3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
b'QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
1X5HA 5F7NC 1HILB 1RJZB 4MHHG 2W91A 1TJIL 1U95B 2Y5TB 1QZ1A 3QP3A 4X6DB 3TO4B 2O5YH 4HUKB 2BY2A 4ONGH 1NUGA 2VLLA 5D7SH 1JNHA 1R3IH 3LEYL 1OAUH 3UBXB 2J88H 3VXOB 5IFHH 1S9KC 1CR9H 1EEZA 3ZT7A 1FIEA 5JNYA 1OCWH 3H9SA 1EJOL 3NN8A 1ITCA 1RHHB 3LSOB 5T33L 1UA6L 3O0RH 4RZCB 4X4ZA 4YK4C 5ALCL 4FZ8L 4JN1L 4RMQA 3PUCA 1A4KA 1NCDH 2ID5A 5ERWB 4XTRD 1SY6H 4EI6B 5H35B 2FZ3B 2Y36H 4YXLH 4PRAB 5CEZE 4W6WB 1CD8A 1MFBL 2GK0B 4ZUTB 5IIEB 1I85A 4HH9A 5I1JL 5FGCB 1J8HA 2CKBH 4ELMA 1A22B 4HPOL 4FS0A 4OLZH 3UC0L 1F4YH 3DX8A 2BVOB 4YDIH 5EIQA 5L2KD 1OTUC 1A9BA 4GRWB 5F3HB 3QWOA 5C0GB 4XAWH 2X4SB 4PRNA 4XC1L 2F54B 3QDME 2CLVB 4R8WL 4F7MA 5LKNA 5T5FL 4ISVA 1OP5H 3TBSA 5ACMA 2R0WL 3F8UB 1IKFL 3RA7L 4FNLH 4NPYA 2FX8H 3DETC 5D70H 1OPGH 2HVJA 2KQNA 2Z0BA 3RVUD 4KQ4H 4YDVB 1N6QH 4MD5A 3E2HB 4NKQB 4HC1A 5JLZA 1SM3L 1QTYT 3DARA 4X6CF 4O58L 5E2JA 5ESAA 2DBLL 2KKQA 2VXTH 5D71H 4L4TD 3QUMA 5C9JB 5I8OL 5I15H 4LCCA 2ZSWB 3P4OA 5KTEL 1KJ2L 2I60H 4JM2D 5AAWA 1RIUH 4M62H 5D9SA 1TZHB 12E8H 1UXWB 2G5BB 4HK3N 2O5XH 1OGAA 5ETUB 1U9KA 1JNJA 5IEKA 3RWJB 4PGEB 1JHLH 5I0ZA 1IL1A 1XZ0B 3IDIA 3MTRA 3T77B 5CGYD 2CK2A 3F7QA 4X83A 5DQ9A 3AS3A 1AO7D 4I13B 2R1XB 3L3IB 2H32H 3VXUA 3T0EB 4F2MB 4WO4D 1LWRA 4HXAL 1UKTA 1S9YB 3ZT6A 1AE6L 2DQJL 5HGAA 3AGVA 2OJZL 4N8PA 2B5IC 2E6PA 4PJBB 3ZKMD 4KK9D 4MMXC 5BW7A 4G3YL 4F15C 3N1FC 4NHUB 4ODVL 3SGJA 2RCSL 4UV7L 5TDPA 4Z7UF 4BQ6A 5EO0B 1KJMA 3FZUC 1QHOA 3LN9A 1SJHA 3V0VB 5JHLH 1NEZA 1U8HA 4EDWH 3FRUB 3OR6B 5F89B 1ODAA 3RTQD 1YEIL 4MAUH 4RCAA 1XH3A 1I8MA 4HJ0C 1S7SA 4GW1B 1S3KH 5CMAB 2ICWI 4IRSC 3GHEL 4RRPA 2YN3A 3GIVB 5E2WH 5FA4A 4DZ8B 3FTGB 3G08B 1MVFA 2A9ML 1DZBA 1OL0A 2PYFB 5D1ZB 2IGFL 5GZND 4WY7L 1YNLH 4MNGE 3LDBB 2FBJH 1HDMB 3O6FB 2VLME 2IAMA 1TVBA 4GXUM 2HRLA 3SKJL 1JTPA 3VDAA 5DLML 1YNTA 2NY0D 4QRSB 3VRIB 4KKLC 3PGFH 5CKGA 4K7FA 4M3KB 3WXVH 1N4XH 3NA4A 1AXSA 1MCWW 4JFDD 2DLTA 1PAMA 5HI3D 1UM6L 3T08A 2R2CA 5C07D 1CGSL 4PRDA 4XMLH 1T5WA 4XVUD 2IG2H 4P9ML 4JDVB 5F1IA 2WAHA 1I8KB 1XCTA 3FT3A 4JZJB 3UAJD 5B39A 4WFGE 2XQBL 4XWGL 4U05A 4JLRB 3H9HA 2MMXA 4IJ3B 3UJJH 5I19H 1A7RL 2HTLD 5J8OA 3A0OA 3G5XA 4NQED 5DQJA 2X1QA 5F6HI 4XBPB 4QY8A 2XY1A 3MV7B 3NAAH 1INEL 3VWKD 2X44D 3LPWA 5T1MA 1X5FA 2Q1EA 1AGBA 4X6DE 5IFJB 3MJ9L 2W0LA 2R0ZH 2WBJD 3QCUL 4UQ2B 2CIKA 3TBVB 4NO0A 2VC2L 4M8QA 2Q8BH 4J3SA 3WFZA 4RQQA 4LRNL 1Q1JH 1AFVL 2OTUA 3BVNB 4J8RA 1T6VN 2D7TH 2DOCA 3V6ZB 2R1YA 2UUDH 2AEQH 4JFPB 1BEYH 1WC7B 3MBXH 1ZTXL 2JELL 5IB3B 2O61B 1N0LA 4WHCA 1RUAL 4WDIB 3GI9H 1KJ2A 4LLUA 3WNMA 3QJFB 3SE9L 4HWEL 2IAMC 1UEMA 5DJAA 3TJHD 1JF6A 5BS0B 4WI2A 4UAOC 4MAYA 1A64A 2X10A 1HI6A 2XV6B 4Y19B 4HCRL 3K8KA 2YOCA 4PB0L 1EGJH 1FFOA 2ICEA 5F3BA 4JVPA 5DD6A 1CFBA 2BNQB 2RIKA 1Q94A 5FGCE 3WE6B 1BQUA 2YZ1A 5IROA 1C5BL 4N68A 5HVFB 5DMIH 4KH2A 2CDFA 5DDHB 43CAA 5IM7B 1W0VA 3RY5A 5I1KH 4F37F 5IKCB 4KRPB 4H0HB 3L5WA 4FQIL 2P7TA 3LQAH 5K93A 5J11C 1JWUA 3ALXA 2AV1A 4MS8D 2F54E 3NCEB 5FAAA 1VADB 2IFGA 4EVNA 3K74B 3V2AR 1HEZB 3EYUL 1QPXA 2NXYB 3M45A 4HJGA 4QOKB 3LKNB 3GJFK 2WBWB 1A47A 4X7FC 1LEKA 2MPAH 1LO3H 4K55A 3MRMB 3VFMB 1F90L 3CUPB 2CMRL 2UVFA 3C87A 3K4ZA 4MJIA 5HYSG 3D69A 2CJUH 4ENEC 4F33A 2X5PA 2NXZD 4XC3L 1HHIA 2IBBA 4QEGA 2EKSB 5B38G 4HLZH 5FKPB 3FT4A 4L4VA 4F37K 1HKFA 1VCAA 1AXTH 3FQWA 3C9NA 1AHWB 3NCYS 1NANH 3KWWA 3EO0B 3BPOC 3VXRB 7FABL 5FXCH 4JY4A 5DFVD 4M5ZH 4R2GC 4R90L 3ARFA 1S78C 4BZ1L 3DV6B 3SEPA 3VD4A 2OR9H 3NIGF 3C2AH 1KNOB 1H3PH 4IOFC 1RY7B 1F4WL 1I75A 2H3NB 3T0EE 1Z2KA 4M9OA 3MOAH 1B4JH 5IT2H 3LIZL 4U33A 4GKNA 1BBDL 4R0LB 4UOW0 4XP4H 1BIIA 1ONQB 3H3BC 3DJ9A 5EUOE 4TVPE 5DA0B 4BFIB 1I1RA 1A7QL 3GK8H 4FQCH 4E5XA 2JE8A 3CK0H 1X3DA 5SWSD 2ARWA 1KLGB 4MNQD 3SDDD 4HIIA 5FKAA 3HNVL 4HW6A 5CSZB 4PJFB 5E2TL 3C60C 3P9LA 4G9DB 4RISH 2NLJB 4M4RA 2HN7B 1OWWA 4X6FA 3GRWH 2H6PB 1YECH 4YXKH 4Y5VA 3RZCD 2HTKC 1RZFH 1I7TA 3K7UA 2BFVH 2AKRB 4F57H 1WFUA 1FDLH 4AEEA 5EA0L 3EHBC 3QFJA 4HXBL 1NMBH 3MJ9A 5KVEL 5IR1A 1RZIB 3NZ8A 3T0VA 3QZWB 2CRMA 3T3PE 3UTZB 2JIXD 3MXVL 1MIEH 1O0VA 3ARUA 3F5WA 5D7IA 3HPLB 3MLVH 5DJXA 1A6VH 1P9MA 2C5DC 3GMLA 4OUOA 4O2FA 3E0GA 3V6OE 4JDTH 1P2CB 3QA3A 5KBNC 4ZUUB 2KH2B 5E9DA 3SCMC 5SWZD 4P48A 4L3AA 3IXAA 4FXGB 5EIIB 3L3KA 1A7OH 2J1KA 1WICA 1U3YA 4ZFOL 2LU7A 1UFUA 2AABL 1BPVA 4XCNB 1QBLH 3H42L 3JV5A 2X1XR 5JO5B 5IB4B 4GAJH 5EORL 5HHQB 5J7CC 1EFXD 5C8JA 2XYCA 4ZOEA 1MAMH 1ORQA 4D0DA 1DR9A 4OFPA 1MCDA 1A6ZB 3MV9A 1WBXB 1HHGB 2MJWA 3RWEB 2WLZA 4LDLB 4LKXB 1A3LH 4AMKH 3DX7B 3WS3A 4X6DF 3QAZB 1KB5A 2GSGA 3VCLA 1FG2A 1T03H 2CXGA 3AM8C 5I1DB 1BD2A 3BQUB 2A83A 4WHTA 2GITB 5BRZB 2F58H 1DVFB 4LGPB 4Y5VC 2B4CH 2DIJA 5KAQG 5JHDD 3MOQA 3PWLA 4QRRD 4X99B 2VZSA 3GKWL 5D5ME 4Z78A 1DN2A 4TSCL 2OYPA 3SE8H 5DVLA 4PJ7B 4S2SA 2C4XA 2DTML 4AL8L 4GMTL 4KHXL 5A2LH 3WL9B 1E6OL 2XI9A 2VL5B 1FFPB 4HKBB 2EO9A 4JFFB 3MV8D 1FZKA 5AUMB 1PZ5B 2BVYA 4NIKB 1QFUL 5I1HH 2FJGA 1RSFA 2PTVA 3MYJB 5IQ7L 1OTUD 5JOEA 3IU3A 4PG2C 