5FHAH

Crystal structure of protective ebola virus antibody 114
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
215
Chain Sequence
EVQLVESGGGLIQPGGSLRLSCAASGFALRMYDMHWVRQTIDKRLEWVSAVGPSGDTYYADSVKGRFAVSRENAKNSLSLQMNSLTAGDTAIYYCVRSDRGVAGLFDSWGQGILVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and molecular basis for Ebola virus neutralization by protective human antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody 114 Fab heavy chain
total genus 49
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fhaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fhaH01
5JOFB 5T3XD 3X12A 2C4FT 4M6OL 5CEZE 3V5HB 5TGBB 4M1CC 5IB3B 3ARFA 4RMWA 1T1YB 3WJJC 4NQEB 4GQPH 2ENSA 3LB6D 3K1KC 2C26A 4YWGH 2CK2A 3GMOA 4URTB 1ORSA 1NAMA 4J6RH 3CH1B 5HVWA 3TNNB 4L9LC 5H37G 3GUTA 1JF5A 3ARDD 1J5OH 5SWQA 4F7MB 3TA3D 5ITFB 1SY6H 2DWEB 1YYML 5I1IL 4QRTA 5A2JH 2AXFB 4X7EC 4U05A 2VDKL 4YHML 4V1DA 5D7IE 3FT4B 3KPSB 4A6YA 5DJCA 1U9KA 2QR0B 4H88H 5I17A 3QDJE 1BVKA 1SY6A 3VFOA 2QSCL 4ZSOA 4DZ8A 3DXAB 3O3EB 5CJQL 4P2QB 5A3ID 1RJLB 1TVHB 1KBGL 2G60H 1IGFH 4NRZB 1M6OA 3MGTB 1T20A 1UENA 3MLYH 4PFEA 3SKNB 4NUJB 3S3SA 4I13B 3P4OB 1MRFH 1AC0A 2F8XC 3CU7A 4I5BA 2BNQB 1BLNB 3ARQA 3OV6A 1V3MA 2D3VA 2H8PB 5LWYH 4Z5RA 3VFWA 4PY8J 3QUXA 1AXIB 4U3CA 5HHQA 3ULUC 1BD2B 1FYHB 2ZUTA 3WXWL 4WNQB 4XBPA 4XVJH 2WIIB 4PR5B 2Q8BH 3LKSB 5I66A 4OLUH 4LAJH 1NGWA 1C5DA 2BFVL 1OM3H 2J2ZA 3SDDD 2R9HC 1NEZB 5KW9L 3PDOA 3QDJA 4IRJC 1T83C 3D0VA 4WY7L 4LPXA 5E2UL 2NY1B 2PETA 2NY5H 3VD3A 3P3YA 1FL5A 3ESVF 2IALA 4LGSB 1OD9A 2FL5A 5FA4B 1FQ9C 3OGOE 4JLRB 2R2EA 1U3YA 4KWUA 5DEGA 4GG8B 4OGYL 5DC0A 1G6VK 3RWFA 1P4BL 1A2YB 4Z7WE 4K94C 1CFVL 3CK0H 1JVKA 3IXTB 5C09E 5J6HA 3FB5B 5ELIA 1P6FA 3MACH 3ZYZA 4G8GD 1E27A 4K8RC 4U1IB 2X7LB 3KHQA 4U1SA 4PGBA 3OR7A 3MRCB 1FL5B 3KHOA 1PEWA 2A6DA 3OAYK 3IGAB 3PWVB 5H94A 4OKVA 4ZUSB 1YEJL 3BKYH 2DD8L 5JO5A 2Y4SA 2XZQL 2AJZB 3BZEB 3V5DA 1CDYA 1QFOA 3BPCB 43CAB 1MIEH 1JGEB 1W8OA 2FBJL 2NTFB 2H41A 4ODUB 1OAYH 1X5KA 5FYLH 4TSCL 2MPAH 2BNQE 3IJSB 5D72H 5I30H 1Q0YH 4UDTA 1GHFL 2FX7L 4J7RA 3RWJA 1F4YL 2A74B 5CZXD 1QHOA 3GNML 5SX5K 1OAZH 1WWWX 5EC1A 2QADB 1SVCP 2DB8A 1NCCL 3V9FA 4N0CD 4OIAA 1JZ2A 1G7PA 4PTTA 2CDGA 5I17B 1RMFH 4JR9H 5EU6D 2NW3B 5C0GB 1INEH 1RFDL 4YGVB 1NFIA 1C16A 4LLUA 4R0LC 2HT2C 4EUPB 5K9OB 3JV5A 2BOCA 5F7EL 3A6BH 3V7AE 5GRVK 5DUMH 5HJ3B 5KOMC 2ICES 4F15B 4NP4H 3QUMB 3AREA 1U2CA 5EO9B 5HDQH 5IQ9B 5MERA 4OLWH 2Y06L 5HI3C 5TPWL 5M94B 1OTUD 3VFSA 5LGJA 1D6EB 3IDXH 1MF2H 2BNUB 1F6AB 4PJFA 3RPIB 4W4OA 2BY3A 4HS3A 3P9LB 1UH3A 43C9A 2QHRL 5C70A 1EGJA 4PJ7A 1UEMA 3FL7A 1MWAA 4TUJB 4XX1G 4JANA 1JMZA 4UDTB 5K93A 2AP2A 1UKTA 1D9KB 3DRTA 3V6OE 4N0YL 3Q5TA 3SBWC 2OLDA 4U1NB 3DX6A 5A2LH 1IGIH 4N0FB 2J8UE 5LVEA 1GOGA 2E27H 4NO5A 4LOUC 1JGUH 1MWAH 2D9CA 2BRRH 1JF1A 4FXKB 4FFZL 5CP7A 3T77A 2MSPA 1EK3A 4HDIB 5J0BA 2WIIA 3OXRA 4PR5A 2V2XA 1B4JH 3HZMB 2VLRE 4NO2B 2Y25A 2BY2A 3O3DB 5HHVH 4IHOB 4HPOH 4NQCB 3RBSA 2P8PA 3ZT5A 1KCRL 4OZHF 2G2RB 2NY7H 2D7QA 2XKSA 4W81A 1Y18A 4LCCB 5E2WH 3LQAC 4JFOB 5DJDA 2FX8L 4LIQE 3U79A 5KSAC 3QXAB 3OWEA 1II4E 1MFBL 1J11A 1SEQH 4HC1A 1EHXA 4L8CA 5JXAL 1VDGA 4MWFA 1KPVA 2AEWA 3KYOB 2ITDB 2VL4A 1CE6B 1A6TB 5CUSL 2P5WB 3ARGA 3P4NB 5EU4A 3T2NH 2XQYG 4HUVB 4NYLA 1IQDA 2APFA 5HGDA 1NCNA 1S9KC 3QUZC 5DD1L 3VXPB 3BJ91 3W82A 4XBGA 1P7QB 4LHUG 1NGQL 5F7WC 2IC2A 4P5KB 2ZNWA 5DJ8B 4LF3B 2XICA 3OPZH 5HDOA 1FJ1B 2EDEA 1NCAL 3QIBB 2CSPA 4JM4H 5C0EA 5BVJB 1F3JA 3AS0A 3RQ3A 4OZIA 1Y6MR 1UA6H 4MA8L 3WKMH 2DQHH 4M7LT 4HS8L 3VXME 3WS6C 3DO7B 5E1AB 3ARRA 4JO4L 1KC5H 3KGRA 4XXCA 1RUQL 3T4AB 4D94A 5L7XL 2R56H 3TEUA 5E24E 1A9BA 5MEQB 1VESA 2H6PA 3E6FB 2Z93A 3P0YH 4EIGB 4IS6A 4WTWA 4XMLL 5J57B 2JCCE 4GMTH 1T2QL 3BGMA 4QKXB 4V1DB 2AEPL 3CDFA 1MREL 2OQJA 4QRTB 5HVFB 5D2NA 3UJJH 4Q2ZB 1TIUA 2H3NB 1EFQA 4KQ4L 4MXWL 4AMKH 4HLZH 3SJVB 4PRBB 3MLXH 3ZLQC 4IOFD 4NCC1 1R5VB 4F9PA 3QEGL 2WV3A 3V5KB 1BJ1H 1MHHA 2V9QA 2R0KL 4PP2A 3SDAA 4MMZC 5ID1A 2IH3A 4BZ1H 5CKAA 1NBZA 2BJMH 1LO4H 2P5WE 2DLEA 3X12B 4R97B 1CDHA 4JFFE 3T0AA 5JOFA 4LSDA 3FN9A 3TPUB 4KK8C 2BVOB 3GK8H 4Q9QH 4C83A 3SHSA 3QDJB 5KSBA 3KLSA 4PJHA 3BEWB 2IBGA 4XTRD 2JIXB 2FWOA 3MMEB 2MOVA 3CC5A 1JPSL 5IVXB 3TBSB 1JWSB 5EG6C 2AERT 2OZ4A 3VXMB 4P2RD 5H2BB 3V6FB 4XNYH 1F4HA 1NAKL 3BESR 1Q9KA 5HYQA 3WN5B 5D70H 5HYSB 2VIRB 2BSRB 4N0RA 3D39B 5DLML 4WWKA 2XWJB 2Z9TA 3FZUC 4GS7B 2GTZA 3VFUA 1RIVH 4MQSB 1MEXH 2XTJD 4ZFZB 4ORGB 5T3ZD 4X4MA 2NCMA 3VGFA 2J6EH 4X4XB 1E4JA 1Q72L 5CAYB 1NCWH 4FQXA 3MRLA 3DURA 4NJAH 3AB0B 5DD3L 2XNAA 3QDGE 2VKXA 5JW4Q 1WEJH 3I6LD 4E42A 3TIDA 3PDGA 3K4DA 4KZDL 5FKPA 2Q8AH 4X7TA 1FLRH 3B9KC 4PJ5D 3SKJL 1L6ZA 4XVSL 2YK1L 4GRWF 1T5WB 5HGHA 2X4TA 5I19L 2AGJH 3MRQB 4UILH 5J6GB 1RUAL 1MHPL 4NZTL 3VE0A 3F5WA 4ONFH 2I60H 1V05A 5IQ7H 5GPRA 2XXCB 4ALAL 1RI8A 4Z7OE 1CGSH 1UKSA 1U8QA 2DLFL 4ZPTA 2NZ9D 1CS6A 4WI5A 5A1AA 3SGJA 1DANT 4Q7DA 2XTJE 4DZBA 1FCGA 2VXTH 3H3KA 2HFGL 3DUUA 1MSPA 1H3PL 3WUZA 4UBDD 1KELL 1VA9A 1MCDA 3MBED 4OZHA 1URLA 5CZXC 4ZXBC 2CXKA 4KRPC 1EUUA 3MBEB 3WFEL 1T2XA 3C5ZA 1FL6A 4P57B 1DSFL 