4PB0L

Structure of the fab fragment of the anti-francisella tularensis groel antibody ab53
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQSPSSLSVTIGQPASISCKSSQSLLDSDGGTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGAHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ab53 heavy chain
publication title B-Cell Epitopes in GroEL of Francisella tularensis.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2014-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L01
4P46B 3EOTL 3BDYL 3SKOA 3MRPA 2WLYA 3SJVE 3ZE2E 3MTRA 1U2HA 3UAJC 4F33A 1S9WB 1EK3A 4G3YH 3P0VL 2NW3A 4BH7B 5I1HH 2DWDA 4DVRH 4KC3B 3ULUL 1IT9L 2R2BA 4ZAKC 5DFTA 1N7MH 1NL0H 4E42A 2AI0L 4P5TA 3KPMA 4LSVL 3X12A 4D8PB 1T4KA 4ZAKB 1JNLH 2NY3D 1YQVH 5DJ8A 3C2AL 4AM0A 4JG0L 4YUEH 5JIPA 3K46A 3QUXC 4JVUA 5J1AA 3HMXA 1KYOK 4PS4H 5HYQA 2O93L 1AO7D 1PY9A 4N1HB 4LASH 3QRGL 5I8EA 1JFQL 3QUXB 1KCUL 4KKNA 3GRWH 1MWAL 4PJXE 4I1NB 1T2QH 2APXA 1EUTA 2EDBA 3MCLH 4XAKD 3GJFH 2Z91B 5I75C 2XPGB 2ITDA 5DFWH 4CKVX 4FMKA 1JUFA 5IB2A 5D70L 5GJSL 1UH4A 3TV3L 3U36B 5I75B 4RFEB 4RWHA 4PJFF 4JY5L 4X4XB 4JREC 5EO1A 3GK8L 2OTPA 3V0WH 3VMPA 4ZODA 2RQ8A 4YXKH 4QT5B 4GUPA 4D0DB 5ESAA 4JREB 3W5MA 1DTUA 4P2OA 2EIBA 2YPKA 3BE1H 1LE9B 4U6TA 3NCBB 1MRCH 3FCTA 1XR9A 2WQRA 4MNGE 1AH1A 1PKQA 4C83A 5F1IB 3MLXH 4TSAH 3QIWD 4KKCC 2HMID 2CMRH 3QZWG 2YKLL 3DX9A 4LRNL 1XF4A 1KTLA 1NFDA 3QP3A 1KJMA 1P7KA 4PJ7E 4U6HB 2WNGA 4PJCF 2QEJA 1QRND 3V4PH 5A2IH 4WW2A 5ENWA 3RNKA 1C5CH 3ALPA 2PTTB 4MAYC 4TVPL 1IGTB 1ES0B 5C6TL 3RY6C 4HWZB 1RZ7H 1FAIH 3DGGB 4PJ7B 1OAXH 4MAYB 4UV4L 1XIWD 4J3VA 1R6VA 3VD3A 5HYJA 4V1DE 2JK5B 5I1CH 1DQLL 1Q9LA 4G6MH 4LSTL 4HUXB 1QO3A 1OP3K 4I9WE 3SDCD 1S5IH 3FTGB 2OP4L 5B4MD 4KJQD 5EZIH 4JG1H 3K4DA 1F6LL 4OUUB 1MVUB 3BWAB 3ARDC 5BO1H 3RNQA 2CLVA 3O2DL 4OIIH 3ZT6A 1INDH 4PGDB 1X4YA 1HIMH 3DSFH 3KS0H 4Y2OA 4I4WB 2ZUSA 1BZ7B 3ARDB 4NBZB 1GGTA 4R90L 5IVOA 4EIZC 4EVNB 3QEGH 1JZ6A 1LO4L 4D9RD 3O6KH 3Q3GB 3WNKA 4LAQL 2CKBH 4H88L 4GMTH 3TF7C 1S78D 2J5LC 1HILB 3RBSA 1XF3B 1PSKH 1MHHA 1CXIA 5T3ZL 4D9QD 1K4DA 5FO8B 4BH8B 3CAFA 5I74C 2J5LB 4LEOB 5E2UH 3VG0L 1EFXA 4WI4A 1QNZH 2BRRL 5DHXB 1BAFL 4P9HC 1QVOB 2XWBB 2NTFB 5I74B 4XZUB 1YYLL 2DQFA 4D2NA 2MPAH 4MDJA 4YHNB 1OSPL 1WAAE 3L7FA 4CVZA 1P4BH 3WNOA 1BFTA 1U2CA 3UZVB 1I1AA 4HMCA 1NAML 4HULB 3VMNA 3L95B 1KJ2A 2J4WL 5GS0L 5E6IA 3PHSA 1XF2B 1RJLA 2NNAA 3WDIA 1H0DB 3QDMD 4WTWA 3QB7C 1E4WH 5JW4Q 4FQ1L 1W72B 4CUCA 3N85H 4CU8A 3VCLA 4YGVB 3I6LD 3ROLB 1K8DA 4NP4L 1KLFA 4JO3L 4XWOD 5CP3H 4EI5A 3MOAL 1U93A 4M02A 1P1ZB 3CH1B 4JY4A 3BGFC 2FECL 1MREH 1LNUB 1BFSA 3QNXA 2VAAA 2HKHL 5D2LE 5KW9L 1INQA 5F7DB 2IH3A 4E0RA 3QA3A 3WUWA 3BGFB 1FV1A 2V2TA 4QRPB 4EOWH 1NFIA 5AG9A 2W1NA 3HHRB 1MJ8H 1XGUB 5JXEC 4NKIH 3LV3B 1WITA 4IRSD 3GHEH 5MEOB 2BVQB 4CMMA 2W60B 3QUMA 4XMPL 2GJ6B 2X4QB 5C0RL 2BMKB 3ARFA 3GSOA 3SGEH 1T21A 3SPVA 4LIQH 3BW9A 5E2TL 1NEZB 3BISA 5EIQA 5I1KL 3MV9A 5FGSA 2RFXA 3NCYS 3I50L 2Y07L 1BD2E 3H6JA 2EDYA 5DJDA 5ADPL 5IIEA 1N5YH 1QBBA 1C7TA 1DE4A 5I1IL 3IFOA 4MZ2A 3U0TA 3RWDB 2EE2A 4ZO9A 2R8SL 5JA9A 4H0IA 5LXGL 2DQIL 5DUBA 5CIPH 1FYTE 1BD2B 1I1YB 4GKZB 1VDGA 2VDLH 4GW4A 1DBML 2WSKA 2Y5EA 4MWFB 1CF8H 2DQUL 5CBEA 3KHOA 2BK8A 5HPMB 4WDIA 3MJ9L 5E5MB 5J11C 1HEZB 2OK0H 4BA8A 3W82A 1XGPB 1U8PA 5HGGS 5T5NG 2ADJA 1FL6B 1P84J 3FQXA 5DHVA 4QRRE 1M71A 3GSNA 4YHOH 4GRWB 2E6JA 5DUPL 4HWNA 4OCLC 5D1XA 5JQ6L 2H9GB 2DJUA 3QH3B 2IGFL 2N7AA 5KOVC 1Y0LB 1B88A 4M7JH 4QHNA 4NOBA 5D9SB 1RQ5A 4OZHF 1CLZH 5GJTH 5I8KL 3VXMD 3NCEB 5L2JA 2YA2A 3KLHD 1E4KC 2APFA 4R4ND 4NJAL 5KSUB 3GM8A 3QWQB 5CILH 2XNAB 1AJ7H 3PXJA 1A7OL 5ESVB 5AWNL 4Z7VA 1NCWH 3B3IB 4JFPA 5DEGB 4D9LH 1IC5H 4JFFB 1YN6B 5I18L 1AQKL 4UUJB 4FXKA 1JTOA 2QHLA 3D5OF 4ZSOA 5E8NB 2F8XC 4D3CL 4U1IA 1RUML 3MRHB 5TE7H 1VEMA 4QHMA 1SMOA 3OBAA 2VZVA 2UWEA 3S35X 4GRMA 3B2VL 4AEIL 5DQJB 3QPQC 2WINA 3KPRD 3CIQA 1HQRA 3BKML 5DUMH 4UOJA 3LQAL 1QSFA 4GRLC 4LHUB 3HUJF 3WDHA 3IFLH 2XTJE 3MRDB 4ODXA 5MI0C 2P5ED 1KFAH 3D85D 3IGAB 4GRLB 1UC6A 3EYFA 3PWNA 4RIRB 4RZCA 3ZE2F 2XTJC 5DK0B 4HZAA 3MR9B 1UCBH 5C0JA 2OMNA 2FGZA 2XTJB 3CXHK 4X99A 2XWJB 3P0YL 4FRWA 3LQZB 4KQ4H 4CU7A 4KJPC 1HXMB 3VGAC 3RX8A 3NTCL 3G6AA 4UT6L 4J3OC 4Q9RH 3NMEA 4G7YL 3VGAB 5DSCB 2VXQH 3EYOA 2M8XA 4I0PD 1WF5A 2HN7B 2UZIL 2JJWA 5E8DL 4Q9QH 2FLRT 4K9EC 3REVB 2HVKB 2O5ZL 2Y6SC 2R23A 1TZGL 4FQJH 4R7DA 2P8LB 3O2VH 1U8NA 3RPIB 1JYXA 4OI8A 1JTTA 1V7NH 3QRFM 2P43B 4J12A 1LO0L 1NC4D 2PR4H 1C08A 2BRQA 4L5FL 3HI1A 1C5DB 4W4OC 4IDLA 3BPCA 3JV6A 4AIZB 1IEHA 3UTSD 2EO1A 4LGSB 2YD3A 1Z6JT 1MLCB 3QEQB 3VWKC 3B9KA 4HLZG 2OR9H 4OB5L 1GGYA 4JO2H 3HRZA 3RAJL 2X89A 3UDWC 1X5ZA 4DK3A 1H3TA 4UV7L 1OPGH 2EIZA 4LCYB 4ODUB 4L4VE 4JRXD 2MFNA 3VWKB 1KENH 1EJ6A 1FL5A 2FB4H 2XRAL 1CG9B 2QJDA 4XCNA 5I1LB 3MRJA 2I27N 4N9GA 5DWUH 4ODHH 4YHMH 5J13C 5DD1H 5HGAB 5A3IC 1JHLH 4L4VB 1QYGH 1MQKH 3JV5A 1J0KA 2EEDA 2H1PL 2YPLE 3EOAB 3PWPA 1YEFH 5DS8A 1I75A 5EC1B 5J13B 2VR4A 4ZTOH 3EO1A 3X3GH 2A77L 2EDWA 4J3WA 2CO7B 1FLRL 2YPLB 1A1NA 4HS3B 3MV8E 5KJRH 1MPAH 5DD5L 2DM4A 4P3DA 4EBQH 1OAUH 1WBYA 1BX2A 1MFEH 