4Y19E 3W9EB 3MO1A 1CFNB 3F7YB 2JTDA 1W72A 2G9HB 1IT9L 3MLWH 3HPJB 1KTLA 5GGQL 5I1AA 2DB8A 3NH7L 4XNMB 4F7PB 2FHCA 4GRWF 4OBSA 5FUOH 1RUPH 1WBZA 1Q72H 3HE6C 4NCC2 2NY6B 4UILH 3BZEA 4NQSB 4PB9L 4HC1H 2CK0L 1F8TL 3G6DL 4O51A 3VFUA 2VXVL 3QUMH 3UBXG 3SJVA 3S37L 5C0CA 3I2CH 5JORB 2ITDB 1U8OB 2NTFB 3OHXB 5D6CA 4Z95H 3QULB 3PABA 4JY5H 1WT5A 4ZUSB 4Y4FA 2VIRA 4TUJA 3OR7B 4LVHC 1CFQB 3H9SD 1OM3L 4PJCB 2WZPD 1R24B 3C5SB 1TNNA 1L7TL 3IKKA 2D7PA 4YXHH 3QYCA 3FQRB 3MUZ1 4TULH 5DSCB 3B83A 1DBJL 2VABB 3NABL 1JE6A 3Q0HA 4OD2B 3SDCB 3JTSB 1BOGB 3JWDL 1MCIA 4TOYH 4I18B 1X44A 3KPNA 4HBCH 2WW8A 2H1PL 1A7BA 3OXRB 1JI2A 5C0DA 2WQRA 3H7LA 4Y5XB 5I8KL 1PG7L 1WUNT 3MRGA 3VXRE 4WEBL 3QR2A 1J8HD 5IBLD 5KZCB 4AM0B 4JFYB 1VEOA 1YEHL 4PJBF 4G8FB 3O3EB 3FCTA 1NCBH 3IGAB 4BQCA 3FO9A 3VFPB 4GKSA 5EUOF 1E6JL 5MERA 2FD6H 4U1SB 2AJ3B 4HS8L 2ZUTA 2IC2A 3FFCB 1EX0A 2XWBA 3EO9H 3QEUA 3VXQA 1T04B 5INCB 3LKRA 5EU6A 3CFCH 2MHAA 4HJ0D 4ZO8A 3WKNA 3R1GH 4ZFOA 1OQXA 1NBYB 3ZTJG 1AGEA 3FOMB 3OKDA 1MHEB 3UTSB 4L8SB 1BVLB 4MA3B 2DWEB 1QSEB 5ACLA 2HAZA 3HAEA 4OIBA 4DAGL 2IPTH 2NW3B 2Q7YA 3WV0A 3CC5B 5JW5A 1PGRB 1XIWA 2X9WA 1GIGL 4NYLB 4YFLI 5I1EL 3LEYH 3GSQB 5EZLB 5C70A 1WT5C 2GHWB 4Y4FC 3ROOA 5F9WB 3JWOL 4JN2B 3VWJC 2FR4B 4LGRB 5ICXB 3BIKB 1OGAD 3IFOB 1EH9A 5C0RH 1JN6A 5T33H 4I9WE 3EYOB 5B4MC 1UA6H 1ZHBB 3T3PF 4KKLD 3WEXB 4FZ8H 1CICA 4JN1H 4LVNB 3KPOA 3ILPB 3KPPA 1CDYA 4K23L 1S7TA 3VXUD 5KVMC 2W9EL 2G2RA 4RMVA 5ANMB 5DT1L 2FO4A 4LGSB 2WUCL 3BP7B 4K3EL 5EO9B 3DV4B 2OP4H 5EDXA 4MCYB 2J8HA 1MFBH 5HYJE 3MLUL 5I71B 5I1JH 4FQ2H 3ME0A 1Y0LA 4XAKD 3UC0H 2C3VA 3Q1SL 5DO2C 1F3JA 4RIRB 1NMAL 5CBAB 4YDLB 1G6RL 4PJAB 3KYOA 4JZNB 1KN2H 4JKMA 5DD0L 3O2WH 2BJML 3WNKA 4R8WH 3STZA 3WXWH 1N0XL 1X5LA 5DRWA 3BESR 2AQ2A 5DRXB 2R0WH 1LP9B 1NCAL 4C56E 3C5ZA 3OG6B 4RGOL 4O4YL 4JFQB 5ITFA 3IJHA 4YIQB 5I8CB 1SM3H 4O58H 3F6IA 4G8IB 5FOBB 4ODWA 2I07A 5I18H 2NMSA 5I8OH 4K3DH 5TE7L 5D2NA 3PV7A 5JW4R 1XIWC 5D5MF 4NOBA 4L4TB 1FNSL 2V2TB 1TVDA 2EO1A 5BRZE 4Z7WA 1N2RA 5KTEH 1KJ2H 1QBBA 1X5IA 3MRIA 1JJUA 32C2B 1KCRH 3D1MC 3FT2B 3EYVB 4RGMB 5EOQL 4P57B 3O3AB 2QHRL 4NFCA 5HD8C 1UZ6E 5FK9A 4JFOA 3L5IA 2BOBA 2YSSA 5CS7A 3BP4A 3RWGA 1CICC 5IEHB 1X4ZA 2P45B 1WZLA 5HY9A 3OJ2C 4JHBA 4CBPA 1PVHA 2PW2A 1KXQE 1Z5LB 1ZLSL 4HXAH 1AE6H 2DQJH 1NPUA 4N8VA 2OJZH 4EN3B 2YD4A 5LQBL 1A7NL 4L9LB 1IRAY 2DIAA 4ZO6A 2UZXB 5H94A 4WTXA 3UZEA 4AENB 4X8JA 2C7UB 1X4XA 4ODVH 2HG5B 2RCSH 1JHTA 5IW1B 3GSOA 1OD9A 3RBSA 2DLIA 1KTDA 2WWMC 3PNWA 4I48A 3QG6B 2MTPA 2ICWA 2YPKA 1JNLL 3PF2A 3GSVB 1FGNL 1S8DA 3H3PH 4C83B 1CXHA 1AC0A 1H0DB 3L3OA 5DJ2B 3OKLB 3I9GL 4CADA 3CAFA 3BE1L 3VI3F 4HWZA 3S35X 5D7JB 4ENED 4BUHA 5DEGA 4WFFD 4IIQB 4LLMA 5DJ6A 3G6JB 3IU4L 3MUGA 4KKAC 4PJCE 5ESQB 3REWA 1XCQA 1LHZA 4MB5A 2B1AL 5LJYH 1S78D 5E2UH 5D2NC 2IGFH 4WY7H 1UCBL 5I1IH 3MRCB 4OKDA 1PSKH 2CDGB 3UJTL 4LASH 5GSVA 3MXWL 4XBEL 4MAYD 3SDYL 5DLMH 3CFJB 2E9WA 3WDHA 3SGDH 5IESH 4U0RC 3WIFA 4M48L 4EUPA 2KPNA 5C09E 1ZLUH 1JGDB 5CKAA 1UM6H 3LD8C 3KS0J 4KJPD 3JWDC 3EIFA 5CJOL 4G8EB 1HXYA 1CGSH 3QQ3B 1KELL 4HWBA 3UO1H 3A6BL 1PZUB 1FLTX 1CGWA 4P9MH 5DUPL 5D7LA 2I5YL 3AC0A 2DYPB 4LEXL 2VAAB 1CLCA 5JPNB 4UMGA 4XWGH 4MQXD 1UC6A 3C6LC 3HCVB 4PJFF 3ULUL 1RUQH 1H9VA 1G6RA 1G9NL 3P73A 1GAFH 4HUVB 4X9FA 2X4OB 3SE3A 5DMKA 2L7JA 1XGQA 4ZUWB 2UZYB 4I0PC 4XH2B 2E3VA 2V2XB 5T1KA 5BV7L 1A1NA 4NBZB 5K9OA 4LCYB 1NGXB 4TN9A 3MJ9H 4MD4A 4MJID 5JQHC 3T1FB 2VZTA 4RMWA 3MPCA 1C16A 2WBJB 3V4UL 2OI9C 3QQ4A 2A0LC 2ZKHH 4JKWA 1AFVH 2UYLA 3VFWA 4YX2H 1KEGL 4BFGA 2EDNA 2D9QB 2MQ0A 1DEEA 1ZTXH 3ARFD 4NFBA 1XR9A 2EIDA 1WFTA 1FVCB 1RUAH 3MLSL 4HUMB 3MFFB 3W9DB 4HWEH 2BNUB 3OJMB 3JWOC 3TYFA 3QUZC 2D3VA 2W0FB 4ZQKB 3BGFB 4P0DA 4PB0H 4KI5C 4OTXL 5EOTA 3MRPB 4DUVA 3IFLH 2KUTA 2AXGA 2EXYD 1ZGLP 3VMNA 5IVXB 4UTAL 3ZSTA 3PP4L 1C5BH 3AAZA 5H2BA 2GTWB 1F11A 4JJ5A 2DQDL 4Y1AB 1E4KC 1KB5H 4HJJL 4ACPA 5C08B 1KACB 4CU7A 2JJSC 5MEOA 1PKQB 1FYTA 5DEFB 5HHVL 3GUTA 1R3KB 4JHWL 2HFEA 5JIIA 3TV3L 5ICYB 5FO9A 3AB0B 2ADGB 1LP9E 3QXUA 3MUY1 3FRPA 4Z0XB 3ZDXE 5C0AA 3VGAB 2HFFA 1IM3A 2I25N 4X6EB 5EOCJ 3K8LA 1DCLA 1TQBC 3QFJD 2DF3A 1F90H 4J23A 2CMRH 2X4UB 3QZWG 4NDMA 3QXAA 1N6UA 3BGAA 4M3JA 4G5ZH 2PNDA 3OB0H 4PJDA 4XC3H 1NUNB 3RNQB 5BVJA 1G7IA 4L4TE 1BAFL 1UZ6F 3DGCR 4QRTA 1I1FB 5GGUA 3S35H 2IQ9L 4LHJB 2QV2A 3MNWA 4KTDH 3BH8B 3RGVA 2APWA 2H2SC 3GSNL 5K9JL 5E08L 4YC2C 1YQVL 3TNNA 4Q7DA 3RX8A 4GLRI 2C4FU 1W72H 4KKCC 3IJSB 3LMJL 4Y88A 5E9DD 2IH3A 5FYKH 1YMHB 1F4WH 3WFDL 3ISWA 3T8XA 2C9AA 4WFED 3GHBL 1PEZA 4OCRL 3QDJA 1KJ3H 4KZDL 3OL2A 3MLYL 1N7ML 4NO3A 3S37X 1HK6A 4OUUB 4ZFZA 3UYRL 3MV9D 5IHUL 1EZVY 2N4IA 1BVZA 2HP4A 2DWDA 4XCEA 3HNVH 3CPLB 3BSZL 2ZZUT 4MNQB 1AI1L 4QKXB 5E2TH 3TCLB 4TUOA 4FFVC 5A2IH 1CGVA 4OF7A 2R23B 1D5MA 4WIQA 1BD2D 4FZEL 4HUXB 4MJ5A 1MAKA 1JV5B 2FIRT 3FOLA 4NCC1 4RFOL 4OV5A 1EBPA 3PV6B 4GXVL 4M7LT 5DVNA 3TPUB 1NDGA 2W0PA 4PJCF 3H2WA 5DI8B 2WM0A 2D7QA 1EERB 3GSRA 4LPUA 1A4JB 2FL5B 5LCVH 1ZGLB 3EKCA 5IGXH 1DQQA 1JTOA 5EA0H 2WP3T 5E8PB 2DTSA 2Y7QA 1Z6JT 4HXBH 