4TVPE 5ALCH 5D72L 1FV1B 3NCJH 3INUH 3MBEA 3QQ9D 3VMNA 5I6XB 3DROA 3MRHB 3MRLB 2F54D 2VDPH 2VH5L 2VLME 4J3UA 2WBJD 3RWCA 5K9JL 1WBZA 1MJJB 1TJGH 4PJDA 3FQNA 5EBLA 1JHLL 4YDLB 4FQIL 3EYSL 1AGBA 4LEXH 1T1XA 1YPZF 5DS8A 2A6KB 1DBBH 4OGXH 1PDKA 4Y19B 3X3FL 3TYFB 3GO1H 4RFOL 3ZDZF 3F7RA 3MGOA 1F58L 1IKNA 3NA4A 5CGMA 4U1KA 2E7BA 3OJ2C 4B7LA 1FRGL 2JELL 2FO4B 3LKPA 1TXKA 4K8RD 1KENL 4R8WL 1E4KC 4YJZL 4P4RA 4KKLD 2E7LC 2XQBH 5IHBA 5IESL 3SJVA 2A73A 2BVTA 2QV2A 4PLJC 3FCTA 3LH2L 2XY2A 4Y2OA 1KNOA 2P5WA 2R0LL 3HUJE 1RD6A 3FOMB 1A47A 3H9SB 2BDNL 3O2DH 4PD4K 1YEIL 2I9TB 1MLBA 3L9RB 3ALWA 5CP3A 2XG4A 5DXWA 1JGDA 3FFCD 2FCBA 3ESUF 1YECH 5DQJA 1YEEH 4PGJA 2XKUA 5CJXC 2WQ8A 1N5YH 3D2UA 4ZAKD 4G7VL 1HIML 2OBGA 2FH6A 4C56D 5HJ3A 5CKGA 4XNZB 3I6KA 3MLSL 3O6LL 4RMUA 5F9AC 5EN2A 3VXMD 1C1EH 1VCAA 2RFXA 1RURH 2R8SH 3D2UD 4JFXB 4ZAKA 2QQLL 3MJ9A 4H1LG 4WCYL 4G9DB 3P0GB 2YWZA 5J11B 4YXHH 3VXUE 4CUCA 4MA7L 4JFZL 4M43H 3H0TB 5DEFB 5BCAA 4LLMB 2VDMH 1TTGA 4PUBL 3MLRL 1MCJA 1NC2A 1IAKB 1KJVA 1YDPA 3VW3H 1WICA 3DGGB 2LAGB 1YN7A 3QNZB 4Z76A 5D1QD 3QPXL 5E03A 4CRPA 4XPAL 3W0WB 3R4DA 4PJCE 3ECBA 3CFCL 1MCRA 4U3XA 5DK0B 1FL3B 3W11C 2X89D 4LLDA 4XWGH 2YPLE 1E4KA 5E9DB 2OCFD 1OAUH 4F7CA 4GO6B 2FGWL 3IFLL 1R3LA 4S1SH 4K23H 4OCLC 1YNKL 4XC3L 3H9SD 5I2IB 5LGJB 1DUYB 2YA1A 5EWIL 5A16B 4P23B 4C59B 1PYWA 5C07A 3UPCA 5IGXH 4YC2C 1WV7T 4C58B 3H3PH 3MRDB 5AYUL 1JYWA 5F9WC 3IRZA 1DQMH 2JJSA 3RVVD 1ZOXA 3NA9L 3ZL4H 3DI2B 5F7YC 9CGTA 4MA1B 4WI4A 5FM5O 3F12B 4RA0C 5CIPB 2OXHA 3IXTA 1MFAL 4OGAC 4F57L 4L1DA 4MZ2A 3D2UB 1D9KC 3EDJA 3GKWH 4FFWC 3HFML 4Y5VA 1IRAY 1OQOA 1CLOL 3KAAA 4R96A 2EDKA 4X98A 1JRHL 4CKVX 4YE4L 4D9QD 2C5DC 3H7BA 3SE8L 5EOCJ 1J8HD 5GHWL 1T1ZB 4WWID 3ULVE 4HK3N 2FGZA 3HPLA 4NO5B 4A6YH 2NY0B 5F7DA 3V6ZB 1BIHA 3BXNB 5GGQH 5HHXH 5IIEA 4S1DD 5GJTH 2DQDL 4XWOD 4IRZL 5ICXA 1KPRA 2P8PB 4KV5E 4HCRL 3DMMD 2DDQL 4Z9KB 3IJSA 5IBUG 4FXLA 2XFXB 3VJ6A 4ZYKB 5BVJA 5C08B 1OAQL 1G1CA 3DIFB 1LNUB 4U1KB 1UCBH 1INQB 2APVA 4MNQD 2WUCH 1DLFL 5ID0B 5MEOA 4JN1H 4GXUN 5FIEA 2G9HB 1RIUL 2VLKD 1V3LA 5IJVA 1LEGA 5SX4I 5GS0C 1QACA 3E0GA 5DD6B 1MQKH 2AKRB 4DKAA 1OTSC 4OZFH 4OD2A 2P42B 5AWNH 5FHBL 2IF7A 4ODXA 1E6OH 5CMAB 1BQLL 2PKDA 1G7MB 5ADOH 3CU1A 5L9DH 3UYPA 1QLEH 2VOTA 1BVKB 5FUZL 1QR4A 1EUTA 3EUUA 4I1NB 5HHMB 1ZA3B 1MCFA 5E2VL 4PRIA 3HZYA 5BO1H 4PJAB 4U3HA 4ZOCA 3U9UA 3I6GA 1X4ZA 2LU4A 1MOEA 4JHWL 4PGDB 3BW9B 4KJPC 3KG5A 4QGYA 5CWSA 3DVNA 4CADB 5C2BL 2EDHA 3QDMB 1FFOA 2WW8A 1UACL 1O7VA 1UYWH 2I9LA 3E8UH 3D0VB 3O4OB 4O9HL 4G43A 4MAYC 2H9GB 2FX9H 2O5YL 3F8UB 3CFDB 3R06A 3MRMB 4NQDA 1KSRA 4P5MA 4U1JA 1QLFB 3RIFF 3TYFA 4PJBF 1IGCL 1CXKA 1DUZA 1N7ML 1QFHA 3B6SA 2P5ED 3STZA 1D5MB 2YC1A 4QXUH 4KHTH 3UTOA 1VKXA 1OF2A 1L0YA 1XZ0A 3HNTH 3HE7C 1BEYL 3FOLB 1KXQE 4G9FD 2ERJB 4E0RA 1A1MB 2MJWA 4HUMB 4KKBD 5KSUB 3B83A 5C0AD 1FZKB 2E7HA 4NWUH 2VZOA 3HNVL 1XR8A 3LS4H 5IEHA 2EDFA 2QLVB 3RVUD 2E9WA 4K55A 5BZDA 4MAUH 2YK1H 2MCPH 3RKDC 4QTIH 3FN0L 3NFSL 1YEHH 1DJSA 5EC2A 3EOTL 3BN9C 4OJFL 4MLIA 3MUGB 5D7JB 4M6AA 4RDQG 3TT3H 3P77A 2X5PA 4N8VG 3PHOB 2WWKO 3RA7L 4GT7A 4FMKA 3T0ED 5CEZH 4NM4L 4PJGF 4JDTH 5HYJD 4WEBH 4RNRB 2UY6A 3MLUL 1ZK9A 2BVOA 1JFQL 2VC2L 1LEIA 1NFDE 4F2MB 4HIXL 3O3BB 2HYMA 4NN6C 3FB7B 4TOYL 1L4IA 3QUXB 4MX7B 2YD4A 3M45A 4FQCL 5DA4A 4FS0A 3WL9B 3VXTB 1E4XL 1OT2A 4PTUA 4JHAL 2V7NA 2DQEH 3RZCC 1TVBA 4E5XB 4Q97A 3BD4A 5INCB 3PXHA 3VA6A 3GMNB 1RZFH 1GGCL 1XF3A 2GSIB 1S9WB 5IHZB 3QIUC 4KJWD 4S1QL 4P2YA 4KH2A 4IMLA 4KVNL 4LU5H 3ZKSD 1M4KA 1QSFB 5ANMB 3GM8A 3HE6C 4P5TA 1CK0H 1KTLA 1B90A 2B1HL 1MCPL 4FNLL 4KV5F 4NFCA 2BVPA 5D1XB 2IBZY 4LVOC 4LKCA 1X6LA 2P8MA 2W0KA 4P99A 4E9LA 2ZUQC 1V8HA 3B9EA 2ZG1A 1UADC 5B4MC 3SO3B 3VG9B 3MFFB 1UJ3A 1Q8MA 2CDEB 3OQ3B 4OFYA 4NRZA 3L3OA 1OM3L 4K7PX 4PLJD 4GBXA 5CJOH 1MJ7L 1IVLA 2W60B 8FABB 2GUOB 3CXHK 1IL1A 2FB4H 2W0FB 2Z8RA 2Y07L 3VWKA 5BS0A 3D39D 3NPSB 3W9EA 2P43B 2RHEA 5E4EB 4UT9H 3D85B 1OLLA 1KCSL 3HKFA 1MAMH 3C60B 1LP9F 2G5RA 3F5WB 3U30C 4ODVL 4JM2A 1EIBA 2W91A 3QEUB 3O2DL 5DD5H 4ZXBD 3KS0J 4O5LH 5F1OB 3QUYB 4OQTL 3GJFK 2NYYD 3MYJA 4FABL 5E1AA 4C57C 5E0QA 2AAVA 4HWZA 4LP4A 1CDGA 3D25A 12E8L 2VYRE 2CLVB 4JPWH 3ARFB 2AXHA 4FQLH 4I18C 1FFQA 3V52H 4PPTA 1R24B 1TZHA 3MV9B 5ICZB 4L9LA 3IFOA 3VXRD 3QUMH 5DFVD 1KLGA 1CFNB 5CJ8A 3TESA 6FABL 2WBJC 4M5YL 2KZWA 3MO1A 4P2QA 4G6KH 3LEYL 4EVNA 5DRNB 4BQBA 4NKQB 3BPLC 1BECA 3ZTNH 2X4SA 3FAWA 4HPYH 2VLJB 4JFDA 5DQ9B 3AU1B 1VSCA 1CL7L 1NGYB 2FJHB 5FOBA 4GOSA 2OL3L 5L6YH 2VDQH 2DQFB 1FNGA 5BXFA 4U1MA 4HF5H 3TN0D 2JCCB 4DGIH 3WFHB 1OWWA 4K94H 4OIIL 3D87B 3IJHB 1AO7E 1EX0A 5GRWA 4ZYKA 3DVGA 1HOCB 1FGNH 4YHYB 1N0LA 1TVDA 4AEHH 4YHPA 2YRLA 1NBYA 1AJ7H 4NQCA 4MJID 1WTGT 1C7SA 4HJ0D 2HT2D 4O2CA 3MV9E 3K7UA 3DYOA 4PJ7E 2FEDD 5KSAB 4UU9B 1K3ZA 1ZV5A 1BQHA 1XIWB 2XACC 4M00A 4J23A 2GJ6E 1B0RA 2E9JA 5TDPB 5BRZD 5HY9A 4QWWD 1X9QA 4FXKA 2ZG3A 3NZHL 2VDRH 4LCYA 2EDJA 1FZMB 2ZUYA 2ADJA 1JK8A 2X42A 2E9BA 2OSLA 5EU4B 5DHVA 4GW1B 1MCEA 3SCMC 2H32H 5D2LF 1HHJA 3H9HA 3KYOA 3MLZL 4Y5XC 1IC7H 1U3HC 1E27B 2I26N 4ZD3L 2IQAB 3LSOB 3GDBA 2VXUL 1JPGB 4PRIB 