3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
molecule keywords Peptidase 1
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
2HJKB 2FLBT 1AQKH 5CBEB 1GVIA 2EDKA 3T0EC 3A6CH 1YY8B 2IBBA 2VDOH 4YX2H 1QRND 4GG8B 5DMKA 3QJHB 4Z76B 5FDWA 3QXAB 1YPZE 4MCYB 1CLOH 4PY7A 3KJ6H 3BKJH 3KPLA 5KSAD 1T0NA 3RUGA 4QRTA 3RWCB 1TTUA 5GGSB 3VA6A 5GZOD 4NO0B 2HKFH 3AY4A 3FQWB 3B9KD 4NSKB 4MA8H 5I1GH 2AEPH 3FT4B 5T3XE 1BVLB 4L29A 4XI5D 4LLWA 5AEAA 3FZUD 5C08E 2ESVA 3OJDB 2AXFB 2V5MA 1BEYH 4NWUL 1N7ML 4LGSB 3LKOB 4MWFA 1ORSB 4XBGA 2DM2A 2D7QA 2I60L 5GGRY 4P2RE 3SGJC 1NLDL 1N7MH 1WZ1H 5ALCH 3R1GL 1K3ZA 3EYQD 2CGRH 4JANB 1QFWM 1JHTA 1DUZA 4P9HH 4NDMA 3BDYL 2NXZD 3Q48A 4U1LB 4UT6H 4WRLA 5SX5K 1N64L 2HWZH 1CVRA 1HHHA 1U8JA 1QFHA 3MV01 4PREA 3NPZB 3C6SB 2Y36L 2HTKC 1MHEA 4UI2A 4AQOA 4M8QA 4YR6A 4N8PA 1S9KC 2YSSA 3SDDC 2P7TA 4OLXH 3LKSB 3DLQR 5C3TA 2ADGB 3WMSA 3I02B 5EZIL 3BAEL 5T1KB 2BNQA 3O0RH 1TCMA 2Q76B 2H6PB 3W0WD 1H3VA 5ERWB 4JM2A 3GNML 1RHHA 4MNQB 1PX4A 5LXGL 1RK1B 3AVEA 4HUNB 3L3DA 1E4KC 5CIPA 1FLRH 1IGFL 3CUPB 4KFZC 5EB9A 4ZPTB 4XP9L 5KZCB 4JKLA 1H3PL 3GMRB 2UZYB 3MLZL 3OX8B 5AAWA 4V1DD 5CINH 3VFTA 3SDCD 2FO1A 1F58L 1OL0A 1P5UA 1RJLB 3STZA 3MRRA 5I19L 1A6WL 3ARRA 1JWSB 3TIEA 1I8KB 4JEGB 2CKBH 4LPVA 1I3GH 1DDHA 3B9KB 2IQ9H 2QV2A 2CDGA 2OL3L 3OAUL 5AAMA 4PRDA 4RGOL 1P4IH 4OCYH 3GMOA 1BFTA 1U8QA 3S6CA 4L9LC 4MS8D 1JNJA 2PTVA 4AEFA 1IZJA 3HMWL 5IEHA 3I50H 2VAAB 4KTDH 2X89D 4ZS7L 4I13B 5F6HJ 4Z0XA 5CEXB 2W65B 2MOVA 1KEGH 5GS0C 4UINH 3B43A 3X14A 4Y16A 1T0NB 3RUGB 5C07D 3E6HB 1N0XL 2E3VA 2FO4B 4U1SB 2Z0BA 3EGSA 5ILTL 4LIQH 4U1JB 1K6QL 3MXVL 3EYSH 4JHWH 5H35B 1NFKA 3RWFB 1Z0MA 3FONA 4MJ6B 4GQ9L 2Z8VC 4EBQH 2E27L 5CBAA 4LSTH 4PJXE 5DA4A 3MYJB 1VACA 1WC7B 5MERB 5C6TH 5J1AA 1ZHBB 2R15A 1R5WB 1A1OB 4POYA 4OZGE 1AXIB 1CTOA 1WCBB 2FJGA 2WIMA 5E7FA 4U6YB 3H7BB 4OCWL 2G2RB 5CP7B 4FFWD 1KG0B 3UPRA 4WJ5A 3MNZA 4K7PX 3KPSE 4XI5C 3SE9H 1I8LA 4LASH 2DBLH 1FSKC 1RZ8A 4IDJH 4MNQD 3V6ZA 3MLPA 1MCRA 5HI4C 2FSEB 1QSFB 3HE6C 4G9DB 3I02A 1PFCA 5KSAC 1YEFH 2PW2A 3REVA 5CJBA 3CVHB 3TPUB 1SJHB 2ATPB 2EE9A 1YYLL 4HWEH 3SDXE 2JB5H 3X11B 1JNLL 4JRWA 1RJLA 4RFEB 2R8SL 2O61A 2NX5A 5A16A 2R9HD 4Q6IC 4I0PA 3T2NH 4LHQB 3RIAF 3LKPB 2XNAB 1LE9A 1F45A 5FDWB 4Z76A 3HC0A 3RL1A 5C0BA 3FKUS 4OFYA 1FC2D 5EWIL 1U3HA 1R24B 2VUYA 3ARBC 5CILH 1QA9A 4K7PH 3WUWB 1URLA 5KSAA 5FKAB 4U1MB 2EEAA 1JJUA 3QG7H 4LK4A 5FYJU 5DD0L 5TE4H 5ADPH 1FCCA 5CAYB 3MRBB 4K23L 2XQBH 3NIFE 3HAEB 1JWSA 3LEYH 4GMSL 3FMGL 4NZJA 2DYPD 5ITFA 1KPUA 1P1ZB 3LEVL 3TO2A 1OQXA 1RIHH 1FL6B 4FFZH 4D2NA 3CVHL 3VFSA 3U30C 4Y19D 5DJZB 1EGJH 1KLGB 4QGTA 3PV7A 4YDJB 3K2MC 3WIHL 3X13B 1UVQB 2YC1A 1KF9B 1XGYL 4UZGA 1KENL 3I2CH 3BJLA 3RWIB 3T8XA 5IHZB 1GC1L 4KMTH 3AB0C 1NBYA 4UUJA 1ORQA 2Y5EA 4BFGA 4G8GA 3TN0C 4YXHH 3QUMA 4PJHE 4F2MA 3VXRD 4MCYA 5IESH 2R9HC 2GITA 3MLRH 1GAFH 1SBSH 1YPZF 3LB6D 4M6OL 4DW2L 4JKWA 1S5HA 3B9EA 4X7TA 4UQ2A 3P2TA 1FFNA 4I0PB 4XAKD 4ZUTB 2VQ1B 3FFCA 3BQUB 3BMWA 3L5JA 5F7EL 5C0EA 5EN2A 2JJUA 2YPLE 3M45A 3K80A 4V2CB 4YFEA 4LPTA 2OSLB 2AKRB 2P5WE 3SDAC 4N8VB 4RFNB 1T7VA 3O3EB 5DMGD 2DQUL 1SYVB 3KPSB 3WL9A 2ICWA 5FO8A 4OM1L 1DLHB 3EO9L 1U8OB 3TH3T 1K4CB 1F4YH 5GIRB 1R5VB 1IQWH 1P69B 2QSQA 4WFFE 3HR6A 1LNUA 5BS0D 1XF2A 4P2OC 1X4YA 1U92A 2R23B 3DRQA 4X0KA 4YAQA 4PLNC 3HR5A 3DUSB 2N7AA 4Q9CA 1UWEH 5BXFA 2M1KA 2I25N 3LPFA 1JFQH 4QHLB 3MRFA 5FOJA 4Y2OA 5F89A 2PCPA 2V5SA 