5KVEH 4QHMA 4Y4HA 5L8KB 4W70A 2VXUL 3DHJA 4YHLH 4JFXA 3OKEB 1MNUL 4XZUA 1ED3B 3MXVH 2VE6B 2YPLB 4OZHB 3QEQB 3RGVC 2J5LC 5AZ2L 1VFUA 3D9AL 1T83C 1VFMA 1NH6A 4DJMA 4PLJD 4MXWL 3LHPH 1I7ZB 5FYKD 1AKJB 1RUMH 4ORGA 1AGCA 1MLCB 1JUFB 2AABH 2OCFD 1S7UB 1CL7I 2NNAB 4FQLL 4G6AC 4HUWB 4NZUL 5C07E 4LQ1A 5ID0A 3HAEH 1BFVL 2Z93B 3AMKA 4MSWA 5DK0A 3RNKB 4Q9RL 3BKYL 3EJYD 1FVDB 3REVA 3S98A 1HINL 2NY2D 3SJVD 5C0CD 1MFEL 3BD3A 4OLXH 5EZOL 4ZSOA 3HB3C 1LK2A 4X9IA 5CJ8A 2BY1A 3MRJB 4PRIA 4KMTH 4DGYH 2XTJC 3QWRA 4GSDH 4AG4L 1EPFA 1DQLL 2NY3C 4M7ZC 2CLRB 1S7VA 4WW1B 4JFZL 4M61A 5IMLA 1HYSD 4TUKL 3ULUC 4YK4B 3MR9A 3OSKA 1G9NC 4NO2B 1OGTA 2YUXA 4NT6A 3JV4B 2BVQA 2EDRA 3E6HA 4AZ8A 4F8QA 3QHFL 3GKWH 1IGJB 3N0PB 3PQYA 1JPFB 1ZHLB 1WBYB 4TSCH 2IBZY 4OF8A 4R6UA 5BV7C 1A6AB 4R4BA 4AL8H 4UT7L 4GMTH 1TVHB 3OKKA 3ROLB 1E6OH 1QVOB 3Q6GL 3L95B 1V3KA 3IDGB 4DEPB 3GSNA 5DJDA 4FQXA 4D2NA 3MLTB 4NKIH 5IQ7H 2XPGA 4QTHA 5FV1L 5KSBE 3U1SL 5KJRL 4FMFA 3ARDA 3OAZK 2VQ1A 1IT9H 3ZDYE 5GGQH 3GDBA 5EU6D 1U3HC 2ZSVB 4X5WA 5BZWB 3HFML 1NGZB 3JZ7A 4OF0A 5JDSB 4ZAKC 1HQRB 1SEBA 1FO0B 1DUZA 3UPAA 2ZPKL 5FF6A 1S7XA 1J8KA 1Q9KA 4EQ3A 4PB9H 2JJUA 2E27L 3ULVL 2DLEA 2QSCH 5CZKA 1YZZA 4UNTA 1U8PA 1UGNA 1JZ4A 4K94L 3C8DA 2CK0H 1F8TH 3G6DH 4G7YL 4JQXA 4P5TA 1LP9F 5CCKL 4OV6F 4QF1B 3ZDXF 3S37H 1XIWD 3QXDB 4PRHB 1PKQE 2BVPB 4PV9A 3RIFF 4CU6A 2PO6C 4MZ2A 3X11A 5IV2A 3CXHK 4AEIL 3P0GB 4I2XB 1L7TH 1EEZB 3H9SB 3BT2H 4HUNB 1TCRB 4LSQL 5J4MA 5GS3A 5BZDA 3IF1A 3NN8B 1DBJH 2Z8WC 1CICD 3NABH 5DD1L 1Y6NR 4WGVB 4HIJA 4J6RL 1KIPB 1AP2A 2DM7A 1JHKH 4PY7A 3JWDH 3DIFA 2FEDC 2VLKA 4DN4L 1OAZL 3WO4C 4BH8A 4I4WA 2H1PH 4PJ8A 1QACA 3QIUA 4L1DA 1PG7H 1FPTL 4WEBH 2ZP0T 2X70A 3RIFK 2V9QA 1P1ZA 4ODTL 3I6KB 4K7PL 4YAQA 2APFA 4F15B 1UH3A 2EDWA 1YEHH 5I8EA 5EN2A 4PLKD 1FZJB 3FN0H 4FQXC 2HFGL 3LKQB 4LIQL 1LEIA 1DUYA 5DYOA 4ETYA 3FB8A 3FQXA 3HRZB 4OI8A 1DBAL 3C5ZD 4UT6L 4ZUVB 3TBSB 3B9VA 4IRSB 1M7DA 1GGTA 1VPOH 3O11A 3MMEB 4MNQE 4KKAD 3IVKA 5EB9A 4MD5B 5LBSL 4JQXC 4NN7C 2ORBH 2J8UE 4NZTH 1VFBA 3O9WC 5ESAB 5FECA 1GIGH 2R39A 3G6JF 3P77A 4YO0B 3TVMA 3JWOH 2HLAA 1WAAF 3GNML 4KZEL 1A8JH 3VXSA 5C0BB 1K3ZA 2DLFL 1MH5A 2Z8SA 4ZS6D 3RVVD 4EUPH 4LPCA 2GFBA 4K23H 1K4CA 2ED9A 2W9EH 4U6XA 4U1IA 1W8NA 2Q86A 5F9JA 3ZYOA 5DT1H 1IAIM 4HWBH 4GOSA 4ETQB 2WUCH 4K3EH 4PJ8C 1CGUA 4WU7B 2EDFA 4YE4L 4N8CL 1OP5K 1JTTA 1JRHL 5HGAB 2NY7L 2R2EA 4XNZB 1L4IA 1GGBL 5KSAA 2YA0A 3OGCA 3LS4H 4PJHA 4U1HA 4U1JA 5KS9A 5D1QD 1G7QB 2CUIA 4NJAL 3R8BB 1NMAH 1TJHL 1EO5A 5SWZE 1G6RH 5E8EA 1KJMB 3OAYH 5E8DL 1BZ7A 1U92A 3I50H 1J86A 4JANB 2BJMH 3FO2A 4MVBD 2XXCB 1N0XH 4OCLC 4YBQC 5MHSD 2YXFA 4Q6IB 5LWYH 5HPMA 3GBLA 1I8MB 1CQKA 1OAKL 1NCAH 4MMZC 1S7SB 4RGOH 4O4YH 2LU3A 4XMPL 4HT1L 4YHKL 3IB4A 2BSTA 3E8UH 1G6VK 3MCLL 4QGTA 3UTTA 3FQTB 4HIXL 5TE7H 1IEHA 4G80B 6FABL 4OKVA 4RSVA 3D2UB 4APQC 2IQAA 1WK0A 4PD4J 5HI4C 1ACYH 1VACA 3P3YA 4NRXA 3OKMB 1JL8A 5TQ2H 2IAMB 3W5NA 1OT2A 5EOQH 4OLYL 5JHDE 2QHRH 1ZGLM 3SKMA 4UAOB 4QRRE 3RPKA 5IWLA 2RGSA 4E41A 5DUBA 1NFIA 5HVHC 4WNQA 4XXDB 4K7FB 5KSBF 3ZDYF 4J7RA 2EDYA 3IYLW 4H0IA 3OQ3B 3DXAA 1DQML 1KLUB 2BMKB 2D0HA 2I9LA 3MV8E 5DUML 1JGEA 5J12C 5LQBH 4PRDB 1A7NH 4OAWB 1E28B 2WQ8A 4LBEA 2YA2A 4ZPTB 4KK5C 5IVXF 3MRRA 3GSUB 5ISZB 5IMMB 3QXTA 5FGSA 1MELA 5CLTA 5B39B 1JZ7A 5J11B 1A5FL 2IALA 5JXAL 2F53A 3H9HB 4LHQB 1J0IA 1A1OA 1JNLH 3HZKA 4PPTA 4J1UB 4ZG1A 3C8KB 1UWXH 3EZ8A 3G5XB 2VUOA 3EBAA 5T1KD 4ODSL 3BE1H 1M7XA 2C3HA 3RI5F 1AGBB 5BJTB 5HHOB 1ZS8A 1KIQA 3HC3L 5EU4B 4PS4H 1SVCP 8FABA 1WCBA 3ULVC 4NO0B 1S7RA 4K94C 4J8RB 3VFOA 4HAGA 3MBEC 1OD7A 2YD6A 5J0BA 3H9SE 3UDWA 2R1YB 3FB7B 3BPOB 5ID1A 4OCMC 1UCBH 1UWEH 4KKCD 4R2GB 1I7RB 3TH3T 1O5DT 4XNQB 3NA9L 4CUCA 1RURH 4Y16A 3U36B 2C3GA 1ULVA 4XBEH 1KJ2B 3HC0B 4UIMA 5BOPA 3SDYH 1X5ZA 3X13A 2ZCLL 1OOAA 5DRZA 3B2UC 1EVUA 1HI6B 3NPSC 1EUUA 2PCPB 3I75A 3KAAA 4M48H 5MI0C 1GGIL 3RI5K 4V1DB 1FNEA 5BO1L 5AZEH 5BVPL 5F3BB 5MEQA 1J8HE 4HWNA 4OT1L 4ELME 4M8VA 1KELH 5CWSA 3A6BH 4N0UB 4ELKA 2MQ3A 5DUPH 1J87A 5EPMA 2I5YH 4Z76A 43CAB 4AIOA 4LEXH 4FFVD 3GSWA 1W0VB 4Y8DC 1C5CH 4JO4L 1T0MA 1LD9A 3C60B 1NLBH 4KTYA 1F2XK 2V5YA 1FYTD 2CRYA 4M5YL 5ICZA 3RIAK 5CD5C 2UUDK 3M1BB 4I0CC 2XN9B 3MRDB 5C0AD 2G75A 3U4EB 1CXIA 5IF0B 4WTZG 1AJ7L 2CUMA 3U9UA 3K8MA 4BQ8A 4LLQA 3V8CA 1TDQA 4JPWL 3DUSA 3V4UH 1OSZA 3U0TA 3TA3C 3CMGA 3PL6C 3RGVD 1KEGH 5GSRA 2PKDA 4S0SD 3FT4B 3BFOA 4L4VB 3C9NB 5CJ5A 1EXUB 3M07A 2FGZA 1AQDB 3UDWC 4PJ9A 4DZBB 2IH1A 2Y23A 1OGAE 3MLSH 4OZHF 3ZZ1A 1K8DB 5TQ0L 3TCXA 4JFEB 4Y16C 4ZOCA 3SCMB 4R4ND 3WFHB 1T21A 2XNAB 4YHPA 1MJJA 4LLWA 5CD3B 4UU9A 3QDJD 3EOBA 4OTXH 3GMNA 1BGXL 4WEMB 1HCFX 3IKCA 1DE4A 1MJ7L 5FDWA 2AK4A 4UTAH 5F7MC 3WFCL 4LFHD 4MHHI 4OZ4A 4PGDB 3WO3B 4BH7A 1X7QA 4XAKE 5GJTH 5C6TH 1JNNH 3FONB 2FGWL 3EOTL 2Y07L 4OFYA 5DD5H 1HZHL 2XTJD 3GB7A 2KDGA 3FB5A 4HIIB 2NY4D 2DI8A 2NY3D 3P9LB 4NQXA 1NGPH 1NDMB 3VFGL 3S3PA 4CN1A 2QQKL 3MJ8B 3T65A 5K9QG 4F58L 5D4QA 5HHVH 2P1YA 4HZLB 4X6FB 1UKSA 4M7LL 3KXFA 4YNYA 3ARXA 2IPKA 3KVQA 2H45A 4UB0L 3LKSB 5IK3B 1JCKA 