4PB0L

Structure of the fab fragment of the anti-francisella tularensis groel antibody ab53
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
216
Chain Sequence
DVVMTQSPSSLSVTIGQPASISCKSSQSLLDSDGGTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGAHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ab53 heavy chain
publication title B-Cell Epitopes in GroEL of Francisella tularensis.
pubmed doi rcsb
total genus 44
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2014-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0L01
3MFGB 5ENWB 2YUVA 1DEEA 3WS3A 1UCBH 2Y9RT 4DEPB 2ED9A 3DETC 5K93A 1ZGLA 2Q8BH 1F3DH 3B9AA 1CDHA 5EU4B 1RJLA 4XP9L 3HE6A 1BEYL 3BUYA 3QG6B 4RQQB 3VGAB 3AB0C 4TVPE 4OZHB 2WQ8A 1QA9B 5ESQA 1QLFB 1NGPL 4L4TA 1BMGA 3P30L 5GJSL 4G43A 3WE6B 3HG1E 4M1GH 4Y0GA 3IJHA 1MVUB 3MOQA 1OCWL 5T1DH 2XN9D 1JHLL 4P2QA 5A2LH 1LE5A 3AY4A 4DTGL 4BYHA 3RWGB 3MROB 3TBYB 1MJ7L 2EDDA 4O9HH 1ACZA 4N0CD 4PBWD 1QZ1A 4FRWA 4Y19E 2NY2B 2CD0A 3C6LD 3EOAA 1R3KA 3SGEH 4EXKA 4FQLH 3HG1A 4X7CC 1FLRL 1BBDH 3WHXB 1DDHB 3LKNA 3WEXB 5GS1B 4LSTL 2NXZD 3SKNA 4JZJC 3PIQB 1UM4H 4QHUA 4Y19A 2GK2A 5DHYB 4Y4HD 1I85A 4QF1A 3S37H 2QV2A 3WUWA 4FABL 1MCWM 1ZHBB 3BN3B 5ELIA 1YNTA 5C92A 2CUHA 4R7NA 4MD5A 3MLUL 4TUOB 3M1BA 3BOVA 3MRRB 1MFBL 4CUCA 3FN9A 5E2VH 4YE4L 2C1OA 5IB3B 4OZHF 3K4AA 1TQCB 1TPXB 2IF7A 4KVNH 2EXWC 1ES0B 1IEBB 3CFCL 4WDIA 5CILH 1FYTB 4KROB 2X42A 3BZ4A 1F3DJ 4X9FA 1FYHB 3KLHC 2Z9TA 5J89A 5IROC 4KDTA 1GC1C 5J12C 3T2PA 4L8SC 3S35X 4HEME 4NCC1 5L8LB 1MJJB 3HPLA 3MBXH 1OM3H 3QH3B 4K8RC 3BGFB 5A40E 1S9XA 5IMOB 3H0TA 1RZ8B 4NN6B 3AVEA 1ONQB 2AK4B 3X13A 1KBGH 2G9HB 2SEBA 4F7EB 4MJIB 4NN7B 1OTSC 4UQ3A 4MXWH 4R8WL 1EBAA 5DURD 3T2OA 4XVUD 3ARBC 2IH3A 3RWIA 3LHPH 3UPCA 4PJGE 4IOIA 5D7KE 1L7TH 1KN2L 5FGSA 4OD2A 2WINB 1S7VB 5HHPB 1S8DB 4W6WB 1T83A 1HHGA 2X5PA 4K3EH 4EJ1C 5C7XL 4N90D 2EYTB 3QWRD 5EBMA 2DJUA 1FBIH 4QCIB 3MRQB 5DO2C 4UB0L 1XCQB 1CS6A 1MQ8A 5FHBH 3SBWA 3RX7A 4PJGA 4MX7A 3UJTL 3VCLA 1MCFA 5HI3C 3WMSA 4X4YA 2X4TB 4OZ4B 2COQA 3MUGB 1D3CA 3CZJA 1FDLL 3WFHA 5TE4L 4MD0A 4M3KB 3RPIA 3D9AL 3EIFA 5J6HB 1CFSB 2GAZB 2Z31A 4EN3A 2XV6B 3MRLB 2FD6L 4KV5F 1XMWA 1FSKB 5TE7H 1PBYA 1N4XH 3QIUC 4NRYA 3QPQC 1FV1B 2OI9C 3VD5A 2VUYA 3OKYA 4QRRB 2DQJL 1VB9A 3HAEA 1KIQB 3V5HA 1JUFB 4GAYA 4K3HA 1EBPA 3O11A 4AIZA 5MEND 4MJ2A 1PZ5B 1J0YA 1U3HC 5KG9B 1H15A 4Y5YA 4IMLB 3QDMB 4XXCC 4S0SD 3JV4B 3QHZH 1IZJA 4WI3A 3RWHB 3WIFB 5L8KB 2CR6A 4WFHE 2DQHH 4QRPE 3EYFA 4J4PA 1GSMA 5I75B 1LEKB 2XTJD 3FO0H 3BXNB 5FM5O 3BQUC 5EBWB 1I8MA 2I27N 2YBRB 2VLME 4PJAE 3TESA 3UTSB 1WBYB 5DVOA 3QHFH 2Z93A 3FO2A 1A1NA 2DWEA 1T1WB 4AMKH 3JWDL 2CRIA 4XPHL 4K8RH 4BKLA 1WAAE 3BW9A 3ZDXF 3CFEA 1GGBH 4OM0L 1PY4A 4HWBL 5F7DB 3T65B 1TQBC 1D5ZB 3KJ6H 4PJAA 2OJZH 3BN9C 2RBLA 3IDGA 4U1JA 2VH5H 3I50H 3KWWA 4BQBA 1CK0H 1PX4A 4JQIL 1MH5A 4KPHH 2EDQA 5HYJD 5IWLC 1B0RB 3GMQB 1VFOA 4YBHA 1I9EA 5IJVB 1LP9B 1AR2A 4XCYB 5ILTL 4AEHL 3F12A 1IEAB 4ZUSB 4JVPA 4C56E 4L29A 2H6PB 4MDIA 2DJ4A 5JHDE 5MHSD 1MCNA 3P77A 4S1SH 4YXHL 5JZ7C 5FCUL 2WANA 3LEYL 1MVFA 1G7MA 1NAMH 1UJ3C 1KJ2A 4MCZB 4G5ZH 4GLRI 1JZ7A 1NEZB 4JFHD 3SDAD 2BY1A 3VI4F 1IAIM 3FZUC 1JPGA 2ICWJ 3DYMA 3QUZD 3RQ3A 3FQTA 2R2HB 1FNAA 5T5FL 5HHMD 4C56A 4LRNL 1UB6A 1K8IA 2B7DT 5JHDA 2AXFB 3FO9A 3JV6A 4NQDB 4QOKB 1KCUH 1ZLVK 1ZGLM 2EH7H 4KKNA 4POUB 4YZFE 2BNQE 4NWUH 3TYGL 4PLNC 5DZOA 2EYSB 3AS0A 2F5AH 4NQCE 4PLJC 1KC5L 2VN4A 2OX5A 4UUJB 4U1HA 2VXQH 5DJXA 1UYWH 3UBXB 3CDGA 3I02A 1ADQH 5GRVK 2RR3A 4IRSC 5MERB 4F7CB 4PRIB 2ESVB 1I3RB 2BNQA 3G6AA 5INCA 2OQJA 5JXAL 1PQZB 4N1EA 4HUKB 3VGGA 2DKSA 3DX6A 2ZWLT 2FATL 4NQCA 1EFQA 1XGPB 4FN0A 3ELAT 3V6ZA 4XNUH 1WLHA 4DGVH 2BNUB 5T3XE 4FA8A 2DOCA 2NY6D 5GISL 1ZLUH 4XPAH 4H88H 4JKLA 4O02H 3RJDA 1OGTB 4ZXBC 4UV7L 1DTUA 3BDXA 1RK0B 2O93L 3P0VL 2HJFB 4MAYD 4KDWA 2X4SA 4U33A 5TFSL 1BD2D 2H32A 4UTBH 5D7LE 3RBSA 5F9JB 3FFCE 4ODWA 5ANMB 4EQ2A 2VIRB 1FZJB 3D2UB 1S7QA 3NIDE 4OCLC 4ORGA 2DYPB 1QKZH 3UTPE 1BIIB 1JPFA 3IFPA 5J6GB 2X4RA 2H8PA 2R0WH 4UDTB 1I3GH 4N9GA 3L3JB 2ZG3A 3D0LB 3PABB 5B39A 4H1LA 5A2FA 3LAFA 5D7LA 1N6QL 1KF9B 5I1KL 3FFCA 1WCBB 3ARSA 1RULH 3B2UD 4XXDA 1C08A 4MQTB 4QHMB 2JF1A 3WXVH 1M1SA 4YDIH 1RIVH 1KELH 3NCFB 4QYOB 4WJ5A 3GSWB 4PP2A 4JFXB 1DVFD 1NGYB 1OY3B 4N5EC 3MBED 2ATPB 4E5XA 4MA3B 2CRZA 2Z92A 2EDWA 3C60B 1AXIB 2A9MH 2VISA 3ZKMD 3KS0H 4WCYL 2ZUWA 3ES6B 1E6JL 4WO4A 2CIKB 3T2QA 2DB8A 1S7TB 1G7JA 3MJGX 1CLZL 3WFDH 3ARYA 3RPKA 3OXSB 1H3VA 2F8XC 1QFUL 4P3CH 3QO0A 4JFQA 2RCSH 1MJ8L 4Y4KA 4RAUA 1P7KB 4U7KA 4FQQB 5JQHC 2J8UE 3OR7A 3LMJL 3LY6A 3ZKND 3S96B 3OX8A 3RZCB 1FPTH 4H25B 1F90H 3LIZH 1IGCL 3OKOB 1KPVB 3KYKH 2H9GA 1BJ1H 2XTLA 3B9DA 3UZVB 4YFEA 5TQ2H 5EA0H 3CH1A 5D2NE 3BEVA 4OCYL 5ICZB 4G7VH 3TIEA 2R1WA 4V1DA 2J8UA 1BFVL 4ZQKA 3VFPB 4AEIL 3HZMB 4M8VA 5C0CE 4XCFH 4I48B 5FYJD 3MNVB 4ISVB 4I1NB 3L3HB 5J4MA 43CAB 3FQXB 2QHRH 1NGWB 1P1ZB 4N0CC 1RURL 2N7BA 2VDQL 4JM4H 2KL6A 3C6LC 3IGAB 5D2NA 1I1YA 1NEZG 5IB4A 5FF6A 1UB5A 2J1KA 4HKZB 4GKNB 1F8TH 1DQQA 5C0CA 3UXFA 3G6JE 5F71A 1YMHA 4HV8B 2YUXA 3PGCA 3OV6A 4NHUA 5D5MB 