1CD1B 2DQTH 5TF0A 2ESVA 4NPYA 1CD0A 3V2AR 1TENA 2XTJC 3WS3B 5ISZB 1CF8L 4MJ5B 1XMWA 4OCWL 4AK1A 5F7UA 1IC4H 4PS4L 2P8MB 2EDDA 4CW1A 3LN4B 3U0WH 1HXMA 3ZE0F 2IPUK 2ZP0T 5KVGH 1B6UA 2OTWB 1D5MA 3NBNA 2A9NL 5INDB 4AM0A 3AAZB 2J6EA 4NUGL 1IKFL 4LCWA 5HYFA 5C0CA 4PJ5A 2CMRH 2AV7B 4OCRL 1Q9OB 1S7WA 1UC6A 1ZEAL 4HIHA 4ZUUB 4GRWE 1I1RA 1Q9OA 2CRMA 3WNKA 3QWOB 4XHJD 4M4PA 2JB5L 5C8JB 3MX0A 3RWIB 1P4IH 5CGTA 1CIDA 1MNUH 1CZ8H 5GGTL 4ELME 1MFEH 2EEBA 1JBJA 4LCWE 3IDGB 4K3JL 4NZRH 1KYOK 1YEJH 1CLYH 3CDYA 1ZS8A 3OG4B 5JA9A 5L2KA 4OLZH 5J6HB 3A67L 5JHDA 3UO1H 2HT4C 4PYGA 5E2TL 5E8NB 1PKQE 1ZA6A 2PO6C 2YZ1A 4HT1L 1HH9B 1VGKA 5B39A 5J1SC 4ZMAT 1WLHA 5I8OH 4XNZC 1P9MA 4JJ5A 4RNRA 4NRYB 5GRJH 4LNVA 3I2CL 3OJDB 5EA0H 3SDDC 1IAMA 1DANU 4CDGC 2UYLA 1RU9L 2NXZB 1NCAH 4HUKB 4X4ZA 1IMHC 4WUUB 4AEIL 2J88L 4Y0GA 2Q7YB 4ONOA 4UQ3A 4ODWA 5FGSA 1IM9B 1RVFL 4RWYL 4OAWB 5D96B 5JW5B 1BEYH 1MI5B 1IAOA 2DQGH 3UROR 4Y2DD 3K4AA 2R23B 4A2MA 5C08A 5FV2A 1AHWC 4ELMB 3SQOL 1E6JH 3MGOB 5CP7B 3NFPB 4K7FA 4QF1B 3JWNC 2XKNA 3L3DA 2HRLA 5DMGD 3X13A 3BAEL 3FB8A 1IZJA 4XNUL 2ZSVA 1GGBH 2AQ1A 4NP4L 1A7PH 5LGKA 4N5ED 1S3KL 3RUGA 3KXFE 1ZT1B 4X6EA 3VXUD 1XR9B 3QI9B 4X8JB 4NQCE 1ORQA 2AXGB 3V4UL 5I1JL 1N6VA 4HXAH 5D7SL 4NFDA 2CUHA 4RQQB 3LRSB 2O26U 4Z76B 3CAFA 4HWBL 4JFPB 4KRPD 4ZO8A 5F88A 2VQ1B 2VQUA 3QWRD 1HHHB 4U1JB 1S7RA 2VERN 5L2JA 3ARDC 4HWEL 4U0RC 2WANA 1CE1H 1KJ2A 3TBWA 1FNEB 3Q2CA 4Z6AT 3JUZA 5DJ0B 3QQ9C 3S5LA 1C5CL 1IL1B 2W0FA 4M7JH 2VC2H 2ITCA 1Z0NA 2QTEA 2AABH 3MO1B 3MRPA 4OD3H 5C07B 1KT2A 2RBLA 3S97C 2VR4A 3MBEC 1BF8A 3BT2H 3VGAB 4LEOB 1WWBX 3HPJA 3G6AA 2C1OB 2GK0B 2X4UB 3G6JA 2D0GA 1GZPA 2IAND 3L9RA 3P9WB 4U7MA 2MCG1 4NCC2 5EZOL 2YBRB 1I3GH 1QFUH 25C8H 1DFBH 1NKRA 5TE4L 2V9TA 3RUGF 5E2WL 2LVEA 1U8NB 2Q76A 3OL2A 1G9MH 3HUJF 3U30B 3WEXA 1ZHKA 4Z7VE 1U8OB 4D8PA 3ZYIA 4K3HA 2Y23A 4TPRL 2LABA 4RBPK 2HLAB 4OF6A 3WKNA 1U8KA 32C2A 4QHUA 1RIVL 4KMTL 3GMPA 4QRRA 3NN8A 3T0XA 3SDCD 4MX7A 3BVNB 1Q72H 1BBDH 3MV7D 5B22A 1RZIB 4ODSL 3QZWG 1Z0MA 3JV4A 3GSQA 3U4EA 4PJ9A 3QDMD 2CKNA 1BFVH 5DJYA 2X70A 3VWJC 1CICB 5FM5M 4J8RA 1DQQA 5T1DL 4JQXA 5DUPL 3Q5OA 4FQ1H 5D4QA 1IEBB 1IFHL 4NQDE 1SMOA 4R4FL 4ZSOB 2OP4H 1NANI 2KL6A 4MNHA 1VENA 2ZG2A 2M8XA 2P7TA 4EN3D 1UVQA 3MV11 1OGTA 1INDL 4APQD 3MREA 4HK3J 4HMDA 2DMCA 4HFUH 1X5HA 3MUGA 4WW2A 4MS8C 1CD9B 2R56L 4UOJA 1EVUA 4BK4A 1WISA 1N3NB 1DLHB 1A64A 5E9DE 5MI0B 4D2NA 4ODHL 4J3WA 5IVXA 3C09C 1JZ8A 4GAYA 3AMKA 1BQHG 3LPFA 1UT9A 4NO0D 4X99B 5FHAL 2VXQH 1T1WA 5EZIH 4M1DL 3BEWA 3WL9A 1ZHNA 3AB0C 4WO4C 2EDOA 3S88L 4P4KA 5KSBB 5HVHB 4P9MH 1TTUA 5HYJA 4TSBL 1KUMA 5J13C 4M5YH 3FB7A 1S7WB 2FDBP 2EH7L 2H2PD 1CLZL 1PQZA 1PSKL 1HHGB 4M03A 5KSAA 1VFUA 2WLZA 3EO1A 3CFJA 3FRUA 4ONHB 1WTLA 3IKCB 2PR4L 3GI8L 3M17B 4IRSB 3T1FA 1JPFA 4HKBB 4M9OA 3QEUA 1NGXA 2Z0BA 4KI1A 2NXYB 2WINA 3UMTA 4EI5D 3BQUB 1W0YT 2WMPA 4O2FA 2WWMC 4Z77B 1J0JA 4OZGB 4UOW0 5D7KD 3HS0B 4GKZB 4LLAA 5JHDE 4LPTA 3LSOA 3K1DA 1KIPA 5KVMC 1U8PA 4LSSH 5E6IB 1VADB 3O8XC 1NGYA 2ZWLT 4ZAKB 5DO2D 4XP9H 4I2XA 3EW3B 3M8OH 4NWTH 4P2QD 4NHCH 3ULUD 2YOCA 2MKWA 3CX5K 3WJLC 1JPSH 3GHBL 3MUHL 4X4XA 5DRNA 3REVA 1U92A 3QPQD 4LSQL 1MY7A 4OI9A 1UH2A 3MLVH 2NPLX 5KVDL 3H42L 2WSKA 4I18A 4XP6H 5D70L 5TQ0L 1YPZA 1VADA 3GSNH 5BVPH 2BCKB 3MLWH 1MJ8H 1HXYA 5EU5B 4YX2H 2AI0H 3R06B 1DVFD 1T83A 1OP3H 3WFZA 2IFFL 1J87A 1KCLA 4O58L 3JTSA 3MNZB 1S78D 3WDJA 5HHME 5BQ7A 4ISVB 5CWSB 3Q1SH 3CFEA 3BQUA 1CTOA 3V6OC 3U36B 3PWUA 2FSEB 3B2VL 3D18B 4XI5C 1YEEL 1A6UL 2XN9B 2AQ2A 2DS4A 3U0TB 1H3GA 3ARZA 2CLZB 3VXQA 3I50L 2JLLA 2VLRB 2OK0L 5C92A 2VR9A 4JFDB 4HUUA 4IM8A 5I73C 1JNLL 4LPWA 2X4UA 4DK3A 3IFNH 1S5HA 2ZNXA 3MJ7A 3PWLA 2W0PA 4MXVF 2XOTA 2VN4A 3VU2A 3LQZA 3L3HA 3O3AA 4NJ9H 2LU3A 3DROB 4YHLL 4WI8A 3EHBC 4LKCB 3D1MC 5GISL 4G8GE 2ATPA 4X0KA 4QO1A 3QHZL 1OCWH 1TZGH 2IANA 5B3JF 3KPQB 3VMOA 2B1AL 2PYED 3LKNB 1CGUA 5D9SB 5FK9B 3GRWL 4ZDHA 2FWOB 1AO7A 1I8KB 3X11A 5GJSH 4OLVH 1P84J 1U58B 1G1YA 3RX7A 1AQDB 4UZGA 3VGBA 2CKBB 4ONHA 5HBBA 1FE8L 3BJLA 4BZYA 4YHKL 3BP6B 3M07A 2VE6A 4N0UA 1IAIL 5EUKB 5HPMA 2XA8L 1RZJC 2VZ1A 3X13B 4AIOA 3PGCA 4UB0H 2P1YA 4QRRB 4Z95H 1EHLL 2IPKB 4K71B 4N1HB 2OR7A 3A6OA 5EOTB 4EN3A 1L9MA 2CRYA 1J1OL 4DVRL 1NFDB 4G9DA 2QJDA 2F53B 3AREB 1S78C 2BVPB 5JW3H 4F80A 1AQKH 5DD0L 4NYLB 5I1GH 3GIVA 4E42B 5ERWA 4JVPA 5DFVC 1F58H 1M7DB 5LQBH 3HNSL 5I8KH 1N0XH 3BX7C 4ETQA 2MKLC 3VDAA 4IMLB 4JRYD 3AMLA 4TUKH 4MGXA 4DUWA 1KEMH 5TH2A 1AI1L 5DMJB 3G6AB 4PRNB 2YD9A 1BAFL 5KSBF 4WWKD 3EYUH 3HRZA 5E5MB 3T0DA 4ZTPL 3DO7A 3PGDA 3FT2B 1NCUA 1YUHA 5F7LB 2JJTA 2FYYB 3DHJA 3OAYH 4PRHD 1QR1B 3IVKB 1JMXA 4UV7L 3T3MF 3QNXB 1G7IB 1H3VA 5FO8B 5C8JA 4F33B 3QSKB 4OD1L 4Y4FB 3LMJH 2D03L 2P47B 3JBG7 4JQXC 2DM2A 5HPMB 4U6VH 4I0PC 3VFRB 4L9DA 2DQIH 3P0VL 4OM0H 4EI5C 2HJLB 4JRYB 1T4KB 5EUOE 2V17H 2VITB 3P77B 2F5BH 1DN2A 4Z0XB 1HILA 4PJ8B 2I27N 1LDSA 4XPHH 4NQXB 1G9NL 2X7LA 3PL6B 4X6CE 4UUJA 3IDJA 1DBAL 4MJ6B 2ICWI 4DGVL 1AKJD 3FQWA 3GSXA 3SE9L 1OB1A 4KHXL 3FHAA 1ZA6B 3JTTB 1DQDL 4LPCA 5ACMA 1RULH 4ZFOA 2OR9H 5IHLB 1FV1A 1FGVH 5E08H 3QQNA 5D5MB 3CFCH 1JTPA 2ADFH 