3RVWD

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
218
Chain Sequence
EVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
molecule keywords Peptidase 1
total genus 44
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwD01
4I3SH 5LGJA 1G9EA 2VAAA 4KQ4L 5D93C 3U0TA 4OZHF 5LBSL 4P59L 4PGEA 2JJTC 1KJ2H 1KJ2A 2F74B 4QXWA 5C08A 2NX5E 1B3JA 3EUUA 5D1QD 4PJ8C 3RWEB 4HXAH 3OHXB 3EDEA 1I1CA 4NN6C 4ZYKA 4JO4H 4XC1L 3EYVB 1KB9K 3BGFB 1VADB 4JDVB 3FOMB 4CU7A 2COQA 3HMWL 1KB9J 3V52L 5CAYB 2VLJA 3OKYA 4PV8A 2PYEE 2XWTA 3HNVL 3MZGB 4LSSH 1DL7H 4P99A 5CUSH 5B8CA 3QPXL 1Y6MR 3LY6A 4PUBL 1WZ1L 1EUTA 4XCEB 3PWNB 3TN0B 3V6OC 2YA2A 3O4OB 3AUVA 5FECA 3KPTA 1NJ9A 5DEGB 2KH2B 2H6PA 4PBVC 4LASH 4MJIB 5A3ID 1UZ6F 3R4DA 3S37H 2HJKB 4LVNC 2VXSL 1HEZB 2JB5L 4XMPL 2IG2H 1I7RB 4BZ2L 3G5VB 3NFPB 5DVMA 4N0CC 4TULL 1F3RB 4KK8D 1DBAH 1EEZB 3OXRB 1FJ1A 1T7ZA 1YN6A 2JF1A 5HXMA 3ILQC 3JWDC 1FAIL 1T1YB 1FBIL 1R3KA 2DQHH 4XZUB 1JWMB 4XCFH 2APFA 5IEHA 3U36B 4NSKB 2X1WL 3BE1L 1AJ7H 1E27B 1GGYA 2FJHA 3LSOB 4F9PC 4YHZL 3D9AH 2XV6B 2D31B 3PXHA 5HI3D 2XQBH 3LEVH 2IQAB 5TE7L 2HLAA 4WFEE 2BK8A 1JWSB 3EYQC 5HPOA 1VGEH 2OTUB 1MFAL 4LLYA 4GUPB 3ULVL 5F9OL 2DQFA 1W2KT 1UM6H 1Q0XH 3DI3B 4P0DA 5GGTH 1YPZF 1RIHL 3C09B 2YPVL 1KPRB 4P2QB 1ZLSH 4JZJA 3QCTL 4NYLB 4QRPA 4JFZL 4ODBD 4F37F 5FOBA 3HMXH 1BD2E 3QDMB 3O6FD 2DLEA 1OAXH 3VFVA 5GS0D 4OGZA 4Y4HC 5C09E 4F7PA 5JQ6L 3VG0H 2OJZH 1LILA 2G75A 1MCDA 2R0LH 5LXGL 1S3KH 1XFPA 1D9KC 3D1MC 3UJIH 2O5ZH 4QY8B 3MREB 3EYUH 2VB5A 4QEGA 1OM3L 3BESR 1GAFH 4PJXB 3PWJA 2NX5B 2EDOA 3LV3B 1I1AA 4DGIL 3HNTL 1RUQL 5EUOB 5C7XH 4I77H 4I18A 4P9HC 4ZFGH 5E1AA 5IOPA 3MJ8A 5DD1H 4KTDL 2IMMA 1A6UL 4FTVB 5DUPH 2DD8L 1TJHL 2AEWA 4U6VL 1KACB 5EWIH 4JKKA 3PWVA 3MRHA 2PYFA 4IHOA 5HHOE 3ARED 4PJAF 1ZT4A 5IW3A 1FFNB 3OX8B 4S2SA 1BLNB 3PDGA 4HLJA 3QDAA 2EH8H 4J6RH 1U3HC 3B9KD 3I50L 3L3HA 4TYUA 2EKSA 1CDCA 2VLJE 4M4RA 4LCCA 4I0KA 3QIUC 5EO0B 4LEXL 3W39A 2YOCA 3OG4B 3EOTH 4WWKB 3RWDA 1G6RA 5FXCH 3B6SA 2V5RA 3WEXA 2YD8A 1Q72H 3CUPA 4I4WA 1JCKA 3X13A 5HYSB 2J6EL 3GKWL 2DQHL 1IT9H 4ODXB 2CPCA 5DJDB 1A1OB 1YJDH 4KHTH 5KG9A 3WE6A 4MD0A 4LHQB 1CE6B 1WBYA 3MA9H 2PW2B 3RVUD 3SKMB 4R4FH 5FM4A 1AE6H 4JRXE 1HILB 2G2RB 1JZ4A 3LRGA 4NKOB 2OJEA 1F4YL 3ARGA 3L5JA 1FVEA 4QHKI 3CLEL 3SPVB 5AAWA 1DUYB 3WLWD 1H0DA 5IK3A 5KTEL 5FGBC 2MQCA 3MNVB 3AREC 3I6KB 2IAMC 3ET9F 4NZRH 5HHMD 5BCAA 3MUGB 1V8HA 4PRIA 2VLLB 1YPZE 5IM7A 3DRTA 1BVZA 4XNUH 1XGRB 4E41B 1G7JB 4HUVB 5ID0A 1JHTB 1DVFB 2OLDA 5HHOB 1WISA 1MJ8H 3MBEB 5JUEL 5I16A 5D2NE 2VLRD 3OV6A 5HYQA 1WCBB 1FFRA 1PJ9A 1EGJA 2HAZA 4TUKH 3SE4A 4LOUD 4LIQL 2X1OA 4NO3B 4F8TA 4UI2A 4YX2L 3VXQB 4JZNA 3L3IA 5L88H 1BZ7B 2OP4H 4OV6F 2YBRA 2ITCB 1OT2A 1TQBB 4IS6A 3LVEA 3NTCH 4KMQA 5GRVL 4HIXH 3U2SB 4U6TA 4D9LL 2HH0H 1DQML 3DXAB 2VABA 3MRRB 5HGHA 1ZHLB 1Z3GL 5MI0B 3BIKA 4PJDB 4NKQB 5D7IA 2C3VB 2E9BA 4R96A 1YA5A 3RL2B 5CP3H 3G5ZA 5DYOB 1K5NA 4DOHE 2X4TB 1G9NH 3MBXL 4EI6B 3BZFB 5I9QC 2AGJH 2OI9C 4NNXB 3KHQA 1U42A 5DTFB 2R4SH 5D7LE 4OD3L 3MLWL 1E4KC 1PDKA 1T21A 2LAAA 2QR0B 2J8UA 1WT5A 5H35A 1UB5A 3HC0B 2V7NA 5KOMC 4EOWH 4LHUD 4N8VA 5HHQA 1YC7A 1IE5A 3IYLW 4MDIA 1HOCA 1HNFA 2A9NH 1EFQA 1AXSB 3QWRA 4LSDA 3T0EC 4AIZA 4UBDD 5TQ0L 1J87A 3GUTB 1JI1A 3BP6A 1FNHA 5T1KA 1FDLL 4C4KO 4C56B 4N0UB 1IL1B 4F80A 5J56B 4J3OC 2DQUL 2PF6A 1U0QA 2CO7B 4YZFF 1F4XH 3P9MB 4U1LA 4HKZB 5MEQA 4F9PA 4RAVA 3VGBA 4XX1E 1TLKA 2AV7A 3QJHA 5J7CC 1UZ8B 5IR1B 2V17H 3C60B 1P7KA 4X4XA 4G6FD 4XAKD 3JXAA 1T1ZA 2CKBL 1KNOB 4LL9A 3CFCH 3DECA 1KTDB 5TF0A 4O2CA 1ZHNB 3DV4A 5EC2B 3H9YA 3O4LB 1N5AA 4UU9A 5C71A 3WFDL 4KZEH 1JPTL 5I1AB 3N50A 1SVZA 6CGTA 3DVGA 3VCLA 1OAKL 1CICA 1XF2B 3PABB 4ERSL 3NZHL 3U9UA 3MNZB 1INEH 1AQKL 3M17A 2HRPL 3PGFH 2N4IA 2VZUA 3IJSB 1MIEL 5FUOL 3FRUA 4F7CB 1N6QH 1BQHB 2VDQH 3NIFE 3SDCC 1MH5B 2DRUA 2VITB 1V05A 2AQ2A 4M6MH 4UT6H 3UXFA 4MD5B 2O5XH 2DB8A 3OBAA 4JO3H 4UDUA 3D85D 3EO9H 1ROWA 2FX9L 3HI1A 5HD8D 3V4VL 5ICZB 2BSSA 1DQJA 4WI7A 4DKDC 5GGSB 4FQ2H 2DQIH 2D7QA 4MDJB 3WS3A 2VLRE 3RTQD 4NQDB 2RCSH 1OSZB 3UYRH 1U8IB 3F7VB 4XMPH 2GFBB 1ZSDB 1XMWA 2GUOA 3LH2H 2W9LA 4U3HA 3PNWA 3LS4H 3ZE0E 1B4JL 1U8LA 2X4TA 4JFDB 2IF7A 4LVHC 5IHZB 2C3VA 4EN3B 3SDAC 5H2BA 4HG4J 4ZD3H 3FQUA 4PRAB 3WS6A 5HGHB 5IFHL 5I73C 1L6XA 1U8QA 1VFAB 2EDKA 2OZ4L 4JRYE 4KK6D 1AD9A 1IGIH 2BVTA 4S1DD 4I5BB 2G9HA 3TPUB 5D7LD 1BBDL 4K2UL 5J9PB 4S10A 4HK0A 2X4SB 3C8HA 3CGTA 4FP8L 4P3CH 3H9ZA 3IF1A 5HI5D 2Z8WC 5FK9B 2Y07L 1T7WA 2DMKA 2CH8A 1A4JB 2R8SH 5BS0A 3S36L 5CGTA 4EUPA 5C2UB 4EVNB 1QD0A 2V17L 4KROC 3WLBB 3VW3L 4BFBD 4JPIA 1MWAH 4QXTA 4NC0B 3TBWA 1RUPH 5T3ZD 1LO0H 2NY3D 5KAQG 5D1XB 3WFZA 5B39B 1XR8B 5CZKA 3FB7B 1YQVH 5C9KA 4HCRL 2VUYA 1CFQB 2B0SH 4IRZH 4O00A 4TVPD 5KVGH 4E41E 4L8BA 5I6XB 3N0PB 5C08E 5ALCH 1INQB 4MAYC 2MMXA 3S96A 2ZSVB 3BUYB 5CLWA 1HHKA 2PW2A 3P4OB 3CXHJ 2P4AB 4LQ1A 4MA3A 2Z8VC 4TNVF 4PB9L 2WWKO 5E6IC 1G9MH 1GZPA 5A40E 3N85H 4K3JL 5EBWA 1YEKH 4Q9QL 3CUPB 1OAZL 1A3RL 3ES6B 4GRWE 1U58A 1G6RB 2XG5A 2AJVH 2VE6B 4EI5A 1RULH 5CP7A 2JCCF 4KKBD 2W9EL 