSAD 4G7YL 2QQKH 3BD4A 1KPRB 3X3GL 3HZYA 4PREA 4PGEA 5DRZA 5EUKB 2W9LA 2ZCKH 1ZLUH 3W9EA 1A7QH 1LEKA 1A4KA 5GJSH 1KB5L 5IV2A 3W0WA 4JPWH 5JHDA 1HINL 4TVSa 2BY3A 4P46C 5DHVA 4NM4H 5BZWB 3ES6B 3IFPA 4GAYB 3PDOA 4MA7H 2IEPA 3RL2B 4M8VA 4X6DA 1T03H 3VWJD 1DCLA 1KPUB 3QPQC 1J8HB 3H9SB 4KTDH 3NFPA 2AEQL 3GBMH 3T2PA 4AEHL 4B41A 1YPZB 5EZIL 3PL6D 1FO0H 5F7YC 1IQDB 2XZQL 1J10A 3TO4A 2PXYD 2PO6B 1ZWIA 5HHOA 1I4FB 4W68A 2EE2A 1HHHB 1YC8A 1E6JH 3O4LE 3LQZB 3QDMB 4LU5H 3GKZA 4Q0XH 2QQNH 3MBXL 1T83A 5DC4B 3WKMH 5HDBE 3VDAA 1L4IA 3VFSB 4G5ZH 3EYSL 4MD0B 1FBIH 3VXQA 3MLUL 3QQ9D 4YWGL 4P2OB 1OSZB 4P57A 1WFUA 1UVQB 3UTSE 3WIFB 2H1PH 1V8HA 4R4NC 4QRRD 1J0HA 1C5DA 4HS6B 4V1DD 3T4AA 2ITCA 2OP4L 2LE9A 1NANH 2O93L 2V2WB 3QQ4B 4UINH 5ETUA 3D3VB 1TMCB 4XNXH 3RU8H 1ADQH 4G6KL 3WL9A 4IJ3C 1A7RH 5EOQH 4GUPA 4NP4H 3U4BL 4AMKH 5KS9B 4HS3A 5FCUH 3BT2L 2EH7L 5D1XA 1N64H 1JWSA 4HX1B 4NQDB 4TSAH 2DI9A 1RSFA 3I3EA 4XCNB 4KI1A 4X6BA 2F58H 2YKLL 1XIWD 3PWVB 2DQIH 1TJIH 3GMQA 4X6EA 5HVHC 4MAYB 3SGDI 4XVJH 1OP9A 3NCCB 3QXWA 4M7ZC 4WFED 5F6HJ 3IVKA 5IEHA 3B3IA 3BGFB 3OF6A 4X8XA 3BKCL 2R2BB 5D7IE 1NFKA 5F7MC 4WFHE 4KRPD 5F44A 5DZOA 1IBGL 1J1PH 1CF8L 3EYFA 3VFWB 1EERB 2XQBL 1CVRA 1SY6H 3NPZB 2AEIT 1IGML 4KI5C 3SDAB 5HGDB 5EFIB 4PJIE 1EEZA 1NGQH 1AIFB 1OP5H 3F7VA 4WW2B 2CK0H 1WBXA 5MERB 1P7HL 2YN5A 3JWOL 4UOW1 1BQUA 4O02H 2DOCA 1UXWA 5LQBH 5AYUH 5HYJA 1MCSA 2OZ4H 1B2WH 4LPXA 2GI7A 4OZHE 3RVWD 2DI7A 3E6FA 4QF1A 5C6TL 2KH2B 1OTTD 3N1PC 1T1YB 1OTUD 1S7XB 3BUYA 5GHWL 2RAMA 1W8NA 4JRWA 4NQEE 4CGTA 3HC0A 1R5WB 3DX6A 1FZMB 4BH8A 1DE4A 1F3DH 4QY8B 4PLOB 4Y4FC 2IPUG 4S1DD 1IC5L 1A1NB 4DKEL 1I7UB 5GRJH 4IMKC 4HJ0C 2YSSA 4MQ7B 2UZIH 4KI5E 1QFHA 3HNVL 4PJXA 1F4YL 3UTOA 5C0IA 4ZG1A 3B6SA 5E03A 1K4DB 1T20A 1QKZL 3ZKSD 2B1AH 4PJ7B 5TJWK 3VRJA 4HKZA 4F9LA 4NT6B 3PQYB 2W0FA 4X9HA 3ZE2E 5HI5D 3ZE1E 2R9HC 5IMKB 3A6CL 3D48R 1LO2L 1EJOH 5C0DB 2JCCB 3ULSA 3WFBL 3HR5B 2NW3B 5DEGB 4R7DA 1MF2H 2ZCHL 1INEL 2K3TA 4GBXC 5HHXL 5B38G 4ZUUB 5H8DA 1W0YT 5FYJE 1HSBB 1OAQH 5D1ZC 3ZDXF 4XWOC 4PJAF 4I9WD 3QA3B 3CK0H 1KF9B 5ALCH 3JTSA 1I75A 3CLEH 1JYVA 3SE3A 4N0CD 5E2WL 4H20L 1QQDB 4PJDB 3BZ4B 4L4VB 3QJHA 3ES6A 1VFBB 1S9WB 4AG4L 5FM5M 4YHMH 1X4ZA 5FYKD 1MCIA 3RL2A 4LKXA 3DUSB 4LLDB 4W4NA 4GXVL 4JPKH 1IMHC 4KHTL 2AJSH 4GAJH 5EC1B 1S7RB 4NN5B 3PWPD 2WIMA 1YPZA 4X7SL 4IRJD 5C09E 2VNCA 1UWXH 1SJVA 1XCQB 5H94A 1DQDL 4PJ5B 1IQDA 1AGBA 1T2JA 3H3PH 1I4FA 3KYKL 2V7NB 4NQSB 1HHHA 2ATPA 4U0RC 5FGCB 3RWCB 3QFJB 2XWBA 3MFGB 2VLRE 2AS5M 1A3LL 5F89B 2ZG2A 4QCIB 1RZ7H 3SO3B 4HGWA 1U8JB 2A6KB 5JA8B 5B39B 5GQBA 1DBJL 4MD0A 5FV2A 3QQNA 3LHPL 2CDEB 4P2OA 1OSZA 3O11B 2FX7L 5I76A 1I3RB 5FGSA 1CD1A 3EO0A 3WIFA 3SKNA 2L0DA 4QTHA 1NL0H 2F74A 2ATKB 4YGVB 1Y18B 4F7CB 1CLZH 4N68A 4E41B 3LKRB 4F8QA 3WV0A 5GS2D 3D3VA 5AEAA 4EXPX 4NQVB 5CCKH 4CW1B 3HMWH 3MLRH 2F15A 1HQ4B 4F3FB 4MAUH 5ICYB 2VDML 4OF6A 3O0RH 5H35A 1DTUA 3AS3A 4XCNA 4UT6L 3W39B 2AABH 5IFAH 1A3QA 3VI3F 1LEGA 3U0PB 4HFUH 4O58H 3ARWA 4N8PA 3TYGH 5D7JD 2F54E 1AKJB 3MLTB 3AGVA 3HLAA 2R2BA 4Z7VB 1BGXH 4KDWA 3VJ6B 4OGYL 4OV5A 1R3JB 1HKLL 3GJFA 1B88A 1LO4H 2DQTL 3U1SH 1KIRA 3OKOA 4GH7B 4P3WA 4JO4H 5F71A 3S5LA 4HT1H 3L5WA 2AI0L 3SDAA 1F2XK 4NZTH 1XF2A 3RNKB 3SDCD 1RZGB 3P77A 4OM1L 5I71B 1U3HD 3C5ZC 5CSZB 1CZ8H 3NCJH 4WW2A 3MXVH 2VH5H 4CMMB 4YQXL 1EH9A 1MAKA 3S96A 3ZT7A 1VFMA 3BAEL 5CJXA 1MFCH 2X09A 1J8KA 2NY2B 2VXTH 4M7KH 3VWKB 4ZNEE 2O5YH 3NCYP 3K7UA 3QFDA 4OFVA 3OG4B 1YC7A 1AXIB 3OB8A 4HQQL 3RZCD 5CIPA 2NTFA 1BFVL 1LNUB 4QY8A 1NMCC 2X4RB 5D6DA 1A1NA 3MRNB 4ZFZB 2UWEF 4AQOA 1I7UA 2DIBA 3TBYB 4LLMA 3IAGC 1X7QA 4RA3A 3GSVA 3OZ9L 2HFFA 4MQ7A 5DO2D 2DJUA 2R0WL 1UQSB 2P45B 1JNLH 5F7LB 5TQ0H 2C3VB 5I1CH 3CFEB 1JNJA 4JRYE 1YMHB 4GRLB 4IIQA 4OM0L 3RRQA 5GS3A 4JKLA 4KMLB 1H8SA 3PQYA 1XR8B 4FQIL 1MHEB 1IAOB 