4PB0L

Structure of the fab fragment of the anti-francisella tularensis groel antibody ab53
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
216
Chain Sequence
DVVMTQSPSSLSVTIGQPASISCKSSQSLLDSDGGTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGAHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ab53 heavy chain
publication title B-Cell Epitopes in GroEL of Francisella tularensis.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2014-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L01
4XPHL 2AJVL 4KXZI 5ESQA 2W60A 4R4NC 1IGIH 4EQ3A 3VFVB 3TBWA 1OTTC 3VWKB 3IFLH 4KK5C 1IM9A 3KPOB 5E8PA 3VRLE 2NYYC 3FT2A 1I9IH 2WQRA 2EKSB 5CKAA 2WNGA 4X5WB 3VXMA 4OT1H 3PWNA 4X8JA 3C08L 1J8HE 3LEXB 3O8XD 3X12A 3IDMA 4LLWA 2DIAA 2NY5H 4NZUH 1EBAA 4MA8L 5DFVD 1NCWL 5ESAA 4ZODA 1X4XA 4XVJL 5D7SL 3Q6FB 3HC0B 4H88L 3B8SA 3D85A 5FECA 3EO9H 2QBWA 5ILTH 2X1XR 1FORH 5IBUG 1QQDA 1BWMA 1BIIB 1L9MA 1NFDE 4QHNB 4J8RB 2VH5L 1NMBH 5T1LD 3F6IA 3MRKB 4N8VG 4R4BB 5IW1B 3HE7B 4YFDB 4QEGA 4CVXB 2R2EB 4HPYH 1J88A 4ZXBC 1K8DB 1J8HA 3DVNA 1QLFB 3H9HB 4KKLD 2G75B 1MCQA 3H7LA 3FTGB 4FFZL 2LTQC 4APQD 2R8SH 5DMYA 3Q3GA 3RL1A 1PZ5B 3MLTA 1PKQE 4TSBH 1AGCB 2CDEA 2XKNB 5CZXD 4NP4H 1A4JA 4JG1L 5EBGA 1IGML 2W1NA 4PJ9B 1AQDA 3GMMB 2IQAA 4LEOA 3GSQB 4XPHH 1L4IA 1NFDA 2PO6A 2X7LB 4Z95L 1I1YB 4RGNB 1MCPH 1HINL 1DP0A 4PREA 2R9HD 1L7TH 3CFDB 3BRFA 2X40A 3V7AE 4LLVA 4ENEC 3PQYE 4JPKH 4ODVH 3TBSB 3SKOB 4YPJA 1JP5A 5TQ2L 3BDBA 3T1WA 3BRGC 2ARJA 1L6XA 4YHMH 3KXFE 2VAJA 4NRXB 3ZTJH 4RMRA 4NN6B 4LCCA 3MRPB 1PKQA 2NY7H 1MIEL 4FP8H 4LSQL 3TN0C 5EB9A 5C0BD 4WWKD 4XVJH 3THML 1DQML 3KPSD 5D7SH 1YEJL 4U1MA 5BXFA 3BFOA 3WBDA 3GI9L 3D39E 2BC4A 4XCCH 3WFDH 1C08A 2FLRT 3IXTB 2DQIH 4MJ5B 5EBWA 1I1AD 1H5BB 3ARBD 4GAJH 3U7WL 3PQYA 3DVGB 1ETZA 3IU3B 5EUOB 2Z91A 4P5TB 1FVDB 2F8OA 4M7ZC 1JPSH 1U8PB 1S7QB 3T0BA 3KXFA 4HDIB 4OGAC 3GUTB 5F96H 2WW8A 5EIQA 1PLGL 3ULVC 5I1AA 3BT2L 3RVTD 1OARH 1A9BA 4EDWL 1BPVA 1P4BL 4QRUA 1L9NA 3L3JB 1MQKL 3ARWA 3BW9A 1AXTL 4XC3L 4H26A 3D0VA 2BNRB 3D39A 2EC9T 1R3LB 4Z7VB 1Q8MA 5JLZB 3MLRH 3QUKA 4ZMAT 1OB1B 1UXSB 2WUCH 1EBPA 3GMOA 1ZHNB 4HFWA 1WISA 3EOTL 1LO5A 1GGTA 4Z95H 1HSAB 3G9AB 4EQ2A 3ILPB 3FO9A 3SPVB 2D7MA 1JCKA 1AO7B 4RMUA 4GXUM 4Y5VA 4G6AC 4WDIB 1WV7T 1BQHG 1KEML 4HAGA 2EDRA 2BNQD 4G6KL 5F89B 4Q9RL 5LCVH 3QO1B 2H3NB 3QA3A 2AV7B 5DD1H 5DMIH 3VGAB 2XTLA 5CINH 1UH3A 1GOGA 4HGMA 3TM6A 4LHUB 2Y4SA 1PDKA 4OZFA 4R90H 2A77L 4HS8L 4D3CL 5KG9A 3PABA 5KSAD 3HZMA 4FZ8L 4M43L 1FC1A 3DX8B 4FFVC 1ZAGA 3RRQA 1X6NA 4JN2B 3CAFA 5IV2B 2KQNA 2VLRB 3THMH 5INDA 4UIKL 1FYTE 3ZSTA 3SO5A 4TUOB 4PGZA 4NDMB 3S88H 3WS6C 2F58L 1CT8A 2YWZA 1T04A 1IZKA 4OD1H 4F58L 5E8OA 5ERWA 3U7WH 2L0DA 5HHOD 2Y06H 1I3UA 5E70A 4N68A 3TWCL 5LXGH 2I07A 2B5IB 3JXAA 1QRNE 5JORA 2Q3ZA 2VISA 5EU6B 5EC2A 3HTLX 4CMMA 4BSVA 3LVEA 4ZD3L 2FH6A 3Q5OA 4WHTB 3SGDI 1T0NB 4XVUC 2YPLB 1I4FB 2NXYC 4NO3B 2FECL 1ZTXH 3PL6A 1OTSD 3D1MC 4ORZC 3U4BL 3SE9L 4JKWA 1FYTA 2CR6A 2Y6SD 1NGZA 1P7KA 3U0TB 1AE6H 2DYPB 3OG6B 5F6IB 1BP3B 4JANA 3V4UH 4XXCC 2F53E 1PQZA 2XICA 1G7LA 3GBLA 1WZ1H 2J6EA 3SE8H 3JSSA 3HNSH 1N7ML 1IFHH 1Y0LA 5HGDB 2EE2A 3H9SB 5HHPA 1QRNA 3HAEB 1BFOB 5EPMA 2Z31B 3UTOA 4FG6C 1IT9L 1J0ZA 3DURB 1BD2B 3MGOA 3OHXB 1WICA 1ZA3B 2FX9L 1CDBA 1MI5E 1T1YA 1OGAE 5F3HA 2WUBH 2CPCA 4AM0B 1OP5K 1VFBB 1PYWA 2V7HB 5IBTH 3FZUC 3MXWL 2EDOA 4LAJH 5E5MB 5M7QA 2F53A 3GK8H 4HFUH 4F7EA 4P2OC 1B0GA 5J9PB 4IRSD 5DQ9B 2HTLD 3EAKA 4UIKH 1IL1A 3BD5A 1O0VA 3QZWG 4M7LL 5CZVH 4GG6B 1BEYH 2CRIA 1LEGA 2F58H 3QIBB 4PJHE 4JHAL 1E27A 3QQ3A 1YC7A 1Q38A 1TCMA 1G6RL 1CGWA 4KK8C 4W68A 4FXLA 1YYLL 1GC1C 1BBDH 1MI5A 3ESUF 5KVDL 1OGAA 2QSQA 2AEIT 4EUPG 1WFTA 4OLVL 4LDOB 1OP3H 1WT5A 4Y2DB 3HR5B 3TBTB 1JF6A 4Y4HB 2DQEH 4OUOA 1AQKL 1TQBB 3EDDA 4KV5F 1I8IA 3QDME 3EO0A 4OGYH 3KDMA 5I30L 2YZ1A 2UV3A 4PJ5E 3GMRA 2R15A 1KIPB 3ZHLA 3MUHL 4PJHA 5EULV 4N0FB 5EC1A 4MJ6B 3AUVA 3MLZH 4K3EL 5SWQA 1KACB 5IQ9A 2MCPL 1I9JH 3V2AR 4AEFA 2IJ0C 1S7RB 1NCCH 5L7XL 3HNVL 1MJ7L 3QQ4A 4U1LA 1Y6KR 2YBRB 4IDJL 4Z77B 4QT5B 4ELME 4JCMA 1KPVB 3E6HA 3IVKB 5D9SA 3OTTA 3MCG1 3D3VD 4FFWD 1J0IA 3LKOA 4PRPB 2H2PD 5L8LB 25C8L 1G7HA 3FQRA 3DHMA 3GEWB 3VCLA 4L9DA 5GS0L 4Y1AE 4PJ5A 2EYRB 3SDAA 1PKOA 2UWEE 5JHLL 4IMKC 5LKNA 3V0WH 2Z92A 4CBPA 3ZDYF 1N5YL 1YEGL 4U1JA 1A6TA 2RB8A 1JNHA 2RCSH 3IAPA 1ZSDA 1MRDH 1OTUD 4GT7A 4O51B 1F45A 1ITCA 2ZP0T 1U95A 3QDJD 3QCVH 3OX8B 3O2DA 4JLRB 4QXTB 4CDGC 3FRUA 1R3HA 5T1KB 1NMCC 4ELMA 1CBVH 4L3ED 3K80A 2VO5A 1DQJA 3WUWG 3HI6L 1S7VA 1ZHKB 1UXWA 4KUCF 2BSRA 2GY5A 3GKZA 4IMLB 4Y1AA 3ETBF 1UM6H 3RDTC 5F88B 1W72L 4NM8L 2UWEA 4F3FB 1Z5LB 4RRPA 3MJ9L 3OKOB 5DK0A 1NUFA 4OCSH 2QKIA 5FHAH 4JHWH 1J1XL 2PW2A 2DTSA 4P99A 1ADQA 1NBYA 5FYLL 5DD5L 2BZDA 2XQBH 2DM4A 1DVFD 1AI1H 1UJ3A 1KJMB 2ZNWA 1MFAL 4FRWA 4L9LB 1HIML 1P5UA 2AQ2A 1TJGH 4UMGA 5BW7A 2PXYC 5EN2A 1HOCA 5LGJA 2PO6C 5KVFH 2ICWJ 2VQUA 1R5IB 1C16B 1CDGA 1AJ7L 5L7XH 4IOIA 1T2XA 2HTKD 3Q5YA 3QEUB 3MFFA 2C1OB 1AR2A 3BE1L 1Q0YH 1RUAH 1WAAE 4MD0B 1P1ZA 1RY7B 5D1XB 3HUJE 1JWUA 1Z3GH 3O9WC 1NUGA 2QV2A 1UG9A 5GGVH 4F2MB 