2DQGL 3NCYP 1N64H 4UB0L 3JWOC 1RV6X 2MJWA 3FMGL 1C5CH 1JPSH 5H8DA 4R97B 4IOFC 5IB5A 4IM8A 4FTVE 1OGAA 1IKFL 1SBBA 3ORJA 4YBLB 3TH3T 3IU4L 5EZIL 3MOQA 5D7KE 4P2RE 2BNQD 1J1OH 4TNWF 5DMJB 3C9NA 4GG8A 3C6LB 4X4YA 5KSUB 1WGOA 3MX0A 3O8XA 2GFBA 4XPBL 1BMGA 2R2HA 3TFKD 2ICWI 3X14A 4MJ5A 4MZ2A 1UWXK 3QZWA 4EN3C 4Z8FH 2R0ZL 35C8H 4POUB 5TE6H 3WS3B 5CZVH 5JTWA 3BN9D 3WIFA 4TUJA 5GGSA 4R4FL 5C0ND 3ULVF 2VDPH 3S98A 4K94L 2G75B 2FWOB 3QFJA 5I74C 4OGAD 1CD8A 4MNHB 1DANU 2YRZA 1GL4B 4G3YL 1IC7L 4HD9A 1I9JH 1ZLUK 3IXAB 4N8PA 1MH5A 3ISWA 3RDTC 4QRUB 2R56L 4RGNE 3RQ3A 5L2KB 4G6AC 3IETA 4HUXA 2XTJE 5FOBB 2NXYC 1F00I 3TT3H 1IAKB 4UINH 4TULH 1S7XB 5C0JB 3KDMA 1FP5A 4MJ6B 3MLRL 3W11D 4OAWB 2IPUK 4Y88A 1PVHA 5BZWA 1NEZG 2BNUA 3INUH 3QULA 4KI5D 5KSAC 3S88H 4GXUN 1OP5H 1HCFX 2YD9A 3BX7C 2X4OB 4FQJH 4UQ2B 3GHEH 1A6TB 3QI9B 1T66D 4XXDB 3ULSB 1U36A 5FKAB 5FFLA 1JNLH 1T04B 2IBGA 4U3XA 4D9QD 4WHTA 3B5GA 2P47B 4KDTC 1QSFD 5CMAB 1K2DB 5F9JA 1TTGA 1QFOA 4I9WD 5I8OL 2ZSWB 4FFZL 3ULUL 4P2OA 1NBZB 4YHIB 1T7XA 4NSKA 2CIKB 2OXHA 3DHMA 1K8IB 5KVEL 2R0KH 3CAFA 5L2KA 2EH7L 4MQSB 5EZLB 3BEVA 3RL1B 4LDEB 3LKPA 2OSLA 4N0UA 3VMOA 5I17B 1XGYH 4XVJH 4GW4B 3VXSB 4XNQA 2BFVL 3MUJA 3GMQA 1JGVL 1T83A 1U95B 2HTLC 3ZE0F 1P4IH 3NCEB 1EHLL 4N8VB 2AI0L 3V6FA 3GIZH 4LLAA 5E9DB 5HHNA 5H35B 5GRJH 3N1FC 3OXSA 3AC0A 3C8KA 1UJ3A 4PG2C 5C2BL 4LKXB 4H25B 2DMCA 3QDHA 4QT5B 1SEQH 1HIMH 1WCQA 4Z76B 5F8QC 1D5IL 1AGDA 1YMMD 1U3HA 5DRWB 1AY1H 4OF8A 4AG4L 1HKLH 1C5BH 1VADA 5I8EA 4U0QB 4GMTH 3T1FB 1S7QB 1G7IB 2QKIB 4WY7H 2X42A 3EOBA 4GOSA 3HG1B 3QQ4A 3VI3E 1JRHH 4MNQB 1U58B 2EDXA 3GMRA 4GKOA 4NM4L 1WCBA 5B4MD 3EO1B 3R8BB 3VU2A 4QRRD 4JPWH 1LDPH 4RSVA 4NQCB 4CADA 3HE7B 3LOWA 1GZPB 1I9IH 1TZGH 2NY2C 2QLVB 3I6LE 4AMKH 3MV7A 1MFDH 5EBGA 4HK3N 1N8ZB 4YXKH 2Q6WA 3VXMB 1FNSH 3B5HA 3O3AB 1QTYT 3UP1A 1E28B 3TA3A 2AP2A 4Z7UA 1KLFA 3LKSB 5C0DB 4X99A 3QXDA 4GQ9H 4NKDB 5TDPA 1SMOA 4JHAL 4U1NA 4CNIB 1MPAL 2B20A 4K94C 4X99B 1F3JB 1XR8A 5GHWL 4KPHL 1WZKA 3ARGB 4HWEH 4LCWD 3OKMA 4NO0A 4OKDA 4EIGB 4FFYL 1F4YH 3VXMA 2BJMH 3O9WB 1TVDA 1WBYB 4M48H 4GG6E 4GBXB 4GT7A 4P5KA 3PWUB 1OP3H 1A1OA 4JY6A 1LO2L 2DI7A 3B4NA 3DX7A 4EVNA 4L4VB 4CADB 3QDGB 1RZKH 15C8L 2GT9B 3ZKXC 5DWUH 4PTUB 5I1GH 2V2WA 5C0CD 2EYTA 1L9MA 4PYHA 3P0YH 3FB5B 4PJGA 3V79C 4P2RD 5D7KD 1A4KB 4JVPA 4QRPD 2QHRL 3SGKA 3QISA 3EOBB 4MQXD 5IHUL 1EO7A 3SKJL 2EDDA 5IB4A 3SGDH 5GIRB 1DANT 3KLHD 1MCQA 1JZ3A 4JM2D 4YPGB 3WFBH 3GSQB 3P30L 1FIEA 2PYFB 1JZ6A 1EH9A 4AK1A 5E8EA 3ESVF 5D7JD 5D7JA 5L88L 1KC5L 3IDGB 3PNWB 4JFFB 5HDBF 2MCPH 4H5SB 4U1SA 5EOQH 3IFNH 2F19H 2E9IA 3FFDA 5IT2L 3UDWA 1OSPL 1U8IA 2AERT 4U1GC 4MS8D 1MHHB 1N26A 4WUUE 5TDOB 4OI8A 3IDJA 3UTTE 4XXCA 1UXSA 5C70A 4PJIA 3PHQA 2O26U 2NPLX 4BZ2H 4FABH 1RUPL 4I0PB 3H9HA 2NY3C 3GMQB 2A2QT 3G08B 5DQDL 4B0MM 3ZSTA 2FJFB 4R90H 5I17A 1UG9A 4PJAE 2QADB 5K9JH 2AK1L 4X6EA 3CC5A 3P9LA 3F7QA 4WUKH 5BOPA 4WCYH 4X6CE 3K7UA 3SE9H 2BVYA 1JTOA 4BSJA 4YHIA 3L3KB 1EEQA 5FOJA 1LK3L 5L6YH 4NDMA 1G9ML 5CEYA 1JIBA 4S1RL 4F3FB 1WSST 2NY6B 1EVTC 3FQWA 3U79A 1HK6A 4PREB 2VN7A 3CDGB 3PUCA 4XPGH 3G5XB 4HWEL 4PY8J 1MCWM 3ARBD 3Q2CA 2BNUB 2XQYK 1FVDB 2AEQH 3V8OA 3AS0A 5L9DH 3GJFA 4RMQA 4ZNEE 4U1MA 2FX8L 3LRSB 4S0SD 2V5MA 3OQ3B 5IEHB 1MQKH 2UWEA 3H3PL 5E2WL 1GHFL 3S35H 5CLTA 4XZUA 3INUL 4FZEH 3IU4H 4LHUB 4OV5B 1QG3A 1RD6A 4BZ1L 5L8KB 4MAUL 4AEHH 3ZYZA 4U1KA 5SV4A 3NA4A 4X83A 1QLRA 1EJOH 3P0YL 4WUUB 2H45A 3VE0B 3DWTA 5FCUL 2AJUL 3MXWH 3GJEA 3JTTA 4X6BB 4K23H 3QZWB 1GGIL 4G5ZH 2Y06L 2ZOKB 1OP3K 1AGCB 4RQQA 1NC2D 2PYEA 3C6LC 4Y5XA 4JQXA 3MNWA 3P30H 3OAYK 3BZ4B 1KJMA 3BPOB 3OB0K 4MNGA 5LAXA 1ZGLB 2OR9L 2BSRA 3LEYL 3ARFA 3TO4C 4I0CC 4YBLC 2OZ4H 3RVXD 4R4NC 2ED9A 1LWRA 1RIUL 5D72H 1G0XA 3TN0D 1FFPB 3NH7H 3UYRL 4M61A 3HG1E 3VWJC 4WFHD 3KXFB 1OGAB 4LCUA 4YXLL 1X5YA 1E6JL 3HC4L 1LNUA 5E2VL 5JZ7D 4PUBH 2VQTA 5SWQA 3QUZD 3CX5J 5GRJL 4P4RA 1OTSD 2P8LA 1OTTC 3SHSA 3IFOB 4GRMA 3GI9L 3WDJA 3ZE1F 1KIPA 2H32B 1EHNA 4G6MH 4ELMB 3CFKB 5SWZE 3VXRA 3U0TB 5E9DE 4MJ4A 1ORQB 4I48B 4KQ4H 1CD1B 3BXNB 1B2WH 4BH8A 4LGSB 2E7LC 1VACB 5JOFB 4OCSL 2VYRE 3WCYA 3T2NH 1INQA 4UBDC 4C57C 1M1SA 3KYKL 4JM2C 3CCHB 5D93B 5GGQL 5T33L 1H8NA 5FM5M 5D1XC 4RWYL 2FO1A 1J9CT 1MCFA 2AEPH 4JFPB 3O6KH 4Q0XH 5JW4M 3VRLE 4QWWD 1NDMB 3EHBD 4Z7VE 4FG6C 5F7KC 3ZE1E 1BFSA 4KROB 1JGVH 5ACZB 1J1XL 1CU4L 1I8MB 4QXTB 2XZAL 3G9AB 1GIGL 1P4LB 1BWMA 1QRNB 3VXRE 4KRMB 4YC2B 1FVCA 1C12B 3CK0H 4LDLB 2UUDK 3GSOB 2MPAH 3PQYD 4KDTA 1T6WA 4L5FH 2FJGA 2ICES 1IGCH 3B6SB 1MI5D 3WEXB 3P3YA 4K8RH 3CVIH 3OTTA 4PJXE 2YS4A 3RGVB 3GIVA 2HTKD 3F5WA 5J9PA 3MXWL 2EKSB 4MSWA 3WFCL 5E2UL 1ZLVK 4LVHB 1P9MA 2H3NA 4S1SH 2B8OT 3BQUB 2DQJL 2XTJC 1ZT4B 4LLVA 4WWID 1RVFL 4IHOB 3S36X 4B41A 1U8LB 1QEWA 5A2FA 4E5XA 4OLVH 1P4BL 1QNZH 1P6FA 1SY6H 3ARYA 5ADOH 4HWUA 5F9WB 1ZSDA 3D0VB 1WWAX 2QHRH 3K81A 4RZCA 1JN6B 4B7IA 1CVRA 3REVB 4PJBA 1CDJA 3TO4A 2DD8H 4P2YA 1CFTA 4Z7VB 3MREA 2A83A 4QY8A 4AENB 3O3EA 4GW5A 5J57B 4MNGE 3RWIB 2XZCH 5D8JH 4K3EH 3ULUC 1TTFA 3VRIA 3BPOC 2MSPA 1IAIM 3GJFK 5TQ0H 5BV7H 3SDCB 