5IVNA 4IJ3C 1NC4A 4H1LH 4Z7UE 2V5MA 4UTAH 3L5XL 1DVFA 1H0DB 4IRSC 4K23L 3QZWB 1IT9H 2PTUA 2BERA 2E6PA 3RGVD 4U6HA 2O5ZL 2YPKB 5D8JL 2B2XL 5CSZA 5I1EH 3T2PA 1INEL 1DVFC 3LPWA 2PO6D 4UQ2A 5KG9A 3OF6A 1I7UA 4PREB 2NX5D 3H3PL 3MRMA 1LO0H 3B43A 1INQA 2DQUL 4LP5A 2DIJA 3G5XB 2CO7B 3W9DB 1S7QB 3D48R 2OXGA 3QRGH 3LY6A 1R3IL 4A2LA 3MRJB 4HSQA 4MA3A 1K4CB 3ZHDA 5GRVL 5LWYL 1JRHH 5TDNA 3WIHL 5DGRA 1RJLA 1TVHA 2J8OA 3TA3C 3RA7H 3L5IA 1CYGA 3FB6B 5CEZL 1VPOH 1MHCB 5FCUH 4O4YH 1T6VN 5C09D 3U7YL 2VXQL 5IQ9A 5MERB 5IJKC 4YNYB 4ESKA 4IRZH 4UIKH 3DI3B 1P69B 4Y5VB 4MDJA 2X1OA 4FZ8H 5FDYA 1XGQB 4NGHH 1NAMH 4P5TD 3LDBB 1K2DA 5IOPB 3DX7B 4R90H 4OZHE 1XT5A 4LPVA 1J8HA 4L3EE 5HYJE 2WP3T 1KPVB 1LP9B 1YEGL 4FFZH 4X6BA 2Z91B 1WZLA 5JNYB 4Z7QF 1FN4A 5DHVH 2DBJA 4YPGB 4CBPA 1EJOH 1E4XH 2EDLA 4U1LB 3FB6A 1BIIB 4K9EC 4P59L 3QUKA 4YDVA 2C3XA 2CR6A 2R1XA 5IHUH 1AR1D 2D0HA 2LTQC 5KANI 2D31A 2KZ1B 3UC0H 3WXVL 5GGRY 5IG7A 2DTMH 5GGRA 1H15B 1C08A 1I9RL 4WU5A 1UXWA 4ERSH 3L3IB 4PJCF 4M1CD 3FO0H 1CXFA 3O9WA 3IDGA 4NNYB 2FJFB 3L1OL 4WU7B 1F11A 3J8F7 3IJYB 3SDDA 4PRIE 1LO2H 4ELKB 3QUYA 2VXSH 2ADJB 2WINB 2VLKA 2HT3D 3V8OA 3F6IA 4BFEA 1ZT7B 4S0TD 2ZCKH 5F8RC 3ULUL 4LSVL 1J10A 4QNPF 4HKZB 1FIGL 1G9EA 5CUSH 3BYYA 2D0FA 1J8HE 1PX4A 3SDAC 5HHPB 1NQBA 2VLJA 2OTPA 5T5NF 5IT2L 3RNQB 3TVMC 5I1LB 1TJIL 1UXSA 5IW1A 2MPAL 1JP5A 4FZEH 4EDXB 4FQ2L 4F9PC 4X0KB 2CDFB 2QL1A 4KDWA 1BM3L 3SDXB 4UT6L 3BOVA 4PJFB 3RPIA 2AQ3A 2R29H 3I3BA 4D3CL 1KCSH 3KPRB 3LQZB 5D2NC 3S34L 3TJEL 3F65A 3OKDA 5L0QB 1P4LA 4XC1H 1M1SA 4MJ2A 5IVXF 4QXUL 3T0WA 1S5HB 2X9WA 4F9LA 3VD9A 2FZ3B 1UXSB 5IROC 2X4NB 1FP5A 5HGAA 5DQ9A 3MA7A 4WW2F 4FABH 4TQEL 3ZYOA 4AT6A 4BSWB 3MMEA 5T1MB 5CEXA 3CUPB 1T7WA 1KTRL 1EO5A 2KDGA 3RVXC 5FECB 5JW4M 5LXGL 3O41B 1OAKL 1JNHB 2D7NA 4JM2B 2ICWJ 2K3TA 3FRUB 4FQHA 2KBGA 5DGQA 3CLFL 3G6DH 3S35H 3MNVB 3PIQA 5E56A 5MEPB 4UU9A 5DZLA 2D2OA 5AG8A 4NJ9L 4N0UE 3VG0L 4JB9L 3LEYH 5HHOE 5C0NC 1HXYB 5EU5A 1OWRM 1ZKAA 3H9ZA 4YHLH 5B8CC 3N85H 3RY5A 5DMKA 5C0RH 2A6IA 1D9KD 2BSTA 3EGSB 2W38A 4WO4A 3ALPA 3DGCR 4W4NA 1P7QD 4JN2B 3RGVB 4R7DB 5GS1B 2KUTA 1CCZA 1FBIL 1XGTA 4NKIL 4BZ1L 4OZ4A 4X8XA 3O11B 4P3CH 1A7RL 1LO4L 4PRNA 3MOBL 2M1KA 3W2DL 4QOKE 2NW2A 4K2UH 3D0LB 1BFSA 3DXAD 1QYGL 4GW4A 5IMMA 3QWRA 4RAVA 4LVNC 3C5SA 4FQJH 4PJCA 4TNVF 1A1OB 3TM6A 4ZUSA 4RAVB 2PCPA 2AXJA 1FE8H 4GAGL 2J1KA 4XMKH 3HPJB 1JHKH 3KPSE 2F54A 1C5BL 1ES0A 4HIJA 2NY4C 4ZO9A 1MRCL 3O2WH 1UJ3B 4CN4A 1W0WB 3T0EA 1UWXH 1H3WM 1PZUB 1C8PA 1LVEA 2XYCA 2XIDA 1DL7L 1G6RH 1RAMA 3OJVC 3OXSA 3RY4A 1D5BA 1EEYB 3ZKND 2VE6B 2A6KA 3QAZC 3PE9A 1YY8A 3FHQA 5LBSL 4FP8H 4XPGH 3K81A 2G75A 1EAPB 4M61A 3IU4H 2EH8L 3BIBX 5LQBL 4ZO7A 4LAQL 4XCFL 5F93C 5F88B 3ZSSA 2Q76B 3O6FA 2DQTL 5B39G 3WNOA 3WDHA 4YBLC 2HVKA 2X6MA 5AD0B 5CZVL 4MSWA 1JJUA 4ZNEE 1T0MB 1BGXH 1CE6A 1I1FB 5K9QG 3P11L 3ARBA 1N6UA 4OM1L 1YPZE 4Y8AA 4B41A 4PB0H 4QXGL 5GRZA 5GXBB 3LAFA 1QQDA 3SJVE 2UWEB 1P4LB 4FQXC 5BZDB 1UCTA 3X3GH 4YPJA 2NY3D 2B4CL 4WFED 4ZO6A 1KC5L 5IV2B 4C56B 5IBUB 5DEZA 2PNDA 3TFKD 5I8CB 3UTTB 3VFOB 4GH7B 4WWKC 1A3RH 2FR4B 3OGCB 1I75A 4LNRA 3PHQB 4XP5L 4ONGL 4JFFB 3REWA 5D71L 2O5XL 1IC5H 3NCEB 3RTQB 1MH5B 4LCWD 3U0PB 1GGIH 1Q9KB 1UKQA 3RGVC 1PX3A 1QFWH 4JO1H 2YD2A 4X6CB 5MENA 1FO0A 2QADD 5KJRL 1YC8A 4OCNC 4RQQA 1MY5A 5INCA 3BEVA 4L3AA 1KIRA 2ESVE 3GI9H 4L4TE 4YDLC 3DVFA 3B9VA 3KJ6L 4BKLB 2EZ0C 3QI9A 4PTUB 2J8UA 5D6DC 2A6IB 1NCTA 1T1YA 1JGVL 2VSDA 1FORL 3BQUC 4HKBA 2DM7A 2EIEA 3MLPA 3Q5YA 4MZ3A 1WFUA 5E70A 2NY6D 3DLQR 4LSRL 5HHOB 1ADQH 1HSAB 3GIZH 5F7FA 3BSZL 3VWJA 1EFXB 1EBAA 1A6VL 3QHFH 2VZ3A 1MRDL 3FMGH 3KDMB 4F7EA 4KJYB 4L8DB 4WV1C 4K7PH 1L7IL 4OKVB 5BV7B 1JWUB 3O6KH 4WUUA 2PXYB 3GIVB 2UYLB 1F42A 4GXUM 3WO4B 1AE6L 4PRBA 1EBPA 3U9PL 3BAEH 3I6GB 4JQVA 4TTDD 4G5ZH 2XPGA 2A77H 2VAAA 3RL1A 5IFHH 4YK4B 5E8EB 3U4BL 1VFAA 4HQQL 5LGHL 1J1PL 5T3XL 3U83A 4KMLB 2ESVB 1AXSA 3UTQA 1AGFB 1OARL 3PUCA 1OW0A 2DL9A 3K8LA 4QXTA 3VRJB 5FUOH 1KB9K 1MUJA 2VISB 2YKLL 4QCIA 5IESH 4JG0L 3L5WB 3T08A 3VI4E 3GMRA 3QCVL 2B8OT 3WLWD 4JPKH 3STBA 5L0QC 4I0CC 1GL4B 1QPXA 4YHNB 4YFEA 3RIAK 3I75A 1QBML 2ADGB 3RNQA 5I1LA 2V2XB 3HZMA 3EOAB 3DPBA 3HMWL 1CU4H 5B3JE 5JIIA 3SKUD 3A6CH 4BZ2H 1A1NA 3ARFD 1U58A 4HXBH 3MPCA 1Y0LA 1LP9E 3QDGD 4NKOB 1I7UB 1ZANH 4G6AC 3NZ8B 2HRPH 3ARTA 1DBML 5D6CA 3CCHB 4GRLC 1G7IA 3F58L 2IAMD 3FQTA 1QP1A 1RUKL 3LS5H 4ELKA 3GSRB 1ZLUK 4HH8A 2IPTH 4NBZB 3I84A 1GC1H 3ROLA 3GMMB 3VG9C 2WAHA 5FYKD 2AV1B 4H25B 1DBJL 3BZ4A 3OR6B 4LARL 3OB0K 1BLNA 1F3RB 1N3NA 3NCYS 2FD6H 4W6XB 1U8IA 3WS3A 2FECL 2BSSB 1T20B 1I9JH 5KAQF 1U6AL 4U6XB 3VXOA 1OGTB 5C09A 5IB4A 5GIRA 4J3VA 1KG0B 4NRYA 4YFLF 4Z7NE 3R1GH 5ESAB 5CILH 2CIIA 3I02A 4WW2C 4X98B 4PJBB 3S5LG 2HMID 4HBCH 1CLYL 5CJBA 2NY1C 4H5SA 5E8PA 5F97E 3S3PA 1CDJA 1K3IA 4KUZL 1T66D 3VRLF 4GRMB 2VXTL 3OKYA 1TJHH 4JZOA 5D2LE 4KMTH 1AR1C 3OKOA 4J4PA 3RZCB 3RX8A 4OCXL 2GJ6B 4ZOBA 2G9HA 4F7TA 1NEZA 4HT1H 3IDMA 4YXKL 3CFEB 1XGPB 2V5SA 4R2GC 1NGWB 3KR3H 1UJTA 3RDTD 2PW1A 2Y7QB 3PGFH 1CFQA 4FTVD 5T1DH 3AFLA 3CXDL 4B7IA 3DXAE 5L2JB 5FO7A 3GSOA 3QIUB 4HWUA 4RWHA 5E9DA 