2YD3A 5CJXA 5M7QA 3QO1A 4DUWA 4R4FL 2NXZC 3RNKB 3O2DA 5EO9B 3JXAA 4XNZB 5EOTA 5MEQB 3WBDA 4JHWH 4NQUA 3S36H 4Y4HC 3GMPA 2CLRA 5DJAA 1FORH 1ORSA 4FQIL 1JF5A 3BE1L 2DQTH 4ODUB 3G6JA 2UYLA 5E70A 3UBXG 4X5XA 2EDFA 2G60L 4RGMB 5C6PB 4AL8H 2VDNL 4ELKA 2CH8A 4HC1A 4KZEH 4P4KD 5JMOC 1SHMA 3O2VL 3S98A 4FTVD 1BJ1J 4XNMB 5C0ND 1UWEH 5K59E 4WHTA 1P6FA 4JQXC 4UIMB 5IB1B 1QSFB 1WZ1L 4Y16D 2V5TA 3AS1A 4DCQB 3OKMA 2C5DC 1HDMA 5ALCH 2IBZX 3L3GA 4F58L 3EFFA 3U30C 4QRQA 4WWKA 1U91A 5ICYA 1GL4B 4NO3A 3VGDA 4UT7H 3ULSB 4A2LA 4XVUC 1CDYA 3BKMH 4LRIC 3RWFB 1QOKA 1AHWA 3QNZA 2C7UA 1GAFL 1NMAL 4HIEA 3GSXB 3CX2A 2B0SL 3MV8B 4HX1A 4XH2B 3FT4A 1ZS8B 3AMLA 4K7PX 1LVEA 3X12B 4QHKJ 1MFAH 5EIQA 4P48A 4D0CA 1X6NA 5AAMA 5I8OL 5I16A 4JFED 4YFDB 2FWOB 2NY7L 1TNNA 1INEL 1KB9J 1OD7A 4UOJA 1DP0A 1KPUA 3LEVL 1KACB 1U8PB 1ND0B 2P46B 2Y07L 3O6FB 2J2ZA 3RGVA 5I6XB 4LSVH 1RJYA 3X14A 1HOCB 5D6DA 4L3CB 1NBVL 2WUCH 5CIPB 3S34L 1G9ML 2BVUA 4Z7NE 4M43L 1F4HA 5HYQB 4R7DB 2HKFH 3GZKA 2CDGA 4GRLB 1A2YB 2Q8AH 3QUXA 1EPFA 1HXMA 4HWEH 3DHMA 3NAAL 1KB5H 1OAQL 3E8UH 5F9OH 5I1HL 1QFWH 4G8GB 1MUJB 1UM6H 2FH8A 5DMGD 2IQAB 1WEJH 2E27H 1ZXQA 5KSVB 2A6KA 3FB5B 2W60A 3PWJB 4CW1A 2J4WH 5GS0L 2XTJC 4CMMA 4XP9H 3VGHA 5BV7C 1JHKH 5BVPH 4U0RC 1AGBA 2R0KH 3C2AL 2ENYA 3OKLB 3GB7A 1FC2D 4ZUWB 2NY4B 4PD4K 2B5IC 3MRMA 5J8OA 1SBBA 3FRPG 4EDWL 2R1YA 3PP4L 5GJSH 3VXOB 4G8IA 4NO5A 4PTUB 4XNQA 1PSKL 2NX5D 2DQDH 1HHHA 3IFNL 3O4LB 1OCWH 5I0ZA 3TJEL 1A6PA 1JHLH 1D5IH 2A38A 3ZHLA 2OR9L 3A6CH 2I9LB 4XHQA 4M1DL 1MJ7H 4P2CG 1U6AH 5KS9F 3EOBB 1T1XA 2AJXL 3IETB 3M17A 3MX0A 1UXSA 3QEQD 1DUYA 2W9LA 3GNMH 1NCDH 4HH9B 1AGDB 1IAMA 4R90L 1CXEA 1CLOH 4LSTH 3FAWA 5CJ8A 4WU7B 5A2JH 1EEZA 5FYKD 4X9IA 3NA9L 2GJ6B 3SDAC 4YGVA 5HYEA 1P84K 3S4SB 3VFUA 5KVGL 3DO3A 4NNPL 4XX1E 3QUZC 2ADJA 2JJVA 2P45B 1SEQH 4KTDH 5AG8A 1A22B 2DMBA 5F1NB 4I9WE 5E9DD 3EBAA 3O6KL 1GCFA 2NMSA 3NH7H 5HI5D 3EJZD 4S1RL 3P73A 3TO4B 1CGXA 1FRGH 3RJQB 5GS0D 2V9TA 3D0VB 1TZGL 3CFCH 4LKXA 1JN6A 4WI8A 1VHPA 1X5LA 2LU7A 3HZVB 3K4ZA 4HWZB 2H26B 3AROA 3I6GA 1MFCH 2ARJA 5I30L 3F5WA 5IMMB 3NCBB 5DS8A 3FOMB 3O8XA 3ZDZF 1CTOA 1I1FA 3KG5A 5HGDB 3HI5H 3IRPX 1MJUL 3JWDC 4OJFL 4LASL 2N1KA 1H9VA 1LEIA 3FAXA 3MLTB 4OCSH 3BH8A 3QUMB 1RZJC 4HQQL 1ZT4A 4P9ML 5D1QD 5JIHA 4OLXL 4U1MB 5DQ9B 1YQVL 2NY6C 3FB8B 3DROB 3VFOB 5BV7H 4R8WH 4L8CB 5GRVL 4FFYH 2HYMA 1G84A 3ULUL 5EFIA 5DUBB 3B43A 4MA8L 5HY9A 4TVSa 2LAGB 4MAYC 4XP1H 4X6CB 4RZCA 2X4UA 1E4KA 2YPLB 2VABB 2P5WE 1LO5A 4O4YH 4ZFGL 3BKYH 3V4UH 4U1NA 2RFXB 1FVEA 1MCOH 2HAZA 4JHBA 2C1PA 3V7MA 4I0PD 3B9VA 5BO1L 2Q6WA 4U6VH 2Y25A 3IDMA 4PTTA 3IF1B 2OTUA 5FO9A 4RFEA 1R6VA 4LDEB 2J5LC 5MEPA 1NCTA 3GSQA 2P5WA 3PQYD 4GXVH 2HT4D 3EYOB 1JHTA 2GY7B 3D9AH 3LSOB 2ZOKB 3B2UC 2FD6H 1ITCA 3CMOH 1MRDL 4JDZA 4EI6B 3NTCH 5EB9A 4ODVH 3KYMB 3QQ4B 5EZLA 2MFNA 2QQKL 4WTZG 1PYWB 5IT2L 1YECL 3VWKA 3BPOC 3DGGA 4PJHB 1DVFC 2DQJH 3MBEC 4L8DA 3NZ8B 3OB0H 4PJFE 3O2WL 1MRFH 1YMMA 1DN0B 2P8MA 1U9KA 3BHBA 5D96B 5T1LD 3JV0A 1YY9D 3WN5B 4QKXB 2LABA 3X11B 3OBAA 3ZKMC 5LWYH 4PLKD 3HMWL 5HYSA 1U36A 1N5YH 4S2SB 4MXVF 2EIZA 4B0MM 4XGZA 3MLZL 4X6CF 1AQDB 1CE6B 1INQA 4G8FA 3BVNB 4FS0A 3GJFB 4GBXB 1K5NA 3K0WA 3ZKNC 3ULUD 2ZPKH 3V0AC 4NC2B 5JXED 3MMEA 4OF7A 5I1GH 2X4NA 4JO4H 3AGVA 1EH9A 1HK6A 3VFTB 4NDMB 3NVQA 4GO6B 3JWDH 4BSVA 4XPHH 4YDVB 3QULB 4PG9B 5JNYB 3VFGH 4F33B 5HVHB 3V0WH 1O7SA 2D0GA 1RZJH 2BVYA 1KJVB 3GBML 5HJ3B 3QQNA 4JQIH 4M1CD 4M5YL 4UNVA 5TGBB 2NTFB 2ITDA 4JR9L 4TOYL 2IG2H 1NGZB 3CC5B 4QTIH 1QFPA 2A6IB 2BXYA 1LDPL 3TC9A 5ILTH 1KIUA 4RRPA 2E8ZA 4WFFD 1P7HL 4PJHF 3LKPB 4PJIE 3QDGD 1I7ZA 1WIUA 2Y72A 2HFFB 3V4PL 2VLLA 3LQMA 4YXHH 2IPTH 35C8L 5FCUH 5GRUL 3LEYH 1EV2E 1CBVL 4ZDHB 5F7YC 2KBGA 4PBVC 5AZEH 1MF2L 3MREB 1VERA 2Y5TA 3P0GB 1QR4A 1T1ZB 2DM2A 4AEFA 2B8OT 2AEPL 4KC3B 2GCYB 2E8YA 3KPNB 3TCXA 3R06B 1X5HA 5C0RL 2GHWB 4PJIA 3V7AG 3WNLA 5FFLA 2QL1A 4OIAA 1EK3A 3WNNA 3BP7B 3I3EA 5GJTH 3UJIL 4QGTA 1Q1JL 2OL3H 3TYGH 4ZODA 3ZZ1A 1UVQA 2V9QA 5HVGB 3ULVL 4XPBL 1A6VL 5BQ7A 4Q0XL 4ETYA 5JHLL 5IG7A 3ARPA 3TZVB 2I07B 3DVGB 2AJUL 2O5ZL 5TQ0L 4P4KC 2D03L 3D85B 3LH2L 4JZJA 5SX5K 3F7VA 4DQOL 3SY0B 2ICWA 4L9LC 5C0NC 4XCEA 3K3QA 4GAGL 4PV9A 4Z0XB 5E8EA 4MA7H 4G6KL 3GSRB 4Y16C 1D5MB 2CGRH 2DKMA 4DVBB 1S9KC 3IJSB 5EIVA 2ZKHL 2YA1A 1RUPL 3ZTJG 5C71A 2FX9L 3Q5OA 1HHKB 3KHQA 3QCTL 3MJ9H 3MJ7B 1U2CA 3HFMH 3PHQA 1S9VB 3P0YL 2VDRH 3T08A 4NUGL 4TULL 2NNAB 4NNXB 1FO0B 3TT3L 5I66A 3EYVB 2GI7A 3TIDB 1CD1B 2P43B 4EKXA 5I0DA 5IROA 2EDEA 1S7SA 1JPSH 4KK9D 5CP7A 5LJYH 4L8SA 1A0QH 1HH9A 3RKPA 5GGSY 3CFKA 3EGSA 3P11L 4LCIL 4YHLL 5FYJH 2WWKO 2FBJH 3MLSH 1ZLWK 4D94A 4WTWA 5E2UH 3FO1B 4AY0A 1YPZE 3BGMA 3HC4L 3DV6A 4KK5D 2YD4A 3HNSH 1H8NA 1Z3GH 2D7NA 2UZIH 2Z8RA 5F6IB 4Z0BH 4F8QA 1KCVH 1I1AB 5GPRA 4X8JB 5DD3H 3ARBA 3MACL 2NY2D 3MRKB 5JW5A 1I7UB 4E42A 5IV2A 4FP8L 5I2IA 3NFSL 1QRKA 3IDUA 5AD0B 2V17L 4CJ0A 3UAJD 1OGAB 3V5KA 4O2EA 5CHNA 1EZVX 1YPZA 5IMLB 1OAYL 1NAMA 3DVIA 3G5XA 3EJJX 3VXMB 4OF0A 1NMBH 4WCYH 4NFBA 5JIKA 1EO8L 1D9KB 3HPJB 1WTGT 4M6NL 3UTZA 5C0GB 1FIGL 1U8IA 3D25B 3GMOA 3BZEB 2YD8A 3MQIA 3O3DB 