3T77A 3DUUB 1HCVA 3W5NA 4X7SH 4C83A 4XCYB 3Q6FB 4QKXB 2W9DH 1Q9OA 5C0BE 1VFMA 5A2JH 1OHQA 3L95B 1I7UB 4GMSL 5GJSH 5BW7C 3QWOB 4F7CA 3O4LE 4OIBA 4O51B 5JR1H 1RJLB 3L7FA 2EECA 3LEVL 2EXWC 4LBEB 2C4FT 1TCRA 2R4RH 1KJVA 4CMHB 2JCCB 3U30B 5FV2A 3AS3A 1BOYA 1SJEB 3VXOB 3H6JA 3HFML 1QVOA 2ZUQB 1B6UA 1AR2A 2R1YA 3AY4A 5IBUG 5MENE 3S8WA 4NRZA 1A6AB 3PDOA 2VH5L 4IRSD 1U3HD 2BNRD 1NDGA 5F1IA 3K74B 2WP3T 1ED3A 4PPTA 4IMLA 5GQBA 1I1YA 3MA7B 3QAZB 3NPZB 2CJUH 4JEGB 2GITB 4KUZH 3ZKNC 2B4CH 4LVEA 4HKBA 1OAXL 4YLQT 3B43A 3RWCA 1NKRA 4PG9A 4RMUA 5IF0A 2DS4A 4P3DA 4M3JA 5GRXG 1VDGA 4YDVA 1JWMA 5D5MA 3ARVA 4FA8A 4JFYA 4PP2B 1T1YA 5HHOD 3IGAB 3MLSH 1PG7L 1VFOA 1MVUA 4Y16A 5I1LA 4UTBL 1N59A 1T22A 3I3DA 3GUTA 3GGWA 1A14H 1KN4H 1WEJL 3KPOB 5HDBE 4L8SA 1A7OL 2UZYB 1AXSA 3RX5A 5C07E 3TNMA 1S7RB 3OAZH 3T08A 2BP3A 5T5FH 4L8CA 2C7UB 2NXZD 5I9QB 1QR1A 4LLMB 4Y4KB 2IPKA 3O6FC 2QR0A 3RX7A 3DUHA 2DKMA 4XCEA 1WLHA 3G9VA 4NNXA 5DT1L 4PRHD 1FL6A 2AK4B 4EI6A 3QUXB 3N06B 5IGXH 1BF8A 2AK4A 3RIFK 5C9JA 1MY5A 4G6AD 3G6DL 4JQVC 4LCCC 4LVOC 4OZ4B 4BFEA 1T3FA 3F12B 3MV8A 2AV1A 5E99L 5IHBA 2Q1EA 1I8IB 4NN7C 3CZJA 1FIGH 3QA3B 4WW2C 4QF1B 2N7BA 4HIJB 3TBTB 1NGWA 1HH6B 4D2NA 4CVUA 4JFDE 4GO6B 4KJWD 1QFPA 3VFNB 4MWFB 1LGVA 3TNNB 3MBEA 4PGEB 4LSQH 5E8DL 2PO6B 2VAAB 4KUCF 2ICWJ 1G7JA 4NNYA 2EZ0C 1FZJB 5FYLE 1XH3A 4ENED 2E6QA 1PEWA 4PGZA 1D7FA 1MJ8L 3QFDB 5D5MF 2AK4E 4UQ3A 5I76A 5F6IC 5TH2A 3BD5A 5IB3A 2X4NB 5EZJB 3U7YH 2Q7YA 1D3CA 1GGUA 5IQ7H 4HMEA 4IMLB 4NKIH 1UQSB 4U6YA 4GBXC 1UGNA 1FGVH 3DUSA 3UTPE 4F2MB 4ZTPL 1T5WA 3OAUL 3MLUH 1QVOB 5I1JL 5F9OH 4HULB 1TITA 3ARGC 3TIEB 5LWYL 1HSAA 2EDTA 2JKXA 1T4KB 4JFFE 1QKZH 4JHAH 1BFVL 3RPIB 2NZ9D 2IGFL 4G8EB 4JGUA 4MXWL 4O2FA 1ZT7B 4GFTB 4P9MH 4RFNB 1C7TA 4Z7QF 5SV3A 3FRPG 5DJ8B 4P4KA 4WWKC 1JHLH 1PEZA 4LKCA 2MHAA 5HHVH 2OTPA 4P46D 3HS0A 3CFCL 4NN7B 1MFAH 1ZA3B 1E4JA 2VLRA 1JNNL 4LCCB 4LVOB 3HE7C 4Y16C 3G6JA 1R3HA 4YHPB 4YWGL 2EIZA 4U1HA 3PDDA 3RTQB 2GYSA 4NQDD 3TO2A 3ECBA 3QUXC 4XCNB 1BJMA 3X3GH 1O7SA 5FHAH 1U8MB 5J1AB 3VFOB 4L5FL 4QHLA 3NACL 1EDQA 1FYTD 1EFXA 4OZGF 1UFUA 3GSNB 3D18B 3SOBH 5IV2A 5SWZD 1J1PL 5T3XL 4MQXC 4PJBE 3THMH 5ANMB 2FB4H 3OJVC 3ARFD 4WW2A 4QHUB 4I3RH 5E1AB 3KNBA 4YNYB 5F3BA 3C5ZB 1G6VK 1TCMA 5DR5H 1IBGH 2LABA 1QLEL 3NA9L 5E4EB 4HEME 5CJBA 2MCG1 2RIKA 5C09B 3ARGD 1OARL 2D0FA 4HH8A 5E56A 2W60B 4FMFA 1KC5H 3IS1X 5EIIA 1TTUA 3D3VD 3O9WD 1T2QL 3U1SL 3IS0X 3HCVB 5CJOL 2Y6SD 4HJJL 5FA4A 1CTOA 1INEL 2X89A 1RURH 2DTML 2MQ3A 1Q9LB 4DQOL 4OI7A 3GBLA 3DETD 1NSNH 5E7FA 4JZJB 1FVCB 3QUMA 3CFIC 3MJ6A 3BAEL 3IDIA 1E6OL 1TJGH 4UDTB 1A7PH 2UZXB 1I8MA 4OZGB 4M7JH 4D0BA 2J4WH 5D2LF 1YYML 1DLFH 3B8YA 1IAIH 4FXGB 5DD6B 4CW1B 4JG0H 4F2MA 1DSFL 5GZOD 4YFDB 4JFPA 2YWYA 4PJ7F 1QBLL 2HJFB 3ZKMD 2C4XA 2X70A 3MRJB 5DJYB 2FIRT 4OJFH 5DSCB 1REIA 5K93A 4M6NL 3KWWB 4MCYA 3WIHA 4QHMA 3T2PA 4AEEA 4DFIA 2VKXA 1LE5B 2X4QB 5C92A 3OKDA 4FFVD 3ZL4H 5KVEH 4PLJC 1WIUA 1PY9A 3IDYC 5GRVK 1FZJA 1OGAE 1UEMA 2DQJH 1IQWL 1BX2A 5AUMB 4OGYH 2BVPA 3MRMA 1AI1H 3VXRB 4FQCH 1U2CA 3U9PH 4ELMA 1IAOB 3IJYA 3HI6L 3BRDA 3I75A 1RY7B 2YK1L 2Q8BH 3EFFA 5JXAL 2RCSL 4MWFA 3NIDF 2NXZC 1MFEL 2CLVA 3T3MF 4HAGA 1KXTB 5F9WC 3U0PA 5I1CL 3EIFA 3LS4L 3T0XA 1ONQA 4OF7A 3D39A 5F7DB 4OQTL 4LGRB 3QHZL 4KMTH 4WTXA 5KSBB 3GSXB 1NLDH 4L3CA 4MGXA 1DP0A 2VMFA 1N0LA 2XTJB 4LASL 2ZPKL 3AVEA 4PRHA 4NHCH 4X0KB 2E3VA 1NANI 4LLWA 3B3IB 2FATH 2A1WL 3DPBA 3TGXA 3MRKB 1HKLL 1BIIA 1KJMB 4J3VA 3HNVH 2JJSA 1DL7L 2J5LC 2PYEB 1ES0B 1TZIA 2YUWA 3WHE0 4L8CB 1EO5A 2GJJA 4PJ8B 4HJGB 4X5WA 3U0PB 4ZYKB 3QEQE 2L7UA 4TVPH 1CXKA 2GY7B 3WKNA 43C9A 2DQEL 2VXQL 3ZDXE 4NM4H 2IH3A 1MRCH 4AIXA 1C08A 3CFEA 3IT8D 5D71H 2HKHH 2I9LA 4L4JA 3CXDH 4GKZA 2C1OA 3G6DH 1FQ9C 3PL6D 2YSSA 1LVEA 2YZ1A 2WM0A 1LP9B 2VXTH 4JFYB 1H3GA 1TVHB 3HUJF 3AMLA 5DC4B 1MCPH 4P3DB 3MYZA 1FH5H 1VGEL 1NBVH 4PG9B 5IF0B 3BW9B 4Q0XL 4ZFFB 1XR9B 4MCYB 3MV8D 3OSKA 2H1PL 5DSCA 3ARBA 4H1LG 3WJJC 3STLA 3MUHL 3KPRE 2GITA 1OF2B 2DLGA 5C6WH 1FVDA 3VGEA 1ZLSL 1PG7H 2H32H 1J1XH 1G0YR 1KSRA 3WKMH 2V7HA 3WFEH 2F58H 2KKQA 4NOBA 3STZA 4N1HB 1I1RA 1A7OH 3WDHA 4J4PA 3RWFB 1HWGB 5GGQH 5T33H 5BRZD 3LAFA 4RNRA 5BS0E 1IGCL 1Q1JH 1CE1L 4MXQD 2EDJA 2EICA 5I1EH 4X5XA 1XIWD 3R06B 3WSQL 1O7VA 4GKSA 4NQEB 4HWBL 4GG6A 3P9LB 4NRXA 3P4MA 3TJHC 3Q6FA 1ETZA 4JFZH 4WGVB 4HIIB 4X9FA 3RIFF 2FYYB 5I2IB 3VFSB 4P23D 3U7WL 1NUGA 3UEZA 2XWJB 3SDCA 2D03L 5CBAA 1JFQL 2JJVA 4JRXB 4X7EC 1FNEB 3T8XB 4JCLA 5IVXA 4KTDH 2R1WB 5DK2B 4PJGE 3TO4B 1YNKL 3EDKA 4M8QB 4PJXF 5F9AC 5BXFA 4TRPH 4PRID 3UCRA 2IALA 1UVQB 2E6PA 1U8OA 2J12B 2LAGB 3DIFB 4YDJA 5IV2B 2P5WD 3CFJA 1EZVX 3UYPA 1F4WH 3MR9A 2F5BH 2ORBL 2R2BA 3TFKC 4U0RB 4YPGA 1U8MA 2A6KB 3T0EA 3T0VA 1CQYA 1NGPL 4NBZB 1QNZL 1SQ2N 4MSWB 4PRPA 2XY1A 4O02H 2VRAA 4N1CA 3A6OA 4MNQD 1XT5A 3V0WL 3OKOA 5I8OH 1CG9B 2B4CC 2EYTB 3DYPA 5HDQL 2A6JA 3VFTA 4DJMA 3L5IA 1S7VB 1TETL 4YGVA 2Q20A 1I3RA 2BRRH 3K1DA 3CJJA 5J6GA 1U93A 1VESA 4EQ3A 3HN3A 3RPIA 4JY6B 4JN1H 4YBQC 1KBGL 5DJXA 4PBWD 4YHNB 4M1DH 2WBKA 1AO7B 3IDYB 4P9ML 4KAQL 4JLRB 