5FYKE 1S7SB 4MD4A 1G7LB 1F6FB 5EN2B 3KXFA 4P48A 4LEXL 4JKMA 1A6WH 3KPOB 3CVHB 3D9AL 4UAOC 1MELA 4DZ8B 1PG7H 1JZ5A 3OG6B 2CRIA 3GO1L 1M7IA 5D1ZA 5F1IB 5JZ7C 3NPZB 4JM2F 5DT1H 2X4OA 5EBMB 2Y5TA 1D6EA 5I76B 5EZIL 1CD1A 4XBEH 1NCBH 5I15H 2BSSA 2JELH 2NY3B 1VFAB 2A6DB 3PWVA 5H94B 1N59A 2SEBA 4MD0B 2GUOA 1MFCH 4XCNA 3ZKXB 2XQBL 5HD8D 5DI8A 3QG7H 1NFDA 4GRWB 3GMOB 2B39A 2DMKA 1CLZH 3LH2H 3V4PL 4L29B 2ZPKL 1NGZA 1UCBL 1S9VB 4Y4HD 4X4YA 5DWUL 5A40E 3GBML 3VFTB 1R0AL 2AK1L 2PW2B 1MCIA 4NKOA 1A3QA 1X5AA 5DR5H 1RZ7L 5EUKA 1YECL 3D25B 3LRSA 4V2BA 3CK0L 4I0PB 2IAMC 1PQZB 4MSWB 2RCSL 4YFDB 4PJXE 5GSRA 2HMIC 5JHDB 3UPAA 1Z3GL 2FHFA 1KJ2H 5D7IB 4GXVH 4XXDB 4YBQC 2QQLH 3PWUB 5K9KB 1MCOH 3QP3A 1GZQA 4GW5A 5HVGB 4KKAC 5I16B 3LKPB 5BQ7B 3PP4L 1M7XA 5J7CC 4QRUA 1FC2D 2D7TH 3BP5A 5A3IC 1KFAH 5HGBA 3W5MA 1WZ1H 2VLLA 1MRCH 3N1QC 1QHPA 2CQVA 1FG2B 2NX5B 1JNNH 2XPGB 3IETA 5GRUL 3KWWA 4HHAB 2FJHA 3QIBC 4DN4H 3K2UL 5I30L 3P4OA 3Q48A 2ZCLH 2FX9L 3U4AA 4TTDC 5E8PB 3V0WL 1BQUA 4NN7C 3P73B 4N0YH 4FG6D 4W6YB 3QXTA 3NH7L 3WFCH 1N7MH 5B38A 5EZJB 4KZEL 4YHOH 2PUQT 4LHUD 3SGDH 4POUB 3EO0B 3CJJA 1UB6A 3TBTA 5FB8B 4E41B 1OP3K 1YN6A 1CVRA 4LHQB 4LIQL 1SYVA 3GMLA 1QEWA 1A6UH 4M48H 5DUPH 3FQUA 2A74A 4LCIH 2HTLC 1QTYT 1JHTA 4F58L 3OAZH 1FVCA 1XAUA 3JWDC 5C08E 3JTSB 3ARWA 4OLWL 4KJPD 3VGDA 4YDKL 3WEXB 4PGZA 3JWOL 1LE5B 1FO0B 1MFBH 1HQRA 4YDIL 1U8QB 1BJMA 1YN6B 4KI5D 5ESVB 5FYLE 2ZJSH 2JK5B 1HHGA 5MEPA 3CPLB 2Y6SC 2R1WB 1UM5L 3H6JA 4FQXB 4JRXE 3WSQH 1OSZB 1J1XL 1QSFE 5ANME 3TNMB 4X6FA 4XHQA 5GZND 4AIXA 5KS9E 1T21A 3FO1A 2H32A 3L5HA 1GGIL 4I5BB 5I9QB 2GYSA 4LRIA 2BNRA 4CGTA 2GEEA 3F7VB 4L4TB 1MI5E 2E8ZA 1IKNC 4NPYB 1MVUA 3BW9A 2F54B 1I8MB 3O3EA 3BI9X 3HC3H 5L2KE 5I1AA 1ZLWK 5BV7H 1DLFH 4C55A 4HG4J 5I1AB 3CSGA 3BO8A 3HG1B 4G6JH 4WFEE 1FORH 2X4PA 3U82B 4YHKH 2OS7A 4GBXD 4XP1L 4NQTA 5JQ6H 4DWHA 4P2QE 1NC4D 3F7YB 4QLRA 3N1MC 5CBEB 5C0CD 2CUMA 3E6FA 4NQDD 4Q58C 2VAJA 2VUOA 35C8L 4G6MH 3Q6GH 1A6VH 1C5DB 1CFNA 3S35X 2GJZA 1KXVC 7FABL 4DKDC 2YSSB 4FNLH 3GJFB 1J0KA 5F6HJ 4NFBA 3M8OL 1QLFA 2GJJA 3PNWA 1PG7X 1FYTA 2DQCH 2VQTA 2K9UA 1CFTA 4FTVB 3ZHKA 1R3HA 3TIEB 4QHUB 3MRKA 1NEUA 4KQ4H 2YPLD 1T7ZA 3IAQA 2HLFC 4P5TC 3SKNA 1I7ZB 2PYFA 2QQNL 1EXUB 1NGQH 5BRZE 4XXDA 1CL7I 4U1MB 4HKJA 4QXWA 1NMCB 2DI8A 1MJ8L 5DJCB 1E4WL 4OLYL 3BE1H 5CHNA 4JGMA 1TMCB 3LIZL 4M6NH 2X4OB 2FATH 4ZTOL 5E4EC 4MNHB 2C3GA 3V7AG 3DX9B 5FUCC 5J11C 2XWBB 3O8XA 1WIOA 1RUML 2ICCA 2GFBB 5TE6L 1ROWA 2UY7A 4NSKA 2DD8H 4NNPH 1CN4A 3GSNA 3OAUH 4PP2B 4MHHG 3DUSB 3P4MB 1I8LC 5SWSD 4UV7H 1XF5B 3OHXA 6CGTA 1U95B 1YEFL 2HRPL 5ESQA 2GT9B 1B88A 5EU7E 4OD1H 4RMVA 4GMTL 4K9EH 1SM3H 5D1XD 3BN9D 5ID0A 1OF2B 4EDWH 4FTVE 2NXYC 1MIML 4IDJL 3ORJA 4QOKA 2XFXA 2Y7QA 3VJ6B 1TFHA 4HKZA 5KZCB 1ZLUH 2FIRT 5TDNB 2F19H 4P46A 1QKZL 4XNQA 2AS5M 3MRJA 2JKXA 2XZCH 3CUPA 2R0KH 1QSED 1O7SA 1TVBB 4E5XA 4G9FA 1S7QA 2ADGA 4XPFH 5D2LB 5GGSB 4X6EB 4DFIA 3TGXA 3G5YA 2ITDA 4ODBD 1TPXB 5E08L 5SV4A 2A83B 2BMKA 5ENWA 1J0IA 5A2KH 2ADFL 1ZHBB 5FO9A 3S4SB 1P1ZA 4R0LA 2DM4A 3FFCA 5BJTB 5EU7C 4LEOA 3BH9A 2YPVL 4XPBH 4X83A 4N1CA 3CVHL 4XPTH 4LF3A 3KR3L 5E8EA 5FF6A 2VMFA 5CIPA 4OSUL 5DI8B 5IW6A 4MS8D 3PV6B 3VDCA 3P73A 5EOQL 3S5LB 2CK0H 1DDHA 3PHOA 1K2DB 5IOPA 2X9YA 2Z31B 3ARXA 3MR9A 3VA2C 4NZTH 2EDBA 4XH2A 3EJZD 3BIKA 3OXRB 1S8DA 3O3UN 4PJGB 2VTFA 2AJXL 4M6OH 3NTCL 2VDRL 3ROOB 4K3DH 5T3XE 4X6DF 3I02B 5D7JC 4P9HC 1F4XH 3BGFC 4LLDB 4OKDA 2E27L 3HE6A 1A1NB 2E8YA 1U8JA 4LQ1A 3MJ9H 1IZKA 5EC1B 1KACB 4YH6A 2UV3A 3VRIB 1F11B 1X6NA 2ADIA 3UTTE 1K6QH 1QRND 5FGRA 5I8KL 5K9KA 3U46B 2K7PA 4TULH 3FOLA 5E8DH 3KLHD 4R4ND 2NTSP 2ARWA 3QO1A 5D1QA 3QCTL 3RNKA 3ZE2E 4O2EA 3LDBC 4L3EB 3T2QA 4JEGB 3FONB 5GGUB 3VFNA 4IMKC 3TO2B 1FNGB 1IC4L 1B9ZA 4PJEA 3DNKA 1YNTA 4DW2L 1GOHA 4GUPB 5HTSA 4EOWH 1IGFL 1YEKH 2EXWC 1JYXA 2X4SB 3L7FB 1BFOB 2OMBA 4UBDC 4KGLA 4UILL 5F6IB 1N4XL 3D3VD 1MCBA 5F6HI 3DSFL 4HMCA 4WUUE 5D7JA 1OLZA 1TCRA 1CT8A 3MROB 3MRDA 3AY4A 3QI9C 2AJSH 1F6AA 1KG0A 5C6WH 4TVPH 4JAMB 1CZ8L 1MNUL 5EO1B 5I18H 3THMH 3MODL 4ENEC 1RK1A 4HW6A 2WBWB 2IMMA 4OF5A 1W72A 3QUZA 1RHHB 2HFTA 4Y1AB 1BPVA 5EUOF 3EYOA 4NC1C 3MJGX 2GY7B 4JLRA 4QHNB 4IHOA 1NSNL 2IFGA 1U91A 4LLQB 4L8BA 4LLVA 5DRZA 4OCMC 5E2UH 1GH7A 4G9FB 2FO4A 1MJUH 2J4WL 4DN4L 4S1RL 5TE7L 2N1KA 4YNYA 4LCYB 5C0GA 4I8DA 2JJSC 1BM3H 2CKBH 1PFCA 1XIWA 5C3LD 3BP6A 1JCKA 1MCSA 2FO1A 4QRPE 4XMLH 3QFJB 4GKSA 4K94L 4OIIH 5E5UB 4UTAL 1OAXL 4QYOB 1WGOA 1FO0H 1DBKH 5E7FA 1HH6A 4P46C 4LLVB 5DRZB 1HXMB 3MRCA 1CGTA 1GXEA 4LRIC 4N90E 2OYPA 3SY0A 3RGHA 4GRWH 4G80A 2FBOJ 1CTNA 3O4LD 4MJ5A 2EXYC 1MAKA 4JRXD 5JW4N 3T0EB 3O6FC 2GTWB 1CR9H 2NY4D 1ES0B 1MHEB 3ALXA 4HIJB 1Z9MA 4YXHL 1L0XA 2IQAA 4XNYL 1B0GB 2FHBA 4HFWB 3WJJA 3O8XD 3QUMA 4LRNH 3UZQA 1R5WB 1XEDA 1LDPH 2PYEA 3BUTA 4ETQB 3AU1A 5HI4D 3QH3A 4AQOA 5I1JH 4JFEB 4RAUB 2QSQA 3DX7A 5J1TC 4JFFA 3U7WH 4BFGA 4DVBB 3IDIB 4RGMB 2A2QT 3GUTB 3RI5F 4PTTB 3MOAL 3GK8L 2E9IA 2CIKB 3EOBA 5SWZE 2BDNH 3X17A 2VIRA 5TQ2H 2OZ4L 3VI4F 5C9KA 4NQEA 3QJHB 4HGWB 4OTXL 1TQBB 2BP3A 4Y16D 3V0VB 3CCHA 4J2XA 3VE0B 1EHNA 1VFOA 3OXSB 3PWPA 