3TH3T 3SOBL 3FFDB 1PZ5A 4PB0H 4L8CB 1U92B 1A4KB 4WI8A 4IRJD 3MV8B 1DUYB 3ETBF 2E6PA 4UQ3A 4WO4D 1GC1C 3AREA 3S7GA 2NX5E 3NPSC 1LK2B 5FGBC 1E28A 2KKQA 1RZKL 4JPVH 3U83A 5CGYC 1AXSB 4UU9B 3RY4A 3O8XC 1UB6B 5SWZA 4JANB 2QHRL 2DKMA 4NFBA 2CLRA 3F8UB 4P3CH 2AXFB 1AGBA 1C1EH 2NX5B 5FO7A 3O8XB 5F6HI 3SDDC 5D8JL 3QUKA 3ULVL 4IS6A 3S6CA 4OLVL 4AL8L 4PY8J 3CSGA 1V3MA 2FEEL 1QG3A 4YDKH 3SDDB 1CFTB 4XBPB 2A9NH 3MRKA 3BGMA 4ZNCD 5KANG 5LGHH 1CFSA 4WUUB 5DZNA 1UH2A 2J88H 4XWGL 4JM2F 3BKJH 4S10A 1EPFA 3S96B 2HVJA 1NUDA 1BVKA 5JW3L 1HHJA 1IAIL 1RVFH 3VD7A 1YPZA 4Z8FL 5DRXB 3QXAB 1G7QB 3D48R 4LARL 4U31A 4ZUSB 5F72S 3INUH 5CJQH 4P5MB 4LRIC 3X14B 2VKWA 2W9EL 1TNMA 1P7HL 1TTFA 4Z7OE 1QD0A 1KN4L 2M26A 3IJYB 1F5WA 2R69L 3ALWA 4NO5B 4PGCB 3JZ7A 4LPWA 4X5LA 4F9PA 5JLZB 3GMRB 3SKNA 1T83A 3MRBA 1ED3B 4PG2C 5CEZL 3RVTC 1UXWB 2XICA 3VRJB 4X4YA 2B5IC 2LABA 1S7SA 4TTGA 3G04A 4LSRH 2CRYA 3SE4A 2B5IB 5MENA 1AFVL 3S37L 4G42A 2DBLL 3CU7A 4FNLL 1ZT7A 3CX2A 4FFZL 3SKOB 1DANU 2GITA 3MRPB 1U95A 1PY4A 5H8DA 1G7LA 3LH2L 4WI6A 2NY5C 2PYEA 2KZ1B 4FTVD 3HAEA 2NW3B 5DC9B 3VFPA 2YRLA 2CRMA 5GGQH 4BFEA 2DWDB 5D2LF 3TJHC 4P5TC 4BUHA 1T7ZA 1A6VL 2R2BB 2LU4A 3U4EA 3VU2A 4E42B 4P5TB 4ESKA 4MQSB 3KPMB 3WFBL 3RL1A 3X12B 1T4KB 4DN3H 3L3OA 4QO1A 3LPGA 1H8SA 5DJ8B 1NSNH 1QACA 4AM0B 3ULSA 1MF2L 1NGQH 2DTML 4XHQA 1FIEA 4MXWH 2AGJH 1MELA 1CR9L 5I8EB 2YXFA 1U3HD 1UKTA 5E5RB 4EJ1C 4P5KA 3CVHH 2HH0L 1RZIA 1WWBX 5IB5A 3IJHA 5FUCE 4KDVA 5KANI 1JUFB 5IB2B 4S1QH 1MFAH 1VACA 1CDIA 3NFPA 5B3JE 2OR8A 4KQ3L 3GMMA 1QBAA 4PTTA 2PTVA 1D6EA 1A7RH 5EO1B 5C2UB 4P2OC 4DWHA 4P46D 1NDMA 1YNKL 3PHQA 4GUPB 5ESAB 2HWZH 5I1AA 4N0FA 5C1MB 4P2OB 3V4VL 4FZEL 4KTEH 1T1XB 2YPKB 1IGCH 4PJDA 3FCTB 2B1AL 1XR9B 2F58L 3UAJD 4QRTA 1PKQB 2CO6B 1AXTL 3HB3C 4HGWA 4C83B 1FO0L 3P4MA 1KUMA 3NPZB 5CZXC 1B6DA 1RI8A 5ICZA 2OJZL 4GW5A 5DI8A 1G9MH 4R0LA 5EFIA 3O3EA 2VDRL 4WW2C 3DX9B 2MOVA 1XF4B 4ZAKD 1KTLB 1NFDB 2CDEA 4PP1C 3JWOH 1KJMB 1P7KB 2H32H 4JFZH 5EOTA 2VLME 4JJHA 4WW2B 2AEIT 5ENWB 3RNKB 3PGCA 2Q87A 2AEQL 3LZFH 2R0KH 3DJ9A 4KMTH 1RURL 4OF3A 2WLZA 3Q2CA 3QUXD 4NCDA 1GAFL 5HYJB 4OCRH 1MOEA 2ZPKH 1OP9A 3P9MA 1MCKA 5HI3C 1Q9LB 4Z6AT 1QO3B 4UILL 3HKFA 3QPXH 1LP9F 2ZCKH 1O0VA 5I1GL 4DOHE 1WIUA 3RNQB 2CLVB 1HINH 3O2WL 5FHAH 5B22A 5DVKA 3EYUL 4DOHB 3DSNA 3VD5A 2OXGA 4HUMB 5ALCH 4ZXBA 5F21B 3SY0A 5DMIL 1MHHB 2JTDA 3HZMA 1K4DB 4L4JA 1EFXB 2EDKA 4WCYL 5TF1H 3SQBA 2Y9RT 5E2WH 5D96C 3MZTA 5DGQA 4O9HH 5E2VL 4KKCD 1I1AC 5LGJA 3CK0L 3JSSA 4MDJB 4UT9L 1ZLWH 2ZOLA 4ZOEA 5K9KA 4NKQB 3L7FB 4CVZB 4ZYKA 1N8ZA 1BJ1H 1HHKA 4K3DH 1I1AB 2IPTH 2E7HA 2D7NA 1CGVA 3BQUA 2XKNA 1KJ2B 4XP6L 1RIHL 5E6IB 3QWRD 2NNAB 4M4PA 5B39A 4MAYD 4ISVA 1BLNA 2RCSH 1LDPH 5HHMB 1G1YA 1KN2L 4EI5C 1MJ7L 4HQQL 1BZ9A 3P11H 3VCLB 1J0IA 1I7RA 4EI5B 3TH2T 1BOGA 3IDMA 4JY4B 2P8PA 4Y89A 5E99L 4H8WL 3GSQA 3QNXB 5CUSH 2VAAB 2XY1A 3S88H 1INQB 2IH3B 1QZ1A 4E0RB 3MXVL 3QA3B 3WUWB 1FV1B 1QTYT 2V2TB 1U6AL 5HVWA 1ZA3A 3ARDD 1NFIB 3OTTA 3T4YA 3T08A 5KSVB 5IHUH 3S8WA 1E4XH 3DV6A 3ARFC 4PRPA 1QBMH 4WTZA 3DUUA 3K81A 5I76A 3PIQA 1VEOA 3UBXA 5EU6E 4CMMB 4DN4H 4LBEA 3QUMB 4N0UA 5J56B 5FM5M 2NR6C 3EZ8A 1YEIL 3H0TA 1CD1A 3S5LA 3ARFB 3GSOB 1TLKA 2J6EA 1T21B 3SPVB 2P49B 3QQ4A 4K94C 2H26A 1K3ZA 3LPFA 1D5ZA 4MDIA 3MV9B 2RFXB 3VFRA 2EDEA 4G6AC 1WWAX 4M93C 3RA7L 3RZCA 1C5BL 1MCNA 2YEZB 5DJDB 5DMKA 1QLEH 5IIEB 25C8L 1DE4B 5D7LA 1JP5A 4I77L 3IFOB 4Z7WA 3T0VA 3U0TB 4M93B 5IT2H 1MY5A 5DUBB 2EDNA 2XFXA 2Y36H 4UIKL 2DRUA 4GW4B 3X11A 1EHNA 3H3PL 3CD4A 5FFLA 1A9EA 4NBYB 5CBEB 5GS3A 4G80A 4HW6A 4WDIB 3BPOC 2EICA 2ZNXA 4H5SA 2L0DA 1V7ML 4OCSH 3BPOB 1U8PB 1UWEH 3HE7A 2ADJB 4K3HA 5D1XC 1U8OB 3VXNA 5T3XE 5DHVB 2GYSA 1M71B 4WV1A 3GSNB 2ICES 1XH3A 3D2UA 3P3YA 4TSBH 2VDOL 5D1XB 5JHLL 1TNNA 2DQTH 3KDMA 3PGDA 3RL2A 4QRPD 3U79A 5JUEH 4QHNB 4QEGA 2OR7A 5HHPA 4Q58C 3BAEL 5JZ7D 5L2JB 5AUMA 5CD3A 2GJ6D 5JXED 1FRGL 3RVXC 4KJWC 1N6QL 3B8SA 1WK0A 4Z7VB 1OGAE 1Q1JH 4JFPB 1G1CA 1NDGA 1KF9B 3M8OL 4HWEL 2CSPA 4PB9L 4L9LA 2L7JA 4FXKB 4XPAH 4ZSOB 3WIHH 3VFOA 4B0MM 4ZS7L 1ITCA 4U1IB 1QSFE 5DJYB 4LFHD 2X4SA 4QHMB 3KLSA 4AENA 5DZOA 2BVTA 2UWEB 1BD2D 4GRMB 5HYEA 2VAJA 1CXKA 3LKOA 4ETYA 4XC3L 2WINB 2VDML 3FB8A 1HQRB 2Z8SA 4G9FA 2X1XR 5IVXA 5A2KH 1FE8H 3BIAX 1QSFB 5E8EA 2FATH 1N64L 4WHDA 2J3SA 3V6OA 3IDYC 4LGPB 2CLZA 3EYFB 3PWNB 4RZCB 1ODAA 4R4BA 4ONHA 3ARZA 4JVWA 1RIVH 2VABA 2YD4A 4N68A 5C0JB 3IDYB 4LP5A 4FABL 4X99B 2P47B 1U3ZA 4DUXA 5L7XL 1RD6A 2B39A 3ZDZE 5FYLH 3VFNA 1A6ZA 5IFAL 3G6AB 1X5LA 1TVDA 3W9EA 3EYOB 1BFVH 1KV3A 1Q0YL 2Y1VA 5ABDE 1W0YT 1X7QA 4DCQA 2R4RH 5DT1H 3JWDL 4FMFA 2R23B 4R7DB 4JO4H 1U8NB 4JFFD 2YD8A 4KUZL 4GG6F 2J8OA 2PO6A 1C08B 3B9KC 3HI1B 2K7PA 3BPCB 3JV6B 1ND0A 1KCRH 3HI5L 3OAZH 4NO0A 3B9KB 3HRZB 4OD3H 1DQDH 2EIZB 4DW2L 1JNNL 5IUSA 3PWPE 1RK1A 1FL5B 2E7CA 5CINH 2VXTH 2E9JA 4XCNB 4LHUD 3MRJB 5KN5A 4N9GB 4UINL 5GRXG 4XXCA 3QPQD 4XCEA 5ILTH 2B2XL 1KB5L 1U8JA 2JB6A 4M62H 4GRLD 5DS8B 3PWPB 2D31A 4OFVA 1UT9A 4NO3A 3L9RA 4M7LT 4EUPH 4KAQH 1MCRA 2UY6A 3CFBA 2XTJD 4PRIA 2Z92A 4AY0A 1A1NB 3QHFL 4J3TA 2R56H 5EWIH 3ISWA 