4YFDB 4ZFFB 5IB5B 4PV9A 2DJ4A 2V2XA 5E03A 4OQTA 3T0XA 4CDGC 4LNVA 4KZDL 5ETUA 4J1UB 4WFHD 3AMKA 1FBIH 1EFXB 3OHXB 2P4AB 2LE9A 2WINB 4HIXL 3JXAA 1WFUA 2BZDA 1PW3A 2NY2D 4MXQD 4ZOEA 1F97A 4YXKL 4LPCA 3F7VB 2D0GA 4N8VG 2MQ3A 3VG0L 4XPHL 2CRZA 3HI5H 1NC4D 1BQLH 3IDMA 3VWKC 4EUPB 3UPAA 4XPFL 5DVNA 2P47B 3NGBC 4ODWB 4XPHH 1DTUA 4FQXC 4BH7A 3S34H 4NIKB 4FQJL 5CILL 4KQ3L 1MQ8A 2IH1A 3G9AB 5IB4B 4J8RA 1EJ6A 1X4XA 4RDQF 1AP2B 5JDSA 1DVFC 2PUQT 5AUMB 4Z0BH 4UTBL 4ODSH 4JFQB 4N0UA 4PG9A 5C0CE 1F3JA 3O2VL 4YGVA 5J6HB 4LRNL 1X5IA 3ARYA 3ZYOA 2EZ0C 1MCWW 4W4OA 4YIQA 4TOYH 2B39A 2DLHA 3V5HA 5D72L 1U8KB 3MV8E 3FFCB 3F12B 5DJ0A 4EN3C 4MAYC 4GXUN 3QH3A 4CBPA 1LO5A 1KEML 1MAJA 1H3GA 4ODUA 1RMFL 3EO1A 3ARPA 5TF1L 5CUSL 7FABH 5IKCA 5CSZB 4PJ8B 4HKZB 4O4YH 4NQDE 2E7CA 3TO4D 5BJTA 3L3HB 4LFHG 1YPZA 5I15L 4YHLH 4KWUA 3VXUA 3E2HB 6CGTA 1BVKB 2XZQH 4DCQA 4ZFOA 5D4QA 3A0OA 4UOW0 1IKFL 1XR9A 2C3WA 4MD4A 4KU1A 4R6UA 4AEHL 4QO1A 1C1EH 3ARXA 2FEDC 4DKEL 5L2KE 2IPKA 3JUYA 4K2UH 1MAMH 4L3EB 1M7DB 4KJWC 2HT3D 3I6KB 4HPOL 1T1WA 3TEUA 1PBYA 2JJVA 3BJ91 1DBBH 1KULA 3EKCA 2GITB 3NVQA 2XFXB 4JHAH 5T1DL 1YJDH 4Y1AB 3H3BC 2IQ9L 5TE6H 2RQ8A 5C6PB 1NDMA 3N1QC 2W9LA 4UU9B 2VL5A 1HDMB 1UB6B 1AGBA 5ICZA 4OCRH 3MRKB 4R0LA 2DQHL 3OXRA 2RCSH 5DEGB 2E7LC 1DP0A 2ZPKL 4KDTA 1U2HA 4ZODA 2GCYA 5ENWA 2MNUA 3HG1D 3Q6GH 1NGXB 1Z2KA 4IHOB 5ISZD 3UTOA 2F58H 1LMKA 3P73A 1A6AB 1DBKH 1NEZB 5FEBA 2NY4D 2VISA 4PJ7B 1P1ZA 3EW3B 1FIGH 5A1AA 4HCRA 4PJAA 3U7AA 1UGNA 5BV7B 3P0YL 3AM8C 4PUBH 1R3IL 4HJJL 1U8OA 3WO3B 4YBLB 2NNAA 4DZBA 1X5JA 3MV7B 5IVOA 2DQCH 3IF1B 2EYSA 2VLJB 4OTXL 4HG4K 5DHVH 3WLWD 2BHZA 3NPSB 2IFGA 4KDTC 4DCQB 4IIQA 3LN5A 4MSWA 1D9KA 4ZMAT 5K9KA 1C5DB 1XF4A 4ZFGL 3QUXD 3N50A 2J88H 4RGMC 1OCWH 4EI5A 4HXAL 3KPPB 5DMKB 2PKDA 4ODVH 3ZT7A 2AQ2A 4E0RB 2B4CL 1ZEAL 3ARFA 4GH7B 3T65A 5DK2B 2XA3A 1WT5A 4OLVH 4F8TA 2QSTA 1S78D 4NKDB 1MRDL 2DDQL 4KK5C 1OB1B 4HWEL 2R39A 5DJXB 4RBPH 1DR9A 2BNRA 4KXZI 5HYJD 2ZJSH 3WN5B 4BH8A 1DBJH 1G6RH 4S1RL 2LQRA 5I1IL 4OLWL 4KMQA 3WHXA 4O58L 2F53D 2PYFB 3KPRA 4CRPA 1M7IA 1B4JH 3G5ZB 2Q8AH 5CD3A 1WAAF 3B8SA 1A7OL 4HIEA 2MWCA 3P4NA 3VXME 3PWNA 3EO0B 2CUHA 3T0ED 5T5NF 3JWNC 1VA9A 1XR9B 3CXDH 1I1AC 3V6ZB 5DC9B 1CI5A 4M1GL 2EDYA 3V0AC 3C6LB 1T2QH 3CXHK 4BFBD 3PP4H 2VDMH 4MA3A 3B6SA 5IKCB 1G9NH 1QYGH 2Y06H 5MEOB 2NY1D 1S7XA 3MRPB 4ZSOB 1YMMB 3U9PH 1NGZA 5F9JA 3T1FA 3KYMB 4YQXL 4XVUD 5T5FL 4J3OC 1H3WM 4OZHB 1FVEB 4O00A 2APVA 3QEUB 3FFCE 4Y4FC 4PRAB 5DRZA 3U0PB 2BXYA 4XNQA 3QCTL 3ARVA 5DHYB 5GS1B 1KPRA 1T1XB 3HCVA 4XC3L 3DARA 4U1KB 2ZOLB 3SCMA 4TSAH 3F7QA 4KK8C 2A9MH 5F44A 5BVJB 1I9IH 3BIAX 4PJBE 2XWTA 4M02A 5EU5B 5EZJB 1F90L 5BO1L 4CVUA 2D7PA 1YMME 3VRJA 1H5BA 4NQEA 4BYHA 2VE6A 2KQMA 4QYOA 4GQ9H 4DUXA 5KTEH 3ARFB 4JFDB 1NH6A 4BZ2L 4JPWL 3GUTB 5IK3A 1YEKH 2R56L 2W65A 4LP5A 4LPXA 4QXGL 3H42L 3FQUA 3SDDA 3UMTA 4DAGL 4S10A 1ZA3A 1ZVSA 3DX7A 2VLMD 4K9EH 3G5YA 3D25B 3PP3H 3IDGB 2JJTC 5IOPB 3EUUA 4NT6B 2OR9H 5L8LB 4IRJA 4UV7H 5T3ZH 4DEPC 4UILH 2YUZA 1S9WA 2XQYK 4XBEH 3WS3A 3EDFA 4YBQC 2IPKB 4AK1A 1GOHA 3ECBB 4WUUD 4H1LB 5D6CB 4HXBH 4NO3A 3KPRB 3O6FB 4FQ1L 4JGMA 2DQFB 3SOBH 3C09B 2GAZB 4PUBL 1WWAX 4QHNB 2JJTA 1XCTA 1Z5LB 1F58H 3VFOB 5I9QB 5HGHB 1FL5B 2ED9A 1A1MB 1BBDL 1T66D 2XY1A 1ZXQA 5GZNC 3R06A 4ZTOL 1OSPL 1JZ8A 3GIZL 4RAVB 3D39A 4HUKB 3RNQB 3UYRH 4CVWA 4F9PC 1BQLL 4KHXL 5GPRA 2CDFA 1MWAB 4TRPH 4N0YH 4KQ4L 5TPWL 3RWJB 1YEJL 1A64A 4MA7L 