1AGEB 1Q94A 4IRSD 3ARBB 3TBSA 4RMSA 1FVEB 3NCCB 2GJZB 3HN3A 5FYJD 1F00I 2IGFH 3NACH 4P3DB 4HV8A 4ZUWA 4F8QA 3SDXE 2HKHH 2A9NH 1H8OA 3OTTA 3UZVB 3MV7A 3T3PF 4XCYB 5DC4B 1IM3A 1U42A 5HI5C 5ILTL 1F13A 1A7OH 5DRWA 2QQKL 1JYVA 2HH0H 3FT4A 3KPSA 3VI3F 4A6YB 4FXGA 3BWUC 1NMCC 4KJQD 5EORH 2AEIT 4D0CB 3BIKB 1K5NB 2B5IB 4S10A 5DSCB 4LPUA 1N64H 1KIQB 1J12A 2IANB 3KPNA 5D7KE 1NMAH 3ZZ1A 4Y4KB 5JORA 2VXSL 2IH3B 7FABH 5M95B 2W60A 8FABA 3HMXA 4CAGA 5DD3H 1M05B 2MMXA 2V2TA 3QUZB 2EE9A 3O81A 2ZZUT 1W0WA 5GGVL 1FFPB 5BOZG 1IGIL 4LVNB 2C3HA 4NKDB 5J1AA 3HMXH 1I1YB 3V4VL 1JGUL 4X6DA 1WFTA 2W9DH 1VEMA 5E99H 2XWBA 2R2BA 5FYLD 1S9XA 5IR1B 5AZEH 4N0UB 1T3FA 3I2CH 1OPGH 3LEXB 4G8IA 3HC0B 3UTPD 5GS1C 4RRPA 3BDYL 5HHOA 2XRAH 5IROA 3O6ML 3TZVD 3SOBH 2IH1B 4NQCD 2ATKB 5KZCD 1JNHA 1OTSD 1MQKL 2R69H 1H3XA 3MLYL 3HI6H 2WWKT 5DURB 2DYPD 3E2HB 1BX2B 3LN5A 1I7ZA 2PYFB 1QNZL 2DYPB 3TZVC 2P8LA 5DTFA 2OR8A 4QOKB 5FUZH 1MPAH 1FVEA 4JDZA 3EYFA 1UZ8A 1FNFA 3SQOH 4L3ED 4TQEH 2AJVL 4MQ7A 1FYTB 2EIZA 3TIDB 3C8DA 4GRLD 3ZKMD 1SY6L 4JFXA 2AK4D 4K9EL 3QXDA 1SJXA 5GGSY 4I18B 1ZA3A 3C87A 4I0KA 2CDEA 5C07E 2J8UF 4ZFFB 5DFWH 1AGBB 1HKLH 3L3KB 4XVTH 1P7QA 2XTLA 2A9MH 1CDBA 5DMIL 5KJRH 5I74C 4OLXL 4O9HH 5FYKH 3QUYC 2GITA 1KN4H 4LSUL 3OPZL 3WLWC 4X9GA 2IANE 1C12A 3C5ZD 3UTSB 2MFNA 5EIIA 4KKNA 1VB9A 2PYEB 3LV3B 3BO8B 3C6SB 2NY6B 2R1YB 4PB9H 4K3GA 3B9KA 5ITBL 2VLJE 3C8HA 1BHGA 3T4YB 4FQXD 1PZ5B 4HJ0C 3V0AC 3BKML 3FFDB 1GIGH 2FSEA 4P3CL 3WD5L 1AR2A 4JR9L 1JIBA 2V7NB 1KYOJ 4Q6YA 1XR8B 2APWA 1KJMB 3K8KA 3IFOB 2BSTB 3EGSA 5DJYB 4GFTB 1R3HB 2EE3A 4PLKC 3TIEA 3VXUA 1WAAA 2VL5A 3SY0B 1HZHL 2ID5A 3PWLB 4OB5L 5JXEC 1KB5H 3PGCB 4C83B 3RI5K 4LKXA 4QOKD 3W9DA 4D9LL 1RJCA 3QDHA 1YY8B 3GJFA 1WWAX 4XNXL 3QIBD 4KFZC 5F9OL 3CX2A 4NQEE 1AXTL 4BFIA 3VGHA 4UNUA 5LCVH 5C0FA 5EU3B 3UBXA 3MCLH 2DBLH 1G9NC 5LGHH 3NPSC 4C56E 1FIEA 4MNQE 1JV5B 2F53E 5DJAB 1UYWL 2HJFA 3QG6A 2V7HA 4D0BB 3B2UD 4XNMA 4JG0H 1P5VA 1GPOL 2BVQB 1EEQA 4GKOA 3VWKB 2R2BB 3HUJB 4CU8A 1KN2L 4HK0A 3STLB 2R1YA 3ZDZE 2ZKHH 1QBMH 3OKDB 4L4VB 4B0MM 1A1OA 5KS9F 1WC7A 3VD4A 1BIIA 3DURB 3DUHA 3ZKQD 1RFDH 2O61A 2VLMD 1XF5A 3PQYA 4JHAH 2HT4D 1LQSR 2XZZA 3QQ4A 4IRJB 1U8LB 4O51B 1OP5H 1ZT4A 5DMGC 4ODXB 3IKCA 1J0HA 3M17A 4IRSA 4CMMA 2BK8A 4FFYL 3UP1A 2IQ9L 4QYOA 4F57H 5F21B 1IE5A 3FRPA 2X70B 3QPQC 1Q0YL 4PJ9B 3FTGB 5D1XC 3WFBH 2HWZL 1DBJH 1XCQA 1IAII 2DQJL 4KQ3L 2VQ1A 2DICA 1BVLB 1A5FL 5J6GA 3FONA 1S7XB 3IDXL 4L4JA 3VFNB 1LNUA 2WM0A 2WUBH 4DUXA 32C2B 5AZ2L 1L7TH 4YIQB 1J5OL 4A6YL 1G6RB 4OZGE 3ZE1E 4H20H 4YO0A 1BX2A 3LN5B 4R9HA 5B4MD 1NDMA 4YAQB 4AH2B 1SBBA 1RZJH 1NCDL 4XZUA 5CBAB 2W65B 5ACZA 1GGUA 2Y72A 3L95A 3HA0A 4QY8A 1KCVL 1BBJA 4H88L 1G0XA 1A0QL 3MRIB 3NOIA 5FYJH 4HZAA 3ME0A 4LSTL 4ZS6D 3ARGB 3P4NA 3HZYB 2EC9T 2JF1A 1I3RA 1CFBA 4JFQB 3JTTA 5CJQH 2YD8A 4U1LA 1Z2KA 2XXMB 1ONQB 4J3OC 5ESAA 3QNYA 3OKNA 1MJUL 2C1OA 2Z91A 1RZKC 4HGMA 4J4PC 4OFVA 3FAXA 5C0IA 3RHWF 1YY9D 2FECI 1UA6L 4JZJC 4MA8H 3WKML 2CGRH 1IGTA 1TLKA 1UZ6F 1H5BA 4JCLA 4JFEA 2X4PB 2AGJL 1QSEB 2V2TB 4AL8H 2NY7L 1KJ3L 4CL7A 4IRJD 5K9QI 4OQTH 1XGYL 4NNXB 3HR6A 4S1QH 5D2NE 5SWSB 4GRLB 4HFWA 1MFNA 4Y4FA 5D7LB 5CEZD 1CG9B 1D5IL 5JDJA 1TITA 1CBVL 1A2YA 4DVRH 5BO1L 1UWXK 5D6CB 3QO1B 3BKJL 4M4RA 2JIXA 3EO9H 3UBXG 2VZSA 4IIQC 1QVOB 4Y4FC 5D7IA 1EERB 1FL3A 5CZKA 1LEKB 3HNSH 2WUCL 1HH6B 5GS2D 4Q0XL 1DEDA 4JKKA 1FSKC 1NCBL 4I9WE 3KXFB 3O9WB 4NNYA 1UACH 4JANB 3S8WA 4X7FC 2X2YA 2UUDK 4HPOL 5T5NG 5FYJE 3HCVB 5FHBH 1A6PA 5JIPA 4LHUB 2EECA 1BQLH 3GEWB 5BMFL 3BRDA 1BWMA 1CGVA 2IMNA 2B20A 3TWCL 4NKDA 5J1AB 1M7DA 2VDPL 4KHTL 3GB7A 2ATPB 1WFNA 2Q7NA 3JUYA 1WBXB 4WV1B 4R3SB 2SEBB 4MD0A 2EXWD 2MQCA 1JI2A 3RZCA 1W72B 5IBTH 4PJAA 5F7MC 3T2NL 1G7QB 3QIWD 1QFWM 2F53D 3WHXA 1HHKB 1VEOA 4JY5L 5EBWA 5C2BH 4YHZH 2ZCHL 1B0GA 5HHMD 2NY6C 4M6ML 3VXSD 1CIUA 1ULVA 1A02N 5IBLD 1T0PB 5HI5D 3KPOA 1DQLH 1EV2E 2AEQH 4WTZG 1NFDF 3VXQB 4KDTC 5DD6A 3U0TA 3TV3L 4P4KD 5EORL 4Y8DC 1AQDA 5DVKA 4ZPVB 5MEOB 1YDPB 3KNBA 3CMOH 2AJ3A 2YPLB 4JFYB 5I71B 1KXTB 1QRNB 3RU8H 5KTEL 1HYSD 1QO3B 2X10A 4G3YH 4LDLB 5AAWA 4KVCL 3GJFH 5IMKB 4Y19D 1NMBL 2QEJA 3ZE0E 3VXPA 3VFPA 3CSYB 4BH8A 4NT6B 1CXEA 3TBYB 2Q20A 4QTIL 3EBAA 3E2HC 2BHYA 2K1MA 1D9KA 3DRTB 3RIFK 2AK4A 4QRSB 3I9GH 1WBZB 1NL0L 2R0ZL 5CCKH 5E6ZA 5BXFB 3VXRE 1IAIH 2DQFA 1DN0A 3E6HA 1BJ8A 2EZ0D 5FOBB 2NY0C 4P2CG 3QEQB 1A7NL 1MHEA 1T7XA 4U6XA 3VXOB 4S11A 1FZJB 4DN3H 5CD5D 4L4VA 4MVBD 2YN3A 1NAKH 4G42B 2GKIA 4JPVH 5I1HH 2BSED 2VN7A 4EXPX 2DLFH 4JKPL 4L4VD 4ZOAA 4XPAH 2DLTA 3HAEB 1QPPA 1CXLA 1ZHLB 1LWRA 3MNZA 2HFGH 3L3GB 1VPOL 3MRKB 4Q9QL 3V79C 3UO1L 4GG6E 5IFJA 4XBEL 5IB3A 1JPFB 3U2SB 2FGWH 1GVIA 4Y4HC 3EYQC 5F44A 1XCQB 2NXYD 5GGUA 3QULB 5FO8A 2VDKH 2HJKB 4Q9RH 3T2OA 4HC1L 4OBSA 5E8NA 1X5XA 3RNKB 5IGXL 1AD9A 3S37L 3I3EA 4WJ5B 2F74A 3B3IB 4GMSL 1S7SA 2PF6A 3ZSTA 2FLRT 3BYTA 2VH5H 4OI7A 4Q74A 3DRQB 3SBWA 3RHWK 5DUBB 2ZUVA 3MRHA 5JZ7D 5KVFL 4HUWB 3TVMA 1ZEAH 2R23A 2R4SL 4JCMA 3RJQB 1B2WL 1FPTH 5IKCB 3MV8D 4I2XE 1DBBL 4KK6D 3LMJL 1CT8B 3X3FH 5DD1H 3T0EC 4PJCB 1F2XK 5FDWB 1KB5L 1UVQB 3O2VL 4APQA 4QRPA 4X5XA 