1GGCH 4UNUA 5DMGC 3U36B 3U4AA 3IKCB 3TBSB 3EJYD 1MHEA 1KLFA 4X5LA 3H42L 3QIUA 1IGCH 2MCG1 4BQ6A 1FYTD 1I9RL 3KPOB 4LOUD 4KROD 4J2XA 5AYUL 4IJ3C 3X3FL 3UPRB 4KTYA 5CWSA 1FL6B 5HDLA 5HHVL 1I9IL 5F9WC 5I9QB 5J1SC 3QEGL 2HH0H 3VXSD 2VNCA 4N0UB 1A6WH 4JLRB 3JV5A 1U3HA 1TJGH 4G8EA 3FB7B 4XXCA 1XH3B 1N26A 2W0FA 2WQRA 2Z35B 4PGJA 4YDJB 3BQUA 4TSAH 3W5MA 1GZQA 2AK4D 3MYJB 1RURH 1QNZL 1U8LA 1FH5H 2ZG2A 3UC0L 3IKKA 5CD3B 1EJOH 5IIEA 1A3RL 4JPVL 3EOTL 1S7XB 1XR8A 3HCVA 1OHQA 4YK4B 5D1XD 4NGHH 4UV4H 4QRUA 4FHBD 4KRPB 5JORB 4PRDB 5DK3A 5H35B 1T5WA 5D7IE 5IW6A 1KTLA 4R4ND 2CKNA 4WVRA 1UM5L 1FL5B 5F8RC 4FQIH 5IWLA 1SJEA 3BE1H 2XFXA 1J5OH 2W9EH 5ETUB 1AQKH 3OKEB 2XWTA 1FGVH 5HI5C 1W72B 1FGNH 3EJZC 3SE3C 1TCRA 3IDYC 2G60H 1X9QA 5GS0C 15C8L 1MCHA 1N7ML 1YEEL 4M8QB 3KPQA 1FVCB 5D7IA 1ZAGA 2FIRT 5EPMA 5JOFB 1I7RB 1S5HA 1UXWA 1UJ3A 5DRNB 1DBKL 4Z7VF 1PG7X 4KRLB 4QRRD 2ITCA 1FFRA 3HUJB 1YNLH 2G75A 3BJLA 1P4IL 7FABL 1OAXL 3PWLB 3EZJB 3MGAA 5IKCB 1YEIH 2KQMA 3CXDL 5IEKB 4JZOB 6FABH 1T5XA 5D1QC 3Q1SL 1KLUB 4U31A 4IDLA 4NZUH 1LK3H 3LQZA 3JUZA 4CDGC 4PB0L 5DJ2A 3WHE1 2E7LC 4JDVB 4J8RB 2P8LA 4XNXH 3UTSD 5F7KC 4JRXE 3K8MA 4KMLB 4IRSA 1AP2B 3EO0A 2ZOLA 4KJPD 4NQEE 4DAGL 3L3OA 1GAFH 1EGJH 1NMAH 4X7SL 4U1GB 3WIHH 1YN6A 2B0SH 4XBGA 4WWID 4OBSA 2AV1A 3DXAE 1AGEB 3FTGB 4KJYA 1YNKH 4A2MA 1F4XL 4I0PC 3JTSB 43C9A 4GG6A 3L3IA 1QVOB 1A6ZB 4F7PA 2X1QA 5D8JL 4XP6H 2WBJA 5JDJA 4JRXA 2GK0A 1INEH 4ZXBA 5F3HA 3RWCB 1H5BC 4NQEA 3S5LA 4HUXA 2PTTA 1Q9OA 5FUCC 3VH8A 2HT4C 5DJZB 1ZSDA 1WT5C 4OF5A 5DD0L 4HF5L 1K3IA 1QLEH 2P24B 3HUJF 4MJ4A 3ZL4H 3SE4C 4FOMA 3H9SB 2D2OA 4C57C 4D0BB 4WV1B 1M71B 1NBVH 3L5WA 1KTDB 1G9MH 3NCYP 1K4DB 3S3SA 2Y7QA 2IANB 3OKNB 3QDJB 4NZTL 2R2BA 3A67H 4H20H 5BJTA 2ZCKH 2Y4SA 1YY9C 1QFOA 2VLRB 1JWMB 3NPSB 5H94A 4PGBA 5I1CH 3D6GA 1XGRB 1OAQH 3LN4B 5JUEL 1CDJA 5I1HH 1CGYA 2BVEA 3QIBB 3L3KA 4WUUE 3WD5H 4QOKD 2DQEL 5GS0H 5CBEA 4U6HA 4KJWD 5C09B 3VWJB 3DURA 4JFOA 2DD8H 2F58L 3MC0A 4XBPB 4HIIB 3HR5A 1PKQE 5JXEC 3HI6L 4XZUB 1YEHH 4EDWH 3C8DA 2ZCLL 4LP5A 1U8OB 2EECA 2VQUA 4PRID 3FMGH 4WUUA 3QEHB 3IFNH 1GZPB 1CE1L 1QLRA 2B20A 2ESVD 3S9DB 2AXJA 3TJEH 3RTQB 4PLOB 4XMKL 2OLDA 3MRGA 5EZOL 5C0AB 3KNBB 3KPPA 3H7LA 4M1CC 1IVLA 3BDYH 1F4AA 3H7BA 1MLBA 2J8OA 4YHIA 3T8XA 1YY8A 4LNVA 4FFVD 4XVTL 5GS2D 3K81A 1NH6A 4JANA 2VXUL 4R90H 3CFDA 1VCAA 2X4PB 4LPTA 1OSZA 5DHXB 3UDWC 1CFQB 3TYFA 3MLPA 1OARL 4LLWB 1IGJB 3NA9H 4X83A 4ESKA 3D2UD 2YPKA 3GK8L 2DYPD 4PGZA 5EOQL 4UAOC 4YHYB 5BMFL 2XN9A 2DQUL 2R8SH 4JG1H 3KPRE 1X5ZA 2EE6A 5E4EC 4DZ8A 4MJ5B 5DFVD 4IIQB 3KYOB 4OLYL 1CR9H 4S1RH 3GIVA 2DICA 1M7XA 1DL7H 1TZGH 3AU1B 3C6LA 1FJ1A 5C0BB 1BVKA 4X99B 2APTA 3SDCD 1EEQA 1QQDB 3FQNB 4M9PA 3DVNA 1BLNB 5FOBA 5K9KB 1MOEA 1NSNL 3FQRB 3V8OA 2HJKA 1MJUH 4R96B 4NNYA 1LHZA 1ZLVH 3LKQB 2QADD 4Y4HA 1EHAA 1FVDA 4R3SA 3U82B 4LCWB 3MXWL 1U3JA 3U9PH 4OLXH 5DMKA 5LVEA 1KB5A 3CFBB 2VITA 2IAMD 1YQVH 4MQ7B 1XF3A 5HXMA 4CRPA 5KSBB 1RUQH 1TJHH 5GRWA 1D6EB 5EBLA 4XPTH 4PJEB 2P47B 4I2XB 3ULUH 1C16B 3N1PC 5CEZD 1L0YA 3GSUA 3RZCD 3P4OB 1EVTC 2DDQH 1X7QA 3QCVL 2JB6A 3VGAC 1BM3L 1ERNA 2FNBA 4X98A 4KK9C 2VJXA 3DYOA 3GIZH 5ISZD 1DR9A 5L7XH 2OZ4L 1NLDL 5IB5B 5E2WL 2UV3A 1VKXB 4JFZL 4FQ2L 2X9WA 1RUAH 5IM7A 1YEKH 4LNRB 5CJOL 3AXLA 4JGUA 2OYPA 5FO8B 32C2B 2VB5A 4P2RE 4L3EE 1S5IH 2V7HA 4HKJA 5GIRA 2ZG1A 4KK5C 3IU4H 1QR1B 4N90E 4OAWB 4QXTB 1QBLH 2YXMA 4ZOBA 4IS6B 4G80B 1MFDH 1MRDH 1KLGA 3QAZB 4LFHG 5EZJA 3SPVA 4M93B 2NY2C 4YO0A 4LBEB 4LRIA 2QQKH 4KXZH 4D3CL 1VENA 1T1YB 3JSSA 5I1IL 4JAMB 4PGDB 1MHHB 2FHBA 1TXKA 2JCCE 3NCMA 2PO6B 4LKCA 3UAJC 3O2WH 3QPXL 4L3EA 4YBQD 1CG9A 4X6BA 5GS1C 1LO3L 3QWRA 3BO8B 1DQTA 5KSBF 4JPWL 1Q9LA 1H3UA 2DQFB 2P8PA 3C5ZD 1NFKA 3OKKB 4NUJA 3RWJB 1BQHB 2VAAA 5CEXB 4D9LL 2NXYB 3NFNB 1OP5K 5MENE 2JCCA 1GGIL 3MUY1 2FL5B 2Q87A 3EJYC 5DD5H 4P46B 4ZUUA 1HZHL 5C0IA 4KHXL 2WM0A 1TPXC 5DC0A 3JWNC 1HINL 3EYSL 2CDEB 4LOUC 4KROC 1ZEAL 4P5KB 5ESAA 2XTJE 2E9IA 2UZYB 1OTUD 3Q6FB 1E28B 3ILPB 2D7OA 1XF2A 3B3IA 3VW3L 2EYRA 1G6RB 4YHPA 1P9MC 1OWWA 3WL9A 1TFHA 5T1KB 4ONGH 5DQJB 5MENA 5GGRY 4M61A 1NFDB 1QSFD 1FCGA 4JR9H 4TOYH 4RWYH 2L7UA 3BDBA 4U4BA 1LDPH 1N59B 3NCCB 4I8DA 3B2VL 3HNTH 5T3ZD 2O5XH 4HIXH 4NN7C 4K94C 1BZ9B 2XKNA 3NFPB 3V4PH 1BQUA 4LU5H 5HYJE 5GRUH 2DJSA 2J6EH 4RAVA 1F13A 1CGSH 1YJDL 2V9RA 1CBVH 2FJFB 5D7JB 4HS6A 5D1XC 3BYTA 5JO5A 4KUCF 4MVBD 1SYSB 1KG0A 2AEPH 2ATKA 2XKSA 1H0DA 5C0RH 2QSTA 3PL6B 4YXKL 4DKEH 1JGEB 1RIHL 3L1OL 4R4NC 4HGWB 1TVBA 4Z18A 3UJIH 1Q1JH 4NP4L 2VR4A 4FQ1L 5HYJA 4JFHE 4LLDA 3CU7A 4KVCH 4GMTH 5DEFB 5C08B 3P4LA 4PJ5E 2XWBB 1HHIA 3U0TB 5F7LB 4J3OC 2YD5A 4M6OL 5KVFH 5SV4A 4XPBH 2MSPA 1UZ8A 5JHLH 4G42A 4IRZL 2F5BH 4JREB 4OCWL 2D4FA 2VMFA 2YC1A 2YRZA 5TQ0H 1FSKC 4Z76B 5I17A 1NFDF 1RU9H 3SDAA 4TSBL 3QJHA 3G5VB 4GAGH 1EXUA 1DQJB 3QUZA 4AENB 4DZBB 1KJ3H 5E8OB 5KTEH 3QRGL 4G6KH 2I24N 3AMKA 4AJ0A 2UUDK 3GMLB 2ZKHH 3R8QA 1IC7H 1RUPH 5HD8D 4CADB 1YUHA 5D2LB 4YWGL 1MCJA 2CLVA 1I8LC 1KTKE 1IKFL 5I75C 4EVNB 1ZMYA 3C6SA 4JPIB 2XPGA 4DOHB 1CFNA 2Q7YB 4OLVL 1T22B 5AG9A 2W9DL 5L0QC 4HUVA 4KJPC 5DWUH 2HFEA 1FNGB 