3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
molecule keywords Peptidase 1
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
3O9WB 5EORH 5E00B 4MCZB 5JW4M 1QP1A 3B83A 1AE6L 3STZB 4LRNL 3AGVA 2C9AA 5DSCA 4OSUL 1Y18B 1RUKH 2R0LH 2VDOL 1U8OA 4KQ4L 2IG2L 4KRLB 4U1IA 3ESUF 4XP9H 5AYUH 3RKDC 4RGOH 2IPKA 3QPXL 5GSVA 5T1DH 1VFAA 3FMGL 4TULH 2VQ1A 1I8IB 3GMQB 1NGXB 3H2WA 1T1XA 3F7RA 1A6PA 3M1BA 4Q97A 8CGTA 2ZJSH 1I1YA 1Q8MA 5FYKU 5CILH 4F15B 3RNKB 5CEZH 1FNSH 3CDGA 5ACMA 1A47A 4EUPB 3CDGB 4NKMA 1ZLVH 2PW2A 5I73C 4KGJA 3GI9L 2AJXL 1F6AB 4NKQB 1GC1C 4JFYA 2E3VA 1Q9WA 3BYYA 1HXMA 5TE4H 4EIGB 1ERNA 1BGXH 5J1SC 1P6FA 3SE3C 4EBQH 1RMFL 1S5HB 1K2DB 1FFPB 3RTQC 4DAGL 5DRZA 1MHEB 3T0XA 5M7QA 3RKDD 2R2BA 3W0WD 1DL7H 2OJZH 1A6VH 3OKYA 3IXAA 4FQCL 2MHAA 2VXVH 1ZVYA 1YEHL 1ITBB 1EPFA 4GW1A 4NQXA 4I77L 3EJYC 4JM2F 5FUZL 1UADC 1JL8A 3K2MC 4YDLB 2NY5H 2WZPD 4LCUB 1XFPA 3CFBA 2E9BA 1J86A 3Q5YA 1AXSA 5C09A 4LVOC 4UIMA 4QT5B 2Z91B 5CJ5A 1KXVC 5GJSH 3GHEL 3T3MF 3L3KA 1CE1L 3PDOA 2GSIA 3VE0B 4UT7L 3U30B 3HZKA 4YR6A 1F58L 4PRIA 32C2B 1KTDA 2ITCB 5C0ND 4LNRB 2JELH 3K1DA 4MJIB 5C2UB 1WLHA 1Z0NA 3G04A 1EAJA 4XNZB 3NN8B 4LSRL 1HI6A 2NW3B 3MOAH 5K59F 4MLSA 1X44A 5CFHA 5ID0B 3HZYB 5HDBE 5DUML 3BUTA 4WU5B 4PS4H 1DQLL 4OFIA 1BLNB 4Z5RA 3GSOB 1D5MB 5LWYL 3WN5A 3DNKA 3RY6C 2B0SH 4LVNC 1F6LL 2GY5A 3L5JA 5D8JH 5FK9A 5D5MA 3ARRA 3GMOB 4WW2F 3V9FA 1UACH 5D71H 1KCUL 3QDJA 5ESQB 2L0DA 3IF1B 2Z0BA 3EO9H 4KUCD 1KULA 1C5CH 1TNMA 3D39D 5FHAL 1MH5B 1MVUA 3QNXB 4CU8A 1INQB 3CFEB 3QHZH 1AH1A 1KJVA 2PYED 1MCPH 4Y0GA 3ARDB 4MA8L 3S88L 1P7KB 2X9XA 3VGDA 3MJGX 3TBYB 4G6JH 4PG9A 1CXHA 3C5SB 1G7HB 4CDGC 1QACA 3H3PH 5GGUB 1XGUB 4ZUSB 1I75A 2EYTB 3MBEA 4F9PA 5DJ6B 1P9MA 1A2YA 1EHAA 2E5EA 4PGCA 1S9KC 4BH7B 4EDXB 2EH8H 4FN0A 4PJ9D 3QEHB 2D7TH 5H35A 4ZAKC 1MREH 2NY6C 2E8YA 1T89A 1CDIA 3D39B 4KZEL 1TVHB 4ZFFB 5HBBA 5DHVH 5FO7A 3FO1A 3AVEA 2V7HA 2R1YA 1N7MH 2YRPA 1MCWM 1A4KB 4NUGL 2X89A 3MNZB 2IPTL 4P5KB 4WI8A 2W9DL 4ZXBB 2Y1VA 1A9EB 2ZPKL 3ZE0F 4I0PD 4KK8D 5T1KD 2BZDA 5E1HB 1A5FH 4ZS7L 2PR4H 9CGTA 1LK2B 2VIRB 3B8SA 1UB6B 3W5MA 1HXMB 3BP5B 4P4RA 4YZFE 5HHNB 3FOMB 1BAFH 1G0YR 1K85A 3LH2H 4CVXA 3WXWL 4GXUN 3UJTH 4YNYA 3UTTE 5CSZA 3BPNB 2YS4A 2PXYC 3FO9B 5MP6H 2P5EB 2OTWA 1M7IB 3IRPX 3KPQB 3IKKA 2BY3A 3REWA 1N6QH 3QIWC 5ERWA 4PJFF 3CXHJ 1I7TA 2ZNWA 1DUZB 4OT1H 3LEVL 2YUXA 5CZVL 5I16B 1A6VL 3UTPD 4PGZA 4QNPF 1HOCA 4PJXE 5FYLD 3SCMC 1ITCA 1XZ0B 5GS1C 4Z7UE 1BJ1H 5TDPA 4JRYB 3I3EA 4IDJL 1QFHA 3MLYH 1F4XL 3PXJA 1JFQH 1NC4B 4U3CA 3REVB 1UQSA 5J8OA 2L7UA 3QP3A 1U58B 2H8PA 3WN5C 3PWPE 1U8PB 1GHFL 1CFQA 1HSAB 3WNMA 4PRID 4YGAB 2DWEA 2XPGA 4X7TB 3VI3E 3EZ8A 3QUMB 1J88A 4AMKH 1MF2H 3ARXA 3JXAA 4P2QD 1A21A 1Q0YL 5I1GH 1UWEH 2WV3A 3HE6D 4D9QE 4PJFA 2ZSWA 5L2JA 4RGOL 4JFEE 5AYUL 4JG0H 5I1AB 4LNRA 5LBSH 3PWPD 2IEPA 1FL5A 4XGZB 3T09A 5MEPA 4UQ3B 3F12B 3WKMH 4H0GA 5E08H 2ADJB 2FB4H 1GGCL 3VGHA 4HULB 2CUHA 1KPVB 4PY7B 5I71C 4KDVA 4TRPH 2NY2D 4S1SH 4CN6A 1T66C 3NGBC 3RWCA 4ONHA 4BK4A 3S88H 4XMKH 1QG3A 2XZAH 3QPXH 5D7LB 1Q9LB 4ZFOA 3MRNA 4K7PH 1NUGA 1FLRH 5E1AB 4FTVB 3D25B 4NNYA 4IMKA 4P4KA 5D2NB 3OAUH 3F7YA 4RDQF 5EORL 2EO9A 1CWVA 4JPVL 3RZCB 4FXKB 5IM7B 1BBJB 2GFBA 3LKPB 4JPIB 4R0LC 3VH8B 3K81A 3MV8E 4HWNA 2R1WA 4WY7L 3SDCD 3O3BB 3I6GA 3TFKC 5K9OA 1OSPL 2ICWJ 4XNUL 5DDHB 3MO1B 2B8OT 3BKJL 4D3CH 3MRJB 1J1PH 4WUUD 2BNQE 3HC3L 2EIZA 4OFPA 2IQ9L 4NQED 2RFXA 4PJBF 1NGPH 2VITA 1HQRA 1QSFD 1JPTL 2VLKA 3HFML 4HUNB 3VG9C 3W82A 4LARH 1QVOA 3BDYH 1SEQL 3QIUA 4L4VA 1JV5A 5A43C 3LKNA 3ZT5A 1KNOA 2NY0D 3PGFL 5FYLL 4K3EL 4PRHD 3A6CH 3RY5A 4QYOB 1U92A 2J12B 3QI9B 5DT1L 5SWSD 4Z6AT 1P4BH 4DVBA 1NUDA 1I3GH 2AQ1A 2AAVA 3BIBX 4Q9CA 4I0PA 4QRTB 5T1KA 5GJTH 4NQDA 1KUMA 1NCCL 1S7WB 3BQUC 4UOW0 2FO1A 3C2AL 2AJZB 5CZKA 5MENE 5BW7A 2X4OB 4XC3L 1WK0A 1FORH 3RWEA 3G9VA 3GSOA 4CW1A 4S1QH 4MAYA 5DHXB 4X99B 4OGXL 2H45A 3OZ9H 1IJ9A 1ORQA 4J3SA 5L2KA 5HD8D 1XF2A 5CJQL 1KJ2H 1SJEA 3QEUB 3BPNC 4KJPD 4KC3B 4IJ3B 1XGRA 3WJLC 1PAMA 2XV6B 4MXWH 1U93A 2CRIA 3OKLA 3ULUC 3K4AA 1IEAB 5GS2H 2HT3C 3SE9L 4G80A 3TH3T 2XA3A 4G6ML 4PJAA 2FDBP 4LAQL 1C16A 4O51B 2IH3A 4E41E 4KKCD 3ABZA 4LPXA 4NHUA 3K8KA 2X4SB 4M6AA 5F1NA 3TZVC 12E8L 2DJSA 4E42B 1DLHB 1PKQE 4XC1H 4RGMC 5ITBL 2R4SH 2VLME 5C71A 2DL2A 2UY6A 4OM1H 3H9SB 2HH0L 3WSQL 5E5RB 3ZHLA 5C07E 5KOMC 3O8XB 5GRJH 5EBLB 5FF6A 5FOJA 1HZHH 2Z31A 4KI5F 4NSKA 4Z7OF 4NC0B 4HGMA 1F3DH 3DX6B 3FZUC 5I1LA 4K3GA 3EGSA 5D72H 1EH9A 4ZPTA 4KK5D 1RK0B 3INUH 1RUKL 2R0LL 3UJJL 1V7ML 4TVPL 5AG9A 1KG0A 1IMHC 4LDLB 1IVLA 3CVHH 2BX5A 3WSQH 1ZGLA 4GT7A 2HH0H 4YX2L 3S8WA 1BQHB 3ZYZA 1U8MA 2DQCL 4XX1E 2V2XA 2HJFA 1JNLH 1IM3A 4LLVA 1N2RA 2EDKA 3EJZC 3K7UA 3VD3A 4C56A 5B38G 4Z7WE 5MENA 5D7LA 1HH6B 2LTQB 5I71B 1N5AA 2Y36H 5EZOL 1TQBC 1DR9A 5EOCH 5EU5A 1IGTB 4OB5H 5I8CB 2MPAL 2EC9T 2XN9D 3N50A 4EJ1C 4OI7A 4WFGD 1S7RA 2BJMH 4ZODA 3MGTB 1ZHKA 2HT4C 2NMSA 2VDLH 1C08A 4AM0A 4KKLC 2QQKL 1LK2A 3ULUL 3VFRA 4NGHL 4QRQB 2Z4QB 3RDTB 4HAGA 2BRRL 2DF3A 5A3ID 3DO7B 2R1WB 3DSFL 3STZA 3GZKA 