5FHAH

Crystal structure of protective ebola virus antibody 114
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
215
Chain Sequence
EVQLVESGGGLIQPGGSLRLSCAASGFALRMYDMHWVRQTIDKRLEWVSAVGPSGDTYYADSVKGRFAVSRENAKNSLSLQMNSLTAGDTAIYYCVRSDRGVAGLFDSWGQGILVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and molecular basis for Ebola virus neutralization by protective human antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody 114 Fab heavy chain
total genus 49
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fhaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fhaH01
1H9VA 2EDOA 4G9FE 2WLZA 3U6RB 1NFIB 1WZLA 4C4KO 2A6IB 4I77L 1BOGB 5F7MC 4PJBA 1AQKL 3ZYOA 3QI9C 5CHNB 5GSRB 3IFPA 1NSNL 5BV7B 3KYAA 4LGPB 4XNQB 2VITA 3F5WB 3B8SA 3D2UB 5H94B 1MJ8L 2HFGH 5C2BL 2FIRT 1WGOA 4LSUH 2XN9D 2EXWD 1OAQH 4O00A 1KLFA 4JPWL 1JWMA 5IFJB 1ACZA 2NTFB 5I1GH 4XPFL 5ACZA 5JO5B 3G04A 3EDEA 3CUPA 5EU6B 1MRCH 2I07A 4OUUA 3KPTA 2QQLL 3QPQC 3BP5B 3LDBB 3GSNH 5IFAL 4Q74A 1ETZB 3ZMRA 5DFWH 4AH2B 4MJID 4ZFZA 1I3VA 1ERNA 4M1CD 1NC2A 1EA9C 3SKJL 1N3NB 4CW1A 4X99B 1CXFA 1WAAE 2QQKL 1FVCB 3MMEB 5KSUB 1A1OA 2EYTA 4FFWC 2UY7A 2CGRL 4OGXL 2EDJA 4LVNC 4Y5XC 3CLFH 3NOIA 4HUMB 5JIIA 3X13B 5CGTA 3V5KA 5EOCH 2DKMA 4RFNC 4WWID 4LVEA 5CIPB 1CE6B 3DYPA 4Z77B 4P23C 1A6WL 1B90A 3UPRA 2VLKB 1EHAA 4ODVH 1F4AA 1UEMA 1GGBL 4XB7A 3QQ9C 4NFBA 4DQOH 2Z92A 4PJCA 1NGQL 2GHWB 3P4OA 2IBGA 3QUZA 4DOHB 4OQTH 2KL6A 2BVQB 3BWAA 4WNQB 4XBGA 4XXDB 3O3AB 2UUDK 2MQ0A 1UWEH 4UTAL 3C5ZA 5IR1B 4NFDA 4ZXBD 3QJHB 3EFDL 2QLVB 1MLCA 4S10A 5D1XD 3JV4A 3GJFH 3VXSD 3DBXB 4PJDA 3MC0A 3QHFL 4S1QL 1T5XA 2IH1A 3LPGA 3W82A 3I84A 3AREA 2C1OA 4UIMA 3P0YH 4R9HA 4MYWB 4HC1L 3GHBH 5D1QA 4KI1A 3KWWA 4DZBB 3IFNL 5T1KD 5EUKB 5D1ZD 1Q9KA 2N4IA 2ED8A 3WXWH 1G6RH 4KROC 4FTVE 1MVUA 2IFGA 2V17L 3OZ9H 3SY0A 1N8ZA 4JO4L 4Y4KC 2P5EA 1KIRA 1QD0A 5EC2B 3KYKL 5GJTL 1KTRL 3JWOC 5DZNA 5FDYA 5E08L 4N5ED 4EBQH 4QY8B 3EFDH 1YY9D 5BS0E 4G7YL 3U9UB 3H0TA 1NGXA 3Q2CA 1G7PA 4EIGB 4JHWL 2JJWA 5LGHH 5I16B 1FFPA 1DLHA 5KJRH 5CIPA 2R0ZL 3NCYS 2DLEA 3LRHA 12E8H 2BVQA 3JBG7 1TTFA 3VD7A 3NH7H 4UQ2B 3PJSA 3QJHA 1IILE 4Q6IB 4MXWH 5I1HL 1XF5B 2PYED 4LSTH 4ODVL 4EN3A 2PXYC 4JPKH 4HF5H 2RGSA 1T0NB 4G8FA 4BZ1H 5I19L 3MV8E 4NSKA 4UOJA 5EOCJ 3V0AC 4LVOC 5T33H 3NMEA 3GB7B 1HQRB 1Z9SA 5HI3D 2H26B 1YJDL 4LK4A 5INDB 4JZJB 3DXAE 2DL9A 1XZ0A 5F7HA 3ZKXB 3UEZA 3H8NA 5FM8A 3I3DA 2LVEA 5IW1A 1MFCL 3DI2B 4M7ZB 1CFQB 4XAKD 1RUML 3BPLC 5DMIH 2X4RA 1H5BA 4I5BA 5F97E 4Z18A 4D0CA 3K2MC 3CPLA 4F2MA 5I75B 4DVBB 4FG6C 1ZT1A 5DJ0A 2D03H 4Y4FD 3MV9E 5LQBH 4JN1L 3PABA 2HH0H 4NQEE 1CDJA 4NP4H 3HR6A 1UZ8A 1EJ6A 1QRKA 5D70L 3ZDZF 4G80A 1ZTXL 4PJIF 3BKMH 5HYIA 5I1EH 1N0XH 4RISH 3HS0A 4YHLH 1FN4A 3HMXL 5DJ6A 5DRWB 3RWCB 1T66D 4FXLA 1CGUA 4N5UA 4P9MH 1KCUL 3TT1L 1IFHH 4HD9A 4O5LH 3E8UL 1CGYA 3KPQB 1G9NL 1RK1B 3GNML 1CD1A 2ATPA 1S7RB 1T3FB 2BXYA 2MMXA 3DV4A 3C9NB 1R3KA 5KS9F 3ARBA 1KJVB 5LBSL 2ZUUA 4K7PH 4PJIB 3M45A 1P2CB 4LIQL 4PLOB 5IBUG 4H0GA 1AGDB 1EAPB 3MYJB 2PO6A 4NGHL 4P2RE 2IBZX 1HE7A 1P5VA 3FO9B 5DA0B 4KJWC 3O4LE 2VIRA 4NUGH 1CR9L 4HUXB 3RFZC 1OAKL 4BZ2H 3SDYL 4G7YH 1NJ9B 1XF3B 2NW3B 1MWAH 2B7DT 2GUOA 3RWEA 2ADFL 5F6IC 4E5XA 4ZFFA 5C9KA 3S36X 1TTGA 4RFEA 1HNFA 4OB5L 1NMCC 4WU7A 1BPVA 2HRLA 2AEPH 4OLUL 4KDWA 5JHDE 3S88H 1ORSA 2VRAA 4J6RL 4OLXH 3BQUA 1HINL 4JY4A 1W0WB 4IHOB 1UWXK 4RIRA 3SKOB 3MBXH 4X4YA 4X98A 4O2CA 3EJZD 4MB4A 1CBVL 3G6JE 2D4FA 4OAWB 1NSNH 4E41E 3O3EA 5E9DB 4E41D 4KK8D 4XPTL 2X1XR 3ARGB 3LQZB 2A6DB 1JI1A 3VXQB 4NBZB 3WXVH 1FFOA 3OJ2C 1CLYL 2Z31C 3L95A 1MUJB 1UZ6E 1BIHA 3TZVA 1N0XL 4RISL 2DTSA 3QDJD 4XVJH 1FVDA 3SPVA 3UC0L 2NY1D 1S5IL 3SGDI 4KGJA 4JDTH 1L4IA 5D1QB 1BVZA 3T2NH 2RCSH 3CFKA 5DJZA 1LO2H 1CGXA 1G9ML 1RJCA 3PNWB 3TF7C 5EU6D 8FABA 4Y2DC 4N9GB 3S7GA 1RVFL 4MAYC 4TRPL 1XGUA 4F33A 2BSRB 3PXJA 3RWGA 4QO1A 4JFPB 5ERWB 2CRIA 3EFFA 5DK2B 2P45B 4F57H 3KPSB 5D1XA 2B1AL 2R1WB 3RUGF 2VDKL 5HYJB 3QCUL 1XIWA 4PRHA 4X7EC 1EVUA 1BGXL 3GKWL 4HLZG 5F88A 3W0WB 1QNZL 4KJPD 5B21A 1ZHBA 4KRNA 1WTGT 2DJSA 4AG4L 5JNYA 3MLRH 4BH7A 5F7YC 3S34H 4WHDA 1FLRL 1G84A 4LFHG 4KMTL 4AM0B 4YJZL 3N50A 4X7DC 5AEAA 3AROA 4P99A 4NOFA 5CEYB 4K2UH 1A14H 3O6LH 4O58H 1RIVL 5EU5B 1JWMB 4M6ML 25C8L 1EK3A 4JKLA 3B3IA 1X9QA 1CL7L 1FNAA 3HMXH 3TWCL 2BNRA 3MXVH 2XWJA 3KYMA 1JV5A 1ZT4B 2DQIL 5EDXA 1WT5A 4AENA 4XNZC 3CFKB 5DJZB 4BK4A 3RX5A 3SBWA 2NTFA 3FQWB 2C4XA 3AREC 1CDBA 5BVPL 4X5WB 1PSKL 4PG2A 2YBRA 3VWJA 1ZHNA 2FATH 1EH9A 3AUVA 3T3MF 5B4MD 4K7PL 2NXZC 1FO0H 4FQJH 1YUHA 3FCTA 5T1LA 2ARJB 1FZMA 2RCSL 3TO4D 3K1DA 4IOFC 1J12A 3ZDYE 4HKXB 1P9MA 3JWNC 4P46B 2X4OA 5JHLL 4R3SB 1PEWA 2LVCA 2PCPB 2OR8A 3ZTJH 3EBAA 5DK2A 5D93B 3UTTB 5CEZD 2JB6B 1CE1L 1XF2B 3PWNB 5JUEH 5KS9E 1GZPB 3UBXG 4NKDB 4U1LA 1CD8A 5I66B 1ZLSL 1ZSDB 4J3TA 3JXAA 3I6KA 4P9HL 1QBML 3TH2T 3MX0A 4HJGB 1F8TL 3KHQA 4PJ5A 5GRXG 5EIIB 2ZUVA 3LMJL 4LAQH 1E0OB 3VXRA 1YEKL 1QSEA 2YN3A 5I0DA 3PV6A 4UTAH 3O6KH 1C7TA 5JQHC 4Y5YA 3IDGA 4N8VB 4CN6A 4P9HC 4M5ZH 2Y06L 3OX8A 1RHFA 3AB0B 1GHFH 3MXWL 4JB9L 2IH3A 3FQNB 5EPMB 1WC7B 3RL2B 1MJUL 