3VGEA 4ZXBC 5A3ID 3KXFA 4NWTH 3FO0L 4WHTB 4X6EB 2GY7B 4X9GA 1MCCA 1FL3B 4GT7A 2DWEB 3DX7B 2W60B 3HI6L 2AJ3B 4MAYB 1S9YA 1X5YA 2HKHL 5CCKH 12E8L 1YNKH 5FDYA 5J13B 4MNQE 1K9TA 1MCPL 2BY1A 4NQVB 4UB0H 1NL0H 3WCYA 3GSRB 4WW2A 1A1NB 4KUZH 3T0EB 4L8BB 4M3JA 4R8WL 1Q1JL 1T3FA 5DA0B 3VWKD 3KDMA 1GGIL 4M6AA 5HHVL 2WUCH 3MJ8A 4I2XE 3C5ZB 1QOKA 2DQDH 3DVFA 2HYMA 4OAWA 4R7DB 2EIEA 2VABA 4QRQB 2Z93B 5ACLA 4Z7UF 3HCVB 4JQXC 4IOIA 1FNGA 3CC5A 2XQBL 5FHBL 3DX9B 4Y4HC 2AK1L 4NO0D 2ITCA 4GBXB 2P5ED 5DZOA 5EZOH 2JLLA 4PP2B 4ELKB 5DJYB 4GQPH 3U6RB 2EECA 4UT9H 5E8EB 5KVEH 3TO4A 5T1KD 4ELME 5CJXA 2W59A 2XPGB 3UBXB 4HCRH 4YHZL 2IALA 5L2KB 4WU5A 5IFHL 1DZBA 2W9DH 3C2AH 4D3CL 5IT2L 3FFDB 3QEQD 4JQXA 3TFKC 4IIQB 4KRLB 4LDOB 1C16B 1DBBL 1QRNB 3KPMB 1TZGH 3T0EE 3P4NB 4KROB 4N68A 2ADIB 3ARSA 3ILPB 1NAMA 3V4UH 4YHNB 2EDLA 1GGTA 2AEQH 4HAGA 3TJEH 4JZOA 1W0WB 4NP4L 4U1GB 5DUMH 3VXSD 5J11C 4F57L 3EJYD 3FRPA 4LCYA 4NRZA 2OMNA 4PBWD 1R3HB 1R0AH 3ARBA 3QQ3B 1NGWA 5IMOA 3L9RB 3VGAB 3O8XC 1NAKH 2PCPB 1AI1L 4LEOB 1CDJA 1FNSL 3HC3H 5J1TC 3AGVA 1I3VA 4X5XA 4UQ2B 3RBGA 1V3MA 3H0TA 1HHIA 4RGNE 4KRMB 3ZTJG 4N9GB 3QUYD 2BNQE 3TYGL 5D5ME 3EOBA 3S88H 2VKWA 1NKRA 1UB5A 4KJQC 2ARJQ 3GO1L 2C7UA 5L0QB 4L4VE 4L9LB 2NW3B 1Z0NA 4MQ7A 5D7IE 4P5KA 1FNHA 4GRMA 4H26A 4QOKD 1KIQA 5T3ZD 3N9GH 1CDGA 3GMLA 4LLMB 3WFZA 2P24A 4M4PA 2HAZA 1MRFL 1TVDA 1AGDB 5AG9A 3KXFB 1RI8A 2VB5A 3AREB 4X7CC 3RHWK 3W39A 5KS9A 3WFBH 4HS3B 2FEEI 1MCNA 3EOYG 1QO3B 1WTGT 4DGYL 1DQJB 5CINL 4XMPL 2JCCB 2OTWB 1WAAE 1FE8L 3OZ9L 3UTSD 5J9PA 3QDGB 2BCKB 4GAJH 3TN0A 3VCLA 1MHCA 4YHLL 3ARQA 3BIKB 1JE6A 1UJ3C 4L8SC 4JPWH 3VXTB 3NH7L 4GRWH 1MJ8H 4FP8H 4NO5A 1ZT1B 1F90H 3VFUB 4L4VA 5D7IA 1KV3A 4OF3A 5C86A 1QLFA 3WIFA 1S8DB 5D70L 2D03H 1SJVA 4JFPA 5EG6C 2HJFA 1T5WB 2HJLA 4ZOAA 3BPOC 1A0QH 5L9DH 1NJ9B 1I1RA 3ECBA 3SHSA 3TPUA 5EO0A 1F3JB 1OPGL 2YWZA 3CSPA 1CGSH 2BVYA 3C6LC 1MIEL 1HZHH 2P49B 1ZGLM 4C56D 5HJ3A 2ZUXA 5IROC 4ODTH 3Q1SH 3D48R 1A21A 4U05A 3LVEA 1I9RH 3VFOA 3BD3A 5HYSB 2J6EH 2OS7A 1G9NL 1ZHLB 4XMLL 5TJWK 1BZ9B 4PRHD 5DURD 3WUWA 1DE4B 3GMOB 3P3YA 1OB1A 1G0YR 5FA4B 1JGEB 3M1BA 3SDCB 1NMAH 4QOKB 5FYLE 3MRJA 4PJHF 4CN6A 4TSCL 4OD2A 4U6VL 1JNHB 1X5FA 1AQDB 4G80B 5ESVA 2D7TL 3GKWL 3D39D 4TN9A 4YHZH 4LQ1A 2PXYB 1OAXH 4MJIA 4ZSOE 5I1EH 3ARBB 1FSKB 3MRIB 4M00A 3UTSB 4CAGA 5I8EB 2EDNA 4HKZA 4M1CD 4M7LL 2J88L 4NO5B 1KIQB 2VSCA 1SMOA 2R2EB 5SWSD 4QF1A 5ACZA 2XWBA 5HXMA 2R0WH 2IH3A 4HQQL 2ZWLT 1A4KB 2HKHH 3BEVA 4P57B 4WU7B 4Y89A 2AABL 1IKNA 5AYQA 1Q38A 3O8XD 4JDTL 5DRWA 4BSJA 2VLJA 3CDFA 2AJUH 1YECL 1SJEA 4KI5C 3WUWG 5C7XL 3G5XA 3S5LG 4K3JH 3EJYC 1RJCA 2P5WD 3CFBA 2KKQA 5I8OH 2L4OA 4HLJA 1GGIH 2EYTA 3IDJA 5T1MB 3CFJB 1CL7I 3U0TB 4IMKA 4PGZA 4C54A 4UB0L 4LLVA 5I74B 2F58L 2VZ1A 3LKRB 5EC2A 3RWGA 3LMJL 4NFCA 4P4RB 5H2BB 5CBAB 1QSEB 2G75B 3QO0B 2Y72A 2V9TA 1KLUA 3HFML 2GUOB 2VN7A 5C0BB 2DQEL 4FFVD 4PD4K 1CLYL 4JRXA 5IVXA 1BBJB 2G5BA 4UBDC 3G6JE 1KJ2L 1YEGH 3VXSB 2X7LB 1J8HB 5FGCB 5D7IF 5EU3A 5IFHH 3PWJA 3IFLL 1YEIL 2VKXA 4XVJH 1OT1A 4OCXH 1KCUL 3MOQA 2R29H 3UYOD 4LHUA 2Z4QA 8FABA 1INDL 4O58H 4XRCA 2OI9B 4FN0A 2E7BA 4PJIE 4OLEA 3UZQA 3MOAH 4R26H 3DMMD 4X6FA 1AH1A 4NC1E 4PY7B 4XPTL 3RWCA 4FA8A 2IAND 4M93B 5FYLH 4PGBB 2WANA 5EUOE 5ESQB 5J57B 1RUAH 4P9ML 4OUOA 1BJ1J 3ZHLA 1D6EA 1QLRA 4K7FA 2HVJA 3BKMH 3NBNA 2DYPB 5E2VL 3RVWD 3V6OC 1NCUA 1IEBB 5F9WB 4PJDA 2PW1B 4LKCA 3DNKA 5JORB 2E8YA 2A6IA 3DSFH 