1ZHLA 4U1SB 4LCIH 3MV7B 4YHLH 4Q74A 1ETZA 1G7HA 4EI5B 2ZUTA 1BD2E 4HUWA 3QUML 2YWYA 3W0WB 1I4FB 2X05A 1NGQH 4K94H 1F3JA 2AK1L 1JV5B 5KBNC 5L2JA 4LPCA 5EN2A 1XEDA 4DWHA 4MAYA 2MCPL 3NFSH 1KNOB 4LHUG 1BD2A 4X0KA 2WW8A 3RNQA 5I1EL 4NQXA 3MRCA 3G04A 5E6IB 2Z4QA 1BQHG 1JF6A 4UINL 1QEWA 2QSCL 2GJ6D 3S7GA 4TUKL 1NLBH 5D2LF 4HS8L 3U46A 1FIGH 4OB5L 3REVA 1KSRA 1R5WA 3GGWB 3BRDA 1P7QD 2R0LL 3BIAX 2VUOA 5KW9L 1FZOA 2BRRL 2OL3A 4OZGB 1MCDA 1B88A 1EEYA 4MA1B 5DLML 3WLBB 4M00A 3TO4D 4AQOA 3TCLA 3ZE0E 3IU3A 1YDPB 2Y36L 4RBPK 3V52L 4WGWB 4HZLA 3DIFB 1EHLH 4CU8A 2X1XR 1JK8A 1DVFA 3MBEA 3BRGC 5IBLD 3LN5B 4NOFA 5SWZD 1R3HA 4MD4B 3GKWL 3MNWB 1BQLL 1BOGB 3QEGH 1CLYL 3LPWA 1W0YT 5DMJB 2FR4A 2PTUA 2OR7A 4KTEL 3FKUS 4Z5RA 5EC1A 5KSAD 1B2WH 1B90A 4BA8A 3CK0L 3A0OA 3G08A 3MJ9A 1F6AA 1WIOA 3K8LA 5FYJE 3D39B 1XGTB 4FFVC 4AG4H 3EOTH 3PDGA 2HLAB 4XMPL 4ZS7L 5DJCA 2BDNH 5EU6B 4NYLB 2HKHL 4I4WA 4YUEH 1ZT7B 5I8KL 2YPLD 2EDKA 3QXAB 2X89A 2FX7H 3B6SA 1X5KA 4NT6B 4PJ7E 2WAHA 4WHDA 3DMMB 1AD9B 1N2RA 5IOPA 1UZ6E 4OZGF 1LO2H 3DI3B 1DEEB 1UACL 3DUHA 4RMQA 3WS3B 3IFOA 4GJTB 4WW1B 4K3DL 5LQBL 1J1PH 1RJLB 5DFVC 2F8VA 2ADFL 1RSFA 3HE6B 4CMHC 3MGOB 3BUYB 2IQ9L 1EMTL 1JPTH 4PJ7A 5ESQB 5EC2A 1C5BL 1YEEH 4L4TB 3KPSB 4PJDF 3SDCC 3IJHB 3ESUF 4OLZL 2KPNA 3S37X 4Z8FH 1A7QL 1BQSA 1LE5B 1HIMH 4ZNCD 4NHCH 1P4IH 7FABH 1G9NL 5EUOB 3S35L 5DHVH 1OAXH 2QADC 4PGCA 2R2EA 2A77H 5E56A 4FTVE 3OPZL 3EOAB 5EOCL 4NKIH 5FECA 3K7UA 4MQXC 3HG1B 5FM4A 2CIIB 2IAMC 1FZKA 3A6BL 3NABL 1EO7A 5LGHL 2VDOL 2B2XL 2V2XA 3KJ4C 3F7RA 4PB0H 2HG5A 4OBRA 1F6FB 3MR9A 2AABL 3RZCC 4P4KA 4DAGH 4QHUB 4Y19B 4FTVA 4PJCE 5ITFA 2Z91A 3WUWB 4OGXL 4L9LA 1ODAA 1YNTB 4KFZC 5L9DH 4M4RA 2MPAH 4MD5B 4OV5A 2NLJA 3K2UL 1F4XH 2H3NA 1CDUA 3N9GH 4Y16A 1LGVA 5L88H 1I9JL 3C08L 1FLTX 2HWZL 5IGXL 4M7JL 3T3PE 4U3XA 1I1CA 4WDIB 4MNQB 1MREH 3BZ4B 4PJCA 4XWGL 3RU8H 3O3UN 5GS2H 1JBJA 3HI1A 4J7RA 2AJSL 2NY0B 4PRPD 8FABB 4YHOH 5EUOF 1FO0L 1ZTXH 2XXMB 3TN0D 2PNDA 3HPLB 3U2SB 3ISWA 5K9QI 5F96L 1P84J 4XBEH 1A6UL 1S9XB 3H0TB 3HNVH 4YBQC 3DUUB 3X13B 2EO9A 1U0QA 2APWA 1XF5A 4HPOH 5HYIA 4PJBF 3GSOA 1IM9D 4UQ3B 3WSQL 3C5ZC 3B9KB 3WDHA 2OCFD 5FOJA 2BCKA 3LDBC 2IH3B 5I1LA 3RWIB 1VACA 4IOIB 4V2BA 1X5AA 1XFPA 3OR6A 2F58H 4OD2B 3N1MC 3LB6D 4RGMC 3W9DB 1HHGB 3NPZB 2FGWL 4ONHB 5EBMB 2BY3A 5GRZA 1OTUC 3Q3GA 1VEMA 2GSIA 3D85D 4N8VA 3IS1X 3BH9B 5CS7A 1TMCB 3VCLB 4MX7B 4NKDA 1ACYH 4X4YB 4J3TA 4XMKH 4JKKA 2E9WA 3RPIB 2Z31B 4EN3B 3LVEA 1VFAB 4D8PB 1QTYT 2NX5E 5L6YL 1QSVA 3C2SA 5DD6A 1LO4H 5CEZH 3QUKA 4JY5L 3V5HB 4GAYB 4WENB 3UO1L 2GUOB 5IFAL 3O11B 2EE2A 4I3SH 4Q6IC 2XNAA 5DFTA 3ZKSD 1ZHNA 1CLCA 1H15B 3QEQE 3KPMA 4Y5YB 1U8NA 5FCSH 1EGJA 3CXHK 4NC1C 2XRAH 4XVJL 3WIHA 2CO7B 3RY5A 5IK3A 4MVBC 2NX5A 5CFHA 1CXLA 2OXGA 3RKDC 3EYFB 4OQTA 1ZVSA 1LD9B 4HK0A 1J0HA 1A9BA 4H5SB 5IP4A 1U8KB 3QIWD 5FHAH 3DV4A 3PWVA 5HDQL 5FYKE 4FMFA 2W1NA 2OJEA 2Z93B 3FO2B 1A1NB 2DWEB 1WWBX 3GM8A 3QEQA 3FONA 4LP4A 4M03A 3V6FA 3T4AB 1SY6H 1CDIA 1I1AD 3CD4A 4QRPB 2P5EB 5E9DE 4BKLB 3BW9B 5F89A 3CFEB 2XYCA 1AY1L 4LEXH 4V2CB 2Q76A 3H9ZA 5J1TC 1PW3A 4PJAB 2CRYA 1OGAD 3IDGB 3KWWB 1IFHH 1CF8L 2W07A 1MH5B 4RSVA 1LNUA 5B38A 1CD9B 1NC4D 3VXMD 5SWQA 5CSGA 3MXWH 1NGXA 5DI8A 4ZUVB 4X6DE 3F12B 4C4KO 4O00A 1I7TA 5IR1B 4UIKH 3ZTNH 2GTZA 4MDIB 4U6XA 5E9DA 1XGUA 2PXYB 2XA3A 4ODXA 3DARA 5EO1A 3SE3A 4M62L 1A7NL 4H0HB 3P77B 4Z7WE 2VKWA 5K9JL 3QJFA 1W72L 1T7ZA 5HD8C 5SX5H 1EO5A 1G7MB 1JWUA 4PYGA 3HC3H 3G5YB 4ZPTB 5JLZA 3QCVH 1JPGB 2V2TB 4X6DA 4NN5B 5DEGA 4GG8B 4N1CA 4RNRA 1K8IB 3O3EA 5JHDB 2OZ4H 3MXVL 4Z7WA 3FO9B 3JV6B 5E2WH 1L6XA 4FQ2H 2ARJQ 4RMWA 3TP4A 3QBTB 5CJOH 3T4YB 5D9SA 3I6KA 4LQ1A 1TENA 5B3JE 3NMEA 3LCYA 5T3ZH 4ERSH 5DJXB 1JGDA 3VD9A 3WYRA 3BP4B 2E7LA 3LKSB 3WO4C 1C1EL 2B39A 3HLAA 1K2DB 2BMKA 3EO9L 3NN8A 4D3CH 1AKJB 2V5YA 4KKAD 2BNQB 3G6AB 5INCB 2OQJB 4ELME 4DW2L 5ACZA 5FUCE 1J88A 2EDTA 1MFEL 3VMOA 3NIGF 1KCSH 1ZLWH 5J3HC 3V6ZB 1UQSA 1WAAF 2I5YL 3JWOL 4I0PA 3H9HB 1H3GA 4I0KA 4ENED 4LLAA 4OLUH 5E7BA 3I3DA 1G6VK 1H5BA 4ELMA 3KDMB 1HQRA 5TDOA 3VA6A 1SBSH 1WT5A 2H32B 3TO4C 3UTTE 1HZHH 2BOBA 4UILH 4ODWB 3LKOA 2PR4H 3VDBA 1YC8A 1S7QB 3Q0HA 1EDQA 2HVKA 1HINH 4ORGB 4U1LB 4DGIL 3T77A 2IC2A 3Q2CA 2UWEE 5KJRL 1CL7I 1JPFB 1W2KT 1WBXA 5IBLC 5A16A 5CIPH 3VW3H 1J11A 5CGMA 3U0WL 2I25N 2HRPL 5DMYA 5T1LA 4GRMA 3ZSTA 3UYRH 3U7WL 5GSRB 2LU3A 1IAII 1CFVL 3UTTA 3FFCB 1FN4B 3E6HA 5DMIL 4XXDB 4RMVA 5IHZA 1C08B 1Z6JT 4JO2L 3MRIB 5DGQA 5KZCD 3OSKA 2UWEA 4YZFF 5KSAC 4M9OA 3G9AB 4WJ5B 2NR6D 3SE8L 4PP2B 1P5UA 1WJ3A 5BW7C 4PRBB 5KANG 1A7OL 4E5XB 4PRHE 4Q9BA 3PGFL 1CICB 5JXEA 4F7TA 1DBJL 2VISB 3WDIA 5I1DA 1E4XI 1UA6L 2IFGA 1BFOA 3AFLA 5ADOL 2VR5A 3QDGE 1J0JA 1G7JB 5KVDL 3WIIH 1VESA 3QO0B 4JFQB 3DX7A 1BVLA 3TBVB 5I71B 4HS3B 1IBGL 2W38A 3B8SA 1RJZA 4O2CB 2YD2A 4NP4H 4FQ1H 2FSEA 3OX8B 5J0BA 1R5IA 5TE6H 2CKBH 3DSFL 3KXFD 2H9GB 3O45B 2NPLX 5CEYA 3D18A 3QDGA 3CH1B 4FZ8H 3WKML 4OCWH 3UDWA 4LCYA 3MODH 2EIBA 3TIEB 2R1WB 5INDB 2J8UB 4ZQKB 2C4FU 4TSBH 2G2RB 3NIDF 4XC3H 2KQNA 1NBYB 1A6AA 4NBYB 4LSSL 3I2CH 4ODSL 1IRAY 3QRGH 2AXGA 5D96C 4PFEA 4QXWA 3S88H 