4GAFB 1E4JA 1GXEA 3V4UL 3WFHB 4NZRL 4TNVF 3PGDA 1P69B 1AGBB 5EWIL 3FO9A 5ADPL 3ARFD 4NUJB 1E4WH 3QR2A 3FL7A 1F3JB 1LEGB 3PF2A 5JZ7C 5E2TH 3HLAA 4TQEH 2VSDA 3RWHB 5FO8B 5F9WC 1AJ7L 3SKNB 3P9MA 5B38B 4YXLH 3G9VA 1KLUB 2DYPB 4LLVA 1Q94B 4KY1L 3IS1X 1WZ1H 2XYCA 4WTWA 3BP6A 4HZLB 3NAAL 4JY4B 5B8CB 3VGDA 3NPSC 2BRRH 1JFQH 5SX4I 5KSBB 2QR0B 3QNYA 2DLGA 3P40A 4LLDA 4U1JB 7FABL 3OAUL 2O5ZH 1PVHA 1BD2E 4X6FA 4G6FB 4HPYH 4B50A 5BV7C 3FT2A 3U30B 2Z91A 5C0AA 3FQNA 2Y25A 4JO3L 1CF8L 5EPMA 1UEYA 4FOMA 3WDIA 3MRRA 5IBTL 2PF6A 4Q2ZB 1F00I 4XVTH 3IDXH 4YWGL 3VGEA 3WFBL 1JGLH 5FA4B 1FYTE 4KI5D 3RHWK 4EZMA 4ONOA 1YJDH 2HT4D 4XHJC 25C8H 3GI9L 1LVEA 1ZVHA 4KHTL 3RJDA 1NAMA 3BN9D 3DRTA 3DXAB 2ICWJ 4ZFZB 4P2OB 1OAXH 4J4PC 4DKEH 1RZGA 5T3ZD 3SJVB 1RUMH 2YSSB 2EE2A 5GGUB 4P4KC 4RA0C 2YK1H 1NL0H 4M61A 4TVPD 4NRYB 3U4AA 4Y1AB 1MFCH 5HSFA 5I30H 1WFUA 1LO4H 1QO3B 1NFDB 4D8PB 1NCAL 1AXSB 4HMDA 5C6TH 1U58B 15C8H 3PWUA 4LVNB 4FQJL 4PV8B 1KXVC 3HUJA 1ES0B 1YNTA 3I50H 4KAQL 1NCUA 2Q76A 5BXFB 4U1KA 5GIRA 1L0YA 3ILPA 4GRWH 3H9ZA 3I2CH 4Z0XA 4HUVA 4P23B 1Y6NR 2NX5E 3I6LE 4HXAL 1EBPA 3EJYD 2QQNH 2BC4B 4GRLA 4EVNA 5GSRA 1CICA 4NO3B 1K3IA 4FNLL 5DRWA 2DDQL 4U1NB 1RZKL 3C5SB 1SBSH 4EQ2A 4PB9L 5J06A 4P23D 3BISA 4ZFOB 5GISH 1JUFA 2MTPA 3LVEA 3MRDB 1D6EB 4HFWB 3ESUF 4YHYC 3VRLE 2W59A 1GIGL 3KYMB 1A6WH 5EU6E 1NCNA 2CDFA 4JEGB 5TQ0H 1I7UB 4K8RH 1YMHB 1U8OA 2NQCA 2FD6H 2NZ9D 2F54B 4JFQA 3VXSA 1SYSA 4TVPH 2ZCLH 4L1DA 4XCCL 2QHRH 3KR3H 4TQEL 4ONGH 4L3AA 1EAPA 3MYJA 5GGSY 1CLOL 4OSUL 3DPBA 5K9JH 3TVMC 1YYML 2FSEA 1YNKL 3KPRB 5IQ9B 1JGEA 3O9WA 1XGYL 4M6NH 3I75B 4KHXH 5CMAB 3ROOB 5EO9B 1NDMA 4MHHG 5T1LD 4YXHH 1HEZB 1YMME 1DQQA 5CUSL 2HT3C 4KROB 4LLMB 2XPGA 4LPXA 8CGTA 4DAGH 5ALBL 3WFCL 5EBLB 2IADA 1I9JH 1UJ3A 3VDCA 1BF2A 5HHNA 2L0DA 5BS0A 3CDYA 3WFEH 3ABZA 2EE6A 5JIKA 3PWNA 5CJXA 5SWQB 1T66C 2QADB 2EIBA 1FBIH 1KFAH 2V9TA 4KROD 3QCVH 1OD7A 2HLAB 2DQEL 1MHCB 1G7PB 5J1AB 5L9DH 3FT3B 1TJGL 2PW1A 5JHDB 1IEAA 3HRZB 4HSQA 1PFCA 4MD5A 4BFGA 35C8L 4KAQH 4O2EB 3L7EA 4YX2H 4MZ3A 2WZPD 4XPAL 1IZJA 2B39A 4JDZB 2AJSH 2GT9A 5HYSB 4EN3B 3BPOB 2V2XB 4PJ9D 1KPVB 3A0OA 5FECB 1ZGLM 4YHML 4G6AD 2H9GB 5BO1H 1W72A 2X4UA 3AU1A 1KCRH 4JFDA 5DJ8A 2H2SD 1M71A 4DKEL 2AQ2A 5SX4H 4YPJA 2CLRA 1Q1JL 3G6DH 1ETZA 1P7QB 1S78C 1CFVH 4J6RH 5J3HD 4WDIA 3F62A 4D9RE 3G5XA 1UQSB 2OSLB 3NPZB 1OLLA 3P0VH 2O5XH 3VW3H 1U0QA 4OKVA 1XGQB 4WFFE 1D9KA 1U8IB 4ZDHB 1O7VA 3GMQA 2XA3A 1G0XA 3C8KB 5DHYB 4YFLI 3ZKNC 3S3SA 3S4SA 4M8QA 3BVNA 1U8JA 4IM8A 4O2FB 5JXAL 1ZS8B 5FFLA 1GIGH 2PW2B 3KPSE 5TPWL 3UAJC 2UVFA 4PGDA 2DQIH 4MD5B 2HKFH 1KLGB 3SGEI 3BZEA 1B0GB 4I3RL 4RQQA 2FECL 3PXHA 4QNPF 4L3EB 1Q38A 4NT6B 2VDOL 1QLRB 5L8LB 2NY4D 5L7XH 5ELIA 4C54A 4OZIE 2AEWA 5K9JL 3AAZB 5I1AA 4LSRL 3L5WA 5TDOB 5MP6H 1G7QB 1TZGL 2BY2A 3NA9H 3BI9X 5E8PA 5CIPH 4LVHB 3HPJA 1N4XL 4S1QH 2HN7B 5FIEA 3BKYL 4N0UA 1GPOH 3QISA 3HZKA 1BZ7A 4X4MA 5CEYA 1T83A 5GS0C 1P4BH 3SGJC 1OQXA 5IB4B 4PJGB 5C07A 1H15B 3LOWA 4PGCA 3B9KA 4NC1E 1MLBA 1NMAH 1NUFA 1RZGB 1AE6L 4Z7NF 2P1YA 4OF0A 1CTNA 1QSFA 3HCVA 3KLDA 1EFXA 1INDH 4GT7A 3EKCA 1TVDA 1T22A 3VFRA 4YXKH 1ED3A 1Z3GL 3TPUB 1OCWH 3T77B 1OTSD 3VFVB 4MJ5A 1FYTD 2AKRA 4RZCA 5DZLA 1DVFD 1RJLB 4JM2F 1FG2A 3HNSL 4F58H 5CEXB 4JFFD 2ESVE 4JDVA 5IV2A 1GZPA 2RJMA 3OB8A 3ZKQD 1U93B 2PTTA 1P53A 1NAML 2PTVA 4GUPA 1VSCA 3F6LA 1GVIA 1S9XB 2EO1A 2DWEA 2JCCB 3VDBA 2PCPA 1IZKA 1MFDH 3O8XD 1Q0YL 5HVWA 3PP3H 3L1OH 1OP3K 5I2IA 3JZ7A 1P1ZA 4OCWL 4M7LL 1K2DB 5J6HB 2D31B 2UVEA 5CBAA 3KWWB 5KTEL 3CZJA 2F15A 3EO9H 2LE9A 5CKAA 4G8FB 4PRPD 1FDLH 2J3SA 2V2TA 4NSKB 1A5FH 3QXAB 1FIGH 5IMOA 3QNZB 3RTQD 4CU6A 2AJVH 1Q0XH 4QXGL 3ARRA 1HHIA 3WLBB 3ZT7A 4F8TA 1D5ZA 4NO2B 4LCWD 2BNRE 1XZ0B 5E6ZA 2CDEA 3S37H 3QWRD 3O9WB 5KANG 4YK4B 4FS0A 3VRLF 4K71C 5I16A 4LPVA 5D1ZB 1G6RA 2VERN 1TJIL 1NUNB 2EDEA 2CSPA 4WJ5A 4M5YH 2DBLH 2OM5A 3O11A 3CDGA 5D7IE 2CKBA 2XZQH 3MRFA 2VXQH 4XZUB 3ZE0F 2VLLA 4JRXD 5A2KH 4GS7B 1TVHB 4G43A 4O9HL 3N1GC 4R4FH 3W11C 3QIBB 3WEXB 2XQYK 4YXLL 3TO4B 2QR0A 4P2QB 3SN6N 4LNRB 3HI5H 3SCMB 2X9XA 1JPSH 4IRZL 3QPXL 2CXKA 5D96B 2UWEE 4MS8C 3FFCE 1IQDB 4MAYA 4PY8J 2GCYA 4QCIA 1EUUA 3A6OA 4GUPB 1JYXA 4U4BA 1GAFH 4WUUD 3ARGD 1INQA 1BD2B 3NCJL 5EU5A 5AYUL 1N6VA 4N1EA 4X6CA 1S7SB 5GZOC 2H2PC 1MCRA 4NQVB 1T7VA 3WUWB 1MCPH 5HGAB 4GG8A 3ULVF 3ARXA 4N9OB 4QRRD 4PRPB 1NGQH 1H8OA 2VXQL 1VFMA 3IDMB 1AGEB 4PRNA 4XRCA 4RGOL 3UYRH 5IVNA 4NC0B 4KDVA 1KB5L 4HWZB 5EBWB 3O3BB 1D9KD 1DVFC 1XGQA 3P3YA 2HWZL 1IGYB 4Q0XL 4CUCA 1P84J 3D9AL 5IFHL 5C0EA 4XWGH 1ONQB 3UO1H 4I0PC 3L3DA 2CK0L 5ID0B 3FN0L 3M17B 3GSVA 5JA9A 4U6HB 4QRTB 5C0GB 15C8L 4KQ4L 4D9QE 1K6QH 1NFKA 4U7SA 3B9KC 3ZKMC 3DROA 5I8EA 4A6YH 1OM3H 1JI2A 5GIRB 1C1EH 1ODAA 3QUML 2BOCB 5JTWA 4GW1B 1FL3A 1IC7L 2I5YL 4RBPH 3BP7A 4JPKL 1XH3A 3MBXL 3U0PA 1MAJA 3BAEH 3RP1A 3T1FB 4XNXL 2R2BB 5C0IA 1PZ5A 2AS5M 2NY0B 4MZ2A 4DK6A 4TRPH 4FZEL 1UACL 1SJVA 2I26N 2Q6WB 4PJEA 4FQ1H 3NFSH 4QRQA 4HS6B 3UYRL 3S97C 2VISB 5EFIA 4X5XA 4V1DE 3D39B 32C2B 2NPLX 3GSXA 3UYOD 2VIRB 4MAUH 4QKXB 2GTWB 2VDPH 2W0KA 3U4BH 3K8KA 2ATKA 5DSCB 1AXIB 5IQ7L 