3G5YA 4UNTA 4GRLD 4M7LL 1FNSL 3ZZ1A 2PR4H 1NLBH 1NL0L 5IBUB 4RBPK 1OTSC 3RUGA 2A77H 1QSZA 3CCHA 1EBAA 3VGDA 3QR2A 1FLRL 1I3GL 2X4NA 4U05A 3O2DL 4J3WA 4JPWL 4TSBH 2NY0B 3MLYH 5HSFA 4GSDL 4L3EA 3MV7B 3DI2B 4L4VD 4EDXB 1DLFL 1F97A 2HJLB 5GRWA 4RAHA 3ZTNL 1I85C 2LE9A 4I0PC 1A9BB 5HTSA 5JW5B 2XN9B 3VXME 3IDUA 4D9QE 4HGWB 5JZ7C 1BVKB 4Y19E 4LRIC 3L5XH 4PFEA 1FO0B 4U1GB 4CL7A 4KHXH 4JDTH 4HFUH 4PTTB 4FQ1L 4H8WL 2Q86A 4DVRL 2DM7A 5JW3H 1XCTB 3TVMA 5EUKA 3VFUB 4DUWA 3F12A 1FFOA 4DGYH 5B3NA 1PLGL 3CFBA 2R0WL 4S1QL 3V52H 3VG0L 5DRWA 3CX2A 1CVSC 4Y5VA 1LO5B 4K7FB 3ZTJG 4Z76A 4PRBB 4JKMA 1UM4H 5KJRL 2ARJB 1ZA6A 1LEKA 1MJJA 2F5BL 5J6HA 4H25A 4JFXB 2FHFA 5DQ9B 1DQLH 3GSXA 3AM8A 1OOAA 1UJ3B 4LDOB 3C5ZC 3NIFF 4YK4C 2ZG2A 4DCQA 5T1LA 3VD4A 1KLGB 3X12A 5DEFB 4ONHA 4WFFE 2R29L 5TQ2H 1UWEL 2L7JA 4NP4L 3JTTB 5CCKH 4IRJA 3BJ91 1DBKH 3Q5YA 25C8H 2XA8H 3ZDYF 2HT3C 1PAMA 1FG2A 4X6FA 4ZOBA 1SJVA 3KPOA 4FQXB 4AIOA 2AXHA 3OR7A 2QADD 2R39A 3RTQC 2OR7A 2R2CA 2GY5A 2XT1B 3O9WC 4LNRB 4ZODA 4Y16B 5I1LB 1U6AH 3T04D 3KPRD 1FORH 4PJGF 1J0JA 3E8UL 3FT2A 2J8UF 1YEHL 3BP5B 5DEZA 1AHWC 4P2OD 2XN9E 5FM8A 1OAUL 3LRSA 3QEGH 3U4BH 3I6GA 1QFWM 4N9GA 3WJLA 1I9RL 3KR3H 3V0VA 5JPNA 2ZSWA 4HH9B 1A1NB 4X98B 5F96L 4Y2DC 5K9QI 5T3XD 4WHTB 5EOCH 3MODH 5DMKA 1GGCL 2UY6A 5EBMA 7FABH 4LPWA 5EPMB 5GZND 3G5XA 3WJLC 3DYMA 1ZHKA 1N3NB 2Z4QA 4HW6A 1AHWB 2I60H 9CGTA 3RJDA 4YXHL 5CGYC 2P44B 5GPRA 2AQ1A 3FQXB 2IAMB 5J3HD 3AREB 1DFBH 1JV5B 4H0IA 1MLCA 3HPLB 3F65A 5DWUL 5I1GL 4K3DL 1BOGB 5MP6H 3LN9A 1G7LA 2EC9T 1UEYA 3RHWF 4UMGA 1S9XB 3PP3H 5C08D 3HNTH 2EH7H 3DVIA 4XMLL 1INDH 1RHFA 4OFKA 5FYKH 4AM0B 3U46A 4C59B 1FLTX 3ZO0A 1GVIA 4JHBA 1NC4A 4L1HA 4JDZA 5JO5A 1FRGL 2R0LL 3BZEA 3DVNA 3JUZA 3FFCE 4TUJB 4NQSB 4NO5B 2LTQC 4PGCB 1OLLA 5CSGA 1EEUA 4ODUB 4JR9H 5D1ZD 3ZTJH 1FN4A 5EH1A 1H15A 2ERJB 2HYMA 4PJBB 3FT4A 3L3DB 3QG6B 5I30H 2Y25A 5ADPL 1P5VA 1KCLA 1U3ZA 4OFYD 3VH8B 4KXZI 1H3WM 4E0RA 2E7MA 1B0WA 4MMXC 1OSPH 4WW2B 3IDGA 2FIKA 1GGIH 3F8UB 5TE4H 3RZCC 5A2LH 1RZ8B 4YEEA 5CILH 4PJFF 4GG8B 3RWJB 1YUHA 3O6LL 1NMBL 2H26A 3P77B 5LG1A 1ZOXA 1H8OA 1KUMA 4G6JL 4R8WL 2VDMH 1CD9B 4ENEC 3KPLA 2EZ0D 1Q9WA 4U1JB 1A7BA 5ICXA 3SOBL 3DARA 3LQAC 1R3IH 1FV1B 25C8L 1Y0LB 1YEEL 3B83A 2ENSA 5F1OB 4N8CH 1ZANH 3WFHB 3TBVA 2NY0C 1HYSD 5HBBA 2VQUA 4JE4B 2G5BB 3A6BL 4O2EA 3SN6N 4KVCL 5KTEH 1WC7B 4X9IA 1OPGL 3BVNA 1D9KB 5HYEA 3QYCA 4OCRL 1OAQH 4W81A 4P3CL 4GRWB 4P5KB 1T4KA 1CGSH 1T0NA 3ARXA 4G6ML 5IFAH 3IDXH 4CVXB 2VQ1B 5DZLA 5F89B 1EJOL 3BN9C 4L4TB 4TTDD 5KSAB 1TQCB 5KSBF 3TJHD 4L8DB 4XMKH 2PN5A 3WO4B 4QTIH 1QBML 3MRFA 3JTSA 4M6NH 3MRDA 4QOKA 3KPMB 4CVZB 3WXVH 5E95B 2DQUH 1BEYH 5C0DA 4NZUH 2NXYB 2EIEA 2UVEA 1EUUA 4FG6D 4NZRL 2XPGB 2APTA 3RDTB 4X7TA 1PSKL 4NQEE 5I76B 1GJIA 4K7PL 1KB5B 4LEOB 4Z5RA 1S7TB 4WU7A 1ZS8A 3PQYB 5EBLB 1A64A 4Y19A 2GK2A 3IDNA 4W6YB 1X5JA 5E8OB 3CDCA 3V6OE 4EUPB 5HHPA 5BS0B 4HK3J 4DWHA 5JQ6H 4F57L 2HFTA 3MRQB 4G5ZL 4XP9H 3GMRB 4ETYA 5IG7B 4JREB 5C0RH 4XWOD 1A7QL 4RWYH 1HHHB 1KLUB 2Z91B 5HDLA 3DGGB 2Q87A 5GGVL 5EN2B 3GSRA 4M43L 1RAMA 4JN2A 3BEWB 1U8QB 1N6QL 2VR4A 4H20L 5HGDB 2A9NL 4LRIA 1IAMA 4QXUH 5FCSH 4KWUA 4EQ2A 1RIVL 1PKQB 1H9VA 3VI4F 2D2OA 5C0FB 5F8RC 3QUXA 4MAYD 2XTLA 4LVNB 2BNQB 5C6TL 5FYJD 1KG0B 4RMSA 1F58L 3AAZA 4J7RA 2W65B 3MYJB 4LSVH 2ADIA 5C0BA 2GUOB 3MLWH 1T20A 2HTLD 2VDML 3O4OC 4Y4KA 3BN3B 4Y5XB 3F7VA 2HWZH 4YGAB 5F7WC 3T4YA 1P4BH 4NZDA 2AJZB 5GS1A 1A6UH 3O6KL 2PCPA 4PGDA 3DGCR 2FATL 5IB1B 2AABH 4UT9L 1DVFD 3KPSA 3BOVA 4PRDB 2F8OA 2FEEL 3BQUC 4OCWL 1A6ZA 4XNQB 2E9JA 1I7TA 1T22B 2WSKA 3VWJD 4I9WE 5AZ2H 1DQLL 3UAJD 3BRGC 2XKUA 3RL1A 4OCRH 1OGTB 1NBYA 1HXMB 3QUYC 4IOIA 2J6EH 2BVEA 4GXVH 3MMEB 4XP5H 1NGYB 2CDGB 3RAJL 3UMTA 1V7NL 5I6XC 2UZIH 2ADGA 5B3JE 5D4QA 2DWDB 3MNZA 2Z0BA 1T5XA 3CXDL 1ZAGA 4HKBB 1DR9A 4BH7B 5FV1L 1B4RA 4GRWF 3IDMB 2QBWA 1QBMH 3UC0H 1KPUA 4YDKH 3NCMA 4YDLB 4PJCB 1A6AA 4QLRA 4EXKA 4JJ5A 4S1SL 3DETC 4JFDD 3L5XL 2X4PA 1ZHNA 5GSVA 2AEQL 2EEDA 3VD7A 4Y4FA 1T5XB 4LBEA 3FQRA 1A6VH 1KV3A 1K4CA 4QYOB 3REWA 5DJ2A 1P7KB 3N1GC 4LSRL 4ZO7A 2HTKC 1A02N 4M7KH 3RY6A 1YEFL 4DTGH 4RAVB 3WUZA 5EOCL 3L3GA 5HHME 1HXMA 1KTRL 4IOIB 4QRUA 1KJ2L 3T1WA 5ISZB 4C56A 3P9WB 3E6FB 3MLVL 4UIKL 1UXWA 1F11B 3K2UH 1DN0A 2EYRA 3H9HB 1MCWW 4PRDA 2A83B 2YMXL 3DX8A 5E4IA 5HHQB 1MOEA 32C2A 5E5MA 2EDWA 2V7NB 5HGAA 3T4YB 4UOW1 5T3ZL 3O81A 1CFNA 4N9OB 4OM1H 2ATPA 1JF1A 1RIVH 1T21B 2XA8L 4F7MB 4FTVD 2ADIB 4PP1C 4OCYH 3AAZB 2P7TB 1YN7B 2YUXA 4G8FA 5F7HA 2BNQA 5DJZB 1UM5H 2BC4B 1A9EA 3RU8H 1T1WA 4QRTA 3V5DB 5F6HI 4PIRF 4MHHG 4NQTA 3H7LA 2LU7A 3MCLH 1SEQL 4U6XB 1AP2B 5DFVC 2ITCA 5KSVB 3QP3A 4HZAA 1ND0A 1C16A 5BRZB 5D2LA 3JV6A 1HHHA 3CU1A 1JMZA 1G1YA 2Y72A 5L2JB 3VFWB 3VA2C 4OLXH 1IM3B 1FIGL 5B22A 5HYQB 4KJYA 4OZGE 4EOWL 1C1EL 1A3LL 2I60L 4JREC 1S9YB 3BH8A 2P46B 1BQSA 1AKJA 5HHOA 1E4WL 5H37G 5LGHH 1AGBB 1YDPB 3PWUA 2D7OA 4Y19B 3HE7D 1LK2B 4OM0L 5TJWK 5DK3A 3DRTB 2QQNL 4DKAA 2IFGA 1HHKB 5HDQH 3ZKSD 5I75C 2KQMA 4N8CL 3VFRA 4P46C 3MUGA 1ZV5A 5JLZB 2AJXH 4WI2A 1MFDL 2VKWA 1FNFA 2APWA 