2PUQT 3V4VL 2DDQL 3V6FA 3SDCA 3TM6A 3OGCA 1A4KA 3O3DA 4MLIA 3HI5H 3DYPA 3HR5A 5D7SL 7FABH 4KDTC 3F7PC 4NJ9H 4YDLC 4PJBE 1VESA 3HZVA 2I5YH 4G42A 5JUEL 2WIIA 3WS3B 1K3ZA 4PJAE 5DI8B 1T83A 2OX5A 4PJIE 4LCIH 5EBMB 3O41A 1IM9D 4XWGL 3CFJB 1FNEB 4TUOB 1JPTH 5IB5B 3T2PA 4L4VD 4GJTB 4TYUA 2DQHH 4KHXL 4JN1H 4HKBB 4LPWA 1L6ZA 5IJVB 5E94A 1FFQA 2W60A 3A67L 1WFNA 1JPGB 4M61B 3RNQB 5DRXB 5CBEA 1AFVL 1HSBA 4I2XA 4P2QE 3QXDA 2WQRA 4P23C 1I1AB 5I1IH 4JFED 4JZNA 3E6HA 1LK3L 3VWKA 3ECBB 4WTZA 4PJFB 3P73A 3ZYIA 2DLEA 1S9WB 4EUPH 4LGSB 3U9PL 1FLRL 3OWEA 5DD5L 3X17A 5I8KH 4KJQD 2I07B 3NPSC 3QEQD 5F3HB 2ADFL 1TCRB 2LE9A 4F37K 3JVGC 4YHIB 5B3JE 3MRFA 4BUGA 1FNHA 1J0IA 3F5WA 5F8RC 4S10A 1C1EH 2A6DB 2GTZA 3LKOB 4ZO8A 1CFTA 2ORBH 4LIQE 1HCFX 5D7LE 1JWUA 4PYGA 3CSYA 1TZGL 4ZO9A 4I3SH 2DQTL 4EI5C 5ANMA 3BAEL 1ZVHA 4I0PB 4QRTA 4WGVB 1QUNA 3SDDB 5CGMA 4HT1L 4G7VL 2FX7L 3EJYD 5DJ2B 5L0QC 1FJ1A 3WHXA 4I9WD 4OGZA 5B22A 2NXZC 2OR8A 2O5XH 4HS6B 1IBGL 3KDMB 4KAQH 5IF0B 4UU9B 4PRNA 2JJTA 2YHGA 4UTAH 2PXYD 3V79C 4HD9A 1UGNA 3W39B 3FB8A 1MF2L 5GZOD 1ZWIA 2HKFH 3BISA 5D2NA 1A7PH 2FYYB 3P9MB 4NRXA 4ODTL 2R2CA 4U6XB 3WHE1 5DS8A 5JW4R 3HR5B 3CK0L 4U1HB 4NQTA 2WM0A 4LU5H 5FB8A 3O45B 4PJ7A 5C0DB 4LSQL 4KRNA 4G5ZH 4OLWL 3SGKA 3MLWL 2GITB 2ZUXA 1HHHB 4NN6C 1KIQA 3UPCA 1ZLWH 5HHNA 5LGKA 5FIEA 1OWWA 3CU7A 3C60B 1E6OH 3TJHD 5HI3C 3PQYB 3MTRA 5DJ8A 4XAKE 4WHDA 4GSDH 1CE6B 5HXMA 1KPUA 1QD0A 3DPBA 3ARDD 3LY6A 4TUKL 4E0RB 4PRPE 4TQEL 4NQVA 2JJUA 4JRYE 1IM9B 4TSCL 1WFTA 2CIKA 5B4MC 1INQA 1CDYA 4YWGL 3EDDA 4MD0A 1T1WA 5MEND 1LO0H 5F9OH 3MRKA 1F90H 4OCXL 4KK9C 4IIQB 5FKPB 4GBXD 1YEEH 1CFQB 5DJXA 3LH2L 3FB5B 3LS5H 1NKOA 2CLZB 2LV4A 2LTQC 4JREB 2EDHA 2MTPA 5JW3H 2NZ9D 4PTTB 1LE9B 2Z35B 1WTGT 3MFGB 5IESL 2WBJD 5CIPH 2XTJD 3VFSA 2A73A 3EHBD 4LKCA 3UBXI 4RMRA 1LVEA 3D2UB 2VE6B 4OZGB 4V1DE 1MRCH 1JRHL 1U3HC 2DQGH 3S36X 1NCDL 1NDGA 4PRAA 1PEZA 4B50A 3PGFH 3R0NA 6CGTA 3LEYL 3O2WL 3VDCA 5GGVY 4UQ2A 2ARWA 3CFCL 4YR6B 2H6PB 1KF9B 1KELH 3KPRB 3R06B 3D39E 1LP9E 1R5IB 2DTML 4GBXB 1M71A 4X6CE 3CSYB 2HLAA 3MSPA 3G5ZB 1YEKH 2F53D 3B43A 5BJTA 5I1KH 3O2DH 3BOVA 4PJGE 5EU6B 5HYJD 1AXSB 5KJRL 1WEJL 4XRCB 4OZFG 4YE4L 1D5MA 1TJHL 5C0NC 4FQXA 5FUCE 2YA1A 3I2CH 2HTKC 3ZE2E 2VC2L 5I1DB 1MAKA 1A4JA 4JDVB 5C0BE 1GXEA 2ATPB 3REWB 3GNML 4NQXB 2KL6A 1A9BA 3O4LB 2R1YB 1AQKH 3QIWA 3D18B 3W9EA 4KQ3L 5DRZB 4HXAH 2WUCL 5J6HA 2D0HA 3B2VL 4NN7B 4F8TA 2MQ0A 5D7JD 4PLNC 2P24A 5KJRH 1NFDE 2KH2B 4LP5A 4MD4B 3GMLB 1XF2B 4XPAL 3UBXB 1ZANL 1N6VA 3L3HA 5EOQH 4OGAC 1FV1A 4HV8A 4M5YL 5IOPA 1PZ5B 4X6BA 5F89B 2FL5A 4JKWA 3FTGB 5T3XD 3M1BB 5HHOD 3DX9A 2E7LC 4HIJB 1JK8A 1N5YL 1JNNH 4O9HL 1KPRB 3T3ME 2XXMB 4YHLH 3UTTD 3N1GC 1KG0B 2ARJQ 3C6LB 4MQTB 1JNHA 2QQNL 3BPCA 2FBOJ 5JHDA 4H5SB 5E9DB 1KTLA 4UINL 4RWYL 2RJMA 3MUJA 43CAB 5E2TH 2E6QA 5FEBA 1CG9A 2IAMB 3S36H 1P9MC 3WNKA 2X1PA 3IJHB 3T4AA 1ZT1B 4U1SA 2GYSA 3CX5K 5FK9B 3R8QA 1ZTXL 3GK8H 2OJEA 2Y07H 4ODHH 3DXAE 1XR9B 3QUMH 3V0VB 1MSPA 2RFXB 3JV4B 4RRPG 3U7AA 4WFGE 1JCKA 1MJ8H 3N1PC 1PZ5A 4F7TB 4ZYKA 2IGFL 3VGFA 1WISA 1ES0B 4I77H 2Y5TA 1HQ4A 3OB0H 4WWKB 3T0EC 4NQEB 5JPMA 3UTSD 5E0QA 1KSRA 4RAUA 3RWCB 4G9FE 2GSGA 4PJBB 1I7RB 2VZTA 1IEAA 4UOJA 1T20A 1U6AL 2QJDA 5L8LB 5DQ9A 4D8PA 1CXIA 2R23B 4OCXH 1URLA 4PREB 5AD0A 1AQDB 5FYKL 5GZNC 1AO7D 1BLNA 5AUMB 5EBLA 1FVCB 4D9QD 5F6HI 5C92A 5EZLA 2EDNA 3RY6A 1PJ9A 4L4VE 3ARFA 3KYMA 1M05A 4I0CC 4WEMB 2DQUH 4A2LA 3L3GB 4FA8A 2HMIC 5FHBL 4ODTH 3ROOB 3O41B 1I3UA 4LHUD 3PE9A 4WNQB 1OTSC 4LPVA 3B2UD 1ZHBA 2X4QB 5MI0B 3WL9B 4WWKD 2X4PA 3PWNA 5C2BL 4YHYB 2BP3A 3O2DA 3TWCH 4YLQT 2HMID 2GIYA 4OKVA 4OLUL 3L3IB 1HINH 1A3RH 1SVCP 1A6ZB 4HHAB 1LD9A 4XCCL 3MX0A 2Y5TB 5DWUL 3UTOA 3ZL4H 3RGVA 2X2YA 4TSAL 4MQXD 3GRWL 1C5BL 1B4RA 1QBLL 5BO1H 3DO3A 4U1MB 3CSPA 3MR9B 3CFDA 1PY9A 4H1LA 4PJDE 4OCWL 4JFFE 1P4IH 5TE6L 4XBEH 3D2UA 1HQRB 4JHWL 4X99A 1N5AB 5J9PA 3FO0L 4JFFB 4YUEL 4EUPA 5JR1H 1AY1H 3TBTA 2VDOH 2V6HA 3SJVB 1A7BA 2VXTH 4WO4C 4ZUUA 4OCYH 3OPZH 5CP7B 2EC9U 5KZCB 1VFOA 3VXQB 1RZGA 4I3SL 5IWLA 1A02N 3MRLB 1TETL 3MRLA 3CIQA 5IV2B 3O3EA 4W81A 2YWYA 2BXYA 1EEZA 5CGYD 4HKXA 1QFOA 4XI5D 5IVXF 8FABA 1LO5B 3H7BB 2ICWA 1DVFD 3GSRB 5BW7C 2ZUYA 2EH7L 1UA6H 5KVEH 4OGXH 4KTYA 3FQXA 5DVOA 1EIBA 1G9ML 3FONA 4HXBH 1T1XB 2VISA 2G5BB 1T1YB 5DEFA 3P40A 4H8WC 2CKBA 3FOMA 4K71B 4MMZC 3ULVE 5DA4A 3MLRL 5ESAA 4O2FA 1RULH 1HILA 3C60A 1OP5K 3BESR 4N9OB 4BFBD 3QQ4A 1KFAL 3MXWL 4AQ1B 4JQIH 4GKNA 4W70A 5J6HB 4LRIA 4P3CL 1I9JH 1QSEA 2F54D 2RB8A 1O0VA 1CR9H 3SGJA 3U0WL 4BQ8A 2VDQH 2J7LA 4IS6B 4JANB 3CZJA 2BVQA 5BRZB 1RULL 1JMXA 5I1JH 4J2XA 3LZFL 4F7MB 2AJVH 1SM3H 3LKSB 1KT2B 5I8OL 3O3UN 1YMME 4ZDHB 1JF5A 4LLQA 1WQVT 2H2PD 4PRPB 4LLMB 3VD9A 1OQXA 3NIDF 1NMCC 4JGJA 4OV6F 3CFEA 1NL0H 4KZDH 2B1HL 4HUUA 1B0RB 2CLRB 2P7TA 3D85B 5D7SH 4XVSH 4GUPB 4AENB 3EDKA 3REVA 1A6WH 5EU7C 4XXCC 1XF3B 4WY7H 4WUKL 1B0GA 1DL7L 4Y5XC 4ZQKA 2DMKA 3HPLA 3WNLA 1SQ2N 5KVDH 4BSVA 1YY8A 3JWDH 5I76B 5K9QG 1QKZL 4FQ2H 3IDIB 3L1OL 5DUBB 5A2JH 5INDA 2EDEA 2CMRH 4H8WL 5BZDB 1QFUH 