4TNWK 4Y5VB 1MLBA 3UPRA 2AEPL 3A6CL 4PJXA 1CXLA 4EKXA 1YMMB 2ZOLA 3FFDB 1ES0A 4Y4HD 1ZE3C 2OSLB 2E6QA 3PWNB 3VXMB 1VEMA 2YRZA 3QO0A 2PXYA 1BAFH 1CGXA 3OV6A 2JJVA 1TLKA 5ESVA 2IQ9H 5DC0A 1GGYA 5K9JH 3GSNH 5E08H 1OP9A 1IAOA 5DMGD 2BSRA 3MRLA 3TO2B 4PJ9C 4S11A 5C2BL 5EU3A 3GMLB 1ERNA 2EDBA 4LPWA 1F6AA 4DTGL 3MZGB 3QA3B 5DTFA 3OB8A 1AD9B 3KPSB 4CVXA 3L3KB 4YHIB 3WFDH 1ITBB 3KDMA 4R7DB 2ZUYA 3GHBH 4DVRL 4OCRH 1KOAA 4KZDH 1CIUA 1NBQA 2V6HA 3MLYH 3HE6B 4DK6A 3NFPA 4YBLC 4Z9KB 4JHAL 1UVQB 3UYRH 2X09A 5CSGA 5C8JB 5GISL 1HKLL 3BO8A 3VXNB 4KDTA 4LLVA 1OWRM 2EXWC 3BSZH 5GGSA 4PRID 3WS3B 2GTZA 3QDGA 1OF2B 3VCLB 2GSGB 4UBDD 2WINB 4LVHB 4FZEH 1N5YL 1EA9C 4RFOH 1CI5A 4GXVH 2XKUA 4WV1A 1CDUA 2H2PD 3EOYG 5HHOE 4M7KL 1FLRL 3PQYD 5D7KD 4WFFE 1XF2B 3O41A 4WWKC 4JZOB 4YZFE 1J18A 2UV3A 3G9VA 1J9CT 3LPFA 2VXUH 2JB6A 1CXEA 2EEDA 2RHEA 2Y72A 3VE0B 4LCUA 4MD0B 2PXYC 1MNUH 1RIVL 5J13C 1JPTL 1FZKB 4XX1E 4FQXD 3B3IA 4OJFL 4WUUD 3RWDA 4KY1L 3D9AH 1JF5A 2FJGB 3BKCL 1QFWL 3ARDD 4LSPH 4A6YL 5DHVB 3PP3H 3IU3B 3F62A 4H20L 5AYUH 3T2OA 4MXWH 3DBXA 3EW3B 1MRDH 5IOPA 3FO0L 1HIML 2JB5L 5FA3A 4ZNEA 4V1DE 1NGWA 5IP4A 3CFBA 3DUHA 3BP5A 4ZTPL 2ERJC 3BKJL 4NO5B 2DI9A 15C8L 5HHMB 4XVSL 4FQLH 5JW3L 4N0UE 5J1AB 5L7XL 1ZA3A 2E7CA 1A7PH 1BFVH 5IB1B 4P5TD 5LXGH 1H5BA 4Q9RH 3BKYH 2A74A 4F80A 5TF0A 4LLYA 1NC4B 2DDQL 3VFUB 1IM9D 2WIIA 4LKCA 1RIHH 5D6CB 1KB9K 2APBA 4GG8A 1TNMA 2AAVA 3PABB 5GIRA 3V0WL 4Y4FB 1KIRB 2Q3AA 3EFDH 4AG4H 1DQDL 1OSPL 4TUJB 3BDYL 3VWJB 2P5WA 2XFXA 4LRIC 3S96B 4Z0BH 1PKOA 4WV1C 4HMCA 2C1PA 1P4LA 3ZL4L 1LO0H 3JWNC 1J0ZA 3HI6H 2IBGA 3P40A 1NJ9A 4KMQA 4B5EA 2Z92B 1R3HA 3HS0B 3QHFH 3DX9A 1YN6A 4HDIA 4MJIE 4IS6B 4U6YB 2VLKD 1BZQK 3LRSB 5LGKA 5F96L 4PJ8D 1LQSR 1ZVSB 3QIUD 2UZIL 3RWHB 5JR1L 4L4VE 1HH6B 4XCYA 1FE8L 5C0DB 2Y6SC 5JW4N 1O7SA 3D39B 3Q6GH 3MRGB 1IQDB 1SEQL 1K8IB 2R2HA 3I6GB 4D0CA 5DA4A 4JFEE 3FO1B 1KT2A 5E5UB 1A6WH 25C8L 3U1SH 2DI7A 3FO9B 3IFNL 5J6GA 1G7PA 1T4KA 2F74B 2NR6D 1LDPH 4ZODA 2CUHA 1NCCL 3E3QE 3N9GL 4JO1L 3N85L 3WSQL 3OTTA 1X6NA 4WRLA 3T1WA 3F65A 3HFMH 5IB5A 3DO7A 4UDUA 5CP7B 1XF5A 1ZT1A 4KJYA 2ZPKH 4PGBA 4GRLC 1H8SA 2E27H 3PWUA 1GC1L 5FM4A 4HEPG 4K94H 3OKNB 4JGMA 1MJ8L 4LCWB 2EDQA 1CXKA 3HAEB 4PTTB 3S8WA 2YUVA 2AXJA 4LCIL 5E8NA 5FYJL 3V5KB 4ZDHB 2VXSL 1FYHB 5JW5B 4BK4A 1XIWB 1NFDB 4AEIH 3TVMD 5HI4D 1YPZA 1G0DA 2EIEA 3P0VL 1WEJL 3VXSD 1BLNA 1TJGL 3ROOB 3MRHA 3MJ7B 2DKUA 3TJEL 3Q2CA 1JN6B 3M17A 2H26A 4J6RH 1YMME 3ZDZF 2QQQA 3CLEH 4QRPA 1YNKL 5KW9L 3QFJE 3T4YB 3EDJA 1OAZH 4NKMA 3H7BA 3V5HA 3H3KA 4FG6C 3ZYIA 3QUKA 1RJLA 4POUB 2X7LA 5KSAD 4NQVA 5TH2A 4ODTH 3VGFA 1HQ4B 4Q74A 1J11A 1IAKA 5E9DE 4K71C 4LIQH 1F3JB 3SO5A 5HGDA 1MWAL 1ND0A 4A6YA 3KYOB 3T3ME 3CLFL 2GK2A 5J89A 1KF9B 4RAUA 5IUSA 3ARZA 2UWEA 4WFEE 2DQCH 1DBAH 3GJEA 1U8IB 5DRWB 1WTGT 5EO1A 5HSFA 1MI5A 4XI5C 1J1XL 3MV9E 2L4OA 2GIYA 1I1AA 3UTTD 1INDL 3IJHB 2D0FA 4PG9B 3VFSA 4Z7QF 5CHNA 3VGDA 3IETB 4FFWC 1CLZH 1BD2E 2AQ1A 5D2NB 3AU1A 3TNMA 1FV1B 4KZEH 2HWZL 2LQRA 1UYWL 1Y6KR 2DLFH 5DJCA 2AV7B 4E41D 2BCKA 3MOBH 3BRGC 5FK9B 2FATL 4P4RA 4U0RB 1CG9A 1F5WA 3TP4A 3NCJL 5CEXB 1DBMH 3KPQA 2GJZA 3GMQA 3LD8B 1AGFA 1N8ZA 1TENA 5K9KA 4YE4H 4N8CH 2LVCA 1UKQA 5JDJA 2OXHA 3UZQA 2NY7H 3TIDA 3HG1B 2BOCA 4XNUH 5GS0H 3LH2L 1EEQA 1ADQA 2VDRL 5B39G 3EO1A 4W6XB 4RAVA 3U7YH 4MXVE 5A2KH 3ELAT 4NJAH 4X8JB 2W9DH 4PREA 1TJHH 5CD5D 3LN5B 3L6FB 2F53D 3C6LB 4UIKL 5E8DH 4P2RB 5FYKE 3T04D 3QHZL 2WUBL 4MB3A 3OWEA 1I3RA 4KXZI 4I0PB 1BX2A 1CD1A 4YGVA 3L3OB 2GJJA 2ZNWA 3AS1A 4BQ9A 1HCVA 5ELIA 3BZ4A 3UYPA 1VFOA 2AJZB 4HT1H 3SJVE 5C0CE 1FAKT 3MCLH 2OI9B 3CMOH 4LLMB 1I1AC 5DJ6B 5E1AA 3PGDB 5JA9A 1T5XA 4G43A 3MUGB 1D5ZA 1RZJL 3O4LA 6FABH 1XCQB 3VH8A 3I3BA 3CXDL 4IRJA 1NCTA 4Y16D 3EDEA 2Z4QB 3N1QC 4X4XA 4M6NL 3K46A 5D6DA 4OCWH 2G5RA 1IJ9A 4CDGC 2ZUWA 4AH2A 4CJ1A 1GYAA 4X5XB 3QUZB 1XGPA 1QNZL 3GSXB 3L1OH 4LLDB 4B41A 2Q76A 3AFLA 4O2EB 1K4DA 5HHNA 2OS7A 4DKDC 3QUYA 1MREL 1DQMH 5DUMH 5FYJU 1OAQH 1JP5A 4NN5B 4HKZA 2V5SA 1AQKH 5GS0D 4ONHB 5D7LB 1TZIB 4X7TA 1G7JA 2XWJA 4CAGA 5L2JA 3HC4L 1PW3A 4P2QA 1Q9WB 1A5FH 3Q3GA 5E03A 1FL3A 1MIMH 5EU6E 1U8JA 1I3VA 1ZHKB 1G6RB 4P46A 1VEPA 3PWPA 4F3FA 2I9TA 2VNCA 1BVKA 5C3TA 2VXQL 1EAJA 2GT9B 3RWCB 4DCQA 2EE3A 4HX1B 3KLHD 2EKJA 1TQBB 2XKNA 3QJHA 1A1NB 4GLRH 4ORZC 4Z7VA 2OJEA 4HMEA 1JVKA 3Q6FA 3UTPD 1NAMB 4LSUH 1GC1C 5D8JL 4KWUA 2E9IA 1ZLUK 4G42A 2UYLB 4YC2B 4BA8A 4PJ9D 5IMOA 2FHFA 4WJ5B 3CFEA 4YDKL 4DKFL 3HUJB 4IRJC 1XR9B 4DOHB 1CFVL 3K3QA 1YEGL 3NA9H 3VXTA 3HI5H 2JCCB 5ALBL 4OB5L 1UQSB 5I1GL 3BOVA 3HLAB 5D6DC 5E56A 3BMVA 4LPXA 1HHKB 2ZCLH 1A6UH 2GJ6A 4LQFL 43C9A 2W60A 1RK0B 2BSSA 2VDQH 1D5BA 1HWGB 5L9DH 3PDOA 1YEFL 4I3SL 1A3RL 1XT5A 5BO1H 4KUZL 1T89A 2AK4D 1TQCC 3QIWA 5BVPH 4EJ1C 5HDLA 1UM4H 2OL3L 4JG0L 4GG6B 3T3MF 2AK1L 4OT1H 3QUYC 3TIEA 2FCBA 1EEUA 3AAZB 5LGHL 3DUUA 5LGJB 1QRNA 1LO5A 3A67L 3U7AA 1U8MA 4JO4H 4LEOA 4LAJH 4D3CH 3MX0A 4ZYKB 3UBXI 5I66A 4M5YH 4UTBL 3F7PC 3KXFD 4WUKL 4JRXA 1MPAH 1YJDH 1DANU 4GAYA 1M6OB 4ZO7A 4D9LH 4P46C 3NGBC 2NX5A 4UT9L 5T1DL 