2I60L 3GMQA 4P3DB 4E41A 1WBYB 1IL1A 1BX2B 4MCYA 1PZ5B 3MODL 3AREC 4KJPD 5SWZE 1VERA 1YEGH 4UQ3B 1DFBL 3AREB 1SJEA 4P57A 3S34H 5L2KA 1A0QH 2JJSA 4LMQE 1E28B 3GO1L 2CD0A 2CQVA 4X7SH 2L7UA 4OJFH 3E0GA 5SWZB 4QHKJ 3LN4A 4MGXA 2CLRB 1PG7H 1AGBB 5FO7B 2Y6SD 2QL1A 1A6UH 3QUKB 4IS6B 3L5XL 3BT2L 2QSCH 3QEUA 1IAIM 4KI5E 5MEPA 4HBCL 3QEQD 4XP9L 3DI3B 1UM4L 1YPZE 3T0AA 1MRFH 3MRKB 1KIPA 3BGMB 1KPVA 3LIZH 3VWKD 1Y6NR 2EXWC 1CFSB 4HC1A 1LDSA 5EUOA 4OTXL 43CAA 1CBVL 4IHOA 3V7MA 2HVJB 1BVKB 1A14H 1HHJB 4WGWB 4HWUA 1YPZB 1VGKA 4L4VD 4Z76A 3F7QA 1ADQL 1QFUH 1OCWL 1FLTX 4NUGL 1S7XB 5A3ID 3NIFF 1IGIH 1RUQL 5B38G 4P49A 2DYPA 2C9AA 5IQ7L 3GI9L 1AGDA 3IDNA 3KLDA 1GGBH 4F9PC 3VI3E 2YPLD 1L0XA 1J0JA 5LBSL 1T83C 4QTHA 5JR1H 3GMPA 5KVDH 1DUZA 6CGTA 1D7FA 3VXSE 4HIXH 2DKUA 4MB4A 5T1KB 3SKNB 4KKLC 1MAML 5MENE 3HC0A 4X4YB 1MCDA 2W0FA 3MV8D 4DTGL 5B3NA 1U42A 1CGXA 2UUDH 4K71C 1S7SB 3G04B 5KS9F 1F4YH 5EU4A 3I3BA 4DKAA 1J88A 3EW3B 5MENB 4K71B 2WBJA 4G42B 4HWBA 2BNQA 1NCBH 3I3DA 1RULL 1CGYA 1ZT7B 1MRDL 5J12C 2NX5D 5CGYD 5AZ2L 1M1SA 2GITB 4KGLA 4RMWA 1U95B 3O8XD 1UENA 3ARXA 4YR6A 1A7PH 1G7LB 3GI8L 5J12B 2IG2H 3NCMA 4PUBL 2PYEB 4NPYA 1DBJH 3HAEB 1AP2A 5CMAA 3OAUH 3SDDD 3VFPB 1L6XA 5AYQA 3FT2A 3A6CH 3EOYG 4RRPA 4WUUD 1GGUA 4Y5VC 5JPNB 2V17L 1SY6A 3U4EB 3RY5A 1BQHA 4NZDA 1PD6A 2DQDL 1UYWL 2BY2A 4GSDL 3RFZC 4S11A 4X80H 3CSPA 3WFEL 2YC1A 3ULSB 3BRGC 3OJ2C 1PGRB 3FB5A 4YQXL 3MACL 1WZMA 2FDBP 3UYPA 3GSRA 1OQXA 3FB6A 2QSQA 3C8DA 4NZTH 3GMLA 4U1MA 1B4RA 4ZFOA 3WN5A 2EE6A 4M8QA 5I8OL 2PCPA 2DS4A 1RZIB 1A7QL 4O02H 4XPBH 5IB5B 4HK0A 4LVNC 4XPTL 4TYUA 3UJJH 3IJHB 4PJEE 1CLYH 3L3KA 4FQ2L 3N50A 3RVTD 1IVLA 4LVNB 4RMSA 1VACB 2X4PA 3NFPB 2CUIA 4M1DH 3GMMB 4PTTB 4LDEB 5HHVH 1D6EB 3V5KA 4PJDE 3UEZA 1MCPH 1NDMB 1OAQL 1OLLA 3PHQB 2H8PA 5I1AB 4N0FB 4XNYL 1CFVL 1UA6L 1DQTA 5E4IA 1OP5K 3G6DL 4PJDB 5C0AE 4QRTB 4LSQL 3P4MB 3HRPA 3GSUA 2RJMA 4R0LC 4JZOA 5ICZB 5BZDA 3UPAA 2F19H 3OKOA 4GW5B 2ADFL 5DI8B 1KEML 2P4AB 4R0LB 5CS7A 1Q9KA 4P5TD 3TJHD 3T2OA 1DBKL 3O3EB 2ARJA 1E4XI 4GH7B 1MLBA 1KJ3H 2C7UB 5C7XL 2CDEB 2DM7A 2IC2A 1IKFH 5EOTB 5E6YA 4KHTH 4U6VH 4CDHA 2R1XB 2Y5TA 4B5EA 4K55A 1G6RL 4HPOL 3SGKA 2OYPA 2ADIA 4Y0GA 1I3UA 3NABH 4XB7A 5CSGA 1J12A 5E8PA 5A2LH 1F3RB 3P9MB 4MJ2A 5J6GA 2ZUXA 1ZKAA 1MH5A 3MA9L 3L1OH 4JKMA 2QKIB 4IIQA 4G3YL 4Z5RA 3DYOA 4G9DA 5HYSG 1DLHA 1OGTA 2VDQH 4NZRL 5I1HL 3L3GA 3RTQC 3KR3H 4XT1C 4OV5A 4G7VH 1J0YA 2XWTA 4H1LA 3LVEA 1IM9A 4ZXBC 5DMYA 2Y72A 4U1SA 4UTAL 2VXUL 3D9AH 2D9CA 3LS4H 2OQJA 5SWSA 4ZXBB 1MIEL 1UVQA 2NMSA 4P2OD 4ELMA 1YQVL 4XAWH 5MERA 2FHFA 3SY0B 4D0BA 3Q1SL 1AQDA 5BOPA 3BP7B 1FP5A 5DTFA 4BQBA 4PS4L 1ORSA 3HZMB 2P5WE 2B0SH 1NLDL 4KTDL 3HB3D 1KGCE 2A38A 2OZ4L 4NJ9H 3TH4T 3GRWL 4O00A 3EFFA 3TNMA 5CZXD 1ZV5A 3REWA 3MBEA 5C08A 5LGJB 4S1SL 5K9KB 2ZOLB 3BQUC 3K1KC 1TVBA 2XIDA 4ZYKB 1N8ZB 1B2WH 1HHKB 4FN0A 1EHAA 5GS2H 5KSBA 4PP1D 3BQUB 2XKNB 5C86A 4LK4A 3LKQA 3SGJA 2YUXA 3MRNA 3MX0A 4EUPG 5LKNA 1A2YA 5B39B 3PP4H 4ISVB 3WL9A 2VLMD 3BP4A 5HYJD 4YXKL 5E56A 2FL5A 1BZ9B 3L5WA 4BQ9A 3TJEL 1QR4A 4HGKC 3FOMA 3PP3H 3BE1L 3LDBC 5JOFA 1I7RB 4LVEA 5HI3D 2YXMA 1BOGB 1UFUA 3IDMB 4FQLH 2P8PB 4JB9L 3VXQA 3GSQB 1J1OL 1MJJA 3LDBB 5HDQL 1WSST 4N0UE 1HOCA 1IGML 1RMFH 4MS8C 1ZA3B 3T4YB 1GPOH 1IE5A 1Z3GH 1I3VA 3DV6B 4PRPB 1XGYL 1CQYA 2Q8BL 3DUUB 4NC0B 3PIQB 5I76B 4DZBA 3UBXB 3BDYH 4LBEB 5IMOA 4N0UB 3V8CA 3RWIA 2AABL 2VZOA 4G5ZL 3H0TB 3V4PL 1CD1B 1YZZA 3S5LB 2C4FT 4U7SA 2ENSA 4DEPC 3BMVA 1CZ8H 2H26B 4J3UA 5D7LE 3RZCC 3VFGL 5DEZA 3OX8A 1D5ZB 2EDJA 1EFXD 4MDIB 1S7RA 4DEPB 3MFFA 4S1DC 3RZCB 4G8GA 2VB5A 1IT9H 5DMKB 3S3PA 1ITBB 2OSLA 5I1CL 1LO3L 3WE6A 4G6ML 3ZKMC 3T2PA 5D7LB 1YJDH 4Z7WB 1CL7I 2AEPH 4LSVH 4DAGL 3JXAA 1U8LA 4JG1L 2WANA 1I1AD 2LQRA 3NA9L 2XFXB 5F9WC 4GMSL 3C2AH 3X11B 4TUJA 4OFPA 5E6ID 4JG0H 1FC2D 1A9EB 3TIDA 1HIML 5F9WB 4KV5F 3QRGH 5HHMD 4G80B 1JPTL 4NC1C 5FYKL 1JFQH 4EQ3A 1I8IA 3HE7C 1KCUH 2C4XA 1YUHA 4NHCL 1MWAH 3B5GA 3RUGF 4WV1C 4GMTL 3RKPA 3HE7B 4KI5F 4EI5D 4K3EL 3VXNB 5D5ME 4OF6A 1LILA 1PSKL 4LU5L 1CTOA 4AK1A 4WV1B 3RWJA 3D2UB 1XH3B 2VO5A 5LG1A 2D7QA 5GJSH 3KDMB 3B8YA 3PGDB 3RL2B 3TV3H 4OUOA 2CR6A 3CZFA 3GK8H 5HHPB 4EEEA 1TJHL 1SEBB 4K7PL 5AUMB 2WP3O 1QSZA 5CD3B 3ZKQD 4GLRH 3ARFD 3QCVH 4PJ5A 5FGCE 4LFHG 3RGVA 2NR6D 5C6WH 4L9LC 4XH2A 3MV9D 1E6JH 3WJJA 2F54E 1NDGB 3ZYOA 4WENB 1X5IA 3EOBB 4L9LB 1T0NA 4OF7A 5FGCB 1GYAA 2GFBA 4L8SA 1GOGA 3VFOB 3DUSA 4G6AD 5IVXE 1F90L 4PRHE 4R96A 2X4SB 4KUCF 4LRNH 2F54B 4NIKB 4AENB 1F58L 1F00I 3LKOB 4KPHH 1JWUA 4Q97A 5IEHA 4G9FB 5IVXB 4PRHB 2G5BA 5KVFL 5C6TH 5IG7A 1MJ8L 5GGRA 4NKIL 1NCTA 4MJ4A 4WFGD 4ZO8A 5E9DA 2CLZB 1LEKA 2DJ4A 2HLAA 2DB8A 4ONHB 5IB1A 4Z7UE 1DQLH 4M6AA 2VABB 2FBOJ 4LSTH 3OJMB 5JNYA 5F6IC 5EBMA 5D1XD 2LVCA 2HJKA 1BWWA 1R0AH 3B2UC 3GHBL 3KWWA 3O2DH 5T3XD 3MUJA 5F6IB 1UWGL 4MA7L 5F7FA 4PBXA 3VFNB 1A6ZB 3UYRL 3T2NL 4R90H 1QKZL 3W9EB 1LO4H 4A6YL 1TQCC 2NZIA 3MJ6A 1ULVA 2X4RA 3MREA 4LAQH 1CXEA 1X7QB 4DCQB 3WS6A 4H88H 1YMHA 4PJIA 2PO6C 2F15A 2VR9A 5LVEA 3ES6A 3ABZA 3RVXD 1TQCB 4KJWD 1S7VA 3ULUE 5T3ZH 4J4PA 3WUZA 1PAMA 3ULUC 2PO6B 