4JFXB 1A7PL 4JFDA 5D7SL 1BD2E 5IMKA 5F7NC 1ORQA 5C0DA 1WZMA 3HR5A 2NW3A 5F6IC 4XXDB 3GGWB 3GK8L 1I8KA 4XP6H 1Q9WB 4BFIB 2VERN 4H1LG 4NO5B 3VI4E 2AK1L 3LVEA 3PV6B 3RY6A 2DTMH 4FOMA 3S4SA 2Y36L 3QQ3A 3T2OA 3LQAL 1HOCB 4EUPG 4L4VA 5F3HA 3MJ9L 3BISA 4JKKA 4I2XE 4A2LA 4HULB 1YEJL 1VKXB 3GSXA 5FKPB 1G7IB 1A9BA 3FN3A 4XPTH 4EZMA 1EFQA 3C60D 4YHPA 2I9LB 4ZO6A 4ESKA 4KVNL 3O3AB 2AJVH 2ZUVA 4PYGA 5GJTH 4HZLA 4S1RL 4HUWA 4JKPL 3ULUC 1MJ8H 1R3HB 2OM5A 4XZUA 5E6IC 5D70L 5HDLA 2YPLD 1A6VL 3LPFA 5FM5O 2RQ8A 3WN5B 4GG8B 4HCRH 1CT8B 2P5WE 1NFIA 2VDRH 4OCNC 4PV8A 4G9DA 3P4MB 4PTUB 3RGHA 5FECA 3WJJC 5KTEH 4PJHF 5F89A 2WBJB 2AAVA 4K7PY 3GHBH 1UG9A 3GMNA 5IQ7H 3NZ8A 3VXSD 3VW3L 2RJMA 1YZZA 3OKDB 1G7PB 2CDEA 4HIJB 1UJTA 5L2KA 3O11A 3CPLA 3DETC 5J11B 1CGSL 4LAJH 4GFTB 2NY0B 2VDKH 3JTTA 3LS4H 3GKWL 2ATKA 1R5IA 4E41A 4HXAH 3GSNL 1S3KL 1ES0A 1UJ3B 1IM9D 1MCPL 1P4LB 4UMGA 2QSCH 2SEBB 5KVDH 5C8JB 1MI5D 3ULUE 2ESVB 4F3FA 1T5WB 5ICYA 2GSIA 2VE6B 4K2UH 4JKMA 4R8WH 4UNUA 5TPWL 1TVBB 4CVZB 4EVNB 5KSVA 3C2SA 4ZAKB 1MJ7L 3W39A 1NCAH 2E7LC 5E1AB 4U6VH 1KELL 4LCWB 4PJFF 2DQCH 4Y19E 1RK0A 4ZS6C 2IBZX 4FZEH 3RFZC 5C07B 2BFVL 5D72H 4P4KD 1X5GA 4FTVE 3BGAA 4MB4A 1NANI 3JV6A 4Z7VA 5K59F 4ONGL 4ODSH 5E6ZA 1R3JA 3VJ6A 2PYEB 3JV4B 1UACL 2DQDH 3LRHA 1MCBA 3KJ6L 2GAZB 5JW3H 2LU4A 1QO3B 1JHKH 3LS5H 1AO7E 3UDWC 3RKDD 3RAJH 5DJZB 1GC1H 3QIBC 2PYFB 4NZRL 4PD4J 3LMJL 3GI8L 1G0YR 3OAZH 1VPOH 4OQTH 5I15H 4K94L 5EBLB 3TJHD 3B9EA 5J06A 2VC2L 2QSTA 5LGJB 4QOKB 1U95B 4YX2L 4RBPH 5D1QC 4EI5C 4NC0B 2NY6B 4LNRB 3PWPA 2I07A 1PJ9A 3BKMH 5CINH 2X6MA 4I8DA 2F5BL 2H8PB 5IMOA 1FSKB 1OAUL 1HWGB 4D3CH 1YMMD 2FL5B 4NQXA 1BF2A 1NLDH 5FUZL 1CXIA 5ID0B 3FQRA 3DWTA 1RJYB 3CFCL 1CFVL 2P5EB 4U1SA 3L6FB 4KRMB 1DBKH 3BIKB 4OGZA 2GSGB 3RGVB 3G5ZB 4HLJA 3TBYA 4L1DA 3EHBC 4P2QD 4Y89A 5JLZB 1RK1B 1GVIA 5ADOH 1UQSA 3OR7A 1QG3A 5I1IL 5EZJB 2J3SA 1W72B 2BERA 3I75B 43C9B 2FB4H 5ICXB 4R90H 5SWZD 2G60L 1B0RB 4DW2H 3EOYG 1IAOA 4JFXA 1ACYH 3ZDYE 4PJCF 2YD1A 5DT1L 2QQKL 5EZOH 4ONHB 2JJSA 3QEQB 2ZG1A 2IQAB 4KKBD 5SX4H 2ZCKL 1EO5A 1A7QL 1J87A 4NYLB 3WNPA 1IILE 1PSKH 3WE6A 1ZLVK 4CADB 5BVJA 3QDJB 2R4SH 3QT2A 3KYAA 4U3CA 4U49A 1U91A 1T03L 5E8NB 1J0KA 2B0SL 1X5YA 4MQXD 1EGJH 3SDXB 4KTDL 3TT3H 3EO9H 1F6AB 4OBSA 3BSZH 3GBML 4ZFFB 3FN9A 1VKXA 1PY4A 4GMTH 4X8JB 4A2MA 1G7LB 1CICB 3VXRB 5F97E 1FO0L 3P4NB 4PRPE 2I9LA 3O3AA 1FGVH 5LBSH 5DA4A 1WIPA 4MSWB 5EBWB 3N1FC 1CQYA 1R3HA 5ID1A 4FNLH 2FJFA 1E6JL 1LD9B 3NIGF 3CDGB 2DLEA 2DM7A 3ULVC 4LU5L 1T1ZB 1AXSB 2W9DL 4Q0XL 1J0IA 3WN5A 1AGFB 4U1GB 3WKML 1I9RH 2P7TA 4KV5E 2CDFA 3PHQA 4YZFF 4G5ZL 4LBEB 5F9DC 5SV4A 1FBIL 4NN7C 4N8CH 3RWHB 3FB6A 4JE4B 1MRFH 2EXWD 4OZGB 1FP5A 2H1PL 3I02B 4P2YA 1RPQA 2Z92A 5B4MD 1T22B 4UINL 4OLXH 3MCLH 3RU8L 4QTIH 1UJ3A 4I18C 1A7RL 1KCRL 4AMKL 4NP4L 4OBRA 1BVZA 2ESVA 2DBJA 2ZOLB 1TQBC 1N64L 4M7JH 2VE6A 3ULVE 1U42A 3MV8D 2GQHA 3MRPB 1UB6B 4CVZA 3OG6B 3DIFB 4O2EA 2DQIL 5D8JH 3S36L 3OAYH 1P7KB 2KDGA 1JGUH 1EIBA 1NCCH 1CGTA 2FO1A 5E94B 3AAZB 1KJ2B 4ZYKA 3QIUC 3K2UH 4Q6IB 4YGAB 1QSFE 1HHKB 4P23B 4M6MH 5GGQH 2NXZB 3PWUB 4F80A 2GAZA 3DO7A 3WDHA 3OKNA 4F7TA 1LMKA 1QO3A 2BOBB 5GISH 4DZBB 5I0DA 1NGQL 5DJZA 1X5FA 5KOVC 4XHQA 5CBEB 1EO8L 2HMIC 2CK0L 3BZDA 4P5KA 1RUKH 12E8L 2WP3O 4RGND 5IEKA 5L6YL 5AYUL 2OZ4L 4LLVA 1B2WL 5IB2B 1U95A 1HH6A 2J12B 5C0AB 4MJIA 1IC1A 2WWKO 5TFSH 2BVEA 1UT9A 3I6LD 4PJ9D 3QCTL 5C0CB 1GCFA 4HWNA 1U93B 2M1KA 3G5YA 2FL5A 4EDWH 3UPRB 4CAGA 1LK2B 1EAPB 4JFPA 4Z0XB 3LIZL 3KLSA 1A22B 5TQ2L 5GRJL 2A38A 1BREA 1JGLH 4XMKL 2P5EA 5CHNA 1OGAD 3BIKA 3U4EB 2GSGA 3RGVA 3BZEA 2UZIL 3DVNB 3G5ZA 3GBNH 1IEBB 4I3SL 1I85C 4WV1C 4GSDH 1L6ZA 5IIEA 5GGUA 4LSPH 1KCVH 5EZJA 4K8RH 4G6FD 2B1AL 1W72A 1XF5A 3NPSC 1PZ5A 3RBGA 5C0BD 5T3ZH 43C9A 1IAIH 2H32H 4QT5A 3P0YH 4XPAL 1KULA 3QULB 1BEYH 