4QYOA 4MQ7B 2QBWA 4XPHH 1C12A 4Z7OE 5MEPA 5C0AB 4QHUA 4R4FL 1IM3B 1LE5A 4JPWH 1CLOL 5GS2H 3G5YB 1LEGA 3QXAB 2PXYD 4PJ5B 2NY5L 4N1CA 5D2NE 4PJDB 3K0WA 4JAMA 1G7IB 2EYRA 4QRTB 4UNUA 5GGUB 2HVKB 4Z7WE 3MNWB 5EULV 3D0LA 4YHOL 1GXEA 3B43A 4OIIL 3TBWB 1CL7H 4WENB 3ARBA 1CT8A 3MCG1 4WW2A 5TQ0H 3STLA 4A2LA 1ZSDA 3HE7A 4N9GB 3QPQC 1M71A 5EIVA 5INDB 1LMKA 4JCMA 3Q5OA 4ONGL 3G6AB 3KPRA 1BGXH 2R8SL 1R3IL 2D7OA 3HMXL 3QDJB 1P7KA 1MJ7H 3O45A 5IFHL 3MA9H 1CR9L 3RVTD 3QIWC 3WFCH 1OCWL 4LVOC 2APXA 3EZJB 1T7ZA 3TZVA 5C1MB 4XNYL 4Y2DA 2DWDB 4XCEB 3QDGD 3MCKA 3OMZA 1I1YB 4L3CA 3ARPA 2W65B 2XTJB 1B0RA 3VFGH 3HZMA 1EO8H 2QQKH 1D5MB 4JE4B 1B0GA 4F58H 2NY3B 4M7LH 2CIIB 4M7ZB 3WN5C 4OV5B 1KN4H 5MHSE 2SEBB 2V7HB 3QDAA 4PP2B 4PRPA 4IEFB 3ECBB 3GMMA 2NYYC 2AEPH 3GSRB 3KR3H 3A6CH 3PDDA 1T1XB 4OLZL 3SDXA 1DQQB 3NFNA 1QR4A 2Y7QB 5BV7B 2Y6SD 3EGSA 4PYGA 1RK1A 5GS2D 5LAXA 5B8CA 1ZK9A 1DTUA 2D0GA 5L88L 4BZ2L 2WK2A 4MWFB 4ZXBB 3E6FB 2FYYB 2BNRB 5IVOA 1RZJC 1QLEL 3ARBC 2FX8L 4WW2C 5HJ3A 3JXAA 2CR3A 2XZZA 5D70L 3R0MA 1U3HB 4KQ4L 3DURA 1KJVB 1LE9A 1ZHNA 4YHZL 5IJKC 4IDJL 1QFOA 4S1DD 2VLJA 5EUKB 4ZAKB 1HHHB 3AREC 1UZ8A 3GGWB 5I15L 1NCWH 3B5TA 3CVIH 2GAZB 4OCSL 4JHAH 1ZWIA 2EECA 5DHYB 2EEBA 5D7LE 5ID0B 4CMMA 5E94B 2I60L 5I30H 4E9LA 3MRKB 4M62L 2OL3A 5GISH 4MSWB 1HKLH 12E8L 4Y89A 2O93L 2ITCB 2O5XL 4U6HA 5SV4A 1U91B 4MCZA 3EOAB 2PO6B 3W0WB 3HNSH 1OB1B 1FZMA 4Y2DC 1LK2B 1KV3A 5CBEB 1N5YH 4GBXA 3VFRA 2BZDA 5GPRA 2BDNH 2BVUA 2IADB 1DLHA 1KBGL 2D4DA 4GUPA 3MGOB 5HVWA 5IB2A 3N1GC 2XT1B 4KJWC 3U82B 1S7VB 3LKOB 1NEUA 2FJHA 2CQVA 3MREA 2BVQB 1IZJA 3E6HB 4HFWA 2DICA 4OQ1A 4PYHA 3D18B 2W38A 3LRHA 4LNRB 1UB5B 2C1OA 3BPLC 4FQHA 1FFNB 5B8CC 2HJFA 3UYOD 5GZOD 3RKDD 5TJWK 2ESVA 5I0DA 1JYNA 1RIVH 4RMTA 4DOHE 1JPTH 2HMID 3SPVB 2AXFA 4LHUB 1GJIA 2JCCE 4OJFH 5D96C 1IEBB 3GEWB 4KY1H 3RRQA 3BKCH 4NNXA 1QFWH 1DQTA 4A6YH 2EYTB 4ZPVB 4DFHA 2JF1A 3CH8A 4H20H 5T1LB 2VQ1B 3FO0H 1HIMH 2JB5H 4OI9A 1V5JA 1P69B 1D9KA 4HLJA 4ZTPH 3BKJH 1J5OH 5C71A 3KJ6L 15C8H 4GG6E 1I4FA 2EZ0C 5JW3H 5E4EC 5IBTH 3ARVA 1S7XB 1YNLL 1VGEH 3HAEG 3HMXA 4WI7A 1HWHB 2FBJL 4JVWA 1F97A 4CNIB 2DM3A 4EDXA 1GZPA 3RVXD 4NN7B 2DDQH 5F1SA 1MRFL 4XXCA 1UM5H 3O9WB 4Z7OF 4X98B 5C0JB 4EI5A 1BQHB 1PY9A 1J10A 3FQNA 3V0WH 4X8XA 1N4XL 1IQWL 1DQDH 1OSPH 4P2OA 3VI4E 1AO7A 4XTRC 4GBXC 2MOVA 5C0AE 3U4AA 3OBAA 5DS8B 3V0AC 4TPRH 1BJ1J 1HSBA 5BZDB 4Z7WF 2ATKB 4QRPD 1J0JA 4R26H 4HIJB 2IG2L 4G9FA 3WS6A 3VGEA 1E4XI 2E7LC 1AP2B 2PYEB 2BX5A 1MOEA 4PJDE 4DKAA 5F96H 3H0TB 2DL9A 3DIFB 3ALWA 3KPTA 4Z7UA 3L3DB 2B2XH 1DFBL 4ZFFB 2GCYB 3DMMA 1FC2D 2UZIH 2IANA 3CNKA 5JR1H 1FQ9C 1XEDA 1FE8H 1T20B 1ADQH 3QI9B 5IQ9A 1U8KA 2HRPH 4JDZA 3LKPB 5FO7A 3TH2T 3CFDA 1CE6A 3MA7A 3MFGB 4ODUB 4QRUA 4B53A 3B6SB 1V3MA 4MX7A 4Q6YA 5JIKA 2MQCA 4BKLB 4P4KD 25C8H 3JV0A 1R3JA 5JZ7D 1FORL 3IFNH 4R3SB 5C0ND 3U9PL 2R0ZL 1NCCH 1U58A 1DUYB 3BEVA 1ZXQA 2F8XC 4JO1H 3N85H 4UUJA 3WSQH 3QDJE 3IAGC 5GRWA 5F7WC 4DN3L 3B2VH 3B9KA 5C2UB 4K3HA 1BEYL 1BF2A 3MBXL 4H26B 1GC1H 1ACZA 1S7QB 4N90D 1I1AD 1REIA 4FTVA 1M7DB 2HT3C 1LK3H 3O11B 1U8LA 4JM2C 4H1LA 2XTJE 4LCIH 1QHPA 4XXCC 4TNVK 2OBGA 1ZT7A 1X5XA 1IGYA 5FECB 4EI5C 1CGTA 5DVOA 3P77B 5F1OB 4APQB 4H88L 4HWUA 3P0VH 5CGYC 1EGJL 2BXYA 3BH9A 4XBGB 1QUNA 1TJGH 3DYOA 4OM0L 4P2OC 2HLAB 5FIEA 3TBYA 3QQ9D 5H8DA 3U0PA 3TJEH 5CJXC 1PQZB 1MH5B 4KHTL 5CZVH 1EEYB 5D93C 1JYXA 4PY8J 3TH4T 5KW9H 3D85A 3WS6C 4PGZA 5I1KL 5HVHB 3QNYA 4KK9C 4U1IB 4WEUD 3TN0B 2Q86B 4XHJD 5F9JB 1S5HA 5KSUB 1F58L 1NUFA 2DQHL 3V95A 4KI5F 1X5KA 3BZFB 2X89A 2APTA 3SHSA 5ABDE 1BBJA 3IFPA 4QT5B 4NQEA 4OFDA 3MRQB 4PJHB 4XPAL 3K81A 5KS9B 1T0NA 3RTQC 2MPAL 4ODXA 4U7SA 2DQTH 4HUUA 3W39A 4YPGB 1G9EA 3P4LA 3BJLA 1QYGL 4IM8A 2P5EA 2WANA 3SBWC 1I7UA 1S9WB 5BMFL 2EYSA 4Y5YA 4L1HA 5HYSA 3ULSA 1YEDA 4RNRB 2YMXH 1RZ7H 4ODHL 5A3IC 5GZNC 4ZSOE 1HSAA 2OR9L 2FX7H 3C2AL 4J3OC 4PRIE 1H3PL 3O4LD 1KEML 4HKXB 4YBHA 3MBEB 1Q9OB 3L5JA 4IRJD 4K2UL 4KROC 4FP8H 2NY0C 5IT2L 1T22A 3DLQR 2IQAB 4AT6B 1M4KA 2X05A 3ARGA 4HPYH 1RZ8B 1UYWH 2DLGA 3HUJF 2WBKA 3QDMA 3PQYE 5D7KE 2F5BL 3CK0L 2JCCF 2A9NL 4E41B 1E4WL 2VLRA 4XVUC 1B6DA 3OAYK 4WFHD 5MI0B 3IJYA 3NCJH 5FGRA 2H9GB 1X5YA 3QUYD 4RISL 1ZANH 3RDTB 3V8OA 3GRWL 1NBVH 1YECL 5I17B 1EHNA 3DXAB 3C08H 1KFAL 1J05A 4IOSD 2VDRH 3ZYJA 4PIRF 4GG6F 4IHOA 3PHQB 5I73C 2HTLC 4NQDA 4P2QD 2BFVL 2X4TA 2X4QA 1VKXA 4MA1C 5HGGS 4F57L 1IMHC 1K2DA 4UIKH 4QXTA 2CO6B 3WLBA 4WI5A 3QHZH 2F53B 4P46D 3PWPD 4E42A 4GQ9L 1RAMA 5J1SC 3K2MC 5TE6H 4MGXA 1QA9A 1R5IB 3HZKB 1DN0A 1XGTA 5E00A 3RL1A 3SKOA 3CSYA 1U93B 1H3VA 4NNYA 4N1HB 1AD0A 5B38B 3VI4F 4Y5YC 5IG7B 3OPZH 4U3CA 3SDAA 1A6VL 3PHSA 1KIQB 4IMKA 1DEDA 1J7VR 3HZVA 1GOHA 3PJSB 4UINH 8FABB 1WCBB 1DDHA 3GJFB 2X4RA 3TA3B 2ICES 3PL6B 4WGWB 1NSNL 1S7RB 3FKUS 3TJHC 2E7BA 3VFOB 2YA1A 4PJDF 1IC4H 1T1WB 4GKZA 4O02H 3VDCA 4WCYL 2RFXA 2P8PA 3VGBA 3FQUB 5MENA 1B2WL 4BQBA 4M6NH 3NCCB 2Z91A 4JKPL 1NL0L 4GAJL 1A2YB 1X5GA 1T66D 4Y16B 3EYFA 2GJ6D 3QPQD 2YN5A 2AJYL 3SY0A 3X13B 5JIPA 1P5UA 1OP3H 1QBML 2VLKE 1CGYA 3KJ4C 