4I3RL 1FRGH 1H5BB 4YDJA 3SDYL 2XWTB 2NLJA 4H8WC 5KBNC 4JM4L 2FEEL 2Z4QA 4XCCH 3V4UH 1WITA 4GG6A 5CSBA 2NLJB 1NGPH 3B4NA 4YUEH 3T1FB 4OQTA 1DBAH 4LBEB 3SE9H 1ED3B 3U1SH 4N8CH 1IQWH 5HYSA 1DSFH 4HKXA 3CVIH 4LKXB 5TGBA 1QOKA 1LHZA 5CINH 1LE5A 2NQCA 5T5FH 3RWJB 2A83A 2J3SA 1AFVH 3HE7D 4P4RB 1U8KB 5DZNA 4UOW1 1ZGLA 3LIZH 2H26B 3AC0A 1LILA 3AXLB 3DBXB 4XC1L 1KN2H 1FH5H 1HIMH 4RISH 1IT9L 3IXAB 1FZMA 4LFHD 4U2YA 3UJJL 1QUNA 5IVXE 3QQ3B 5AAMA 2AK4E 3RKDD 1ZLVH 4NQUA 1FAIL 1UGNA 4HKXB 2VJXA 1H3PH 3PV7A 4CVXB 2YXFA 4RFOH 3EJYD 3SCMA 2CR3A 4H26B 3IT8D 4L5FL 5MI0C 1DFBL 3EJZC 3ULVC 1PLGH 3OR7B 2IG2H 5I8CA 2BOBA 4I0PD 3ARFC 3GJEA 4NBYB 1XF2A 3INUL 3QISA 3CLFH 5IW6B 2AJUH 4R8WH 3B9DA 4X99A 2OJZL 4PJIA 1J18A 3ILQD 4I2XB 2JTDA 5FAAA 3BPLB 3JV4B 1V7NH 3HR5A 4Y1AD 3C8KA 3MGAA 1GGYA 3DTXA 4J6RL 5F3HB 3WLBA 2XZCL 4ZD3H 3B9KB 4MNGB 1BZ9B 3EYSH 2IALB 3UYRH 1BBDL 1V7ML 3C5JB 3WUWA 4HDIA 4OCSL 2CLZA 3HNTL 1HHHA 4F7MA 4KRPB 4Q9CA 2R39A 4NC0B 5AUMB 5MEQA 5IFAH 3TNMA 3MOQA 5DUML 4Z7VA 4YR6A 1KLGB 1YQVH 5KN5B 5CEYA 4Q6IB 3QULA 4KAQH 1FAKT 3U4EB 1QG3A 3LHPL 2V2WB 4PGEB 5JPMB 3PP3H 4LVOB 1KCUL 4MA7H 5KSAD 4FQQB 4TYUA 2BRQA 4LQFH 1MEXL 1XGYH 4GAJL 3UJTH 3QJFB 4LLWA 1GRWA 4Q6IC 1LMKA 3DVGB 1T5WA 1R5VA 2Q8BL 4OF7A 1FSKB 2NY2B 4I77H 5KAQG 4XBGB 5EO9A 4KUCF 4G7YH 3FFCE 4Y5VC 3UAJD 2VDOL 4ZFGL 5D93C 2DQDH 2CPCA 1TNNA 3IDIA 2XA3A 5LG1A 4YDJB 3MJ9L 2DLGA 1HINL 3IU4L 3W9EB 1BZ9A 1TQCB 3CXHJ 5FKAB 4J1UB 4P2OA 2FR4A 2WNGA 4PRID 5JIKA 3WHXB 4FQCH 2JJTC 3WV0A 4FRWA 1HSBA 1FFNB 4MCYA 1B4JL 3VXSB 2DJUA 4NOFA 3P11H 1DQML 5L2KB 1ETZA 3BP4A 5JPNB 2HKFH 1CFVH 3MRPB 4PB0L 4QXGH 2IADB 4PUBH 4FTVA 2VDLL 3TFKC 1MFAH 2OMNA 5K33A 3V5HA 3V6FA 5C1MB 2CLVA 1YEDA 2A1WL 3RAJH 1KTLB 3HI1B 1F2QA 3B6SB 4EQ3A 2E7MA 2HJKA 4YE4H 5ACLA 2DYPA 1EHAA 1WJ3A 2XV6B 4MD5B 4RBPH 4Y5YB 5DJXA 5JXAH 3TYGH 2AJZA 3BZEA 4JO3L 4RRPG 4NHCL 2A38A 1Z9SA 3JV6A 4HIEB 4S1SL 4IJ3B 1UM6H 2H1PH 1A6AA 1U8NA 2O5XH 3THML 3RDTB 5CD3B 3AXLA 4V1DE 1OAYL 3IGAA 3RWDB 5J12C 4FFVC 3MA7B 2YD6A 5EUOB 5HI4C 2BY1A 3HG1A 2V5RA 2X4NA 4WDIA 5T33H 3ZDXF 3GMQB 3H7BB 4LVHB 5D5MA 2XKNB 3L3DB 3DTXB 2R4RL 1XF4A 2BNUA 3RP1A 1OAZL 1RK1B 5DVMA 1AXSB 3QEQA 3CDCA 2L4OA 3NFNB 3CMOL 2CIKA 2C9AA 4S1RH 1NBQA 3OJMB 3ULVF 3DSNA 2W07A 5D1QC 5FXCH 4WV1A 4XAWH 3EYVB 2CKBL 2XG5A 1E6JL 1FYTE 5C6TL 4UDUA 3IFPA 4NRXB 3W2DH 1LK2B 3GSRA 3BN3B 2X40A 3O4LB 1BZ7A 4NZUH 2EKSA 3RBGA 5J89A 3FKUS 4I4WA 5EH1A 1RZIA 4LSSL 1S9WA 1JF1B 1TTFA 1X5ZA 3QQ3A 5C0ND 1G7PB 2MCPL 3I9GL 1ITCA 1NFKA 2A0LC 2NR6C 4PJ9D 3DX8B 4AQ1B 4NBXB 4O2EB 2YS4A 4X80H 1YEDB 2NXZC 4PJ5E 1EEZA 5C6PB 4AMKL 1QBLH 3VD7A 1U8MA 5I1DA 1A7NH 4LGRB 1ACZA 3JV0A 5JR1H 3FN3A 4R26L 1DCLA 1YEIH 2BC4B 3LKRA 2JB6A 4HJJH 2W9EL 2YEZA 3E8UL 3KYMB 1W0VB 3I6LE 2P48B 3ZTNL 2PO6B 4MAYD 3BPOB 3MBXL 5TDOA 3KPRD 4YK4C 1LEIB 4MNQA 2YBRA 1JPGA 2MQ0A 3QCVH 5EZJA 5SX4H 4Z7NF 4P2OB 1RV6X 1MWAL 3GGWA 1EO7A 4HF5L 3SEPA 3OZ9H 2RFXB 2XZAL 5T1KA 1BFVL 4F37F 1NGZB 4B53A 4JZOB 3QBTB 4AEHL 4NRXA 3NGBB 2Z31D 4Q9RL 5IMLB 1AJ7L 1ZTXL 3JZ7A 4R3SA 1M71A 1WAAE 3PQYB 4XRCB 1A14L 1G7JB 3SDCB 1R3JB 4U6YA 3PQYD 4AY0A 4Y7MA 3N1FC 4GMSH 5GRXG 4H1LA 5EO0A 3MV9D 4TPRH 4CVZB 1VFBB 1EZVY 3SGJC 4MCZB 3LZFL 2FD6L 5GS0D 5FEBA 1ZS8B 3ZMRA 3TLRA 2HH0L 2FL5B 2HT3C 5DK0A 4JO2H 3AGVA 1U6AH 3EZ8A 3VRIA 3H9SE 4EKXA 4Z7VB 1YYMH 5I1IH 1G6RA 3DX8A 4XB8A 5F7KC 4PRPA 2DJSA 5IJVB 1N6QL 2GCYB 4N5EC 5HDLA 4OZGF 3ULUF 3KXFD 4UV4H 5MENE 1QO3A 3IYLW 1HYSC 3K3QA 5ISZD 1BMGA 5E8OB 3QDMA 4L29A 1DDHB 3T8XA 3EJYC 1LE9A 3SE3A 1CLCA 1MJJA 5B21A 4EVNB 5TPWH 3DETD 3P9LA 4KK5C 1ND0B 4FHBD 1RHHA 1QSEA 4AJ0A 3HAEH 1XIWC 4OIBA 3SE8H 1OTUC 1RZFL 2R2HB 3PL6D 3WS6A 3BP7A 2YWYA 3KPRE 4JKLA 3BD5A 2CH8A 1I1CA 4FN0A 3QHFL 5DEGB 3W0WE 3VGEA 4KPHH 2B1HH 2EYSB 5HDBF 1G7QA 5KVEH 2AXFA 4KK9D 3EFFB 4PJXA 1MFEL 1GAFH 4TVPD 3QIUD 3QCUH 4OM0L 5SWQB 3OAZK 3QYCA 4HUNB 5EU3A 3UBXB 4JFED 1EZVX 3W11D 2BHUA 3HE6D 4L5FH 3GMMA 1E0OB 5DVOA 4ISVA 1EAPA 3QAZB 1G9NH 5TDPA 2IG2L 2D7PA 4RFNB 2MQ3A 1BQHB 4P2RE 2DKSA 1R24A 4MQXC 5ICZA 2YPLA 4DK6A 4HULB 2LV4A 3NZ8A 3NCJL 3MA9H 2I5YH 4UT9L 4DKEH 4JRXB 4EBQH 4PJ8D 3MGTA 3ZT7A 5I1CH 4GSDH 1AHWA 1LEKA 5DQDH 3FQNB 5EBLB 4M7KH 5DR5L 3MV7E 3O8XB 4HH9B 3ARBC 4KK6C 2XZQH 4QRPB 4X5XB 2KH2B 1ADQA 1OTTC 2PCPB 4ZS6C 1L9NA 1Q0XL 3B5GA 3S9DB 3UTSA 4LSQH 3GHEH 2YD7A 4Y5YC 3SJVD 3EFDL 2EO1A 3HLAB 3BHBA 2FB4L 1WQVT 1A7PL 4IOIA 2V17L 5F3BA 1CXHA 4UIMA 1F4WH 5JHLH 4PJGE 2F5AL 4PJIB 4F37K 2OX5A 3FQTB 1JNNL 1YMMD 4O58H 3WE6B 1PVHA 1RK0A 1RJYB 1RZGB 5LCVL 4KHXH 1N64L 1R5IA 3BZFB 3EZJB 3L6FA 1AY1H 3AS2A 3CFJB 1MFDH 1KTDA 3NABH 5HVHC 4JO4H 2X1PA 2ED9A 2YSSA 1I3UA 1HILB 1KGCE 2P8LB 5DTFB 5D2LA 4Z0XA 4KGJA 4X7SL 4O00A 4OGZA 1HQRB 3O6FB 4WW1B 3TZVA 5F96H 3L5XH 5F7NC 5HYIA 4HKJB 5AUMA 5CJXA 2ORBL 4M7LL 3QUXC 1SJEA 2W9DL 3IXAA 1Q9WB 2VDNH 3WNPA 2AEPH 5FGCB 3FQXB 1LK3L 3MXWL 4ZUWB 3MLSH 2X4TB 5D93B 2C1PA 2M2DA 3UPRA 5I1EL 4OJFH 5JHDD 3PGFL 1KTDB 1QR1A 3J7HA 4NUGH 2DQUH 1RUAH 3ETBF 3UTTD 3C6SA 2VDLH 25C8L 1U3ZA 1NBVL 1MCQA 3I6KB 3V5KA 2F58L 2A6JA 3G5ZA 4YPGA 3UCRA 4TUOB 2X05A 1HSBB 4NSKB 1U41A 1SYSB 