1NEUA 4R26L 5J13B 5K9KA 3JWDH 2HTKD 5I1AB 3VFOA 4HWEH 2F53E 3ARTA 2VSCA 2NZ9D 2XKUA 4X6CB 3MR9B 2GUOA 2IQAA 2X4PB 5I30H 4UIKH 1IGYB 4NPYB 3AM8A 4L3ED 3QEUB 5GGTL 5FYJU 3T0ED 5HYSG 5E1HB 4JM2D 2N7AA 3W9DA 3OKLA 3CK0L 5GS0H 5ALCL 4LQFH 1JNNL 3S37H 1YEKH 4Y2DA 4CADA 5L2JA 5JW4R 3QDJA 1T21A 5I66A 1I3VA 1FJ1B 1WICA 2H6PA 4P9MH 3V5KB 1GGBH 3SOBH 4U6TA 4WUKH 4O5LH 3INUL 2BY0A 4MZ3A 2AJSL 5AZEH 3HZVA 1PQZB 2LVEA 3O2DA 4N1EA 1UKSA 1A3RH 2MKWA 5A3ID 4OGXH 4ZFFA 5BQ7B 3U82B 5DDHB 1D6EA 4LIQH 1FNGB 2Z91B 3ET9F 4Z7OF 5KOMC 4M48H 5DVNA 5IFJA 2BP3A 1QLFB 3HMXH 4S10A 2NQCA 5L9DL 3NCYS 3NFNA 4GG6E 3U46B 1WWAX 3RUGF 1W8OA 5BS0E 1F4AA 4PJ8C 1A2YB 5SWQB 4KDTA 1T1ZA 3O4LB 1AGFA 2Z0BA 1A1MA 1BFOB 4P46B 3H8NA 1RZ7L 5GXBB 3QJFA 4WFGD 5CMAB 4LMQE 1EJ6A 4ZUVB 4MNQE 4Z7WE 4CJ0A 5JXEA 2HT2C 3G6JF 5DMKB 5CJOL 3PWNA 5ITFA 1JZ3A 1V3MA 1KXTB 3UTSB 1NL0L 5ISZE 1I8LA 3DSFH 1RIVL 2O5ZH 3O4OC 3OXSB 1ZT4A 1CLZL 4WU7A 4JN2A 1AQKH 5I19H 2RHEA 3MCG1 2I9TA 2YS4A 1Q0YH 2X1PA 5LJYH 4XGZA 3MLXL 1MCKA 3O2VL 4RISH 3ROLB 5CCKL 4V2BA 3MLRL 4XPGH 1MCLA 3L7EB 4MAUL 4X4YA 2DB8A 2Z31C 4DUWA 2DDQH 2ZOLA 3O0RL 3KYMA 4URTB 3WIHH 2VUOA 3BDYH 1FL5B 4LCYA 4HUVB 3MRPA 2AJYH 4MX7B 2QR0B 4O9HL 4MJ4A 4HFUL 3ZHKA 2R1YB 4LPTA 4O58L 1P7KA 3TYGL 5IBTL 2MCPH 3BH8A 4D9QD 4DKDC 1FNHA 1BGXL 1KJ2A 4KKCD 3TNMB 1MQ8A 5DJCB 4LRIA 4Q6IA 4Z7OE 5ESVA 1EFXB 1HHKA 4P23A 4XP1H 2C1PA 4M1CD 1S7WA 3U1SL 3KYOA 1MAJA 4JO4L 3TIEB 1J86A 5JW4Q 4LLAA 3PWUA 4HT1L 2VLKD 1OB1B 3SKUD 1NKOA 1ED3B 3L3OB 1R24B 1J8HD 5CD3B 2DLHA 4ZOBA 3H9SD 1FPTH 5D7LE 3QPXH 4PJIB 1CZ8L 3NCJL 3MXVL 2VH5L 1FYHB 5HVGB 3HB3C 4NO0B 2AK4E 1U8QB 3C6LC 3CSYA 5TF1L 1NAKH 2EO1A 3PHOB 3L3HB 2VXTL 1OAZH 3D0VB 2PO6D 2YHGA 4XBEL 3BFOA 2O5YL 3G6JE 3PP4L 4OZHB 3O3DA 5C0CA 4JHBA 4P2RA 1U93A 2VLLB 4NQEB 1XH3B 4M7ZB 2P4AB 3VFPA 3QDMD 3ARGC 1YN7B 3BHBB 4PLKD 5TDOB 4JVUA 5EU3B 3SKOB 3ZZ1A 4KTEH 3MJGX 2XI9A 4OTXH 1EEQA 4WU5B 1Y0LB 3TLRA 2H2SC 4NOBA 5TE6H 5E70A 5J6HB 1IEBA 2UYLB 1JNLL 1XGPB 4NKMB 4YAQB 3JWNC 5TQ0L 1JCKA 5I1CL 1YY8A 4TNWK 3IDNA 3C9NB 4BQCA 1IAIM 1HHGB 1YEIH 4U1NA 3SQOL 5E9DE 3QI9C 2FO4B 4MB3A 4PGDB 2A74B 1BAFH 5CP7B 4ZPVB 1KC5H 4GW5B 4KK6C 5BXFB 5I1AA 2FWOA 1FFOA 4HUUB 4X6CA 3MR9A 1JMXA 3SBWC 4NPYA 4M62L 4ERSH 2C4FT 4XPBH 4Y4FB 2RFXB 3EJZD 4XWGH 3B83A 3SN6N 2DTML 1KXVC 4Q9BA 1Q8MA 3MPCA 1F58H 2Z35B 4U1KB 3HAEG 4W70A 3LQMA 3MRFA 3QEHB 4MHHG 5F9OH 2D03L 5J9PB 2OS7A 3T2QA 3Q0HA 3V5KA 1F3DJ 2W1NA 2X2YA 3UTPD 2W9EH 3SE4C 4XHJD 2VDQH 4WI4A 4XX1E 1H15B 1Q0XH 5ADPH 4XPTL 4FFWC 3VDCA 2J2ZA 5IR1A 1OARH 5SX4I 3VG0H 1U6AH 5BRZA 1BHGA 2Z91A 4HS8L 3TCXA 2AJZA 2AJVL 3PWJB 4OCXH 5C09B 2DICA 4WO4C 5GJTL 4LCCA 3VCLB 3OAUH 3L3DA 2VZUA 4WEUD 3TIDA 4GBXB 3LN4B 1OVZA 4WDIB 5D1ZB 1A2YA 3TT1L 2YWZA 1XF3A 2EC8A 2ZCLH 3HHRB 4W81A 5I1LB 4NDMB 2VLRB 4HUMB 4L29B 3T3MF 3GHBL 3WFEH 5IQ7L 1ERNA 2W0LA 5JORA 3DBXB 4OLYL 3WYRA 2BK8A 4AIOA 3ECBB 2C3HA 1BJ8A 2WWKT 3BO8B 1A1OA 1MFNA 4HV8B 5C08E 4C83A 2EH8L 2QHRH 4I0CC 3LS4L 3O41A 5SWSB 1XZ0B 4EUPB 4PGJA 5EO9B 1NDGB 1EMTH 1HI6B 3OMZA 1CDYA 2QSCL 5GRXG 3FQTA 1YEHL 2BNRA 1T2QH 5KVDL 2IH3B 4D8PB 3FCTA 3ROLA 4PJAB 5FDWB 4MNGE 1KIQB 4LGSB 5I1JH 4XNQB 1F45A 5DWUH 1N2RB 2V9RA 4F7EB 2OCFD 3KR3L 4U0RB 3NCMA 1FL5A 5HYIA 1CL7L 2A1WH 4R7NB 4U6VL 3IJHA 2AJXH 5JQHC 4K7FB 1F42A 1JPSH 4IRSC 4HK3N 2DMCA 4DOHE 3MXWL 5D72L 2DLFL 4PLNC 3PGDA 2F54B 2VXUH 4ODSL 5GZOC 3TNMA 3V4PH 5F88A 2CGRH 1N7MH 2J8UE 3D85A 3BP5B 1CXFA 3VFUB 2X70B 3RWGB 2Q7YB 5JW3L 1TITA 4E5XB 1J12A 1OB1A 1JHKL 3LS5L 5HI4D 3RVUC 2ZSWB 1G7QB 3RAJL 1R24A 4MD4B 2XTJC 5CD3A 5CGYC 1GC1L 1IC4L 3I85A 3TPUB 4GKNB 2R56H 3VXME 1ORSA 3UJIL 4OQTL 5EUOE 1DLFH 2KPNA 3T3ME 4ZDHA 4GT7A 4H1LH 5IKCA 4PJ5D 3PHOA 4ISVB 3L3HA 3D0VA 5DJAB 2GY7B 3BKML 5CINL 4M9OA 2FSEA 4D3CL 2OK0H 3IKKA 4EUPH 1X4YA 3L3GA 4RAVA 2H26A 3QFJD 