2ESVD 2Z4QB 1MWAA 4F9LC 3QB7C 2VLJD 5HVHC 5GHWH 4NQVA 4HCRL 4PRDA 4I0PA 5E94B 4PYHA 3RVUC 4PBWD 3UPAA 1YN7B 1FIGL 2X7LB 1I9RH 2BHUA 3FRPA 4UT6L 3EOTL 3MJ9A 1R3LB 2OZ4A 2OR9L 6FABL 4RIRB 3VXOB 3D18B 1I8KA 1JRHH 3WIIL 5EBWA 5DD0H 3ZKND 4NBXB 3U0TB 3MRIA 4IRJA 5MI0B 1B0RB 1RIHH 4HKXA 2R29H 3FFCA 4JFEB 4RAVA 1Y6KR 3HG1A 1FO0A 4K8RD 4GMTH 2KUTA 5CZKA 3QDJE 3PGCA 4FQHA 4LDOB 3D69A 1IAIM 2YUXA 5ICYA 2O61B 3WSQH 3RGVC 5TH2B 4JFFB 4GLRH 4ODUA 5CSZB 1ZHBB 4V1DD 3LY6A 3HUJE 2VLKA 3LEVH 5E8DL 1L9MA 4EDXB 2AJZB 5DFTA 4AM0A 5T3XE 3DNKA 4LCYB 3RZCB 4CBPA 2RHEA 4X7FC 4PJXE 3B2UC 1OY3B 2HVJB 3MRMB 5SWSB 3ZDZE 1ORQA 5IJKA 3CU7A 4HGWB 3BT2H 4GKNA 3KPMB 2Z93B 5DJ8B 2HJFB 3CFEA 3T3ME 5IEHB 1HOCA 2W38A 5M94B 4ODBD 2H6PA 1F4WH 3IGAB 4OCRH 4L9LC 1MF2L 3VMPA 4KKBC 4Y5XA 4A6YL 3T0WA 2I07B 4OUUB 1F8TH 2H26A 1MQ8A 1K4DB 1AFVH 3BOVA 2MQ3A 2BY1A 3WYRA 1KPRB 2JJTC 1BF8A 1VFOA 4PGZA 3VFTA 1LEKB 4W81A 2NCMA 4G8GA 1OM3L 4D9RD 4Z95L 3MRLA 1VACB 2YD3A 3DX8A 3QCTL 4MMZC 3STLB 4F37K 3SKJH 1IRAY 3QXUA 2FRGP 4IMLA 4LLUB 4JZNB 4GXUN 2Z9TA 1KLUA 5HYQA 4DGVL 1UQSA 1MREL 4LQ1A 4OZIB 1EXUB 5I1GL 1YEDB 4HKZB 4OGYL 1U8LB 3PWVB 4OZFA 3BPNC 5FGCE 5AZ2H 4WEMB 4LKCB 1QLEL 1YMMA 1Q8MA 3Q6GL 3DECA 4POUB 2Z0BA 1QPPA 4NN6C 2EZ0C 4JM4L 5HGBB 3M1BB 5F3HA 4TULH 5TH2A 5EORL 1DEDA 4BQ8A 2Z92B 4PJCB 3CFCL 1MPAL 5CKGA 5DEGB 2YA2A 3I6GB 3P0VL 3VW3L 5GS1B 4X5WA 2X89D 5ACLA 4L9LB 4JLRB 4IIQB 1BJ1J 4MMXC 3Q1SL 4YHOH 1ZA3B 4OF7A 2OL3B 3T0AA 3VGAC 5AG9A 3LKQB 3CZFB 2K9UA 4FFVC 3IDJA 3F6IA 1NGYA 1UH4A 3MOQA 2VR4A 4N90D 4UIMB 3HPJB 5HHOE 4H88H 3TYGH 4U3HA 1IFHL 1MELA 4NQSB 1XCQA 3MLSH 3NGBC 1FNSL 1RIUL 3MLZL 3HFML 1NFDE 3ARYA 3KVQA 3ARUA 3L3JA 1PKQE 1R3HA 5CMAA 3ROOA 5J13C 1UWGH 5HBBA 1MVUB 3D87B 3RWEB 4MLSA 1PQZA 2R56L 1HYSC 1HSAB 3HNSH 3MO1A 3PV7A 5D5MF 1KGCD 1YY8A 5KOVC 3IKKA 3CMOH 5F7DB 4DN4L 4NUGL 4PJXB 3T4AA 3ZT5A 2C3GA 4ZOBA 2DWEB 3ZE0E 4PBVC 2CLVB 4FQLH 1G1YA 4GBXA 4JVUA 4XP1L 3NCFB 4ZOEA 2Y72A 5H94A 2E5EA 3REWB 4KGLA 2A6KA 4NKMB 1P1ZB 5TGBB 1J8KA 4K94C 4JHAH 4K94L 2X40A 4POZD 2BOBB 3MTRA 2R0ZH 3QRGH 4QTHA 2DQUH 3AS3A 3QHZL 2C3VB 1IGJB 5F7FA 5GS0H 2OL3L 2Q7NA 2HJKB 1QNZH 3FO0H 1F3DH 1E6OL 3MRRB 2GEEA 4BQ6A 5JOPE 1F6LL 3VU2A 2QQKH 5GJTH 4KJYA 5DLML 1RMFH 3SDXF 2H45A 4BSVA 4AH2A 2DIBA 3L5HA 4CL7A 2DMKA 4WEBL 4U1SB 1RI8A 2OTWB 4GRLC 3MACH 4RMWA 4MWFB 3AMKA 1G0DA 4XPAH 1CWVA 1MJ7H 1WTLA 2WQ8A 2Q8AH 2GQHA 1A6ZA 5C08B 2FECI 2YK1L 1FFNA 5C08D 2YWZA 3I85A 3QDAA 2XNAA 1WAAF 1I8KB 5C07E 1D5MA 3NH7L 5J7CC 3V2AR 1E6JH 1MI5D 3NPSB 4HUWA 4OLEA 1AR1C 1BZ9B 3CDFA 3VD9A 4M5YL 1IAII 1J88A 3F7YB 3QEQE 5JW4M 5JIHA 5ISZB 5IW6B 2VXSL 3EFFB 4LF3B 4UOW1 5EB9A 4AY0A 3SO3C 4WO4D 5DVLA 3FOLB 3ARDC 3KPLB 2A0LC 1U3ZA 1KTDA 2PW1B 3UTPE 3CDGB 1UXWB 4WI6A 4KDTA 1NCCH 5FHBH 4QTHB 4OLYL 4I9WE 4PRIA 3LDBC 5FK9B 5D2NE 2GJZB 5HHMD 4OM1L 4EUPB 4PJ7A 1KTLB 1F90H 3QIBA 2OBGA 2HVJA 4JAMA 1CQYA 5E99H 4DTGL 3FO2B 3QDHA 5F9OH 1VEOA 4Z7NE 3O0RH 4QGYA 5TQ0L 4OZ4A 4QXUH 2KZWA 4X6EA 1ZHLB 5EU3A 1KJMB 1R5VB 1J0ZA 4KXZH 2DJUA 1S7WA 3GJFA 3E0GA 1QSZA 3V6BR 1PKQA 3JWOL 5I15H 2ZP0T 3K1KC 3JVGC 2OXHA 5E8EB 3ZE1E 1NFIA 4ISVA 3OPZH 3LEYH 1DLFL 5HGAA 5D70H 1T20A 5IKCA 1IKFL 4HXBL 3QUXD 3ARSA 3QDGB 2N7AA 5EN2B 4JRYD 4XH2A 5IW6A 4NGHH 3L3DB 1OW0C 3BE1H 3IJHB 3NCEB 1RUQH 2R2HB 3QO1B 1YQVL 3ZTJG 4GW4A 3GRWA 4L8BB 3VH8B 3U9UA 4HUWB 3O3BA 3TP4A 2BVEA 4KKAC 1O5DT 4NQEA 3OGCB 5ITFB 3VI3F 5IMLA 4MDJA 4P3CL 3QWOB 2OTUB 2X9WA 4HAGA 2DQFA 3BPOC 2VE6B 4Y4FB 1OARL 3AM8C 4Z7OF 1W2KT 1G7HA 1MCJA 3KLAB 5JHDA 1UCBH 2AJUH 4X4YB 4OLVL 1QA9B 3FO2A 3TBVA 5JW4R 1X3DA 2X42A 3VFPB 4UBDC 2FLBT 4YBQD 4YC2C 4AIZB 3K2UL 5T3XL 5IOPB 5IVOA 3ARTA 1J18A 1L7IL 2IAMD 2E7HA 4QRUB 1U8PB 4XNUH 1IQWH 1JGVH 1FFRA 4XWGL 1V3MA 3SE8H 3NBNA 1JYNA 4ZMAT 4P5TD 4PJ8D 1NGPH 4X6BA 2DQGL 4M03A 4TUOA 3OWEA 5CWSA 3AU1B 2CKBL 3X13A 3E2HB 4JREC 4JO3H 2VXSH 5C07B 4Y1AE 1J7VR 5KW9L 1E28A 3NACH 2DLTA 4PS4H 4QRPA 1Q9OA 1A1NA 2FYYA 2Y06H 2GJ6D 4D0BB 2H3NA 3LEVL 5E8DH 3KLHD 2BRRL 2VDML 3WO4B 3FRUB 1VDGA 5K9OB 1OAKH 5HVGB 3VXUE 1LQSR 3T2PA 4PJDF 2AV1B 4S1SL 5KS9A 4OIIH 4B7LA 5AD0B 1B4JL 1U93A 2PTTB 4G6JH 4WENB 3ARFA 4DFHA 4JCLA 2R0LH 3HE7A 2XICA 4WW1A 2NY1C 1X5HA 4IRJC 4WI2A 1DDHB 3VXRE 3N9GH 1JTPA 2H2SC 5DD1H 5BRZA 1KJ2L 3RVWC 1FG9C 1DUZB 3NIFE 2DICA 1NCCL 1EMTH 1B3JA 4BQBA 2Y36H 3P4OB 1G9MH 3G5XB 5ESQB 3HA0A 1GYAA 1DBJL 3INUH 4Z5RA 3FZUC 5GGVY 1NGZB 2G5RA 1CZ8L 5EIQA 4X9BA 4OZGB 1K8IA 3QIWC 4U1SA 2VDKH 3C60C 4Z7WF 5L8JB 4CDGC 4K23L 1C8PA 4M7KL 4AIXA 3DWTA 5CBEA 1OGAE 3PQYE 1F13A 4KWUA 2Z8RA 4ZOAA 3AC0A 2HRPL 5FCUH 5SV4A 5D7LD 4P9HH 4G8GE 1HDMA 3AVEA 3MV7B 4JM2D 2HTLD 4OUOA 3K74B 4CU7A 3PJSB 1OSPH 3HPLA 3TIDB 1FSKB 4LLUA 3E6FB 3VFRB 1D5XA 2P8MA 3ARBD 2ADGB 2H3NB 5ID0A 4KMTH 2PXYD 3H9HA 4Q9QL 5IP4A 4XNUL 4DW2L 4P2QE 1IGCH 1CCZA 2PTUA 3FRUA 1N8ZB 3QUZC 3IJYB 1RUAH 4OD2A 3H2WA 4NQCD 3W0WD 2JB5L 3ECBA 3V52L 1ZTXH 4UAOB 4ZTOL 4ODXA 1XF2A 4NIKB 1RURH 4PRIB 2HFTA 3RGHA 1UM4H 2R1XA 2KKQA 4MJ6B 3U83A 4YZFF 5JR1H 3D9AH 3UO1L 4PRBB 5EORH 5E4EB 1CN4A 1AXTH 3EIFA 4I3SL 5D5MA 3R1GL 1UVQA 4NRXA 4X8JB 4HIHA 4M7ZC 1VEPA 5J6HA 