2YMXH 5JW3L 5TFSL 1UM5H 1AGCB 3SGDI 4B5EA 1HQ4B 1CGWA 3P40A 5C07D 3S96B 1JWMB 5GRYA 3ZDXE 1KELH 5JUEH 1FIGH 1WIUA 2HFEB 3WIIL 2XN9A 2J7LA 4OT1L 3O9WD 1FDLH 4JPIB 2CO6B 2VLKB 1JTTA 4CNIB 5C86A 4QRUB 1U3HD 4R7DA 4EEEA 1D5ZB 3G08B 3BH8B 3DUUB 1Q9WA 3PDDA 5BV7L 1SHMA 1FYTD 5C08D 3WFDL 3RTQD 4NZDA 4WI6A 5BRZB 1P9MC 1Z9OA 4E41A 2XNAB 4RGNB 1P7KA 5D7LD 4ACPA 4CN1A 4JFEE 3GSWA 1FZOB 2FJGB 3UTPE 5T3ZL 5B38B 4PGCA 1ACYH 3MRBB 3HE7B 1I1YA 1LGVA 4GBXB 2G5BB 1J8HB 3GM0A 4QHMB 1KT2B 3CX5J 2LQRA 5FDWA 4CADA 3HAEA 4LLQA 5IBLC 1JHTB 4IOSD 3PWNA 4KTEH 1M05A 5C0BE 3VGAC 3ULUH 3BMVA 5EPMA 4KZDH 4Y1AA 4BUGA 3RPKA 4OQ1A 1Z9LA 3QFDB 2DM3A 4Y4FD 4HWBH 5EPMB 3HR5B 3VG0H 5GRUH 1TJIH 5FB8A 5GGVY 4OV5B 1ITBB 5DD5L 4HJJL 4R4BA 2FIKB 3QIWA 4JQIL 4JAMA 3DETC 4OZGA 5GRJL 5I16A 3KJ4C 1FGVL 3D0LA 4UT6H 2WP3O 1JUFA 5FM4A 1A9BB 1XZ0B 3CFBB 4BFIB 5GSRB 3STZB 1ZGLM 3JWOC 3CZFB 5ETUB 1SEBA 4MD4B 4ZUTB 3VFRA 3GSQB 4MNGE 5ADOL 4JDVA 5L9DL 1BD2E 1HWHB 2APBA 4XMPH 2AJYL 3BVNA 4OV6F 5GS2H 2ARJA 3JVGA 1UZ8B 4GAGH 3T04D 1T22A 5C0EB 2OTUB 1FNSH 5EZOH 4U7SA 3QEGH 4PJHE 3FQXA 1ZGLB 4QNPE 4ODWB 4YHZL 3QXVA 3K74B 4DOHE 3QEHB 4EI6B 4IOIB 3NIFE 4EDWL 43C9B 5IIEB 4G8GB 3WIHH 5E5MA 3MREB 1YNLL 2WUBL 4F9LC 1F4YH 4H20L 3OKNB 3QNYB 2L7JA 3E6HB 2YRPA 3L6FB 3N1PC 3MFGB 4IOFC 4MJIE 1U92B 4ZS7H 2IFFH 5GIRB 5B39B 1FVDA 2O5ZH 5ISZE 4XPFL 1HNGA 1WVZA 4PJGA 3IFLH 1K9TA 4YC2B 3ECBB 5AYQA 4G8EA 4EI5B 5C0BB 1EMTL 1A0QH 1NAML 2VITA 5MP6L 3FCTB 3B2VH 1YMMA 3A0OA 1QYGH 4RIRB 1BGXL 3GSOB 3QIUA 4P9HH 4UTBL 5F1NB 2VSCA 4FQJL 1QZ1A 4NIKB 3QUXD 5H2BA 2FRGP 5J8OA 2APTA 3OKEB 1PYWB 3OF6D 5TDOB 3QWQB 1QRNA 2IPKA 4WTZA 2B5IC 1JNLH 4FXGB 2R0WH 5CCKL 4N9OB 4O2FB 4OBRA 2KQMA 4M3KB 2ZUWA 1IM3B 4AZ8A 4YWGL 1Y0LB 4BFBD 4JDVB 5F1KC 1Y6NR 2P4AB 2WLYA 5F9WB 5C0DA 1ZSDA 1B4RA 3WXWH 4NDMB 1TZIB 4Y16B 4D9RD 1ZT1A 2LVCA 3D39E 4JPVL 5HGAB 4TUJA 1K4DA 3MJ8A 4Z7OF 1QLRB 4F8TA 2AVGA 4PJBA 4P2RA 1KTKE 5IG7B 1CF8H 5ISZA 5CS7A 4Z7WF 4WHDA 3H0TA 4Y16C 5DEFA 4TSBH 4XH2B 3DWTA 1T1WB 4KKCC 5T3ZE 1FFPA 1FJ1A 1S9VA 5JW5A 5SV3A 3T0BA 3HUJA 5IP4A 2VAAB 3RL1B 2NNAA 4WRLA 2HAZA 1D7FA 3PWNB 4OUUA 1N59B 5DJ0A 3WXVH 1N8ZB 4FQ1L 4O02H 3TBVA 1P4BH 2GSGB 1E4WH 3CD4A 3GSUB 3ZE2F 4GRMA 3S34H 3TJEH 5HHPA 1V3KA 3DV6A 4Y5XB 5ECJE 3W0WD 1OTTD 1MQ8A 1E6OL 1I7RB 1INDH 4D0DA 1DP0A 2BZDA 4K3JH 5HY9B 3NAAH 4IS6B 3VD5A 5JXED 1JF6A 3OX8A 2V5TA 2I9TA 2B4CH 4ZUTA 2EKJA 3MUJA 5L8JB 1RIHH 4HV8B 2VABB 1X3DA 2Y9RT 1B2WH 2RIKA 5EDXA 2EXYD 4NT6A 2IWGA 4ZXBA 3RWCB 5J9PB 4PY7B 4WUKL 1IC5L 1ZMYA 4YO0B 4M6MH 1S7UA 5FYLL 3MNWB 1A7QH 1AIFB 1J1PH 3OX8B 4DQOL 1IFHH 4J12A 5KS9A 2GCYA 5J3HD 4HX1A 5JNYA 1IEHA 3HB3C 4R96B 4DUVA 2CLRA 4PV8B 3S96A 3TT1L 1C12B 2ARJQ 4NUJA 1AP2A 5C0BA 3T1WA 3TCXA 3VXSA 2EYSA 2D4DA 4LL9A 4X9BA 1SBSL 1T03H 4KTDL 1H3UA 2NNAB 3GBLA 4HGKC 4ODHH 4BJLA 3V6BR 3VRJA 3FO9A 4XNUH 5LXGH 3BP7B 3SO5A 5I2IA 3D3VB 3P4LA 2E6QA 5CJ5A 2ZOLB 4ZQKA 5IMOA 4BQCA 3C5ZB 4QHLA 4Y19E 4E41E 1WZKA 3KPLA 3QFJD 2BMKB 4N0CC 4NQXA 2ITCB 1FAIH 1UEYA 1T7VA 1U8MB 3BH8A 4GW1A 3MYJB 4W4OC 2Y36H 4NO2A 3RWHA 4K7PY 4NDMA 2J5LC 1XCTA 3MV01 1ZSDB 1KIUA 5CLWA 3N9GH 4KY1L 1DL7H 4KJYA 4L8DA 1CDCA 2Y6SD 4L4TD 4YEEA 2AJUL 4UINL 3RRQA 2CD0A 1F4XL 4CU6A 2FJGA 1FZOA 4L3EA 5FA3B 4R7NA 4XBPB 2AABL 3RL2B 4U1HA 3R0MA 3PHQA 5C0AA 1EGJL 1NH6A 4I3SH 2WBJB 4PV9B 5F7EH 1HE7A 4L8BB 3UTTA 5B3NA 3KLHC 3L3JB 1U8HB 5IK3A 5KOVC 2BNQA 2UUDH 4MLSA 4JGUA 4UI2A 5GJSL 4HS3B 4WFGD 1OT1A 5IV2A 2A6JB 3EDDA 5JOEA 4Z18A 4IDLA 5DVNA 3QIWB 3OHXB 5H8DA 1UM4H 2CJUH 2XT1B 2P45B 5ABDE 1R3JA 1T89A 1MIEL 3FQUB 3V5DB 5D7JD 3SO3C 4AENB 4J1UA 1A3LH 3C8KB 1EDQA 2GIYA 3P9MB 3D5OF 3MLVL 1XFPA 4RGNE 5EIIB 3H42H 4KVNH 2PTTA 3QRGL 5TQ0H 3WN5C 2F8VA 4RZCA 4M02A 3GNMH 3O11A 5LBSH 3CH1A 4ETYA 1QSZA 5DLMH 1OAUL 2G75B 4GQ9H 1DE4A 3LQAH 3VFMA 4ZFFA 4J4PD 4LAQH 4XCFH 1HCVA 2R1WA 2VRAA 4OI8A 3QNXA 3HI1A 4KJQC 4JQVC 2DI9A 3O2VH 1ZE3C 4GKNB 4L1HA 4Z7UA 4R2GB 3VFWB 5FO9B 2VXUH 3H9YA 1TJHL 3PABA 4KTEL 4MVBC 4G9FE 2VNCA 4FQPA 1RQ5A 1EVTC 2GAZA 1KBGH 4Y88A 1NGPL 1TPXC 5DVLA 1M6OB 3O0RL 2VZUA 1MRFL 4N8CL 3FN0H 1UQSB 2Z8SA 3HRPA 3QXUA 4ZTPH 1SJEB 1NJ9B 4L3CA 4UNTA 2JCCF 5HYEA 5HGDB 4X6CA 3F7YA 4WW2B 2NY0D 1WT5C 3SOBL 3RIAF 1JWMA 4XVJL 3WDIA 1BD2D 3AM8A 3P9MA 4OLUL 4XP5H 4W70A 3UTSE 2GITB 4G6FD 5GJTL 4DAGH 4IRJA 3VFGH 3IRPX 4TUOA 1QA9A 2D03H 2C3VA 4S2SA 3AVEA 4NQVA 4U6VL 4XHJC 4J8RB 2KKQA 4M5ZL 1PJ9A 4FFVD 1ND0A 4DZBB 2EYRA 5HYQB 3F7QA 1DQJB 2F5BL 2DLIA 4MDIB 1I8IA 4JZNA 3SKMA 4DEPB 2PR4H 3GI8H 3H2WA 3VXMA 4HQQH 4Q2ZA 2N7AA 4LRNL 3GBNH 5KN5A 5I1KL 4YXLL 3BGMB 4ZOEA 3SGEH 4GW5B 1DQDH 3QO0A 1GGCH 2JJUA 4NO3A 1A8JH 1ZLSH 3QO0B 1NLDL 4ZODA 3DMMB 4FA8A 4D9RE 3DBXA 4MQXD 5ITBH 1J1OH 1K8IB 3IU3A 1FGNL 4KZEH 1AKJA 2QSVA 1XIWD 2J5LB 3BKMH 2FZ3A 3PJSA 4FQIH 4MYWB 4Z5RB 3ARVA 5DURD 4LIQH 1T0NB 4X6DB 4ELMA 4X9HA 4P9HL 3MXVH 4UTBH 3S7GA 3KPRA 5MHSD 3PG2A 4DTGH 3U4BH 3VXRB 2L7UA 3IDMB 3WJLA 1LP9A 2P5EE 3FFDA 1OARH 4JFDD 2O5YH 5IMLA 4U33A 1QSEE 3T09A 3OKOB 4APQB 4Z0BL 3NIDE 2HG5A 1B6DA 4NKMB 4BUHA 4K71C 3HI5H 3H8NA 3UJTL 1E4XI 3BKCL 1G0YR 3QDME 1T5XA 1U93B 3BGAA 3BWAA 5IB2A