2LQRA 1JJUA 1JMXA 4HWNA 4U1NB 4JZJC 2EDLA 3C6LD 5B39A 2DM3A 5D1XA 3WV0A 1EEYB 3KYNB 3TBWB 5E70A 3IVKB 3QNZA 4PJ9D 4XNMA 2HFEB 1IRAY 2APVA 1NLBL 2PR4L 3BP7A 4WNQB 1AGBA 5IEKB 4YUEL 4FQJL 4NQCA 2OMBA 1B0GB 4HS8H 3CFKA 4S1DC 1R5IB 2EC8A 5F1NB 2Z9TA 5FK9A 4DN4L 1R5VB 2W92A 2BRQA 1ZVHA 2F8XC 3RWDB 1T89C 4ORGB 3EJZC 3TIDB 1G7PA 1AGEA 3GMPB 3QQ4B 5EO1A 1D5BB 3JV6B 4G6JH 4R8WH 4FQ2L 1FGVL 4OLYH 2OI9B 1WQVT 2FX7H 3RA7H 3T1FA 2I9TA 1CXIA 1MFCL 1B0RB 4LCWA 4OD1L 5BVPH 1C7SA 4MD4B 3SDAA 2NQCA 3MRHB 3D39E 1A9EB 1FPTL 3KYAA 1YN7A 4G8FB 4ZO6A 5LGKA 5JW3L 1AXIB 4F7MA 1DBBH 5C8JB 1HQ4B 5M7QA 3FB6A 4U6HB 3VXUE 5IFHH 2DQTH 5IQ7L 3RZCB 1UB6A 5EU5B 4X8JB 3GK8L 4XVSL 2LVCA 1W8OA 4MDJA 2NY5C 4YHOL 5DF0A 3FO2B 4RFNC 1CF8L 1DVFC 2ERJC 5ICZA 3BZEB 3S88L 2DLFH 5D7IE 1NC4B 4OZIB 4GLRI 4JFQB 4ZUWA 1UXWB 4I0PD 1VENA 2WIIB 3IFPB 4LPTA 4G9FB 2J88L 4N5UA 5BQ7B 4YFLI 3VXPA 2W9DL 4F7PB 4RFEA 5KZCD 1ACYL 5H94A 3L1OL 1R5WB 3THML 1KEML 3K0WA 3LKQB 3A6CH 1ZT1B 3FQRB 1NBZA 2W59A 4G9FE 3SGDI 2O61B 5E9DD 4HC1H 3HB3D 2R0KL 3WIIL 1JP5A 4KQ3H 5EUOF 4GUPA 2OTUA 1HHIB 5C0EA 1G9MC 3K2MC 4OFDA 1RJYB 2SEBB 3W9EB 3D0LA 4NT6B 3K4DA 3IDMA 2E27H 1A1MA 4X98A 2D31A 1F3DJ 3QH3A 4HAFA 2CSPA 2A0LC 1T1ZB 3S4SG 4N9GB 3KDMB 3ROLB 4HCRH 5FGBA 4Y2DB 3MOBL 2AV7B 3QJHB 3DURB 1L7IH 5H94B 5K9KB 3IAGC 4N5EC 1EXUA 2YEZB 3IXTA 4QHNB 2OL3H 5DI8B 3LB6D 3EYOB 4X6EB 4XRCB 4ODTL 5CSBA 1E6OH 4G7YH 5DXWA 5T1KB 5E2WH 1UH4A 5MP6L 2FWOA 3QFJB 5DO2C 4U1IA 4OZIA 1AQDA 3B9EA 4ZOAA 2EE9A 5ENWA 1U8NA 2VISA 4W4NA 5EU5A 1DBJH 1A3RH 3QPXH 1Y18A 4OD1H 5BVPL 4YHKH 3X14B 1IKFH 1EO8H 3O8XB 4CN6A 3UDWC 5C2BH 1N64L 3QEQB 5J12B 1OTUC 1JE6A 1JGUH 2Z31D 1WJ3A 4PRNB 5ID1B 2R4SL 1AR1D 4XVUD 2FH6A 3NBNA 1PKQA 3R1GL 3GSQA 4JB9L 4LARH 4LCWB 5IJKC 3CFBB 1GSMA 3BWAA 3TLRA 4NC1C 4KKLC 1BJ1H 1NFDE 4OQ1A 5I1HH 5LCVH 2ZUYA 3GSRB 2VLKB 5KS9B 4RRPA 3WDIA 3A6BH 1WBZA 5D7LB 5CZVL 4JZNB 2Q8AH 4Y4HB 5F1SA 4MA8H 2VE6A 4EI5B 3RWGB 2CXGA 3MRQA 1UA6H 5GJTL 4XTRD 5C08B 4ZOEA 1R5VA 3QCUH 3KJ6L 4PTUA 1MSPA 4LU5L 3PP4L 5C0CA 3UJJH 5CD5C 5MHSE 2P42B 3FAXA 3KPQB 4OCXH 4WEMB 1WTGT 4KKBC 5HJ3B 2P43B 4PJHB 3QSKB 3P4OA 2E9WA 2VC2L 3KYNA 3IB4A 3LKOA 4XAWH 4KAQH 5I75B 5CJ5A 1HHGA 1MCJA 3OKNA 3T2NL 2GTWB 4R7NB 4KTEH 1J86A 1B88A 1V3LA 2BCKB 3DROB 3GB7B 2MPAL 1HHGB 1E4XL 2OJEB 4ERSH 1E28A 5JLZA 3LKOB 5TDNB 2A6IA 1Z2KA 2J6EA 2G2RA 3VFRB 1J0YA 3P2TA 3TA3C 2Q6WB 4HIHA 4HS6B 3ARDC 2ZPKH 4WI4A 3CZFB 2W0LA 2WUCH 3WE6B 4ZO9A 5L6YL 1F3DH 4PJHA 1I3RB 1NGZA 2NLJB 3VFTB 3BYYA 3BH9A 4KMLB 4QRRB 2C3WA 4P23B 5DVOA 2CRYA 2X4SA 2ITDA 4M93B 4KHXL 1C5DB 4K3GA 3RVTD 3SO3C 2YXMA 2OTWA 1JWUA 2F19L 1CR9L 5D7LA 1ND0B 5LWYH 4OLVL 2CO6B 3V4PH 5IFJB 5ALBH 3TO4D 5I74B 2FBOJ 1N4XH 1VFAA 1QUNA 2PXYA 2VZTA 1MF2H 2B1HL 3WS6C 1B9ZA 3NVQA 3BGFC 3CFJB 2XYCA 5HY9B 2A6DB 2R69L 1CCZA 1ZWIB 4Q58C 2Y7QA 1MJ7H 3DMMA 4Y1AA 1ZXQA 1MHPL 3I50H 3QUZC 1VB9A 3NPSC 4HX1B 1X6NA 4M9PA 1U8KA 3FFCA 3OXSB 3MGOB 1JF1B 3ULUE 3BKJH 4PG2A 3RGVC 1CFNB 5BJTA 4NO2A 1KPVA 4H0HB 2FBJL 4N0FA 1W8NA 1S5HB 5FHBH 5DK2A 4PGCA 5CIPB 2VTFA 4ZTOL 3EJJX 4NWTL 4P2RA 4KI1A 3I02B 4D94A 1OL0A 2PTVA 4HCRA 5I0ZA 3E6FA 3H3KA 2VITA 5C0NC 3LKPB 3RJQB 1Q1JL 3QJFA 4AL8H 1OD7A 3LPFA 4EDWH 5DQJA 5DVKA 1HHJA 1K4CB 3M17B 2HRLA 3H8NA 4WENB 4Y4FB 1RZIB 3BAEH 4JM2B 4PY7A 1SJXA 5CMAA 3LN5B 2LU4A 2A74B 3FQXA 4HC1A 3BGMA 3MJ7B 1FNGA 2IWGA 3EJYC 2RBLA 4OKVB 4JJ5B 2Z93A 4AEHL 1WWBX 4O9HL 1I8KB 2E7LA 1A6TA 3QI9A 1XZ0B 5DRZB 4YXKL 2HLAB 3NAAH 2HP4A 3MCKB 3QUYB 1QSVA 4IEFB 4MB3A 5GHWH 3BKYH 5AZEH 4YAQA 3QIBD 4BH7A 5BZWB 5JORB 3V8CA 1NCCH 2MNUA 5DJ6A 3GZKA 1J0IA 4GW1B 3HC3L 3LHPL 3FT3B 5D9SB 1LE9A 5K9OA 1X5LA 3ZE2E 4X6DA 1LP9A 1YMME 3PV6A 4LAQL 4Q9QH 1Z3GH 4ZFOL 1NUDA 2R23B 4H0GA 3SE8L 4HBCH 2YPVH 4IBLT 1I7TB 3WNNA 4M48L 2QQQA 4XAKE 4ZUWB 3H7BA 4D0DB 4R6UA 4PGBA 5F72S 3VWJB 1MJUH 3SDYH 5CKGA 1YJDC 5IB1A 4WFGE 4XBEH 5DUBA 3U4EA 4M4PA 2HJKA 4RISH 4D8PA 1UB6B 2CQVA 3MLVH 3IU3B 3NZ8B 5DEGA 1BM3H 2XKNA 3ARFC 4TSAL 1XF1A 2B1HH 3V6OA 2L4OA 1NAMA 1HQ4A 2RGSA 3PWNA 3TN0A 1NLDL 2W65A 2J5LB 3C6LA 1XGTB 4YDIL 4Q97A 1MCIA 5KVDH 4JN1L 1ZEAH 4X0KA 4OFVA 3RL2A 1AIFB 4MD4A 1JUFB 1ZHLA 3SDAB 5KVFL 5DLMH 3ARZA 4M1GH 4JN2B 4DAGH 1VKXA 3DGGA 3EYVA 3D39B 1RPQA 3S34H 3P0GB 4U6VH 4GAJH 4HPYL 3BRFA 4K94H 5DRNB 1XF5B 5D1QA 6FABL 5CEZL 3UTTB 2VXQH 4HS3B 5AD0A 3RWEA 2P5WE 4ZUVA 4P46A 1NCBH 2EXWD 3ALPA 4ETQA 5EBWB 4ZAKB 2GSIB 4RFOL 5ID0B 4JO2H 4NKIL 2E27L 4E41A 1WFOA 4M02A 3UX9B 3LB6C 1UM4L 2WK2A 3CLEH 1KB5A 4LEOA 1FO0L 4OLXL 1HI6A 2FD6L 3IVKA 2EO9A 4WTZG 2C3GA 3OB8A 1JGEA 4U2ZA 5E8NA 5CZXC 1U3YA 3T4AB 3GSUA 1CFVH 2A0LD 1QFUL 5HYIA 1MRCL 5MERA 2YD4A 4DVRH 3C5JA 5LVEA 1DUYA 5DA4A 4CDGC 1OT1A 3G5YB 1FVEB 4GSDH 2F58L 3ILPB 1UYWH 2NYYC 3H9SA 2GEEA 2N7AA 2VQ1A 4JPIB 3UPAA 3IDIB 1TVBA 4ALAH 2IMNA 3GHBL 4Z7NF 1BVLB 3WLBA 1FE8H 4DN4H 3MACH 4WTZA 1K6QL 5ILTH 3FONB 5A1AA 5HVWA 3H3PH 1DLHB 1U93B 4ODXA 5HVFB 1AKJB 4KK5C 2DYPD 3X13B 3FN3A 1WAAE 2A6JB 3MBED 2FX8H 3DSFH 3KR3L 3VFWA 1GYAA 3MLZH 5CJQH 5C0RL 4PRPD 4JVUA 3W39B 1BF2A 2XQYG 4HKXA 1C8PA 4JB9H 4F9LC 