4ENEC 5DMJB 3UBXA 4WO4A 1A0QL 3SE9L 4YBLC 4YIQB 3FOMA 5IM7B 5EU7C 1KJ2H 1IT9L 2A77L 1LK2B 1H3GA 1ZT1B 3MOAH 5GGRY 1GCFA 5J3HC 1KIQA 2DDQH 4MNHA 3DYOA 3T77A 4EUPG 3SEPA 3VXSB 4QHMB 5LXGL 1UADC 4KRPC 2V5SA 2IPUK 4YDVA 1NMCB 3CFJB 3PGDB 1GAFL 3WHXA 1UZ8B 4J3OC 5I1IL 2P5WA 1N26A 2HFFA 1HYSD 5ID1B 4AIOA 4F15C 3EYOA 1BBDH 3HNVL 4NUJA 3U7YH 2NXYD 1T03H 2FSEB 2OCFD 1U91B 3QEHA 4NNYB 3IJHA 3QO1A 4PGBA 3IFOA 1NGWB 2ID5A 1E4WL 2A83A 2DM7A 2JELH 5FA3A 3P9WB 5DQ9B 1X5GA 4AL8H 3DJ9A 4NQCB 4KV5F 4WJ5B 4WU5A 3BMVA 1TNNA 4D0CB 4HBCL 4RGOH 4LLVB 1HINH 3QG6A 3OHXB 4WFED 1LGVA 2R23A 5FHBL 1WCBA 4YHMH 5B22A 4JKKA 1MJ8H 2HFGL 5C2BH 3VFUB 4LSVL 3OR6B 3W39B 1YYLH 3BWAB 4WNQA 4XBGB 2BSSA 2PO6D 4LRIC 2J8UA 5JQ6L 3OKEA 1OL0A 3QQ4A 5I9QB 3VXTA 4OZFG 5E2UH 5M95B 5F44A 2DM4A 1UWGL 4FFWD 5T1KA 4R4BA 5FUZH 3O2VL 5FA4A 2D9CA 3H7BA 4HHAB 5I15L 4EI6B 1YPZF 3THML 1MCLA 3IRZA 4X4XB 1HH9B 5F7EL 3W9EB 5FKPA 1DANT 1U3HA 3GMPB 4UB0L 5B39B 5B3NA 1I1YB 1TZHA 1YUHB 4IOSD 4QHMA 1N64L 4L4TB 4U1IB 3CLFL 1FGVL 3VXOA 3VGBA 2IAMC 3O3EB 4ZXBA 2YA0A 5E9DE 1KCKA 4RMTA 4P2OD 4UBDD 5IQ9A 1I85A 1MCEA 5GHWL 5GS0L 4WTZG 3QG6B 3GRWL 4LHUA 2OJEB 4NQUA 3BDYL 3ARPA 3MNVA 3O3DA 3V5DB 1BX2B 2BZDA 1BZ9A 2W65B 4DN3L 1T2JA 2FD6L 5F93C 2APFA 3MGAA 1S7SA 5DQDL 2EICA 3RI5K 4WW1B 5CSZA 2ICWB 1WF5A 3RWJB 3SDAC 2NX5B 4G3YH 1Z3GH 3VG9B 3VWKB 3C8HA 3QQ4B 4BQ9A 5CEZL 1I3UA 4U1HB 5MEND 1Z6JT 2NTSP 4L8DA 4F9LA 3OKKB 2AJVL 1KIPA 1T0NA 1T21B 4DZ8B 4R4ND 3QEUB 1C08A 2XTJE 2EH8L 5K93A 2R4RL 3VFOA 3DMMD 4U7KA 5B3JE 2A73B 4HT1L 2X44D 4G42A 3R1GH 2BNUB 1U95A 5F7KC 3OXSB 4HS8H 1KPVA 5D1XB 4HEME 3UJTL 5EIVA 2AV7A 3O4OB 1HXYA 3L1OL 1SVCP 1JZ7A 1WQVT 4X0KB 4BFIB 1G9EA 1FPTH 5EA0L 1KEGL 2FEEI 2NY7L 1T6WA 2RQ8A 3W0WE 2R9HC 4FQXD 2PYEA 1S7WB 2C5DC 1ITBB 5DURB 3N1PC 3MREB 3TV3L 4BZYA 5GGQL 3RVXC 1EHNA 2H1PH 1HHJB 2FO4A 4R4FL 4TPRH 5AZEH 3C6LB 4YHPA 4OZHE 1JGEB 4JY6A 1P9MC 5HI5D 3T2QA 4ZQKB 3DX6B 5DWUL 3QNYB 3S35L 3DMMA 5SWZE 3FFCB 2HLFD 4NDMB 3L9RA 1QBBA 1SBSL 2VISA 5EFIB 3CSPA 3RWFA 3JWDH 5IFJA 4U2ZA 2V5YA 4NJAL 1A2YA 3MBEC 5JPNB 3PQYD 2H8PA 3LQAC 4R2GB 1BJMA 4HJJL 5JW4Q 3OKLB 3UDWC 3FO1A 4ACPA 4CMMB 4JGMA 2RBLA 1ZHKB 2B2XL 3WDHA 4L3ED 5ENWB 1CIDA 3V9FA 4C83A 2BSED 2OTUA 5HVHB 4URTB 1YYMH 2F19H 2AJZA 3VFGH 3KG5A 3V0VA 4YGVB 3UXFA 5F1OB 1CL7H 1UCBL 1U95B 3EYSL 5DI8B 2Y36L 2Y5TA 1FGVH 4R96B 4DWHA 5BW7A 2X10A 1BBJA 3HAEA 3RY5A 4WI9A 3O41A 4NQTA 3QEUA 4NWTL 1JPTH 4U6TA 1W8OA 2H9GA 2EYSB 3RL1A 2P48B 2VABB 4N0UB 5BO1L 3W81A 3REVB 1FO0B 4XNMA 4P9ML 1JNNH 3LKNB 1A1NB 2FYYB 3SE4C 1WICA 4G6JL 5GGUA 3IU3A 4DZBA 3GGWB 1N2RA 3AS2A 2R8SL 1JNJA 5HI5C 2F54D 2W91A 4HS8L 4H20H 1SEBA 5KSBF 3BP4A 4G9FB 1UXSA 5KAQF 1E4XH 3K4ZA 2I24N 3C2AH 1MIEH 4X6CF 5FYLL 4U6VL 1TMCB 3VXRB 1JCKA 1YMMD 2Q76B 5K9QI 1A2YB 4LIQH 3FAWA 3PWPD 5KG9A 3OQ3B 4NO0D 4O02H 4ZFGH 2VH5H 4LF3A 1QLEH 2GJ6E 1OAZL 1N6QH 1AGFB 3HZYB 3ARDA 3Q6FA 1DLHB 1EIBA 3WNNA 1URLA 1RIUH 1V05A 4FFZH 1HZHH 1T1YB 5D2NA 4MDIB 4LQFL 4GAJH 1RZKC 3TT1H 3TESA 2I5YH 5FKAB 4Q6IA 2YPKB 4EUPA 3LH2H 3BEVA 4GG6B 2XRAL 3P2TA 3P9LA 3RVTC 4EN3C 2VN7A 4LSQL 1I7RA 4I77H 4OLWL 3H7LA 3O6ML 4HG4J 2PYEE 5IROC 1BFVL 5T1DL 5JHLH 5HJ3B 5KN5B 1N5AB 3HC4L 3SDCA 1FZOB 43CAA 3VCLB 2J6EA 1NLDL 1AO7A 1YNLH 2VLJB 1N2RB 5CSBA 5EWIH 1A7QL 5J13B 2Y7QA 3FHQA 5LXGH 3HC3L 2VKXA 4HQQL 1NGXB 5HPOA 4OF5A 4XRCB 4F7PA 3PWVA 4OZFB 3RIAF 2B4CH 5GXBB 1JMZA 4WFGD 5TE7L 2GYSA 5IWLC 1RU9H 2XNAB 3BDBA 4J3SA 4N9GA 3UJJL 1E6JL 1EHXA 1FBIL 4MGXA 4M7KH 2XZZA 1R5IB 2M26A 1R24A 2B8OT 1QSFE 3NIGF 1NEZA 4NKIH 1F3JA 2FLRT 2FIKA 1CD0A 2OJEA 4X6DE 1WWWX 4HGKC 4L8BA 5HHPB 1SJHA 3UX9B 5BZDB 3NAAH 1T0PB 5DUPH 5KAQG 1X5JA 3GMMB 5F70A 4CU8A 5LGJB 1FH5H 1QBLH 1DLFH 1QVOB 1LNUB 4KTYA 3G6JB 1A3QA 4RGNB 4YO0B 2EDFA 1C5CH 3RTQC 5BV7L 4Q6IC 1MFAL 1QPXA 2A9NL 4JFYA 5LG1A 2GT9B 3WFDH 3OAZK 3TO4A 1ZXQA 3FQUA 1DQJA 2DQUL 4G8IA 5AG8A 3VFNB 4P2OA 3KNBB 4HC1H 4Y88A 4AIZA 3QUMH 4XC1L 4G9DA 1K85A 5IIEB 1FGNL 4JQIL 4N0UE 3GKWH 1JPGB 3GM8A 5EC1A 3RX7A 1YQ2A 1I9RL 4M3KB 4LCUB 4HWEL 5FYJL 3EOBA 3NGBB 1U3HD 3GI9H 4I0KA 5DGQA 3QUYC 5F9DC 3PHQA 1CFTB 1JTTA 3CC5B 2VL5A 2R2CA 4XVSL 1MIEL 2ZOKB 1HIML 1U8NB 2ORBL 3SDDD 3GHEH 4ODSL 3U48A 4QRSA 1OTSC 2Q3ZA 2UYLA 4X7CC 1U41A 2AERT 2PW2A 4ZO8A 1I1RA 4M1DH 1AE6H 2VC2L 3U82B 4X7TB 4N8VG 3MJ8A 2X70B 4YDVB 1ZK9A 3BIBX 2FWOB 2BNRD 1ZOXA 3K0WA 3GK8H 2ZCHH 5CINL 5C09D 4RGNC 2WWMD 1F4HA 5D72L 5C09E 1VPOH 2L7JA 1XF4A 3GI8L 1BFVH 4GG6E 5DQ9A 1R0AL 5FUZL 4PV9B 4XI5C 5DMYA 4CMMA 3QCTH 2VDLL 3T0ED 1NUGA 1V3KA 2XWBB 5LAXB 3ZDXE 3NTCL 3U79A 1T6VN 2UWEB 3P4LA 3QQNA 2GY7B 4K9EC 3IDNA 1OOAA 1J0JA 2DAVA 2WIMA 3ULUH 3EO0A 1DUZA 5LJYH 2QHLA 2FGWL 4QRQB 5FV1L 5BVJB 4HT1H 1NEZG 4DCQB 4F9PA 3RZCD 4J4PA 2ZZUT 4I5BB 3OAYK 5JLZB 2BY0A 3S3PA 1LO2L 3FFDA 5DJ0B 4M4RA 1PBYA 3W9EA 3FKUS 3MZTA 3HCVB 1MCPL 1QSFB 4GAYB 4M3JA 1RIVH 5D7LB 4QRPB 5DMGD 1TQCB 3TZVD 3UPCA 5BJTB 2HFEA 3GSOA 4GKOA 4IOIA 4N8CL 1LO3L 3OR7B 1LE5B 1C5CL 1KGCE 2ZOKA 2XFXA 5IBLD 5I8KH 5C0CA 1DBJH 3VRIB 4X4XA 2HTLC 43C9A 3VG0H 4QRSB 3WNLA 4YQXH 1BEYL 2X1OA 1QFHA 2O26U 4JQIH 4IDJH 3CU1A 5GRVK 3BRDA 