5JOFB 1YN7A 1UZ8B 5KAQG 4G8EB 4MD5B 4KDVA 2A9MH 3O6FA 1G0XA 3ZLQC 1X44A 3QUKA 4H25A 3W82A 4B0MM 3S36X 5T1LA 4YDLC 4ENEC 4XX1G 4DUXA 2VRAA 2HJKB 3UC0H 5J6HA 2XTJE 1M71B 4XTRD 5EIVA 1DZBA 1YYMH 4BQ9A 5CD5D 1SM3H 5D2LE 2A9NH 3C9NA 3GMLA 4X0KB 3JV5A 1HHGA 2IMMA 5DVOA 5IBUG 4BSWA 2FB4L 3C5ZB 1KCLA 4JRYB 4R90L 2WZPD 2GEEA 1LP9F 4DW2L 2FO4A 5CILL 5FK9B 2CKNA 3CCHA 1ACYL 4EOWH 4ZPVA 2ED7A 2FNBA 1XT5A 3KPSD 1BD2B 4GW5A 5T1KB 15C8H 2BVUA 3GSQB 3GJEB 4HUUA 1JPFA 5L0QC 2D7TH 1XEDA 3BWAB 1G1CA 1GAFH 5LGHH 3CMOL 3KPPB 4LF3A 4NZUH 1PSKL 3UP1A 2PTTB 2EC9U 1NMCB 2RFXA 1XGYH 4EQ2A 1Z9MA 5LXGL 1AKJD 4U6XA 2R4SL 3R8BB 3VRLE 2Z35A 4U1KA 1MJJB 2Y9RT 4AENA 4I0KA 2ZPKL 1MEXH 8FABA 1IAII 5J9PA 1G6VK 4Z78B 4Z77A 1WBYB 3ZKQD 3U9PH 2N1KA 2N56A 4NN6C 3VGEA 1FHGA 1EGJL 4FQXA 1DQJA 4I2XB 1ADQA 3TT3L 3EO9L 1MNUH 3BSZL 4XBGB 1FCCA 4GMTL 3BPOC 5MP6L 5IMMA 5E00B 2VABB 2XA3A 3RNQA 4UT9H 5DC0A 1QBAA 3GBLA 3BN9D 4HPYH 4HJGB 2ITDB 2BXZA 3TVMC 3VCLA 1QPPA 4LSDA 1BBDL 2PN5A 2XZZA 5F6IB 1FZKA 1VEPA 2NY2D 4GBXA 1RV6X 2F8XC 1R3IH 4FFVC 5IROC 1QVOB 4NRYB 3VWKD 3MROB 4PS4H 3IRPX 1W72L 2OR8A 1LDPL 3IF1B 1I9RL 4WTXA 2P5WB 1QFWH 1LP9E 2VXQH 4UIMA 2APVA 4N8CL 2BY2A 1ZHNB 1MRFL 2AVGA 4U05A 3CVHB 3VXUE 4RIRA 2WUBH 5GIRB 2PETA 3ECBA 4LSSH 3KYNB 2BMKB 5I17A 1FG9C 5ACMA 3AREC 1JF5A 3TFKD 3FMGH 5SWSA 5HHQB 1E6OH 1MHCB 4OLXL 1Z3GH 1H9VA 4GRLD 5EO9A 1QRND 5E8PB 1IL1A 3HG1D 1CXLA 2IH3A 1F3JB 4D8PA 1N5AB 3Q5OA 4PJAA 1G9NH 1BF8A 3HA0A 5J57B 1UH3A 2IAMC 1O7VA 4XRCB 5E6IB 3QUZC 3UTTD 4F7EA 5IHBA 1RZ8B 4UTAH 5DSCB 1KJ3H 2ADFH 4O2CB 2ZUTA 1NC2B 1ZVYA 4Z8FH 1JGUL 4GRWH 4WFFE 3BUTA 5BVPH 4Y19B 3MJ7A 2W59A 3SCMD 5I2IA 4WI5A 2CK2A 5I1GH 4PD4K 3K2UL 2F54A 1ACZA 4FTVB 1BZ9B 4Y4KC 4HWBA 2H45A 2X1XR 4K3GA 4WRLA 4CVUA 4MXQD 4M6ML 5GGQL 3IKCA 2LAGB 1I1AC 3CU7A 1MFDL 3BP5A 4C56D 5JDJA 1MVUB 4FG6C 3MRQB 2X70A 3EOBB 3WNKA 2PUQT 4ALAL 4OAWA 4QWWD 4G8IB 4JFFE 1TNNA 1QEWB 4PB9H 2ZSWA 3DVGB 5GISL 1E4KA 1AO7B 1JGVH 1S8DA 3CXDH 1XFPA 5IB4A 3TPUA 5JW5B 4GKNA 2ID5A 3MOQA 1RUKL 1CFSA 3FT2B 1QSEE 2NY5C 4LLWB 3UJJH 3D39E 5E5UB 2BCKB 3Q5YA 3LCYA 4QRPE 3E2HC 3QXTA 4Y5XA 1ZA3A 3MRKB 2WMPA 2E9IA 4ISVA 4MLSA 1OT1A 5FKAA 2HG5A 5IB3A 1I1RA 4JDZB 1MUJB 1EZVX 3QDGE 4RAUA 5HJ3B 3BWUC 1DBML 3DX7A 1D5MA 2H9GB 3FFCE 4EDWL 4UQ3B 2VIRB 1P6FA 5IWLA 4UB0L 3L5IA 3QHTC 4G8EA 4MVBD 1NGWB 4MD5A 3EZ8A 3SGKC 1LO0H 5F9JB 3IS0X 5IT2H 3TBTB 1G6RA 3ULUH 5HSFA 5F96H 2XZCH 3QDHA 1RJCA 2HJKA 4E9LA 1M71A 4TPRL 4LSPL 1N8ZB 2NY0D 3QIBB 4K8RL 2GITB 4X0KA 5C0RL 5DMGD 2DTSA 5T3ZL 1KBGH 1N0XH 3P0YL 1CVSC 1KJ2L 3GSOB 4DKAA 1BEYL 1N6QL 4ZD3L 1G9MH 3BEVB 5D1QB 4EI5B 5CSBA 4HWEL 1I8MB 1PYWB 1BX2B 1BD2A 1EHNA 2A2QT 3GSQA 1WAAE 3H2WA 4PG2A 4UIKL 4JLRB 4PB0L 4ZAKD 1IFHH 3ESUF 5FO9B 1OW0A 1T66C 4ODXB 3KPPA 3PJSB 2Y06H 4LCWD 4NSKA 4U1IB 4Z9KB 3C6SB 3N1QC 5BMFL 1NGZB 2VLJD 1OPGH 4J3UA 4APQC 1GGBL 2X7LA 5FA3A 1P2CB 3GUTA 2PYED 3BQUA 4Z78A 1BWWA 4WUKL 3F7YB 4O5LL 3SKMA 4YEFA 1D9KB 5E8OB 4YXKH 4JRXA 5AZEL 4YUEL 1S7QB 3C5JA 4OGXL 3EGSA 4KMTH 3I50L 3U7AA 4LIQL 3HE6C 1U8MB 1NFDF 5EU6A 5IJKA 3E6HA 3SDDB 5DJ6B 4M48L 1ETZB 2GFBB 1QFOA 4PRPB 1EA9C 5HHPB 5CZVH 4QOKD 3X17A 3QH3A 5KZCB 2X4UA 2IALA 5MHSD 4X7DC 2GK0B 2DLTA 4KJQD 3WUWG 3QDAA 1QFWM 1S7UB 3KPRA 4RMWA 5FYLH 5F9WC 1K3ZA 5FF6B 4HBCL 5TGBB 3K0WA 5FO8B 2YEZA 4G3YH 5HYSB 2DQJL 3MZTA 3DV6B 3S35H 4AQ1B 1LGVA 1IGJA 1FG2A 1ZHNA 1JI2A 3IAPA 1IM3B 2A0LD 3EDFA 3GSRB 1CD9B 1I9JH 3CVHA 5ICZB 5AWNH 2WIIB 1S7TB 1MJUH 3M17A 4KH2A 3KYNA 4RFEB 1EO7A 2O5ZL 1E27B 5D93C 4NKDB 2R0LH 3V7AE 1AQKL 4L3AA 4HIXH 4N5EC 3VGDA 5HHQA 5T33L 4BQ6A 2X40A 1Q0YL 1OQOA 4ZO9A 1K4CB 1MHPH 5E8PA 4RISL 3NA9H 1WIOA 4XPGL 4ZUTB 4KQ4L 4M5YH 3VXNB 5IOPB 5MEND 2DDQL 1I7TB 5T1DH 3GFUA 2IGFH 3BDYL 4E0RB 1J11A 1GHFL 2AJYL 3IETB 3QEQD 1RZ8A 5DSCA 3U7YH 4O2CA 2BNQA 1NC2A 1QNZH 