1G7PA 2GSGB 1JGDA 3QB7C 5C6WH 3I02A 4GRLB 1KC5H 5HYQB 3C08H 1L6XA 1MJUH 5ICYB 3QCVL 1GPOH 4XNZC 1MJJB 4P0DA 4NM8L 4KU1A 2X4RA 1KJ2A 4Y4HA 2EZ0C 1PW3A 3W2DL 3QUYA 1BJ8A 3DMMD 4HC1A 4S1SL 2VLRA 4HPYL 4IEFB 4LHUA 2Q87A 1R3HA 2PKDA 3HS0A 2HP4A 3GRWH 4KTEH 5JW5A 5BCAA 3HG1A 1OTUD 1V7NH 1VCAA 4ODSH 3ZL4L 5ITBH 3INUL 4M8VA 5TDPB 3WIHL 2YKLH 4M5ZL 4P48A 1OL0A 1CXFA 5D1ZD 1DANT 4YHOL 4EDWL 4WHCA 2CJUH 1EUUA 1NC4D 1YJDH 1Q9OA 5IB5A 5KS9F 5C2BH 3MQIA 5MI0C 1HZHL 4XB7A 3MNVA 5GRJL 3K80A 4KTEL 4MB3A 3RVWC 3MRKB 5JTWA 3BVNB 2BY2A 4PRIB 3KNBB 3V8CA 4ONFH 3TPUB 4XC1L 1P7QD 3D2UD 5E2WH 3WIFB 4D0CA 5L7XL 3UAJC 2IFFL 2Z92A 3KPMA 3QDGE 3G6AA 3D9AL 1U8HB 5CJXA 2XY2A 1A2YB 2NYYD 2FIKA 4R2GD 2NR6D 4U3HA 3PWUA 3HCVA 4S1QL 5EU6E 4G7YL 4YGVA 4CMHC 1BD2A 1U2HA 5C0IA 4I8DA 4FQIL 5J1AA 5IFHL 4HIEA 4U6TA 2PO6B 3UTZA 3QISA 2QKIB 3RVTD 3DOSA 4WFED 1OD7A 2IH1B 5JLZB 3D0VA 3PWVB 4LQ1A 1S7SB 5F44A 1W0VB 1BZQK 1WWCA 1Y6MR 5TGBA 1DVFA 4KJWD 1QRND 3Q3GB 4FQHA 3MREB 5EU6D 3QUKA 3QHFL 3CX2A 4KKAD 4ZOEA 1NGXA 3NCJH 1YZZA 4ELMA 1JYVA 3BDYL 4MQ7B 2BDNL 3S37H 4XTRD 5HVWA 2D4FA 1AGDB 1GAFH 3NIGF 5IF0A 4XVUC 4PV8A 1CLYH 1MFEH 1JZ6A 3C60D 1MPAH 4GAFB 4RMSA 1TZHB 2PW2B 4OLVH 3PQYD 3ES6B 1QR1B 1GVIA 1IZJA 1QRNE 3ZDZE 4IM8A 3V7MA 3LV3B 4XVTL 2LAAA 3OXSB 2W9DH 3QEQE 4KKCC 4PJ8B 4NRXB 4U6XA 1CFSA 5FF6B 1E27A 4ODVL 5BXFA 4YHLL 5JW5B 4JZJC 3LRSA 4MNHA 2VR5A 4U1GB 5HYQA 3ZO0A 4LMQE 5JOFA 3LEXA 2CDEB 2IAND 1LO3L 2NTFA 1RIUH 1B6DA 4MA1C 4HKZB 5DJYA 3FQTA 1J8HD 1IC1A 2WSKA 1JWMB 4XNQA 3QH3B 5DURB 1REIA 5CEZE 5TF1H 3VMOA 4OZ4A 1LEIA 4LASH 4TN9A 4HIHA 1J1PL 1CD0A 2QQLL 3MRRA 3VRJA 3Q5OA 4JPKL 3ZKQD 2Z91A 3HI6H 3OQ3B 4P4RB 4HUVA 1Q9KB 4V1DA 1RVFL 1NEZB 4RFNB 5HGHB 3TPKA 1EJ6A 4J6RL 4POYA 1T4KB 2QADB 5L6YL 2VC2H 1DVFB 2EDTA 3U36B 2HFFA 2EYRA 3ARZA 2DQDH 4LLQB 2B4CL 1J8HB 1P4IL 1FCCA 5DI8A 3VCLB 4D8PB 1WEJH 1M1SA 2A83A 1FNLA 1T7XA 3SDXE 5IBLC 1LP9A 5IT2H 1CE6A 1OAYL 4LF3B 3EOTH 3SKNB 4N1CA 15C8L 2F53B 4IRSD 3QEGL 3VXSA 4P5TD 4L8BB 3HZMB 5FCUH 5CCKH 4MXQD 3GKZA 1BD2B 3RGHA 3Q6FB 3QUXA 1FFOB 2DI7A 4YQXL 5KSBE 2PTVA 2E6PA 2MFNA 2VISB 1X5IA 3QDAA 3QXTA 4FQLL 2GJJA 3O6LH 1F4XH 3BE1H 3MLYL 4JFQA 3BP6B 2V2TA 1UWEL 4L4VB 5BOPA 4U1HA 2OL3L 3VG0H 3MLSH 4QHKJ 1NANH 1MFAH 4LLWA 2EKSA 2IMNA 1XGYH 4YUEH 3NFPB 5FYJL 4PLJC 5D1ZB 4Y5YB 4P2RA 4Z7VE 1MCEA 3CVIL 3RIAF 2APXA 2FNBA 1ZE3C 2QHRH 1VB9A 1X3DA 3STBA 5GRVK 3KJ4C 2MQCA 2JB5H 2UZXB 4WHTB 3KAAA 3FCTA 4Z0XB 3N9GH 4P9ML 1QBLH 4QHLA 1R3JB 4URTB 5C0GA 5JW4Q 1BBDL 4L3EB 1I9IH 1JWUB 1NCAL 4MA3B 1BBDH 1DQDH 1P4LA 3UPAA 3L3OB 3DX7A 4K94L 4LHUB 1OY3B 3AS1A 3VDBA 4Z76B 4NPYA 4WEBH 1P1ZA 1S3KH 5EBWA 1CGXA 2C3VB 3STLB 1KOAA 1FP5A 2HJFB 4XNYH 3SE3A 4MNQE 1INEH 3LKQA 4QHMB 1L0YA 4PJIB 3OR7A 3GMLA 2JCCA 1FE8L 5JHDE 1FL6B 3OAYH 4S1RH 4R97C 3QUML 4JZJA 4YHPB 3WE6A 5IQ9B 2D31A 2DI8A 2VQUA 5EU3A 3L6FB 1BGXL 2FEEL 4BKLB 1U93B 2VO5A 1FC1A 3GGWB 2DJ4A 4LCWD 4QF1A 1EAPA 3BQUB 3ISWA 2H2SC 1KJ3H 2PR4L 1UKSA 5DFTA 1MY5A 5EIQA 1Q38A 5D2NE 1A9BB 5E6YA 3LN5B 5HGDB 2HJLA 2AKRA 2WWMC 4DKEH 4AEHL 5F88A 5IWLC 2V7NA 5C0CE 1XMWA 3WO4B 2CRMA 1PYWB 3RVVC 4GXVH 5EUOE 2HT3D 3Q6GH 1JUFA 4NRYB 4S0TD 3SKMA 4KK9D 3V8OA 1IQDB 1F6FB 3OJMB 3VXRA 4LLAA 3OB8A 5DD6A 1RJZB 5BJTB 2J8UB 1BX2B 5IB1B 3BEVB 3AREA 1MJ8L 3TVMC 2DM7A 4O4YL 4O2EB 4YPGB 2GTWB 1QQDB 1J11A 5ESVB 2FJFB 1NC2A 3T8XB 5IUSA 4DZ8B 4FFYL 4D94A 3EYSH 4ORGA 1II4E 1JWMA 1UM4L 2JB6B 2ORBL 3U6RA 3S36L 1GYAA 2W07A 1Z3GL 1OAZL 1F00I 1UJ3C 5HPMB 4LLYA 4JY5L 2WUCH 1H3VA 1ODAA 4KQ3H 1X4XA 1IKFL 1CF8H 3MUZ1 5E9DD 1CIDA 3GBNH 2GY7B 3QHZL 1CQYA 3RWEB 4CW1B 3DUSB 2YPVL 4C56B 5H94B 1C5CL 5A1AA 1CG9B 5CIPB 4X7CC 4X6CB 2R56H 2WWKO 1EZVY 1I7ZA 4LLUB 5ENWA 4R96A 1CBVL 5CHNA 1JF6A 1KCUH 4GQPH 2V2WB 2QBWA 3HPJB 3BHBA 4XP6H 3HRZB 1AGEA 4N0FB 3O2DL 4RA3A 3TCXA 4ZAKD 4MYWB 3G5YA 3MV7D 1UEYA 1JMZA 2B0SL 1Y18A 1ONQA 5LWYH 2ERJC 3LS4L 1UXSB 1DQLH 4XPTL 1W0VA 3UTPE 1JGLL 1HDMB 4Z95H 5LQBL 2KPNA 3TESA 3L5XH 1Q0XH 5I74C 3TZVA 3MMEA 3C6LD 4NDMA 3MUHL 5DD0L 2NLJA 2ZOKA 4ZFOB 2E27H 5CMAA 2FD6H 4NP4L 3QDMB 1GIGL 4PGDA 1X9QA 3G6JE 2YD3A 1WZLA 2A83B 4X98A 1VADA 5B8CA 3TNNA 4Z77B 4PJGF 2VLLA 3LN9A 1QQDA 4YHNB 5E7BA 4H88H 5C3LD 5T3ZD 3BXNA 1G1CA 2DWDB 3G6DL 2J8UA 1P2CB 4OUOA 5ACZA 3T0VA 3F12A 2V5RA 2LVEA 3FQWA 3E1F1 3ZDXF 4O58H 2C1PB 1N8ZB 5F9OL 5E5UB 3C2SA 5AZ2L 2H32B 4QKXB 4W6YB 4WTWA 2WQ8A 3CMOL 5FV1L 4RDQG 3C5ZB 4KHTH 1TJGH 3SY0B 4YFLF 4TNVK 4ZFZB 5CILL 3SDXF 2ZJSL 4WTZG 3HE7B 1IC7L 4K2UL 2E9JA 4M8QB 2X4OA 3NCMA 2H6PA 5E8DL 4DGVL 3UYRL 2PCPB 5IGXL 1YECL 5CBAB 5MERB 3FMGH 2UZIL 4I48B 2QSTA 4I0KA 3PWLA 4LCWA 3JWOH 4M93C 1UFUA 1RU9L 2X4RB 1NDGB 3MLWH 3MJ9L 4JPWL 3QQ9D 5JPMB 4FMFA 4YK4B 2XWJA 3MBXL 1JZ4A 4Z7VB 3ARGC 1WCQA 4L4TD 2DQIL 5E6IC 3SO3C 3VFSB 3BO8B 1B2WL 3V5KB 3QRFM 1EDQA 2B1AL 1U8QB 3CJJA 4I18B 5D1QB 4MJIA 2F5AL 5EIIB 3QULB 4IMLB 2XQBL 3W2DH 3ES6A 2BY1A 3ZYOA 1NEUA 4KUCF 3LN4A 1OGTA 2WP3O 3RL1A 3AAZB 4GKSB 1H3PL 1A14H 2NY3D 2VDMH 3WUWG 1G6RH 4JFDB 2BOBA 2ZP0T 3LKRB 2CMRL 3MLSL 5CSZB 4G7VH 1A1MA 3SDDC 4HT1H 1K4CA 