1KBGL 4WFED 2BRRH 2XQBH 2E7MA 4LHUG 1ND0B 1QFWM 5F93C 4NO0B 1YYLH 3I85A 2EZ0C 4PJEF 2ITCA 3D39A 3NFNA 4MXQC 2FJHA 1V3LA 1RK1B 5GSVA 1FYHB 2OJEA 1QSFD 3HLAA 2J4WH 4FOMA 5GS0H 5KN5B 5F7NC 3IAGC 4HXBH 1T2XA 4XCEB 4PRIE 4M7JL 4K23L 2JB6B 1U8JB 3S97C 4Z0XA 3MMEA 4FQ1H 2D31B 2FJFA 3LKNA 3MLVL 4NO3B 3L9RB 4RA0C 2ENYA 4NQTA 4E41E 1Z9OA 1MCEA 3CFBB 2CKNA 4HIEA 4NP4H 4PRIB 5CILL 4JO3H 2Z92B 2FEDC 3MOAH 3RP1A 4AYFA 4M5YH 5CJBA 1IC5L 1ZTXL 5KW9H 1JZ3A 1TXKA 3GMQB 4E41B 1IL1B 3JTTA 4MCYB 4M5ZH 3BMWA 2JJSC 4P23A 2ID5A 3F62A 1SJEB 4P57B 5L2KB 4LLAA 1I9JL 4XMPH 1GIGL 5C0RH 5M94B 3U7AA 2GTWA 5E2TH 3K2UH 1Q0XH 5D6CA 3PWLA 3C9NA 4GO6B 5FF6A 5I1KH 4CBPA 4HLJA 1AHWA 4ZUTA 4RMUA 2Y07H 3QEUB 1UCBL 3B9KD 2EYSA 2X89D 1EH9A 1KJ2H 1RZGA 3CSBA 1KIPB 4TVPE 2R8SH 1ORQA 1KPVB 5LXGH 2DQIH 2B4CC 2Z4QA 5EUOB 43CAB 4KQ4L 4NWUH 3MUGA 4IHOB 1DBMH 4KU1A 3TWCL 1ACYH 4J2XA 1VGKB 3CMGA 2XA8H 2DQUH 5JDJA 5TPWL 3EDFA 3PWPD 4Z76B 4Q9RL 2V2WA 3MJ9H 4MD5A 1P4IH 3E1F1 1F4AA 2DYPB 3DOSA 4QNPF 4TN9A 2YUWA 2CXKA 3IDNB 5DD0L 3F65A 4YDLC 5IFJA 3D1MC 3O2VL 4QTHB 3GMPB 1DUZB 1HE7A 4MNQA 5DUPH 2GHWB 1MJUL 5JQ6H 4YDLB 4OCXH 2IGFH 1QP1A 3VXOA 3F6LA 3HC0B 4XNQA 2BNQE 1JYWA 2W0FB 2VUYA 1YEJH 4OD2A 3ARED 2WBJC 1EEYA 1MFBH 4M7KH 2ZP0T 5EH1A 2C3WA 1MFDL 3Q0HA 2IWGA 4NFDA 1KENL 4NJAH 4NQDE 2WBJB 2BNQB 5AAMA 5SWZD 1UKSA 4XPHH 1A7OH 1M7XA 3JTSA 3DXAE 5IHBA 1IM3A 4XMLH 4JKPL 5DD1L 1KCKA 3MZGB 5JW5A 2XG4A 2UVEA 3QISA 2YS4A 5I18H 4YR6B 3UTTA 1P7QA 1AQKH 1X4ZA 4WUKH 2D7MA 4QXTA 1A47A 1FG9C 4L29A 4NPYB 3X3GL 4K3JH 5CMAB 1AP2B 4PJAF 4D3CH 1NUNB 2X4TA 5ANMA 2WUCL 3FT2B 5C0CE 3HFMH 2EEBA 5CEYA 5GISL 1RZJC 4BFIA 5J57B 5F1OB 1MPAL 5BV7C 3VFTA 3B2VH 4AEIH 1BQHB 3BKMH 4NQCA 2EXWD 1MFEL 5E95B 1EGJA 4V2BA 4C54A 5BV7B 2BNRE 3RVUC 2F5BL 2YC1B 4J23A 3RHWK 4ZMAT 5EIVA 3FB5B 4ODWA 3GSRB 5E2JA 4ZFGH 3FB6B 2DM3A 3UP1A 2C1PA 3AS3A 4WEUD 5HGHA 3AS2A 1S7WA 5FUOH 5DVMA 3UX9B 3P0YH 4MQ7A 3W0WA 1OD7A 4U1MB 3MRIA 1QFHA 4JEGB 1C1EL 5T1KD 4ZFOB 4M8QB 4L4TA 2PCPB 2YPVL 2Y25A 4QY8A 4HK0B 2BSTA 4ZUWB 3KLAA 4OLXH 3BX7C 4UT6H 4KKLD 3LKRA 3L3KB 4G7YH 4XVJL 2A9NL 2D7OA 4K2UH 2X4PB 1FFPA 5MEND 1P5VA 2R1WA 2UZIH 5E8DH 2J88L 3V5KB 5C8JA 4RBPH 3BKJL 3ZE0E 2O5ZH 1RVFL 1TZGH 2H8PB 3DVGB 4OQTA 2AJYH 1LO0H 4UZGA 2HJLA 2PYED 2Z0BA 3OKMA 1JGEA 1IAKA 4PJFA 5EO0A 1TJGL 3GSUB 4LPVA 2ZKHL 3R8BB 4M48L 3K0WA 1LQSR 2BVYA 4JZOB 4UV7H 5BZDB 4FQHA 3OKOB 3C5ZA 1E0OB 3EBAA 4W6WB 1UM5L 4WNQA 1Q9KB 2XRAH 3ZSSA 3AUVA 3VD9A 2XY2A 3H7BA 2ARJB 3V6FA 1AIFA 4ZQKA 1MLBB 2YN3A 5I1EL 3SGKC 5ICYA 4LPTA 2H1PH 1UKQA 2Y5TB 5F3HA 2A6DA 3VA6A 4LSRL 1A3QA 2FLBT 1JL8A 3QUZA 4CDGC 4OFKA 2ADIB 4LLDA 2A77H 3H9HA 5E8PB 1CGSL 4CVWA 3LD8B 1FLRH 1FNGA 1CGWA 3H9SE 2ZCLH 3RJQB 2AK4E 4PJCA 1J7VR 1GVIA 4OLWL 1RJZA 5EB9A 2A74A 3UJIL 1FGNL 5J6GB 1EEUA 1FNHA 1MH5B 3SOBH 1YECL 1YQ2A 4GKSA 5E94A 4Z5RB 4G9DB 3H9SB 2IANA 1DLHB 1OGTB 3ARBA 4ORZC 1OAZL 1FNLA 4RGMB 4ELME 4Y4HA 2W38A 5EULV 4OV5B 4H1LB 2XWTB 2OCFD 1ZANL 1IM9B 1UB5A 2JE8A 3V5HA 5HXMA 7FABL 2IF7A 1DQML 3KG5A 2QHRH 2XKUA 3GGWA 4DN3L 2OQJB 5SWSB 1UVQB 4ELMB 2C1OA 1NSNL 5MERB 1F2XK 1FNSH 1Y6MR 4U6XA 5D8JH 4D0BB 3SE9L 3ULVH 1L9MA 2A73A 4OLVH 4AL8H 1AQDB 3LSOB 1F11A 5KVGH 5DTFB 2VQ1A 1CDJA 1ORSB 2YR3A 3EYQC 4WFHE 3BDBA 4FFVC 3SDXA 3RWGA 4IOIA 3OAYK 1JPST 5KSBE 3EFFB 3TNMB 2NY0C 3CFIC 3REWB 1CDCA 4BZ2L 3ZHLA 5C08B 3L3HA 5JW3H 5BQ7A 1IAIH 4Z8FH 1TVBB 2C3VA 2NY0B 3LRGA 3C08L 3SGJC 2B1HL 3BWUC 2BX5A 5D7SL 4GLRI 5KSBB 2X1QA 3LKQB 3MRNB 1Q9WA 5F88A 3S9DB 1A2YB 1A7RL 4KVNL 3BP4B 2QSTA 2Q76A 4YDIL 1Q8MA 2HWZL 2FL5B 3BGAA 1MCLA 3L5WB 3FOMB 4WHTA 5JOFB 3HN3A 1N3NA 5CEZH 3F58H 4CVUA 3VXQB 4N1CA 1OLZA 2NTSP 3HNTH 1MJJB 1TFHA 4Y16A 2A83A 5EA0H 3MYJA 1HOCB 1UH3A 2OTUA 3O6FC 4JPKL 3QJHA 1AFVH 3S37H 1G9ML 4HKJB 2DBLH 1R3JA 4FNLH 5F1SA 4DZBB 4ZXBD 2XA3A 4FFZH 3JWOL 2DIJA 4LF3B 2EDXA 3RWIB 4KK9C 4XNZC 2V5TA 5GQBA 4OZFA 5FO9A 2YRPA 3VXUE 2GSGA 3MLPA 3OX8B 4XNZB 1S7RB 1JRHH 3MFFB 4G8GB 4ONFL 4DGVH 3D0LA 1TETL 2AJVH 2OSLB 3OKKB 5I1DA 3MPCA 5C09A 3EDKA 2H2PC 2I9LA 3NIDE 1OTTC 3WFBH 2F8VA 4R26L 1KGCD 1U8LB 5IW6A 2ZCKL 1NEUA 3MRMA 3KPPA 1NLBL 3BQUD 3BP5A 4TUJB 1MF2H 1HINL 3TIDB 5EOCH 4KKBC 2F5AH 5FHAL 4JZNA 1DZBA 1X5YA 3IDXL 4FQIL 4KZEL 1CR9H 1I8IB 3WUWG 4GS7C 1YUHB 3LKSA 5E03A 3BUTA 3LN9A 3Q5YA 2HH0H 4GS7B 1R3KA 2W9LA 2VZUA 4ODTH 3H9YA 2ZCHL 3IDIA 5JPMA 3RWJB 4I8DA 2RGSA 5IBUB 5H2BA 1RZKC 1U58A 1NANH 4KQ3H 4PJ5E 4F7MA 3CZFB 4PRPD 1G0XA 4N9OB 3EDEA 4MS8D 3QG6A 1MIMH 4TQEL 1YNKH 4W81A 3RGVC 4P2RE 1X5GA 3HAEH 1R3HA 1W2KT 1KOAA 4LLMA 3WJJC 4PGZA 4FZEH 3V4VH 4PJ5B 3RGVB 2B1AH 2MQCA 2EDOA 1OSZA 4L1DA 4M1GL 4PV9A 3NACL 4F57L 1AXTH 4XH2B 1FO0H 3EDJA 4L8SC 4OZHA 3RZCD 2AQ3A 2ED9A 1T0NB 1D5XA 1C12A 2GFBB 3KYMA 3P11L 4L8SB 5D7LD 2OJZH 5GZNC 1CT8B 3DUSB 2MCPL 4S1DD 3MLUL 7CGTA 2VDRH 4R96B 5DC0A 2C3GA 5F7WC 3ZKMD 4P4RA 3S88L 1QHPA 3J7HA 1JWUB 2AP2A 5CEXA 5IEHB 4XB8A 4MMXC 1ADQA 2AEQH 5GRYA 3O3AA 2G5BB 2X05A 5IG7B 1RURH 5IHUL 1E4XL 3GBMH 1QBML 1S7UA 5E9DB 5CEZE 1OB1A 5EC2A 1GAFH 2HLAB 4N8CH 3RKDC 5IB1B 4XCFH 3HE7D 4LCWE 5FYJE 2DQJL 3R8QA 4UILH 5HGDA 4PRDA 2UYLA 