5GZND 1U92B 5BW7C 3ILQC 3MLPA 3G6AA 5AYQA 1P9MC 1AQDB 2MCPL 5ESAB 4XVUC 3O9WC 3TPKA 3H6JA 3NH7H 4NN7B 1NLBH 1OTSC 4BSVB 3LKQB 4LRNL 3ZYOA 2V9TA 5EBGA 1QSFB 3O8XC 2QADC 4JANB 5E2TH 1KJMA 3MRQA 4P2CG 1F13A 2FCBA 2DM4A 3HC3H 2GTWB 4YHOH 4QHLB 3QPXL 5CBAA 4G8FA 1DN0B 4YLQT 2GJ6E 5BV7C 1NBVH 1DR9A 4I18B 5JW5A 1F8TH 4V2CB 4Z7QF 1CICD 3ARRA 3FT2A 3VXRD 5ILTH 4HPOH 4M3JA 1TQBB 4XT1C 1SEQL 2XN9A 4PJHA 1B0GA 1OAZL 1NDMB 3CMGA 4G43A 5HHVL 4PP1C 4N0UE 3M8OH 1AI1H 3TF7C 2NPLX 1K2DB 4G6AC 4PJGF 2V5RA 5C0JB 3KDMB 2H9GA 4LOUC 1HILB 3NCBB 4L8CB 2FGZA 5EOCH 3QIUB 4KTEL 1UA6H 3HCVA 4C4KO 4XVSH 2F5AH 4LPUA 4U2ZA 1AXTL 4W4OA 4XP4H 4S2SA 5E2UH 3MBEA 3MRJA 5DYOB 3TO4C 4MJ5A 2YC1A 1WGOA 1YEIL 1W0WB 5K93A 3FHAA 3QG6A 2X4QB 4GLRH 3EJYD 3KLHD 5EZLA 1N6VA 1G7HA 1MH5A 4GKOA 3W0WE 4PJFA 1EX0A 2P8MB 1SBBA 3GSOA 1KC5L 5JHDE 1NJ9B 1PEWA 2DQGL 1T83C 4BZYA 4KY1L 1N4XH 1PYWA 1BX2A 2CLRA 2EZ0D 1SEBB 4JFEA 4YR6B 1GL4B 4NWTH 2F53B 3K8LA 4X6DE 3REWB 1B90A 2FRGP 2V7HB 4YDVB 3D2UB 2F19H 4XPBL 2Z93A 1HSAA 2XICA 4K8RD 4U1IA 5HHNB 4XWGL 3H9HA 5T3ZD 4ZXBD 2ENSA 1F58L 5DUPL 4PRID 4HHAB 4POYA 5DJ2B 4OZFG 5F9OL 3IGAA 1FN4B 3IXTA 3V52H 4WV1B 1P2CA 2HN7A 4NC1C 3V7AG 5K9JH 1CLOH 5HHOE 1F2QA 2NXZD 1TJGH 1U8HA 4M4PA 2VDQL 3P0VH 1D9KA 2APTA 4K3HA 5D1XC 5E8OA 2ICES 3WNLA 3NPSB 3GMRA 2FIKB 3VFNB 3GNMH 1Q0XL 1S7QA 2PCPA 2W60B 1OARL 4RAHA 3VG0L 2B4CH 3ARDA 3VA2C 5GS0D 3IDJA 2HVKB 3SDDA 1K8IB 1RZKC 3OAUL 4ORGA 4H26A 1MCEA 2EDJA 3DXAE 5C0AD 1LVEA 4LARH 4GW4B 4GG6B 3VRIB 5BS0B 1OD7A 4ODVH 2GK0A 2XKNA 2ZCLL 1J18A 3SE9L 4I5BA 5TE7H 3ZKMC 5TGBA 2D3VA 3S3JA 1XGTB 4GQ9H 4NC1E 5FHAH 1MREH 2BSTB 1CDBA 3BP4B 1D5BB 4TUKH 3GSRA 4Z7WB 1J05A 3OGCB 4PJCA 5FB8B 4RMUA 1ZLWK 2QHRL 3HAEB 2YA2A 4RFEA 4KC3B 4Y16D 5ISZB 3D25B 3MNZB 4RFOH 3H3BC 4G8GA 1K4CA 2BSSB 4ZUTA 1C7SA 1FH5H 4H0GA 5I1JL 1NEZB 5DWUL 3NAAH 1QR1B 2WW8A 4NCDA 4HIHB 1QFWI 1EBAA 3LH2L 4PJ8B 5LCVH 1F5WA 1UM5H 4N0YH 3IETA 2EDLA 1FVCA 4PRHA 1M6OB 3EZJB 1UGNA 4ZFOB 2XFXB 3QYCA 3VD4A 4AM0B 4WCYH 1QBML 4CU7A 5ESAA 2IJ0C 1I9IH 4DGYH 3LKQA 4F9LC 1N7ML 2D0HA 2DQFB 5JHLL 3Q1SH 5HYJE 3P9MB 3KPMB 4JANA 3B2UC 3O4OB 2OL3B 4D9RE 2GTWA 1U8IA 3QRGH 3T1FA 4ACPA 4IOIB 1DN0A 4OJFH 4ONFH 3NGBC 4P48A 4PGCA 4KWUA 5D7LB 1ZLSH 4KFZC 1LE9A 1R6VA 2R39A 3B9AA 1DLFL 2R0KL 2Z31B 3TA3A 4DN4H 1TVHB 4XP9L 5KJRL 2X4SA 2AK4B 1FIGH 1V7MH 3KPQB 1MFAL 4MXVE 2ZWLT 1QBBA 2Q86A 3SE3C 1NUDA 3HAEH 4PJXE 3G6JB 3MGTB 3T3PE 2EYRB 1T6WA 3Q5TA 3UTZB 1D6VL 1KCUH 5E5MA 3CNKA 3WXVH 1M05A 2CUIA 3O4LD 2FR4B 1V05A 5DEFB 1HXYA 3GHEH 3KPNA 1T3FB 4P46D 1DBAL 1P84J 1BIIA 1AR1C 1H8NA 3MODH 1YEFH 2X4NA 4HKXA 1OP5K 3QXDA 3VFTB 1YYML 3QPQD 4YDIL 3U6RA 3TZVD 3UTSD 1M7IB 4LAQL 1W0WA 1MFBH 2E5EA 1CFBA 2E8ZA 4W6YB 1CS6A 5IHUL 5JPNB 3C6LB 5E9DB 1BWMA 5DK3A 3BMVA 4EOWL 4IHOA 3VFRB 1EUUA 1NJ9A 5F8RC 1BZ7B 2NY4B 15C8L 4CVXA 3DNKA 5EWIH 1HHJA 3DGCR 4K71C 1SEBA 4JM4H 5DI8B 3WBDA 2F53A 2D7TL 2OL3H 4NQCE 2NX5D 2O26U 4HEPG 3REWA 4JAMB 3ARGB 1TLKA 2RR3A 2V7HA 3C8KA 3FOMA 4L3CB 4WHTB 4YDVA 5DHYA 1AD0B 4HSQA 2OQJB 1X6LA 3TN0A 1XGYL 4NKQB 1FFNB 5KW9L 35C8H 1RURL 2YD8A 2ADGB 5DMJB 2ARWA 1EVTC 2ICEA 3QISA 3VG9C 5DJ2A 4JZNB 4OF3A 1FN4A 4WV1A 4WFHD 3U9PL 1X5JA 2PTUA 4A6YB 4R4ND 4K3JL 3CFJB 5ACZB 2FIKA 4JQXA 3QI9B 4JFYB 4LHUA 4ODWB 3P9LB 1CE1H 5DRWB 3QXVA 4HF5H 3RWDB 3F62A 1GOGA 4HPYL 3OX8B 5CSGA 4NO0D 3LN5A 5IBUB 4F58H 4JDVA 4EJ1C 2XOTA 2HJLB 4AL8L 1H3TA 1EEYA 1B6UA 3VRIA 2VZSA 2G2RB 3RWIA 2VQUA 4NQED 5E95B 5ABDE 5CZXC 2D2OA 1FNAA 1J1OL 3SDAC 3RIAK 3MGOB 4PJBF 3R0MA 3R4DA 5DUMH 1Y6NR 4M9PA 4M1DH 4WW2C 4FFZH 4Z7WA 5L8JB 3IU3A 3T77B 4JG0H 5CJXC 1A6ZA 4TVPE 1E6OL 1GGUA 1Z3GL 4MA1B 3D18A 5F9AC 1NBZB 3PL6C 4ZUWB 3U30C 4ELKA 5MEPB 1CIUA 2BSSA 2QQLH 2XPGB 4JKWA 4WO4B 5D96C 3VH8A 4C4KT 2PXYC 1NEZA 5KG9A 4BM7A 2CLZB 3U36A 5KSUB 4MNGB 1QR1A 2X9XA 