1A3LL 2YPVH 4AMKL 3IRZA 1KULA 3DRQB 1T03L 1YDPA 3SGEI 4O9HH 3P30L 3BD4A 4NZJA 1UWXK 1MREH 3C2SA 4LSRH 1G7HB 4H5SB 3R06A 4MS8C 4AIZA 1QRND 3V7AE 4AQ1B 3VW3H 5IFAH 2QQLL 4Z76B 4EIZC 4FQQB 2B4CL 3GSWB 5BQ7A 3HC4H 4MNGA 1NBZA 2FECI 1R5WB 1CLYL 5I1LB 1D5IH 1ZLWH 5I16A 1S9XB 2QJDA 4JRXD 4PTUB 3CZFA 4Y4KA 5DURB 1IGFH 3V9FA 5ICZB 3GBMH 4DWHA 4ZTOH 3FRPG 1K5NB 4LARL 1ORSB 4MA7H 1TZGL 5ENWB 2A6JA 4JRYA 1YUHA 3CCHA 4XB8A 2NXZC 4LP4A 2VXQH 2VH5L 1HHJB 4OM1L 1VFAA 1PEWA 5I1HL 3ULUF 4JRWA 4XCFL 1MFNA 3PWJA 1FG9C 2A2QT 3SDAC 5JTWA 4OIAA 1F2QA 4IMKC 3GO1H 5GRUH 4U3HA 5D8JH 2I27N 5FB8B 5E8OA 1OAXH 4YQXH 4KVNL 3ARBD 5T3XL 3VXSE 4BSWB 3V6BR 4YDKH 4DKFH 2X1OA 4PJ9B 5J6HB 1CFVH 1GVIA 1VENA 2EICA 5FUZL 1RJZA 5I1GH 3HE7D 1QRKA 1U95A 2Y5TA 4YR6A 3T0BA 4OGZA 4POZD 1NC2B 4YHNB 1MJJB 1OY3B 3KPRD 1AR2A 2BC4A 1YEFH 1A3RH 3EOBB 3SDDC 4KUZH 3GMNB 4XHQA 1CE1H 1CK0L 1R5VB 4MJ2A 4YBLB 4MLIA 2AGJL 2OL3H 4JG0H 1EBAA 4KAQH 2AK1H 3RGHA 3UBXA 2DQGL 4PJHE 3AVEA 3VXOA 5KS9E 3TZVD 4M1DL 2P47B 4LF3B 4BH7B 1X7QB 2NPLX 3A67H 4Y2DD 4RMUA 1RFDL 3TGXA 4Q58C 3LSOA 4F7CB 1MY7A 2CH8A 3RZCC 1JI1A 4RZCA 3FB5B 4HKJB 1ZOXA 4QHNB 1FJ1B 4TOYL 5ERWA 1YY9C 3T65B 4Y4KC 2YKLH 3V6FB 3KXFB 4PRPD 5H35A 4UT9H 5T1DH 1XF1A 2GYSA 4F7TB 4U6VL 4X9BA 4R4FH 4ZUTA 5F7LB 5IIEA 1KENL 1OTSD 3UTTE 4WWKB 3MNZB 1CLOH 5DR5L 1YY8B 4LDEB 2NY5H 3D48R 1U42A 3VD5A 2BVOA 4HGWB 2I24N 5J13B 1SHMA 5EC1B 1K6QL 4M03A 5C0GA 3V79C 4OIIH 2VZ1A 2X4SA 4ERSL 2BSRB 3MRLB 4JJHA 3R1GL 2F54A 1BZ9B 1XR8B 3OJVC 1MQ8A 1WJ3A 4I77L 1YEJL 1I8IA 4E41E 2Q87A 1KPUA 1IEAB 4YDJB 3GZKA 5JXEA 4XGZB 2EZ0D 2IPTL 2VLJD 1WZ1L 3SE4A 2ERJB 4YDVA 5FEBA 2AP2A 1RV6X 1DSFL 5GS1C 2R8SH 5HYQA 1RU9L 3HMXH 3DXAE 4LSVH 1Y18B 3HR5B 4P5MB 4UNVA 5F72S 1EFQA 3OF6D 5C9JA 5C0EB 4N0YH 2NW2A 3CX5K 5IJVB 2ZSWA 5FGBC 2OR8A 5CZXC 5C0RL 2YD2A 4L8CB 4XNYH 1TZHA 1UXWA 2C3WA 1IBGH 2NY1D 2E6JA 2HKHL 1E4XL 5ETUA 2F53E 2WMPA 4LIQE 5EH1A 3RWJA 2GUOB 4PGEA 4GBXD 4BZYA 1XZ0A 4NKDA 4HMDA 3MC0A 4JPKH 3T77A 4G6FD 2R1XA 3L3IA 4WV1B 3S36X 4K8RL 4LVEA 4F2MA 2OP4L 3B5HA 2VRAA 1S9YA 3O3DB 5GRZA 4R96A 4U49A 2CSPA 1T7VA 4FQ2L 1FL6A 1QLFA 4R7NA 4PJBA 3O8XA 2OTPA 4BK5A 3NPZB 4MDJB 4NHUA 4P3DB 4LHUG 2ESVD 3CVHB 1KN2L 5EO0A 5L88H 3NVQA 2JB6B 4BZ2H 4B50A 3O2WL 4LCUB 1BFTA 4HG4J 1L0QA 1N59A 3LN4B 3WXWL 3V0VA 3B3IB 3FRUA 1QLEH 5HI5C 2AJSH 3ZHKA 2Y06H 4MJ6A 1DBBH 1MCNA 4WI6A 4WTWA 1PLGL 1G7MB 4GW1A 1D9KD 3DBXB 1PYWA 1SYVB 5FA3B 5JXEC 4YHZH 4Z7NE 4IDJH 5A40E 3SE4C 3GIVA 5I18L 1A1MA 4K3DL 3I02B 4J4PA 4DZ8A 4C57C 3FTGA 4GRLB 4ZMAT 4OCSH 4OSUL 3SQOL 2HT3D 2A1WH 2PYFA 5D1ZA 4H1LH 4CU8A 2PTUA 1KCRL 3L3GB 1BQHG 2ATPA 1HDMA 3O6FA 4EI5D 3IT8D 1MJUH 2WIIB 3TFKC 2EE6A 5CAYB 1AXIB 1A02N 1FVEB 4P2OD 3V4PL 2B4CC 3WD5L 4QRSA 4UDTA 3VRIA 1HN1A 2QTEA 2VDOH 7CGTA 2P5WB 1KBGH 4DFIA 1P4LB 4G9FD 2V17L 3ALPA 3WJLA 5EUOB 1I85C 3PP3K 3DX9B 5IBLC 4HDIB 5FDYA 3UTPE 3B9EA 4JDVA 3DMMD 2IAND 3O8XC 4TSBL 2DKMA 4JZJA 2ZNXA 1SYSA 4XCYB 2LABA 3V7AG 5IBUG 1A14L 1V3JA 5ILTL 3H3PL 2PTTB 5TFSL 3RZWA 1E27A 4XBPA 3T4AB 3L3HB 1RJYB 3MV7A 5FUCE 1AGDA 4PJHF 5J6GB 5KS9F 1JFQL 1JIBA 5JQ6L 1G7PB 5IFJA 1Z9MA 3VRJB 1W2KT 2VDPH 4LMQI 5EBLB 4UQ2A 2OK0H 3B9KD 3KJ6H 2V2WB 2AK4E 1WTLA 4JHZA 2DMBA 3BVNA 5E2UL 5A43C 4GAGL 4LCCC 4J4PC 5A3ID 5CEZH 4FTVD 3V6ZA 5I1IL 4JFPA 4I1NB 1PSKL 4LASL 5IB3A 1MRFH 4WDIA 2P8MB 4XP5L 4KROD 3MGTB 1JZ3A 1RMFH 3GMRB 3ULVF 4XP9L 5BS0A 5IESL 3KXFE 3UEZA 1IQWH 1KC5H 5KN5B 4Y19A 3F58H 3BPCB 4JCLA 2R0LL 1BLNB 1BQLL 3BAEH 2HLFD 2LAAA 3UO1L 2BNQA 5C0IA 3D85D 3WE6A 1A6TA 2AERT 5BW7C 5DDHA 5L0QC 3S36H 5IM7A 1OAYL 1DFBH 3SGJC 1WIUA 3L7EB 3V5HB 1YEEL 5IKCA 1URLA 3EDDA 1RUQL 2X89D 3QUKB 1GGCL 1GAFL 2F5AH 1CFSB 3A6OA 5CILH 3BXNB 1HEZA 3D25B 1QOKA 4QOKA 1FORH 4HEME 1FC1A 3LKNA 3U9PH 3VFVA 3WYRA 2MWCA 2P5ED 3MRMA 5D5MB 3VFMA 3S4SB 3CUPA 2EC9U 4YFDB 2ZKHL 4DN3H 1MHCA 4W6YB 3BN3B 3JV6B 4YX2L 2VWEC 4U0QB 3GJEB 4H25B 5FKPA 2X9YA 2R2BB 2OMNA 3B9AA 5CUSH 1AHWA 5DJYB 5CEZD 3MRFB 1MI5B 5FHBL 5DQDL 3EJZD 2BVTA 5HHXL 3FB6B 3QDGE 5GGTL 3VFSB 1MEXH 5CEYA 3VFTB 1IAII 3TPKA 3SQBA 1KNOA 4H88H 3S5LB 3AUVA 3OAUL 1OTTD 4B7IA 3HMWL 3AU1B 4OM0H 3ARGD 3TNMB 2J3SA 3IFLL 1I8LA 3QDMD 4R0LA 4L8DB 4M43H 4Q97A 1IC5L 4KHTH 1UACL 1ONQA 4NRYB 2VDKL 3W5MA 2BCKB 2VLRD 4K8RC 1F00I 1KB5L 3GMOB 4P4RB 3TT3H 1KLGA 5JOFB 2ENYA 5CSZA 3GMQB 1F58H 4PJFA 2DQHH 4RGND 2DL2A 1OVZA 1ZT4B 4G9DA 3P11L 2V7NA 2NLJA 1FSKC 3C5JA 1WVZA 2HN7A 3TIDB 4NUGL 4NNPH 4Z7NF 2H6PA 3IDUA 4NQDD 1KCUH 4XPAH 2QR0A 4YGAB 3SGKA 3P9MB 1R3LB 1CDGA 2CDEB 4ZNEE 1KCVH 5FM5O 4F7EB 2AKRA 1D7FA 2R69L 4F9LA 3ZE0E 1QYGH 1H3TA 4G5ZL 5EZJB 2EDXA 1OHQA 4S1QH 5E7BA 3PIQB 5FM8A 3S35L 3QIBB 5K9QI 2VKWA 5SX4I 2VQTA 4KTDL 1CDIA 5BMFH 5JA8B 2I26N 4L8BB 4J3VA 1CD1B 1V7NL 4QCIB 3X14B 1PX4A 3SDAD 3UTZA 3U2SA 4ODHH 3BZ4B 1W72L 1AHWC 3K1DA 4QGYA 2PW1B 3TBTB 5FYKL 1P2CA 5E1AB 3WNOA 1KEMH 1T5XB 4MAYC 4ZUUA 4OZIA 3RAJL 5CGTA 5EIIA 1D5ZB 2P5WE 4FXGA 4K2UH 3O4LB 1RHFA 5MEND 2EIZB 3KLSA 1KJ3L 2YWZA 2AJUL 4D0BB 1LVEA 4X4XB 2Z9TA 1NANI 4XCNA 1I8LC 3QUXD 5JO5A 4R0LC 4KJPC 4AH2B 