3CMOL 1ZA6A 3D2UD 5EBMB 3FOLB 5I1GH 5KVEL 2HJKB 1CWVA 3VGGA 1BM3L 3CUPA 2V2XA 3QUYA 3SJVA 2R9HC 3KWWB 4AG4H 4EN3C 3O2WH 4RMVA 1QLEL 4PJIE 4OZGF 4POZC 5HHQA 3WS6C 2NY2C 5DRNA 4EN3B 3VWJA 3ARSA 4WI5A 1P84K 1FH5H 3MREB 3VE0A 3EHBC 5ACZA 1U3YA 3HR6A 2NY2B 3ROOA 4J4PC 1YMHB 4PJIB 2A0LC 4RX4A 3ES6B 4YZFE 1YMMA 5DMIH 1S7VB 2G2RA 4HF5L 1D6VL 1PW3A 2ZSVA 1L7TL 3OKDA 5IW3A 2DMKA 2IBZY 1QLRA 1BGXL 2CRZA 3D69A 1CD9B 3QULA 2F54D 2VQTA 3CK0H 4UT9H 2ITCB 3D39B 1NUFA 5JO5B 2FJHB 4TSBL 5GSVB 3H2WA 4G9FD 1NMAL 4PJXA 5ICXA 2OJEB 2ILLA 3HLAB 1RIHH 4PRHD 1T1WA 2PW2A 2VOTA 1R3LB 4TOYL 3OJVC 1NCAL 1FBIL 5CGTA 4Z0XB 3MMEB 3LKNB 2FJFB 1FGVL 1KN2H 3NIGE 2GTZA 1JVKA 4OLEA 3T3PE 1MJ7H 4HQQH 4K7PY 2CIIA 2Q6WA 4PY8I 4R97C 4IMKA 5J06A 4HIEB 3C09C 3ARVA 5CKGA 3RVVC 4FXGA 5E99H 1Q1JL 4H8WH 4JDTL 4R97B 5BVPL 3C09B 4P23C 3JTTB 4XPAL 4K07A 2P1YA 1U6AH 5IB4A 4XX1E 3B2UD 3MJ7A 4MNGA 4P23B 4TNWK 1FVEA 1RUAL 5H37H 3CVIH 4L8BA 1YEIH 4RQQA 4RFOL 1OP3H 2ZSWA 3FRPA 3LEXA 3NZHL 1AHWC 2GTWB 3QDGA 5DJAA 3WFDH 3UCRA 5C92A 5I30L 5D6CB 3PWLB 3C9NB 4M03A 2PO6D 5FF6B 4HWZA 3O9WA 4I3SH 1P4LA 4PJ7A 1CYGA 1AHWB 4ZUTB 3AXLA 4QTIL 3R1GL 3RA7H 5DJZA 1C5BH 3IAPA 3KYNA 1YYML 2DJSA 2IFFH 2P24A 3ULUD 4NO0D 25C8H 2A1WL 2EYSB 4I77H 4UOW1 5H35A 2WP3T 3PF2A 1RZGB 1HI6A 1ORQB 5BJTA 2Z4QB 2EZ0D 4UIKH 3MUGB 3MLYL 4V1DA 1I8LA 4BQ6A 1UQSA 4MXQD 3TZVA 5FYLL 2BJML 1WFNA 4L3EE 1CL7L 2NXZC 3PUCA 3PE9A 4YDJB 2OI9C 4MD5B 3WHXA 3DRTA 1IC7L 2NXZB 2R4SH 1V7MH 2UVFA 1CDBA 4PRID 4PJHE 2OI9B 2R4RL 4L3EB 2FH8A 2JJTA 3GDBA 5IFJB 4MQXC 4ACPA 4JO4L 2I25N 4MNQB 3F7YA 4E41D 2FEDD 1QRKA 5JHLH 3DRQA 3VXOB 2XWBA 2M2DA 4XNQB 2NTFA 3CCHA 5E08L 2DKSA 3QCTH 4OD2B 1FZKA 1EEYB 4OD3L 5L2KD 3MO1A 1DQDL 1FRGH 3RI5K 4UIMA 3I6GA 2HT3C 3LCYA 3QR2A 4QXUL 1KIQA 2ARWA 5CINL 2VXTL 3T4AA 5GGRY 3JTSB 3C60A 4YHKH 5JOEA 1IM3B 3PXHA 1M05A 3P4NA 5ANME 5ILTL 5JW5B 1JYVA 4M62L 3K80A 3M8OH 3UTTB 1P7QB 2OL3A 3F12A 4PB9H 4QXTB 4L29B 5EU7E 1EHLH 2KH2B 4OFDA 1BHGA 4NQCE 1F4XL 2A6KA 2X4TB 4Z7VF 5ANMB 2ARJQ 5EU7C 4OBSA 4MA3A 2DDQH 1VFUA 4XNMA 2CIKA 5CEYB 4MLSA 4BFIB 3GJFA 4PD4J 2VDMH 3G6JF 4NQCB 3V0VA 1KTDA 4NWTH 3MGAA 3NOIA 2NLJA 5ITBH 4PGJA 1N64H 4ZPTA 5GGVY 2WK2A 1YEGL 1QOKA 3G5XA 3K1DA 3CNKA 5D2LA 2WIMA 4HKXA 3S34L 5MEOA 2DYPD 3NCCB 1A0QL 2IH1A 4OLZL 4U1LA 1ZHNA 4ENEC 4ODWB 4YBLC 3WXWL 4X7SL 2BSRA 4OJFL 2C1PB 4HCRL 4MD0A 3THMH 5HGHB 1S7WB 3WFCH 5BS0A 1ZSDA 4ONGL 4MQ7B 3W0WB 1EXUA 5L7XH 3GKWH 3MRIB 1A6UL 4L4TB 4P9HL 5IVZA 4QY8B 2BSTB 3NIDF 3KLAB 4GXVL 4M00A 5FCUL 5IFAH 3LKRB 1EMTL 1T7XA 2BNUA 2NXYC 2Z31A 4H26A 5C71A 1FFPB 1BVLA 4O5LH 2R1WB 3TLRA 3HAEG 4Y19E 2WBJD 3IKCA 2BNQD 4FG6C 2FHCA 1K2DA 2BVOA 3STZA 3B4NA 5C8JB 5AG8A 3M07A 2DI7A 2DLFL 3JWDH 2NXYB 3EO9H 1A14L 4PJFE 5I2IA 1W72L 4Z78B 4Q9BA 1B0GA 3GNML 1GOHA 3RWFA 1FYTA 1X5XA 1QFUL 5ELIA 3SQOH 2HJLB 3PL6A 5I66A 1NPUA 4KROC 3OKMB 1JGEB 1IAKB 4PJFB 5EO0B 3C5ZC 1HXYA 1GGBL 4KROB 4IRZL 2ZUYA 5KVDL 2VZ1A 4FQHB 4DW2H 1PBYA 1JNNH 1T80A 3C5ZB 5EBGA 1FZMA 4WNQB 3H7BB 1QFWH 1AIFB 5DR5L 4ZQKB 4NN5C 5C0GA 3ULVF 2D2OA 1DANT 1DQJA 5LQBH 1EBAA 3DWTA 3QUZC 4HJGA 5ICYB 4KWUA 4QRRA 1GGCL 1KB5H 4KHXL 1JZ2A 5F3HB 2A6DB 5GHWL 4CADA 1DR9A 4NN5B 4DFIA 3KYOA 2ZUVA 4XP4L 1WLHA 3QUZB 5D71L 3RVUD 1CD8A 1TMCB 4LLDB 4PJGF 3G5YA 4WWID 3O45A 1NBVL 2CKBA 1XAUA 1UGNA 3H9HB 1FNGB 1JRHI 3BUYA 4PJCB 4BYHA 5DEGA 2GW5A 1IGYA 1RJZB 2A74B 2I60H 5DHYA 3TNNA 4QYOA 1A7PL 3ARBC 3M45A 3QCUH 2KPNA 3M1BA 4YX2H 1W0WA 5E94B 4GKSB 1JGUL 1JN6A 2BDNL 4Y4HC 4K8RC 2FR4A 3OAUL 5HTSA 2IANB 3ARBB 5MHSD 2VLJE 5IF0A 3QDJE 3STLA 5H94A 4UDUA 4Y4HB 1UB5B 3V5HB 3GO1H 1G7MA 5IBLC 1IC4H 2VIRA 4U33A 5I73C 5MP6H 3BFOA 3GGWB 3BYTA 1LP9A 4XMKH 2BHZA 3JBG7 2C1OB 4JDZA 2C5DC 4U6XB 4IEFB 2A73B 3L5XH 3VGHA 3B6SA 1F11B 3BT2H 2EIDA 2VQ1B 2EDFA 4XP9H 3W81A 1NJ9A 5IGXL 4HH8A 1UM4H 1I1FA 4HXAL 4X6DF 5DK2A 3SDXB 4NZTL 3RWGB 4IOIB 4Z0BL 1H3GA 5A16A 5CP3A 5GPRA 4OTXH 3Q5TA 3L3HB 2XZZA 5BQ7B 4XPBL 1EVUA 2C3VB 5I1JH 1JK8A 2J7LA 3GSVA 2X1WL 1OCWH 4NUGH 1SYVA 1RUQH 3X17A 2A9ML 4M8VA 1Q9WB 5F88B 5IQ7H 3GI9H 3T3ME 2X09A 3ALXA 4MAUH 5LBSH 2AV1A 4BSWA 2KUTA 2Q8AL 3FO1A 4WHTB 4BK4A 4Y16C 1MAMH 2E9IA 2HTLC 1N3NB 2LU3A 2YUZA 2CDGA 3H9SD 3IKKA 3WYRA 3ORJA 2ICEA 4DTGH 2PYFA 2I5YL 4Y16B 3PJSA 2A83B 3TVMA 1F42A 3MYJB 5H37G 1CCZA 2OTUB 1IFHL 1IM9D 1F2QA 1A1OA 3E2HC 3QJHB 5CIPA 1R3JB 3TO4A 1RULH 3S35H 4H0HB 1MRDH 1KJ3L 5SWSD 3E2HB 5AZ2H 1F45A 1BEYL 4TVSa 5F6HJ 4F37K 2DBJA 1A8JH 4KHTL 4U6VL 3BVNA 3GI8H 4G6KH 5ALBL 3DGCR 3VRIA 4OZFB 4PUBH 5FO9B 4ZNEE 2D0FA 2GSGB 4NQEA 4HC1H 1K4CA 2X4UA 5EDXA 3NABL 3TFKC 2YN5A 5BMFH 4Q0XL 4HUKB 3EYQD 3WO3B 4JR9L 3D0LB 4FFVD 2V17H 5HD8C 5I1DB 5C08D 4M6ML 2W07A 4WFHD 5C09B 2I9LB 1KXVC 4MXVE 2NY0D 3DPBA 2DQDH 1UYWH 1V8HA 3DVFA 4GAYA 4GSDH 4JPIA 3VFUA 5F70A 5IW6B 4JN2A 3MRMB 3KPPB 5HHXL 3BP5B 4YBQC 4PJBF 2FX8L 3HNVH 1H3UA 3L6FA 2DD8L 4PYHA 3MACH 3DROA 4JZNB 5E1AA 1R5WA 1FFOA 3KYAA 4HV8A 3FAXA 3K8LA 2GSIA 1EHXA 3N1QC 2YD2A 3QXUA 4XAWL 1EEQA 5I8OH 2NCMA 4BZ1L 1A7QH 1R3KB 3DO7A 1RUPL 4X6EA 1MFCH 4NKMA 3UBXG 4Y4KA 4XPTH 5JPMB 3IDIB 1VKXA 4QRSA 3BXNB 3S5LG 4M1CC 