4K3JH 3TFKC 2A1WL 3BGMA 5HDBE 5ECJE 2AJSL 4YPGA 3PGDB 3CVHA 4JREC 3KPRD 1FL5A 4YHOH 4KK6C 2BY0A 2WSKA 5DA0B 3QUXD 1XH3B 3QUYB 5HTSA 43CAB 2Q6WB 4ZG1A 1T20A 1A4KB 7FABL 3L9RB 3EYQD 2ATKA 3DV6A 1RSFA 3JV4A 1T21B 1HKFA 4P5KB 1WAAA 3HMWH 2VXTL 1G9EA 1F4WH 2VZTA 4Y16B 5GISL 3HUJA 4PJDE 2AERT 3MRLB 2X4TB 1NC4A 1XGQA 3MYZA 3H0TB 4OB5L 3K81A 3IJSA 3KR3L 3VXMD 4G8GE 4HS3A 1CGUA 4X5XA 3CH1A 2VABA 1EA9C 3KPNB 3RPIA 4FZEL 3O2WL 2YN3A 3CGTA 4JRXE 1VSCA 3FT3A 4NM8H 3L3OB 5FA3B 2ITDA 2CLRA 3QEQB 4PR5A 2DWDB 1MJUL 2CMRH 3GKWL 2H8PB 3MBEB 1EJ6A 4ZOBA 2WBJB 3D85D 1KB9J 4LLYB 5DRWB 2B1AL 2FHBA 1MOEA 3IFNL 2HFGH 3VRIA 5FA4B 4Z7UB 3IXAA 3BZFB 4OFVA 1CD9B 4G6FD 4Y4FC 1QLRA 1TFHA 3VD4A 5JZ7C 4NQDD 4X0KB 4CVUA 1H3UA 1WWAX 2DI8A 4Y5XB 3I2CL 3AB0C 4PJDA 1M6OB 1AJ7H 4B53A 4Y5VC 4ETQA 4U1HB 5IJVA 4QRSB 4G8GA 1ZT1B 3L3KB 4A2MA 5C0RL 3EKCA 1HSBA 1T5XA 4JRXA 2NR6C 3LY6A 1RMFH 4PFEA 2LAAA 3U1SL 3VW3H 2ZWLT 2R0ZL 4XCYA 4OTXL 1A7OH 1DN0B 1NC2B 1JK8A 4YHPA 2VDOH 2YK1L 3BEWB 1U93B 2W0FA 4GO6B 2GI7A 4PLJD 3VXQB 2R1WA 4LVNB 4Z7WE 5C09D 4N9GB 5DRNA 5DUBB 3PHOA 1WLHA 3V79C 5SX4H 2V2TA 4XC1L 4EVNA 5DHVA 1MWAH 3HFMH 4GG8A 3QUMH 2AXFB 3GIZL 3GRWH 4NZJA 3P0GB 3TH3T 2IBZX 1YMHA 2GFBA 5TE6L 1L0XA 1UYWL 2FNBA 5HVGB 4DCQB 3WFBL 1IAIH 3TBVB 5J7CC 3QNZB 2R0LH 3GSNL 4M9OA 1CXEA 3RWFB 3O2WH 3IJHA 1AD0B 4OZIB 5GS1C 4FN0A 4DZBA 2XN9D 4R2GC 4MDJB 4U49A 1YDPA 5I74B 3QG6B 4Z7WA 5JW3H 3KYOA 5MENE 3MACL 2G9HA 4PRAA 1MHEB 1CFTB 4K94H 4UT7L 4NWTH 1BREA 2AVGA 5MEOA 3PQYD 2BCKA 3HPLA 4EOWH 1GXEA 2AJ3A 4LLQB 3MRDB 1WGOA 1NBVH 2P7TB 2G5RA 4WCYH 3KXFD 1QFWH 3MV01 4J3UA 1U8QB 1WC7A 4AYFA 4JE4B 1LO0L 5ETUB 2BY2A 5T3ZE 4HC1A 5GQBA 5IBLC 3ARFB 4J1UB 4FQHB 3OF6A 4MMXC 3U1SH 4PGEB 1QO3B 2IQ9L 5CEZH 2CLZB 5DD6B 1UWEL 3BWUC 3D39D 5I1KL 2WP3O 5MENA 4EI5D 4N0YH 2GCYA 4LHUG 1JHKH 4HKBB 1BGXL 1XF5B 5DUML 4FQXB 1I3RA 4ZUWA 1RHFA 3NTCH 4G8EA 1E6JH 5T3XD 4PJIB 4F7MA 3PNWA 4KUZL 5T1MB 4DN4H 1OSPL 1MFDL 3PP3H 1NDGA 3T2PA 4GRWF 3T08A 4POYA 4YDJA 1WFUA 4M5ZH 4N90D 4MZ3A 4QTHA 5EOTB 2DD8L 4KVNH 1V7ML 5ITBH 2UY7A 1WBZB 4NHUA 1HH6A 1YEIL 1DN2A 3RHWK 4NKMA 3KHOA 3WFBH 4YHIB 4EKXA 1VGKB 3DUUA 1IE5A 3WDJA 1H15B 1RPQA 4G6MH 5I8KH 3VRJB 3MV7B 4CU7A 3BDXA 3JWDC 1MPAH 2P8MA 4WFEE 2IFFL 4RMWA 4LPWA 4JKPL 4FQ1H 2V17L 4X7CC 5DJ0B 1I9RH 4WW2C 5CGTA 4PUBL 1FNGB 1NAMA 2K1MA 1IQWH 5L0QC 4PLOB 1G0YR 5I71B 5EZJA 1TQCC 2NLJB 4I5BA 3O2VL 4TTDD 3QNXB 3Q1SL 3V6ZB 3QWRD 4JRYB 1F97A 4OCRH 3RHWF 3RIAK 1RZIA 1Z9SA 1P4LA 3BISA 2F8VA 1FYTD 1K4CB 1WCBA 4MLSA 5E6IB 4F57H 3C5SA 3QG7L 1GGBH 4EI6B 2Y5EA 1N2RA 4LEXH 3SO3C 4XNQA 4U6VH 5D2LF 1BJMA 5E56A 4J3VA 5IESL 1D5XB 3T1FA 4KC3B 3W2DH 4K3DL 1ZT7A 4U0RC 3BKCL 1T66C 4LRNH 2ICCA 4YIQA 1FFNA 3HPJA 4X4ME 1KIRA 1A6WL 4PLNC 3TCLA 5KVEL 1I85C 3RWGA 1AD9A 1YY9C 4RBPK 3SKNA 2Z8SA 3R8BB 5FYJE 1I8MB 1WBXA 1G9ML 4P4RB 3GMNB 4NKIL 4I0PA 3RIAF 1KB5H 4PYGA 5GGUA 4G8FB 3BP4B 2EH8L 2F53D 1C1EL 3T65B 3WXVH 4I3RL 1D7FA 5EBLB 3PJSB 4P2RE 1G6RB 2FJHA 5TF1H 1JF1B 4WI4A 3JTSB 1DEEA 3EHBC 1F90L 4JFZH 4NBXB 2Q86A 4OUUA 3ULVL 1A8JH 1HZHH 3FOMA 1AXSA 2ZUSA 2X2YA 3FL7A 3MLWH 4JFPB 4ZPVA 1CD8A 4X4MA 4X7FC 3VXRD 4L5FH 1FP5A 1KCVL 3GZKA 5AAWA 3PIQA 3OR7B 2C4FU 1OGAD 3D9AL 3HMXH 3SDXE 2PYEE 4NRZB 1SYSA 1EV2E 3MNWA 4Y5YB 3C8DA 1OAZL 1MLCA 3L1OH 4ZFFA 1FRGH 3Q1SH 3O45B 3RTQD 5ADOH 1JWSB 2OTUB 4PD4K 1QR1A 2J8UF 4N8VA 4FXKA 1JHTB 3LEVL 1CDCA 2N4IA 4K23L 3WD5L 1FNLA 2QHRL 3UO1H 3QG7H 4JPWL 4TVPE 1R3KA 4X4YA 1JJUA 5DTFA 1BX2A 3FT4B 3O6ML 4DUWA 5DA4A 3K1DA 1PBYA 3UJTL 4U05A 5GJTH 5FUZL 4XP1L 2VWEE 1RD6A 2ITCB 1FHGA 1AGEA 4LCIH 3MA7A 3GO1H 4MA7L 1EZVY 2VDLL 5DJAA 3SDXA 1B4JH 2PYEA 3ZHDA 2I9LA 4C55A 4NO2B 3CX2A 3V6FA 4XNXH 4LSTH 3O6KH 4W4OC 3G9VA 4DFIA 4R6UA 5B4MC 2V2XA 4DN3H 4I4WA 2ZJSL 5GGSA 4KK9D 1EHLL 3HZVA 3CXDL 3CZFB 2WMPA 4AEIH 4S1DD 1XEDA 1A7NL 4PY8I 5D72L 4PJ5D 1PFCA 3SDAD 5C0GA 1QHPA 3QO0A 3BZDA 4AIOA 1R5VA 4KRLB 1FGNL 2X70B 4YDVA 2EDLA 2C3WA 2PTVA 1ORQA 4EDXB 5A2IH 1CE6A 4QRQB 5DHXB 2PTTB 3VGFA 1KN2L 1RJZB 2HH0L 3L5JA 3T0EE 4XNMA 4CVWA 5F1IB 5I75C 2XOTA 1XAUA 1MH5B 2XZAH 1EH9A 2B0SL 4DWHA 2JK5B 1W72B 3U0WH 2D3VA 3D9AH 1QYGL 3LDBB 3DROB 5DVNA 4HS6A 1IAOA 3QIWC 3VRLF 3OXRB 5E2TL 3C9NB 4LSDA 4O5LH 4YBLB 3WIIL 4ETYA 1ZHBA 2ZZUT 3HZKA 4HT1L 1X5HA 4O4YH 1AHWA 3OKMB 4ZTPL 3ZLQC 4LCWB 4GRLD 5HD8D 2X10A 3GBNH 2D03H 4GMTL 4HGKC 4YDKL 1HI6B 1A7BA 1LMKA 2Q7YB 3GSUB 2IPKB 4M9PA 5EOCJ 5JDJA 5F1SA 3DTXB 1MCCA 5IM7A 4XNZB 4XHQA 5JHDE 3UJTH 4D8PA 3SCMB 2OI9C 3CK0L 4AL8L 1Q94B 3T0EA 3OGOE 2PN5A 2V5TA 5JR1H 2KPNA 2ZSWB 2GY7B 4C4KT 4GKNB 3QIUB 3DARA 4QOKE 4L8BB 1SJXA 2WWMC 4JDZA 1L6ZA 1EO7A 3P9LB 1GHFL 3VMNA 4WTXA 2R2HA 2NY3B 1G7IA 5HYEA 4OF0A 3VA6A 3UTZB 3H6JA 5JXEA 4DQOL 4M93C 3DV4A 2ICWA 4NKOA 1M71B 1X5XA 5I9QB 5HDQH 3RI5K 5FK9A 3O3EA 4Q6IB 3TYFB 4WUUE 4ACPA 5JHDA 4P3DA 4XI5C 1CFQA 5EIIB 2X4UA 5ADPH 4I8DA 1G7QA 5CILH 3QI9A 2C1PA 4HWBA 4BUHA 4LLAA 4M1GL 4QOKA 1CLCA 2D7NA 1UKQA 5DSCB 3STLA 4U1GC 3SDYL 4RIRA 4R97B 3CPLB 2NW3A 3IGAB 4S2SB 2GJ6E 5DYOA 4IJ3B 1QYGH 4CMHB 5I76A 3KYKL 3T77A 1NC4D 4PRNA 5HPMB 4QRRE 4JZJA 5E2TH 4OLUL 3G5XB 3TESA 