5AAMA 4Y5VC 4DUVA 2OX5A 1NCUA 5HGBA 2BOCA 4X6DE 4U4BA 5BV7B 4FXKB 5I15L 3T0EB 1NCAL 5IW1A 3IRZA 1RFDH 3PWVB 2Y36H 4OZFA 1J0KA 1YUHB 3J8F7 3KNBB 1AC6A 3X3GL 1MCOL 2F53E 2R29H 3VG9C 2FX7L 2UV3A 5DDHB 2WWMC 2Z31A 5CCKL 4NZTL 3QUML 3FO0L 4YHML 5GGVY 4OCXL 3LV3A 3S36H 3L3DA 1OSZA 3QG6A 3PWJB 5FYKL 5GGTA 1FPTH 4JKPH 2MWCA 4ODUA 5E5MB 3GEWB 3QT2A 2GI7A 3BKCH 4KKCD 4WU5A 3RTQA 4HPYH 4PJ9B 3DVNB 1MCLA 2BSSB 5MI0C 5AYUH 4JRXA 1NGQL 2H2PC 3ELAT 3DO7B 3NCJL 4AH2A 3RNQA 3WNLA 3HS0B 5J0BA 2DLHA 2E7CA 4RIRB 4W6XB 4M7JL 4IMKC 2YA1A 3GBMH 4AT6A 3TPKA 2WWKT 3AU1B 4AMKL 3RKPA 4M7ZC 3TYGH 4WJ5B 4IDJL 3DX6A 3HKFA 1AR1C 4XVUC 2XWBB 3JV0A 3HPLA 4FOMA 3PABA 1S9KC 1H3PH 5F7NC 4IMKA 3DVGB 5E2TH 2LVEA 3NFNA 3ARRA 4K55A 4WI5A 4PJCA 4WHCA 1N3NA 3N9GH 4XP6H 3W2DL 4IJ3C 1J88A 3DV4B 5HVHB 2NY5H 1UACL 1QSEA 1I4FB 2NY2B 1LEGB 5L8JB 1KTDA 4RMVA 5CD3B 5E5RB 4K8RC 3AROA 1O0VA 2W9EH 3RDTD 4XNXL 5EU7C 3ULVH 3LSOA 3WUWB 1XR9A 5DK0B 4FQXC 4QOKE 1OAZH 1I75A 4ODTH 3G6JF 4OGAC 4UT6L 5FF6B 5T1DL 3S4SB 5MENA 4A2MA 3PL6A 5IMLB 15C8H 4P48A 3P9MA 4U1LB 5FKPB 4UIMB 4CVWA 1MF2L 5F6IB 3FN9A 3IDXL 1NUNB 3CSGA 3DSNA 1AQKH 4PJ5A 4P9HL 5GGRA 3GMMB 5F7LB 3W11C 1IKNC 2UUDH 2B1AH 2F5AH 3NFPA 43C9B 1NCCL 4HIJA 3CVIL 3T3ME 4OD2B 4ONHB 3VD9A 1F6AB 4J8RA 4LFHD 1S9VA 5F7YC 4J23A 1M7DA 2DQCH 1BQLL 4DZ8B 5J06A 2Y23A 3ZTNH 1KB5H 3MYJA 5FDWA 5JXED 5C9JB 1UWGH 1OAQL 4XBPA 1LEKB 1ZA6B 4K7PH 2NZIA 1EJ6A 4FQQA 1CLZH 4JY4B 4B5EA 1K5NB 5HYJA 4N68A 5HYJD 5D7IB 3BIKB 5FDWB 2EO1A 2VABB 4EN3D 4P2QD 1NFIA 2AS5M 4G43B 4LLMA 4POZC 1IQDB 2VNCA 1BZ7A 2C7UA 3DV6A 2Z91A 4RRPG 4TNVK 4ONFL 5FEBA 1XGUB 3VJ6A 3O6FB 1I3VA 4J6RL 1T2JA 4Y4KC 3TNMB 3WNPA 3RIAK 2R0WH 4S1QH 4M5ZL 3B9VA 4V2CB 5I16B 4PJ5B 1IAOA 1EGJH 1N59B 3MLRH 3PGCB 4ZOCA 5HHPB 4LSQL 3RWHA 1UKQA 1A22B 4GMSH 5GJSL 5LGJB 5AUMA 3FKUS 1S7TA 4WU7B 2UYLB 5C0GB 3PL6B 5IMLA 5IM7B 2NX5D 4F33A 2H41A 2VLLA 4ZUSA 3VFGL 1D5MB 3NN8A 4YZFE 5ETUB 4DN3H 2VO5A 3QIBA 1I8LC 2VLME 5CEZH 4X6CB 1NMAL 1XCQB 4EZMA 5D1XD 2YD1A 3HFMH 1A7NH 3FTGB 3WHE1 3QUXD 4MAYA 1QR4A 3C09C 3MRDB 2YRLA 3QAZC 1Q9KB 2BFVH 3LPWA 1CK0H 3ZLQC 3C5ZD 1KCVL 4O5LL 1JGLL 4LLQA 4LF3B 2UY7A 3FN0H 5IROA 4XBEL 5DJXB 1T0NB 3BIBX 5DMIH 2ZUQC 5D1ZA 4LSSL 3ME0A 4XP9L 2NY4B 5GS3A 3PWPA 5EU6E 5ESVB 4MQ7B 3U30C 3X3FH 1T89A 1WC7A 3M45A 5ISZD 1CQKA 5E94B 1S7VA 4Y4HD 2NY7H 5BVJA 2DYPA 4HHAB 5I66A 3MV11 4XC1H 1HYRC 4K3HA 4KK6C 3UTSB 4FS0A 5A16A 1A6WH 4U0RC 3QO0B 2FECL 2PO6D 2DLIA 3UAJC 4AH2B 2AJUH 4R7DB 4Y1AE 1CLYL 3NIGF 4RA3A 4Q2ZA 5DLML 2XNAB 3BQUD 2FR4A 4U31A 3S3PA 4D3CH 3OX8A 1FFNA 1KCRL 1F4WL 5AZ2L 3FFCD 3NACH 3S97C 5I8KL 3P77A 1OAYL 1DQDL 1GPOL 5IB2A 4JRYB 3QCTH 2VDNH 3SE3A 4A6YB 3ULVE 5JHLH 3EZJB 3U0WH 3GMLA 2BHUA 3S37X 1ZVSA 1DE4B 3SDDB 1AJ7L 3D18A 4X4MA 2GHWB 2AGJL 3NCFB 1BFOB 4LLVB 3TP4A 4BSWB 1FZKA 1I1AC 1QO3A 1D6EA 2K7PA 4QGYA 5HGBB 4NKMB 3TJEL 1Z0NA 4M5ZH 3K4ZA 2ZNWA 4XPTH 2VLRB 2JB6B 3VGHA 4H26B 4Z8FL 4HIIA 4NJ9L 3VWKB 4LKCB 3OKEA 4OM1L 1F4HA 2DIAA 4NQEA 5E94A 3QQ3B 3AY4C 3CPLB 3MJGX 2YA0A 3O3BA 1EBPA 5KN5A 1KEMH 1F8TL 3RVTC 4POYA 1DLHA 1P6AB 1RK0B 1U91B 3EO0A 2H2PD 3OJDB 4XBGA 1EZVY 4J4PD 4PJCE 3D2UB 1C1EH 1Z9OA 2DL9A 4JGMA 3NAAL 1CGUA 5JHDA 4K7PX 5D2NA 2DQFB 1WBXA 1KULA 3NGBB 2O5YL 1Z9LA 1WFTA 1GGTA 1MFBH 1PQZB 4P5TA 3E3QE 2PTTB 2EDRA 4R0LB 4TTGA 4Q74A 3HZKA 4M62L 5K9QG 4UOW0 1CLOH 1QFWL 2VLKE 3MJ9H 1URLA 4KJPD 3O6ML 4HWZA 4A2LA 3FN0L 2Q3AA 3QDJD 2HVKB 1IC4H 3EYSH 3BXNA 3ESUF 1FL5A 1ADQA 3E6HA 4I48A 3X3FL 1ORQA 3MFFB 3JUYA 4MXWH 1RJZB 3WFBL 5ITFB 1GRWA 2ICEB 4ZAKA 4GKZB 1V7ML 2JLLA 4RISL 1EEZA 1T80A 4MJIE 4GRMB 2XN9D 2BSED 3A67H 5MEND 3HR5B 4URTB 1WV7T 5AD0B 4HXAL 3JWOH 4NQVB 1CS6A 1F4AA 4YHMH 5E2UH 2BVOA 4P4RB 1QQDA 3OG6B 4Z77B 4LPYA 4NPYA 4D9RD 2K1MA 4NNPH 1TZIB 2FEDD 5JDSB 4WEUD 5KVDL 1VKXB 3L9RA 4OGXH 2DBLL 1CDUA 3BP4B 1T3FB 3MV8B 4OIIL 5ERWB 5FHAL 3SGKC 4OZ4A 5I8KH 1ZGLP 4Y2OA 2NW3B 2ZOLB 3OZ9H 5J6HB 5FUZH 5C0BD 5B8CB 1A7RL 4YWGH 1UWEH 2FL5A 4UILH 1NEUA 4JY4A 4OM0H 3FO9B 2FL5B 4M8VA 4WEBH 5ECJE 4PV8B 3HPJB 5FO7B 4LARL 1K85A 4NFBA 2W1NA 1CLCA 4L4VE 4L3AA 1AGCA 1PY4A 1UCBH 4OD2A 1OWWA 1T66C 2CKBA 5I71C 2GJ6D 3QPQD 1OP9A 4TRPL 4Q9RH 4NRYA 2C3HA 3ZHKA 1RUAL 3VE0A 4ZUTB 4G9FD 1E4KA 5GGRB 3I75B 3W5MA 2BY1A 1DQMH 2DDQH 3CD4A 4KC3B 1MVUB 4ZS6D 1F90H 2CUMA 1G84A 4J3SA 1TJIL 4QHKJ 4WO4D 1NH6A 4G8GB 3QIWC 2R8SL 1HN1A 3OGCA 4XP5L 3RAJH 4L3EB 4XHQA 3OKDB 2G60L 4BELD 4OF0A 2D9CA 4BFGA 1DBBL 3VXMD 2HLFC 2IANA 1DEEB 5T1DH 1L6ZA 5JORA 5DJYA 1YY8B 4YAQB 3MA7A 3RUGB 2BNRA 2DQDL 5L2KE 3L5WA 5F1IB 4HT1L 3MRGB 1NDGB 3MRIA 5D7SL 1DZBA 1A7PL 4KKAC 2R1YB 2P5WB 1AO7A 4MNQE 3LQAH 1FBIH 1EV2E 2A74A 1CFVL 3WN5B 1DSFH 2YKLL 4LFHG 1RJLA 3L7FB 3D39D 4UNVA 3MRLB 3AU1A 4DTGL 3RY4A 1QHOA 4JKLA 3Q6GL 3QJFB 4RIRA 4DEPB 4Y7MA 1CG9A 4HZLA 4XI5D 4P2RB 4XPHH 2UWEF 3VRIB 1KTLA 1INDL 2H9GA 3O41A 3HAEG 4KZEL 4NKMA 3O3EB 4GW5B 5C0IA 3RVWD 4CMMB 1AXTH 3U9PL 1IM9B 4JFOA 5FYKU 3HI6H 2NY3B 2J88H 2VXVH 1S9WA 3H2WA 3MLZL 5IMKA 5J8OA 4KDWA 4ZXBC 3P73B 4H5SA 1IILE 4Z7OF 4YXLH 1TQBC 2Z31B 4FFWC 5IQ9B 3ZYIA 4JG1L 