3K2UH 5C9KA 2D3VA 5DJXB 2XKNB 5GIRB 2EE6A 4Z78B 4JM2D 3IVKA 4XVJL 5KG9A 3LKPA 3U2SB 5IMKA 5IK3A 2WMPA 4BJLA 3OKMA 3WJJA 3T1FA 3VFTA 4E0RA 2YOCA 4G6FB 3Q3GA 2XZQL 3MFFB 2FL5B 3IDGB 2R2HB 3L5IA 1MLCB 1D5XB 1S9XB 4KZDL 3L9RA 2DLHA 1MIMH 1IAKA 1EERB 4RAHA 5I8EB 1IGYB 3MLXH 3EYOB 1HHHA 3M17B 3ET9F 3M17A 1FZMA 4EXPX 1YPZF 3P11H 5JIIA 4LLDA 1SBSH 4AEIH 5FB8B 4OJFL 4P2OD 3U4BH 1N4XL 5FA3B 5SV4A 2CO7B 4UTBH 1BVZA 2FH6A 3FT2B 5I9QB 2YRLA 4FFZL 2VDQL 4XZUB 4PGBA 1FSKC 4HMEA 4R6UA 3CFIC 4CVUA 5JORA 3KPRE 2VNCA 4FQJH 3BAEH 3I9GL 1HH6A 1TQBB 3KPOA 4KXZH 5KSBF 2KZWA 2FHBA 3FO1B 1EMTL 1S5IH 3T77A 8FABB 2AGJH 5C0AB 4ORZC 3V0WH 4IIQC 1AGCA 1OT1A 2PF6A 3SOBH 3P11L 3HFMH 1YQVL 2VR4A 3QDGA 5BV7B 3S34L 1RFDH 4WWID 4X7TA 1MFNA 4APQC 3VU2A 3QDME 4OFVA 2EIEA 2A6KB 4C54A 3QEQB 4GG8A 4N90D 4OQTH 3R8BB 4E5XB 4J3OC 4QRRD 2DRUA 4DOHE 1U8QA 1EMTH 4APQD 5EU4A 3UPRA 3KS0J 1R3KA 2I07A 3LPWA 3SCMD 3IAQA 1UXWA 5CKAA 5ID0A 5KVGH 3MV9A 4P23D 1E28A 2YPKB 1UVQA 2HG5B 4PJCE 5IKCA 3MGAA 3NFSL 3QUXC 2HG5A 4OLVL 3PJSA 3ULVH 4NWTL 3VXMB 1MPAL 1CLYL 1MFEL 2NY7H 5EOCL 4KKBD 1I85A 3MOQA 1GAFL 1H3XA 4DZ8A 4XMKL 2A9NL 4GG6A 4XP1L 2NY0C 1NGWB 3TJHC 5JUEH 4ZFZA 4C57C 5F7DA 5I15H 3BIAX 3WMSA 1D9KA 2HFTA 4JLRB 4Z7QF 1EEYA 4CVXB 4EIZC 4PV8B 4YHML 5C0CD 5JDSB 2DDQH 4NQDD 2GK2A 3WN5B 4GMTL 4Y16D 1Z9MA 3U1SL 3GBML 2ICWI 5INCB 4NKDB 1VACA 3OKDB 2QADC 1DVFC 3BWAB 5DD1L 1P2CA 4L3ED 2R8SL 3ULUH 1H9VA 2GJZB 3CDCA 1QLRA 4N8VG 5HI5D 4N8PA 5IEKB 1X6NA 2IALA 3OGCB 4JHAH 2WW8A 4I4WB 1MHEA 3S35H 3ZE1F 4ZTOH 1I9EA 2QSCL 2HT4D 1T20B 3VMPA 1K2DA 1J05B 1L0XA 4R7NB 4NN7C 4X8XA 3IYLW 1R24A 4WFHE 2YEZA 1BM3L 2BHYA 3V52H 3OR6A 1HKFA 1MVFA 4Q58C 1E4XI 5C09B 4D9RE 3VWJB 3UJJH 1QYGH 2I9TB 3VDAA 4JPWH 4F7TA 1IC4L 4JO1H 2NLJB 3GSWA 1I1YB 1A6TB 2DOCA 3KPSD 2FYYA 4HCRL 1LO5A 3H7BA 4KI5E 3M45A 4HWZB 4R9HA 3FHQA 4PTUA 4XBPA 1B6UA 2FJHA 2YA2A 5EC1B 3JV5A 4KGLA 4L8SB 5F71A 4GFTB 1A64A 3I3BA 3RZCC 5C6TH 1RZGB 3OJVC 1VFBA 1WBXB 3EDJA 5MP6L 4ZPTB 4XBGA 2Z31D 3WS6C 12E8H 3O3EB 1MRFH 1A1NB 4E41A 2CK0L 2V5SA 4GKSA 1ETZA 3QCVH 5FECA 4PP2B 2LU4A 2IAMC 5E8OB 4PB9H 5F7LB 4JY4B 3D3VB 3TP4A 3B3IA 3C09B 3WD5L 3B9KD 3GMNA 4ZXBC 5CIPA 4GRLD 1MRDL 4XPGL 2E7LA 4OF0A 3VG9B 4FRWA 2AEIT 4Z5RB 1FN4A 1GGYA 3GJEB 1J18A 4RFEB 5DQDL 1YMMB 3HNVL 3ZKXB 3U0PA 3CFDB 4KZEH 3QXAB 5J6GB 3ECBA 1DE4B 2BVUA 2ZKHL 2E27L 2PXYB 3BEVA 2OM5A 4LQFL 2QTEA 3MV8B 5E6IB 3SO3B 1CLOH 1QLEL 2EH8L 4EQ3A 4A6YH 5DSCB 3LRHA 5ETUB 5DRNA 3O6KL 3TV3H 3G6JB 4L5FH 1JGLH 2HT2D 3B5GA 4QCIB 3O9WD 2ATPA 2DICA 3ARFB 4APQB 3IDJA 3I85A 4APQA 1YUHA 3TVMD 1UM4H 5FYKE 1BOYA 1LDPH 1G6VK 1HYSC 2QADD 3OAUL 4JQIL 5EIVA 5E2JA 1BD2E 3VXPB 2A9ML 2I60L 3QFDB 3HZVB 4G42B 5IVXB 1VDGA 2ZUSA 5FHAH 2YRZA 1UZ8B 3BKCH 2ED8A 2HLAB 3NBNA 2R29L 5HVGB 1CLZL 1S78C 4EN3A 3ZDYE 4GG6B 5I30H 3NFNA 1OF2B 1FNGA 3EYFB 4UAOC 4DEPB 2XA8L 3FB7B 5HYEA 4I13B 1E6JL 4Y4FC 4HKZA 4PJBA 1RIVH 1DJSA 5C0CA 3K46A 1ZAGA 2BERA 4P59H 3TZVB 4LL9A 3F6LA 2J8UF 2XXCB 4J4PA 2FJGB 5CUSL 5DEFB 5JOPD 1T2JA 5GRYA 2Z8RA 3GUTB 2NY6B 5I1HH 1ETZB 2HFEA 4GRMB 5DXWA 1EHLH 2YR3A 4HH8A 4H26A 4JVUA 4N8CL 5B38A 4QHLB 5C0GB 5HHPB 1X5AA 2ID5A 3V0VA 4AMKL 2FCBA 4YDVB 2JJTC 4ZSOB 5JZ7D 4PRHB 5LGJA 2W9EH 2JF1A 1A14L 4JZOA 4LSPL 4QEGA 1FZJA 5FO8A 3IJHA 3EDEA 4Z7UB 1JJUA 2XACC 4I2XE 4M6OL 3UC0L 1U8KA 4M1GH 1J05A 1BVLA 2BHZA 2OXHA 2FX9L 4NBXB 3WKNA 1Z5LA 2EXYD 2HTLD 2VL4A 1FFNB 3L7FA 4K94H 5ALBH 4MCZA 5IVXE 2BSSA 3RHWF 2VH5L 4PJHB 2AABH 4NZUL 4OZGE 3GRWA 2MMXA 5B4MD 2J6EA 3T08A 5GGRB 2NY5L 2HFGL 2BVTA 1CQKA 2ZUQB 1HNGA 1HH9B 5IB2B 4JCMA 1U0QA 3RGVC 3OXRB 5IBTH 4E42A 4FZEH 1FV1B 4HV8B 5IOPB 3Q1SL 5F7KC 1UENA 3FT3A 2ESVE 4S1RL 4OD2B 4NYLB 1CFNA 5AZEL 3KPLB 4IRZH 5A40E 4PV9B 1B4JL 3IDUA 4Q9QL 1B4JH 4WU7A 3ZSSA 4XXDA 3RZWA 1ZGLM 5BS0A 3TA3C 2IBGA 3QT2A 3PHOB 4WRLA 2P4AB 3VRLE 4E41D 1Y0LB 1XF4B 3CCHB 4N0RA 3BE1L 4LHUG 1AI1L 4OUUA 3U46A 1OTTD 3EBAA 2L4OA 1WC7B 4XP5H 1L9MA 2OQJA 1EBPA 4MNQB 1UVQB 4N5UA 2EE9A 4DFIA 5H37H 5E24E 3GJFA 4H88L 1RZKH 5EPMA 3TT3H 2BOBB 3SEPA 4M3KB 2OYPA 1RIHH 1W72H 4HEME 4U49A 4BQ9A 2D03H 2DN7A 3JBG7 1MOEA 2VAJA 4L3EE 3HS0B 3Q5TA 5DMGC 3S5LA 5DD0H 2LU3A 1IAII 2XG4A 4TTDC 4X4XB 5CKGA 5H2BB 3U7YH 5E9DE 5IIEA 2JJVA 1KJMA 3BO8A 1FPTH 1ZTXH 1JGEA 3GK8L 4YBQC 4ODWB 4XB8A 5FXCH 2VE6A 1UXWB 3JVGA 4XCFH 4IOFC 3HB3C 5ERWB 4HBCL 1F42A 1S9WA 4R90L 5IW1A 1UM5H 1A6AB 4M1CD 1HXYB 2GAZB 1TLKA 4Z7QE 4PJHF 5IKCB 5E8NA 3CZFB 1CD8A 5FYLE 4GRWE 2FGWL 3VGEA 3EAKA 4Z76A 4OZGA 1OLZA 4M4PA 5CLWA 3WLWD 4NUGH 1N7ML 4BZ2L 1O7SA 5DTFB 4UB0L 4NO2A 2F58H 3I75A 3L95A 5IJVA 4EOWL 2R69H 2DQDL 3QUZD 2NY2C 4LLDB 2CLZA 5SX5K 4OD1L 5IW6A 4ZXBA 3MPCA 5L0QB 3BGFB 1MWAH 3MOBL 1M7DB 3O8XC 4FXKA 3A67H 3IDGA 1OAUH 3NFPA 3VFWB 2R15A 1JK8B 1LMKA 1E6JH 4MHHG 4NM4L 4W4OC 1BVKB 3IETB 4MJIE 4FTVA 3IGAB 4J4PD 1KEML 3O11B 1G7MA 1MFDH 5MEQB 1S9VB 2E7CA 1CYGA 4JPKH 4Y16B 2WINB 5J7CC 5DUMH 4U4BA 3OKNB 1CGWA 4LSRH 4O4YH 3NA9H 5I8EA 1WIOA 1T7WA 4NJAL 3LPFA 2C4FU 4HIEB 4DN4H 1I3RB 1S7XA 1D5IL 3I75B 2RCSL 3OG4B 4IOFD 4U05A 1KPVA 3I2CL 