4HWBH 5H2BB 4FQ2H 1PG7X 4ETQA 4XNUH 1N5AA 1I9EA 5JW4N 2BCKA 1HDMA 4F7MB 3CFJA 5CZKA 2O26U 4G6FB 4M6NL 3QG6B 1OAQH 4FQQA 4OZHE 1R3HB 4XNYH 4LLMB 1CFVH 1UA6H 1WFTA 3JVGA 3G6DH 4PJHF 4KK9D 1OSZB 4PV9B 4FFYH 3S36L 5ACLA 4LSQH 4X8XA 1KCVL 4OZHB 4NNYA 1JGLH 2QR0A 2JCCF 4G8GD 3L5HA 2X44D 1AC6A 2WM0A 3KPQA 1D5XB 3CH8A 1C12B 5DJXA 3KYMB 2ZZUT 3KS0J 4JAMA 4L3AA 2ADFH 2GJJA 2CK0H 1KEMH 2NY4C 5IR1A 5GGTL 2IMNA 4QGTA 4DKEH 1YEKH 4O58L 5FYJU 5C7XH 4P4RB 3AFLA 3Q6GH 3WEXA 2H2PD 2NY4B 1V3KA 1OTTD 1IZJA 1GC1L 4HSQA 5CEXB 1SEQH 3FAWA 2E7BA 4HPOH 3O3AB 5J6HA 1JIBA 1ZHKA 3VD4A 3HUJE 4KKBD 1S7UB 1YDPA 1OB1B 2YD5A 5EC2B 5ISZA 4DJMA 3SGDI 3A6BL 1A7NL 4KDTA 1FDLH 1WBZA 5HGDB 3QUYC 4PRDB 2UYLB 3MA9H 1CZ8L 3HUJB 2R15A 3BPLC 1ZA6B 5INDA 2JLLA 2RR3A 1INEL 3CUPB 2V2XB 3QUYB 3SJVB 5BCAA 4NZRH 4NQUA 1WCQA 3BPLB 3VWJC 4LEXL 1S7QA 5HHQB 1YJDL 1YMME 2YMXL 4UTAH 5DRNB 2AEPL 3VWJB 2VXUH 5FECA 4S0TD 1MIEH 3VE0B 5ACZB 3WIFA 4PJ5D 3ROOB 3RGVD 3Q1SH 1YMMB 2G2RB 1QUNA 1LEIA 1NLDH 1I9RH 4KTDH 1CDGA 3VG9C 2ZSVB 3OKDB 1G9NC 1WIOA 2OZ4H 2X5PA 1LO5A 2X6MA 1QLRB 3VG9B 3D69B 3UBXI 3QULB 4S1SH 1A1MB 1K8IA 4U1NA 5GZND 3M17A 4PBWD 5DQDH 4GG6A 5ICXB 4PJXB 2RIKA 5GGSA 5SX4H 4PPTA 4JHAH 3U1SL 4TUKL 2AK1H 1T1WB 1G9EA 2PW2B 2LVEA 4Y1AE 4YDVA 3N9GL 4XVTL 5E9DD 1AKJA 4IMKC 4U1JB 1IEAA 2GTZB 2LTQC 1FJ1A 2CIIB 2Q6WB 1VB9A 3QCVL 4OZ4A 2GUOA 4HKBA 3TJEH 1T1XA 2IPKA 3RKDD 4H0GA 1WQVT 4Q6YA 2NY5L 4PBVC 2E7LA 4FXGB 1BJMA 4H1LH 5KVMC 2EKSB 4JB9H 1J1OH 1E6JL 1G7IA 5HDQH 5FYJD 2YA1A 3V8OA 1IGMH 5IB4B 4YHZL 2R9HD 3MJ7B 2EEAA 5D6DA 1CI5A 4MNGB 3QDGE 4EN3D 4HLZH 1XGYH 3W5NA 2Q8BH 1FVEB 2JJVA 5IWLA 3HMXL 4POZD 1FZJB 2W92A 2NY2D 3QQ3A 2AABH 4L8BB 4G5ZH 4RQQB 1D9KC 1DBBH 1KPUB 4KPHL 3O9WC 2ZSWB 3LEXB 2X10A 1TCMA 1KB9J 3QDGB 3EHBD 2FO1A 5DJAB 3DARA 3WKML 3VFGH 4J4PD 2H3NA 2EC9U 3IXAA 1S8DB 3O9WB 1I1CA 1P4LB 2A0LD 1IMHC 2X42A 3AXLB 5J1SC 3ZE1F 5DJZB 3KYNB 2P24B 4YNYB 4CL7A 4RGOL 1LO3H 1S3KL 3TN0A 2EDTA 5DK3A 3D39D 1I8LC 5H35B 4DAGH 1HI6B 3TZVC 5AD0A 3SO5A 5BJTB 4KH2A 3NA9H 2KZWA 1R0AL 3TM6A 3I6KA 4GMSH 1ZGLA 4V1DB 5FUZH 1UQSB 1FVDA 3MRGA 3MOBL 3TZVB 1G7PA 4TRPH 4Z7WF 1BBJA 3CXDH 3VFMA 4JN1L 1H8OA 4PFEA 5L8LB 5DDHA 4WJ5B 3GB7A 4O2EA 1JPTH 5FYKH 4JM2C 2J8UF 4JGUA 3WHXB 3DRTB 4NHCH 2JJTC 4MZ3A 1SVCP 1GH7A 4K3EH 4JE4B 4GOSA 4LLQA 4DUWA 2GKIA 4LU5H 4H20H 4N8PA 1ETZA 5HSFA 3F7YB 1DL7H 1F8TL 3OMZA 1F6AA 3DRQB 2XQBL 1MI5A 1QFWI 4P23D 4WW1A 1S9KC 3CCHB 1FFRA 1EAPA 1FZKB 4X9BA 2I24N 1TJHH 4K7PH 3MO1B 4LLVA 5HVFB 3C60C 4ERSL 4PRNA 4UIMB 3I6GB 4CMHC 5HI4C 1KIQB 4N0CC 3T4AB 5HY9A 3T3MF 3ZTNL 5CHNB 3C60B 2EECA 4HXBL 1M05B 3MRCA 3P4NB 4CMHB 4MLIA 4PJ8A 2N56A 3IU4H 4LSUH 1OTUC 2OL3B 3F12B 5KS9A 2J1KA 5CAYB 3H3KA 4IOFC 5F7KC 2A6KB 1M4KA 3N1PC 1F90H 1VESA 4OCYL 3CVHA 1H3WM 4MA3B 2RAMA 2NY6C 2CIKB 4XNMB 1F58H 1NGWA 3GJFB 4M5YL 3PQYA 4X83A 1YNLL 3U4BL 3V0VB 3IXTA 4M5ZL 1KTDB 3HTLX 5KVFH 2NLJB 4M9OA 5GSRA 4ZPTB 5KSVA 5BS0E 3G5XB 2X9YA 4ORGA 5D2LB 4OIAA 4YK4C 4HKXB 5LJYH 2NXZD 3OSKA 1KELL 2IH1B 5J4MA 4U1LB 1ZHNB 2BP3A 2AVGA 4L3ED 4HIHA 2BSRB 4YK4B 4LKXA 4MD0B 1OM3L 3TESA 5BS0B 5D7IE 1CFQA 1ZSDB 1ZVHA 3K2UL 1U8KA 2EYRA 1Q0XL 1EXUB 4MNQD 1PLGL 5EU6A 4MQXD 3GHBH 2MQ0A 1MQ8A 4X6CF 4M43L 5IVZB 1EAJA 5TH2A 1UWGH 2YEZA 2Z31C 4MA7H 4WWKA 4MXVF 3ARTA 3ZYJA 1XGRA 3UYRH 4Y4FA 3T2NH 5EOQL 2BNUB 3WXVL 1QKZH 1BF2A 1KJ2L 5IQ9A 4A6YH 2Z31B 4H26B 4NNPL 4C55A 1BVLB 3IKCB 4NWUL 3UO1L 1K2DB 2BVOB 3STZB 4X7EC 1U41A 1ACYL 5I2IB 2HT3D 3PL6C 5INCA 5HPOA 1C8PA 4RRPG 4I0CC 5C0EA 4N8VA 2XA8L 1B0GB 3UTTD 1P7QD 3RWFB 1FYTB 5I66B 1KBGH 3PL6B 4ZOBA 2ED8A 1P4IL 1E27A 3DHMA 1AE6L 4BFGA 3NVQA 3KPSE 1HXYB 1T22A 5A43C 5J11B 1CU4L 1T03L 1U8OA 1J0ZA 2V9TA 2DQEL 1V05A 3OR7A 4UNVA 5IFHH 1FZMB 1LMKA 4MNHB 4NQCD 5FYKE 3MNZA 4OCXL 1B3JA 3KPSB 1VGEL 5C0GB 1DQJB 3QUML 4HJGB 3LHPH 1YEJL 4K23H 4QRRB 3VXPA 4OFYA 1NCUA 4M7KL 1MFBL 4CADB 4AMKH 2E27L 3KYOB 3MLVH 4YEFA 2MHAA 2SEBA 3BPNC 3G5YB 3O45B 3VH8G 2CKBB 4GQPH 4XPHL 4K94L 4ENED 3W0WD 2XOTA 3HI6H 3BPNB 2WAHA 4XMLL 3BUYB 3S3JA 2DLGA 1ZTXH 1IGYB 3OV6A 5DHYB 4L4TD 3TNNB 4QYOB 4WUKL 3M1BB 1W0WB 3HZVA 5GGVH 4CGTA 1JN6B 4K3JL 2K1MA 4LPUA 2FR4B 4WHCA 4HDIA 1OGAA 2VLKE 5DJYA 5IF0B 4C4KT 3HFML 1LP9E 3DMMA 3DIFA 5H94B 3BH9A 3STLB 1Z9SA 3ZKSD 5ECJE 3GMOA 4UDUB 4GXUM 1J8KA 3MJGX 1I9JH 1GIGH 2GY5A 1CVRA 1G7MB 3HA0A 4LSSL 2NXYD 1CLOL 2VIRB 2CPCA 4L1HA 1LP9B 3SE3A 1VHPA 4OF5A 4AEEA 4JDZB 5CCKL 5D7KE 1U8MA 3V79C 5TDOA 4MQTB 5IJVA 1F3JA 1NC2A 3B6SB 5L0QC 1R5IA 1K5NA 1CS6A 5MI0B 1SVZA 1NJ9B 3GSNL 4ZFGL 2AXGA 4KROD 1I1FB 3KXFA 5DK2B 5FUOL 5A16B 5L0QB 3C5ZD 5C07A 3VGEA 5T3XL 5FV1L 1RHFA 5C0DA 1KCLA 1PYWA 5BRZA 3TWCH 3QG7L 3WNLA 1JK8B 3GSVB 4OLXL 1PFCA 1UWXK 5TPWH 1A6AA 4LIQE 3ARGA 4X7TA 1SYVB 3QUZD 4HX1A 5F71A 4K2UL 2BXZA 4YH6A 3ESUF 1P2CA 5DD0H 3IVKA 1C7SA 1D5IL 2AV1B 4J3SA 3RBGA 4H1LG 4BSWB 3UTPE 1JWMA 1UACL 2AJYL 1O7VA 1MCFA 4HJ0C 4R2GC 3FHQA 3IS1X 3FO1B 1MJUH 5T1LA 3EGSB 3TVMC 3Q5OA 4WI2A 2CDGB 2NY3C 2ICWA 1VENA 2IAND 3ARBD 4R2GB 2ICEB 2PYFB 1AO7E 4N90E 2IJ0C 4XBEL 1X5AA 3PJSB 5IESH 3TVMB 4Y4HD 3TO4C 4K8RD 3FMGH 3VFVA 4YIQA 