3MRQA 4MVBD 4G6KL 1OARH 3WN5A 1B2WL 1I7TB 3QHZH 3QIWD 1Q1JH 1FL3B 1KOAA 5KSBA 2AW2A 2VQUA 1CD1B 4AQ1B 1LK3H 3DGGA 3GNMH 1XH3B 2DOCA 5DGRA 3DV4B 4OCYL 1RSFA 4UNVA 1C7SA 4UQ3A 3JTSA 1DDHA 3QULB 3QXAA 4F9PC 4LPTA 4X6FB 4JRXA 2LABA 4ZAKD 1V8HA 3LPWA 5J12C 3U1SH 1FV1A 1BJ8A 4KVCH 1N7ML 2UY6A 1RJZA 5IHUL 1H3UA 4X5XB 3D39E 1GGCH 2C4FU 4ZTOH 4ELKB 1QFPA 1YC8A 3GM0A 1Q9LA 3MA7B 2GSIA 3JUYA 4D3CL 2P5ED 4K3HA 3RWIB 1Z5LB 5ITFA 1DFBH 5E94A 2Y9RT 3JTTB 1YEEL 5C09B 4H1LG 3PHOA 4IOFD 1VB9A 1J0HA 4I2XE 4IOIB 1WITA 4PJAF 1UYWH 3MLVH 5D1QD 5IESH 5GRZA 5IGXH 4NZUL 3PE9A 3RY6A 4NDMA 5DF0A 2ARWA 1J0IA 4A2MA 3CFIC 3MPCA 3ULUE 1I9EA 4OM1H 3ILPB 4P59H 1PKOA 4M1CC 1CFBA 1HXMA 5D7KE 5EULV 4PJEE 5K9QG 2ADFH 5IB4A 5CGYD 5INCA 2OP4L 1QG3A 4KTEL 3PDDA 4ODUB 5IFAH 2YPLD 2EKSA 5LCVH 4OFPA 1IKNC 1P6FA 1EMTL 2J4WH 4X7SL 1HQ4B 3BPLB 3ALPA 1ZHNB 3KPPA 5IVZA 2WANA 1XCTB 4HK3J 4XI5D 3I2CL 5FOJA 3O41B 3B83A 2J6EH 2GFBA 1G0YR 4LU5L 5T3XD 3DETC 1NGZA 1IKFH 3MV01 5E03A 3ZHDA 5M7QA 1RURL 1AKJA 2JJVA 1OT2A 4HUKB 4YAQA 5EZLB 4M43L 1P4BL 1MJJA 2YPVH 1CLYH 1ZEAL 2JB6A 4QY8A 2AJ3B 4PJ9B 3B5HA 4MNQD 1MFDL 2OI9B 1T04A 1GSMA 4NQCE 5TF0A 1LO5B 2BDNL 1NCAH 3OJVC 1XR8A 4U6HA 5HYSG 1IC5H 3OKMA 3SDDC 2F5AH 1WFTA 4UAOC 3ZO0A 3P9MB 3Q5OA 1DQTA 5DUBB 4JKWA 3P11H 1C16B 3WIIH 3K46A 3ZE2E 4MD0A 5CCKL 2O5YH 4K3DL 1FAKT 2AI0H 1NC4B 1GGIL 1VESA 4CAGA 5E8OB 2XZCL 4EDWH 2Q6WA 5DRXA 1FAIH 3D39A 3MRGA 5I1DA 5HHQB 2MKWA 1N7MH 1ZLVK 4JY5L 2KPNA 4HZAA 3K7UA 4KUCD 1D7FA 5C3TA 5B38G 5IBTH 5FK9A 1AGFA 1DQLH 1NCWH 4UINL 3DSFL 3SGKC 5KVEH 3WFEL 4KKLD 3ULSB 4JO1H 2VLRA 2YN5A 4JR9L 4JO4H 3HFMH 4K71B 4L4VD 3LH2L 1U92B 3BJLA 1CBVH 4KC3B 4M6MH 2C3VA 5CBAB 4L29B 4U7MA 2I60H 3FFDB 5DS8B 1CFSA 5D7IB 3BYYA 1CDUA 4GH7B 4GRWF 2NY5C 4YNYA 2MPAL 2NZIA 3MFFB 2JK5B 4TTGA 1X6LA 3U0TA 3ETBF 4XCYA 4M43H 2CH8A 2EXYD 4HIXL 5KSAC 5HGHB 2XOTA 3BZFB 3LKRA 1MRFL 2EH7L 4LPWA 3PWPB 2Z31B 5KVFL 3GMMA 3C5ZD 3OKOB 3BD3A 4PS4L 4BSWB 2H32H 5CJQL 3FQTB 3WS3A 3EJJX 5KZCD 2NY6C 2ERJB 4AEHL 5HTSA 1DBMH 3VXUB 1B0GA 1XR9A 3PL6A 2ICES 5DJXA 1FL6A 3WD5H 5L2JA 1A7QH 1MCNA 3EYVB 1HWHB 1OP9A 4NNXB 1HH6B 5DMIL 1G9MC 1U8HB 3QUXC 2VQ1B 3G6JA 1QLFB 4ESKA 4MAYB 1MFAH 4GAGL 3L6FA 1AGDA 2D7QA 2CLZB 4XMLH 3LMJH 4LAQL 4MQ7B 4JFHE 2ZOLA 3MV11 4M8VA 1XGRA 1O0VA 2NLJB 4N0CD 3SKMB 2LU3A 5FM5M 3TN0C 1K4DA 4P0DA 5T33L 2BXZA 3WKML 5DUPL 4DGIH 4WUKH 4YHZL 4P2RB 4PD4K 1WFNA 1VFAB 2UYLB 3IVKB 3O4LB 2NW2B 4NP4L 2J8UF 3ZE2F 4J3XA 2WV3A 4KPHL 1L9NA 1U8KA 2IALA 4U1IA 1OAQL 1IBGL 2EDYA 2CIIA 2HKHH 5FO7B 3VFUA 2ERJC 4NZDA 4W6WB 4X9FA 5KVEL 3LS4H 3WO3B 3BPCA 5ISZE 3DYMA 5DURD 5C0EB 1YC7A 4ODWB 3C6SB 3TA3D 3L3HA 1F11B 2JCCF 4MJ4A 2Z35B 2R8SH 3C6LD 1XIWB 4PRHB 3BP5A 1C5BH 1Y0LB 4NBYB 4WEBH 1RJYB 3HZYA 4R7DA 4ZYKB 4FQ1L 4U31A 1II4E 2OJZL 4U6XA 3S35X 2KDGA 2HYMA 3T4YB 3QBTB 4S1DC 1H0DA 3HZVA 4PRIE 5C8JA 5CJOH 3T3PF 2LFGA 5D7LE 5F72S 3ZTNH 2PR4H 4X4ME 2MWCA 1KIPB 5DD0L 4HBQA 4DCQA 4NNXA 2DQJH 4LHUG 1FNHA 3B3IB 4O5LL 4QRUA 5ESQA 1EAJA 1U6AH 1CD9B 4K7PX 5HJ3A 5I1CL 3EO0B 2ZSWA 3S96A 5DXWA 3GSXB 5BVJA 3NZ8B 1YEJL 3LD8B 5CJQH 4MNQA 3MNWA 2F5BL 3VJ6A 1UCTA 3Q48A 3MNVB 2IF7A 1T04B 5F1NB 1MHCA 5J1AA 3QAZB 2OSLA 4PRDB 5JW4N 1YY8B 2F74A 2CR6A 3OPZL 2J5LC 4B5EA 1PQZB 1MH5B 7CGTA 5DD5H 3EDKA 4LEXH 3RPIB 1NH6A 2DM3A 3D25A 4Y2DB 1EO5A 2XV6B 3GSRA 1X5LA 5IK3B 5IJVB 1F4XL 1QFUL 4QNPE 1IGMH 2HP4A 4I0CC 5ESVA 1FCCA 1RZ7H 3G6AA 2MOVA 4NN5C 2Q8BL 3VXUD 3BO8B 5ETUA 4OCXH 5F1KC 4L4TD 2WP3T 4DUXA 2W1NA 3H3KA 4C56A 1Z0MA 2FBJH 2BJML 2R1XB 3JV6A 1RULH 4JFDE 2SEBB 2YD6A 3VFTB 4JZOA 1TITA 5DD3H 3KXFE 5ALCH 5E6IB 4G8EA 4NZJA 4P4KD 3ULVC 4BH8B 1A3RL 5IHUH 3WLWC 2HN7A 4ZUVA 3D48R 4GG8B 5CJXC 5DHYA 4XP9H 4PJHF 2GSIB 5CWSB 1DBBL 3IDMA 4KU1A 4XP6H 5F1NA 4GSDL 4MXVF 3CCHA 3RBGA 1A6ZB 2HT4C 4NC2B 2P5EE 2P8PA 2OMNA 2ITCA 3QSKB 4DQOL 2MQCA 1W0VB 4MQXC 1UB6B 3H3PL 5DQJA 1YMMB 3DOSA 4YHNA 3LN5A 2ZSVA 1KYOJ 5HDQL 2A2QT 1N5YL 4YR6A 2QEJA 1T89C 1XMWA 4AQOA 3ISWA 1JF5A 3F7YA 1ONQA 3BQUC 2VZOA 3LEYL 1IC5L 2CJUL 4L3EA 4NM4H 4Q7DA 4ZSOB 1Q0XL 4EBQL 3EO1A 5IBUB 4Z95H 1S7VB 2QJDA 2Z31A 4MJ5B 5FO8A 5D7JB 4HWBA 2WBJA 3I6GA 1QSED 5ADOL 2AK4D 1R3IL 1XGTA 3STLA 2NXZB 3HR5B 3O6LL 1UYWL 3K2UH 3GIZH 1X6NA 3V5HA 4GKZB 3VI4F 5EZIH 3RIFF 5C0DB 5I30L 2Z8WC 1BZ7B 4LBEA 2P5WD 5DA4A 4L5FH 3GSWB 3GSUB 2XWBA 5MHSD 5E6IA 3FRPG 2R4SL 3UBXI 2XXMB 2VWEE 4JO1L 3QIBD 4PUBL 4BUGA 1UM6H 1X5IA 2C26A 3S8WA 2A1WH 3O6KL 4HXAH 4P5KB 1XFPA 2MSPA 3I3EA 1ED3B 2AK4A 1GC1H 1N3NA 1PLGH 1TCRA 4CW1B 5KN5A 2XT1B 5IJKC 1OF2B 3C60D 4LCWB 2WK2A 1NBQA 2X4QB 4RDQF 1UB5B 3CVHL 4HK0B 4CVUA 4EI6A 3BZDA 4L8SC 4Z7QE 1HHHB 4Z7OE 1S7XB 2OXGA 7FABH 5I17A 5KW9H 3GSOB 1MCSA 3QIUB 1DBBH 4ODHH 1RZIB 5D7JA 1SM3H 4XB8A 2WWKT 4OGZA 4H8WC 1EGJH 2YMXH 2C7UA 1JIBA 1OAYH 1G9NH 4IRJD 2G60H 3U36A 3IXTB 3LPFA 3MLUL 3TFKC 4P5TA 2WUBL 2DYPD 4PJ8A 5DLMH 3MLYH 3C9NA 1I7ZA 1LD9B 2FL5A 5MP6L 3QPXH 4KJYB 4JJ5B 4NYLB 5BRZE 1ZT4A 1OVZA 3ZE1F 5GZOD 1MIML 2GCYB 4TSBH 5EO0A 4XVUC 5TE6H 4PLKD 5B8CC 4EI5D 5DMKB 2KH2B 4PRBA 5CINH 1MLBB 4FRWA 2O5ZL 1KFAL 5AAWA 1NFDF 3RAJL 3UP1A 4LAJH 1XF3A 5L6YL 5L2KE 