4ZDHB 4KK5D 3DGGA 1FFRA 4KV5F 5D1QC 3UJIL 1PY9A 4ZO9A 2Q6WB 3PDOB 1C8PA 4Z0BL 4RGND 3UTTD 2D9CA 5HYFA 1JZ2A 5B21A 1XFPA 5HHMD 2PR4L 5D7JA 1J87A 3GUTA 1U6AL 1A3LL 2X1XR 3DECA 2R0KL 2EYRB 1I85A 2IPTH 3Q6FA 4Y19B 1KGCD 5C0AE 4JFZL 4TVPD 3GIVB 1KJVB 5FK9B 2L7UA 1HOCA 4CN1A 1BX2A 1JNNH 1UXWA 4I48B 3OKNB 5KSBE 2CUMA 1E4WL 5F7DB 5GRUH 3SDCA 4EI5C 1HZHL 1N6VA 3G04A 4FFYH 4OLYL 3TN0D 2HLAB 3DYPA 1MHEB 3MA7B 4JFXA 5I1AA 5H37H 3BP7B 4PJ8A 1QSED 4XP1L 4OF0A 1HILB 4XCYA 1MF2L 3RVUD 3H9SE 4S1SH 1N2RB 3PJSA 3RWIA 1OGTB 1FYTA 3GJEB 1CICB 3JWOC 5I16A 5MHSD 4NKMB 3NCJL 2RHEA 1G7QA 5HHPB 4OZIA 5FECA 4F15B 1Q9OB 3CLEL 1JZ7A 4PGBA 2G5RA 1MH5B 1OWWA 2H3NA 4FHBD 4GXUM 4E41B 1IM9A 1IGYB 1WITA 2FBOJ 1B0RA 2R23A 4X0KB 3AREA 4J4PD 3HE7A 1I1CA 2D03L 3FB8A 4X98A 5HVWA 5DZNA 1ACYH 4FTVB 4PJCA 4GSDL 2X42A 3VXMA 43C9A 3CH8A 3MRNA 1OAUL 2CIIA 1RIUL 4HBCL 4IRZL 1MCQA 3MLSH 3EO9H 3TVMC 5GGRB 4HUUA 4KTEL 1U8IA 2DN7A 1YQVL 3RY5A 5A3IC 3VXSA 2XKSA 4MDJA 1HCFX 2I9LA 2R1XB 3FRUA 2IAMA 1S9XA 1QQDA 2GFBB 4NN7C 1A47A 1M1SA 3AREC 5AWNH 1NCBL 3UBXA 2VJXA 4F3FA 1KGCE 3MLZH 4D9RE 5B39G 1UKTA 4D9QE 1NSNL 2ID5A 3BHBA 4J8RB 5TDPA 5TGBB 4JFZH 3MROA 2A73B 2BNUA 5HHME 2NY2C 1NEZG 4MJID 3U36B 5HHVH 4G9FD 3GGWB 4RMQA 2A1WH 3VG9C 2EC9T 1CFTA 5E9DD 5IESL 1E6JH 4YHIA 1F4HA 3CFIC 3QH3B 5FECB 3L3IB 4R96A 5SWSA 3N85L 3MRHA 4HFUL 2Z93A 1KOAA 4TYUA 3AU1A 4Y4HB 1FO0L 2CLRA 3PL6B 5TDNA 5CWSB 4NN5C 2FWOB 3NZ8B 3T0AA 4X9HA 2E6QA 3U0WL 3S96A 5DJ6B 3DRTB 4NQXA 4J6RH 5JIHA 4OD3H 1LP9E 4LCUA 5EU6A 2OXHA 1OAKL 5FA4A 3EZ8A 4UAOB 1RU9L 4OSUH 4JB9H 4N5UA 3V0VB 3QUMH 2BNQB 4Y4KC 2FYYB 3BXNA 4ZAKD 2YOCA 4PJFF 5DD1L 4P5KB 4MJ5A 2HN7B 3E6HA 5MHSE 3H9SA 1NGYA 4JFFB 2VLME 1DQQA 3VXRA 1LDPL 2VXTL 4PGDA 3RIFF 1MHHA 1VGKA 5K9QI 1TNMA 4P2QD 3NFSH 1G7JB 4QRSB 1YEHL 2R2BB 3EDDA 1P53A 2EKJA 4OI8A 1TLKA 1AR1C 4J1UA 3DMMC 4DN3H 1MJJB 4R97C 1T6VN 2XG4A 4QY8B 2HTLC 1OWRM 1FZOA 3PQYA 4DGVH 4H25B 1VESA 1ULVA 4FABH 1TQBC 2J5LC 2NY0C 3OKMA 2FECI 5D8JL 3FB8B 3GSNB 3HNSL 4RNRA 4M03A 1CDHA 1NCWL 2DTML 1T66C 2VDRL 2FWOA 1II4E 4IHOA 1CDUA 5BQ7B 4OBSA 5I0DA 1XH3A 4F9PA 3GIZH 4G43B 4I5BA 5E8OA 3VFGL 2XRAL 1XGRA 4UDTB 4KZEL 4HEME 1MLBA 5BW7C 5C2BL 4ZUVA 1R3KA 3GSQB 4LLUA 4YO0A 4G5ZH 1G9MH 4XNYH 1A3QA 1B2WH 5LGKA 1P7QD 3L5WA 3QCVL 1MFEL 2YA1A 1ERNA 2I07B 3HPLB 2EIZB 1QTYT 3VXPA 5I71B 4X6CF 4LCIL 4E0RA 4G6KH 1CIUA 3LPWA 4CUCA 1IJ9A 1YEEH 3O3AB 5LBSL 1JTOA 5JLZA 3GO1H 1PYWA 4LRIA 4PGCA 4OUUB 2F74B 1NMBL 5CKAA 3GIVA 3P0YH 5FYKU 3K2UH 1WICA 3MUGA 4BQCA 5GGUA 1SBBA 4HZLB 5I2IB 5HI5C 1AC0A 4HWZA 4XNMA 1DANU 3QPXH 3ARGB 3GSXA 2XG5A 2FEEL 3K4ZA 4LCYB 1J0JA 5HYJE 3VXOA 4O5LH 2AJSL 4GSDH 4PJ5A 2NW3A 4R2GD 1CDYA 1AHWA 1FHGA 2WWKO 4Y4HA 1JNNL 1C12A 4RNRB 3E6FA 1KN2L 5EZLB 5HHQA 4HXBL 3BRFA 1MFNA 5ECJE 3LDBC 2JF1A 1MH5A 4Y5VC 5GRZA 5I1LA 1J88A 1UZ6F 4WHYH 1S7QA 3IJYB 4C4KO 4PTUA 5CJXC 1U8PB 1HKLL 1L6XA 4S1SL 5DQDH 1NDGB 3DVIA 4LCWB 3MCLL 5D7LA 3QIUD 1DEEA 1F11A 1EVTC 1ZS8A 4LSSL 3V5KB 3BDBA 3BKCH 3ALXA 3EYQC 1XR8B 3C60B 3FO0H 3KVQA 4HC1A 1CQKA 4N5EC 3NCCB 1EA9C 1MRCL 4WO4C 2CH8A 1RZJL 3VMPA 4L3AA 5D1QB 4QTIL 2X4TB 4Q9RL 3I6LD 4S1DC 1AGCB 3QIBB 3ZL4L 5GSRB 4XBPA 3QDGE 5C70A 3P0VL 1B0GA 3TJHD 1TZHA 3BGFC 4S1DD 1QZ1A 3TH4T 2OK0H 4RAHA 3RVVC 4DAGH 1Q94B 4JPIA 4JHZA 1OT2A 2V2XB 2JJSC 4NCDA 1K85A 4JFEB 3F58L 1W0YT 3E3QC 3GBMH 3I9GH 5EA0H 2BX5A 3TIDB 4M61A 3TT3H 4JO3L 1U93A 1MCPH 1YEDB 3EO0A 5GSVA 5B38G 1G6RA 5HPMB 