4MZ2A 3PWUB 3STBA 1KJMA 3O0RL 2KDGA 3OJ2C 5D2NB 5IB4B 1UB5B 3G5ZB 1F45A 2WK2A 1YMHB 1IGIL 3GEWB 2D7TH 4KUZL 4NHUB 1PEZA 3VWJD 2R4RL 3L9RB 1UWGL 3QO1B 4FQXB 1P4BL 2W9DH 4WHYG 5E99L 5BRZD 1CTNA 1VA9A 5EOTB 5A2IH 2MHAA 1DBML 1XZ0A 4A6YH 1YEJH 3GMPB 1YEDA 3H3PL 2CLRB 1T6WA 2D7QA 1ORSB 1JGVL 2IGFL 4POZD 2MQCA 1BWMA 1MHCA 1BAFL 3TV3L 5CJQL 4JN2A 3G6JB 2UYLB 4HGMA 3L6FA 1CI5A 1XIWB 4K7PL 4RDQG 4X5XB 4HZAA 3RTQD 4ZSOE 4QTHB 3ARDD 4OZHE 1NBZA 5C0AD 3GUTA 4UT6H 4ELKB 5H8DA 5IW1A 5ENWA 1MLCA 5J57B 2J8UF 4RA3A 3VFWA 3IDJA 4XTRD 1VFUA 4R2GB 3WXWH 3ZTJH 4WHTB 3HC0B 3QG6A 1MELA 2J6EA 4RQQA 2RQ8A 3TN0C 4ZSOA 1C5DB 4OZHA 5D7SL 5CMAB 5E6YA 1HDMB 3BZFA 4HS8H 3EFFB 3DRTB 3BSZH 3ARGB 1NCBH 4M4PA 4WRLA 4NO3B 4WU5A 5IW3A 4RAHA 3RWGA 3VGBA 4TQEL 1AE6L 3TBYA 4Z7OF 3W39A 1YYLL 1WBZA 2O26U 5GGVL 2ZNXA 1EERB 2DLIA 3QNZB 2C7UB 1VPOH 5SWSE 3TBWA 4JRYE 4LAQL 3V52H 4HFWA 3THMH 2LTQC 4R9HA 3LB6C 2BP3A 5GGQH 4DGYL 3FT4B 3WHXA 1DDHA 1BQLH 2H2PD 4BZ2H 6CGTA 5GS1A 4RFNC 1DSFL 2GIYA 5C0DA 4LEOB 2VZSA 4KTEH 1KPUB 5F72S 3GI9H 4LCWD 3GO1L 5F97E 3V4VL 3VXSE 4BSWB 4TUOA 3SGKC 1HI6A 4EIGB 1VADA 3RGVB 5DRWA 4P5TB 3CVIL 1WFUA 4WEBL 1GGYA 1RUML 5GGTL 3CPLB 1IQWL 4ZS7H 4WFGD 1FYTA 3FHQA 2EH8H 5LBSL 2BVQB 1IGMH 2CDGB 1QSEE 1LWRA 3QUXB 1Y18A 1L4IA 1QACA 2AK4E 3QG7L 1P9MA 4TPRL 3SJVE 3VXSA 1G1YA 1G6RL 2VQTA 5K59F 2AV7A 4HBQA 4EUPG 4HCRH 5A3ID 2A6KB 4MWFA 2BZDA 2YUWA 3QH3A 3QWQB 4KGLA 4CMMB 4UU9B 1WK0A 5E0QA 1TZHA 3BIKA 1I3UA 5BS0B 3QIWC 3EUUA 1AGBB 5A1AA 1CXFA 4LCCB 1QSEA 4MMXC 5MP6L 2AK4A 1EMTH 2VDPL 5E8DH 2NQCA 4GRWE 3MRMB 3SJVA 1CWVA 5F6IC 1MIMH 1I1AC 4NO5B 4XNQB 4EBQL 4F57L 2FJGB 3SGDH 3ZDXE 1BX2A 3REWB 1IE5A 5D1XA 5EZIH 3SO3B 3FHAA 1A7QH 2BY0A 1WZKA 2Q1EA 5HHPA 2CQVA 3PG2A 5FKPA 1S8DA 5FUOL 2CSPA 4KMTH 1T1XB 3M17B 4LHUD 1UXSB 1SEBB 4QCIA 3GMNB 1MHPL 1A7PL 4HMCA 1UH3A 1J0IA 4QRRE 1DUYB 4YX2H 4KUCD 1NEUA 3Q48A 5LGHH 5IJKC 2VDOH 2PKDA 4YAQA 2B2XH 2NXYD 2V5SA 5E95B 5FDWA 5JDSB 4L8BA 5JPNB 4GKOA 5H2BA 5FB8A 1H3XA 1IC4L 3IXTB 5FM5M 5J6HA 1EEZB 3MRLA 4EOWL 3QNXB 1LMKA 3WV0A 1T66C 1SM3L 1TITA 2YEZB 4JFYA 3VFUB 4X7TA 2ADJB 4QRRA 4J3VA 3NZHL 5I9QC 1GOGA 1KIQA 5IHUH 2VAJA 1N0XL 1NCCL 5T1KD 3P73B 5FA4A 3C08H 1U8QA 4MNGE 4YHML 5CP3H 3RAJH 5KG9A 4LKXB 4UDUA 4FZEL 3QCUL 4M6ML 3WIFA 2UVEA 1I8LA 3I6GB 1KXTB 2ARJB 1LEKA 3BXNA 2V5RA 3CFIC 3D69B 5DS8B 3O8XB 3QA3A 4RIRB 3INUL 1I1FB 1KGCD 3LRSB 1QPPA 1WBYA 3RUGE 5FV2A 1KXQE 1LEGA 4P4RA 3V6OC 4KKAC 4OCNC 4PBXA 1NFIA 4IOSD 4OGYH 1T1WA 4G3YL 5D7JD 1FNSL 1HXYB 1ZT4B 2LV4A 2EDNA 4YK4C 3JTTB 2O61B 1HQ4B 4BJLA 3C5JB 1MCCA 3PL6D 5ABDE 4OKDA 4ENEC 4APQB 3W81A 4YBLC 3RUGA 4Z7UF 1H3PH 5C07E 5EFIB 2H1PH 2X4OB 1KCRL 2J7LA 4RZCB 2X4UB 1EAPA 5IJVA 3O4OC 2IALA 4FQJL 3MV9B 2YS4A 4WEMB 5H37G 2EC8A 1U8HA 2R1XA 3U79A 1MWAA 2GTWA 4U6YA 2IEPA 4Y1AB 1U8JB 3L95A 1SVCP 3O9WD 2Q6WB 3IDMB 5C07A 1T04B 2OTUB 5FO9B 3MV11 4NCDA 2WBWB 1NEZA 4NJ9L 5MEPB 3IXAA 5EORL 4JN1H 4M7ZC 1NL0L 5DHVA 3GSQB 1OP5H 1C8PA 3CLFL 2R2HA 5DR5L 1DLFL 1JHTB 2VXTL 3W9EB 3SKUD 4NM4H 3BKCH 1JPST 2AXFA 5EZLB 2NR6C 3DGGB 4CKVX 5IEHB 4JY5H 4DKAA 4L8DB 1GRWA 1EAJA 2P8MB 2VTFA 3F62A 3BHBB 3UO1H 1FNEB 2K7PA 2MQ0A 3SQOL 3UBXA 5HYSB 4F7CA 5MERA 4PRIA 2VZUA 5DC4B 3WNKA 4U1GC 1KFAH 2ESVA 2X41A 1I3RA 2EIZB 4XGZB 1A7RL 3MV7D 2F53B 3L5IA 4G8FB 2AS5M 3E0GA 3WCYA 1IAOA 4PJFB 4EI5D 1O7VA 5HDQH 4OD3H 1K5NB 3P4MA 3MNZA 3VRJB 4XP5L 3SDXE 2BNUA 5ANME 3LQAC 4BELD 2IBGA 4JQVC 4Q2ZA 3W0WD 3MMEB 1A02N 2X4NB 1OGTA 4PB9L 5GRJH 4U3HA 3WFBL 4BSVB 4E41D 4HJ0D 1RZ7L 1AY1H 2EC9U 4OM1L 1Z0MA 5CUSH 1K9TA 3SDXA 1KCLA 4WV1C 5ANMA 3RVTD 5HGAA 1IAIL 3D2UA 2ITDB 2DYPA 4HULB 3WFEH 3DECA 3QZWB 1BIIA 1NJ9B 3U4EA 2B1AH 1U95A 2I9TA 1I7ZB 1M4KA 1TETL 3LV3A 2VLLB 5K9JH 2BFVH 3D0LA 5TF1L 1QYGL 3KYNA 4BUGA 2Y5TB 3SDCA 4O51B 2MMXA 3VWJC 4XP4L 2AP2A 4QYOA 3GSWA 2EE9A 2E9BA 4JFXA 4PJIB 1JNNH 4PJFF 2RGSA 4R0LC 4RGNE 5CLTA 2UUDH 5CSZB 2ATPA 5FGBC 3MXVH 1NCAH 5CEZE 1HKFA 2JB5H 4POZC 5FUZH 1EX0A 1T0NA 4TVPL 1PLGH 3ES6A 4NQSA 4ZOCA 1Q38A 2CIKA 1UVQB 4X9HA 5K33A 1S7TA 2IAMA 3ARDC 5ISZE 2FO1A 2A73B 3CCHB 5IG7B 2WZPD 2DBLL 3MOAH 1P7KA 1XR9B 1D5BA 4F3FB 2UY6A 1C1EH 1JGLL 5E2TL 3EO9H 4JZJB 3F7VB 4XTRC 3S96A 2D0HA 3RZCA 5D71H 5F7HA 4H25A 3D39D 4XCEB 4XCCH 4PV9B 1MFEH 1R3JA 1YC7A 2BNRE 4G6JL 4LSRH 1WFNA 4X80L 5ISZA 4OV6F 4XAWH 4JJHA 4LARL 5J13B 2XA8L 4MHHG 5ICZA 4NRXB 4EDXA 2E6QA 1LE9B 4DKFL 4HIHA 4HMDA 4JO1H 4YHYC 2DKUA 3FRPA 3LQAH 3PHQB 4B7LA 4YHKL 1RHHA 2A74A 1JTPA 5I66B 4IIQC 3AC0A 2BNRA 1OAKH 4HXBL 1P1ZA 2IBZY 4U6TA 5J12B 1S7SB 2EDHA 5CP7B 1SY6A 2A1WH 3IGAA 5EU5A 1HH9B 1I3VA 1IJ9A 3I6LD 3CFKB 3EGSB 4JO3L 4HKZA 4K2UH 4GKNA 3KPSD 4KAQL 1RI8A 5KJRH 4I18C 3B5HA 5J11B 1VGKA 4OLWL 3U0WH 2H2PC 2YOCA 5BXFB 3MRJA 3U7WH 3BGMB 4DUXA 3TVMD 3R8BB 3DV6B 1K8DB 1CFVH 1FAIL 1F4YL 3C5ZA 4TVPD 2XZCH 3SKOA 1JRHI 4I77L 1MI5D 3BGAA 2WUBH 5JW5B 2MJWA 4K7PY 3JVGA 5IV2B 5I2IB 4RBPH 3HG1D 4N8CL 4PRNB 2QR0A 4YNYA 2YWZA 3VFMB 4ZFOA 3BPCB 1A7OH 3V5KB 3ROLA 1A4JA 5CHNB 1Z2KA 3PGFH 1NCWL 4ODTL 1G7IA 3G5XB 3L5JA 4KZDL 1DBJH 5C0FB 1ITBB 4KQ4H 4BZ1L 4NO2B 4Y19D 2Y6SD 4ZD3L 5T3ZE 2PW2A 5KVDH 