4EOWL 4WIQA 3ULUF 4CN4A 2XQBL 4NQED 3TGXA 3QXVA 4H1LH 1WBZA 1JK8A 4PJAE 1I7UA 4QRPD 4XZUA 4Q9RH 3P77B 1G6VK 2ADJB 2HAZA 3RUGA 4NC1C 5LVEA 4LCCA 3CVIL 4MQTB 3TIEB 3PWLB 4S2SB 4F7MA 1QBAA 3EW3B 1J5OH 2IAND 3LQAL 3PP4H 2J8OA 4ZS7H 5DRZA 3RU8L 4PRAA 4S1SH 5DEFA 4WHYG 1CFSB 5D7IA 1U42A 3FN0H 3WXVL 4L9DA 4YO0A 4WUUA 3H0TB 4ZAKA 4J7RA 43C9B 3KPRA 1I9IH 3QXDA 3S5LB 4HJJH 4RWYH 3O0RL 1HEZA 2B1HH 1VHPA 3H9SA 3RDTD 2G5BB 4YFDB 2Q87A 4R90H 3BO8A 2OR9H 5D96C 2D0GA 1IGIH 3CGTA 3EOBB 4MA8L 1VCAA 5MEPA 1UWEL 4FHBD 1WC7A 1F42A 4JANA 3QUYB 5F3BA 1UGNA 4XHQA 4F58L 4XGZA 1FNEA 1S7UA 1OTUC 1BMGA 4XBEH 3MUGA 2JF1A 2QBWA 1TQBC 5HGDA 5DK0B 5E5UB 3QRFM 1NPUA 2GJZA 3R8QA 2VAJA 4RX4D 3EYVA 4LDEB 4JRYA 5CFHA 2BCKA 1RZJC 4WFGE 4QT5A 4MNGE 4Y4HA 3U7WH 2V5MA 3PWJA 5ANMA 3GMRB 4TVSa 4KY1H 2XKSA 4OF3A 3N1MC 2CPCA 2G60L 4H25B 3FT4A 1JN6A 2EIZA 4OM0L 2QSVA 1U8MA 3LKNA 2E3VA 1G7HB 2YPLA 4PRHE 4DGIL 5E8EA 3U2SB 1ZLWH 1OAZH 2EDXA 3NIDF 3RBSA 1GC1C 3O6FC 2ZUYA 4LNRA 4L4TE 1IC4L 1IEAB 2YXMA 4JRWA 4IRJB 4Q9CA 4R26H 2YD9A 5DD5L 4Y8AA 2BVTA 4RMSA 4JFEA 1RZFH 1JZ2A 3QDGD 4LMQE 3C5ZC 1Z0NA 5FM5O 1U3YA 3EJZC 1X5AA 1ADQA 1EEZB 1ZVSA 5IEKB 5I8CB 1T7WA 2X1PA 1ZKAA 2CIIB 3OTTA 1RJYA 4B7IA 3P30L 4X6DB 5GS0D 3HE7C 3QUYA 1KJ3L 1MFEL 4P3CH 5DVOA 2VSCA 4U6XB 2BFVH 4D2NA 4LFHD 5A1AA 4HWEH 3MUGB 1JV5B 1KJ2A 2IFFL 3VXME 1S7RA 3HZVB 5C8JB 3MLTA 5HDLA 4RGNE 4CADB 2X1WL 4BQCA 1RUPL 5JW5A 1EZVY 5I9QC 1T7XA 4R97C 2AXJA 4FQCH 1FJ1A 2HJFA 3CFEB 1S7UB 4MCZA 4Y8DC 4PJFF 4X80L 2PO6B 3NCJH 5MERA 1KIRB 2VR5A 5HHOB 4R96A 4KTDH 4WVRA 1CDIA 3PGCB 4FQHB 4KKLC 4MNQB 3S4SB 4JKMA 3GUTA 4K3JL 1SBBA 2ZCLL 3FB5A 2QHRL 1BECA 1RZ7L 5IB1B 3BH8B 4YDJB 4WV1C 1B6DA 2OL3H 2ZSWB 3TN0A 1BOGA 3SCMC 4JFFA 5C6WH 4OLZH 2WBJD 1LO5A 4F7PB 5MI0C 4G6ML 4KUZH 2Y1VA 1KLGA 4ALAH 2DL2A 3NZ8A 5FCSH 1M6OB 1X4ZA 4WU5B 4WFHD 3GMNB 1R5IA 4GKSA 4ORGA 5IUSA 3QULA 2NY5H 4RNRA 1YN6A 4PB9H 4LSUL 3LKSA 12E8L 4OAWA 5IHLB 4Z5RB 3F7RA 1KC5L 3L5XL 5A16B 5JW3L 1JHTA 1TENA 4XBEL 1RZFL 4XXCC 1BM3L 4OTXH 5TF1L 4JY5H 4P2QD 2DQEH 3BRFA 3PIQB 1LDPH 5EA0H 4NJAH 3M1BA 1AIFA 3BFOA 4LASL 4XWOD 5D2LB 1EVTC 4FZEH 1LEGA 4OFVA 3QFJA 3LIZL 4WTXA 5DD1L 3CSYB 5MERB 4G8GB 1B4RA 2EDKA 3VH8G 4EKXA 1S7QA 1IMHC 4MVBC 3RDTC 3KPNA 4M6NL 3MCG1 1QACA 1F2QA 1QOKA 1KCRL 4YPGA 2R0KH 2WM0A 5GRVL 3TPUA 3LN4A 4JFEE 4LLMA 3TN0B 3HUJF 3QIBC 3QH3B 5EO1A 1P7KB 1R6VA 4K55A 4QWWD 4NPYA 5JMRA 3HKFA 1X44A 4P2CG 4PJHB 4U6YB 1XAUA 3HRZA 4S0TD 4ZO9A 5K59F 4OQTL 4XAWL 3CVHB 2NYYD 3QUXA 1P84K 5CCKH 4Q2ZA 2IG2H 2K1MA 3HPLB 4L9LA 3QUZD 2EDLA 1RK1A 4FQ2H 4LLWA 1JRHL 1T21A 4DZ8A 1M7DA 5E8OA 4JG0H 2FGWH 1YY9C 1JFQL 3AREB 3RA7L 1YPZE 5KZCB 3GSWA 1CDCA 3MR9A 5LGJA 3MRBA 3MRPB 1REIA 1HYRC 5DYOB 4K3JH 3TBVB 3V4VL 4GLRI 2BOBA 2OLDA 1C08B 5EZLA 4JFXA 3JV4B 5FDWA 3WNMA 1DVFB 1T4KA 1I1AD 2JJUA 3ULVL 1JGLL 2W0LA 4KI5E 4HIEB 3DRQB 4AYFA 3P9LB 3RKPA 5IWLA 2FR4B 4APQA 3L3IA 3C5JB 4Q9QH 2DN7A 4PJXF 4BSVB 3X14A 2R2EB 4MHHI 4OT1H 1UT9A 5FYKD 3V7AG 4M7LT 1ACYL 5CJ8A 1N6QL 4L8CA 4PBXA 2CKBB 1NFDA 2G2RA 2RFXB 1JBJA 3BT2L 2ZUXA 3MOBL 4GMSL 1PG7H 4G5ZL 2HKFL 3HNTH 1TNMA 1PG7X 4PLJC 3CVHH 1GH7A 2Y07H 1P7KA 4C59B 2NY2B 4PP1D 3VWJD 1IARB 3REWA 4JDTL 4XT1C 3CIQA 3BUTA 2FJFA 1MI5A 4JKPH 4M7JL 4HUVB 1S7TA 3T09A 4U6YA 4UT7H 2IANB 2JE8A 5C92A 1MFBH 5F6IB 2WUBH 4NKOA 3QUXB 3CVHA 1CVSC 3QG7H 1MNUH 4ONGL 4XHJD 1S3KH 1Y0LA 2X05A 4IRSD 2YD8A 3SPVB 3PDOA 1LEIA 3BHBA 4HWBH 1S8DB 1L7TH 2VDMH 1J8HB 3T0BA 1JHKL 3CZFA 5D2LF 1KTLA 4DTGH 4LU5H 4TUKL 5E2VH 1FL5A 4FFZL 4FMFA 4G8IB 2APBA 1B9ZA 3UTTD 1MAMH 4U2YA 3O2DL 1N59A 1WUNT 2BHZA 5E6IC 4NN7C 1PYWA 1FVCA 5KSUA 3L7FA 3X17A 3BDXA 2NLJA 5GZND 5D93C 4LCCB 5C0AD 4Q97A 4DN3H 1MVFA 2R56H 4K7FB 4WW2A 4ZNEA 2ITCB 1IL1A 5F21B 4YHNB 3B5TA 4MA7L 1MHEA 3UTQB 2O5YL 2F74B 2GTZA 4HKJA 5DT1H 1V7NH 2YUVA 2ESVA 1FORL 1U3HB 2CO7B 3GMPA 4GXVL 1IC4H 5B39A 5L2JB 4KHXL 4BYHA 2OX5A 3OKKA 3BESR 2DLIA 1S7VA 3RNQA 3TT3L 1BQHB 1FRGL 1ZMYA 3TA3C 1S9VB 4GOSA 3GBNL 4RGND 2CUHA 3H9YA 4NO0A 3ORJA 3ARDB 5D7JC 1DJSA 4R7NA 3VGAB 3X11B 2NXYB 3RY4A 5JDSB 2DLFH 3Q1SH 4YHOL 2CDGA 3O3DB 4NKQB 4JQXC 5I74B 3V8CA 2BJMH 3KXFB 5HY9B 4DKDC 2AK1H 4I0PD 5A2JH 1W72B 2X4UB 4HX1A 4JFDB 4P4KB 5CILH 1AY1H 5I8OL 2HWZH 3RVVC 4RSVA 4JHAL 4K94H 2PXYA 3KPPB 2CDEB 2IMNA 3QQ9D 3MCKA 4NZRH 3UMTA 3TN0D 3H3BC 3A67L 2NW3A 2MPAH 1P2CA 4MSWB 1TJIH 3FB6A 3TJHC 2ZPKH 5I1HH 3D3VA 4Z7VE 3QXWA 2J1KA 1OGAB 5IW3A 1AXTL 5L2KA 1OF2A 4ZFOL 1BHGA 4LDLB 1WBYA 4XNXH 3MUZ1 4HS3A 2V7NB 3MLWL 1Q9OB 1GZQA 2B0SH 3D2UD 5HHPA 3U7WL 2D0HA 4ZSOE 3MUJA 3DVNB 1CZ8H 1A7NH 4NM8H 5H35B 1MHEB 4DW2H 1P4IL 3ARGA 3LQZA 5ADOH 1I1CA 4H88L 3TYGL 1Z9MA 4KQ3H 2VITB 3WN5C 4IJ3C 2AABH 4XPBL 3F7PC 3E8UH 1D3CA 1JZ5A 1BLNA 3OJMB 3EOAA 3WS6A 5SWSA 4BK5A 4LKXB 1K5NB 3GBML 4NO0B 4Z7WA 1NC4A 2CUMA 2Q7YA 4JQVC 5F1IA 1FCGA 5EOQH 3EOTH 2I27N 3TC9A 3ILQC 4ONFH 1U8OB 5EC1B 1KELH 3CC5A 1MOEA 3I9GH 1MJ7L 4PJGA 3ARFC 1FVDB 3VXTB 1ZHKA 3FB6B 4GO6B 1FJ1B 4MCZB 3QI9D 4RFOH 3SDYH 3RWHA 4XPHL 3V0VB 5CILL 1UM4L 3WHE0 1CXKA 2VDPL 3U4BL 5E7BA 3MCKB 1Y18B 1BD2D 1AC0A 2YOCA 2VAAA 1EO7A 1IBGH 1T22B 5BS0D 4QRTA 3MQIA 