1J1OH 4PGJA 4V1DE 4CW1B 2W1NA 5JLZB 4RZCB 3D2UD 3T65B 1HIMH 1MSPA 5ALCL 5KSUA 2IH3B 2VIRA 1HQRA 3O0RL 1S5HB 3QDAA 1U3YA 5MEOA 1NAMH 4ZAKB 3WL9B 3RPIB 3WHE0 5LAXB 1INEH 3ALPA 3GHEH 2L0DA 2WW8A 1UG9A 4RAVA 1U3ZA 1OP5K 1G7HA 3ZE0E 1JBJA 5DC0A 3W9DA 3D0LA 3UZEA 4K8RH 4AH2A 2RGSA 3K3QA 5DRZB 2IGFH 4NFBA 1A7NH 1JGUH 1VERA 4S1RH 2PO6C 3EOTL 4XAKE 1PYWB 2V7NA 1KN4L 2EDOA 4C58B 5EO9B 3O4LB 3BKML 3B3IA 5F1IA 4XCFL 3STZB 4UIKH 1DE4A 3S5LB 2VXQL 5D7JB 1FZJB 1R3JB 3AAZB 3QXAA 1PSKH 4JRYA 4Z7WA 4RRPG 3TV3H 3PGFH 1JUFA 4PJHA 4L4TD 3QRGH 4OQTL 1IC5H 2QHRL 5I6XB 3B2VH 4F37K 3FQTB 4IRJC 3VD5A 4NZUH 1AHWB 4G5ZL 5HGBB 4HFWB 3NOIA 4QXTA 2VR4A 4JO4H 3IS1X 2VLLB 3LQZA 4UTAL 3OXSA 2F5AL 3AM8A 1CCZA 2BRQA 3T0DA 4Q7DA 4CNIA 3BQUA 1XGPB 1CGUA 3RGVB 3MBEA 5EC1A 5IMOB 3EYVA 1OGTA 3GJEA 4FOMA 1GGBH 3UTSE 3CCHB 5F3BB 4KK9C 3QZWA 5E00B 4F58L 5DLMH 1RZKH 5DJAB 4OGXL 4EOWL 1U0QA 2VDML 4ZFGH 1CLCA 2H8PB 1D9KC 1T7YA 3R4DA 1KCKA 1ZHKB 4U4BA 1QRKA 1F2XK 3C8DA 2F19L 4GFTB 3GSQA 4LLUB 1TJHH 2WSKA 3AS0A 5CJQH 1BQHB 4U0RB 4LSPH 2NCMA 2H6PA 4NBXB 1JRHH 3L6FA 3MREA 4M93C 4GBXD 1T4KB 2UY7A 3U4AA 4AEIL 2K3TA 3Q6FB 4LHUG 5ICYA 4EN3D 3LZFH 4ODUB 5IB3B 5HD8D 4CKVX 5SWSE 1YEIH 3MACL 5HYJA 2FX8L 3WXWH 3CLFL 4I77H 3CVIL 2J12B 2NR6D 4H20H 5GHWL 2PTUA 4ZUUA 2B0SL 5L8KB 4HGWA 1MFAL 1FFPA 4JDTH 4RCAA 3BPCA 3T0WA 4OBRA 5TDPB 4BZ2H 3BWAA 2HVJB 5DK0A 1U8NA 4LMQE 2GKIA 3ZDXF 4HH8A 1RVFL 1ZT1A 3RPIA 2ADFH 1G0XA 1I8IB 1PKQA 1XGUA 4KC3B 2Z31D 2XFXA 5BS0E 2D9QB 2GEEA 2ARJA 2NTSP 1JGDA 2GJZB 3MV9A 1A6UH 2Y7QA 3DHMA 4JO2L 3HRPA 2BVOA 5GISL 4L8SB 4YK4C 4UDUB 2CLZA 1ZHBA 4NM4L 1RIUH 4HBCH 4IRZH 2YXFA 3INUH 4ORGB 2LABA 3BMVA 4LCCA 1NMAL 4LNRB 4AMKH 1KFAL 2OK0L 4YHKH 4MJ6A 1YEFL 4XMLH 1CFNB 1DL7L 2FECL 1XIWA 1KB9K 1KN2H 5BVPH 3GSWA 3QNXA 2ITCB 4XP4H 3BXNB 4DTGH 3K8MA 1CFVH 1FP5A 1HHJA 1K2DB 3G5ZA 4YHPA 3BP6B 4M7LH 2CKBL 4P46B 1XF5A 4S1QH 1NGYB 4WGWB 3B9DA 3TESA 2APXA 2NYYD 1IC4L 4ELMF 4E5XB 2UWEE 3VFRB 1GJIA 4GKNB 4BUGA 4EI5D 4I77L 1IC7H 2HH0H 3LRSA 5C0AD 4P4KA 1MRCH 1FN4A 1L9NA 2KL6A 5L6YL 4OQTH 1OLZA 5IFAH 3BI9X 2GTWB 4EN3B 2Y5TB 2FL5B 1F4WL 1YJDL 2QQQA 5A2FA 2R2EA 2A6KA 4GMTL 1ND0B 1Y18A 4K94C 1UA6L 3SKNB 1RUPH 4YDLC 4UT7L 1KJMB 1Q9OA 3GRWL 4RX4D 2P5EB 1N2RA 3PJSB 3QP3A 5BMFL 4XVTL 1TVBA 5ID1B 1I4FA 5FYJE 4QCIA 4JQVC 3MLUL 3OWEA 3Q3GA 3VFNA 4KHTL 4N0CD 4F37F 3FT2B 3KLAA 1I1FA 1DBKL 2LAAA 1JCKA 3IRZA 3PGCB 5IG7B 1PZ5B 1N6QL 2Q3ZA 1CE6A 1KNOB 4OGAD 4JFFA 1B0RB 1MRFH 4EUPH 1T1ZA 5CMAB 1HI6B 1R3KB 3LPGA 4NKDA 3W2DH 3SDCC 1MCBA 2J7LA 4M7ZC 4K71B 4X5WA 3VXMB 4AEIH 2GSGB 3JV6B 1CU4H 1UXSA 2IADB 4MJIE 3HR5B 4HUUB 1ZTXH 4M5YH 3C2AL 4D3CH 2ZJSL 2X05A 2G60L 3O11A 4GG6B 3IB4A 3GMMB 3MCLH 1OTUD 3CSYB 2EDWA 4MXQC 3AU1B 3NAAL 5DK0B 1SVCP 4J3UA 4QRRB 5JDJA 5D8JH 1QSVA 3VI3F 4JZJB 1I7RA 5ETUB 4F7MA 1DANT 2NY0D 1K3IA 4K3EH 2R8SH 4X6DF 4LVNB 3IDIB 5KVFL 4KJYA 4H88H 3U36A 2FD6H 4JY4A 1LEGB 4AL8H 3CFDA 3RZCC 2DQFA 3C6LA 3KYAA 3FQUB 3SDDB 3QIUA 5JTWA 3GB7B 4HMCA 4QTIH 1C12B 1GZPA 3LV3A 4GAFB 3TVMA 5I18L 3CD4A 4HG4J 5DRNA 5D2LF 1OP5H 3KYOA 5D2NE 2SEBA 2E5EA 5D7KE 4LSVH 4OIIL 4HWUA 3QXVA 5BZDB 3MZTA 3UJTL 4C57C 1J1OL 3NA4A 5GS0L 3DGCR 4JFDA 2XA8H 1HSAA 4GW1A 1NMBH 2R0ZL 4HS6A 1E28B 3GJFA 4KDWA 3RL2A 1I75A 4MNGB 4Q6IB 3SY0A 3JTTA 4WHTA 3H3PH 2HLFD 3KWWA 3RU8L 5E94B 5E2UH 4GKZB 4JG0H 2NY6D 4ETQA 5KANI 1RZKC 3KS0J 4QYOB 2JELH 4MMXC 2BY3A 3TBYB 5KVEL 2HFGL 3NH7H 4WUUA 5HHMB 3HMXL 