2COQA 1RZGB 3IFOA 3LKPB 4WUUA 4ZTPH 2OTPA 2R1YB 3OZ9L 4BSWA 4JKMA 1W0VB 3RI5F 3WN5B 4FOMA 3LS5H 1JVKA 1M7IB 2IH1A 3SDCC 3RZCC 5CIPA 1NGWA 4ISVB 1MCLA 4PJEE 5DWUH 4C54A 2X4PA 1A21A 2FEDC 2OSLA 4R8WL 1SEQH 1OGTA 1A14L 1D6VL 3UTTE 1SY6A 3ELAT 4P2YA 4OSUL 5C6WH 3DX9A 2EDBA 2NY0C 1G84A 2GJ6A 1FLRL 2GK0B 1TJHH 2AKRB 4QRRA 3IDNB 4XNYL 1Q9OA 2A83B 4G8GD 4RNRA 1CGSH 2JJTA 4N5UA 3ARGD 2OL3L 3MPCA 4JRXD 2WZPD 3V5HB 4E5XA 1OQOA 2R29L 2GEEA 4J3WA 3RWJB 4HCRL 2FECI 3GJFK 3FQTB 3ARDA 4X80L 3QWQB 4HV8B 2WM0A 1LEIB 1F3JB 4ZFOA 2F5BL 4PJEA 1JHLL 4E0RA 2YD3A 3UTTA 3MRHB 1CFVL 2IALB 4PLKD 2ORBH 4M1GH 4XMKL 5TE7L 4TUKL 3QDGB 5IROA 1SJHB 2GW5A 3C6LB 1DUYB 3SDYH 2DQUL 3AFLA 4P57A 5EU3A 5C0CD 4UZGA 1YYMH 4ODWB 2AEWA 1GZQB 4ODSH 2ESVE 2CUIA 2D9QB 4BQBA 4GRMB 5J6GA 3V4VL 4WEUD 4YWGH 2YA1A 1BIHA 1OQXA 3DYMA 1ZVYA 2VZ1A 3LB6D 4JGUA 4U2YA 3FB6B 1JNNL 1V3LA 3EJZC 5E2UL 1RZJC 5IMMB 3GSRB 3VD7A 4LAQH 4JFFE 3WLWD 2RJMA 4LP5A 5D71L 3MA9L 4PJAB 1JV5A 2HWZL 3JTTA 3O3DB 3C5ZC 4OKVA 5D2NB 3DXAE 1ACYH 5HYSB 2ESVA 2BHUA 43C9B 4UB0H 5E94A 4PG9A 5KN5B 5F6HI 4CVZB 2UZXB 4XNYH 5JDSB 4NC1C 3JUZA 4JO2L 3DGGB 5HGAA 4RFNC 5HJ3A 2OL3H 5E00A 1XIWA 1EK3A 4K8RC 4WFFE 4YHKH 1PJ9A 1U8OA 3STZB 5K9JH 4PJBE 2HJFA 3VXOA 4JFFA 5BMFL 2CD0A 5MEND 1RFDL 2HVKA 3QFJB 5KSAC 5MP6L 3IDYB 4DK6A 1WWCA 1NL0L 3RJDA 1XF4B 3CC5A 2E7CA 3GSOA 1CFVH 3DXAA 4OI9A 1RV6X 3MRGA 4HXAH 5J13B 5DC4B 4HIEA 3GSWB 1NLDH 3RVWC 4L8DA 1T22B 2DQUH 4HUXB 3TPKA 3WDIA 5T3ZD 1FL6A 3MOQA 3RZWA 1Z2KA 5JIKA 1LO3L 2NNAB 5IB4A 2YD4A 1NH6A 4PJBA 1WFNA 4WO4A 3U36B 1RJYA 1G7JA 4YHZL 3CFKB 2VXUL 2VDPL 1JNNH 4R4FL 4UILL 1UCBL 1T03H 1XR8B 4HX1B 3MV9D 1KTLA 2XYCA 3OAUL 1RULL 3MLUL 4KQ4H 3TA3B 2YD8A 3BI9X 5E08L 1EXUB 3S6CA 5ISZB 2P8PB 5JMOC 3HR6A 1A3RL 3UC0L 3LQZB 4X8XA 2F19H 4ZDHA 2UYLA 3VGDA 3DHJA 2OZ4H 4XBGB 4BQ6A 2FRGP 4PJHF 2OR7A 4L3CB 1U8JB 2DTML 4K9EH 4JJ5B 4I3SL 1FGVH 1XCTB 1T7ZA 4NQSA 3WSQL 1WBYB 4PB0H 4P4KB 1J5OH 3SJVB 4HXBL 4YK4C 1MY5A 1ND0B 2H6PB 3NPZB 4CKVX 3I6GA 3L6FA 3OJMB 4WFED 2DMCA 2HRPH 1TVBB 3U79A 3CSBA 2A6KB 5KOMC 3F7VA 4HIIB 2R0WH 3VFWA 1S7UB 5C92A 2XWTB 1FNEA 1NL0H 2JJSA 1H0DB 4BQ8A 2ZOLB 5HI4D 1TTFA 1A6PA 4IHOA 5DJZB 3KPOA 2SEBB 4O00A 1IRAY 3S36X 1BHGA 5GJSL 1B9ZA 3FKUS 3QJHB 5A16A 4X5WA 3GI8L 2BVPB 3C60B 3LEXA 5J3HC 1XR9B 3VFOB 2DKUA 3QEGL 1MAKA 2QSTA 5BV7H 3Q6FA 2IAMD 2GIYA 3LKQB 4PY8J 2CSPA 1NJ9A 3RWCA 3VGHA 5FO9B 4Z7QE 1AHWC 1Z9OA 1BIIA 3N9GH 2QQNH 4RCAA 2DQJH 1A5FL 2UWEF 4J8RA 1RULH 2GITB 4RGNE 5DRZB 3DBXB 3MLUH 2DDQL 3MRKA 3R06A 4R4BA 1QACA 3MYJB 3UC0H 3PWJB 3AREA 3PXJA 5IW1A 3HE7A 3T0EC 4CVXA 1GGUA 1X4YA 1V05A 1KYOJ 1QLFA 3TT3H 4GXVL 2G75A 3NN8B 3ULUE 4HULB 3FTGA 3EYOB 3EYVA 1ZVSA 1AGCA 2XKNA 2ZSVB 4KRPB 4L8SB 4JM4L 1CLOL 4YBQD 5C2BH 1K8IB 3KS0J 1UB6B 2Z93A 3FAWA 4PJ9A 1QG3A 2DI7A 3GNML 3E8UL 5FKPB 4OF8A 4C56E 5M95B 2H2PC 4G7VL 2I5YH 2XA8L 2FJFA 4RA0C 4H20L 2Q8BH 2LV4A 4I0KA 1M7DB 4FQPA 3CFDA 4N9OB 1B4RA 4C59B 4RQQB 3SKOA 3JV0A 5CBEB 2P46B 5EUOE 5D7LB 3LKNB 5IMKB 5F21B 2PYED 2NW2A 5E99L 1FZMA 4K71C 2VL5B 3BZEA 12E8L 1A3LH 1TZGL 3GHBL 5EORH 3JWDL 1HE7A 3MRPA 3IF1B 1BVLB 4L8CB 1UWXK 5CJQL 5MEPB 4Z7OE 3AXLB 4K3HA 1X44A 4C56A 4IS6A 2BNRE 3HMXA 2XZZA 1EGJL 4Z7VE 2NY2D 2IPUK 3MODL 4L1HA 5HDBF 5HHNB 5TH2A 1X5LA 1H5BA 4ODXB 1Q0XH 3QRGL 1FN4B 3AS3A 4AH2B 9CGTA 5M94B 4OCXH 5DGQA 3STBA 2R23A 2VSCA 3IU3A 2NXZD 5EUOA 2G60H 4P5TA 1FVDA 1U8PA 1S7QA 1AO7E 4Q74A 4PBWD 5I8EA 4WHYG 1FE8L 1LO2H 4OLZL 5HHMB 4NQEB 1KCRL 2QADD 4V2BA 2D0GA 5BRZB 3H9YA 1ZEAL 4PJDF 5D96C 2CXKA 5ELIA 2BNRA 1J7VR 4L4TA 2DB8A 5T5NF 4AK1A 3FO0L 2Z8WC 1UZ6E 2G5BB 4Z7VA 5JLZA 4FQ2H 1OWWA 3KJ4C 1DBKH 3VG9C 5TQ0L 3U4EA 2VIRB 4XVTH 1C5BL 5DUPL 1HSAA 1U3YA 3ILPA 3NIFF 4U31A 3SPVA 5D1ZA 2DRUA 4FXGB 5FGCB 3WFHA 1U8NB 1AO7A 4ZUTA 4P2OB 2YKLH 1UM5H 2EE6A 4NT6B 4WDIA 2HFEA 1JTPA 3MCKA 3S3PA 5CD5D 5HI5D 2R39A 4JZOA 5F89A 1Q9LB 4CN1A 35C8L 5EU6E 1GPOL 1FG2B 3GM8A 12E8H 1TZGH 4M6NL 2YPLE 2R4SH 3DX8A 1N4XL 1A1NA 4JN2A 2BSSB 3QUZD 5JXED 2YD6A 4OFKA 3B9VA 1DBAH 6FABH 3OB8A 4NDMA 2ZUXA 2EIDA 3LPFA 1P4IH 3R0MA 4M7KL 4UDUA 1V7NL 2UY6A 4HUVB 3L5XL 3KPMB 4HWZA 3Q48A 4MB3A 3QI9D 1Z9LA 1IKFL 5KJRH 1U8IA 1HQ4B 4QOKD 3H9SE 1ZK9A 5DQJB 1N6QH 5L2JB 5E2WL 5EU6A 1D5BA 4XBPB 2F54D 4Z7WF 5EO0B 3LKRB 3RNQB 1BD2E 2AXJA 3MRMB 1T0NA 2YPLA 5ICYA 1I4FA 4U7SA 2D7TH 1D5IL 4ZOCA 3LHPH 5GGSY 1OPGH 5FUOH 1KCUL 4AY0A 4X6CB 2E7LA 1K3ZA 2J3SA 1PW3A 2DYPA 1FNHA 3HB3C 4X4XB 4WUUD 1XCQB 3DSNA 3D2UD 2FEEI 1XIWC 3TP4A 3QH3A 3EYSL 4NC2B 3E3QE 5DLMH 3W9EA 5HGDA 4RISL 3H9SA 4TNWK 3HAEA 4A6YH 1BFOA 1WQVT 3B9KD 1SJEB 4LP4A 1BD2A 4O2CB 5DEFB 2AJZB 3OHXA 3D18B 3LH2H 4UI2A 3REVB 2OL3B 1KFAH 2B1HL 2I25N 1I7UA 1ZA3A 3X14B 3ZDXE 4ZTOH 1DQQB 2GJ6D 5IJKC 1QSVA 1U41A 3I9GL 2FX7L 4AM0A 3T4YB 3O81A 1VFBA 4XPBH 1KIQB 4NJAL 5E6ZA 2JJUA 4XAKD 1S3KH 3U9PH 2LAGB 3SDDC 3C2AL 2BMKA 2I27N 1MCOH 4H0HB 5DQ9A 5C08B 5IUSA 4KU1A 3ARDD 2X4RA 3CZJA 3OPZL 4NHCL 5IVXE 3QIBA 1V7NH 5EBMA 1FFPA 2OM5A 4TNWF 4NO0A 3UTTD 3LZFL 3O4LA 2K3TA 1P69B 1RI8A 1S9KC 1CFBA 4P46C 5IFHH 1FIGL 5KTEL 5JQHC 2VLLA 3RGVB 4XCFL 4HWEH 5C6TH 4Q6YA 3MUGB 4RAUA 