4HIHA 5KN5B 5D6DC 3BH9B 3I9GH 4X5XA 1JWUB 4UTAL 1KJ3L 2ADFL 1N3NB 3DARA 2Y07H 4UUJB 4B5EA 3T04D 4XC3H 4N90E 1JWMB 4P3CL 4UAOC 1UB5A 4Z8FL 4ZFOA 3A67H 1VB9A 1E4XL 3DROB 2D31A 4IOSD 5INCB 4D0BB 3MQIA 1HHIB 4Y4FD 4OCMC 5I1GL 4DOHB 2FZ3A 3E3QC 4IIQC 4X4MA 5HDOA 4HJ0D 2X1WL 2DKMA 2DQFA 1AFVH 4HWZB 2J8UB 2A6IA 4G9FD 1JZ4A 4PRIA 1YQVL 3CXDL 3RUGA 3O6ML 3ZDZF 2CKBA 5FUOH 3WFCH 3UJJL 1S9VA 3VXMB 1BPVA 1AGEB 2EYTB 3L95A 2R9HD 1EEUA 5EUOB 5IF0A 5JA9A 3WJLA 5C09D 3CVHL 4Q97A 4KJWC 3RY6C 5DVMA 2EKSB 5DQJB 4NC2B 3L9RB 3DX8B 2PW1B 1RU9H 3G6JA 4RMTA 1XIWC 4R4BB 4IRSB 3E3QE 1KN2H 4OFYD 1Q9KA 2XWTA 2P1YA 4LLQB 5DEFA 3MRDB 2VLRD 1LO0L 3EYUL 4OCLC 5IT2L 2EEBA 4NN5C 3ULUL 4QRRE 4JFDE 3I2CH 5F96L 1NGYB 2XZCL 4TUOB 2MQ0A 2G9HB 3MRMB 3MRIA 3OL2A 2XTJB 4GRMA 4O2FA 3V5HA 5J1SC 4RGMC 4YFLF 3IDIB 5D2LB 4QNPF 3X3GH 1UCTA 1N0XL 1H0DA 4Z95H 2JK5A 3HMXA 5E9DA 1Z9SA 1P6AB 2NW2B 3DX9B 1HQRB 1KB5H 1KT2B 3H7LA 3VFRA 1C12B 4U7MA 3MX0A 3RTQD 2C7UA 4C59B 4QHNB 1G7JB 4L4VE 3EYVA 5CAYB 1VENA 3CFDA 3RBSA 4JAMA 1H5BB 2FYYA 1G7MA 5IVZB 1AD0A 4R96B 3MRRB 3VMOA 4NZJA 5F1NA 3OKEB 4GLRI 4YDLB 5BOPA 2ZUSA 2YD3A 2KZ1B 3LB6D 4NO3A 4A6YA 4KPHH 4Y1AD 4YXKL 1EPFA 3CFJA 1I7ZB 4N9GA 2CLVA 4KMTL 2WWMC 2YXFA 1HNFA 4ELMF 5D5MF 5IM7B 1DEEA 3WIHA 2P8LA 3ARFD 3OX8A 5DMIL 3MBXH 5CZVL 4DKFH 3S5LG 4I3GA 3QIWA 5L0QB 2HJLA 4NNPH 3SBWA 1LEIA 5L2KE 2VZ3A 2BHYA 1FVEB 1D5XB 1L0YA 4YWGH 3MZGB 3SY0B 3B2VH 2FEDD 1U58A 4G3YL 2EIZB 3OKMB 1TDQA 2WLZA 1LP9B 3S35L 1NCUA 3MUJA 4JPIB 5TDPB 3OTTA 3GB7B 43CAA 4MWFA 2XY1A 1I9JL 5AWNL 3RVVC 4NN6B 1MJUL 4NKOB 3SE4A 3VXUB 2QTEA 3BT2H 3EDKA 2ILLA 4AY0A 4HIXL 2E7BA 4HC1H 4L8DA 1SJHA 2E8YA 3C5ZD 3MRGB 5I8KH 1MHPL 4JRYD 3U2SB 1CXHA 6FABH 3AY4A 3K80A 3NA9L 1TJHH 1NBZA 4FHBD 2VITA 4Z18A 4M5YL 3TVMB 2XPGA 4JO3H 3L5XH 3PE9A 3TZVA 4CN4A 5KSUA 2IGFL 5IVXF 1WBZB 5IBLC 5T1KD 5KN5A 3QNXB 3BH9A 2Q7NA 2I26N 4CUCA 1KTLB 1N3NA 1RFDL 5MEQB 1IBGH 1NC4B 4DEPC 4ZOCA 1PG7H 3UO1L 4PR5B 5EOTA 5T1MA 3BYYA 1IGMH 1HHIA 3NH7L 2G75A 1NLBL 3MA7A 4EI6A 2OX5A 4I77L 3JWOH 3RWJB 4YPGB 3FONB 1C7TA 3AREB 4DWHA 4DVRL 1RJZA 3S34H 4YHOL 3PWPE 1AP2B 4JFFB 4JHAH 2V5YA 4Y5YA 1SJXA 1JMZA 1F8TL 3S4SG 3ZE0E 1NMBL 3OJDB 3NN8B 5A2KH 5GHWH 3UJTH 1CGXA 3LSOA 4MQSB 4QO1A 3C08H 2FBOJ 5ILTL 4F57H 2IAMB 4R0LA 4Q9QL 3D39B 2VJXA 5T3XE 3LKOB 3QUZB 4QRPB 4HH9A 4XP5L 4DKEH 5GSVB 3BJ91 2EKSA 3M8OL 5HXMA 2VISA 3CSPA 3MV7A 3ARBA 2PW1A 3K3QA 3MRBB 3QDGB 4R4BA 4JPVL 3HNVH 3TC9A 1IAKB 4J8RA 3V6FB 5EOCL 1OWWA 3FFCB 2YD4A 3D69B 1UA6L 2R23B 4Y4KB 2P5WD 1CFTA 1NAMA 4DGVH 5A1AA 1P7QA 1AD9B 4XNMA 5ERWA 4XVSL 4NUGL 2F5AL 1I1AB 4WJ5A 4Y5VC 4OFDA 4XP4L 5E2UL 5GS1A 2OXGA 4JFZH 3D0LA 3ULVL 1BQLH 2KUTA 5LAXA 3MRMA 4JFHE 2ZG3A 4LLYB 1HYSC 5I8CB 4RMRA 4G42B 2ZCHH 4WTZA 1INEH 1LILA 3WNOA 1VGEH 5AZ2H 3V6ZB 3PXHA 5B39G 2VZOA 4MHHI 1K8DB 5M7QA 2JIXB 4O51B 2NW2A 3WN5C 4JY6A 1UENA 1KT2A 2ZKHH 1C12A 1ZV5A 5GGRB 3ULUD 3FFDB 2E27L 5F1IB 1G7JA 5E6ID 3VD7A 4Y2OA 5E2WH 3GSWB 2OBGA 4CMHC 5C1MB 2NZIA 2Q87A 4AG4H 1IRAY 1T4KA 4Z6AT 2APBA 1H5BA 1FNFA 5FOBB 5J11C 1DUYA 2BRRH 4LKCB 4Y19D 4Y4HD 3U0TB 4FTVD 4X7SH 4AIXA 1CLOL 1KG0A 2BSED 5E56A 3DETD 5A16B 1TJGL 2VZ1A 5J56B 4RMVA 4WY7L 3GNML 1MOEA 2DLGA 1AO7D 1GH7A 5HY9A 3SGEH 3KYKH 3LRGA 1G1YA 3QUYA 2XQYK 1MLCB 2CO7B 4HK3J 4OB5H 3KPLA 4G9FA 5DJXA 2ZZUT 1ZANH 5EPMB 1L7IH 3MMEA 1L9NA 2R2CA 4LARL 5DJ0A 3VXPB 4ODVL 3LHPH 3Q2CA 1ZHLA 1D5XA 3IDUA 1M7XA 1SVZA 2B2XH 2FX7H 4ZS6D 1ZMYA 5TE7L 5T5FL 4J23A 3KXFD 5ENWB 4NFDA 2MCG1 4GQ9L 5FHAL 4APQB 1LP9A 3GB7A 4K23L 3MRCA 2ESVE 1SHMA 2QHLA 3VXUA 1S9YB 5DLML 1LHZA 3BXNB 4OZFB 1A21A 3HE7D 4WGVB 1OGTB 3QIBD 3LEYL 3HE6B 5FYLD 1OAKH 2H2PC 4YDJA 5KSBF 1PX4A 1FH5L 3ETBF 1JGDB 3QXAB 2H3NA 5HGAB 2C3GA 1KLUA 1CFNB 3ZHDA 5D1QD 4EI5D 3P40A 2XACC 2X42A 3H0TB 1DDHB 1UM5L 1HKLH 5IB1B 4XVTH 3RGVC 1JF1B 