2F5BH 5IROC 4O5LH 2ZWLT 2A9NH 1XGPB 5HGBB 1E4WH 2K3TA 2Q76B 2QKIB 4XRCB 4Y0GA 1MAJA 4IRZL 2FH6A 3DX7A 1TQCB 4NWUL 4N0CC 2DQIH 2ADJB 4MQXC 3MRNB 1KFAH 1QSVA 2X42A 4LL9A 3CJJA 1XF3B 3DVNB 5JPMB 3BQUA 3T2QA 1N64L 2GITA 1DVFA 3O3UN 2XWJB 1YY9D 5L2JB 4OF5A 5LCVL 4Y4KD 4HG4K 5IGXL 4GJTB 2EE9A 4X99A 3KPMA 3O2VL 4GW5A 1FBIL 4GQ9H 1U8JB 1MCCA 4JRYD 5F71A 1MWAB 4P46B 3NGBB 4YHLL 3CDGB 1IE5A 4PJ7A 1TTUA 4U1LB 3WL9A 5IW3A 1T2JA 1FFPA 4HKBA 5DK3A 4JFFA 5HYJB 5AUMA 3KYMB 4Z7VB 2V5TA 3ZE2E 2V5RA 5IVNA 4H8WL 3ARFC 3MYJA 1FHGA 1EZVX 1EHLL 3DO3A 1GZQA 2NZ9D 4GRWH 3EFFB 1NSNH 1YPZE 3LHPL 4YEEA 3VGHA 1CFNA 5GGTA 3GM0A 1RUML 2ARJA 5D2LB 4BFEA 4WCYH 3D0VA 3E3QC 3CFEB 4XNMA 4X7DC 3F7VB 4F7PA 3INUL 1B2WH 4JKPH 1NL0H 3TYGL 4FQJH 2XY2A 4QRPE 3RPIB 2AJYH 2EXYC 3QFDA 5D72H 4NM4L 3GBNH 1QBMH 3ZTJH 2VN4A 4NQSA 4X0KB 4C56B 1MHHB 1N6VA 4OLXL 3TO4D 1CQYA 3PDOB 1AIFB 5JORA 2ITDA 4KMTL 1WWBX 3OHXA 4DGYL 3P30H 4GSDL 3QIWB 4WHYG 3CH1B 5CZXD 4LVOB 4HAFA 3OR7A 2X4NB 1R24A 3C5SA 1QQDB 2QQLH 3IDYC 3FQRA 5DEZA 3BHBB 1CLYH 4OD2A 1JF1B 3SDCA 3CSGA 1P4BL 5I66B 3JTSA 1UXSA 3WN5B 4BSVB 2YUZA 5KVGL 4ZO9A 4LARH 1QFHA 1TZGH 5EBMB 3BWAA 1U8QB 4FFZL 1ETZA 3OXRA 4MNHA 2A6DB 3LRGA 2NX5B 2VH5H 1E4JA 1MI5E 4OM1H 4Y5XA 4D8PA 1C12B 4N90E 4NQCA 5IHZB 4XCFH 4LSTL 3RY6A 4JFYA 4NKIL 4DKEL 3ZLQC 2M8XA 3BYTA 1P9MC 4G8FA 2MFNA 3IGAA 3VFPA 3AXLB 4U1SA 2AJ3A 2DKSA 4DUWA 3FFCA 5HI5D 4KVNH 5T3XH 4U7KA 3D0LB 1T04A 5INCA 2F54D 1P7HL 4L29B 2EE2A 5FUZH 1P7QB 4Y8AA 4WW2B 2AJXH 5EOCL 2QSCL 3STLB 2VMFA 5JXED 5E95B 2EC8A 3UP1A 1MHEA 1TTFA 3UTSA 4L8SA 4MA3A 2DWEA 3DSFL 1M71B 1QSEA 4K7PY 3N1PC 1JYWA 3EYSH 3AREB 5CGMA 4NRZB 3KPRB 2IBZX 3L3JB 2NW3A 2OTWB 1CK0H 5GQBA 3OKOA 2ZUUA 2AGJH 4NYLA 4JQIL 1UENA 1BJ8A 3RKPA 5FYKU 5EZLA 3RWIB 2DQGH 2D7NA 5E6YA 4DUXA 4M1DH 2C26A 3BT2L 1J0KA 5KANG 4CVZB 3TFKD 4JN2A 4N5EC 4QO1A 1RFDH 3BIKA 1C5DA 3IFOA 3VXPB 3EYOA 3BD5A 1ZHBA 2N56A 1QFWM 4IOIB 3WEXA 1JHKL 1MCQA 1H3WM 3ILPA 3GM8A 1INQB 3SDCC 2YD9A 3KYNB 2DBJA 1YN7A 4HIEA 5C09B 5ANMA 1QEWB 3Q5TA 3BP7A 5T3ZH 4KGLA 3F7RA 3GMMB 4U6VH 3O8XD 4OLWL 2FIKA 3NBNA 1KENH 4CMHC 2DQEH 2AEWA 1M1SA 3FN0L 3SDXB 5DR5H 3NFNB 3QCVL 3UTQA 1SJVA 4QHLB 3BJ91 2BSED 3BPLB 3EGSB 3O4LE 5FYJE 5B8CB 3U6RB 4CN4A 5CBAA 1DQJB 4PJAA 4PLJC 1K6QH 1H3GA 1Q9LB 4L9DA 5D96B 2WV3A 4ERSH 2JK5B 5T3XD 1T7YA 2A73B 2DQFB 1UJ3A 2Q20A 2AS5M 4ZOBA 5EU5B 3ABZA 4I77H 1YEJH 5DRXA 5FHAH 3EYQC 2Q8AH 1IGIH 1LP9A 1VPOL 3BISA 4HF5L 3QO1A 1F3DJ 4WFHE 4JFQA 2ORBL 1WZ1H 1D5XB 3DURB 4NZTL 1C8PA 4L8SC 3EJYC 1DSFH 2NY2C 1MFDL 4PBXA 4J4PD 1RU9H 5E4EB 4G8IA 5FOBA 4JREC 2FBOJ 5D1ZD 5A16B 2MKLC 3O6FD 32C2A 4P2QE 1OW0A 3UXFA 3FT2A 2WLYA 3EYVA 1HXMB 2HKHH 1E4XH 1HYSC 4JY6B 3O3AA 2FLRT 4NUJB 3ZE2F 3KPLB 1OT1A 3PWPE 4PJGB 5F1NB 5IEHA 3VFRB 2DRUA 1DLFL 3BW9A 1T1YB 3F6LA 4HWBL 1P6FA 2F19L 1YC8A 4K8RH 1DLHB 4GUPB 1WFOA 4Z7VE 5SWQA 4WVRA 4EN3A 3LS4L 5DJ0B 5T3ZD 4L9LA 3ZSSA 4HFWB 1L6XA 2FB4H 1AC6A 4AENA 2C7UA 5D2LE 2HG5A 5JMOC 4NZDA 3V52L 1H8NA 1P53A 5IW1A 1JWMB 3I50L 1S7WA 4H8WC 5L2KB 2HJFB 1MCLA 3LB6D 2A6IA 3QG6A 5CINL 3CFKA 1FRGL 2YZ8A 5LWYL 3GSVA 3CFIC 3MV7D 3SOBL 4DGVL 1UJ3C 2GJ6E 3BN9D 4MDIA 5DJ2A 3OKLA 1PLGH 3G5VA 3BUTA 1QLRB 2VZOA 1T0PB 5D7JA 3E8UL 3D6GA 2LFGA 3IXTB 3DROB 4IIQA 1KSRA 5SX5H 3S34L 4OD3H 3G6JA 1KCSH 1CZ8L 1IC7H 2A38A 1IAIL 1WZKA 5DGRA 4U1GC 1FCCA 1EHAA 3DVFA 4OSUH 1WAAA 5ESQA 3SQOH 4KQ3H 1QRNE 1GSMA 1MVUB 2VYRE 1ACYL 4JKKA 5TQ2L 4Z5RB 3MRCA 4JM2B 3DX6A 2CDGA 1GZPB 3PXHA 2RBLA 3VU2A 1OW0C 5BS0D 4RGMC 4JRXE 4Y19D 3V4PH 3WD5H 1EO7A 3FQNB 1BFOB 5AD0B 2ADIB 1RULL 2D31B 1VDGA 1AO7B 2NX5E 4RFNC 2VDMH 2Q6WB 4WO4B 2BNQD 1JGDA 2YRPA 4K8RD 5JW4Q 2V17H 3WUWA 4X4YA 5D93B 2IMNA 1SJEB 3LQMA 3QQ3A 3LV3A 4WU5B 1MCOL 4ZS7H 3LQZB 3CIQA 5FO8B 1CDHA 5D1QA 4TSBH 1E0OB 2CKBB 2DYPA 4KRPD 2VAAA 1JBJA 4PLKC 5JPNA 5IQ9B 2J4WL 3WKMH 3V7MA 1A14H 5ILTH 4QRUB 1GGUA 5TFSH 1IZKA 5J9PB 4HUVA 2NXYD 4QOKD 1C08B 4MX7B 2X4OA 4HD9A 3RTQB 1SBSL 1TFHA 4ZUWA 4XH2A 3S4SG 2V2XA 2VR5A 3C5ZC 1JFQH 5JQ6H 1K3IA 4PS4L 4LCYA 1NGXA 1U58B 3KPRE 3ARYA 5F9OL 2VZUA 5EBGA 2VDNH 2R9HD 4NP4H 4IIQC 4QXWA 5EBWA 1NGYB 1JZ5A 1ZVHA 4GAGH 3RUGB 3ZTNH 3K80A 1UWEL 4PGCA 4BSJA 1D6EA 3G5ZA 1S9VB 3O2DA 1RURL 3R0NA 1FVCA 4H0GA 4E0RB 4XP5H 4H1LB 3S5LG 3MFFA 3W9DA 2BNUA 4C55A 3EJJX 4XP9H 4ZS6C 4NHCH 1IGYB 3RVVC 2NY0B 3CDFA 4PJEB 1I3GL 2W0FA 4ZQKA 2R0LH 3BH9B 5AZEL 4PRPE 1BQLH 4JFDB 1JMZA 2H32B 4UQ3B 2M1KA 3CXHJ 3MRPA 4CN6A 2YBRB 1XGRB 5IVXA 5C07B 3DECA 3SDXE 2VISB 4GRMB 4N0FB 2GTWA 3WNNA 4N0CD 4KK8D 1C5CL 4GXUN 1OAYH 4Y1AA 1NLBL 4GFTB 5D1QC 2KL6A 1R0AL 1YEEH 3MNVB 5C08A 2YC1B 1QBAA 5DK2B 3P0YL 1GGCH 2YUWA 5DEFA 4I3GA 5DZLA 5I73B 3BEWA 1BBJB 5ICYA 2ADGA 4MVBC 4NQEB 5E0QA 2H41A 3DYPA 2IWGA 2YD8A 1QO3B 1T0NB 3VWKB 1T6WA 2K1MA 3LPGA 1IFHL 5K33A 5DHXB 4X6EA 4WTZA 2VKXA 2X4UA 1U2HA 3RNQA 3EUUA 3MUHL 3W82A 1I1FA 5HYEA 4Y5YB 3C09C 3BH8A 5JIHA 4QHKJ 2YK1L 1BIHA 2BRQA 5FHBH 5DQDH 5C7XH 3KYKL 5HHXH 4PR5B 5I74C 2Q7NA 1EVTC 5GGTH 4Z7VF 2WNGA 4PJGE 2EDOA 3IJSA 5KSBB 3NFSL 2PETA 5HDQH 1MCWM 1YMHA 3OAUH 