5C0GA 4WI5A 5HYQB 2A6JB 1XGPB 2FJHB 2IGFH 4YDKL 4PJFB 4YNYB 2BOCA 1HZHL 4OLXL 1WBYB 3PL6D 3TBSB 2OZ4L 5ANME 1KN2L 3ES6B 3M8OL 4LSSL 3MGTB 4N0FA 2C7UB 2J4WL 2E8YA 3QXDB 1R3IH 1DQDH 1QA9A 3QHFH 4RAUB 5C0AE 4K9EL 3H9SE 1T1XA 4OJFL 1MRDH 4M62L 4JE4B 3BMWA 5A16A 3ZT6A 3VFWA 2W65A 2P8LA 3BYTA 3P4MB 4JN2B 5HI4C 1K2DA 1MRCL 2W9DH 1W72L 3UTSD 2BVOA 1MCCA 4GKZA 4AMKL 5E56A 3VCLA 2E6JA 1ADQL 4PJEF 4HKBA 1WWAX 5CP7A 2A38A 2WBWB 4R6UA 5C2UB 2DIAA 4Z7VA 3JWOH 3MRCB 4MA3A 3GFUA 1CDHA 3MJGX 2XWJB 2X4NA 4HIJA 1CGWA 4IMKC 3HN3A 1LMKA 4WO4C 1T1ZA 3HI1A 2ZNXA 2HJKA 4WCYL 4QHKJ 2UZYB 4MNGA 4NO5A 3PG2A 3GDBA 4PTTA 1D5BB 2DQGH 5I71C 2AJSL 4ZFFB 4M62H 3RQ3A 1VKXB 2NY3B 3HI5L 3MUY1 4J8RA 3QCUH 3CNKA 4XCNA 1FZOA 3O8XB 3LEXA 4M8QB 5ICZA 2EC9T 1FLTX 2WQRA 2NNAB 1W0WA 4IHOA 5CGYC 5EZOL 4Z7WE 4U1NA 4DOHE 2ZJSL 4JKPL 1SJEA 4LSTL 4N1CA 3WNOA 1SYVA 3MRQB 3QZWG 1J10A 1G7IB 4P5MB 3HAEG 4ZS6D 2FJGA 4KKAD 3DGGB 5I8CA 4F37F 5JOFA 3RNKB 4HJGA 1YEGL 1J1PH 3S4SG 4LSDA 4XVSH 1RUQL 2VL5B 4DKFH 4QTIL 1YPZB 1I9IL 3LKOB 3MRGB 5I1DB 4R26L 1BZQK 4IRSC 2N7BA 4JZJA 5FUOH 2BSSB 1W0YT 3CD4A 5TQ2L 3QEQD 5T3ZE 1Q72L 1ZLSH 3BH9A 3S98A 3O2DH 3ELAT 3RWIA 3KYNA 3L3IB 4XC1H 4PGBB 5GGRB 3TNNA 5DRNB 4R97B 2VXVL 4E42B 3DARA 3PHOB 4K07A 1OTUD 2ICCA 3REVA 1T5WB 2D7NA 5BS0B 5BW7C 3U0WH 5SX5K 3VFGL 1T1WA 2BVUA 5EUOF 5FB8B 3TO2B 5BMFL 4XP1H 5H37G 3GSVB 3B9VA 1X4YA 2P7TB 4HDIB 4HIIA 2OI9C 1UFUA 1AD9B 1RJLA 3BSZL 3WJLC 1F90L 1RK0A 4UMGA 5D7JD 3LEXB 1U8NA 3QDJB 2LAGB 1X5KA 4JDZA 4BKLA 5IHBA 4FFVD 32C2A 3T8XA 5HGHA 4NRXB 4X8JA 3PWPE 4XX1G 2V2XA 3H3PH 3HRPA 1BX2A 3ZKXC 4RFNB 4JN1H 2XY1A 3L95B 2NMSA 5HI3C 5GGSA 3B4NA 2GSGB 3SE9H 2BK8A 4TPRL 1HKFA 4CN1A 3G6AB 4FABL 1EUTA 5HPMA 4MNHB 3MACL 4PB0H 1NAMB 2D0FA 5E2WL 5I8OH 1AO7D 5JR1L 4KJWD 2VC2H 2Q8AL 1YPZA 2X2YA 4NJ9L 4UIKH 3U46B 1S8DA 1DANU 3CLEL 5E6ID 3V52H 3VRIA 1DN0B 1SJXA 5E0QA 4G42B 3ME0A 1XGUB 4GBXC 4FP8L 4NRZB 2VDOH 4ZUVB 1I3GL 1AXSA 3LRSB 5FGSA 4QYOB 3IFNH 5F8RC 4MNQE 1U8JB 2BHYA 4ZUSB 3PGFL 4L3CB 3ARBC 4PV8A 5HHOD 1OAYL 4P46A 4XCFH 4OLUH 1JNHA 5EO1B 1C16A 4LCIH 5IMLB 2NY1B 4Y4KD 5ABDE 3G5VB 2HJLA 3QJFA 4OF6A 3BN3B 1HHJA 2FO4B 3D85B 4FZ8L 3S35H 5ICYB 1EPFA 3RDTA 4GW5B 2GJ6A 4MA7H 1AD9A 2IALB 5FF6B 1B0WA 3EO1B 2E9JA 4XMPL 4NQDB 3LV3B 4JFHD 5CHNA 3VFPA 1YA5A 2E9IA 3QNXB 3MRDA 4MA1C 3VXQA 1P7HL 4AL8L 3FZUD 3IAPA 5DK0A 5CZXD 1SEQH 2FX7H 4TSAL 5A3IC 1Q72H 1WVZA 2BNUA 3WKMH 2VDRL 4JG1L 3X3GH 1RMFL 3QO0A 3DSNA 2ZUTA 4LBEB 2J8HA 4YH6A 1FZJA 1G6RL 5HGGS 1I7TA 3U0WL 1Z5LA 5D2LE 1T0MB 2IAMA 4ZXBC 4WI8A 3JWDC 3WDJA 4OI7A 4P48A 5CD3B 3DX8B 4FQCL 5IVXE 2YBRB 3IF1A 5DI8A 4ELMA 2EEAA 3O45A 1JWSB 5EZIL 1D6VH 1JF6A 1EO8H 2XTLA 4G8EB 3FB8B 3RWDB 1IE5A 1XT5A 2Q1EA 2AKRB 1GGCL 2XTJD 4JZJC 5IBLC 3SCMD 4K3EL 5LWYL 1GZQB 4JM4H 4KDTC 3V0WL 4RBPK 3D85A 3A6CH 1IM9A 3KLHC 1CVRA 3E3QC 4H5SB 2DTML 4Y89A 5AD0A 1MPAH 4W6YB 4XPGL 1OGAA 4X6DA 2APTA 2XZAH 3U6RA 1UKQA 4NZTH 5J8OA 3Q5TA 1BJ1H 2I9LA 4MA1B 4K7PY 1FFPB 2V7NA 1E4KA 5F9AC 3TWCH 4PGEB 5GS2D 2NY2C 3T0VA 3ZDYF 4Q6YA 3RPKA 4L8DB 5IESL 2WUCH 5ALBH 2LU4A 4ERSL 3MUHL 4NKOB 3WO4C 4YXHL 4WY7L 1NGYB 4OCWH 1QTYT 2APWA 3GO1L 4OI8A 3OKDB 2EYSA 3OSKA 4JM2C 3MYZA 1HH6A 1ZEAH 1RUKL 5FGRA 4ZUUB 5CD3A 2HRPH 1D5ZB 4NO2A 3BWUC 4LHQB 3CMGA 4XAWH 1T5XB 1F5WA 3O6FA 4KFZC 1NMBH 3WFZA 4HJ0C 4KMLB 5IB1A 4Y0GA 1PAMA 5EUOA 5CP3A 2AK4E 4LP4A 3CFBA 1N59B 4X6CE 5GSVB 3MXVL 1KCVH 3CDCA 2KZ1B 4WGVB 4X9GA 1IGTA 3CXDL 1Y18A 43CAB 4XWOC 2R2EA 3O45B 3GMNA 4GKSB 4ORGB 5I6XB 1I9JL 5JXAH 4DEPC 3T4AB 3RVWD 4OKVB 4K7FA 5HHXH 3HG1B 3CFJA 4L5FL 2P43B 3QWOA 3MV7E 1BVLA 2R0LL 5FO9A 3MGTA 3ECBB 1DUYB 4N0FB 5D4QA 2IANE 4FQIH 5F6HJ 5HD8D 2CXGA 2DI9A 4XBPB 4ZO7A 2BC4A 4EVNB 4F7CA 4U0QB 1DL7L 1QLRA 2BDNH 1QFWL 4LPYA 1U3HC 4GG6A 1G7JB 4L3EE 2EDNA 4C58B 3CX2A 1A7BA 2XWTB 2F9BT 3H9SB 2WSKA 3MRJA 3IKCB 4KI5C 1EZVX 3BKCH 4HPOH 3RY6C 1I8IA 4JG0L 1LO3H 1H8SA 1OSZB 5E24E 3X11A 4U1GC 3KPNB 3KPQA 1KUMA 1NEUA 3T0DA 4KRLB 4Y19B 2IH3B 3NFPA 4GQ9H 2LAAA 4YHIA 5IEHA 3ULVE 4UI2A 5GRYA 1HK6A 2VZSA 1RZ8A 3OGOE 3FQXB 3GGWA 1VGKB 4JPIB 1CL7I 5F96L 1DQLL 2C3HA 1VGEL 2J8UB 3VJ6B 3VXMB 4HCRH 1H15A 1TVBB 5E4EC 3O2WL 4WI7A 1AQKH 1A3RH 2NY4B 4YFLF 4D8PA 5FYJD 4BUHA 4ODTL 2C1PA 1VKXA 2DQHL 1TCRB 4R8WL 1SMOA 2BP3A 3PWJB 5A43C 2W60B 4JJHA 1JPFB 4YBQC 3SDXB 4XPTH 1CE1H 3TCLB 3RJQB 4LHUD 2EXWC 4ZPVA 3VXUA 3TYFB 4KPHH 1A7OH 3F8UB 2DI7A 3LCYA 3TIEA 2R29L 4LLWB 1AC6A 1ZV5A 2ESVB 1KNOA 4TNVK 3G6DL 4LP5A 3BQUB 3GJFK 4ZOCA 3CFDB 3GHBL 2X5PA 5TFSH 5B3JF 1FRGH 2Q86A 4LEOA 1OSPL 4YBHA 1QRND 1WLHA 4J12A 2YRZA 4CMHC 3SDCC 4P46D 2H41A 1KT2B 1DFBL 2H32B 5EOTA 2Z91B 4LSQH 1DL7H 3L3KA 4OLVH 5FECA 5I2IB 3DUUB 1CR9H 3CVIH 3B2VL 3GSQA 5J56B 2CR3A 2AK1L 3ARWA 4R4BB 1FNGB 4C56D 1GC1L 3FQXA 1AO7B 2VLJA 1J1XH 5F9WB 1UWXH 3U4EB 1A6VH 4KK6C 3IETA 1JPST 1F02I 1KJ2B 2OR7A 1GGBH 3QDMA 3FMGH 4NHCH 5ISZD 5IW1B 2XG5A 3VFSA 3IDYB 3ZHLA 1U6AL 4E0RA 4Y16C 3ALXA 3EO9L 3VFOB 2GFBB 1CS6A 3IDIA 3MV7A 4NWUH 4JM2A 5F8QC 2IJ0C 2UZIL 2FJFB 3O11B 1TCMA 1RZJL 2H2PD 2ED7A 3BH9B 6CGTA 3BW9B 1WZ1L 4UUJB 3Q3GA 1NAKH 2ADJA 1H3XA 3AY4C 1ZE3C 3IAQA 