1MFDH 5D2NA 1FZOA 1A1OB 5CIPB 1JGVL 2W0PA 3TO4B 4O4YL 3N1GC 3D3VA 3K2MC 4XAKE 4NQEE 3EIFA 5IBLD 3FQWA 4JKPH 1YEHL 2DL2A 3DETD 5T1MB 1NGYA 2EDRA 3BVNB 3BRFA 4JQVA 3VRIB 4YXHL 4YHYC 2VXVL 3P4OA 4NQEB 5FV2A 5F7HA 3FN0H 2K3TA 3MLSL 1K4CB 2X4UB 2D3VA 2WUCH 5DJCA 2PKDA 2ZCLL 5GISH 4YHYB 4POYA 1Q38A 1VPOL 4IBLT 4F7EA 4XP1L 1WFOA 2XZCH 1IAOA 4GAYB 3VFUB 4JPIB 2X4NA 3QO0A 4JN2B 4AIOA 2F5BH 3OHXB 5J3HC 4EKXA 3KGRA 3L6FB 4NCC1 2EYTB 3DROB 5E1AB 1R5WB 4RWYL 1FFOB 5AYUL 2HMIC 3NPSB 4HV8B 5CFHA 3QIUA 4FQCL 2GSIB 4OD1L 5T5NF 5DVOA 2BSED 3NH7L 4Y4KC 3W11C 1QRNE 1FNSL 5DO2C 4I2XA 2YPVH 3DO7B 4X6EB 4RISL 4NKMB 5KVGL 4Y4KB 1VKXB 1XCTA 3ZT7A 3K7UA 4QRSB 4Y16D 3WIHA 2HTLD 4FQXA 4XVJH 5T5FL 4B41A 4W4NA 4XVUC 4ETQB 3HC3H 1N5AB 1MUJA 4GXUN 5SX4I 3RUGA 3PV6A 2BCKB 1HDMB 3CFJB 3LY6A 1EERB 1XIWC 1ZLVK 4GAFB 3UPRA 3DNKA 4FHBD 3JVGC 3FT3A 3PWJB 2NY7L 4FQQB 1KLGA 1NH6A 4XNXH 4MJ6A 4S0SD 3PWVA 1CXLA 1S7XA 1ZE3C 2VZSA 3EO0A 1CLCA 3C6LA 5BXFA 1TJGH 2ZKHH 4M48H 4NNYB 1T6VN 2QR0B 2C26A 3KPQB 3BKCL 5DJXB 4D9RE 3TFKD 4JAMB 5C09D 1X6LA 1HH9A 1UM5H 4OM1L 5IR1B 2B8OT 4GKNA 3MLWL 1WEJH 5T1KA 2IAMA 1T7VA 2FIRT 2N7BA 5HD8D 5I1EH 4XP5L 1S7TA 3F58L 4QKXB 3WEXB 5IK3B 3HNTL 2LV4A 1U91A 3WD5H 3EAKA 4E5XA 1KIRA 5HYSA 5ISZE 4IDJH 4U0RC 5EA0L 3VXSA 4TNVK 1SBSL 5J6HB 1ZHKB 4YBQD 1ROWA 5IBUG 4U0RB 4KDTC 4DUVA 1CGSH 1YDPB 1EX0A 3G5VA 5ISZB 3BRDA 4OLWH 5TE6H 1WBZB 4HZLA 3TA3A 3UJIH 1FGNH 3S4SA 4EI6A 3ZZ1A 1YECH 1N2RA 1KSRA 5INDB 4XPGH 4HIIA 5HDBE 1M7IA 1BJ1J 5C2BH 1OAZH 1JRHL 4JFEA 2EO9A 3IF1A 4DGVL 2ATPA 1S7QB 1ZANH 2AJVL 4B7LA 5JPNA 4G6FD 1I9IL 7FABH 1DQMH 5FECB 4W68A 4Y5VA 3CZJA 3Q6FA 5DGRA 4NFCA 3BN3B 4OZIE 4QOKA 3WIFB 1AGCA 1HQ4A 1OY3B 5T33L 1PX3A 1A7BA 2IPUK 3SE9H 2MNUA 5EOCL 1JHTA 3BZDA 2F5AL 3OGCA 4P59L 3ZT5A 1LEIB 5D7IF 5HJ3A 4I3GA 4GG6E 1LO5B 5C3LD 1TJIH 1F02I 4XPFH 4BZ2H 3ILPA 1K8IB 4U1NB 4ODTL 1U3JA 3M17B 2NY4D 3C08H 3VRLF 2B1HH 4GG6B 4RDQG 5D7SH 2BVEA 1OP5H 3QFDA 1CICA 5GGSB 5DMGC 1W8OA 3H8NA 5FUCC 1L0QA 2ZOKA 1LWRA 3IETB 4YDVB 2W9DL 1AKJB 4KVNH 5FA4A 4PJEA 3TIEA 5IMKA 1MIML 1IEAB 3IAQA 4YDIH 2ICWJ 1MCJA 2E7LC 1FJ1B 1FORL 4OZ4B 2GUOB 4HKBB 2YSSA 3QFJE 3K4AA 2FHBA 2IPKB 5ETUA 2YOCA 5TQ2L 1QA9B 3U7WL 2XG5A 2AEWA 2ZNWA 1FFQA 4JFYA 3QUYD 2G9HA 3SJVD 3X13A 5D6DC 1G7IB 2XKSA 1LE5A 3V4UL 3NBNA 3O6LL 3QFJB 4JPKH 5IWLC 5C0AA 3VWJD 3G5ZA 3B9VA 2C7UA 3UZQA 2G60L 4DQOL 5D7JA 3QQ3B 1E6OH 2YK1L 1VFOA 2R1XA 2GCYA 2DN7A 4RX4D 2ORBL 1YMMD 1RJYA 2H3NB 3VW3L 3IXAB 3GBML 3D6GA 3O11A 3TN0C 3VXME 1F4WL 4GFTB 4ONFH 5K59F 4N8CL 1TETH 4XCFL 1FL3A 1A3LH 3TN0B 1CFNA 3T0EA 3HZYA 3TBYA 3B9EA 4KI1A 4R26H 5KSAA 4F9LA 2QKIA 2CUMA 5AD0B 4R4NC 1EO7A 2FX7L 2BVUA 3I6KB 1NLBH 2XACC 1W8NA 4YC2C 1ZGLB 3MCG1 1FVDB 3MRGB 4AG4L 1G7PB 1BBJB 3VFMB 3ARUA 4YC2B 4FQIH 2CGRL 3IDXH 2FIKA 5DDHB 3GB7B 4O2EB 2HTKC 4KZEH 4NN7C 3RTQA 3ZO0A 4U6YA 1Z9MA 1KPRA 1JPGA 3MOQA 1FH5L 5J9PA 3A6OA 3TT1L 3NIFE 4NN7B 3FHAA 1MI5E 3KPRE 4LLQB 2CK2A 3HG1A 3BP7A 1IGFL 1U8HA 1ZVSA 12E8L 4TUOA 2ZCHH 4YWGH 1ETZB 3FO2A 4C56A 1F6AB 2IMMA 2PF6A 1MI5B 2Z35A 3O3BA 4LCCA 4YFLI 4WW1B 1QBLL 3QXDA 1EAPB 2P5WA 4OGYH 4TTDC 1O5DT 5D96B 3EJJX 4TQEH 2E3VA 4LLVB 4OZFH 4PRNB 3TYGL 1UJ3C 5KS9E 5SX5K 1Z9LA 4PJ8C 3QDGD 4Q2ZA 5M95B 3HC4L 4LDLB 5SWQA 5HY9B 3MNWA 5IW1A 2GI7A 3WKNA 2QSVA 4M1GH 3MRCB 1UJ3B 3NACH 4F57H 3QI9A 3O9WD 5D4QA 4J6RL 2X7LA 1I3GL 4PJ8B 2NW2A 5KS9B 3DI2B 3BP6A 3FQTA 3PQYE 3ARQA 2MCPH 3MLUH 1T5XA 3MRFA 3CVHB 4LQ1A 2A2QT 4DGYH 4DGIL 1NGWB 4S1RL 2VDKL 4V1DD 2I07A 1TCRA 3PQYB 3TZVD 3QHZL 2A6JA 2MKLC 3IXTB 1MNUH 4I9WD 1P69B 2IQ9L 2VZ3A 3WCYA 4PJAA 3LN5A 5GSRB 3UTSE 4ZDHA 4LCIL 4ORGB 3AB0C 2R2HA 2X40A 3B9DA 3CVIL 3FB7A 4JRXE 5IROA 4XTRC 4HIHB 3QYCA 2DMCA 2DQJH 2X2YA 4LKXB 4PG9A 4Z95L 5DEFA 1CFQB 3CMOH 3S37X 3WFDL 1U8KB 2EYRB 5GGUA 4M7LL 4WWKC 5KVEH 5EU6B 4I3SL 4GT7A 1BM3H 3GIVA 3RWCA 4HG4J 4Y4FC 1MCWW 4NOFA 3GUTA 2H2SC 5TH2B 2IFFL 2AJUL 4WWKB 2R0ZH 4X7DC 1J1XL 1XGRB 3JWOC 4Y4FB 1FPTH 1YEDB 5IQ9B 2AS5M 5KAQG 4XC1L 4JM4L 5IEKA 5CBAA 1BPVA 3C60D 4AT6A 5INCB 4PRAA 5FYKU 5HI4D 5C0EB 4N8VB 4HF5H 4N0CD 1D6VH 2CRIA 1L7TH 3E8UL 3DTXA 1E27B 1BBDL 3KPNA 1NCNA 2R4SL 1OTUD 1BGXH 2MJWA 3MNVA 1T22B 2W0KA 4NSKA 2YHGA 1J87A 4IOFD 5ITFB 3OR7B 3CPLA 1HZHH 3MLRL 3P2TA 2EDLA 3E6FA 4P48A 1NMAH 3MBXL 3MNZB 3MRQA 1MCQA 5D5MA 2HFFA 4JCLA 4TOYH 3VXPB 1NCAH 3QCTL 3FQUA 1FBIH 2J6EL 1FGVH 1SEBA 2MHAB 15C8L 4HD9A 3WBDA 2SEBB 5K9JL 3TYFA 1YY8A 5BS0D 4KK8C 4YHKL 4Q6IA 4LSPL 1DJSA 4JDTH 5BVPH 3OJDA 1WVZA 4IJ3C 3EOBA 3DMMC 3HZVB 1EHLL 4OQ1A 4OF0A 4IJ3B 4HDIB 1OGAB 3QHTC 2APVA 2Z31D 3DIFB 3DMMB 1RUAH 2F54A 2DDQL 3BH9B 3JUZA 4WI7A 3GMOB 1JHKL 4JLRA 5EORL 2DL9A 1JCKA 4RFOH 3SE3C 3NZHH 4NWTL 1ZAGA 4PRHA 4HJJL 5ITBL 5I30H 3KXFE 3N1MC 4OGAC 1FYTD 5IJKA 4IM8A 3PL6D 5C07E 1U8MB 3ZKNC 4QTIH 3R1GH 5TDOB 3BJLA 1F3JB 5IJVB 1NC2B 1EZVX 3AY4A 1D5MA 1YYMH 1R5IB 1K5NB 5C0BA 3TBWA 5BRZE 5KG9A 3QQ9C 2A1WH 2AXGB 6FABL 3KXFB 4YLQT 2VLRE 5HDBF 3THML 3V7AE 3WFCL 5C07B 1ZLSL 4PJ9A 2P45B 3GKWL 1CK0L 4TPRH 5C0DB 4LNVA 1JMZA 3MLYH 3KPSD 4Z7UA 1PYWB 3SE8L 5BRZB 3ARGC 5K9OA 4ZFFA 1UJTA 2BJMH 1NAKL 1WZLA 