4UUJA 3DMMB 1KN2L 3CLFH 3F7RA 3MGTB 4YHKL 3DTXB 4ZO8A 3BKCL 3P73A 3QHZH 4XXCC 3V6BR 5L7XH 5E99H 5BXFB 2ORBH 4M3KB 5LXGH 1U8JB 3VFOA 3G6JE 4XPBH 4XWGH 4FXKA 2XG4A 2H3NB 4NHCL 4LSUL 3MBEC 3HZMB 5JHDD 3QCVL 1PLGH 4BKLB 3LMJL 1RZFH 4U7SA 4Q2ZB 2Y9RT 3VXUD 4EUPG 1OAYH 2ATKB 3O45A 4XH2B 4HXBL 1IGML 1IAII 4Z95H 4PJGB 5DD1L 3GIVB 1AKJD 3MRCA 3EFDH 3T0DA 2YD5A 4M00A 2DYPB 4HHAA 5I66B 5GS0H 4F7TA 5E8PA 3SQOL 3GM0A 3FO1A 8FABA 1NKOA 4CUCA 4JHWH 4LRNH 2KZWA 5FGRA 4R4ND 3GI8H 4HUNB 3KJ6H 3WXVL 3EYQD 1BVLA 2AEPL 1BGXH 2MTPA 1P4LA 2PUQT 1SEBB 3O9WA 3TIEA 2C1PB 1FZMA 3B9KA 3CK0L 4OFIA 3C08L 1UENA 2IBZY 4XPTL 2ZCHL 3OKMB 3VFMB 4PY8I 3QXWA 1QACA 5L9DL 5KSAD 2BCKA 1LQSR 3L5WB 4HGKC 2HRPH 1XF4A 5BRZE 3LEXA 4KRPB 5C0AD 2PO6C 2IAND 5HDOA 3GKWH 1Q0YH 1TDQA 2IH1A 4P3WA 2Q7YB 5ETUA 4S1RH 2P5EE 3O3AA 4K8RL 1Z5LB 4UQ3B 1N8ZA 4OUUA 1MVFA 1TMCB 3W2DH 3BMVA 4G8GA 5I1EL 4JY5L 5ICYB 5FM5O 3RWHB 4OTXH 3RZWA 2ESVB 3O11A 4M6OL 3EBAA 3B9AA 3RVVC 1LEIB 3VFNA 4Y16D 1NGWB 3D69B 4PP1D 1KCSL 5E6IA 3C6SB 5ACLA 1RZ7H 5CWSB 4JFED 5KS9A 3KLAA 3PP3K 5EO9A 3TJEH 1YY9C 4XMLH 5JOEA 4PGJA 3GRWA 5E6ZA 1J5OL 1X7QB 2R1XA 4W68A 4NHUA 1FL6B 1SMAA 3QEQA 3CMGA 4PD4K 1FRGH 4IOFD 3BZ4A 1RHHA 2IPKB 3BP4A 1RUML 2GAZB 1F8TH 2W0PA 3RVVD 3KYOB 3IU3A 3NZ8A 1BFTA 4M1CD 4NPYB 3ZDXF 1T2QH 3VXSE 4D8PB 5B21A 2H8PA 2VISB 4YFLF 1RZGA 3U4BL 4OIIH 4WO4A 5ENWB 1BECA 6FABH 4MLSA 2W91A 4HXBH 1PGRB 1T7VA 5IBTH 1VA9A 3GMMA 5FHBL 3O2WL 1N2RA 2C4FU 4U1KB 1WWCA 4UIMA 2X4RA 1LDPL 4LHUA 5EZLA 2FSEA 4X6DB 4PP2A 3QB7C 3IXTB 2EYSA 1YEHH 3MLXL 1M7XA 1K8IA 2OQJA 4Y8DC 5JXEC 2X4QA 1L7TL 2QQKL 4K71B 4Y4FD 2HVKA 4UTAL 3BI9X 4U1MB 3ROLA 3M8OL 3WUWA 2A73A 2Q76B 4H1LA 1JK8A 3IKCB 4YHOH 3GJFB 3Q3GB 5IROC 4OF5A 4CMHC 1CF8H 4KJWC 1QRKA 4MCZB 2EDQA 3OKLB 4QRPE 3HTLX 2HJFA 4OCMC 5BMFH 5TE6L 3KLHC 2SEBA 3CDGA 1XZ0A 1B2WL 5L0QC 4E42A 3V4PL 2PTTA 4ZNCD 3GBNH 1HHIA 5C0EB 1SY6A 2Z93B 4NRZB 5KS9F 3IJHA 1KN4L 1WEJH 1F6FB 3VXNB 3NFNB 5FYJH 1WBXB 4ODSL 5F7EL 1NCNA 1OAKH 3FCTB 1J8HD 4TQEH 3JWOL 4FQHA 4XPFH 1T2XA 1EMTH 4MJ6A 3D25B 3R8QA 3IKKA 1ZT1A 2BY2A 5IESL 2IBZX 4MJ2A 1FNLA 3OAYH 3O3BB 3KPRA 4HUWA 3AS2A 3QQ3A 5IUSA 2HH0L 3BD3A 4ZS7H 5KOVC 3UO1L 1R0AL 3CH8A 4UB0H 3IXAA 4QRSA 4TSBL 4NQCD 4R2GB 2R0ZH 2CR6A 1KCUL 1YEFH 2WIIA 3LDBB 5EDXA 4X6DF 3RPKA 4HV8B 3I02A 1FNAA 1MIMH 2VERN 5C0AE 3RWIA 1UKTA 1JNHB 2J8UE 1JTPA 4DKEL 2AJ3A 4N0YL 1UXSB 2FZ3B 5M94B 1D6EB 4I3SL 4FFWD 4PBXA 5TDOA 4CN1A 5E00B 1T1XA 3DRQA 2AQ3A 3Q5TA 1RUKH 1WAAF 3DLQR 2R2HB 3TF7C 1A2YA 5BO1H 3SDDA 4GKNA 4P49A 4KKCC 2Y7QB 1ZWIA 4JANA 1QSED 1QYGH 3GSNA 1OQOA 4PJ7B 2Z35B 1ERNA 5SWZA 1WFNA 3ABZA 3F62A 4TPRH 3W9DB 2M2DA 4HBCL 2AKRA 3ECBB 4XCNA 5SWSB 5IB5B 1ZEAL 4BJLA 3AS1A 4S0TD 4NJ9H 5IBTL 1JWUB 4YC2C 3W0WE 1AGEB 4R97C 1YEGH 3F5WB 4FN0A 1CI5A 5E08H 4MZ3A 4ZXBD 3UTSA 4NN5B 1J11A 4O58L 1KYOJ 2K9UA 1X5XA 1MFNA 3MV9D 4P4KB 3ZHDA 4UOJA 3QXUA 1ZT7A 3PWPB 1FGNL 2QSVA 1X5IA 4YQXH 3DX7B 1T6VN 1QZ1A 3GMOA 4MA3B 1Q72L 5D1ZB 2VIRA 1OB1A 4MQTB 3PWLB 3E1F1 4LF3A 4LLQB 1PYWA 1CICD 3H9SB 1LK3H 2NY1D 4R26L 3GB7A 3VXTA 2GCYB 4HPOL 3C5JB 5AWNH 4JFFD 4MAYB 1ADQL 3GIZL 2ZUSA 2GK0A 3FB7A 2C9AA 1W0VB 1DEDA 4Z7UB 2B5IB 2NYYD 1F02I 2VZ1A 4G8IB 1KF9B 4NGHL 5LKNA 3ARWA 4UV7L 2OK0H 4F33B 4BH8B 3RUGE 2DF3A 2VJXA 4KKAD 2CD0A 1CLOL 2XQBL 4LQFH 3STBA 1U2HA 2GSIA 3L6FA 2ICWA 4OLYL 3TV3H 3QPQC 4L3EE 1JL8A 4HUKB 4KJYB 4TOYL 5DRXA 3WUWG 3UTTA 2YUZA 3RKDD 4PJHF 5DRNA 5EUOE 2FHCA 1QLEH 1XAUA 2DWEA 4QNPF 2QKIA 5FA3B 1LNUB 4ZUUA 2GJ6A 2NTFB 1AP2A 1OTUD 2FB4L 4F58L 2B2XL 1JGDB 5DO2D 1W72L 4JY5H 4LCYB 4GS7C 4RGND 1CBVL 3UZEA 1ZTXL 5IWLC 1AIFA 2UWEE 4QRTB 5J1SC 1A3QA 3GHBH 1PW3A 3MACL 5I73B 2AK4D 2P7TA 1T0PB 2X1QA 3ZDYE 1CGTA 2EE3A 3M1BA 4OFYA 3WNOA 3SQOH 3CMOH 3QDME 2ATPB 4G6KL 2ZKHH 5HGAB 1ZLUH 4TSCH 32C2B 3QIWA 1Q8MA 3V2AR 5J89A 5HI3C 5C7XL 4ODVH 4KV5E 5M95B 3VWJA 4K9EC 3T65B 2EYRB 4KXZH 4U1IB 2GJ6E 3GK8H 2QL1A 3SJVB 1JVKA 4UDUB 1WT5C 2BJML 3EGSA 2K7QA 1W0WA 4NC2B 2FLBT 3WNMA 1G7QA 5DI8A 3IGAA 2ID5A 1OPGH 1UT9A 3HRZB 3L3GB 1QPPA 5DD0L 5K9KA 5MENB 4DW2L 1RUAH 2NY6C 1NC2B 5DK0A 2VL4A 3RWCB 3T2OA 4YHZH 3HAEB 2BY0A 3CIQA 4AY0A 1A1MB 3I9GH 3LQZA 1T03L 1I1YB 4LSPL 1R6VA 2X4PB 4CDHA 1RZJL 2XXMB 2P8MA 3D0LB 4NT6A 4WIQA 4WHYH 1IMHC 1AI1L 1Q94A 2ZZUT 4J4PC 4Y5YB 2N1KA 3QG7L 1WITA 3BFOA 1Q94B 3BGAA 4OKVA 2X4OA 1D5XA 2IGFH 3BDXA 3MSPA 3ARUA 3VGAB 5FGSA 4Z7NE 1SJEA 2AVGA 2E6JA 2QADC 4R90L 4JM2A 1MWAA 3L7EB 2DWDA 2L0DA 2BVUA 4Z0BL 4XNZB 1IKNA 2IADB 4O51A 4ZTPH 1S7SA 4Y2DD 4AT6B 4HIEA 1Q9OB 4XCYA 1J1OL 1MIEH 1FZOA 1IARB 2OXGA 1HNGA 2FJFA 3RNQB 4NUGL 2V6HA 4ISVB 1B6DA 2FNBA 3FZUD 4QTHA 2CMRH 5TFSH 2X4UA 4W70A 4XHJC 2CRIA 4PJ9A 2QQLL 4WU5B 4MDIB 3ZDZE 4PGDB 3NCJH 1CFTB 4Z7VA 2VDRL 4Y19D 2YD7A 4L3ED 2AJZA 4NO2B 5GS1B 2BXYA 2AJYL 1UB5B 3HC0A 5D70L 5IJKA 1A8JH 1CBVH 2YR3A 7CGTA 4BK4A 4U1SB 4RZCB 3HUJB 4LHUG 1T20B 1FYTB 3PHOA 1IZJA 3BZFA 5GGVH 1LO3L 3GSVB 1QEWB 2WUBH 5DYOA 3ZSSA 5HVGB 4YX2H 4PJDA 5CSZA 3RUGF 1SY6L 5T5NG 5ISZE 1AY1L 4OZFG 1I1AD 1B0RA 1C5BL 4C54A 4JPVL 3ZKXB 3MLXH 2VDKH 1D5ZA 1CDGA 3LS5H 