1I8MB 2NZ9D 1F4XH 4NZDA 4PR5B 2ICES 2OI9C 4I9WD 4KMLB 4M48L 1HI6A 4KAQH 3T4YA 3NAAH 1DUYB 4NPYA 5E08H 2BSTA 4Z7OF 4KY1H 3P0VH 3M07A 4PG2C 1RHFA 1TZIA 3ARZA 1T22A 2X4PA 1LO3H 3U46B 4IM8A 1IGIL 1J9CT 4UT7H 4H88L 3LN5B 4MSWB 3VXNB 3NIDF 4GAGL 1FPTL 1S7VB 3F62A 1KB5L 4NQCE 4R8WH 3QPQC 2Z92B 4FFWC 4NZRH 4YDKH 2D0HA 3MUZ1 4G6MH 2OTPA 3K74B 1YDPA 3G6AB 4F7EA 2OR8A 3U6RA 3CSBA 4UTBH 4WUUE 1QLEH 4Z7VF 4WVRA 1OAUH 5F7LB 2NZIA 3IDXH 1REIA 3E3QE 2NMSA 4Y5VB 3V79C 2WLYA 4F15C 1JNHA 5IMKA 2C3XA 1G7LB 4WEBL 1LO4H 3U9PL 5EUKB 3FB6B 4XNXH 3VA2C 1TMCB 3WFCH 4IOFC 3FMGH 4P23A 4LVOB 1ZAGA 1RQ5A 2HTKD 2VNCA 3QYCA 4QHKI 3MV8B 1EFXD 3BIBX 3OX8A 1AO7B 2UZIL 3VFVA 4BSWA 5CZXD 5B4MD 2CIKB 3ARGA 5D1ZA 2OL3H 1KXQE 5T3XD 2XN9D 2C4XA 2ZSVA 1X44A 3SDXF 3CX2A 2WUBH 3H7LA 4G8GD 2V2WB 3WXWL 2KDGA 1UJ3A 5IBTL 1UWGL 3PWNB 2BMKA 1QFWH 3ULUL 2Y36H 3T3PE 2AXHA 4JG1L 3HNVL 1BM3H 4K55A 3QA3B 3QWOA 4G8IB 4YPJA 4CVXA 4JCLA 5DC4B 3V2AR 2RIKA 3FFCD 5E4EB 1D3CA 2WK2A 3G08B 3DURB 5FCUL 4UIMB 5KS9F 3MV11 1NGQL 4PRID 5D1ZC 2DQIL 1CBVH 5SWZB 1EEZA 1QEWA 4PPTA 4RMWA 5JMRA 3QUML 4MNQA 4Z7UA 2DM7A 1DLFL 1U8PA 3G04B 2EC9U 4X9BA 2ICCA 4WFHE 4LSRL 2CKBB 3AB0B 3MQIA 3KLDA 4X99B 3TN0B 4N9GA 1EIBA 1KJ2B 4JANA 1P9MC 4YIQB 4DKFH 4ZS7H 5IROA 4ETQB 4WTXA 1BQUA 2VLJD 3DI3B 3GM8A 1G7QB 4QGYA 4DN4L 5BVJA 1EBPA 4UV4H 5FYLD 2NXYD 3RWEA 3U30B 4FNLL 4YR6B 3MRNB 4Y1AA 4NNXB 2JELL 4OF7A 5I1KL 1EGJL 4BK5A 4A2LA 2DLEA 5LWYH 1FDLL 3D1MC 2HJFB 3QRFM 2FB4H 3E8UH 2AS5M 4AT6A 2FR4B 1BVKA 5I19H 2XICA 3S36H 2X1WL 2VDNL 5EO0B 1C5CL 2DD8L 1HWGB 3MLWH 4KI1A 5ESQA 3SE4A 4PRIE 4TRPL 5D7KD 5DJAA 3ULVH 4XNUL 4NN5B 1QG3A 4W4OC 2Z91B 1OW0A 2FX7L 3ARTA 3GB7A 4XAWL 5E8NA 1HQRB 2DLIA 4NKMA 4F7PA 4IRJB 2DQTL 3S98A 2B4CC 1JHLL 3DBXB 4FQ2L 2ZUQC 3WNLA 1HQ4B 3CVHA 3HAEA 1A9EB 4F7CA 3I50L 1IKNC 1JGLH 2QEJA 1DFBL 3H2WA 4C59B 2HFGH 5INCA 5IHZA 1WVZA 4MA1C 3A6BH 4P23B 1GIGH 2C4FT 3FQWA 3RY4A 4OLXL 4CADA 4EZMA 3BZDA 4TVPL 3QPQD 2UYLB 4WHYG 3VFVB 1WWWX 2H2SD 1H5BB 2YD7A 2WUCL 4NQEB 2DI7A 5JIPA 3NIDE 3W39B 4EXKA 5IJKC 5ANMB 3H7BA 1TJIH 5TQ0H 1EZVX 5L7XH 1ORSA 3PABA 2P8MB 5BRZA 4CJ0A 1UZ6E 4DVRH 4JR9H 4NQEE 4PRHB 5DUBB 4K9EL 4EDXB 1JGVL 1MPAH 3HNTL 2XZQL 4BA8A 4UNVA 2EEDA 4KJPD 1I7TA 3IT8D 5AYUL 2H45A 3MODH 5IQ9B 2FSEA 1X3DA 4JZNA 3F7RA 1NAML 3ROOA 5CGTA 1FFNB 4LVEA 4NKQB 3FN0H 5D1XC 1A7PH 2A0LC 4O02L 4JFOA 4HIEB 2WBJC 1EMTL 4XZUB 3V7AG 4N8CH 4QRPE 3VU2A 1RV6X 3FAXA 4MA3B 4QOKE 4UUJB 4WUKL 1Q0XH 2PYFA 2E9JA 1YUHB 5CJOH 1ES0B 5EZLA 2F53B 2NY4C 2EKSA 4BQ9A 5F7FA 2VL4A 4R2GB 2IPUG 3DV4B 3FN3A 2XWTB 5EZJA 1ONQB 4JDVB 1LNUB 43C9B 3MBXL 5C7XH 3LQAL 5DSCB 1QBLL 5IGXH 4JN2A 3WN5C 4MAUL 3H3KA 4UINL 1U95B 1S9VA 1PSKL 1TDQA 4KTEH 2B8OT 3O3BB 1ZVYA 4YE4H 4NQDA 3IKCA 5TDOB 4N1EA 4NO2A 1GOGA 4MA7H 3OKDA 3LDBB 1A2YB 2ADJB 1FYTD 4XPGH 4APQC 5KVMC 1JZ6A 1EHAA 2B20A 1LO5B 3IDMB 4NNPH 3QAZB 1T0PB 5DJ8A 5D1QA 4XPGL 3QDMD 4X99A 1JGDB 3CXDL 4PJ9B 1WBXA 3HUJB 1IAII 3EJZD 4P2QE 2Z9TA 5K59F 5EORL 3V8CA 1JK8B 2MCPH 3FHAA 4Y19E 3WIFB 1A3LH 2EIZA 5E2TH 5I1JH 5AD0A 1IL1B 4CVZA 1UQSA 1CLZH 2ZKHL 5I8EA 1ORQB 3BP4B 1WIUA 1CD0A 2P45B 1HKFA 4HUWA 4DGYH 3LN9A 4HUXB 2KPNA 4MXWL 4P5TB 4HPYL 4YHNA 2J6EL 5IM7B 4NKOB 1WQVT 1BZ7A 2E6PA 3GSOA 4ODHL 4PJBA 5KSVA 3OGCA 5HDOA 3SDAA 1HH9A 4YPGB 1MAML 5FFLA 3LKOA 3ARFD 2HT2C 5DD6A 3GRWA 3OZ9H 3VE0B 2GW5A 1MJ8L 4FP8L 5ACMA 3VRLE 2AGJH 1ZA3B 4RMSA 3U0PA 5IR1A 1IAIL 1T7WA 3QNZA 3MCKA 1HH6A 2JJWA 