3PV6B 2ATKA 3TCLB 2VZ1A 3ZDZF 2ED7A 2VXQH 1NMBL 4KKLD 4PLOB 2DQJL 1E4JA 2DMBA 4NZTH 4LSTH 3AY4A 3HNVH 1HKLH 4I4WA 5TH2B 3VXRE 4BUHA 5D8JL 3GHEH 5CJXC 1OARL 5I1KL 2GT9B 1IGCL 4P5MA 1J0ZA 2QHLA 2N7BA 4PBXA 3HAEG 1NBQA 4KTDH 4P2YA 5A16B 4G7YH 4A6YL 3OKMB 2BMKB 4X0KB 3HRZA 1R3LA 4N5EC 1I4FB 1HSAA 2IPKB 2YD6A 3MRMA 1DLFL 4MAYC 2DM2A 4FP8L 4YDVA 5K9JL 1IRAY 4EKXA 1MCHA 4WI3A 2OR9H 3CH1A 3WFZA 5ICZB 1YEFL 4FFVC 3V5KA 4BK5A 1WBZB 3ULSB 3GMOA 4IRZL 2M1KA 4WU5A 4I9WE 3WD5H 1DANU 3QO0B 3K4ZA 3KLSA 3QUYB 4JJ5A 1U91A 4PJ8D 1PG7W 2C7UB 1WC7A 1E4KA 1GGBH 4M6ML 4XHQA 4HFUL 4I2XB 2P8MA 4NKIL 1I9IL 4JVWA 3W5NA 1PG7H 4H20L 1XH3A 1JNJA 1GGIH 1G7LB 4JM2C 3E6HB 1A0QH 1QEWA 4LBEA 4NO5B 1U3ZA 4RMQA 4TTGA 3GKWL 4UUJB 2DIAA 1H3WM 3LVEA 4YWGH 4PGJA 4GBXC 4QOKE 3FB5A 2EDRA 5E2VL 4HDIB 1UYWH 3VE0A 1N8ZA 3O0RH 2OP4L 2OL3B 3QDGB 4Y5XA 5DEZA 2OK0H 3MRBB 4DKDC 4FQ2L 4MJ5B 2E7BA 4EBQL 5F7FA 1G7QB 1BM3H 4ZUWA 1GOHA 2IPUG 4BSWA 4XCEB 3KPOB 4FNLL 5KSUB 5CUSH 5FO7B 3GSNL 3MRHB 4GG6E 2AP2A 3DUUB 3ARFD 5J13C 3ULUE 4B41A 3L6FA 2C1OA 2W0PA 1MUJA 2J8UE 3GMPA 4JFDD 1OAYH 3OAZK 4HK0A 5D7IA 4Z7UA 2PW1A 4PRDB 1AIFB 4U1LB 4R96B 4WWKA 1TIUA 1MCKA 1DQQB 2H41A 1SM3L 2Z8VC 1R0AH 2IBZX 3RDTC 2BVPB 3GFUA 2CH8A 3VRIA 2OR7A 2DD8H 3FJTA 5JXEC 1NCCH 3MACH 4RBPH 3NH7H 2GEEA 4ZD3H 1XF5A 4OQTA 2FX7H 1F6AA 3MLVH 3L3OA 3O4OB 1BQHG 2VOTA 3JTSA 1MHCA 1SY6L 1W8OA 2XWBB 5DLMH 5I18L 1WTLA 2IJ0C 1KCSL 5CD3B 3HA0A 4JO3L 1Z2KA 5IHUH 2Y25A 4ZUUB 4LCWE 3BPCB 5JHDB 1FAIH 2V9QA 2QQLH 4RMWA 5TDNA 3BH9B 3VH8A 3TBWA 1RD6A 1T7VA 4IOIB 4WCYH 5IBUG 1OGTB 3WHE0 4KTDL 4HFWA 1A3LL 3VXMD 3WDJA 3RVUD 1E4XH 1JGUL 3QFJD 3TC9A 4U1MA 1JWSA 3VD5A 3DJ9A 4Y19A 5EZJB 4CADA 1HYRC 1MELA 1V3MA 4OCRH 2VSDA 3I9GH 4M7ZC 1LEGA 4OQTL 4JO2H 5JIHA 1KN2L 5L88L 2YMXL 2NY4B 4NQCB 2G60H 1OGAA 32C2A 1SBSL 4AEIL 2WWMD 1B3JA 3MV8A 5E6IA 2WLYA 4UUJA 3NFNB 2ADGB 5IHBA 1OM3H 4JZJB 2MNUA 2HVKB 4R4FH 2O93L 4X80H 3X14B 3VXOB 5I19H 5KVEL 1A3QA 5JIKA 1X6LA 3DROB 4NJ9L 4XCNA 4D0DA 1OAUL 4UOW1 5JNYA 5D7IE 3VXPA 4PJ9C 3TO2B 1TPXC 1JUFB 5TQ0H 4F3FB 4JAMB 3L3GA 1DEEB 1Y6KR 2BRRH 3GMNB 1IEHA 2VLJB 5K33A 1WWBX 3ZKND 5E8EA 4JLRA 1UQSB 3DURA 3KPNA 1SJHB 2BVOB 4D9RD 2VLLB 2OP4H 3RWIB 3FN9A 3LKQB 4YXLL 3QH3A 3OV6A 1MHPL 1UG9A 4L1HA 3GKWH 4FNLH 4GKZB 3OKOA 4OBSA 4HBCH 1T0MB 4LSVL 3HMXL 2WAHA 4F15C 5DF0A 2R2EB 3K2UL 4L9LB 3MXVH 4KWUA 1F4HA 3DTXB 1NGYA 3T0ED 5EZJA 1RZJH 4N8VB 5C07B 1UXSA 2B2XL 1GGBL 3UXFA 3IDNB 3GSQA 4GXUM 3MA7A 1IT9H 5J89A 1CK0L 4K23L 3EFDH 4R7DB 2XFXA 4WO4B 4K3DH 1IKNA 1I8KA 1ZSDA 3VFVA 1N6QL 2OMNA 1I7ZB 5EUKA 3V4PL 4NCDA 5B21A 4W6WB 2MWCA 5DO2C 4L8SA 4DN3H 1NBZA 3LPGA 4AEFA 4JREC 3RZCA 5D1ZA 5HYJB 4LAQH 5F3BB 4OF6A 1IKNC 5DEGA 5C3TA 1XF5B 1J1XL 4FQQA 1S7XB 3UTTB 2ZCLL 1CN4A 4PY7A 1FYHB 4MXWL 3HLAB 1ZK9A 5IW3A 2GJ6D 1DN2A 3C5JB 1OSZA 3QDJD 3CUPA 2ILLA 2B4CC 1IAKB 1MCOH 3WIFA 5GGTL 1A8JH 1K4DB 3WJLA 1BP3B 4OV5B 2BXZA 4MS8C 2HRLA 1H0DB 4JQVC 4BELD 2JTDA 1ZHBB 1G1YA 1JZ3A 1DCLA 2VABB 3D18A 3W9EB 4FQ1H 4NQEE 3VXMA 3HB3D 3UMTA 1F4WL 5B3NA 3U36A 4UU9A 1BF2A 2GKIA 1FNFA 1S5IL 4Y19D 1VGEL 3AREC 1X5FA 3U0WH 3VXUB 1NGQL 2KQNA 3QRGH 1Q9KA 2VDKL 5EU6A 1GC1L 2A0LD 2GJ6B 5FYLH 2BSRB 4M7LH 1Q0XL 2A6DA 3GNMH 3HAEB 4I0PC 4KK8C 4PJ9A 5EOTB 3MLZH 4KRPD 5F7DB 5EH1A 5JOPE 4XPHH 2ARJB 2CGRH 3VFUB 3EO9L 1KCLA 5C1MB 3TBWB 4PD4K 1D9KC 4ZPVA 1T7YA 1NH6A 1G9NL 5FM8A 3PWJB 5IBUB 2GCYA 3PG2A 2NY4C 1IARB 4JCLA 3RU8H 3HE6B 3S4SB 1FH5L 4KK5C 5J11C 3GIVB 3SKOA 2X9YA 4ZYKB 3LV3A 3AFLA 1CL7H 2NX5B 5D6DA 1WT5C 1J87A 4PRAB 3U46B 3QXDB 3FFCB 5MEOB 4OGYL 1JHTB 5DHYA 1P4LB 3DGGB 3SE8L 2Z8WC 4KMTH 5FECB 1HHJB 4HPOL 1WBZA 2FZ3B 3CFCH 2CGRL 2AK4B 3PL6A 5EG6C 1WUNT 5IJKA 3VRIB 4EOWH 1YNLL 4HKBA 1MCRA 4WVRA 2XWTB 2NXYD 3K4DA 4DW2L 1QA9A 3V5HB 1G6RL 1AD9A 3KPLA 1IKFH 1MRCL 2VTFA 4PJCF 3BP5A 1MHHB 3N85L 3MYJB 4P46D 4J3VA 4HUXA 1WBYB 4YE4H 1T22A 4NNXA 4RMTA 2F5AH 3ARUA 5GISH 2VL5A 1DBML 2NYYC 4A6YB 1VEPA 3BVNA 3EYSL 3S97C 2CSPA 5IK3B 4V1DD 1KB9K 4NQSA 5EU7E 1KIPA 3DV4A 2FO4B 4POZC 2D2OA 1AKJB 3CC5B 5IFAL 1WCBA 2NTSP 2A77H 4HG4J 1U8HA 1C12B 4JRXD 4LEXH 3LB6D 3O45A 1MCOL 4GKOA 4HUMB 1MCJA 4EZMA 1T2QL 1LP9B 2CK2A 5LGHL 2CXKA 4WHYG 5IG7B 4IRSA 4U33A 2ZCLH 4P2OB 3VXSD 5HHPA 4J8RB 1J1XH 3BZDA 2IWGA 3HE6A 4JJHA 1AGFA 4QRSA 4PB9L 1P6AB 4Z18A 1ZLUH 4MVBC 3SKUD 2H1PH 3BP7B 1VACB 1WFUA 2X7LA 3OKDA 4HGWB 4MMXC 4V1DB 4GRWH 3MYJA 3QBTB 1VFUA 5INDB 3WNOA 4E9LA 2DYPD 1FNSL 1TPXB 3S4SA 2VAAA 5ECJE 5JMOC 2BC4B 5DC4B 2VZVA 1T21A 3K3QA 4P2RD 5I1LB 3F5WB 2GJ6A 4N5ED 3HC0B 1OP3H 3UTSB 3R06A 5IBTL 3WEXA 1BREA 3SY0A 3CVIH 3DGGA 3TJEL 3VFNB 3IFOB 4Z7WB 2CLVB 2P7TB 4UQ2B 5FYJH 4EI6A 2O5XL 4KAQL 4KRMB 3BZFA 4JQXA 4LSDA 2NY3B 1JPFA 1VGKA 1ULVA 4PRPA 1KJ2B 2CDEA 5CJ8A 1E6OL 1ZA6B 3EO1A 1BAFL 4G6AC 1KIRB 4JM2B 1J0JA 3HE7C 1E27B 4K8RC 1FNGB 3EYFA 5HYSG 3WFHA 3O2VL 4L29B 4OFYD 5FGBC 1JZ2A 4O2EA 3BN9D 4F2MB 3BX7C 4LSQH 1W72A 3PQYE 5ETUA 1X5ZA 1KBGL 1VENA 1D6VL 4JDZA 4Q6IA 5E99H 3C8HA 3RIFK 2IPTH 1QLFB 2WNGA 4G43B 4R2GB 1CFVL 3WLBB 1GZQB 4TNWF 1SYSA 3MCLH 2ZCKH 4UTAL 