2VSDA 3EFFB 5F9WB 3WFZA 3FTGA 3S88H 3HRPA 4MCZB 4H8WC 3QUMA 4OD2B 1ZHKB 1BVLB 3HS0A 3HUJF 5KVGL 4DGYL 3GMPB 1QD0A 4YIQB 3UAJC 5DJYB 3Q1SL 3EHBD 4XPFH 3RWJA 3SKJH 3WLWC 1IGTB 4JG1H 4MJIE 4YQXH 5D93B 4HK0B 2JB6A 3AMLA 1R5VB 3QRGL 2AXGB 4F8TA 1AP2A 2ZUUA 3RPIB 4EN3B 4OJFL 1JHLL 1ZLSL 1LK3H 3HFMH 4S0SD 4X99B 5K9OB 4MA3B 4LVEA 2GJ6B 3OJDA 2R1XB 2X89D 3JVGA 4BJLA 1S9KC 4JFQB 4POZC 2IAMA 5CJ5A 3WKNA 1AE6H 5EDXA 2BNUB 3O3BA 4I4WB 3IYLW 5H2BA 4Y2DC 2ICWB 3GM8A 5KZCD 4NNXB 2OTUA 4P59H 2IWGA 4OZFH 4YFLI 3P4OB 4N0UB 5IG7B 1IEAB 3TYFA 3ARFA 1KCUL 2Y7QA 4F2MB 5AUMB 3O9WB 3WXVL 4Z76A 1CTOA 1XMWA 1UC6A 5GSRB 3VXSE 1JK8B 3D69A 3I6KB 3KAAA 4Q58C 1AD9A 3O8XB 7CGTA 2QADB 1PG7W 1RUPH 1YEFL 1EHLH 2IANA 3CAFA 3V0VA 4N0RA 4LLYA 3C8HA 4ZFOL 5BV7B 3JUYA 5BJTB 1KNOA 4G42A 4PGEB 4PREB 4M61B 1RY7B 3GK8H 3W9EB 4ZFGH 5B3JF 1BQSA 1LEKB 1A4KB 2JJTA 1DLHB 4HGKC 1H3UA 1K8DA 4KDTC 3W0WB 2AV1A 3AS2A 3MV9A 5JHDB 1X9QA 2DIJA 4U1GC 5EN2A 1X5AA 5EWIL 5DHVB 5GGRA 2Y36H 3FFDA 1RUQH 4JM4L 3IFPB 2OL3L 2QEJA 1B4JL 3PDOB 1WITA 5JXEC 2Q20A 2BHUA 4X6DB 3MJ9H 2FD6L 1D5IL 2C5DC 3NFPB 3VD9A 1I8LC 4NCC1 2EIDA 4L4TA 2QL1A 3TM6A 4KUCD 3U0TA 4LP5A 2DBLH 4HIEA 1J7VR 5EOCJ 1D3CA 4NRZB 4RFNC 1QSFD 4R9HA 3TO4B 5DJ8A 1ZWIB 2V2TB 2HTLC 1NSNH 3X13A 1CE1L 1JPTL 5D70H 4HF5L 1J88A 3X11B 5I75C 5HBBA 4HH8A 1JPGA 3W11C 2IC2A 4OKVA 3NTCL 4F58L 2QQQA 4KGLA 4KAQL 2XQYG 4PPTA 5CLTA 2MPAH 2I24N 2HFEB 2D4FA 3DXAB 4I13B 1F4XH 4LRIC 3VXPA 4I0PD 5SV3A 4P57B 3VW3H 1NMAH 4P23C 4Y8DC 3T0XA 1QFUH 1DQTA 2GY5A 1FFPA 4JZOA 5FEBA 2ITCB 2X4OA 1FL3A 3S3SA 5ENWA 4Z7UF 3QIUD 1FRGL 3PDGA 5ETUB 3ILPB 5F1KC 1S3KH 5DUML 2VO5A 3CH8A 1J5OH 3WL9B 3DJ9A 3KHQA 1TZIB 4M1DL 4FFZL 2DIAA 2Q1EA 2EIEA 2L7JA 4O4YH 2B8OT 5DHVH 2Q6WA 4HS3B 4MQXC 2CXKA 1JWSB 1U8KA 4TTDC 1U2HA 4X6BB 4OLWL 3VGHA 5HD8D 3HE6A 3JUZA 4HBQA 1MJ7H 3GMQB 3PF2A 5F72S 1T0PB 4X6EB 1NQBA 1SMOA 4HFWA 4PYHA 1HXMA 4K9EC 4R2GB 3IVKB 5IEHB 3B3IB 3FQWB 1I8IA 2BFVH 3BPCB 4A6YL 4ODTH 4UDUA 3RL1B 3I9GL 4ONGH 5FHBH 2Y07L 2R1WA 3CFBA 4NGHH 3B9DA 2AXJA 1DANU 3D2UD 3KJ6H 4YNYA 4MCZA 1EEZB 5H37H 3F7VB 4NZRH 4UBDC 4BKLB 1WBXB 1NFDA 4J3WA 2FJHA 2EXWC 5JXAH 1J1XH 1WJ3A 2IPKA 2J5LC 1DVFD 4IDLA 3TO2B 1UXWB 2VC2H 4LLUA 4MMXC 5HYJB 2FH8A 3WEXB 1R5VA 3E6FB 3S35X 4Y4HA 2DRUA 1ZVHA 5C0CE 3EW3B 4P2RE 4EN3A 3QWRD 3QHZH 5DR5L 4X99A 3HC0B 2F5BH 5EA0H 1OAUH 3DX6B 4POUB 4BH8B 3RQ3A 4F7MB 4JFQA 1DE4B 5FUZH 1AJ7H 5D2NC 2YPKB 3SGJA 3RWEA 4HKJA 3CFCH 1CLCA 4ETQA 3BEWA 2YSSB 1RU9L 1KXQE 4BQ8A 4PJXB 5BS0D 4N0UA 5C0IB 1KN2L 4F2MA 1HK6A 3L5JA 1T20B 5GGVL 5HDQH 3QUXB 1RJLA 5INDB 1QLRA 5EORH 3CDCA 3KVQA 2V2XA 1JK8A 3VRJB 4HKZB 3WXWH 2W0FB 1AGCB 2JLLA 1CBVH 3O8XA 4AEIL 4OGAD 1NUNB 1NCNA 3QSKB 3RWFA 4MNQD 3ULSB 2R2HA 4HAFA 3KXFA 4LCCC 5DT1H 3HKFA 4MJ6A 4R7DB 3NGBB 1I1YA 5ISZD 5BJTA 5C9KA 1UFUA 4Z95L 3TBVA 4M61A 5D2NE 3DUUA 1MCCA 1DLHA 3FB8A 1RAMA 3LDBC 4PY7A 3SO5A 3JTSB 2FIRT 1I3UA 2EDFA 4UV4H 1RMFL 4HMEA 1P69B 3QJHB 4PJ8D 5JW4N 1DQLH 3T65A 1WQVT 1JYXA 1Q94A 3LD8C 4NQCB 4LKXB 1WC7A 3RDTD 1X5HA 2B0SH 4PJEF 3MREA 5IW6A 1TZGH 5D6CA 3NA4A 4FQ1H 3KPOB 5BRZE 5HPMA 4XCFH 1ZLWH 4P5MA 2HT2D 3T0VA 4JM2F 2D0GA 5H94B 2XZAL 4NRZA 4S1QH 3QB7C 4KPHL 3DRTA 4G80B 1AGBB 4CJ1A 2V2TA 3IB4A 5TF0A 2ATPB 5C7XH 4PJGA 3X11A 2XRAL 2W9DH 2XWBB 4FZ8H 4BYHA 2Z31D 4M03A 1OD9A 5ESQA 2AK4D 4PV9A 4DKFL 5A40E 4K71B 4HGWB 4WI6A 1NCBH 4NNPL 2HFEA 3AUVA 3PWLA 3DXAA 4GW1A 1WFOA 2P46B 5I76B 4M6OH 1E4WL 3OR6A 5MEOA 1CD1B 2CIIA 3EO0B 2UZYB 3SKNB 4QTHB 4JCLA 4HD9A 1X5XA 4QXGH 2F74B 3B2VL 3GEWB 3EO1A 3DURA 1OGAE 3ZO0A 3VG9B 2BNRE 1Q72H 1PKQB 3ILPA 2Z8VC 2P42B 4R3SA 4PP2A 3SGEI 3OJVC 1T7ZA 1TZIA 3EJJX 1KCRH 5E99H 4NUJA 4M93C 2A73A 4FQHB 1TIUA 3G5VB 5C0BE 5H35B 4HC1L 4LPCA 5C0GA 5I8KL 1LEGB 1CIDA 4LGRB 6FABL 5AD0B 4PJEE 1TJHL 3S36H 3HB3D 3FL7A 5HGBA 4JO3L 3WDJA 3L5XL 