4HUUA 4Q9BA 3PHSA 3D85D 3AXLA 5EZJA 2X9YA 1FH5L 2DQHH 2VLKE 3W0WA 1NL0L 3D39D 4G9FD 5H37H 1JP5A 1BM3H 2ICWA 3RWJA 5FXCH 4AZ8A 2OQJA 1U3JA 2EECA 2XY2A 1U8KB 5DHXB 4HJ0D 4Y19E 2FHCA 5J1SC 3OF6A 5FYJU 3S34L 1ZA6A 3S36H 4G9DB 2OS7A 3IAGC 1IM3A 3LKSB 3O2VH 4APQC 2E9WA 3RGVA 5IOPA 4UV7H 1MCFA 1NCBH 2DBLL 3T8XB 2DJ4A 1K4CB 4NCC1 5EOTB 1CGSH 2CO6B 5CP3H 2WIIB 5C0BD 3IXAB 1JZ6A 1NANH 4OSUH 3EZJB 4Z9KB 3TVMD 3INUL 1MRDL 1KYOK 3SJVE 3CLEH 3FQWA 3U4EA 2GITA 4F3FA 5DJDA 4TOYL 4XX1E 4EIZC 4Y5VC 1A6AA 1FYTA 5E2WH 3ZLQC 1HHGB 3TJEL 3DV6B 5TFSL 5JUEL 2ZNWA 5DHVB 3TBTB 5C6TL 5FGBA 4D0BA 2DQJL 4HCRA 2GK0B 3TPKA 1ITCA 2WP3O 2BVPA 4YPGB 5C0CE 2Q8BH 2FB4L 4MXWL 4Z6AT 3GMRA 1QQDA 5D72H 3WN5B 2XXCB 4YGAB 2WINB 3QH3A 2OJZH 3GUTB 1J0KA 3RTQB 5CS7A 3CAFA 3QEGL 4NN5B 2R1WA 1PJ9A 3V7AE 4XCYB 3O8XC 2H8PB 4WHTA 5C0BA 4U49A 2AGJH 1XF5A 4JHWH 4G9FA 4NT6A 5FF6A 5D8JL 5T5FL 4HX1B 4TSBL 3QQ3A 2ORBH 4UZGA 2XKNB 1Z2KA 1A4KA 1MH5A 1JNLH 4G6AC 4YHKH 4F7EB 1I8LC 3MA9H 4MXQD 1X7QB 1HQRA 3D2UA 4G7VL 4FTVD 2EDHA 1U2CA 5DZOA 3KS0H 4OV5A 2UWEF 5IMOB 5L2KD 3QFDB 4H8WL 4M5ZL 4GJTB 1AD0B 3SDAD 5LKNA 2OYPA 1CQKA 5GGQH 1BAFH 1WBZB 3RL1B 3MBEB 1MAKA 4DN4H 2D3VA 1A6AB 1FYTB 2QV2A 4UB0H 1MCDA 5GGTA 4UT6H 3RHWF 4ELME 2ED9A 4F7TA 2VZ3A 5ALCL 3TLRA 1MCQA 2QADC 3HMWH 1XGRB 3LN9A 4AK1A 3NTCH 3VXSE 1CLZL 1ZGLA 1AKJB 3HLAB 4PTTB 4JFZL 4K8RC 3HR5A 3C8KA 4F33B 1HHGA 3MLSL 4E42A 3D69B 1NCWL 4UINH 2EDDA 3SKNA 1FZMB 3BGFC 5DDHA 1VPOL 1LP9E 4N0RA 4HPYL 5DEZA 4KXZI 1TJGH 2W0FB 3MRIB 2XN9E 4U0RC 5HHME 3UTZB 1X5ZA 4NQEB 4PJGF 3VA6A 4WI4A 1WIPA 4WV1A 4Z7QF 4Z7WB 3IJYA 4H8WH 1DQML 1WEJL 2NY2D 4PGEA 5JNYB 4JFFE 4JGUA 1JWUB 4XP5L 3EDFA 3H9SD 4IEFB 5FKAA 3I6KB 2XACC 1GOFA 4U6VH 1OP5H 4DUVA 3WJJA 4V2CB 4POYA 2C9AA 3LKPA 1LK2A 1OTTC 1XIWD 4PRHD 3RNKA 5T5NF 2V5RA 5IQ7H 2AK4B 1HOCB 5E8PB 5T5FH 1QR1B 3IDGB 4N8VA 4WO4B 1LNUA 3HZKB 2AJXH 5E2TL 3V6OE 4GRMA 3IETB 1ORQB 2ATPB 4LSPL 1FC1A 5TF1H 2IQ9H 2E8ZA 3GBNH 1HILB 4PJDE 2E7BA 5D6DA 5DC9B 2CJUH 1AD0A 4KKBD 1S78D 2FX9L 4PJFA 4HWZA 3WLWD 4LOUC 3SOBL 4KZEH 3MLWH 2PYEB 1DN0A 1U8MB 2VJXA 2PNDA 4LCUA 3B9KD 3RVTD 4EN3D 5FOBB 3EYOB 3D0VA 1JMXA 1NAMH 4Y4FC 3Q3GB 4PJ9C 5TPWH 1JNLL 1QUNA 5FUOL 1DZBA 3QUKA 2A74B 3FOLA 3QA3B 4JJ5A 2P44B 3EGSB 1PD6A 1SY6L 5DRXB 4KRPD 1RK0B 5FGCB 3V4PL 2EH7H 4I18C 4F7CB 4Z0XB 4KK9D 3RGVD 4YXKL 4PUBH 3GRWH 4PG9A 4HKZA 1EEZA 2D7PA 2YXFA 4GW5A 4MXVE 1UKTA 5E1HB 3SDDA 2VOTA 5DEGA 5HDOA 3OF6D 1IT9H 3SKOA 3D25B 4C83B 3WXWL 3VXNA 1NBYA 2AEQL 3PL6C 4DGVH 5FO9B 4JLRA 1I4FB 5IGXL 4GRWB 3L3GA 4RMRA 2ZUSA 4WFFD 2AXGB 3KJ6L 5F89A 2WBJC 2DQDL 3H7BB 4HHAA 2HT3D 3W5NA 4FXGB 4RMVA 4NWTH 1INEL 1FIEA 2CDFB 3JVGA 3GKZA 4PV9A 4CJ1A 5FKPB 1M7XA 3F7VA 5T3ZL 3U7YL 1H5BC 2NXZD 4XTRC 1IAKB 4S11A 4JFDD 4P4KA 3ZSSA 4XMKH 4ZXBB 4JFXB 4ZD3L 1A7RL 1LP9A 3QDGA 2YC1A 5E1AA 2B0SL 3UTSE 4TVPE 5ICXA 4YDJA 3DXAA 3ZHKA 1I1YA 1TZHB 3ILQD 5JORA 4UT9H 1CFQA 5HHMB 3PP3K 1HDMB 1AHWC 4QWWC 3TM6A 2W0PA 3EYQD 1PY9A 8FABB 1DBAH 4Y1AA 1LE9A 1JGDB 3MRFB 2VO5A 1CE6A 5JZ7D 2VH5L 5LGHL 1A6TB 5AZ2L 4L4VB 1BREA 2IG2L 3NCCB 5C6PB 5FEBA 5DJYB 1WBXA 2DWDB 2VXTL 4XPBH 3GEWB 5SWZB 3MV9A 5GGTL 2MKLC 3BDYH 2FEDD 5F7DA 2WBJB 5ITBH 5C7XL 1U8HA 3C60A 3BPCB 5EG6C 4L8SB 1K6QL 4ZTPL 2ZG2A 5F6HI 1KENL 3MRMA 3CFDA 1A47A 4UNTA 1KSRA 5FYJE 5DHVH 4K2UL 3W5MA 1HXYB 3CSYA 2AAVA 2DF3A 1KN2H 2HT2C 3KJ4C 3WUWA 1D9KC 2WW8A 5C71A 3FOMB 5IM7A 4Y16D 1TPXC 4Y2DD 2R4RH 4J2XA 4N8PA 1A7OL 1RHHA 1UJTA 5IB5B 1T1WB 3QIWA 5I18L 1AO7E 1BQHG 2IPKA 3HE6C 4JRXB 2QQQA 3U2SA 1I3RA 3QDME 5GQBA 4KK6D 5E8NA 1KCSL 1IGFH 4XGZB 4F8QA 3OV6A 9CGTA 5C08E 1A02N 5H8DA 1RV6X 3L9RB 1B0RA 2P5EB 2V2WA 2VXUL 2F5BH 4XP4H 1G7LA 3O3UN 4UUJA 3ARGC 1OWWA 4P4RB 3QUMA 1WBXB 5HHVH 3C6LA 1I85C 4YHPB 1KELL 1NLBL 2BCKB 2QSTA 1IM9B 3NFSL 2PN5A 1MJUH 2MJWA 4LSRH 3MJ7A 3HE7B 2A6IA 5HHNB 3BKJH 2ZUWA 4Y16A 3BIKA 1CYGA 1XR9B 3U0PB 2IPUG 1IGCL 4L8SA 4P23A 1CGTA 3WFDL 4QGTA 4CADA 2R23B 2VLRD 1DEEA 1OAXL 1FORH 1F4XH 2FX8H 3GK8L 3SGEH 4O2EA 5F7NC 4MB3A 1I7ZB 1LD9A 5KVDH 2XI9A 1T03L 5TQ2H 3HC0B 4X6EB 5B39G 5ACZB 2VZVA 2V6HA 5AUMB 4PJ7B 1HN1A 1MFBL 4R0LB 2ATKB 3IT8D 3HE6B 3MV9D 4APQD 5JA8B 1JE6A 4NRZA 3IGAA 3QO0B 4FQIL 4ELMF 3N06B 4F15B 2EIEA 1NMBL 2IAMB 5GJSL 5D5ME 4CVWA 5DO2D 4Z7UB 5C0ND 3S5LG 4MQSB 1OQOA 2DLHA 5IB3A 4BFBD 2ZG1A 2HG5B 1A1OB 2VLJE 1RZKH 5DJAA 5I0ZA 3CPLB 4UOW0 1T1ZB 3HI1B 1P5UA 1Q94A 1V3JA 1PZUB 1YQVH 1RFDL 3P77A 5EZOH 4WHYH 2X70A 5E2JA 2FX8L 1WK0A 3CCHB 2Z8VC 3P30H 3OG6B 5B8CA 2A74A 4OCLC 2NY6B 3VFVA 1D5IL 3S9DB 4RRPA 3QAZC 3WBDA 2DD8H 4POZC 1JZ4A 2MHAA 3WUWG 2F53B 3PIQA 5ILTH 1DUYA 1U36A 2XRAH 2VDLH 2YPKA 1FYHB 1AIFB 1KV3A 1WZKA 2KBGA 4JO2H 1MY5A 4ZYKA 5F88B 1S9XA 3D5OF 1RIHL 1UVQB 5HDBF 1A14L 3EUUA 4HH8A 4LEOB 1A7PH 4R2GD 3VWJC 4QTIH 3L3GB 4HWUA 4BH8A 3E1F1 3F58H 3NFNB 5CLWA 3SDCB 3SBWC 1XCTA 3LS4L 5FAAA 4NCDA 5JOFB 2PUQT 1WT5C 3RX8A 2Y7QB 3TO4C 1KIQB 2RIKA 1QP1A 3MFGB 4Y19A 1CXLA 3P4MA 3LN4B 1BGXH 4Y7MA 3C5ZB 2YKLL 3DVGB 5IR1A 2VNCA 4P46C 2WNGA 2HTKC 2E27H 1BVKB 4HBCH 2VZTA 1MHPH 4JFED 1E4XL 4G6MH 3DVFA 4KUZL 1HHIB 2B5IB 3WLBA 2A0LD 3N1QC 4GAYA 1F3DJ 1PYWB