1IAOA 1OOAA 1KIPA 2YKLL 4YO0B 3JUZA 3UTPD 4WENB 3L3GA 1UXSB 3D9AH 5HDQH 3O45A 3MGAA 4L8DA 4Q0XH 2H32B 3P73B 4OCSH 5GRVL 1A2YA 1WK0A 2ADJA 1Z5LA 5AZ2H 1P4IL 4QHUB 4OI9A 3QNXB 1V7NL 1BGXL 2DMBA 4D9QD 1WEJH 3BP5B 4YHYB 1VFAB 4YXLL 5C0GB 3CFKB 1VADA 5GGSY 1B0WA 4HEPG 4UMGA 4NQSA 2AK4A 3M17A 3LCYA 2FGWH 3SKJL 4NGHL 5E8DH 4PJEB 4QRPB 1ZVSB 1EPFA 3EHBC 3MR9A 2RR3A 5DFVC 1HHHB 1U8JB 1WISA 3S88L 4OZGA 4X8JA 3WBDA 4D9RD 4FQJH 4FQLL 1MY7A 1QLRB 2FRGP 1UH4A 4LSQL 4G6AC 5CSZA 5CEZL 2X1OA 5C0IB 3D18B 4F9LA 5JXED 4G9FA 2PW2B 2YXMA 1XH3B 4OIIH 5IP4A 1IE5A 2YD6A 1EMTH 2V9RA 2AEPL 4ZAKC 4LMQI 1EO8H 2MKWA 4U2YA 5FYJD 2OM5A 4JFED 3C09C 4YDIL 1MLCB 2APTA 3CH1B 4NYLB 3X3FL 1X5HA 3CFDB 2X70A 4CMHB 3RWGB 5I9QC 2WMPA 5EPMB 3ULSA 1Z9SA 5FKPB 2BVQB 4OJFH 1MFBH 4DKAA 3P9MB 3QIWA 3JWOL 4LVHC 1UACL 1BQSA 3SDYL 3C2SA 1BD2E 4RQQA 2X4NA 4XVJL 1FE8H 2Y07H 4BFEA 3O6ML 3VGHA 1CGVA 3ARGD 1CFQA 4ZAKA 2ENYA 1JF6A 5IQ7L 2Q7YA 4OD1H 2LTQB 1S9VB 2NY1C 3T4AA 1D9KB 2CXKA 3O9WB 4RZCA 3QWQB 1JGEA 5EU4B 2IADA 5E5RB 1GIGL 3D2UB 4ORZC 5I8OL 4KKCC 1OAZL 5GGRA 4XB7A 2W91A 4U1JA 3REVB 4MS8C 4U7SA 1S9YB 3LMJH 3UTTE 3L7EB 3U9UA 3OMZA 5CLWA 1D5ZB 5I8CA 3VXUB 3WXVL 3BE1H 1MIMH 1D6VL 2DQUH 1CYGA 3QFJD 2BJMH 3GEWB 2A83A 3FZUC 5AYUH 3P30L 4N1HB 2VZTA 2F5AH 5CEXA 1FZMB 2X4SA 2WWMD 5DD5L 2Q86A 4HK0B 1S78C 5DJ6A 4KKNA 5GRYA 4FQLH 1BLNB 1W2KT 3W81A 1L4IA 5CWSA 1NC2B 5IV2A 2OP4H 4JY4B 3I85A 4ZUSB 1JPGA 1NGWB 1S7RB 4B53A 5JQHC 3IETA 3O45B 3P40A 3H6JA 1Y6NR 4ZXBA 8CGTA 3STLA 2GHWB 1AKJA 4GBXC 3EBAA 5IFJA 3VJ6B 1X6LA 5JIKA 5I1KH 1OTSC 1I7ZA 1LD9A 3TBYA 1CF8H 5MERA 2YUWA 4HHAB 3WNKA 2W0PA 4GO6B 5HHXL 1RZFL 3ZKQD 1F2QA 4N0YL 1CDBA 1Q0YH 3TO2B 4LLYB 3CFKA 5IVNA 5JPNA 4TTGA 3S35H 2BSSB 3RX8A 1E28A 3GJFB 4BQ6A 1DQJA 3O3DA 4ONHA 3REWA 1U36A 1D5MB 5MI0B 5JQ6H 4KTDL 3QQ4A 3UTPE 2H2PC 3W82A 2R4RH 1LK2A 4YDVB 4EQ2A 2EYSB 4MCZA 3U4BL 5JW4R 5BRZE 4GMSH 1EZVY 1ZLUH 2R2HA 3RVWC 2CRYA 4MX7A 1DUYA 4GUPB 3WFEH 4NC2B 3JV0A 3WFCL 4JJHA 3M17B 3AROA 1BQHA 4GMTH 2VQ1A 2LAGB 1V3JA 1O0VA 4EI5B 4K7PL 3LQZB 1NLBH 3N0PB 4KUZL 2GIYA 4PJBB 1HHIB 3TT3L 4PJFB 5I1CH 5MENB 3QUMB 1E6JL 5HGDA 4F2MB 3TH2T 5MEPA 1QLEL 2E9BA 1OTSD 4Z7VB 4LBEB 5ITBH 4Z7UB 3ARDC 1A14H 1LEKA 5FF6A 1CICC 1NC2D 1RZ7H 2DTMH 4HS8L 5FGBA 5FO8B 4H26B 3U9UB 4ERSH 4HC1L 2FJFA 4I18B 4PJAB 4ODHH 3NCYS 4D8PB 3AXLB 1RHHB 1QR1A 1UWEL 1WZMA 4K8RD 4OZHA 4PJ9A 1B90A 4IMLB 5EFIB 2DBLL 3SE8H 2P48B 3NCFB 3H9HA 3QNYB 4ALAH 5D7LD 2UZXB 5A40E 4U6TA 3ZKND 5I75B 1IGCH 1I9IL 3PGDB 4PV8B 2I5YH 4JLRA 1GC1H 4PGDB 4UQ3A 4PG2A 4GG8A 1KCUH 2AW2A 1MEXL 1KCVH 3OKMB 2Y6SD 3NZHL 3MLYL 4M8QB 4A6YA 3IU3B 3EO1B 2Z4QB 4DZ8B 4EXPX 1WGOA 5DJDB 4PJ9C 4PP1C 2V6HA 4PRHE 5F8RC 1KYOJ 3X12B 4K3GA 4JJ5B 4NKIH 3IETB 1XGRB 3CFEA 4R4NC 4MD5B 2F9BT 2HA1A 1OHQA 2VDPL 4FXGB 4MXVE 4W4NA 4KVCH 1UJ3B 4Z77B 1K4CA 1X7QB 4YJZL 3QO1A 2PR4H 1YY9D 4XZUA 2XA8L 2WIIA 2YD5A 1NBZA 2GJ6B 3CZJA 5A2LH 2EIBA 5BS0B 4P2RB 2DTSA 2R29L 4WFEE 1GOFA 4QXWA 4GJTB 2XI9A 5JUEL 3A67H 2RFXA 3WEXB 1KPRB 1T1XA 4LSPL 1YEHH 1H5BC 5LJYH 1JRHI 3ZHKA 5F7UA 4U1GC 5FHBH 4GLRH 3MYJA 2WP3O 5F9OH 4XP4L 1CF8L 3BE1L 3MRKA 4R0LB 3TIEB 1GRWA 5JHDD 1FO0B 4Y2DD 2Y25A 3RY6C 5DO2D 1K5NA 5F93C 3QUYA 1AIFB 1C7TA 4H0GA 3WLBA 5D2NB 2VLRD 2PXYC 1ZTXL 5JDSB 4XBPB 3F7YB 3TZVD 1JYXA 1ZEAH 3QDJD 4LCWA 1OAQL 1YEJH 1EO5A 2BXZA 5DWUH 3C60D 4IDJL 2R1YA 2WWMC 4PRPB 1IGJA 3HB3D 5TH2A 4UIKL 4JZOB 2YPVL 5CZXC 2DQGL 3OTTA 3U0WH 