2O26U 3HR5A 2I60L 3QISA 2NY4C 3BKJH 4MD4B 1UM4H 1MFCH 3KVQA 1YNKH 3WFCH 2JCCB 4JO4L 2CK0L 3VXSB 5HYSG 2Q7NA 2YUZA 4F9LC 5IVXA 4DZ8B 1RUML 1KIPA 4D9RD 1IGYB 1Q1JL 2E27H 4N0FA 3P73B 4OZHB 4S1SL 2AABL 4Z8FH 1EAPB 3EYSH 2XTJD 4DTGL 4XP9L 2VDNL 4RISH 2APXA 3WNLA 5B8CB 4G80B 1HHHA 1BAFL 4EI5C 4V1DB 4XCNA 2BOBB 2YBRA 4TN9A 1II4E 5IB2A 4ALAL 3S34L 3VWKC 1MFNA 2ESVD 4YFLI 4ZS6D 3NFSH 5MERB 4PJXF 3P4LA 3T3PE 4JO3H 4C4KO 4OQ1A 4OD3H 3S9DB 4JQVA 2EYRA 1DL7H 1MFEH 5C71A 2YRLA 4OI8A 4YXLL 4JFFD 2YZ8A 5HVFB 1P2CB 4I2XE 4D0BB 3JWOH 4DKFL 1R0AL 4JDVB 1S5IL 3OX8A 4XNUH 1MJJB 4JLRA 1X5KA 3IDUA 2H41A 5F1KC 2UUDK 3DXAD 4ODBD 5A3IC 1OT2A 1NGYA 4XPGH 2QL1A 4KGLA 4XZUB 3VFSB 2FSEB 5DDHA 4YHYB 3Q6GH 2GYSA 4AMKH 2P5WD 1F8TL 1C7SA 1F6AB 1RJCA 4MQXC 5FOJA 4IMLA 1F3DH 4WNQA 1DFBL 1G9NC 3VE0B 3DYPA 2VC2H 2HLAB 5FYKL 1FLTX 4WO4D 1ACZA 1X7QA 3ALPA 4TTDC 1ZOXA 5D7KD 4I2XA 1AKJB 1RUMH 4AZ8A 4L9LA 5IMOB 3OGCB 4UT6H 2WWKO 1UGNA 4OJFL 4YNYB 5JNYB 1MIMH 1VESA 3NZ8A 3ARVA 1R5IA 4RGNC 1NGXB 1QSEB 1C16A 1CN4A 5CEZD 3UJJH 1ONQA 1OP3K 5KSBB 4Y4KB 1CGTA 1CK0H 3A6BL 4I0CC 3WE6B 3FO2B 2QQKL 5D1XA 3KYMB 3PHQA 5F7DA 3RQ3A 2NZIA 4TUJB 1NCDL 4LIQH 1T83A 4U33A 3S5LG 4AENA 1OAYL 3SDXF 4XP5L 4NN6C 4LLMB 4BFBD 2FWOB 2ADIA 2VZUA 2X1QA 1W8OA 4Y8DC 4JKLA 2XQYG 3N85L 4OFIA 4HLZH 3QEQE 4HIHA 5C8JB 2APFA 4MX7B 3QUYA 5I66B 2DQFB 43CAA 2WV3A 2ADGB 4HWUA 1A4KA 3KPPB 3L9RA 5LWYL 4U1KA 4Z7UE 5GS1B 3RKDD 1T21A 1EHXA 2XKSA 5IR1B 2EH7L 3B3IB 1GZPA 1DANU 2OMBA 4Y16A 3ZDZE 4P5TC 3BDYL 3H2WA 3MRLA 3TH4T 3MLSH 5TDNA 5HYIA 1I1RA 2X4TA 5HHVH 5D6CA 3H0TA 3NCJL 1RZJL 3DRTB 4YFEA 2OXGA 3UMTA 4P59H 2X4OA 1LHZA 1PG7L 2NZ9D 3HE6B 2Y25A 3L3OA 3QEQA 1M05B 4RDQG 2DWDA 3MJGX 5I18H 3W11D 2H8PA 5KVGH 3MBEA 1CGXA 2WBJA 4LLYA 4H1LH 5HDLA 5DRWA 5F7EH 4DVBA 1JUFA 4Z7UA 3VJ6A 4NZTH 4MS8C 1SQ2N 2VR4A 4PGBB 2WQ8A 1ZLVH 1MFBH 3FQNB 1T2JA 3HRPA 3TO4B 3GMQA 5I8OL 4KDTA 3QQ9C 1M6OA 3ARED 1YEDB 4B50A 4ELKB 1I7RA 3TJHC 3P4NB 3AS0A 4PYHA 5E9DB 4U1HA 3A6BH 4QRSA 3A67H 1BF2A 4LFHG 3L3KA 3VGAC 5IP4A 4JFYA 3QB7C 2DQGL 3CFIC 2AJXL 4XMLL 3I85A 1NC2A 3DECA 1YJDC 3KGRA 3S4SB 2EYSB 1UACH 4G9DB 3BEWA 4OZIE 3WNOA 1TJIH 1U93A 1GOFA 3VXQA 4KK9C 4NJ9L 2I9TA 3LIZH 5DUBA 4IOFC 4LF3B 3HHRB 5LWYH 3MMEB 4HPOH 2H32B 5IB3B 4Z7NE 3NH7L 3DNKA 1AY1L 3AVEA 3G6JF 4XP6L 2AXFA 1KCKA 2B5IC 3BDYH 3ULUD 4UTBH 3A6OA 1PX4A 3EW3B 4DCQA 1KPUB 4XVSL 3CVIH 1AD0A 1AGDB 3ABZA 4OZIA 4C56D 1TQCB 5K33A 1KB9K 3K1KC 5TDPB 5IB5B 3BX7C 4P23D 4P48A 2DIBA 1NCAL 2DQTL 5F6IC 1D9KD 3IJYB 4XTRD 4MGXA 1UWGH 1SHMA 5E1AB 1BJ1H 4ERSH 4PBXA 1EAJA 4OGXH 3HZYB 1G0DA 1JGLL 3IDXH 4GW1B 4PGCB 4LLQA 1U8MA 3CLFL 3SO3B 4OCWH 4PJIE 1EVTC 3AS2A 4NQCE 2Z31C 3P0YL 2PKDA 3PGFH 1Q9KB 3NACH 1A7RH 3RL2B 3SQOL 3BKYL 2GSIB 5LGHH 2AI0H 4J1UA 4YBHA 4FQHA 4KJQC 2VYRE 1QO3A 4K07A 2CLZA 1QPXA 5DD6A 4L4TD 3FOLB 2GJZB 3OV6A 1U91A 4Q9QL 1FO0A 5K9OA 1BZ9B 3WEXB 1DBBL 2ZCKL 4ZFZB 3EOBB 3MV7E 4HKBA 4JB9L 4PJGB 4Y89A 1XF5A 4X6BB 5BJTA 4F7PB 1T89C 1JMXA 1JZ2A 3TZVB 5D1ZD 4PJIA 4NQCA 3CFCL 1E4XH 1U8HA 3MLVL 2PNDA 4YE4H 5T1MA 5E0QA 1S8DA 4PJEF 5EOTA 1KC5H 3P3YA 4LBEB 2P5EB 1CF8L 1QEWB 4YHNA 3JVGA 4JRYE 4Y2DC 1VGKA 2P8LA 4Y4HC 2PYFB 1H15A 3QBTB 3VRJA 1TQBC 3MV7A 3RAJL 2B39A 3MTRA 3PE9A 4HJGB 4QHLB 1NGPL 1F58L 4X99A 5C0FB 4ZFGH 1H3PH 2DQTH 3QPXH 2WAHA 2R1XA 2W9EH 3BSZH 3GSXB 4ZUSA 5DJ0A 2VLME 1HHGB 1LO4L 4UT9H 2GUOB 3LQMA 3ROOA 3NABL 5EU7C 2YEZB 1KNOB 1FNGA 4OD2A 5IHUL 5EU5B 5CJOH 2RFXA 2NLJA 2HKFL 5CSZB 3ZKND 1I7ZA 2YPLD 4JRYA 2OP4H 4ZQKA 1Q72L 3FQWB 5HI3D 3G04B 5F70A 3U30C 1K4CA 3TO2B 3TPUB 3G5YA 4EI6A 1KLFA 4UIMB 3NFPA 1B2WL 2FD6L 1K5NB 3J8F7 4JQVC 3WJLA 1E0OB 1P9MA 1D5XA 1ERNA 5EWIL 4ZUVB 4GRWH 4HJ0D 4XT1C 5DMGC 4UDTB 1ZANL 2JF1A 4H8WH 1EJOL 3CFCH 5EDXA 4DW2H 2VZSA 1BD2D 4WI2A 5JMRA 2VAAA 2RHEA 2J88H 3IRZA 3F7QA 1UEYA 3RP1A 2X6MA 2NY5C 1CICB 5HGHB 1I8MA 4Y19B 3O3AB 5MI0B 4P4RA 5ID1B 5I75B 4PB9H 5GRWA 3GMNA 5ICXB 4YUEL 4MHHI 2FLBT 1MRFH 4YDIH 4EEEA 4JFOB 4G8FA 2FCBA 5FDWB 3BP4A 1KJ2A 1B3JA 3T65A 8FABB 5GZNC 2MQCA 1EO5A 5EBLA 3PJSA 1G6RA 5F3BB 2VLKB 4M4RA 5DJYA 5FHBL 3RA7H 3F65A 3UP1A 4WJ5B 5C6PB 4WU5B 4JFPA 1T7XA 4UU9B 1K6QL 4NO0D 4JO1L 3F12B 4L9LC 3O4LD 3GBMH 3MBXH 2YMXL 4L4VB 4R3SB 4V2CB 2A9NL 4X6DB 2Y5TA 3TC9A 4MCYB 2DJUA 1VENA 5DJ8A 3U82B 4Y5YA 5IWLA 1A6VH 2NY1D 3FN3A 1U6AL 2MCG1 3FB8B 3BZ4A 3RX7A 3T8XB 3T0XA 3O45A 4S1QL 1KENL 3LMJL 1JWSA 5LBSL 5K59E 2OTUA 3OKEA 3ZMRA 1WTLA 1WF5A 1X5IA 2ARJQ 1JHTA 4LSUH 2D7OA 4AG4L 3MSPA 1YNLH 5ACMA 3EDEA 3H42L 3FT4A 1GGIH 4OF3A 1B2WH 4NWUL 5IEKB 1DE4B 2YC1B 5CHNA 4S1RL 2DLEA 4U0QB 3VFPA 1LE9B 3OJDB 3DETC 4D0CA 1JGEB 5EA0H 4M93B 1UENA 3S35L 4FQLL 4LCUB 4ONGH 4KROD 4M61A 3UYRH 4JY5L 2A6IB 4G43B 3RFZC 3MREB 3HS0B 1BQLL 5E8DL 2OBGA 4R26H 2R4RH 4DKAA 4WI5A 4Y16C 4U1GB 1RJLB 4YUEH 5FYLE 3UTSE 1PVHA 5E4IA 1J12A 4LCWE 1A7QL 2FB4H 4J3TA 3X13A 1NLBH 1AR1D 2DQCL 3RWHA 2HN7B 4LRIA 3MRNB 4PGDA 3LPGA 2X70A 4TPRL 3W39A 4EDXA 2B2XL 1SMAA 2WBJC 2PTTA 5IVNA 4WGVB 1RJZA 1C5DA 3QP3A 1GC1H 2HP4A 3OMZA 3GMLB 5F1IA 4U6XB 1GGCL 1MH5A 1KN4L 2Q76B 1AGBB 3RZCB 4APQB 1W72A 4R0LC 3AGVA 4Y5XC 1FAIL 