1U8IB 4Q58C 3GMOB 3F7YA 4GUPB 1JGUL 2HA1A 3MLWL 1EFXD 2OZ4A 1F58L 3B8YA 5DFWH 3SDDB 1KUMA 1CFTB 4UIMA 5IB1A 1J1OL 3U7YH 4F15B 1IBGH 2E7CA 5A3IC 1YZZA 1QSFA 1DFBL 4XB8A 1MHEB 4U2YA 1DQML 3WLWD 2V5MA 4BFGA 3QIUB 5F1OB 1YA5A 4MNQD 1DLHA 5CJ5A 2OI9B 1PZUB 3EW3B 5FYLD 3LPFA 3FRUB 1OTTD 2Z0BA 3D3VE 4KH2A 5IQ7H 1ZT1A 1BP3B 3QAZC 4Q6IA 4P23A 4MB5A 4M93C 1EA9C 4P59L 3O6ML 3QZWG 1N6VA 4FQCL 4G8EB 2DN7A 3RWFA 5F7FA 5TDPB 2W0FB 3HRPA 1PG7L 4LSSH 4ODSH 1B6DA 5JPMA 3BPLC 1T21A 3X12A 3O0RH 5KS9E 5B4MD 1U8LB 1AC0A 3B9KD 1FG2B 2QEJA 5IIEB 1MPAL 3AM8C 2QKIA 3HCVB 4KUZH 2E3VA 2NXYC 1UWGH 3RX8A 2OTPA 4QRUB 4CAGA 3FT3A 3H3KA 5E99H 3DSNA 1BGXH 1NUFA 1T5WB 4HUUA 1JZ3A 5IW6B 5KS9A 3OGOE 1KTLB 2P49B 4Z95L 1ZOXA 1AGFA 1T3FA 4L3CA 3ARTA 2IGFH 1SJEB 3TV3H 5CJQH 5TH2B 3CLEH 5HYQA 2XFXB 1ZVYA 1DBAL 3RL2A 2VO5A 4WTZA 1GHFL 1IILE 1RUKL 1TCRB 1TCMA 2F54B 2VZTA 5KOVC 4K07A 2DQGL 4P2QE 5K9OB 3KPQB 3IVKB 1G0XA 2IJ0C 3VGFA 4ZAKD 5KSVA 5EDXA 1TLKA 4HPYL 2ILLA 3BKJL 1UJ3B 2CUIA 3MO1B 1JTOA 5JQ6L 1AIFA 4DFHA 1SMAA 1S7WA 2ITCB 2BVOA 3TM6A 2G75B 1A21A 3QFJB 5I1JL 2VZ1A 1JI2A 4MJ6A 4XWOD 1BHGA 5D7JC 4K23L 2Z8VC 2BY2A 4PTUA 1KEGL 1T5XB 3GRWH 3MLXH 1JFQL 5FV1L 3TBTA 1JNLL 2NY5L 3BISA 2Y23A 3PL6C 4PY8J 5C6TL 3LQZB 1X6LA 3KR3H 5DJ2B 4TQEH 4L3AA 2R69L 5DRZA 1Q72H 8CGTA 2CKBA 1PX3A 2AGJH 2ZNWA 3EOBA 3EO0B 3E6FA 4N0FB 4P0DA 1IT9H 3SGEI 4GW5A 3L3OB 2YK1L 2QTEA 4P5MB 3ZHDA 3GHEL 3CSPA 2KZWA 1YN6B 2OP4H 4XBGB 5IHLB 1CZ8L 4DGYH 1S3KL 4QRPD 2P5ED 2AV1B 4HH9A 1AGDA 3QXUA 3VMNA 4KJYB 2IPKB 4D9QD 1WZMA 3O9WC 2BHYA 43C9B 4F7PB 4L5FL 3V7AE 1C5CL 4Q9QL 5E8PA 2WBJB 2M26A 2GJ6A 4JRXB 2GK0B 4DFIA 4GW1A 5F3HB 4NQEB 2YPVL 3S5LB 3U83A 4HUXB 2PTTB 1Q9OB 3VH8B 1IGFH 5SWZE 1P7QA 3GO1H 4QHNA 5JMRA 1ZSDB 5IMKA 3V4VH 1E4WL 2AVGA 3DXAB 1KIPA 2PXYD 1NAKL 3L5HA 3TO4A 5IFHL 3STZA 3RY6C 1IQWH 2CRMA 5GGRB 1K6QL 5T3XL 3WJJA 1AC6A 5BJTB 3MYZA 3QG7H 5SWZA 4JGMA 5H94B 4QNPE 4PGBB 5IMMA 4A6YA 4TPRH 3ULVF 1ZGLP 4LAJH 1INDH 1G6RH 1U3ZA 5HGDA 2YD9A 1U41A 4KQ3L 4BFIA 4UQ2A 5CBEB 4U6HB 1H3WM 5LCVL 4EI5C 4PR5A 5KSAA 4KU1A 1J0KA 4ONFH 4I5BA 1KEML 4PJ9D 4U1MA 2KKQA 2VDPH 4HIJA 5BW7A 2DQCH 3DROA 4YDKL 2ORBH 4PGEA 5DJYA 2PCPA 1RFDL 4H0GA 4XRCB 4HJ0C 4WUUB 1JYNA 4F57H 4UMGA 1AKJD 3R0NA 1QLRB 2JK5B 3QQ9D 5HGHB 2VABA 1T20A 2YR3A 5FYKU 3MRGB 4X5WA 3HHRB 1Q0YL 5FUOH 1DANT 3KPPB 3RVTC 1IZKA 3FQUB 3HKFA 1PKQB 4BH8A 1BVZA 2CK0L 3MPCA 3QR2A 3H7BB 4S1QL 4OSUL 5AZ2L 1A7PH 3MRBA 4RISL 4PJHE 2LVCA 1T2QL 4WUKH 1MCPH 1OAZH 3N1GC 1R24B 3NCYS 4CGTA 3IB4A 3CFDB 3MLYH 3SDYH 4CBPA 2DQIL 1OSZB 1CN4A 3QI9D 1J8KA 3TYFB 4XMLH 2WP3O 2ZOKA 3U48A 1NKRA 3QWOA 1N3NB 4LSUL 1ZLSL 1SM3H 3KYMA 4RMUA 2YPKB 1UEMA 4XNYL 4ZTOL 4XC1L 3MRHA 5KVEH 1RZFH 4FNLL 4PJHA 2ICWI 3TLRA 3NZ8A 4DZ8B 1QO3B 3H9YA 1DN0A 1N0XH 4I3RL 2HT2D 4YHMH 2Z8SA 5DSCA 1FHGA 4FZEH 5LXGH 4M6MH 1BVKB 5EU3A 5ID0A 1KN4L 4S2SA 2JELH 2XWJA 2A83B 3FN0H 3W2DL 1L0QA 1AQDA 4ZFFA 4KHTL 3DVNB 3EYUH 3BVNA 3KPRB 4LIQH 3T0VA 5FOBB 2OBGA 1A14L 2AJZB 4ZUTA 3INUH 3S97C 2XY1A 2HJKB 4HDIA 1WV7T 3T3ME 3DTXA 4NNYB 3C9NA 4GKZA 1CICD 3O2DL 2IFFL 1T03L 2AEIT 4Y4HB 1SMOA 4R3SB 2EIDA 2ZUUA 3LZFH 4LHQB 2AQ2A 4PJ8D 4QXGH 1LO0L 1NPUA 2CDFA 4LQFH 4PRPE 1KB5B 2VITB 4WI5A 1C7SA 1XF3B 4OQ1A 4JHZA 1Z9LA 4HCRA 1OAUH 3MLVH 2F74A 4JHAH 1JF1A 2D9QB 2NTFA 1KCRH 3GSUB 3I85A 4EQ3A 4HC1L 1B4RA 3IDIA 4MZ3A 4OUUA 3LKPA 4PRPA 4X98B 4YPGA 4YIQB 1O5DT 4U49A 3BIBX 4M7KH 3TN0A 3B9EA 5KVMC 5I19H 5DC9B 2A0LD 4FXKB 3MRFB 3T0BA 3VH8G 4TNVF 1NUDA 4ZDHA 4OKVA 1JMXA 4LF3A 4ONOA 2VZ3A 3MSPA 4RMSA 4Y89A 4F80A 1DQDH 3U30B 1CGVA 2V7HB 4G7YH 1OW0C 3AY4C 4HKJB 3OHXB 5GIRB 3TVMC 2GCYA 3KPNA 3CLFH 3R06A 1IM9A 5DR5H 2ZJSH 4R4BB 1HCFX 2NW3A 3VXNB 2WBKA 2XKUA 3GI8L 3ZDYF 3BP7A 3WFZA 2UVFA 4C55A 4H8WL 2AJVH 5E08H 3OKDB 4HHAA 4U1IB 1FE8L 5HHNB 2KUTA 5HVWA 4LKCB 2FECL 4P2RB 4L3EB 3MFFA 1IC5L 2NY1D 4X6BB 4FQXD 2J88L 4HEPG 3IRZA 2OS7A 1LP9F 1Q9LB 3VE0A 3VXRD 1AJ7H 3D85A 4ZFZA 2Y6SC 1IKNC 3FB6A 1MCBA 1A1MB 4R26L 2X10A 2VAAB 3TO2B 1A7RH 4YHZH 3QYCA 3I9GH 2JCCB 3KLAA 3UP1A 1XIWD 3P4NA 3ZYIA 5CP3A 5I18L 4ZUUB 5T33H 3PWPE 5C0IB 3SGKA 1IGTA 2VKXA 4NWTL 4BFBD 4GMSL 3PXJA 2BC4B 4HKXA 3RY4A 1ZA3A 2HMID 4HG4K 3WFBH 4GXUM 1XF2B 2F19H 5FIEA 2EYRB 2VSCA 3OJVC 4P9HL 1OTTC 4YHPB 1J05B 3WL9B 5B8CA 1V7MH 7CGTA 3VXQB 4GXUN 5MENB 5M95B 1CD1A 1TVHB 4M61B 4OM1H 1XGYL 3UMTA 5LAXA 2JJUA 5EH1A 1J12A 5HHQA 3DLQR 3PWPA 4XPGL 3MCG1 2X2YA 3SKJL 4G6FB 1JRHL 4KKLD 2XTJB 3RWEA 3DBXA 1BF2A 5BV7B 2Z8WC 2I60L 3QIWA 3ARGD 4U0RB 5B4MC 1OGAE 2XKNB 1N5AA 2GT9A 1BJ8A 2FCBA 3B9KC 5D70L 1R0AL 2JIXB 1QYGH 3RL1B 2B5IB 1L6ZA 1T4KB 5D72L 5E1HB 1BBJB 1I1AA 3GHBH 3HMXA 4HS6B 2OMNA 3UROR 4J1UA 2ATKB 5C0EB 4NRZB 1P5VA 4KY1H 1GH7A 3DX8A 4MCYA 3RWDA 1VEOA 1OGAA 2VYRE 1FFOA 2EKJA 3O41A 1TVBB 5BCAA 5HYJB 5CAYB 5E94B 1QBMH 3BD5A 1NC4A 4TVPH 3RP1A 3HZKA 4OIIH 1HHIB 3WFCL 3SBWC 5IBUB 4FMKA 4V1DE 1MAKA 1MCEA 1F02I 2R56H 4HLZH 2GY5A 5ERWA 1ED3A 2X1WL 5IJKA 4G42B 2DBLH 2EXYD 1JNJA 5F7NC 3U36A 1DZBA 3IKCA 1JGLH 4ZAKC 4W6XB 3RGVD 3TBSA 4P5TD 4J3SA 4LPUA 4YEEA 1JZ8A 4O2FA 1OB1B 3ZE1E 3SDAB 4Z7VE 3QJHB 5IQ9A 4PJ5B 4Q6YA 