4RFEB 3HMWH 2R56L 5D2LF 3F12A 2W9LA 1F4XL 2YWYA 1LO4H 2XZCL 3DI2B 3BGFC 3PWVA 3NCFB 1GCFA 1U36A 5HGHB 2ZUSA 1IC5H 5C0FA 1UACH 3TEUA 4U1KA 2VDKH 4OUUA 5GJTL 3RWFA 2LVEA 3U79A 1JNNL 1X6LA 1XGYL 5C6TL 3KJ4B 3RY4A 5DD5L 3MROB 4CW1A 1DBKH 3IJYB 1T2QH 5L2KE 4NN6B 1NGPL 5E1HB 3DGGB 3TCLA 5E5MB 5L8LB 3P11H 2R23A 4HUXA 4NUGH 3BQUD 1J05B 3O6LL 4MA8L 4M6OH 3SE3C 3TPUA 4GW4B 1DVFD 4NJ9L 5I1CL 4UZGA 5DI8A 3QPXL 5DJ8B 4Q0XH 2XXMB 1A4JA 1R6VA 1X4YA 3R8QA 2R69H 1KPVB 5EWIH 1ZGLA 2UY6A 5E8PA 5HHPB 1C1EL 4R97C 4F9PA 4NSKB 2NXZB 5H37G 3WHE1 5E00B 3MLZH 5DRNB 3CSYB 1WWWX 1V7NH 4OCYL 4JFFD 3OKEA 1ED3A 1AD0B 1N5AA 2YPLA 5E5RB 4OZHA 1C7SA 1NUDA 3QEQA 4PRBB 3CDCA 4QRQB 3QEHB 5DVKA 4KKNA 2XICA 4HS3B 3QG7L 3TLRA 3W11D 4PUBL 1DDHB 3JTTB 3RAJH 1AO7E 2A6KB 2ADFH 3BRFA 1EAPB 1AKJA 4GKZB 3VG9C 1OARL 1MLCA 4XPGL 1MCPH 1JUFA 5I76B 2AJUH 3D3VA 3DVGB 1S7UA 4G9FE 2NY6D 2P8LB 1H8OA 4HUWA 3W2DH 4LLAA 4KJQC 4WW2F 5FV2A 4Z7UE 2WSKA 1FZOB 3RNKA 4XP1L 3WIIL 5SWSB 4IRZH 3SDDB 1VGKB 4NWUH 2J8UB 1W0YT 4HHAB 4M1CC 1YDPB 1A0QL 4N5ED 2VO5A 5EC2B 1Q0XL 3MQIA 1X5AA 3K2UL 4WW1A 1CF8H 1N64H 1HYRC 3RZCB 5F93C 5BQ7B 4JM4H 4NO2A 3SDCD 1F4AA 2OLDA 5GGVL 3O2VH 4Y4KB 1FBIH 1JPFA 4P3CL 1ZHLA 1WBYA 3MV01 3VG0H 1HOCB 4BUGA 3RUGE 1A6AA 4F9PC 3U83A 1TVHA 2P4AB 4GQPH 4NQCD 3ROLA 4FTVE 1QVOA 5KZCD 1RVFH 2JIXB 2OQJB 3L95A 5I2IB 2XRAL 4JB9H 3IDGA 2X40A 2XWTA 1N3NB 1QR1B 4KVCL 4H8WH 4JEGB 1OP3K 3PWJB 4LSPL 3BP6A 1SQ2N 2BRRL 5GRJL 2P24A 3MLTA 1EHLH 5AYUL 2ENSA 4HK0B 4PJEE 1MRDL 3FFCD 3SDXF 3I6LD 4R4NC 5SWZB 4JFDE 2J6EA 4HS6B 2ZSVA 2AJVH 5F7DA 1FNGB 3INUH 2AXHA 1G0XA 3EYQD 5BZWA 4HV8B 5JDSA 3TYGH 1HQRA 1FO0A 5F7FA 1A7PL 5LXGL 5EU7C 3FAXA 4NM4H 3UTSD 1EFXB 4YR6B 1QSED 1J0HA 3QNZB 4K3JL 1ZLWK 2ZG2A 5GS1B 1J0YA 2BC4B 2KZ1B 4QF1A 3RHWF 1RIHL 4I3RL 2N1KA 1A3QA 3QXDA 4PRHA 5FYLL 2BVPA 5DFWH 3HRPA 3EFDL 1DP0A 2NY4C 4NQEE 4Z0BL 3QH3B 4I2XA 1LO0L 1OLZA 5J3HC 3BGMA 3HI6L 3O6KL 1TCRA 1T2XA 1RUKL 3RX7A 3UROR 5JHDB 1KIPA 4QRRB 2P5EE 1P4BH 1I9IH 5KVGH 2FJFB 4Y4HC 4PJGF 3P4NB 4FFZH 3RVWD 2VB5A 3RHWK 2MCG1 3AS0A 3P2TA 2R1WB 3MV8B 4LSTH 5BXFB 3I6KA 5DMGC 4DKEH 4WUUA 1A6WL 2GSIB 2R0KH 1H15B 3WBDA 2D03H 4DEPC 1FZJA 1LDPL 3GI8L 3LKQA 2VJXA 3CGTA 4JQVA 4ALAL 3X12A 3HRZA 4B0MM 3RU8H 5EOCH 4FQ1H 4ZUVA 3U48A 1I8IB 3BPNC 2VLRE 3PXJA 1KPUB 5AWNH 4PGJA 4X4MA 4IRSA 2QL1A 3DSFH 2DM2A 1DL7H 3MMEA 1B90A 1IM9A 3QXVA 3MZTA 1RZKL 2VLLB 5IW6A 6CGTA 1JNHB 5HYQB 3W81A 2VDLL 4RGNE 4JQIH 4G7VL 2Z8RA 1EUTA 4UBDC 2NW2B 4YO0A 5JNYB 5KVFL 4NQDE 3B5GA 5EFIA 4ZFGL 4RWYL 4WI3A 3H6JA 5C0BA 1T80A 3T0DA 2H2PC 3BMWA 3CLEL 1A4KB 4JM2F 1G1YA 4U2YA 3I3EA 2P49B 4NKDB 4MQSB 2B5IB 4ETQA 5EZIH 4EN3D 1XF4A 4WU7A 4R96B 4HH9B 1J8HB 1NMCC 4OLWH 4ELMB 5LVEA 1FL6B 1QLFB 4R7NB 4EOWH 3NIGE 3T2PA 3O8XB 1KYOJ 3ESUF 1G7QA 3QCVH 4JPIA 3DX8B 2UVEA 3ARDC 1JMXA 1A9BB 3QWOB 4PRNB 2DQCL 5MENE 3N06B 4JQVC 4JANA 1PDKA 2YXMA 4OCXL 2FX9L 1N59B 4CKVX 4F7MB 5EG6C 4ISVB 2FH8A 3TM6A 1RD6A 4Q6IA 4MJ6B 5HYFA 4NPYB 1BP3B 2HVJB 4HQQL 5D7JD 2YD1A 5SWSE 4HF5H 3D87B 4P5TC 2R4SH 4NGHL 3H8NA 5JLZB 1PYWB 2DN7A 1I9RL 3RBGA 1MFDH 5CSBA 3QUMB 1A1MB 1CLZL 3FQTA 2CRIA 1J1OL 4LCCB 3UPCA 3L9RA 1JK8A 4L3EA 4PJIA 3O2DH 3WNLA 3P4OB 4G80A 1BWWA 4X6BA 3D2UA 1ZAGA 5D9SB 3RUGF 2ATPB 4DGIH 3QEGL 2HT2D 1OGAB 3MACH 3TWCL 3MOBL 3DWTA 3OKMA 4UV4H 5IEKB 1V7MH 4I8DA 1IL1B 3MRBA 2O26U 3IDIB 4MXQC 2N7AA 5DQ9B 3C6SA 4LPVA 1DBML 4JRYE 3BYYA 3VXUB 1DLFH 4UDTB 4XXDA 2F19H 4U1NA 4PJEF 3QIUC 4XNUL 5GS0L 1KLUA 2BMKA 5AAMA 2R4RL 4OAWA 5A2JH 1E28A 4YEFA 2CPCA 3U7YL 2HYMA 5L0QB 4ZPTA 2DYPD 2W9DL 5IMKA 4XNZC 3GSUA 1IGMH 5ISZA 5IMMA 5TDPB 3LZFL 2VITA 3V52H 1SYSB 1KPRA 2X2YA 1SJHB 2NR6C 1NEZB 4WI8A 1U8HB 1II4E 5CINH 3PGCA 3DSNA 1FRGH 1NAKL 2C4FT 2QSTA 1E27B 4J1UA 3SOBH 3GFUA 1XH3B 4DGVH 3C8KA 4OZFA 2ZCHH 3OKYA 4NC1C 4Q6IC 2ZCKH 1AGDB 4ZOAA 4NZRL 4X7SH 2VL4A 2ZOKA 1BM3H 5BJTA 5HHOA 3NZHL 2W07A 3CMOL 5EU4A 4NC2B 3S34H 3DRTA 1CZ8H 1SVZA 1MQKH 5FA4B 1IAIH 3NACL 2J7LA 1Q0YH 2PN5A 3OJDA 2B0SL 2XZQL 1J12A 1U41A 3TVMC 4H1LG 1GPOH 3FB7A 1YC7A 4OCWL 4JO3L 1I7RA 1AY1L 1TVBB 4XNQA 3U36A 3JUYA 3HC0A 3L1OL 3FN9A 1YNTB 4N1EA 4GKOA 1H3XA 1RULH 1AXSB 2PCPA 2BXZA 2NCMA 4V1DA 1TETL 4LAQL 1KB9J 1OAQL 3J8F7 4P2YA 1EHXA 1T5WB 1QSZA 1AQKL 5C0IB 3WLWD 2E8ZA 5F1IB 1MCOH 5KSAC 4I5BA 4N0UA 4Y1AD 1XCTB 3FT3B 1A6TB 2GQHA 3VRLE 5C08D 3T0WA 1KTKE 4PBVC 1K9TA 3FMGL 1TMCB 2H8PA 4OLVL 3C60A 1MIML 4GRWE 1HNFA 4XVJH 1FSKB 2J4WH 5DQJB 5SX4H 2CXKA 3M1BA 5C6WH 1L0YA 3S3JA 2XN9A 4QY8B 2LU4A 3MRDA 2QADC 1SBSH 3U4EA 5T1MB 5IF0A 4MQTB 3KHOA 4XMKL 3VFVB 4ONFL 2CIKB 2FEEI 5F9OH 2E8YA 4LSUL 4M8QB 2K7QA 4RQQB 1IGCL 2OTUB 4XVTL 1MHCB 5C86A 3O3BA 2FNBA 3WHXA 1A21A 4Q9QL 1RZKC 3IS0X 1EXUA 4FRWA 1AQDA 4DZBA 1OLLA 3HI5L 1JPST 3DTXA 3RIAF 1H3UA 4LLUB 1N26A 1NKRA 5DJAB 4XWOD 1A6UL 1K8DA 4RX4A 2X9XA 4M4PA 4JFEA 4MAYB 5CEYB 3SCMA 5IWLC 1XAUA 2VDQL 3WFHA 2XNAA 5JUEL 5L9DL 1I3GH 5CD3A 1FFOB 5I9QC 1MUJA 2ICEB 4KJQD 2XG4A 5DD6B 3B4NA 1UM4L 1Q94B 4PJBE 5C92A 2X41A 3H9ZA 2CDFB 4DK3A 4PGDA 4M1CD 3FONA 4OGAD 4D3CL 3L5WB 1R0AH 1WV7T