1OCWH 3MJ9A 1RURL 3OXRA 5JO5A 3VFGL 3U6RB 5AZEH 3UTSA 4S1QH 4G3YL 3VFMA 1YPZB 1KENH 3LMJH 3OKMA 4FABH 4LCWA 3QHFL 2QQLL 4MCZB 4HWNA 1HI6A 4AG4H 2X5PA 3P30L 5EZLB 4YH6A 1LVEA 3BVNA 3DTXA 1JZ4A 3SCMA 3DX7A 4FMFA 4Z7QF 1CFSB 3BJLA 1J1OH 3HKFA 4UNTA 3BWAA 3GSVA 2VDML 1X5JA 4NGHL 5E5RB 2ZSWA 2F5AH 4MVBD 3TIEB 2R2BB 1HHJB 4L8BA 2OXHA 1PY9A 3BP5A 3FFCD 2XRAL 5C0BB 4WWKB 1K4DB 5D1XD 4WV1A 4LPCA 2W0PA 4H5SA 5HI4C 1O7VA 4U1NB 3K8LA 3VD5A 3KJ6L 3UTZA 1FAKT 3UJIL 3BMWA 3C6SB 3HI5L 5GIRA 2BDNL 3ARBB 3ZE0E 3ULUF 1SYVB 4PTUB 2CUHA 4QXUL 1A0QH 2WIIB 1KJVB 4Q6IA 3VWJA 3S96B 4KMLB 4KAQL 4NQTA 2DBLH 4Z0XB 3F5WA 5I74C 4UQ3B 4TPRH 2IAMC 3QUYD 1VHPA 3ECBA 2B2XH 4X6FB 1GL4B 1NANI 3MCLL 5DSCA 1S9WA 3VXUE 3FN0H 1DLFL 4ZS7L 1PX3A 2PR4H 4AQ1B 1GGCH 3TVMD 4YX2L 5ALBL 3CPLA 3IGAA 3D25B 4EIZC 3KPLA 3QDAA 5KSUB 5FYJU 2X1OA 3C09C 1JFQL 5HPMA 2J8HA 1MF2H 1RURH 5CWSA 5BVPH 3G5XA 4LASL 3BO8B 2X42A 1JGVL 2DLFL 4G3YH 1RZGA 3LKPA 2FIKB 1INEL 2R1YA 2OJZH 2QQLH 3ARFC 1W0VA 3WN5A 1DDHB 2EXWC 2LVEA 1M7IA 3GM0A 3OKLB 3MBED 4Z7OF 3SE3A 2XWBB 2Y7QB 5AG9A 1A22B 4ISVA 2BNQB 1A6UL 1J1PH 3VXUA 3FMGH 2HJKB 3B6SB 5T3XL 3L3HA 4W6YB 4O02H 4W81A 2AGJH 4FQXC 3S4SG 3WO4C 4P3WA 5KSAB 1A9EA 3QDGE 3UTQA 2AKRA 4J23A 4RAVB 5IFAH 1L7IH 2XRAH 3QXDA 3ZYOA 1E4KC 2AJYH 3V5HA 4J2XA 1NAKL 4EIGB 5BOPA 3RWJA 1BWWA 1FVCB 3UJIH 2W92A 4KHTL 4ZAKD 3MJ6A 2BRRL 1T1ZA 2NX5D 3GIVB 1T2QH 5HHOB 5AZ2H 1LEIA 2OR9L 5B3NA 3CMOL 4XAWH 5L9DL 4BZ1L 1FNFA 3MRHA 4MAUL 1VERA 2IALA 5BO1L 4IRZH 3W5NA 4P2QE 2WIMA 3E6FB 3QDGA 4PJAE 2EEDA 3RWDB 1SJHA 4YHLL 3C6LA 1DLFH 3EUUA 1G9NL 2C3VB 1LE5B 4M1CD 2CKBL 4HKXA 4LOUD 1CQKA 1F2QA 2A74A 3LN5B 4ODWA 4OAWB 4RDQF 5D2NE 5AWNH 3MRQB 2EYTB 2ZCLH 3GSNA 5ALBH 32C2B 1XGRA 2VDRL 5DD3H 2NXZC 2W9DH 1DTUA 4JFDD 1EUTA 1FH5L 5TPWL 5HVHB 1QNZL 4KI5D 1D6EB 1RUQL 3FB6A 4ZOAA 4NFDA 2VDQH 1PEWA 5I1JH 2YXFA 1I9EA 4UTAL 1GIGL 1SBSH 3GSRA 1AP2A 5E6IC 1AGFB 4GQPH 1EX0A 1DBMH 1PEZA 4FFYH 3EDFA 3QFJE 4YK4B 4P2QA 1IGFL 4PJAA 3BAEL 1RU9L 4LSPL 1HYSD 3O3DA 1P9MC 2XNAB 5IB1B 4TRPL 5D2NA 3ZTNH 3X11B 4ZUUB 2ADFL 4K7PL 43C9A 5KN5A 4KKCD 5IK3B 5AD0A 1QPPA 1WZLA 4CVZA 4O58H 1YY8B 5HYJE 4IOSD 5JDSA 2XZQL 3OKNB 3NAAH 4IRSB 4LQFL 2MHAB 3DGGA 2ZUWA 1KT2A 4ZSOB 1S78D 4OZFH 5HI5C 3TNNB 4NCC1 1YMME 3K0WA 1CI5A 1F4YL 1MCHA 4PS4L 1HQRB 1NBZB 3INUH 1TXKA 4WFHD 3OKKB 1ZLWH 5C2UB 4X7TA 1B6UA 4XH2B 5AYUL 5F1NB 5DC0A 4BSJA 4DUXA 5JQ6L 4GJTB 2GSGB 1ZGLM 5F7UA 3QFJA 4NQXB 3F7YB 2M1KA 1YECL 3ES6B 5L9DH 2C4XA 1XF4A 3C8KA 4NPYB 5KW9L 2ZKHH 5GZOC 4JQXA 5TGBA 1JYWA 4HEME 1E4JA 1FG9C 1FIEA 5ISZE 4DKEH 4NQCD 4JAMB 1C5CL 5B39G 3GSWA 4LVHC 5L6YL 3MOAL 5HYJA 1T22A 4Z78B 1BECA 5FO8B 1QA9A 2R69H 4LQ1A 1NGQH 2C3GA 3QCTH 5DGRA 1KV3A 1YMMA 2VDRH 1BLNB 1XF2B 1WWWX 2NNAA 5GGTL 4HHAA 2VUYA 1IKNA 4L29B 1T6VN 2EDEA 4QTIL 3IDGB 3CFKA 3DUHA 2DBJA 5CCKL 2CJUH 4TVSa 3SJVE 4LVEA 4IRJC 4RGOH 1SEBB 5CBAB 4HX1A 3SGKC 1GIGH 3ORJA 3T09A 1N5AB 3QHZL 4MAYD 3OAYK 1EXUA 2J6EH 5ISZA 2P8PA 3PGCA 4WWID 1WIPA 1MJ8L 5K9KB 5I1CH 5TE4L 5IVXF 1TITA 4XWGL 3D3VB 5GRJH 5F1OB 5ICZA 1S7WB 4MSWA 4HJJL 4L3CA 2B4CH 1U8JA 5D2LB 2MOVA 2N7AA 2IGFL 3BYTA 1FFOB 2ARWA 2HJLA 4KMTH 3MRFB 4WHCA 5DF0A 1N64L 1XCTA 4M1DH 1WBYA 4EZMA 4POZD 2IADB 1ND0A 2H6PA 4HUUB 1NCBH 4XP4H 4LHJB 5DEGA 4K71B 3C5JB 1QBLH 4KZDL 3ZL4H 1TTUA 3DJ9A 3V52L 4HH9B 2OYPA 1ZGLP 3QDJB 3ULVE 1TVBA 2VE6B 1CGYA 2A6KA 3VGBA 3LKSB 1INQB 1K2DB 3J7HA 3TN0A 1QFOA 2UZYB 1S7UA 4L3EB 2VLMD 2XWTA 1J05B 1H0DA 5DVOA 1EO8H 2CGRH 5KW9H 4N8CL 3AM8C 3VXTB 1FQ9C 4U1IA 5E2VL 1RIUH 2SEBA 2PETA 1TZIB 1IC5L 4PRHE 3S3SA 3QJHA 5L6YH 4OI7A 5H37H 2L4OA 4I18B 5D1QD 1EEYB 4CDHA 2BVPA 4DGVL 2A73A 4P3CL 1EZVX 1XR9A 4NYLB 3VFOA 4YXKL 5I19H 3LDBC 1R24B 2MWCA 5GRUH 2WK2A 3T2NH 1JMZA 1DVFB 2CRMA 3LKQA 3O6FD 3VGEA 1ES0B 4NQVB 2MTPA 5T5FH 1CWVA 1TLKA 4QTIH 4YBLC 3BPLC 5FO9A 4CW1B 4O9HL 3T3PF 3L95A 1LK2A 4LPXA 5DS8B 5JIPA 3QAZB 1CL7H 1ADQL 4WFGD 4UINH 1NDMB 5IG7B 1YQVH 5MHSE 3U46A 2GITA 2J8UB 3DBXA 1RZKL 3OL2A 3MYJA 1RUPL 4XNZC 3LV3B 2XXCB 3H3PL 3CLEH 4PRHA 3SCMC 2R0KH 3NIGF 4WY7H 4XWGH 2VZOA 4EBQH 4M5YL 1BQUA 1FBIL 4WENB 3BD4A 5D7LE 3D0LB 2HG5A 3QIUC 1CR9H 3EDKA 2VJXA 3NN8A 3SY0A 2CLVB 1WZMA 5I0DA 3IDJB 4HUWB 3KAAA 4J4PD 3EYOA 4HUKB 3KPRB 1MCWM 2NY3C 4ODTL 5GSRB 2ZSVA 5ESQB 3K3QA 5I1HH 2HT4D 4MXQC 1K8IA 2CDGB 5EZIH 3QUXB 4HGWB 5F7MC 3W9DB 5FKPA 5DURD 4PJ8C 2JIXD 5D6DC 2HMIC 3BQUC 5I9QC 4HLZG 2CRZA 1WVZA 4QXGH 1FZKA 1NEZG 2FDBP 1A6ZB 5CBEA 2FGWH 4JR9L 5D7LA 3O2DH 3LKNA 4H25B 5IMKA 4NZDA 3PWNB 1RZ7H 3ME0A 2MQ0A 4GAFB 3X12B 1LP9E 1QKZH 3SEPA 3ZE1E 4OCYL 4DGYH 1DBJL 3T0AA 1EVUA 3P77B 4PBVC 3LSOB 4EUPB 5GS0D 1INDH 5KAQF 4P9MH 1KUMA 1RZ8B 5F9DC 4NQEE 4L8CA 3D85B 3MO1A 3AXLA 1RUKH 4IJ3C 4CMHC 2MNUA 3NOIA 5GHWH 3OG4B 2XPGA 5BRZE 4OM0L 4PTTA 1HKLH 1NSNH 4G6FB 5DMKB 3MLPA 3CDGB 3QSKB 1CTOA 4NQDB 1XGYH 4O9HH 3WKMH 5K9QI 3KPQB 1ADQH 4ODXA 3WN5C 4TSAH 2AW2A 3L7FA 4H1LG 3PUCA 1P7QA 3I3DA 3ARRA 1RIHH 5D7JD 5J0BA 1AFVH 4S0TD 5FGCE 1VGEH 4KFZC 2VSDA 1LP9A 3GMPB 2EZ0D 3MR9B 2DQDL 4XB8A 3V5DB 1EIBA 3M8OH 4KKAD 1JRHH 1CE1L 1KYOK 1TNMA 1FPTH 3MGAA 5HDOA 2C5DC 3SGJC 