4NQVA 1EXUB 3QUZB 2GEEA 3KPOA 5BVJA 1HKLL 1V3KA 3L5XL 4GQ9H 4Y5XC 4XWOC 5FGRA 3OGCA 1B3JA 3ALXA 3V6OE 4AT6A 3MOBL 4LPXA 1YUHB 3TWCL 3FB7A 1L9NA 4DKDC 1G7PB 1XH3A 4K55A 4Z7VA 4J6RH 4JG0L 4YHKH 5DVLA 2QQNL 5KAQF 5BS0D 2Z35A 5IVXB 3GMMA 4K9EC 5FYLH 2HVJB 4HUVB 3KPLA 1Q9WA 2AI0H 2P7TB 2B4CC 4LVOC 3TPUB 2CXKA 2HFEB 2VERN 3V6OA 5CZVL 2FDBP 2PYEE 2FX8L 4XB7A 4LK4A 1S7XA 1ETZB 1IGYB 1AFVH 5I74B 4OLWH 1OPGL 1XF1A 3KS0J 2E7HA 5FKAA 4QHKI 2YKLL 3BWAA 4RGOH 4QT5A 1FAIH 4JPKH 4O5LH 1VFBA 1F3JB 5L2JB 5EN2B 1UCBL 3G6DL 2FJHA 2PYEA 5IF0B 5IVNA 3WNMA 2AJYH 4MAYB 3VG0H 4N8CH 4W81A 2PXYC 3HUJE 3OKEA 1WC7A 4ETQA 3ARUA 4X0KB 3RNQB 2HRLA 1UADC 4W6YB 4NQXB 4C58B 3RIAF 3G04B 2Z4QB 4JVUA 4POYA 4KZDH 4M8QA 1T2JA 3ROOA 4HXAH 3HS0A 1I7RA 4BZ1H 4ZD3H 2IMNA 3U46B 3TNMA 3VFSA 5DRNA 2FO4A 4NN5C 5T1DL 2J5LB 3HUJA 1KIRB 5IVXF 2OL3B 3F58L 5FGCB 1EEYB 4O9HL 1M05A 2NY5C 4N0YH 1QUNA 1QBBA 3T0ED 3TCLB 4TNWF 5D5MF 1DQMH 5IKCA 3IU3B 4M5ZH 5SV3A 4DN4H 3VI3F 4JZOA 4PJ9C 1JK8B 1DVFB 3MBEB 3NGBC 5ITBH 1R3HB 1AGCB 1U92B 2A6JA 4U2ZA 3M45A 3IT8D 4J8RA 2X70A 3O6MH 2HFTA 3BFOA 3CVHH 3KXFE 1R5VA 5I73C 5L2KD 2FR4B 1U8MA 1UM4L 3QQ9C 5D1ZB 3S37L 1RJCA 2Y1VA 3K2MC 3BEWB 5EC1B 4LVNC 1HWHB 3JZ7A 3AS3A 3G08B 5E2VL 1A6ZA 4APQD 2MNUA 4K9EH 4JQVA 5KAQG 4KVNL 3KXFA 25C8L 5CILL 1MIEL 5DJCB 2B4CH 3RWCA 5GRYA 4ALAH 2GITB 4IM8A 3VD7A 1AO7D 3QI9C 4I4WB 5ALBH 3VXPB 2F15A 1MCIA 3GSNB 3MV9D 4U7SA 1N2RB 5IOPB 3PP3K 1CD0A 5IBUG 4WV1A 4Y1AD 3MBXL 2R0ZH 1TJIL 4UTAL 2ID5A 2PETA 1WITA 4MSWA 1Y0LA 1GHFH 5DK2B 2HT2C 5BRZE 1KBGL 4MLSA 1IM3B 4NKOA 3OJMB 1XGRA 4PJ7B 2DQGH 4MXWL 1QFWI 3E2HB 3H8NA 1BEYH 3TA3D 3SCMB 4MGXA 5DQDL 5DK0A 1L0XA 1C7TA 3LHPL 3ZE0F 4TNVK 1Z0NA 1DE4A 4LLVA 5JQ6H 1NGPH 1NDGB 3P30H 1L7TL 5C0AE 4N0RA 4X4ME 5BRZA 4WW2B 1CICC 5CBAA 4R0LA 4XZUA 4K3EL 5FGBA 1FBIL 4DTGH 3ARED 4PJ8C 1KEGH 5FECB 2DWDA 3QEHA 2NY5H 1GZPA 1QFHA 4WHYH 5FHBL 1ORQB 1FZKB 5ICXA 1K85A 2F53D 1I75A 3ARDA 5DYOA 3HZYA 5I71C 5C0AA 1GPOL 4P2OD 4D2NA 1FLRH 4JM2D 2R69H 4X4MA 4KWUA 3LEXB 2HG5B 4UOW1 4P4KB 5TE7L 3FQWA 4Y2DD 4FQPA 3PF2A 1N4XL 5ITFB 2WLZA 2W65B 2Z91B 5AUMB 4IHOA 3N1QC 4L9LB 4OF8A 3MRDB 2IH1A 4JFPA 5DZLA 2GFBB 1VDGA 1OWRM 4FABH 2LE9A 4G9DA 2A0LC 4JJ5A 1T7VA 2J12B 3HE7D 2X7LB 4Q9QH 2AAVA 4HK3N 3MLUH 3RX5A 4K3GA 1MFBH 5FXCH 2DQHL 5CINL 4PJCB 4YE4H 2C4XA 1CQYA 5FA3B 1CFBA 3ZT5A 4MJ5A 4IIQA 3V0VA 1IARB 4WW2F 4I13B 2H32H 1GC1L 1K6QH 1BZ7A 3EKCA 4B7IA 4C83A 4AM0A 2NY1C 1QQDA 3ABZA 4I18A 4FQXC 4K8RL 1GGBL 1IAKB 1XF5B 5KSBE 3GSOB 3RDTB 5K9KA 3FQRA 4OI7A 2E5EA 1JCKA 2VH5L 3I50L 5I1LB 3DUSB 3LKQA 4OLEA 4KPHL 5DVMA 1G0DA 5E03A 2VRAA 3MRPA 1UJTA 5LCVH 3OR6B 1XIWC 1ZE3C 1KEMH 2ZUQB 3CFBA 2VLJB 2X9XA 3BYYA 4K7FA 3ZYJA 5KSBA 2FEEI 4QRTB 1KN2H 4S1SL 3PDOA 2HMIC 4U1KA 3Q3GB 4I2XA 4EXPX 5EBGA 1NAML 1F97A 4G5ZL 5C7XH 2QSQA 4NKDB 3P4OA 4PJCF 4WEUD 4UB0H 2EDOA 4EEEA 3UJTH 4MNHA 1WWAX 2DI7A 1F3RB 1YMME 3GRWA 5IB5A 5JR1L 4S1QH 1KCUL 4KKLC 1FDLH 1LK2A 3PHOB 5AZ2H 1F5WA 1F11A 4ZOAA 5TE4H 2EH7L 5DD6B 4NWUL 4H26A 1T2QH 3ARGC 3VFRA 32C2A 3VRIB 3SHSA 1EHNA 2F5AL 4NCC2 4CN6A 4EUPH 5HHOB 1X5YA 4XCNA 3U6RA 5F9WB 3IAPA 2XNAB 2VL4A 4OAWA 4QXTA 1ZHNB 1UYWL 1J8HE 3KLSA 4NSKA 3PXHA 1ZLSH 1Q0XL 4S11A 4XNYH 4ZTOH 3FFDA 1ZVSB 2DAVA 2G5BB 4LLQA 5EIIA 1A9BB 3PWVB 4MLIA 2ZUYA 4XNUL 4I3RH 4DGVL 3WKNA 2OJEB 1U42A 3MUJA 2RJMA 3BO8A 2WIIA 4LHUA 2R23A 1J8HA 3QEQB 1R3IL 4O02L 1G7LB 3V6FB 5E5MA 1KN4H 3V8CA 3QUYD 3RWJA 2H45A 3AM8A 2FLRT 1BQHA 5E2JA 3W2DH 5CEXA 2M8XA 4J23A 3H2WA 2EXYC 4M7LL 2Q76B 4P5TC 4UTBL 4OM0H 1LNUB 4P9HC 4HWBH 5B38B 2CDEA 1QKZL 5SWQB 3GSVA 1NGXB 2WWKT 5DI8B 5HHXL 1E28A 5ADPL 3KAAA 4U6XB 5E9DB 1G6RA 1XGUB 5BZDA 3HN3A 4ODXB 2R0WL 2D0FA 3Q5TA 4LDLB 4CVXA 3QJFB 4AEHH 3SDDD 1KCKA 5LGKA 4YC2C 4JY6A 1NFDA 3RIAK 5DTFB 1JWUB 1RULL 2V2WA 2X9YA 4Y4FB 2DF3A 1FFPA 3S4SG 3WXVL 4YHNA 2ICEA 4YDIL 1RIVL 1KELL 4LCCC 4X6DB 2EDXA 4RNRB 4LGSB 2HJLA 3O3EB 2XG5A 1CU4L 4RCAA 4Z7WB 2APBA 5T5FH 2R39A 3ME0A 4PJXE 4C54A 4LRNH 4TNWK 5D7JA 4YDLB 2G5RA 4MAUL 3B83A 5D9SB 3I6KB 3SO3C 5E00A 2NY3B 3ALPA 3WFDL 5SX4H 2AEQL 3PL6A 1JGDB 2YUZA 3RVUD 3GI8H 4Y5VB 1KC5H 2BMKB 5DEFA 1FPTL 4PJXA 1F90L 3LIZL 2XWBA 5ACZB 3V5DB 4CVUA 3DX9A 2BSRA 4JFFD 1M7IA 5TQ2L 1UQSB 5EA0L 2J88H 1ROWA 5JW3L 5JXAH 5AEAA 2GJZA 4HUNB 3O9WA 2FATH 4G7VL 4Z76A 4OI9A 1LQSR 1U93A 5H37H 4LIQE 4PV8A 4JB9L 4XCFL 5GISH 4N68A 4ELMB 1M7DA 1OT1A 4UV7H 4DZBA 4CU6A 5FK9A 5TDOB 4X6DF 1FNHA 4M6AA 1LILA 4TTGA 3D48R 3FCTB 3MA9L 3P0VH 3T0EC 2F54D 3L3DA 4JM4L 2CMRL 3ARRA 1X3DA 4NWTH 4GMSH 3I75B 4Z7WF 2HVKB 5TFSH 4P49A 4Z7QF 3T77B 3TF7C 5D2LA 3RY6A 1A47A 4D9RD 5A16B 1WBXB 4P9HH 4JPIA 5T1LB 4LLYA 4GRMB 3C09C 2Q7YA 3EHBD 4LVHB 3UTTB 3QFJD 4JHWL 2C3VB 3E6HB 1G9EA 3SKJH 2AKRA 4E41E 4ZG1A 3N0PB 4U1SA 3LS5L 3KYAA 4X4XB 1XF4A 1RMFL 3R4DA 2UWEB 2VSDA 1N6QH 5I1KH 2AQ3A 1TTGA 1TZIA 4EI5A 1N8ZB 3W5NA 1NDMA 3ULVD 1G1CA 2VL5A 4APQC 1R0AH 3DPBA 1IL1A 4AL8L 1W0WA 4F7TB 3B5TA 4KZEL 1BFOB 4OFYD 1XGQA 4E41A 3P2TA 4F2MB 4YR6B 4YFLI 4ELMF 1YYML 2HTLD 1E6JH 5D93C 2XZAL 3DX7B 1BVLB 1UWEL 3KLDA 1A1OB 2GSGB 2ZUVA 1RJZB 3RBGA 1CLZH 1A6TA 4PRHB 4D0DB 1QFUH 