5EN2A 1MFCH 2Y6SC 3MOAL 2IPUG 2DICA 5F7FA 3S34L 1K8DA 4ORGA 4K3EL 3ZHLA 5IG7A 2Y06H 3BH9B 2VC2H 4QRRA 1WZLA 1NBVL 2DBJA 1FCCA 4QXGL 5CJXC 2DQCL 1AGFB 3C2AH 1JNLL 4L4VA 2F53A 1I9IL 3FONA 4H88L 1YYLL 3CNKA 3MTRA 3BP7B 4KVNH 1H5BB 3NH7L 5MEOA 3GO1H 1J0ZA 2A6IB 3W0WA 1JRHL 1NANH 4IIQA 2P45B 5E2VH 3TYFA 2FH8A 2WUCL 1QA9B 5JW4R 2AJSL 3KPMA 1CL7L 3X17A 3VDCA 1SYSA 4IIQB 5HGGS 4BQ8A 1FGNH 2VWEE 5HD8C 1DDHA 2X1PA 3DOSA 1HILA 4BZ1H 1PYWB 4Z6AT 2CK0H 1XF3B 1EGJL 3EW3B 2VIRB 1CD1A 4MVBD 4GRLC 1LK2A 5KG9B 1NAKL 5ESQB 2DAVA 4RDQG 4WFHE 1EX0A 3BH8B 4JVWA 4N0CD 3VXUB 2XY2A 1KIPB 2H32A 5ALBL 5E24E 3F58L 3TBSB 2EDBA 1N4XL 1N7ML 1RJCA 4ZUVB 4OLUH 1ACZA 4RGMB 1HIML 2PW1A 5CFHA 2P8LB 1R3JA 3TPUA 2NY7L 5C1MB 3MJ9A 1C16B 1G7IA 1QSEE 2OJZL 2ICCA 4MLIA 3SKUD 4FZ8L 4MXVE 1FV1A 1CLZL 4I3GA 1BLNA 4J2XA 2YK1H 4LCUB 5IMMA 3BWAB 4S2SB 1YMMA 3L3JB 1U3HB 3BPNB 3MV9E 1C5CL 1JTTA 3B5TA 3C2SA 1H3TA 4QT5A 1BAFH 5FUCC 1NGPH 3GSVA 1S78D 1X5AA 3SDDD 4RBPH 5CP3A 1ZGLA 4XB8A 2VL5B 4GKNB 2X2YA 3MJ8B 5CD5D 1FYTA 3TVMC 4I18B 1A2YB 2XACC 5EUOA 3MNWB 4PD4J 2NX5A 5I18H 2BX5A 1MREL 1NGXB 4OZHB 1F13A 1U8NB 4RAUB 2BHZA 4PJ8D 4NO5A 1F2XK 1DUZB 2ADJA 1F42A 4K07A 3SY0A 5B38G 5INDB 1QOKA 3JV4A 4PR5A 4R26H 1PZUB 4GW4A 3VWKD 1WIOA 2NCMA 3WNKA 4XRCA 4QCIB 3VFGH 1J8HE 2D7MA 3IRPX 3QIWD 1G1CA 1CGXA 1EXUB 2YEZA 5TF1H 1ACYH 1NPUA 1S7UB 1CGSL 1QLFA 5HYJE 1I3GH 3QI9C 2IADA 3IJSA 4GW1A 1TJHH 3NCYS 4P2QA 2J3SA 1K2DA 4XMKL 4MA8L 4XP1H 1H3PL 4DKFH 1ITCA 3O8XD 3EZ8A 3IJHB 3P0VH 5FKAA 3L3OA 4YR6A 1I8KA 3QEQD 3MFGB 3MA9L 4YR6B 4UTAH 1N5AB 4LMQE 1OM3H 5EC2A 1AD0A 1FNGB 3PV7A 3LQAL 3H42H 5EBMB 2FX9H 5DMKB 5K59F 3RKDC 3QDJB 3OKLA 4BM7A 2CK0L 4OBRA 3UBXG 3NZHH 4DZBB 4O9HH 1X5HA 2W07A 2JJTA 3FOLB 1DN2A 2GQHA 3WKML 1HHJB 3LKQA 4X7FC 4JJHA 3DNKA 3ZT5A 4HUXB 4XVTH 3DHJA 4N0RA 2WINA 2FSEB 2YN5A 1XIWB 3KJ4B 1IL1A 2XA3A 5BQ7A 5KANI 4JFEE 1X4XA 3BP6B 4JFQA 2X10A 4OSUL 3CH1B 4XPHL 2ADJB 3SY0B 3QRFM 3I2CL 4Y8AA 4JRXD 1HEZA 4PJIB 2HT2C 3EOTL 1R0AH 4TUOB 1HKFA 1MHHA 4IRSC 1U92B 3KYOA 3NIDE 4OI9A 4TSCL 4OCLC 1MCHA 4DCQB 5C8JA 4JFFA 5HI4D 3DBXA 5C0BB 2DN7A 2UVFA 4YPJA 4HMCA 5EZOL 5IBLC 1HDMA 3QQ9D 5CEXA 4LSTH 5FYKE 2CMRL 5TFSL 2VLJB 3FOMA 3D6GA 3FMGH 5MEPA 1A14L 2V9QA 1MCRA 2GJ6B 5CINH 1Y6KR 3MV9A 5E6IB 4KK5D 1I9RH 3R0MA 5T1MA 1A4KA 4KI5C 1L0QA 5BW7A 2CGRL 3E0GA 1RMFL 4NNPL 1RU9H 3DO3A 3UTTD 2F74A 1QRNE 5D2LE 1KJ2B 5DC0A 1R5IA 2GT9A 4KGLA 2R4RL 3C5SB 4PJFE 1MUJA 1VEPA 5TF1L 3SCMA 1UH2A 3L6FB 4CKVX 2RFXB 1JPFB 2HJLA 3IDNB 5EIQA 3PQYA 1XGRA 5TPWH 4KUCD 4DUXA 3D87B 12E8L 1TENA 4X7TB 4HLZG 4PS4L 1MQKL 1R3LA 1ZHBA 2IH1B 3GMNB 3WD5L 2GSGA 3I6KA 3MNVA 4DFHA 1SBSH 3P0VL 1YQVL 1JZ8A 3WL9B 1HQRA 5I8CB 3JTSB 3ARBC 3WJJA 5J1TC 1SM3L 1E4XH 4OGXL 4JLRA 4L8DA 5ALCL 4WW2F 1KCVH 4O5LH 4DGVL 3V7AE 4WI8A 5LQBL 1CR9H 2I07A 4UTBH 5C0CE 1N5YL 3DSFL 1FDLH 2MQ0A 2V9TA 3WIHL 4LLDA 1KELL 1YDPA 3UTZB 3OAZK 3MV7D 5HJ3A 4J1UA 2DM4A 2JELH 1NMAH 4JFHE 1AGFA 4L9LC 1A4JA 5FGCB 4CAGA 2MOVA 5JHDE 4TNWK 3ULVC 3BO8A 3BPLB 3BWUC 4F7TB 4C4KT 1LO2H 2G5BA 5T5FL 3MLYL 2R15A 3RWGA 5I15H 3MOBH 5IVNA 4ZXBA 1MCNA 5T1MB 3HG1A 2I26N 3MV9B 4P4KD 5D2LB 1JPGB 1WIPA 4PRPB 1WBZB 2RB8A 4HJ0D 5CBEB 5KSVA 3TEUA 5I1IH 1IGFL 3AFLA 5C3LD 1LMKA 4NN5C 4BFIB 2A6KA 5D96B 1U8JA 4HF5L 5INCA 1F5WA 2R2BB 3GM8A 2BC4A 4X9GA 5CEZD 3DIFA 4YDJB 5DS8B 1UH3A 1I9JL 5IQ9A 5DFTA 4QXGH 3C8KB 2A1WH 5D7JC 3MQIA 1Y18B 2D7PA 3D3VE 3FT4B 1X5FA 5GRZA 4I1NB 5IJVB 1IEAA 4NQDA 1SYVB 2YXFA 1QFWI 5CJXA 3U4AA 3O41B 2OS7A 2X4UB 1ZVYA 3CH1A 1BZ9B 4QTHB 3PXJA 4ISVA 2XWJA 1F11A 4PJEF 4HJ0C 4JHZA 5F44A 3VI4E 3VXSA 3E3QC 2G60H 3KHOA 4K9EL 3S3JA 2FYYA 5ESAB 3EYOA 4EEEA 3P4MB 1JYNA 3BEVB 4HIEB 1ITBB 3QIBC 1JF6A 3KPRB 4OLEA 4I2XE 3DURA 3QWRD 3TCXA 4WI3A 2KBGA 3RVXC 4P2OB 3K46A 3ZT6A 4FQHB 4DZBA 1VPOL 1SBSL 4CU8A 4DK3A 4H8WC 3VXNA 5DZOA 3C60C 1B90A 3ULSA 1HWHB 5D2NC 1ZHKB 2Z4QB 5EA0L 1KPUB 5EPMA 4OBSA 2O61A 4KUZL 4J3UA 3QBTB 1GGCH 1N5YH 5JPNB 1DEEA 5GS0L 2WLYA 3U36A 3VRJB 4XPAL 1CL7I 1R5WA 4ZQKA 5I1DB 3K8LA 2HT4D 5F3HA 5JIIA 4FNLL 2HT4C 1KIUA 1P2CA 5T1KD 1LD9B 1G7QB 1LP9F 4LCIL 2WBJC 3HHRB 3EGSB 4D9RE 3JV4B 4M43H 4PR5B 1HXYB 2H2SD 3E2HB 3WXWH 1U41A 1UYWL 3LD8C 2IH3B 1K3ZA 3RGHA 3G5VA 2BNQE 5D6DC 2FDBP 5KSBE 1WUNT 4I18C 5FB8B 2ARWA 4X8JA 4P9HH 1A0QL 5TE4L 4HJGA 3TBYB 3PG2A 2OR9H 1KN2H 3CLFL 5DEFA 5KVGL 3F7PC 4X5LA 3X12B 2GAZA 2WUBL 3FB6B 4U6HA 1RHHB 3MLSL 3UBXA 3G6AB 4X4YB 4K7PY 5DJAB 4NQXA 4U33A 4NHUB 3GI8L 1K4DA 3NFSH 4LPUA 3UBXI 1D5IH 1LO5A 4K7FA 3N1MC 4L3CB 4RFOH 5HYSG 2NW3A 1JHKL 2VLKD 4FQLL 5IMMB 4LK4A 5E1HB 5EUKB 3VFUA 4MJID 4V2BA 2Q8BL 4RGMC 5JR1L 2BNRE 5FA3A 3HE6D 1CDIA 3C6SA 2ZCLL 3O3DA 2DLFL 2PW1B 3TIDA 4NWTH 1DBMH 3GKZA 4ESKA 5DRXB 1JPSL 3ARDD 1BVKA 2FBJH 2JJSC 2X41A 3EYFB 5ITBL 3D3VA 4UV4L 5IEKA 4RGOH 4Q6IC 5T3ZE 1OD9A 1QPXA 3FQNB 5TE7H 3V5KB 3ZYOA 2DL2A 2HFEA 4IIQC 1XF3A 2ZSVA 3BUYA 2D7TH 3CSBA 2YN3A 4PRIB 3KWWA 3QRGH 1BEYL 1DDHB 4RMWA 4OFPA 5D6CA 5C07D 1NCTA 1SVCP 3K3QA 4M1DL 1NUFA 1UJTA 3JZ7A 4JO1H 4NZJA 1L7TH 2QQKH 4Q6YA 4AJ0A 1YPZA 4DVBA 4CVZA 3BHBB 1GXEA