1FBIH 5GGQH 4HIJA 3WKNA 4NQEA 3RL1B 1A6AB 2P45B 2X9YA 3BPCA 3N1FC 2CDEB 5FOBA 3V4PH 1I3GH 2A6JA 5JIIA 1HH9B 1AQDB 3ILQC 4GQ9H 3UTSD 3TJEH 4OF7A 5ALCH 3IFLL 2CK2A 5DXWA 5HYQB 1HILB 4MB5A 5C09B 3Q0HA 1I9IL 1KSRA 1BVZA 4JPVH 2VIRA 3SE4C 4N5ED 3CVHH 4HAFA 4K7FA 3WS3B 4EXPX 4OT1L 3VG0H 4QGTA 3MRJA 3SDDB 1AC6A 4FXGA 2CDFB 4P2OA 5E7FA 4AIZA 2BSED 1CLYL 5HGBA 1AXIB 1Q9LA 2D7QA 3EO9L 4XHJC 5ILTL 2ZUTA 3LN4A 4NM4H 1FORL 2VQ1B 3Q2CA 5F7LB 1FG2A 2X4SA 5FGSA 3C6LC 4E42B 1EDQA 2XN9B 3DMMD 4U1MB 5BXFB 1NMBL 5CD3A 4K2UH 5KS9F 3UPCA 4KJWD 1HXYA 4JM2F 4F7TB 4Z0BH 5C0IB 4GW4A 4X6CE 3PQYB 4HPYL 4ORGB 3FFDB 5GPRA 2L7UA 3VWJD 3IETA 3TV3H 15C8H 1N8ZB 3HA0A 4HUVA 3V6OE 5ITFA 3KPMA 4KI5F 2EIZA 3RGHA 2R8SL 4HD9A 1NCUA 3QJFB 4TSBL 5E24E 3D48R 5DQJA 5L2JA 1IJ9A 4NP4L 4XBPA 2HFFA 1X5FA 3RNQA 5GGVY 1CE1H 1UWXH 2BVUA 3EYUH 3IKCB 5D2NC 4DAGH 5I2IA 1MCPL 5LG1A 5HXMA 3I50H 3D39B 1U8LA 1KBGH 2WINA 4EI5B 5I0ZA 1L7TL 3QUKB 4PRIE 2RBLA 1U8KA 4X6CA 4JPKL 4ODVL 1DCLA 1LO5B 5B38A 3V6OA 4B7IA 3KG5A 4YHML 2EO9A 1CVSC 3VA2C 5K9QG 4BYHA 4KKBD 1FNSL 2JELH 2NY7L 3I3BA 4FP8L 4NSKB 1RK0B 4GAYB 3VXUD 3IDYC 1SJEA 2OLDA 4IMKA 2AXGB 3RU8H 4BH7A 3OJ2C 1RVFH 4O2CA 2AJZA 3ZYJA 2XWJB 3D18A 1DJSA 4M03A 4JQXC 1CLYH 3X14A 1DQQA 4MXWH 5KG9B 2FO4A 4XCCL 3WFDL 5DHVH 3T2QA 5J13C 1NFIB 2DQIL 5T3ZL 1XZ0A 4HCRA 3T4YA 4PRIA 4GAJL 1KIQA 1HHIB 4KJPD 5SWSD 2EIEA 1A47A 3ARPA 4QHMB 5L2KE 1Z0MA 2RAMA 1HHKA 2NMSA 1JPSL 5CGMA 1IBGH 1CT8B 1ZLUK 2XZCH 5F96L 1IKNC 4AEEA 2JCCE 5E8OB 1CD0A 5GS3A 1UH2A 3RDTA 2FX8L 3D69A 1C12A 2I07B 1OARL 4XX1G 3EJYD 4OZHE 5IT2H 2CKBB 1MNUH 4JZNA 1RAMA 3IDIA 4BQCA 4BSVB 4JGJA 3GJFB 3TA3C 3IU4H 1E6OH 1A1OA 1FVEB 4D9LL 3QDGD 3MLRL 1Q9WA 4V1DE 2WUCL 1LD9B 2OMNA 2PXYA 3MUGA 1FYTB 3KLHD 3M17B 2R56H 5L2KA 1NCNA 4X5LA 4HC1H 4HZLB 5D4QA 3V6BR 1PQZB 2H26B 4M8QB 2JCCA 4TQEH 3CH8A 2HFTA 4P4KC 5LCVL 5DD1L 5DMIL 1Y0LB 4DZ8A 5A2KH 5CMAB 5CINL 1SM3H 1IGYA 1YEFH 3P73A 3O9WA 4OZHA 4WW1B 1BVKB 4N0CC 1EAPA 4R90L 3O3UN 1HK6A 1FNSH 4GMSL 3CSPA 4E41E 1EMTH 4P2QD 1X9QA 4KZEH 4IM8A 1D5MB 4ONHA 1XF1A 2VUOA 4V1DA 3U2SB 1TZHB 1T1YB 2BOBA 7CGTA 3N1GC 2D7PA 3PDOB 5C0AD 4BKLB 4R4ND 3S88L 1G9MC 5AYQA 1TNNA 1UB5A 5MERA 5T3ZH 2F53B 2HLFD 4OD1L 2VQTA 4XPFL 5KVMC 1OTTD 4KK5D 2Y06L 3ZO0A 5LXGL 5DFTA 3C60C 5A2JH 3I02A 5IOPB 4M62H 1LEGB 1RIVH 5KBNC 3VXRB 4NO5B 5J89A 3WNMA 5FUCC 1U3HC 4E41A 1P2CA 2FX8H 4D0BA 4PPTA 3EYFB 3QR2A 1ZTXL 4R7DB 4G6JH 2AK1H 4JDVA 3DRQB 2ZUYA 1MJJA 2AEPH 2J1KA 1RZFH 1AE6L 3C8HA 3OQ3B 3V4UL 3RTQB 4D9LH 3L3GA 3FCTB 2FSEA 1SJVA 4Y4FA 5HYJD 5KSBE 1T4KB 1NAMH 2HT3C 1WZ1L 3SE8L 1LWRA 5JTWA 1F6AA 3HNSL 1IFHL 4KGJA 1YMMD 5E5UB 1B0RB 2FATH 3O0RH 1UKTA 1BM3H 1QBMH 3ARYA 3C2SA 2M2DA 5EC1B 4LPUA 4TNVK 2J8OA 4ZXBD 5SWQB 2Y36H 3ZKNC 5ACZB 5IQ9B 4L8SC 4KRPC 4LU5H 1LILA 5BS0B 4NNXA 2WUBL 5IMOA 1GVIA 3QQ4B 3OGCA 4U1LB 1LK3H 4YNYA 5IBTL 5JNYA 1KGCE 2VR5A 1MLBB 1NGXA 4GMSH 5ISZD 1Y18B 1WUNT 3A6CH 1KCLA 4X9GA 3RBGA 3GK8L 4HFUL 5D9SB 5KSBA 3MFGB 3VFUA 1JNLH 4M6OH 3ZSSA 3FQRB 2Q1EA 3FO2A 3CCHB 5CZVL 1BEYL 4HJ0C 1T7VA 3LD8B 3VCLB 2AXHA 5JUEH 4TUJA 4CL7A 4ENED 3SDAB 3VFNA 4RX4D 4K8RH 4XPFH 3FAXA 2Z92B 4LLMA 5D8JH 4U1JB 2E6JA 1LDSA 1BBDL 4TNVF 5EH1A 5I1IL 5K59F 1ZGLA 5D5ME 3EFDH 1U95B 2PTUA 4MX7A 4PRBB 5HVWA 3T3ME 2ADGA 1R3HB 3FRUB 4G42B 3T0WA 3WFZA 2N1KA 3KPPA 3TN0D 2DQEL 2X1WL 4JHBA 4BFEA 1G1CA 4WVRA 5GS1A 4NQUA 5F8RC 4X7SL 4X9FA 2Q8AH 4S0SD 4JN1L 1JN6A 5GGRB 4OGYL 1UXWB 2VNCA 3B9DA 2VZ3A 2E9WA 1FFQA 3U9UB 1R5WB 4PV8A 1MREH 5C1MB 4GRLB 5FYJH 3MLZL 5E9DE 5CJXC 3UAJC 2E8ZA 5DK0B 1I9JL 4CN4A 5B3JF 3C87A 4U6YB 1NCCL 4OGAD 5EO1B 5DR5H 1M05A 2IBBA 4KVCH 5D5MA 3ULVD 2NY1C 5D7IB 3RVUD 3K8KA 1H3XA 2UUDH 2X4NB 1IC1A 1H3WM 5J06A 4PGBA 4X6EB 3PP4H 1E28A 3FQNA 3MFFB 3TO4A 3EOAB 2DLIA 4CU8A 1PG7X 2ICES 4WHDA 2YWYA 4KI1A 4PRHD 4ELKA 1VADA 3V0WL 5E9DA 1JWUB 4RGMB 1TDQA 3VD9A 2RCSL 4FQQA 4P2CG 2H2SC 1MRDL 2Z35A 5DT1H 4G6AD 3L3DB 4HKJB 4NIKB 3QCVL 1J18A 1FL5B 4HBQA 5HYFA 5ESVB 1CBVL 4G9DA 4QLRA 2V2WB 3HI1B 4TVPH 1T20B 5I1IH 2H1PH 3U48A 3WXWL 3EO1A 1T7YA 5MHSD 5FB8B 4YXHL 4LF3A 3A0OA 2BVOA 3BIKA 1UM6L 4FFVD 4NKDB 4NOBA 3WNPA 3L5WB 4HWBL 5JOFA 3CFJB 3MMEA 2H32A 5IB3A 2W91A 3MXVH 4X7SH 4EN3C 4QNPE 4JN1H 4OCSL 3HC3H 3O11A 1DUZB 4W6WB 5FHAL 4JHWL 4HS3B 2XQBL 3TIDB 4X5XB 3CH1B 1CQYA 4IEFB 1AI1L 2CIKA 3RPIB 4KXZH 1TJGL 1EGJA 4PR5B 4WW2A 5KVFL 1JZ3A 3B83A 2VXSL 4ONFH 4LGPB 2J4WH 3RVXC 4QY8B 3VRIB 1N6VA 5KOVC 3IXAB 4LPTA 5I17B 4PP1D 4XVUD 1QLRB 1Q0YL 1RUAL 2NXYD 3IJYA 1S9VB 3ZE0F 2I26N 3V6OC 1Z3GL 3U30B 3QDMA 4PJGE 5GGVL 3HZYA 1UVQB 1QR4A 4GW1A 4K3JL 5EFIA 4PGCA 1P7QD 2IFGA 5IJVB 1GJIA 4G8GB 5MEQB 1SY6L 4Q2ZB 3V8CA 4OZGE 4GW5B 1GOHA 3ARGB 4JRXB 3MQIA 1A7PL 1ZLSH 1Q9KA 4YHOL 3MZGB 3LAFA 3RL2A 1CXLA 2GSIA 4YQXH 5DJDA 2X9WA 4FG6D 2P5EE 1T3FA 2DS4A 1I85A 2DJ4A 2W0FB 3HMWL 4RZCB 1OM3H 4M6MH 2GJZA 1JE6A 1F4WL 2R1WB 3I3EA 2MKLC 3W0WB 4GLRI 1BZ9A 5DRNB 6CGTA 2P1YA 1ZLVK 3EOBA 3WXWH 2MJWA 3B2VH 4PJGA 3FZUD 1T1WA 4YXHH 2AQ3A 5C0CB 4M8VA 4OZGA 4HWBH 4P2OD 4F33B 2C4FT 3FN9A 4N0UB 2CMRL 3EBAA 4I48B 4Q9CA 1REIA 3OWEA 3MLXH 2YPKB 1KELH 3E2HB 2OQJA 