2FSEB 4JGJA 1R5IB 3ARZA 2WBJD 1MJ8H 5ALCL 3WFCH 3VXTA 4JRXD 1SYVA 2AQ1A 3LMJH 3D18B 3QDGB 5DA4A 4BQ8A 2XZQL 4JCLA 3WUZA 3MCKB 3AUVA 4GW4B 3LD8B 1EIBA 3NIFF 4LCYB 3DXAD 4UT7L 3TA3C 5B38G 4OZGA 4PJDE 5F88A 3VXUB 3WLBA 1ADQA 4OCYH 1A6AB 3ET9F 4PRAA 4UAOB 1S9WB 2UWEF 3PWNA 1BFVH 4AEIH 1RVFL 5C86A 5E4EB 2FZ3B 1W0VA 1JL8A 2ENSA 3AREC 5HGBB 3D39E 4PJDA 5TPWL 3MOBH 1CVRA 2VDQH 4MJID 3QT2A 4JG0H 4O58L 2QQNH 5C8JA 4P2OC 2C3WA 4JM2C 3CIQA 4ZPVA 4P3DA 2MHAB 4Y2DC 4LSVL 1UCTA 4X7EC 4KJQD 4IRJB 1VGEL 4R4FH 2VXVL 3D39A 2WUCL 3T0WA 1G9MC 1MHCB 4JN2B 4NYLA 1P2CA 3L6FB 1N64L 3V6BR 1ZT7A 3HE7C 3MRNA 4TUJA 5C9JB 3OF6D 3GUTB 3I6LE 5EO0A 1KB5L 3SOBL 1AD9A 4Q9RL 5F9OL 5IW1B 3KPSE 2WSKA 1MLCB 1UM6L 1WEJL 2E27L 4WI9A 3GMRA 3GKZA 1HCVA 3VFWB 3G6DH 3IDJB 2J4WL 4WW1A 2VDNH 3O3BA 5GZOD 3ARFB 4NZRL 3ZT7A 2PW1B 5E5RB 1JHKL 5BVPL 2R0KL 3WHE0 1BOYA 3MGOA 3BP6B 3O2VH 5EUOE 3D1MC 4ZSOB 1JZ4A 2Y06L 1MI5E 4MHHI 2HN7A 3LOWA 2BVPB 3KPSA 1SJXA 3BZFB 1D6VL 4LLMB 1A9EB 1WZ1H 2FIKA 4JFDB 2DQDL 5T1MB 4PJBE 4WU5B 1D5IL 1OW0A 3QDMD 3TVMA 3A6CL 3VFNA 1N0LA 4BQ9A 4F58H 2P42B 3F58H 5EUOA 3W39B 1WBZB 4Q9CA 4KRMB 1U6AL 4LCUA 1MI5A 3PV6A 3TBWB 4GG6E 3AAZB 3MUHL 4HFWB 4PG2C 5ID1A 2CIIA 3GNML 1NCDL 4CN4A 3DRQA 5E8NB 4PJBA 2Q86B 4AH2A 3KPRD 1CLOL 1PG7W 4Q7DA 5C0DB 4MNQE 3QISA 5SWSB 2EEDA 4JRYB 5FYLE 4G9FB 3VJ6A 5I8OH 1IKNA 4JZNA 1SEQL 1EFXA 2NY7H 4KTDL 3BRFA 4ORZC 1X5JA 1HI6B 1VADB 3LEVH 5J13C 5DRWB 3NH7L 5GGUB 3EZ8A 1QRNB 1U3YA 1FRGL 4DK3A 2Y07H 25C8H 1MIEH 4MNQA 1M6OB 2VZVA 1Y18B 1MFCL 3S34H 5DJ6B 3QXVA 2FYYB 4B5EA 3BPNC 3VFVA 4M43H 5J1AB 3VXSB 8FABA 4WY7L 3HI5L 2AV7B 5D6CA 1W8OA 3NAAH 4MWFB 3U2SA 5HVFB 4PLKC 1TJIH 3TNNA 4UTAH 1TZHB 3LKRA 4OCSL 3BIKB 4FQHB 5J11C 1IQDA 1PKOA 3CSYB 1QSEB 3DUUA 4NQDD 4E9LA 4OUOA 5DUML 3F65A 3SJVB 5BV7L 4HWNA 3B9KA 2FEEL 2VLKB 3C2AH 4FFYL 2VE6B 3IS0X 3QUYC 1QD0A 5DQDH 3ULUC 4NKMA 3GJFK 4XP1L 1BX2B 4X7DC 5D1XB 1C12A 3PP4H 1SJVA 4X6EA 2C26A 4O4YL 4WGVB 3BKYL 3V4UL 1PSKH 3W9DA 4P2RD 4L3ED 5E4IA 5FKPB 3PE9A 1MCOL 4ONHA 1JE6A 4GRWB 2OR9H 4BH7B 3N1FC 4U6VL 4M1DH 4FFWD 3BH9A 2AJXH 5GXBB 4YAQB 1JWSB 3SDDC 5DF0A 5FDWB 2XN9E 1GPOH 1EUUA 4GXVL 4L8BB 3CFJA 5H2BB 4F15C 5FB8B 3V79C 1X4ZA 4NPYA 4NOBA 3CMOL 4IMKC 3NTCL 1VFAA 4ODVL 4ZAKA 4D8PA 2F8OA 4JFYB 2P4AB 1HHJA 4X7TB 5F7MC 4F37F 4BM7A 4FG6D 2HLFD 5KVGH 4NNPH 1MRFL 5LGJB 2QQQA 2GUOA 2A6DA 1MY7A 2HT3D 3CVHA 2ADGB 2DMKA 5FA4B 4Y5XA 1U8QB 2NW2A 5LWYL 1J0ZA 2VR9A 2OMBA 4UDUB 1JI1A 3O6KH 3CMGA 1N5YL 1FL3A 5CINH 2P5EE 4G6FD 5FO7B 1LD9A 4D9QE 1OVZA 4ZS6D 4H5SA 3RVUC 3QA3B 1U8KA 1IC1A 5L0QB 1LEGB 1YN7B 4P4RB 5I30H 2ZPKL 4MNGB 2JIXD 4GRWF 4QHLB 5DDHA 1NFIB 5I1GL 4KKBD 1GC1H 4JO4L 3T4AA 2ZSVB 2UZXB 3NIGE 4OJFH 4QRPA 2P5EA 4LASH 5A43C 3C60D 5JOPD 2WV3A 3VFGL 1RZGA 5MEOA 2XICA 2F9BT 3V0WL 4JKMA 1HH6A 4HQQH 1RZJL 5TDNB 4P9MH 3BI9X 3QNYA 1AR1D 3RHWF 3RUGB 3TJHD 2P48B 1HN1A 1WF5A 12E8L 5KSUA 1I8IB 2IG2L 4QTIL 1EAPB 3FN3A 2EKSA 2IALB 4ZUVA 3OMZA 3BD4A 5IR1A 3VDCA 3NOIA 4DEPC 5I8CB 1WAAA 4MA8H 1U8HB 2PXYA 2R1XB 1MWAB 2GTWB 4GLRH 4U6YB 3WNOA 4B41A 3L95B 4ZFGH 3L7FB 2IPTL 4Z9KB 4UBDD 5C07B 5AZEL 4WNQA 4JQXA 4CVWA 3G5YA 4ZPTA 3QDHA 1A4KA 2OTWA 5CGTA 4PJ5D 3IXAB 5BO1H 1SJHB 5DHVB 2V2TA 1XAUA 3EHBC 4GG8A 2DL9A 4FXGA 1CXIA 5JR1H 5GJTL 2DIJA 2OR8A 2OL3L 3T4YA 4F7MB 4S0TD 2MTPA 3QEUA 4L4VB 1AXTL 4ZO9A 4PJ9A 3RVWD 4OFVA 2K9UA 3ULVC 2ERJB 5C9KA 5IT2H 4OT1L 1YECH 1T0MB 1N6UA 5EU7C 3Q6GL 1HNGA 3BP4A 5I8EA 3LKSA 1Q0XH 3RUGF 5IFJA 4KXZI 1K2DA 1AKJA 4PS4L 1I8KA 4HT1L 2HTLC 4FFZL 3HMWH 2YHGA 4PJEF 3DVFA 1IAOB 5F7WC 3P4MB 4MA7L 3MNZB 2EDRA 4W4NA 5BZWB 3MLZH 2CGRL 4Q2ZB 2WBJC 5HDBE 1R3IH 3H9HA 4LLUA 1F4WL 4OZFB 3MJ9L 3EFDL 5I76A 1TQCC 3HFML 2VDRL 2CLZB 5IESL 1IEHA 3KDMA 3QI9A 4M7LH 3AS2A 4NM8L 3EO1B 2BSTA 3SDXB 1CIDA 1UH2A 3GSNL 1JPSL 5HGAB 3S3PA 1A0QL 2EICA 3CUPB 1ZWIA 1OOAA 3WJLC 4U1LA 4G6ML 3GBMH 5HHXH 4BQCA 5ADPH 5FYJL 4M5YH 2DRUA 3DOSA 3U4EB 3BGFC 2VDKL 1U95B 5DJDA 2FBJL 3MA7A 3MLSL 2I9TB 1OLLA 4CMHB 5E2UL 2X1PA 3LV3B 4NN6C 1PGRB 4PY7B 5GSRA 3IDNB 3HNSL 1Z3GL 2UZIL 5C0JB 3KYNB 3MJ8A 2BVTA 4Z0BL 1FN4A 3C8HA 1KCVL 4HG4J 3SDCB 1AH1A 3MRIA 5DD3L 35C8H 1Z5LB 1B4JL 3SN6N 2BJML 1MF2H 3EDFA 4PRBA 1KPRA 1BPVA 4KJQC 1CU4H 3BX7C 3R1GL 4PUBL 5MHSE 1CICA 2QADB 1T0NB 3MV8D 1P69B 3VD4A 1NMBL 3TH3T 4NQSB 1KENL 4MAUH 4OIBA 4PJ8A 3MTRA 2IAMB 2BSSA 5D1ZD 2AEQH 1AXSA 1OF2B 2X44D 3KJ4B 1GGCL 3TBVA 3ZT6A 1DUZA 1D5BB 2ED8A 4RGNB 4HS3A 5HHME 3ULVH 3V9FA 3SDXF 4O2CA 1A6VH 4Q0XH 1NMCB 5GZOC 4YXLL 1HSAB 4EUPA 2AJUH 2O5ZH 3O6FD 3O45A 4U7MA 2D03H 5C3LD 1R3JB 3LH2H 2H2SD 4DQOH 1S7RB 2DIBA 3D87B 5ISZB 5DJ8A 4E0RA 5JW3H 2X89D 2CR3A 2HH0L 1RK1A 1HILA 1A6WL 3BMVA 3U0PA 5INDA 4EDXB 4GRLD 1QHPA 1TJGL 4HIHB 4JB9H 2YSSA 5GS3A 2G2RA 2YMXL 1NBYA 2ZZUT 2FX9H 4CU7A 1RHHB 2A74B 4G8GD 3QCTH 2BNRB 4TSAL 4Z7OE 3VXRE 2CUMA 3MA9H 1ULVA 3PWUA 3P0YH 4NUGH 2CMRH 3K8KA 4TULH 1FH5L 5EU5B 3TT3H 1WSST 1DEDA 2EDLA 3SCMD 1EJOL 3G5ZA 3U9UA 3L7EB 4NIKB 1NANH 1VGKB 2NY4D 3VMPA 2DM4A 5ESVB 1K4CA 3L9RA 3P11H 3PHSA 4FQXA 4NGHL 1JZ2A 3MRJB 4UV4L 2DLFL 3VXRA 4HMEA 4HWBA 1NANI 3O4LD 3C5ZB 3SKOB 5JTWA 3ARVA