2VLRB 2Y06H 1UEYA 4QRRD 5IHLB 1CL7H 1AY1L 3VGFA 1A6AB 3ARYA 4OZIF 3ARGB 1A4JA 2GT9A 4X7TB 4HX1B 1HN1A 4P9ML 2D9QB 1IC7H 4O5LL 3TO2A 3JV4A 5J7CC 1YC8A 1P2CB 4LHQB 1ONQA 2K7QA 3EO9L 5SV4A 3IVKB 1KTRL 4NRXA 2XZQH 1JWMB 5I15H 3SQOL 3K8KA 5T1LB 5IMMA 5D2NE 2HAZA 1R5VA 3MUY1 2ICWB 3KNBA 1QLFA 5E08H 1PX4A 3D3VE 4NT6A 5D2NC 5DFVC 3VFVB 5AZEL 4YIQB 4APQA 4QHLA 5D2NB 1FZOB 5A1AA 4QXWA 4QXUH 3VJ6A 3KAAA 3P4LA 2DLEA 3D3VB 1QFWL 2WWMC 3U0PA 4JGMA 4JQVC 3NN8A 5DZLA 3FQWB 5LQBL 4U7MA 1NGYB 2BHYA 4Y5XA 3FFCA 4Y5YC 2HYMA 4U4BA 2Y7QA 3P4OB 3I2CL 4DK6A 1MWAA 4RMRA 1F4XH 4OT1L 4Y5YB 4XVSL 5DJCB 5F96L 2GK0A 4N5EC 1REIA 1I8KA 2DLHA 3C8HA 5TFSH 1F3DH 3T0BA 4BKLA 1VCAA 3QCUL 4F7EB 5CP7A 5D1ZA 4RMQA 2O5XL 4YX2L 1N4XL 3CLFL 1IAOB 4AZ8A 2X4NB 3H9ZA 3QO0B 4GAJL 1KCSL 2V7NA 4HFUH 32C2A 3QIUC 4JGJA 4OLZH 4R6UA 3UTOA 1XR8A 5DJ6A 4I2XE 1IC4L 3WXWH 5GS1A 3LMJL 5EBLB 4HCRH 4KV5E 3QIUB 5MP6L 4ONGH 4KJYA 4XMKL 3LS5H 4LPXA 2AJ3A 5JORA 3IRPX 1I4FA 3RX5A 4OLYH 4FQXC 4EXPX 5I17A 4P9HH 4I2XB 3RUGE 3T04D 4HJ0D 4R2GD 1XCTB 3DX7A 5FCUH 4GXVH 3UTPD 1ZK9A 2HT4C 1S5HA 3TVMD 4FQXB 5F44A 4KI5C 1EMTH 4OZFG 1MUJB 1PG7W 3RUGB 1BZQK 3PV6B 3TO4D 2DLFH 4N90D 3UPRB 5FB8A 2OL3H 1W72H 3FT3B 5C0FA 3F5WA 1TTGA 3OR6A 3T0DA 1KLGB 3C6LC 5I1JL 3GNMH 1E4JA 4MJ6B 1AD0A 4J1UA 3PWVB 1BOYA 1WTLA 3EO0B 3C6LB 4NQED 4PGEA 5BXFB 3UTQA 2WMPA 1NCDL 3BYYA 4MAUL 4IRZH 5FYLE 5FOBA 2IAMC 4IMLB 4AQ1B 2BOCA 3VDAA 4Z7NF 1HH9B 1NBQA 1JYNA 4GKNB 2IAMB 1QSVA 4ODBD 5DR5H 3UTZA 3O2DA 4U0QB 1S7TB 2F9BT 4QRUA 1GGCH 3QWOA 1I1RA 1U91B 4KHXH 2GQHA 3I84A 4I0KA 1KIRB 4P2CG 4E5XB 5HYSB 5GHWH 3VXSB 4XP4H 4R8WL 2R39A 5D71H 2AW2A 2CJUH 1T0PB 1BP3B 5J3HD 1NBVH 3BOVA 3S35L 3TA3C 2V5SA 3RDTA 3G5VB 3SKJL 1MHEA 4HS6A 4JFEE 4X6BA 3VI4F 4NBXB 2DMBA 2QADC 4HZLB 3TA3B 5TF0A 4G6KL 3S4SB 4EI6B 4NQDA 3VA2C 4Y4KD 4PTUA 3W11D 2FNBA 4X4MA 1JGUH 1N2RB 2BDNH 4WHYH 1DEEA 4HC1L 3DXAA 5DO2D 4HIIB 3U6RA 3ECBA 2QADB 1M7IB 4HFWB 3N1FC 2IQAB 4ZFZA 4JFEB 3O41A 5BMFL 2Q20A 1RUKH 3IF1B 3MROA 4QOKE 2B4CL 9CGTA 5L8JB 2ATPB 3EJZC 5BVJA 1B0RA 4JQIL 4XVUD 2E6QA 2Z8RA 3IB4A 1NAMA 4Y5VB 5C0CA 2MCG1 3Q6FB 3BZFA 3LEYL 4QOKB 1AGCB 1LO2L 1HQ4B 3IDJA 1D5BA 2V6HA 3HNVL 1KULA 1JHTB 3MLTA 3OGCB 3TBVA 1PZUB 3E6HA 4OZGA 5IGXH 4GRWH 1WZKA 4NQVA 5HJ3B 4EUPB 4HXAH 4UTBL 2BNRA 2FZ3B 4Z0BH 4J3XA 35C8H 2YD6A 3WSQH 3R06A 3AU1A 3JUYA 3ILPB 5K9QG 1CICC 1MFCL 4ZUWA 1TIUA 4AIXA 5EZLA 3SDXF 2DQCL 1AD9A 4HWBL 1AR1C 3QFDB 1CICB 3CDGA 1ZLUK 1GZPA 4XNUL 2A9MH 2ZOKB 4ODVL 2EXYC 4G8EA 5FA4B 3D18A 4PJEB 3TIEB 5IMKB 5ISZD 8FABA 3QO1A 2D0GA 3DVGA 2XT1B 2Q8AH 2YSSB 5ETUB 1JJUA 1OARL 5HDLA 2JB5L 5AAWA 1Z5LA 2CDFA 4FFYL 3T8XA 4JFOA 4JFYB 2G9HB 3X13B 1SY6L 2I5YH 1JGLL 4NM8L 1LE5B 3RGHA 1RZJL 4X6FA 1IFHH 4R4FH 5BV7L 5C0AB 5D7JC 2CK0L 2AQ2A 3G5ZB 5CJXA 4DKEL 1YEKL 3C5JA 2V5MA 2F53E 3Q6GL 5D7JB 1BEYH 5FOJA 2GCYB 5ALBH 1SEQL 4J7RA 3MJ9A 4QRPE 3T0EE 1RJYB 3P73A 5DJ2A 3I75A 2VSCA 5JHDA 2F53B 4ZFOL 3ZTJG 3O11B 3T0EC 3HMWL 1B90A 4Q0XH 1MSPA 3VGBA 5C70A 5KSAC 4UAOC 4JR9H 4ZTPH 4F9LC 2GJ6E 3B5TA 3HPLA 1FL3B 1CFNB 1FDLL 3T0EB 4M6MH 1RFDL 5JZ7C 5EO9A 3HZYB 3TBYB 2YD7A 4RSVA 3WFHA 1T0MA 5KSAB 3EUUA 3MV01 4OCWL 4UAOB 5LWYL 1JNHA 4YHIA 3H9SA 1NQBA 2BXYA 4ZUVA 5HHXH 2AK4A 1C16A 5DXWA 2FX8H 1OT1A 1H5BA 1X5FA 4KXZH 3K3QA 2DD8H 3KPTA 1AKJD 4K9EH 2FIKB 4M6OL 5DMGD 3HG1E 3RTQB 4U6YB 3OAYH 1KPRB 4C56E 3WNNA 3IJSA 1JPGB 1K6QH 5J9PB 2P7TA 3WHE1 4BQCA 4BZ1H 4MA1C 5E70A 4LGRB 4QNPE 3LSOA 1RUPH 3HG1B 3OXSA 3A0OA 1U8HB 1ZVSB 4OSUH 4TUOB 5EIIA 4LCCC 3FO2B 1I9RL 1CE6A 4C56B 4Q7DA 2X4OA 2IFGA 4MA1B 3FRPG 3QFJD 1P53A 2Z35B 1PJ9A 3O3BB 4LCCB 1RIUL 4Y8AA 5K9QI 4ZS6C 3QXDB 2ESVE 2EE9A 4M6NH 4R7NB 3W2DL 1NGPL 1DBAH 2P5WB 5IMLA 3QNZA 4ZPVA 5FA3A 2YZ1A 4AQOA 3PABA 5DQDL 4GRWE 3QI9C 4NYLA 3MXWL 3HNSH 2PNDA 3UMTA 4Q2ZB 2NY1C 4I18A 5SWQB 2ESVB 3QDHA 4JHAL 3MNWB 5IW1B 4KTYA 5FXCH 2AK1L 3GFUA 3OB8A 4GKOA 3S36H 3QI9B 1KCVH 2X7LB 2NW2B 3BO8A 2NY1B 4JFXA 4R3SB 3CLEH 3P77A 5E8OA 3BP6B 3FQTB 3TN0D 1CQKA 3EYSL 2EDHA 3VMOA 5GGTH 1T5XB 3MRFB 3C6SA 4PJAE 4QCIA 4O58H 4YE4H 1HH6A 4Z9KB 4JFFE 2I07B 4I3RL 3G08A 1TCRB 3RIAF 2A6JB 1GC1H 3P40A 1EA9C 1WT5A 4PJAB 3LN5B 5EN2A 4HKJA 3I02A 4ZDHB 5IROC 4Y88A 5MEQA 1Q72L 4HGMA 2R0WL 4X9FA 2R2HB 3O6FA 1VSCA 5LAXA 4LF3A 2HTKD 3A6BH 1A7NH 3FB7B 2D7PA 3I9GL 3G6JA 1DBBL 1NGZA 4PG9B 2X9WA 1X5JA 4Y7MA 5DEFB 5I19L 2EH8L 1IQWL 5GGUB 4D0CA 3RQ3A 1T3FA 1WZ1L 1INEH 3B5HA 1MI5D 3GIVB 3RWCB 2IEPA 3GUTB 4LEXH 3SDAA 3OKKA 1LK3L 3VXUA 3EFDL 2FX9H 1YNTA 2Y23A 2Q3ZA 1JTPA 2YMXH 4WY7L 3GSXA 3AS1A 4LVHC 4JVPA 1H3VA 1EBPA 3JV0A 4TTDD 5IEKB 5CBAB 4P2QA 5FUZL 3BIBX 4LVHB 2VISA 3EZJB 4AT6B 2D7TH 4TRPL 4PRAB 1RPQA 3CXDL 1ZT1A 1CDYA 1OD9A 4PJ8D 2COQA 1NFKA 3ME0A 2HT2C 4NKOA 3PWUA 1G0YR 4RFNC 3NFSL 3RU8H 3DTXB 3P9WB 2X70A 2HP4A 1AGFA 3KPNB 1F97A 3MNVB 4NSKB 4RFNB 3O3DA 2VL4A 4I5BA 3W39A 4H20L 3CPLB 3PQYD 1QQDA 1DL7L 3E6FB 3WO4C 4QXGL 2CR3A 2KQNA 1S9VA 1NEZG 3U1SH 4TUKH 3MRQB 4YPJA 5D5MB 3UZEA 1T7WA 3U48A 2HFFB 3QEQE 3WO4B 3FQUB 3N9GH 4XVTH 5F97E 1ZWIA 4PGBA 4PJXF 4ZOAA 1XMWA 4GAGH 3MSPA 5B21A 4Q6IC 1BMGA 3TYFB 1YY8B 4PD4K 2BY0A