2ZNXA 4F7MA 1KTKE 1Y6NR 1SVZA 3O6LL 3SE8H 3C5JA 2FSEB 4NFBA 3L5WB 4MCYB 4OGYH 5TQ0L 2A9MH 3JWDC 1NLBL 3QIBD 3B4NA 4O5LL 3P9LA 3ILPA 5CEZD 4Y2OA 5LCVH 3E2HC 5JORB 2Q20A 3LDBC 1OAZH 5EUKB 1T0NB 4JANA 3SJVD 5IT2L 1BVLB 3BHBB 2D4DA 3CDFA 3O3DB 3WLWC 2VLJE 4FFWC 4RAVA 5C0IB 1MCBA 5KSAB 3QXAA 1U41A 3UBXG 4JB9L 4TNWK 3DGCR 3PL6D 4DVBB 4QHMA 1UJ3A 2A6IA 1YA5A 5GRXG 4MD5B 2NY7L 4LASL 3CVHB 3FFCD 1TZIB 3C6SB 2VXSL 1N64H 1FDLH 1JGVH 3EYQC 1HH9A 3P9MA 1LK3H 2UZYB 4P46A 3QDJE 4TPRL 3D3VA 2OJEB 2X6MA 5C8JB 4Q9RL 5C0EA 1IC5H 3ILQD 3NIDE 4AEHH 5DDHA 5T1LA 2NNAB 1CDCA 2X70B 4X83A 3RWGB 2XWJB 1U8OB 4MZ2A 3SDAB 2Q8BH 1JZ5A 2J4WL 3BKYH 1TVBB 5I9QC 3OKOB 4R8WH 1YNTB 1I8KB 4ZG1A 4YJZL 4N68A 2P8LB 3V7AE 2C1OB 3T0BA 2O61B 1R5WB 3MOAL 1RK0A 1M7XA 1DBBH 5D9SB 4Q7DA 3OKKB 3LQZB 3IS0X 2DAVA 3IDNA 4JO3H 1K5NB 3DXAB 4XWOC 3VW3L 2ZUVA 5DLML 2Y06H 4XP4L 4DCQA 1MRDH 4XPGH 4ZAKA 4GAGL 4K3DL 3OR6B 1S7VB 43C9B 4AG4L 4FFZH 1FGNL 4ONHB 4OM0L 5GRUL 1A6ZA 4KJYA 3KYKH 3MUGA 1TJIL 3G04B 4OIIH 4G80B 4CDHA 2EDJA 3PWLB 4LCWB 1I9RL 3X11B 4HCRH 4RSVA 1EFXB 4XWOD 1ED3A 2CK0H 5DFWH 3X3GH 4NHUB 2QV2A 1ZHLA 2C3HA 3QIUC 1CGSL 1Y0LA 5JIPA 1F90L 1I7RA 2FX8H 4AJ0A 5C6TL 5GRWA 5CSGA 2WP3T 1K8DB 4FTVE 2VZSA 4LSSH 1CL7I 2DS4A 5FO9B 3ZKSD 4Y8AA 4CGTA 1JRHI 1KTRL 2NR6C 4GLRI 4WI9A 5L9DL 2VJXA 5DK2B 1XAUA 3CFJA 5C08A 4QGTA 1CTNA 5DJZA 4LCUA 4NHCH 4CN1A 5TQ2H 2VXUH 5FAAA 3B3IB 1YUHB 1CU4L 4Z8FH 2ZWLT 3QI9D 5TQ2L 4OLZL 3T4AB 1BZ7B 3LQMA 3VRJB 1MCQA 1H8OA 1UYWL 5HHXL 2JK5B 4X6CF 2OTUB 4ZTPH 4X98B 3BH8B 4RISH 1Z5LB 3MNWA 3DLQR 4UAOB 2CIIB 4LCCC 1D6EA 1A0QL 4P57A 1INDL 3D69A 5ILTL 5T33H 4WGWB 2RGSA 3FKUS 5ESAB 4NN6B 1TTFA 1EHXA 1ZLUK 2BMKA 1IL1A 4WIQA 1KPRA 4XP1H 4Y5VA 4QYOA 4NM8H 3SGJC 1ACYH 2A73B 4HWBH 4U1SB 2LQRA 1RZFH 1QFPA 4K9EC 3AUVA 3H9SE 43CAA 2VRAA 5EDXA 1YMMD 1SMOA 2V5MA 3OL2A 5F1SA 1RZIA 4NOFA 5DZLA 3T65B 5K9OB 1I3GL 1TFHA 1OW0C 1S78D 3GBLA 3KVQA 3PIQB 4MD4A 4HPYH 1R24B 1UCBL 2R0WH 1RZKC 4RGNC 3VXSB 1FVEA 4FQPA 4L8DB 3NIGE 4M9PA 3OKEA 3T3PF 3MNWB 5C0FB 4JFEA 3SO5A 1W8NA 4ODXA 2Q86A 3RWIA 1MJUL 4PGEA 2PW1B 2CIKB 1T5WA 5TF1L 1ZV5A 5IEHA 4AY0A 5ADOL 3TLRA 4KPHL 3DX8B 4PP1D 5HI4D 3KR3L 4R0LA 3JWDL 1KXTB 2AV7A 1QRNB 1S7TB 3F58L 4UILH 3RVUC 3MR9A 3EW3B 4QOKA 1J9CT 1SYSB 2X4UB 2YXMA 5GS2D 2AXJA 1KIQB 5SX4H 1PDKA 4KVCL 1VA9A 2DLFL 3G6AB 3JSSA 1A3LH 4P9HC 3EIFA 4LIQH 5T1LD 4OZIB 4Y5XB 4PJ7B 4PBVC 3DVIA 4YFDB 3MV7E 1N4XH 3O6MH 4L1DA 1WT5A 3OKLB 1YC8A 2WWKT 4RNRA 4Z95L 5LQBH 3FQNB 3S37L 3VXRB 4XNQB 2X41A 4MJ2A 2PXYA 3RA7H 4GRLC 4XHJC 2HWZH 4X7SL 1PYWA 1XIWC 5D7JB 3E8UL 4G6KL 3DXAD 2E7MA 3H9HA 1GJIA 4XVUD 1SY6H 5I18H 2DLFH 3Q2CA 4QXTB 2VZUA 4KKBC 3H0TA 5EOCJ 4ELKB 3WKML 1MWAL 4X9GA 4JY6A 3JV6A 4UTBL 2VKWA 1F45A 4HDIA 4XCYA 4UT9H 4YIQB 4BKLA 3F58H 4UILL 1NLDH 4MXVE 4CMMA 5IP4A 4R26H 3MZTA 4G8FB 1KB5H 4UIKH 3ARFC 3RKPA 2BJML 5DMIH 4PJEA 2F5BH 1I8LC 1MIML 2OTPA 2R4RH 3GB7B 2MPAH 4U6YA 1CI5A 5F3HA 5ADPH 1UKTA 4O2CB 2W65A 3SPVA 1KBGH 2XKUA 2B20A 3H42L 3HZYA 1T5XB 4JHWH 4QRRA 5DVNA 4JQVA 1UC6A 3V2AR 1Z6JT 3VXUD 5JOFB 4KROC 1P69B 4DUVA 1DFBL 2VLKB 1CD1A 1GGIL 3J8F7 3RUGA 4P23A 5B39A 4HFUH 5C9JA 1MWAB 4DUXA 1NDMB 1FAKT 4JHZA 3J7HA 4X6DE 5FUOL 5IMMA 4JFQB 2R9HD 3SBWC 4IRSB 4Y5YC 1HEZA 2X1WL 3RL2B 4QNPE 5JZ7C 1UJ3B 3C6LC 5EFIB 2YZ1A 3Q6FA 3LEVH 1W72L 3LMJL 3ZKMD 3WUWA 1UB6A 5JXED 3NCBB 2VIRA 3SDAC 4Q2ZB 4DKEL 2XTLA 1KLUB 4NNXB 3DX8A 1FO0H 2YD4A 5EULV 4DKAA 4Y16A 2X1OA 2I27N 5FYKH 1AXIB 2HAZA 5I66B 1BVKA 4DK6A 3MV01 3G5YB 1QFUL 3RBGA 5K9QI 5DQJA 3V4UL 3SE9H 4M03A 1OWRM 2NZ9C 4K8RD 4BA8A 3JUZA 2F53A 5KVDL 3HUJF 4U31A 4ODUB 4QTIH 4ERSL 1HCVA 5T5FH 5GS0L 2DQJH 1MCSA 4NIKB 4NZTL 2Z93B 5BRZE 1HN1A 1HHJA 1T5XA 1WICA 4XAKD 2P8MB 3QXVA 2ZUTA 3B6SB 1OD9A 3G6JF 3GDBA 5F1KC 3W9DB 3SKJL 3MUY1 1YEIL 3ZDXE 4QOKD 3ZSTA 3ARGD 2P5WB 4K3JL 2QHRL 3FB7A 4LSTL 5GJTL 4AG4H 4G6JL 1D5ZB 1I7UB 3DV6B 4UINH 2Q6WA 5HVFB 1KJMB 5I0ZA 3MRFB 3D0LB 4K3HA 3BKML 5T1MB 2XNAA 3I6KB 3RUGE 3HC4H 5KW9L 4NUJB 4P5TB 3CMGA 3TO4A 2GTZB 3LKOA 4NJAH 4AZ8A 5GQBA 4X6DA 2UUDH 1RHFA 2R0ZL 3U9UA 3NTCL 1NPUA 3DETC 4OFKA 4P3WA 5HHOA 4ZFGL 1MREL 3GSNB 3BWUC 4U6HB 3LKSA 3QUYC 4LCCB 1CGTA 3OMZA 4MNHB 5IB3B 2RIKA 4J1UA 1ZHNA 3M8OH 4H0IA 2VQTA 1K4DA 2OTWB 1YC7A 4XNUH 4OCNC 4I48A 1U8NA 2APTA 1YPZA 5J06A 2APVA 2O5ZH 2NY0B 2X4PB 3PWNB 1G9NH 3HZKB 3B2VH 1ZOXA 1JIBA 1AGDA 3HLAA 3O6FD 4ZQKB 3MRGB 4JPVH 3THML 5D93C 1T7ZA 3BKCL 2VXTL 3MCLL 5CD5D 4H25B 1PKQB 4PV9A 3ARSA 1IGIL 3X13B 5AEAA 2XZAL 2WINA 3WIIH 1A7OL 2WBKA 2YSSA 1YYMH 3UX9B 1LDPL 5J13B 4OTXH 4WI4A 3QPQD 5DYOA 2V2XB 4L8CA 5CD5C 4YBLC 5DK0B 3B9AA 4R4BA 3X12B 1RZKL 3JV0A 2VLMD 5DVLA 2N56A 3U2SA 5EO1B 4M43L 4PGCB 5I74B 1JYNA 4NQEA 5JHLL 4XP5L 1X4YA 1HINL 1U92B 1A1MB 2VLKD 2ZKHH 5FUZH 3RVWD 3VFRB 4I3RH 3OXRA 3MODH 3ZT6A 1MCNA 3QIUD 6FABL 5DTFA 3MMEB 4GXVL 3VWJC 3WYRA 2A38A 3ORJA 2YXFA 5ANME 5JXEA 3JTSB 5GGRA 1CFVH 1ZWIB 4BH8A 3KXFD 4YC2B 2E8ZA 3IU4L 3RDTD 5I0DA 3HAEH 4NNPH 3WFDH 4NKOA 5SWZB 4H26B 4MDJA 3CX5J 2G75A 3SDYL 4WWKC 1MCDA 4QTHB 1RHHA 4DTGL 1QSFB 3V6BR 1M4KA 