4LBEA 1F02I 2HFGL 2P5EA 3RGVC 2A2QT 3WL9B 1OT1A 4KK8D 5BZDB 3QCUL 4YC2C 4UUJA 4GAGH 2PYFA 2VXSH 1VFOA 5C7XL 3CX5J 2I24N 3FQXB 3BH9A 5MEOB 4QHLA 2BCKB 4OM1H 4F15B 2AJ3B 1KLUB 1XGPB 5CIPH 3GSXA 1MAMH 1RMFL 1UKSA 3VW3L 1HHGA 4MYWB 1A7OL 1CCZA 2GUOA 4Z5RB 1CXFA 3MLYH 2YEZA 1W8NA 3VU2A 4JJHA 2FO1A 1SY6H 2VDOL 5B8CC 2CQVA 4U6HA 1M1SA 5I16A 4Y88A 5IHLB 1A7PH 5CSZA 3PWPE 1KTDA 4KH2A 1QFHA 3FQWA 3G04A 5CP3A 1V3KA 2L7JA 3TPUA 1YNTA 2GCYB 4MMZC 4HH8A 4W4OA 1N59B 4UIMA 5J12B 4OZFG 1MWAL 3HFML 3QUML 1IM9D 4ZUWB 1K5NA 3GRWL 1G6VK 4G8EB 3ULSB 4F7MB 4N1EA 3X17A 1BZ7A 4ZUVA 3WIHA 2VLKE 2FYYA 1IAIL 4WTWA 4YDJB 4UDTA 2EDHA 3HLAB 4ZAKC 4QF1B 2R0LL 2Z9TA 4KV5E 2GAZA 5CEXA 5L8KB 1QSFB 1MVUB 1WSST 1MAJA 3NZHH 4YGVB 3H3BC 2ICEB 3PWPA 4JG0H 1HH6B 3E0GA 4L4VE 5JW3L 1CFNB 2DL2A 3X3GH 5EO9B 4NKMB 4OF5A 4X6DE 3HC4L 5BV7C 2NCMA 3O3AA 4K94L 3RBSA 3FHAA 4NWTL 5J6HA 1OAKH 1WTGT 1CG9B 2VLJE 5ID1A 4PRID 4YHYC 3K4AA 1XGTB 3S37H 3HCVB 1X5GA 3NCMA 4EOWL 3MV9B 4J12A 5FGBA 3QCUH 3AY4A 4JFOA 4LOUC 1PZUB 1NBVL 8FABA 4R0LB 4WCYL 3UTPE 4JM2C 5C7XH 3QIWA 2QHLA 1QFWL 2FGZA 5F3BA 4G5ZH 2VLKA 4LVOB 3BPNB 1CVRA 1J8HD 2R2CA 3NPSB 3RDTD 4WJ5A 2FJGB 3BOVA 4WU5A 4UBDC 5DJCB 1BFVH 2A0LC 3F12A 3BXNB 5CEZL 4I5BB 1NQBA 4L4VA 1ZXQA 4S11A 2KDGA 3RY4A 4X6DA 3FONB 1A64A 1OAQH 3ZDYE 1YN7B 2VLJA 4NBYB 4N0YL 1JHKL 3T8XA 2PXYD 3FB8A 4Y4KC 5LQBH 1WCBB 2PO6D 3KWWA 1E4WL 5L2KD 2QTEA 3NTCL 1E6JL 4M48L 4RMQA 1FV1B 3H8NA 5DVKA 1F11A 1YEEH 4KKCC 1NPUA 4DN4L 4NRYB 1F4XH 4WU7B 3T1FB 2F74B 2KL6A 4LSRH 4M5ZL 1EHNA 2F15A 5IEKA 4FQJH 2YC1A 1N26A 4PJXB 1RHHB 4KVNL 5ITBL 2E7BA 1LE9A 3O9WD 3OJDA 3TFKD 1FFNB 3SGDH 3WMSA 3TCLB 3TLRA 4LCUA 3UYPA 2NY6C 3CNKA 4LLDB 1AD9B 2A6IA 3HNTH 2P43B 4LSVH 4PJ7E 4G43A 4G6ML 2Y1VA 5I8KL 3MREA 4DJMA 4XBEH 1T5WA 4KK6D 3HS0A 1MPAL 2ZCHH 4F9PA 2IAMB 2ZUQB 3L3IB 4OLXH 4NN7B 1BF8A 5GGUB 4FQ1L 3HC4H 2IANE 3GJEB 3UZQA 3N0PB 5FYKE 2IG2H 4X9HA 1RJLA 4PJFF 1I9RL 4UV7H 3BKMH 1P6FA 5TFSL 1YPZE 4OUUB 3BHBB 1IQWL 3S37X 3ZYIA 3C09B 4BK5A 3HE6C 2HN7A 1FSKB 3MRNA 1I8LC 1FJ1A 4E41D 3KLSA 4OCRL 4PJ7A 3ULVF 4G7YH 3GMLA 2P42B 4U6XA 1AGBA 3MNWB 4F57L 1GGBL 3SDCA 3RZCA 1EUUA 4LEXL 1VACB 3TO4C 3RNKB 5CSGA 4YFLF 1UJTA 2KZWA 5IMLA 4MAYC 2IANA 4U6VL 3BPOB 3PF2A 4Y4FD 4QHKI 3LRGA 5C0BE 3U6RA 3W2DL 2VR9A 4YR6B 1E4WH 1YPZA 4HIXH 4X4YB 2CUMA 4LRNL 4M48H 3WO4B 4LCYB 1BX2B 4JQIH 5L88H 4JDTH 3D87B 2HKHH 3B8YA 3SKJH 1ROWA 2D9CA 5EZLA 1AGEB 1R3IH 2NR6D 2A38A 1VPOH 1TETH 4PG2A 1CFSA 1JGUL 2VL4A 5EOQH 1DQTA 5EUKA 3V6FB 1KB5L 3TIEA 2R2BA 2FEEL 3EDJA 2DAVA 4RFEB 4P0DA 3QXWA 3WXVL 2EDXA 1JPFB 3LS4L 4RWYH 1JZ8A 3QPQC 2FBOJ 5TF1L 5C0BA 1KCSH 1K4DA 3ULUL 1DSFH 2W0KA 4JFZL 1PSKH 2FR4B 1HZHL 4M7JH 3MLWL 2NY2B 3C6SA 3QO0B 5IVZB 5I1DA 2BY3A 4L5FL 1R5VB 3ARBA 1EFXA 3RX5A 1SYVA 1IGTA 5D1QC 4PTUA 3DWTA 1HDMB 5TFSH 1U3JA 1KJVA 4MNQB 1CTNA 1CE6B 2NXZB 3S96A 3HMXL 3VH8B 3NA9H 1KF9B 5DO2C 3L1OL 1KGCD 4UQ3A 1FRGL 3P2TA 4NC1E 2G2RB 3DSFH 4YAQA 2YD1A 5ADOL 3L5IA 4X6FA 4OV5B 3MV8E 5GRVK 3BP6A 2BNQE 4KJYA 3EZ8A 5DEZA 5BOZG 3PL6D 4R2GD 1IGCH 2QADB 4I13B 1IAOB 3UO1L 4JGMA 3D25A 5J56B 3HZKB 3NFNB 5KSUA 1I3VA 5GJTL 1FDLH 2B7DT 4GBXC 5T33H 3VI3E 3C5ZA 1LP9F 5KANI 3QULB 4LCIL 4QGYA 4OQTA 3GO1L 4QWWC 1H8NA 2V7NB 1QRND 1B4JL 1DDHA 5IM7B 5DHYA 4D8PB 4XNXL 4LSTL 3WO3B 2XWBA 1H3VA 3O6KL 1MQ8A 3G08A 5DMJB 2Y7QA 3DUSB 5HHOE 3MV8A 4P5MA 4R9HA 5IBLD 2BNQA 4DN3L 3VGGA 4JDZB 2FBJH 2HJKA 1JGUH 3B6SA 2R2HB 4X98B 4MD5B 1KEGH 3CD4A 4AEIL 1G7IB 2EXYC 3TZVC 1BOYA 5KSAA 4X9BA 4WRLA 3IAQA 1TVHB 2FL5B 3LS4H 4RAVA 1GAFH 3PDGA 4XXDB 4YZFF 3QUZB 1UZ8B 3ULUH 2ICWB 4NKOB 3SOBH 2UZIL 2EIBA 3ESVF 1TTGA 5FK9B 3LOWA 4LVHB 1FVCA 3G6JB 2X4UB 2XZAL 2DMBA 3BN3B 5LVEA 1KTKE 5IEHB 2OTWA 3UXFA 3GIVA 3QI9B 2C1PB 5HHOA 3U0WL 5IF0B 1MI5D 4QOKB 4UV4H 1DQDH 3WDHA 2F54B 1YC8A 4ZO9A 3N1MC 4O5LL 2AK4E 4LARL 4O4YL 3E6FA 3RWDA 4IRJB 1HXMA 2OK0H 1CXHA 3GBNL 1BMGA 2D03L 4LMQI 2C3VA 3T77B 4P2RA 3H7BB 4J6RH 4Z9KB 5C9JA 4PRNB 2O5XH 4OAWA 4JZJB 2DM7A 2M26A 1PG7W 2JB6A 1BBJB 1UQSA 3UCRA 4B0MM 3ARTA 4NKQB 3D2UB 5T5NG 4FNLL 3QFDB 5JR1L 2BNUB 4KKAC 1QLEH 5DD0H 4ZSOE 5CIPB 3CXHJ 2AEQH 2IPUG 2O5ZH 5J11C 1U2CA 3B9KB 1AGFA 2AK4A 1V5JA 1QFUH 3MJ7A 3UDWC 4X7EC 2APBA 2GJ6B 3QDMD 2IH3B 1ZHLB 2ID5A 3G5ZB 3K8MA 4HK3N 3ISWA 2XNAA 3X11A 4ZUUA 5HDQL 4RNRB 1VEOA 3U83A 5IK3A 4WI3A 2VKWA 2CKNA 1YY8A 4AT6B 4KPHL 5ADPL 4XWOC 3OKNA 5HGGS 1CU4H 5CILL 3MNVA 2F9BT 1T66D 2UZIH 5HHXH 3TNNA 1M7XA 1CICC 1YJDH 3ARDB 5EOCH 5KANG 3G6DH 1HQRA 1NBZA 5MI0C 2YPVH 3OKKA 4PJEB 1CZ8L 5F7FA 4XH2A 1YY9D 4UOW1 3UTTB 5FGBC 3AY4C 2V5SA 3BEVA 5AUMB 3R8QA 4HUNB 3F7YA 4ZNEE 5C0NC 4UQ2A 4NPYA 4FTVB 2VTFA 3BPLB 4LARH 5EU3B 2D0FA 4Y1AD 1PGRB 3AC0A 3I6LE 3LS5L 4Z78A 1F4HA 5CUSH 3EHBD 2NTFB 5IKCB 1UC6A 4MA1C 5D2LE 5ACLA 1BLNA 1XF2A 4M3KB 4FHBD 5DWUL 4FNLH 1SEQL 3UPRB 4NNPL 3ARSA 2XTJB 4KTDH 5C0JA 4RSVA 1NFDF 4RA3A 1SEBA 4ZNEA 5CBAA 4QHUB 2B8OT 1TJHL 3VI4E 1IGJA 4KTEH 3QDJE 1OF2A 1N5AA 2MPAH 1CGSL 2DQHH 1K85A 2JCCF 3ZTJG 2P24B 2XG5A 5K9KA 2ESVB 4L3EE 5GSVB 1NBQA 5E94B 3HAEH 1F6LL 1YEHH 1S7WA 4PJ8B 1KXTB 1BQHA 4OZHF 3BQUB 5D2LA 3P0VL 4KKBC 5HGAB 