1BBJA 3VMPA 1OAYL 3FQWA 5CKGA 3TGXA 3HLAB 4OV5B 3BPCA 5F1OB 3O6FC 3RL1A 2AJUH 3GJFB 1ZVSA 2EECA 4OUUA 1KIRB 3OKOB 1A6TA 1PG7L 1RZIA 3ARGD 3S5LB 3FOLA 3L5WB 4JY5L 4FABH 4YDKL 1GZPA 1DFBH 1XF2B 2WBWB 3P77B 1FNEA 3DTXA 3CC5A 5FYKU 5C2BH 4PRBB 4X4XB 3EDJA 2OR9H 3CFKA 1EO8H 1MY5A 1J0JA 4BKLA 4ODHH 1IGFH 1CN4A 12E8H 2GT9A 3S96B 2NY7H 2X4TA 3S34L 3STZA 3TO2A 4JEGB 5L6YH 2HRPL 3E0GA 4JO1H 4JHAL 3WEXA 4F33B 4QRUA 1UKTA 3PL6B 3QI9D 3QFDB 3UJTL 3QCTH 3FAXA 1JUFB 3U30B 3C08L 4F57L 4P5TA 1R0AH 5D96B 2PXYB 5CIPB 2NTFB 4F7MA 4YE4L 4KK6D 5I73C 2YPKA 2RCSL 1INQB 3LIZH 5TQ2H 1EHAA 1WCBA 5D7KE 3SJVD 4P3DA 4XMKH 4LLMB 1X7QB 4UAOB 3GSVB 2HFFB 3GMMA 1YPZF 3MSPA 4I3SH 4RGOL 5FM4A 4TVPH 2UVEA 2MJWA 4WFGE 4FQXC 1MHHA 4IIQB 3QUXA 1KEGH 1W0VA 4DGVL 5INDA 4XCEB 3C5SB 1U8NB 5J1AA 4I0PA 1AGCA 1BZQK 4QRRB 4XPAH 4JFDB 3SPVA 4JFZL 5ACLA 3GJFH 2F9BT 1BQLL 4R26H 5CGTA 1ORQB 4NJ9L 3QZWB 1KYOK 5C08D 5DD6B 4YBLC 3ALWA 3P9WB 1VGEL 5AZ2L 4FFWD 2Q8BH 1I8KB 4NNYA 4H5SA 2K1MA 5GGTH 1SYSA 2ZKHL 4WO4D 5HHMD 2EDQA 2EE3A 4MNHB 3S4SB 1JNNH 1PZUB 3QQ3B 4J2XA 1BFTA 1XIWB 3ZT5A 4F15B 3CDFA 3LZFL 5F3HB 3MLSL 4NQCA 3U7WH 2VOTA 5KS9F 4PLKC 3INUH 4R4FH 4M5ZH 2BRRL 2ADIA 4KRPB 3P73B 5JZ7C 3GSXB 5CIPH 1GJIA 5I74B 1A9BB 3KPOA 4JHWH 2V5MA 3DO3A 2VLKE 4YHPB 4U0QB 2J6EL 4HZLB 4G80A 4RGMB 4HUWB 2VQTA 5L9DH 2VLMD 4XZUB 2L4OA 2LV4A 3UYRH 4W6XB 2DAVA 1DVFA 4OB5L 3VXMD 1U36A 1NFIB 1XGRB 1YYLH 4PV8B 4G9DB 5FECB 1ZANL 1LDSA 3QO0B 1L7IL 3GMNB 3QWRA 4Q74A 4MJ2A 2MNUA 3NZ8B 5EU4B 5TDNB 5L2KB 2B2XL 3CPLB 5CJOH 5SWSE 4IRSD 2NY5L 1DSFH 3JTTB 2G5RA 2ICWI 1Z6JT 1R5IB 1RIVH 3OKKA 1E4KC 1ES0B 1RUMH 1XR9A 5GZOD 4X4ZA 1E28B 1PKQA 3GRWA 3RIAF 3ZDXE 4B50A 2VN7A 4PJAE 1XCTB 4AT6A 3MLXH 4M6NH 5DA0B 3O2VH 1ITBB 3WO4C 2J4WH 4JQVC 2GSIB 4Y5XC 5IJVA 3HI5H 4FQHA 4JDTH 3G5VA 1MCRA 1NKRA 2XTJD 4TULH 3HZKB 1A8JH 5KSVB 5L8KB 1X3DA 3BKJH 4LHQB 5JTWA 1OAKL 3ZTNL 5DRXA 5AD0A 4O9HH 1HE7A 1WZLA 1RK0B 3HRZB 1JIBA 4MS8D 5IBTH 2JJUA 5IWLC 5KSAA 3L3IA 3JV6B 4G6JH 4KJPC 2DQHH 3OB0H 4PJ7F 5TH2A 4XVTL 3T0AA 3K8MA 3S88L 2HFTA 1U8LA 2GJJA 2FJGA 5E0QA 5EBMB 3HZMB 4L8SA 2JCCF 3BVNB 2ZUYA 4BFEA 1YJDC 3F12B 1VEMA 1ZS8A 4WUUD 1ZGLB 4PRBA 4YBHA 4X4XA 2NY1C 3J8F7 1ZT1B 4XPFL 2NYYC 3SKJL 5TF1H 3DYPA 4JG1L 3RDTA 3VWJA 5CP3A 3VXOA 4PUBH 3VU2A 3RJQB 1MWAA 4PRNB 3MUZ1 5DUBA 3PWPB 2I07B 4XBEH 5JDSA 4F33A 1LK3L 1ND0A 3HFML 3PP4H 3FQUB 5IMOB 2GJZA 3CLFL 4PG2C 3PL6A 3EBAA 1JUFA 4PJDF 3OPZH 4NQXB 1UEYA 2PXYA 3MA9H 1OW0C 4PRDA 1AE6L 3VDBA 4JVPA 3FQRB 1GGYA 4WHYG 4PJBA 4U1SB 1INQA 5HPOA 4P59L 4K3EH 4N1CA 3CXHK 4DEPB 2HRLA 2GKIA 3K4AA 5C0EA 5FGRA 2V6HA 4N8VB 5DD3H 3BQUC 4OCSL 5CEYA 2ENYA 3OR7B 4X5WB 5FCSH 3IFOB 2OTWA 3VI3E 2HH0L 1T5XA 4XPHH 4OQ1A 3X12A 3SQOH 4XCEA 1AY1H 3C5SA 1U8NA 5J6GB 4LSVH 5DHXB 1SQ2N 1NCTA 2RBLA 4ZOAA 1RUPL 1EHLL 1QOKA 5IJKC 4QRRA 4V1DA 3CFIC 1E4JA 2WLYA 5BZDA 1OM3L 3QZWA 1CDGA 3THML 5DD6A 5IMLA 1A5FL 4ZFGL 2J88L 3FT3A 4M62H 2EDNA 4BUHA 3WE6B 2ED9A 1XAUA 4NFCA 3QCVL 3TVMD 3OXRA 5BVJB 3MLVL 4MNHA 3B9KD 3F7PC 1RUQL 5JIHA 4FFVD 5I8OH 1XIWA 5F93C 2D03H 1U91B 3TBWA 1NC4D 4JRXE 1U3ZA 2X41A 3EUUA 2VL5A 5IUSA 2AP2A 4FFYL 3ARQA 4WFFD 5GRWA 2IMNA 3P73A 2YXMA 5EU6E 5FO7A 3NCFB 3QBTB 2BZDA 1WIUA 4Y5VB 5JQ6H 2DBLL 2HKFH 2HT4C 5T3XH 2AJ3B 1EVUA 4HS8H 3NIFF 2GCYA 2UWEE 1KLGA 3ARED 2VB5A 1NSNL 3B8YA 5ID1B 3HI6L 2E3VA 1JN6B 2FJFB 4Z7VF 3KPRE 32C2A 1TETH 1PGRB 1SVCP 1FYTD 3WHXA 3TT1H 4TSCH 4IM8A 1XGRA 4I48A 1QSED 2A83A 2P7TB 3D39D 1VSCA 2CDFB 3PHQB 5T5NF 2MPAL 3QUZD 3QO0A 4CMHB 1VERA 1F4XL 3FB6B 3QWOA 1UWGH 4OLYH 5JOPE 3OJ2C 1NMAL 5BV7L 1QFUL 5EU4A 5TDNA 5CEXA 4RQQA 2DYPD 1KJVB 2K7PA 2DS4A 1IVLA 2EH8H 2Z92B 3F65A 3FFCD 1VACA 5L88H 5CUSL 1YDPA 5JW4M 5CZKA 4Y4KD 1J5OL 1E28A 4O4YL 1KTKE 1XCTA 1YEHH 1I1AD 1NCDH 2CRYA 3STLA 3FJTA 1WZ1H 1C1EL 4U3HA 4KKLC 4JY4A 1IQWL