3SPVB 2CDFB 3SKJH 4MDIB 1H3TA 3G08A 1CDHA 4IDJH 3IDYC 5JA8B 1MRFL 5H2BA 3F8UB 4KUZL 3DURB 5CHNB 4K55A 3CXDH 2X44D 1PX4A 4LF3A 1YEGL 3F7YB 1BOGB 3PNWB 2MOVA 4G6AD 5JQ6L 3TJEH 3D3VE 4HS3B 1KCRH 3EO0A 2BCKB 5BV7C 5DK2A 4ERSH 2DIBA 2G9HA 4XAWH 3NABL 3E0GA 1WFOA 4D0DB 2W0KA 5E8EB 2IH3B 5DFVC 4EI5A 4M93B 2CO6B 5HY9B 1CGUA 4JO1L 1BIIA 5AUMA 4CN4A 1CXKA 4RMVA 4ELMF 1DLHA 4QXUH 1FYTB 3UEZA 2A6JB 3ARDC 4DVRH 5DJDA 2VWEC 3ARGA 1KGCE 4YHPA 3WE6B 4Z7VF 4KI1A 4YHYC 2CD0A 1B90A 5FCUL 3VH8G 2I26N 1E4KC 3DECA 2QQNH 2Q1EA 1A4JB 4JDVA 5C0RL 3O6FC 1KIRA 5GXBB 5LXGL 1QFWH 2F74A 5GHWL 5C09E 4WNQA 5BS0D 5DVMA 2X4UA 4J3WA 5KAQF 3ULVF 1JV5B 4HS8L 1NBVH 5KVFH 1N5YH 4HSQA 2PTTB 4P99A 4EI6B 2H26A 5T1DL 4C83A 1IBGH 4WEUD 4QCIA 1R5WA 4ZAKB 1T6VN 3N06B 4PY8J 4OSUH 4Y19B 3PDGA 4HLZH 1CL7L 5EWIH 2CPCA 1KB9J 3P4LA 4PREA 1YN6A 2JCCE 4OIBA 3TYFB 1LP9F 1CIUA 3ZTJG 2NXZD 2P5WA 5GISL 2COQA 4JKMA 3H3PL 1SEBB 5C0BB 5DC0A 4KMLB 2V2WA 1ZHKB 3IDMB 3LEXB 4NO0D 1Q9WB 1AJ7H 5D7LD 3OR7B 4XPHL 1ZLVK 3MBEC 3VXQA 1B9ZA 4YAQA 3AB0C 5D6CB 1WBXA 4L3AA 2MKLC 3ULVL 3D25A 4PJGB 3JUYA 2W38A 2FLBT 1S9YB 1RVFH 5DR5H 1BWWA 4ENEC 2WANA 1SJXA 4PG2A 1RIUL 1TZHA 2P44B 5HHME 1MAJA 3QFJB 4ISVA 4DFHA 5FV2A 4R7NA 3B5TA 4E41B 2XQYK 3WFBH 5I1CH 3TIEB 2B1HH 1FH5H 3RU8L 4NNYB 1S7UA 3F7QA 1YY9D 3TN0C 2FJFA 4W4OA 3ILPB 3C8DA 1KCVH 1IM9A 2AJVL 5JO5A 1RZ8B 4ZXBD 4D9LL 5IHUL 1T3FB 5DJ8B 1WBYA 1DBJH 1F4AA 3CNKA 3DMMA 3ZTNL 3NCYP 5TPWH 3U48A 3BKMH 5E4IA 2FSEA 3HCVB 4KRPC 3U79A 4PLKC 3MRBA 4G3YL 1SYVB 5KSVA 1F8TH 1NMCB 5GGVL 2DQHL 2Z31C 2XWTA 4KHXH 4OBRA 1IFHL 2EYTA 3LN5A 5HGDA 1LNUB 4XNXL 5C0AE 3LS5L 3VWKD 3DVGB 4LK4A 3HG1B 3WL9A 2GK0B 5ADOH 4D2NA 1CT8A 1F3DJ 4NWUH 3MJ8A 3M07A 3ROOA 3H8NA 1DE4A 1GGUA 3U9UB 5F7HA 4O02H 4NC2B 4QO1A 1MVUB 3WFHB 5DGQA 5L7XH 2Y23A 1NAKH 4FG6D 5J56B 1TXKA 3P4NA 3K0WA 2GCYB 5IB3A 2G9HB 4X5WB 4LKCB 2HLFC 4TUJA 3BT2H 3S96B 3MZGB 2EEAA 1CICC 4YX2H 1IT9L 3D0LA 4FQXC 1T1ZA 3OPZL 4WUUB 3HC0A 4FQIH 1TTUA 4CVZB 3OKKA 1QSZA 5CINH 3RVVD 1T03H 4XH2A 2Z9TA 4XX1G 1D9KB 4MA3A 2VDML 3WEXB 1EGJL 1DSFH 2Y6SD 2B39A 2AJXH 1ZA3A 1JHKL 1P5VA 4IOSD 2IQAB 4DGYH 5TE6H 1H5BA 5E5MA 1CXEA 5HI5C 3GM8A 3S5LG 2DQCH 3KYOA 4LU5L 2D7OA 5HYSB 4QHNA 5CEZL 5DJYB 2QQQA 3HE6C 1UH4A 2YPKA 4U1KB 1IQWL 1J1OH 4HF5H 4RISL 3VJ6B 1V7MH 5DWUH 3D0VB 5A16A 2GK0A 1XF4A 5HGAB 3Q0HA 4IRSC 3ELAT 4C4KT 4XP9L 3BSZH 5E94B 1HWGB 1DUYA 5FOBA 3FFDB 4CU7A 3VWJA 4HJGA 4BQBA 4CMHB 3MRCB 1P84J 1WCBB 2ZSVA 1VSCA 4XP4H 3HE7D 4TUOA 3IJYA 2Z92B 3KPMB 3QNYB 3BMWA 4ZS6C 5I19L 2P5WD 3HZMA 3TT1H 4ZDHA 3QG7L 5IM7A 3EYUH 1CGVA 4QRRE 4R4FL 4KHTL 5K9JH 4YXKL 4PJFE 2IANA 5J12C 3FTGA 3IDXL 2ZOLB 5F8QC 4FABL 3QA3A 3DI2B 1GZPB 1J8HA 4O58L 4NQSB 1B88A 2AXGA 2HLFD 1EVUA 4YZFF 3O11A 3L5WA 3BGMB 1U9KA 3U4AA 3UTQB 2Y7QB 5KVGL 1U6AH 3DBXA 3AROA 3MBEB 4LHQB 5BMFL 4AEEA 1SMAA 3PWPB 1DUYB 3L3JB 1MCFA 4Q9RH 2YD9A 2D7NA 5D96B 4MJ6A 5EO9B 4TTDD 3WLBA 5D70H 4YXHL 3CLEL 2X5PA 3T1WA 1AC0A 3FAWA 1WWWX 3RHWK 2ZSVB 1R3HB 2RBLA 3PXHA 1JGVL 5DT1H 4MVBD 4JFDA 2VXSH 5FOBB 4NWUL 1R5IA 4F7EB 4U7KA 1RUMH 1J10A 4HIXH 1DBBL 5D6DC 4YAQB 3BD3A 4LPYA 3RP1A 2X9WA 3AS0A 3V0WL 4G8GD 4U1KA 3LS4H 3RIFF 4XRCA 5BZDA 4ZOCA 5C0BA 5TE7H 4S11A 2WBJB 5DJAA 3TN0B 1H5BC 2Q8BL 1I1AA 4XPBL 4EUPG 1KCSH 1OTTC 1TDQA 3GEWB 3KDMA 5MERA 4YHKH 1VKXB 3LB6C 2XZQH 3RX8A 5KANI 4O2CA 4P5TA 2W0FA 5TPWL 1OF2A 1T83C 2NX5D 2UVFA 5E00A 4NQUA 5BQ7B 3L7EB 2GSIB 2BSED 2HKHL 3NH7L 1IGML 3L7EA 4MXVF 3MACL 1CBVH 1LNUA 3V6OC 3NA4A 4B0MM 2FECI 1FG2B 1SEQH 2DTSA 3KLDA 1AD0B 4Z7OE 4IDLA 2H26B 1NFDA 4I18A 2YPVH 1ZLSL 4KPHH 4DEPC 4F3FA 4LLMA 4JY6B 3MGOB 1AY1L 1FIGH 4C4KO 1ORSA 1UA6L 5JR1L 3KG5A 3NACH 4F9LA 1FAIL 2YPLE 5IHZA 1BMGA 2DB8A 1RZ8A 2EDXA 1OSPH 3AXLB 2H32A 2VDNH 1Z3GH 5D7JA 3D87B 2X4TB 2IANE 5AYQA 1TETH 3T4YA 1PKOA 3HKFA 1KTDB 4HXAL 2XKSA 3FRPA 1R5VB 5E08L 3QDMA 1T04A 5IQ9A 2HVJB 1A3RL 3VFMB 4LDEB 4PJDB 1OGAD 5CAYB 1XGTA 2XT1B 3MGTA 3V95A 3FO0H 4AT6A 5E03A 4JFYB 1H8SA 1R0AL 1OSZB 1Q0YH 5D7KE 5TF0A 5I1GL 2OSLA 3P4MB 2P8PB 3ALWA 3QZWB 3FT3B 1WJ3A 3UDWC 4CADB 5HI3D 3RQ3A 4FQQB 3LDBB 3UTTA 1NUNB 2APFA 4WJ5A 2BY0A 5DS8B 2VWEE 4UI2A 1D6VH 3DRQB 4F7PB 1GGCH 3TIEA 2FB4L 5DUPH 1OGAE 1YPZE 2R0KL 4L8DA 3CMOH 5T3ZL 1KJ3L 1PQZB 1QNZL 2ZUQC 2EDDA 1FGVL 4KJWC 1XCQB 2GQHA 2X70A 1SBBA 1ES0A 3ZKMC 5KVFL 1YECH 3EOAA 4UV7L 5I6XB 3UYRH 2VLRE 4NKMB 1S5HA 4DGVH 1UJTA 1U8JB 2H9GA 3EFFA 1BFVL 1RUPH 4NHCL 4ONGH 5SWZA 3FT4B 1EEQA 3TBYA 5D6CA 1TJGL 3FB8B 3U7WH 2VQ1B 5A2IH 1K6QL 5HVHC 5HPMA 5MENB 1WIPA 4MQSB 5FYKD 5JQ6H 3RI5K 5L8KB 3NCFB 5KOVC 1MLBA 4NKIH 1F11B 3WXWH 1AGEB 3GJFK 5GRVL 1NC2D 1EK3A 1X7QA 1PQZA 4F9LC 4OI8A 4M6NL 3CDYA 4LEOB 1BX2A 1IFHH 4HIJA 3C5ZD 4ZS7H 1I8LA 1A5FL 1HSBB 2FX9H 4ZNEE 2IBZY 2OTUA 1PFCA 2RCSH 2P46B 3O81A 3A6CL 1J8KA 1E0OB 2F54E 1DBJL 4ZOBA 4D9LH 5ID1A 2HJLB 1LE5A 4PJDA 4M7ZB 3LD8C 5HHMB 1AR2A 1YYLH 3ARGB 3UZQA 4FQLH 4R8WL 1D7FA 25C8H 2ADIB 1K3IA 5IFAH 3ZYJA 5C0BD 1IEBB 3MV11 4G5ZL 4OLWH 2BNRD 3IDJB 4DJMA 3RGVD 3G5ZA 1S7WA 3BXNB 2W60B 3QEGH 1EFXA 1VPOL 2RQ8A 3O6FB 1I85C 