2YOCA 3K2UL 5HJ3B 5E00B 3O8XC 1MUJB 4KPHH 1MWAB 5DFVC 2XY2A 1BQSA 3QUMB 2YUWA 3LN9A 4F9PC 3SN6N 1UADC 2IADA 2ORBL 4W70A 1N0LA 3N06B 4HUUA 2WBKA 1UH4A 3C5JA 1A02N 3JV6B 1CZ8H 5INCB 3GHEH 4HH9A 3QDJA 5I1GH 5I1EH 1YYML 5B4MD 3CC5B 3MROA 3LKSA 1INQA 4ODSL 1K2DA 1MHPH 3DLQR 3DXAB 3DX6A 4L3EA 4CJ1A 4YWGL 4HIEB 1EPFA 3VXTA 2WWKT 4FQIH 2P5WB 1FL6B 1OW0C 1TZIA 4I18A 3PWPD 4KKLC 3M45A 4U3HA 5IB4B 4LAQL 2BJMH 3V5KA 4NYLA 1ZLWK 4APQC 3LQAL 4KHXH 3UROR 1KJ3H 3MRIA 3NCYS 5CZXC 4IIQC 4XMPH 3QEHB 1DVFA 1X5ZA 1IC4H 4NQVA 4P9HL 1KTLB 3KLAB 3P9MB 2ZNXA 4NNPH 1CD1A 4CW1A 1ACYL 3KLHC 2V5MA 2LQRA 5DS8A 4UB0L 3QIWD 1WIOA 1NKOA 2R9HC 5IG7A 4JY4B 4ZDHB 2IMMA 4ODHL 5C07B 4MWFB 3WYRA 5F44A 3LV3A 4YHKL 4PG2C 5H35A 5K9JL 5D93B 4L4VD 5F7HA 4HF5L 2VXVH 3P0VH 4QHKJ 4GSDH 3F58H 3T0DA 2VLJD 3K2UH 1I7TB 1LNUB 2CLVA 3MUY1 2QJDA 3IDJA 1OD9A 4HUWA 4BZ2H 4QCIB 5IFJB 4WEBH 3DO7A 4WWKC 5KSBF 5JW5B 2WWMD 2CDGA 4BM7A 3T4AA 3UTPD 4HXAL 4BJLA 3QUXA 4HGWA 4WUKH 3F7VB 1NLDL 3OAYH 5TDOA 3W9DA 3VFWB 1FNEB 4NUGH 4QRPB 2HLFC 1I1AC 3ARBC 4XPTH 1VFMA 5E8NB 4MNGE 3QZWA 4NQDE 1YA5A 4IHOB 4QYOA 3RWIB 3ZT5A 1A6ZA 5A16B 4H25A 2CRYA 3VXPB 5H2BA 4TSCH 4XI5D 5F97E 1W2KT 3CMGA 1ZA6A 3F7RA 1N0XH 1T03L 3RVTC 4DVRH 3P77A 4EUPA 3LSOA 4MQTB 4OKDA 4JKKA 1DEDA 3EFFA 1U0QA 4KQ4L 1RZ8A 3P4MA 1IEBB 1NJ9B 3RWCB 3LQAH 3IT8D 2LU7A 2F19L 1ZMYA 1CLZH 3MRCB 4KTYA 2OZ4L 5DMKA 3CDGA 4P9HH 4DGIH 1MRCH 1GRWA 4MNGA 4NQDA 2VN7A 5JW4R 1WEJH 4KUCD 4O2EB 5C09E 3R06B 3VDCA 4K9EL 3KPQA 2ICWI 1FGVL 1JTOA 3AREB 4Q58C 4ODHH 3V95A 4PB0L 2QSCH 5D5MF 1J5OL 3DI2B 3MR9A 3GMPA 1IC7H 1NMAH 2W9LA 3V5DA 4PY7B 1LEKA 3T3MF 2JB5H 3OF6D 3S8WA 1N3NB 4OLYH 3SDCD 4MZ2A 3RZCD 1DQLH 2HRPL 3EYVB 3W81A 4HF5H 1A6AA 1ZVSB 3GGWB 4N0RA 2IAND 2R0WL 1Z0NA 5FYKD 5CEYB 2Z93B 2FEDD 1HH9A 3S36H 2Y72A 1JI1A 2XN9E 2QQQA 2AJVH 5HYQA 1WFOA 2NY0D 1HILA 5C09A 5IJKA 2FJFB 3HRZA 4R96B 1S5HA 5ABDE 1ZE3C 3WS3A 1KB5B 3ARZA 4WGWB 3U4AA 5EIVA 3SDDA 3RUGE 3LRSA 1D5ZB 1S7TA 4WEMB 2CDFA 5BV7L 1X5AA 2NW2B 1FZMB 5FKAB 5IHBA 3BZEB 4Q0XL 3RVVD 4C83A 4KWUA 3C08H 2VQ1A 4MNHA 3VH8G 1Y6MR 3WUWA 2J5LB 4MA8H 1NCWH 3N9GL 3SKMB 2QQNL 4E42A 2DQJL 2XN9A 4C56B 1OTSC 4IS6B 4LKXB 3B9AA 1WZKA 4H88H 2Y6SC 4P46A 4HZAA 2ED8A 4N8PA 4P23B 1EEQA 1D9KB 1MCEA 5TH2B 4F7TA 5C0IA 1EFXD 5HVHC 4ORGA 4NZRL 3FFDA 2R23B 3RUGA 5BCAA 2IBGA 2VH5H 3TT3L 2V9QA 1N8ZA 4U3XA 4WW2F 2YS4A 5T3XE 3D6GA 2VXQL 5J8OA 5I8EB 1KOAA 2C3HA 3QJFA 3DI3B 3FHQA 4F9LA 5C2BL 2DOCA 3EJZD 4N90E 4HK3J 3RVUC 1YN6A 3BIAX 4XCEB 5FO7B 2I5YL 3IKCA 4FFZH 1NCTA 4L4TB 4QNPF 5E4EB 3QNYB 2Q8BL 1URLA 1J0JA 4EI5A 1IM3B 5I73B 4JG1H 2DKSA 3C5ZD 1IGMH 3S5LB 3VFVA 3U4EB 3G5VB 1G7PB 3VWKA 4IRSC 2HTLC 5F9OL 2Z8RA 5TF0A 1HINH 5D1ZB 3WFHB 5AG8A 1FO0L 2EKSA 3F6LA 4ZUTB 1A3LL 5EORL 1X5YA 4O2FB 2HFEB 5C9KA 3MCKB 3MV8D 3UYOD 4JZOB 4K8RD 4H8WC 1RK0A 4GAYA 4NSKA 5DJ6B 5TQ2H 1PY4A 3UX9B 2AXGA 4HK0B 4ELMF 2XWJA 5B21A 4I0PD 3HC0A 4Q0XH 4PJGF 1EEZB 1U3HB 3BH8B 4S10A 1R6VA 2APWA 4MJIB 1MIEH 1NFIA 3KS0H 5FIEA 4LSQH 1A1NB 1HHIA 1Q0XL 1JWMB 4OZGF 4OCXL 2ED7A 1DQMH 4QHNA 4KDVA 4NN5B 1YEJH 4QHMA 2G60L 4HW6A 3GI9H 2YSSB 4UDUB 1MVFA 3QWOB 3RVWD 5I8CB 1ZT4B 2R2EA 4HWZB 5SX4I 1LO2L 1UA6L 1K8DA 3BP7B 4NZRH 1U8IB 4AIXA 5FYJD 3BGFB 3H9HA 1B0WA 2VXQH 1D5BB 2CKBA 3I6KB 2ADJB 3V7MA 2V6HA 2WLZA 3KNBB 1FZOB 1PZ5A 1PLGH 3OR6B 3GJFA 2E9IA 4PP1C 1FVEA 4FQ2L 3QWRA 5ICYB 1IAII 1DBKL 1JNJA 1LD9A 3BT2H 5JOPE 4P2RD 1MCNA 4EDWH 3GMMA 1P4BH 3GSQA 4XVTL 4FFWC 1MQKH 5CAYB 3M17A 1AXTH 2X7LA 4XC3H 5E6YA 1I1YA 3NCEB 1BJ8A 2NTSP 2V9TA 4HZLA 3ALXA 2YKLL 2H26A 1UM5L 4M8QA 1YN6B 3QH3B 3TBSA 3EOTH 3U7YL 3W9EB 5F9OH 5HHQB 5CMAA 2AV1B 1IZJA 4WW1A 1FO0H 1BVKA 1KLGB 4NRXA 3NCCB 1HNFA 1OTUC 2AK4D 3VXRE 1QFWI 4YDLB 1KEMH 2EC8A 2R4SL 2V5YA 5F7YC 4G6KH 5ID0B 1RK1B 4Q9RH 1I7UB 1D5MA 1VDGA 2BX5A 1WAAF 3U2SA 3REWB 1FL3B 1TZHA 3O6LL 1DANT 3PDOA 3ZKXC 3HUJF 4BKLA 1DBAL 4TVPD 6FABL 2A77H 3FJTA 4HS8H 4D3CH 1P4IL 2EKJA 4FZ8H 3IXTA 4M43H 2BMKB 4MJ5A 5F9AC 4I1NB 2WANA 2C26A 3DVGA 4I18C 3H9ZA 3O3BB 5KJRL 4MDIB 1KG0B 1N6QL 5IOPA 2X4RB 4HDIA 5EBMB 1FFPB 1KJ2L 3GUTA 1DVFC 1QFPA 2IEPA 4NO0B 4NO5A 3VXRA 4F58H 3O4LB 5J3HD 1UA6H 5BS0E 3TWCH 2D7TL 3EYFA 4R7DA 3QAZC 3OBAA 3R4DA 3DRQA 5BQ7B 2JJVA 2VLLB 3L3JA 1OPGL 3LHPL 1FZJB 5FUOL 2D31B 3WCYA 2HTKC 4HKZB 2NY1B 2BP3A 4ZD3H 1OWRM 1T0PB 4RAUB 1NUNB 1OHQA 5E8EB 1R3LA 3HN3A 3RTQA 5GGTA 3FCTA 1OB1A 1UXSA 1T4KA 2ILLA 1ZHNA 2VLRE 3M07A 3U4BH 5DLML 3SE9H 1ZLUH 3VDBA 1B0RA 4A6YL 4LKCB 5IVXB 3T0ED 5JOEA 4X6DF 3ROLB 5GS2D 3LH2L 1KFAL 5DRXB 3U7YH 5ACZA 4CNIB 4ZTOL 3MRBB 5BS0A 1N7MH 2H3NA 3QO1A 2AV7A 3FB7B 4KROB 3QUXC 4L4JA 3PWUB 1TIUA 5DJ2B 3RY5A 5J4MA 1HHHB 4GFTB 4XCNB 4LHUA 3EYQC 4XPBL 1IT9H 1HEZB 1MLBA 1S3KL 4G9FB 3U9PL 5IB2B 1Y18A 1MCOL 3I6LD 1FCGA 2FX9H 3O6LH 2HRLA 5IV2A 2RR3A 2VLRA 4BFGA 4ODUB 2UVFA 3CCHA 4TUOA 4DUVA 3MXWH 1QP1A 3KYNB 1H9VA 3V8OA 5JHDD 3BIBX 4EN3B 1W0WB 1O5DT 3NGBC 1JTTA 4M7LH 5IFHL 1MHCB 2P47B 3UBXB 4HWEL 4NUJB 1KJ2H 2Y9RT 5C6TL 1KPRB 1MHHB 4WHTA 5EU4B 4UAOC 4JHAH 4PRBA 5D7IE 3S7GA 1G6RH 4G42A 3BKJL 4NO3A 1NGYB 1UM4L 5EZOL 1MFCL 1YYLH 5JXAL 1HWGB 5KVDH