3HNTH 4XMLL 3H3KA 1V3JA 5ICXA 1HQ4B 4QRUA 2KBGA 3VA2C 2VZOA 3RI5F 2OMBA 3OB0K 3VI4E 3FHAA 1IGJA 5BZWA 5KSBB 2HTLC 1V05A 2DM3A 2WUBH 1AQKL 1QZ1A 4N0CD 2JCCB 3BGFC 3GBNL 2BNQA 2K7PA 3LRSB 3NA9L 5F72S 2F53E 1WWAX 5I75B 1ZT1A 4XPAH 1NBYA 4DCQB 4LCYA 1NBZB 3QRGL 1YDPB 3DVNA 5EBWB 5J12B 2CKBL 1NMAH 1EAPB 4MGXA 4NC1C 2KUTA 1UACL 5D71L 4CVWA 4JFEB 2L7JA 3O4LE 3T2NL 4K9EH 4Y2DA 1MEXL 5DC9B 3OBAA 1FL6A 2PYEE 5C07D 1OVZA 1CVSC 1MIEL 5SX5H 3QG6A 1AGFB 1KIUA 3THMH 3FQRA 4LRIC 5IVOA 3OJDA 2P48B 3C87A 1IILE 4OZHE 1CDUA 1LE9A 1NGYB 1RIHL 3ARVA 1KB5A 2ERJB 3PWVA 1FE8H 3DX7B 5LXGH 4XMPH 1JYWA 1KPUB 3UBXA 3HC4L 2ATKB 3TCLA 2X10A 4MSWA 5AAWA 1P53A 1QSED 2F54A 2W1NA 4PBWD 3A6BH 4M1DL 4PR5A 5F9AC 1GRWA 4WEBL 7CGTA 4DVRL 4R90H 3MYZA 4PJ7F 1YYLL 1C16B 2EXWD 4O51A 2BDNH 5D2NC 3FRUA 5ITFA 3LEYH 3O2WH 4HK3N 3BN9C 2DKSA 2IADB 1QLRB 3GSXB 3JWOC 5SWZD 5DD6B 3KNBA 3VFWA 4NRZB 2FEDD 5GZND 3NABH 2F19L 3KPSE 5IFJA 2V2TB 4PP1C 5HI4C 1YNKL 4HH9B 1YNKH 2D7MA 5T5FL 5GS0H 1TENA 2F19H 5IMOB 4HS6A 3TYGH 1AGBA 1BZ9B 1JP5A 2MSPA 3PL6C 5GJSL 1HEZB 4DAGH 5EZLB 1YEGH 4NUJA 5E56A 3VXTB 4L8BA 5FCSH 5F21B 5BQ7A 1WIUA 2P24B 3UJTL 4FG6C 2VH5H 4MX7B 1KENL 4OZ4B 1LEIB 3LN4B 4JM2A 3V52L 3BZEA 1LO2L 3R0MA 4YFEA 4U6HA 2A1WL 2OBGA 4X9FA 5D1QA 2ZZUT 1VGKB 3IT8D 3A6BL 4M1DH 1EXUB 1XH3B 3B6SA 4DKFL 4ZTOL 2LAGB 4NNPL 3FZUD 2X1QA 1NFDF 1KN4L 1T2QH 5KAQG 3EO0B 4Y7MA 2XIDA 5FKAB 4OD3L 1VERA 4OZFA 3T04D 4N8CH 1CK0H 1OTSD 5DD1H 3PNWA 2PO6D 1U3HD 2Q76A 1HE7A 4ZUVB 2HFGH 2BSRA 1JTTA 5E8OA 2AERT 4CNIA 3T2OA 4YQXH 1JPGA 4M61A 5IBLD 2BNRA 4AL8L 4PRIE 4ELMB 1BQUA 4HIHB 2IAMA 1A1NA 1I3VA 3DV6A 1ZT4B 5EPMB 3D85A 2NNAA 4G8IB 3F6IA 2RHEA 4IJ3C 3ROLB 3TN0A 3NZHL 2CKBH 5TH2A 1IAOA 1JPST 2M26A 3BP7A 4NRZA 3FQNA 4KMQA 3GSVB 3D39A 4MA8H 2W9EL 2YC1A 2IG2H 4RMUA 3WBDA 1S8DB 2BNQD 2EIZB 5FA3A 5B8CC 4JKKA 3MJ6A 3QEHA 2CQVA 3IS1X 4YHNA 1JN6A 3VI3F 3QNYA 2AK4D 5TFSL 5FGCB 5HD8C 2VYRE 1AGBB 1BZ9A 3GHBH 1DDHA 1W2KT 4FOMA 1AIFA 1JPSL 5CWSB 5HDBF 5DMYA 4XMLH 1MFBL 1A6WL 1G7MB 1I3RA 1FLTX 3TV3L 1CVRA 3O6KH 3NACL 1QRNA 3MV9D 3DRQA 1P7KA 2FIKB 3DHJA 1EJOH 3GSXA 2C3WA 5DMIL 1CLOL 1CTOA 4Q0XL 4ZUWB 3ME0A 3OJDB 3QA3B 1G7QA 3SOBL 3FOLA 4XWGH 2Q86B 4LCIL 1TNNA 1ZEAL 3VD4A 2P42B 3GSUA 1EEZB 3AM8A 1ROWA 3PQYA 4XHJD 5JXAL 1PEWA 2OZ4H 3QIBA 4ODVH 3QZWG 3L5HA 1GC1H 3MLUL 2FRGP 3HPJA 5E6ZA 5ISZB 2DWEB 7FABL 2EYSA 4U7MA 4Z78A 5GS0C 4ISVB 4YHKL 2V17H 4K3EH 4XGZA 1RZIB 4A2MA 5IMMB 2ZSWB 4BM7A 5L2JB 1YDPA 4YH6A 3KLAB 2C4FT 4HIXL 5DA0B 4KFZC 4I5BB 3X3FH 1VKXA 4U7SA 1G7JA 4U6YB 4LIQL 4FHBD 5J4MA 1HNFA 5HHOB 4RGNE 4JJ5B 5GGTH 4WI7A 1R3IL 2PCPA 3BH8A 1QBMH 1FG2A 4CBPA 2DYPB 3HPLB 3DARA 1QBBA 5EU4B 4UBDD 2XNAB 4YBHA 3KPQA 1UCBH 3SE4C 4RQQB 3VXTA 1UH2A 4N0YL 1HK6A 3VRLF 3G5XB 5IB1A 5DRWB 4LDOB 4LPCA 4ZD3L 4EVNA 2X4QA 1FNEA 2W9LA 1RZFL 2C1PA 3CFBB 1LHZA 4G9FA 3KYMB 3O4LD 1G7IB 4HQQL 1J1OL 1IGFL 4WV1A 4HUUB 5IVZB 4HZLB 3A0OA 2V9TA 2DKMA 2R0WL 3RPIA 4P5KA 4U6VL 5D4QA 4OM1L 2X42A 3EUUA 2D9QB 1S7SA 1EBAA 2ENYA 1IEBA 1YJDL 5C0FA 5FGRA 5FYJU 5LBSL 1A7RH 2PO6A 1QPPA 1U3HA 2EDBA 4FMKA 1TITA 4PFEA 1A7RL 3NPSB 3PWPA 5J11B 4OLZH 3TH2T 3QWRD 4HX1B 1MCWW 3B9KA 4X6FA 4NFDA 4YDJA 4HF5L 1MI5D 5HYFA 1OLLA 4U3XA 3D85D 3NOIA 4PJEF 5L9DH 1KT2A 2R4SL 1FVDA 4JFHE 4DGYL 3RIAK 1T1YA 4NBYB 5C08D 1DP0A 3IXTB 2JKXA 3N1MC 2YD7A 1PD6A 1J0HA 1ADQL 1T5WB 2NXZB 5ITFB 5HDQL 4R7DA 2AQ3A 1T03L 1UM6H 4M6MH 3QI9A 2XZCH 4R26L 3BW9A 3PP3H 1NLDL 1OARH 2SEBB 3D48R 5J1TC 1I9RH 3KJ4B 3RTQA 3PHQB 3W0WB 3O9WA 5FM5M 2BNRB 5C9JB 3IRZA 3FQUB 3C09C 4MJ4A 3GUTA 5C08E 1RJLA 4L4TB 2R1XA 5CP3H 3SQOL 3H9YA 2ICEB 4UZGA 2OI9C 3VW3H 2FX8L 3MLUH 4WUUA 4X80L 3KPPB 4V2BA 3ULUF 3P77B 3DUSA 4J4PC 1J5OH 1A6AA 3ZKXC 3DTXA 3P0YL 4PJGA 1LILA 5DZNA 3LQAL 3KXFB 3MLRH 3NZ8A 3BI9X 2UWEE 2VLJD 3LZFH 4Q0XH 3H9ZA 2IQAA 3RWJB 2G60L 1NUFA 1RUML 4PJEB 2J4WH 3BKYL 3KPNB 3HC3H 4P2OC 3X12A 4R4BB 3EGSB 4PY8I 4V2CB 1F02I 4BZYA 2CUIA 3VFGH 3PUCA 3HMXA 4PYHA 5J3HD 4JFOA 1X5GA 4YPGA 2IALB 1KLGB 1SJHA 3D5OF 3QNZA 4X5WA 1BJ1J 2J5LC 5EUOF 4ALAL 4QXTA 4EI5B 4PIRF 2R69L 3EHBC 1UB5B 4LAJH 2F58L 4UB0H 4DGIL 5D1XD 4YDKL 3ULVC 5GGSB 5I1CL 3GO1L 5F88B 4X4YB 1AD0A 4K07A 2BHUA 4XBEL 2Q7YA 1IC5L 1FVCA 2NCMA 3HMWL 5ALCL 1OOAA 3IXAB 1YNTA 1MNUH 1UWXK 3TVMB 2R23A 4HUWB 1QSEB 5AD0B 5HHQA 2CDFA 5F7MC 2C26A 3BYTA 3GSNA 3U7YL 4S2SB 5DJAB 1JPFB 3WDHA 1K5NA 3F62A 2DD8L 2NTFB 3RWHA 5M95B 1RV6X 2W91A 5CJOH 1M05B 4OD1H 4HJ0C 1OAQH 1NFDB 4WDIA 2EIBA 4Y4FB 5HHMD 5E2UL 4HWBL 2I9LA 3CU1A 1I7TB 2VB5A 5F3BA 5JO5B 3QIBC 3FONB 1XIWD 2H32H 2XQBH 3DXAA 3HNTL 4UNUA 1U8JA 2ZUUA 1F3RB 5D2LB 5GS3A 2AJZA 2BC4A 5EWIL 1WSST 2UYLA 4Y1AB 2A6IB 3MV7A 4Y16C 5F70A 3WS6A 4JHBA 3ZE2F 3IDMA 1KYOK 3AB0B 25C8L 3DSNA 2XG5A 4PS4L 4P2RB 4Y2DB 5TDNB 1VFMA 4Y8DC 3SDCC 3TFKD 5T1LB 1CU4H 3BGMA 3TZVD 1S9YA 4X6BB 3C6LA 2P5EA 3C8KA 4GOSA 4HJ0D 1F58H 2ZOLA 4ODUA 1XF1A 2I9LB 4F58H 5KSAC 1A7QH 1IL1B 4HUKB 1FRGL 4WTXA 4LVHC 2PTTA 1XGTB 3O2VH 5DGRA 2EDFA 1OPGH 4Z7UF 3D6GA 2HTKD 4WI5A 5F7EH 3PWUB 4KY1H 2XN9A 3QXUA 4GQ9H 1DDHB 3AS2A 4HWEL