5FGCE 2WBJB 3JV4B 1BFVH 1OAQH 3L1OL 3WNMA 4GKSB 3ZDZE 5HI5D 4NNXA 1P7KA 2VXVH 3NIFF 2A38A 3PXJA 2MFNA 5C0CD 1VB9A 3T3MF 4JM2F 3BZ4A 4Q9QL 4JFHE 2FLRT 5F1NB 3HI1B 2O5ZH 4Z7OE 5BJTB 2DQCL 1DDHB 1VPOH 4H1LA 5D6CA 4X5WB 4RMUA 3GBLA 2UYLA 3P9LB 4S2SB 1S3KH 5DJYA 4WW2B 4OFIA 4XCNB 3WD5L 3LRGA 4TVPH 3S4SG 4U6XB 2J2ZA 3JVGA 4L9DA 1G6RB 1NCBH 2H26A 3RX7A 1FCGA 3LKRA 5CEZH 3CSYA 3MRGA 2WBWB 1EAPB 3NA9L 4HPOH 2VO5A 5DO2C 1G7MB 3EZJB 3NCBB 1YN7B 1I1YA 4YHMH 3T77A 1DQLH 1CU4L 1IQDA 3N1GC 1IC4H 1MHCB 1QUNA 2JB6A 3L7EA 1WZ1L 3RAJL 3RVUC 2GCYB 2DQHH 4J3TA 5E95B 2VDNH 2BFVL 4M4RA 1EJOH 4LFHD 2NLJB 5D96C 1BPVA 5FUOH 4AG4H 3H9HB 1IM3A 4AZ8A 3QDGD 4LKXB 4MYWB 5DJCA 1C1EL 4YE4L 3QXDA 4Q97A 4OCSL 5BO1H 1G0DA 4EVNA 1CWVA 3DGGB 3O4OC 1JPSH 1KLFA 4BSVA 4JFXB 2OJEA 1YQVH 3GSNH 1BFVL 3L1OH 5DFVD 4I8DA 4K3JL 1VFOA 4C56E 2JK5B 5A2JH 1WSST 3PWPE 2MCPL 3VCLB 2KBGA 2XT1B 4Y19A 2RB8A 1Q9WA 1HINL 1TVHB 4OM0H 4BZ1L 4PRPD 4HUXA 1G7PB 4BQ8A 3WKML 3VRIB 3EYOA 3ZL4H 2Y06L 4HPYH 4OCLC 5DFWH 1PG7H 4PRAA 2AJYH 4JY6B 1BHGA 4K3DH 3WKMH 4JDVA 5IEKA 3K4DA 1CL7H 4CDHA 1LE9B 1JV5B 3VXRE 2OZ4H 4QRRD 5F88B 1J11A 3QIBA 1OARL 3HNTH 1KFAH 2QTEA 2X40A 2D4DA 1AGFB 3FQXA 1NEZA 1XIWD 2H8PA 4Q9BA 5KN5A 3ILQD 3SO5A 4P5TA 1MY5A 4JVWA 2YD4A 4XP5H 1Z9LA 2GTZA 2B2XL 4OFPA 1I3RB 3GKZA 4IRSC 4WCYH 1NCTA 2XZCL 2ZSVB 5C08A 4X98B 2VZ3A 2A74B 1A9BB 1T6WA 2HJKA 3TBVB 5BZWA 3WNOA 2YRZA 1LGVA 3PWVA 3QZWG 3F7YA 2K9UA 3KLHC 1I8MA 1I3GL 3QIBC 3N06B 1QFUH 3SBWC 2GJ6D 4H8WL 4U6XA 2WBJD 4WI5A 3OKOB 4OZIB 2DIBA 2GJZA 3MV9B 4HJGA 1YMHA 4WFFD 4S2SA 1UENA 3VH8A 4HK3J 1DQML 4XPBL 3OB0H 3UP1A 4XVSH 1FNSH 5FM8A 4HGKC 3V0WH 4BJLA 1X7QA 1JTPA 4R4FL 2O5XL 4XTRD 4I18A 1FORH 4AIZB 1F8TL 4R4BB 4GRLD 5DI8A 3MACH 3VRIA 5SWSB 5CS7A 3PP4L 1A6ZB 3WLWC 2XTJB 4WI9A 2YMXH 4B41A 4ZO8A 1SQ2N 4OIBA 3LIZL 1AO7A 5EZIH 2FHBA 3MOBH 3VXSE 3MRMB 4JQVA 3BEWB 4LPUA 3UO1L 5LQBL 2UUDK 5EUOF 5KSAB 1WV7T 5E9DB 3KPOB 1OSZB 1TJHL 2BVPA 2HRPL 1J0HA 3BP6A 4P46A 4QRTB 1DBAL 4I18C 1FJ1B 1YN6A 3ZLQC 2H2PD 3V5HB 4JO4L 5M7QA 15C8H 4PLOB 3B6SB 3CFCH 4G6JL 4KKLD 5EDXA 3WXVH 5IBUG 4OV5B 4G9FB 1H3PH 4LVHB 2WNGA 5I1EL 1SYVA 1EFXA 5HHXH 2C9AA 1NCAL 1BP3B 1ZT4B 4QRRE 2NY5C 2W07A 2ENSA 3QDJA 3F5WB 3OR6A 1I1AD 1Q9WB 1A6TA 5TPWH 1IEHA 5C0DB 1INQB 5EPMA 3ZHDA 1WTLA 4KRPD 5DQ9A 4JPIB 3AS1A 2P7TB 4Q2ZA 2NXZB 3E6FB 5FO7A 3VGDA 5J6GB 3U82B 1FV1A 2J8OA 1NGPL 5C6WH 4J3SA 2ZUQB 1UWXH 3MRDA 4OI7A 3KDMB 1BVLA 1CFQB 3MFFA 5CLTA 3W5MA 3S3SA 3KHOA 4L3ED 3FT3A 4OV6F 3RZCA 4ZQKB 3D69A 4PGEB 1ZHLA 5L9DL 1HYSC 3TV3L 5SV3A 1ZS8B 2OSLA 5TE4L 5JR1H 3BZFA 3F8UB 1P9MA 4ZPTA 5L88H 2XKNB 4YNYA 3L3OB 4MDIB 4JRXB 2GAZA 4DQOL 5C08B 2VDLH 1BFSA 3MO1B 2NR6C 4P4KD 2MSPA 3SDXB 4TULH 1PDKA 3UTQB 1I3RA 1H8SA 1AQDA 2KQNA 5GS0H 5DLML 1R5VA 4I2XA 1FAIL 1GHFH 1UXWB 4P4RA 5ADPL 2EH8L 3RWDB 1DN2A 1C08B 3C6SA 1D5BA 1NANH 4R2GC 5LG1A 1G9NC 3OB0K 2F8XC 1AXTH 4ZTOH 3SGEI 1ND0A 1Y18B 1S7WB 4PJDB 4WEBH 4XNZB 4NQVA 1NFIB 3R0NA 1CDCA 4M1DL 5I15H 1JHTB 5KVGL 1ZANL 3PDOA 1INEL 3MJ7B 4JRYB 5I66A 1OP3K 1HXYB 4HLZH 3GMPA 4WWID 5C09A 1OW0C 2XXCB 3OAZK 4M3KB 4R3SB 3W2DL 2W9EL 3MRCA 4ZTPL 4DFIA 1IGYA 1PKOA 4KRPB 1KJMA 4TSAL 2ATKA 4XPFH 2W0FA 4U1IA 1BZ7B 3GSOB 4XPBH 5KSVB 3O81A 1ZV5A 3DMMB 4L1HA 5HDQL 1PVHA 4ZFOB 4XT1C 1AKJB 3LS5H 1ZOXA 5E1AB 4FQXB 4X4XA 3PXHA 5DUPH 1ED3B 1S7RA 4Z78B 4EKXA 2AXFA 3ILQC 3V4VL 4IOFD 2GI7A 5IVXE 1G7IB 4LSRH 4GRMB 4AIZA 1CZ8H 3GMMA 2ZPKH 1RK1A 5HHOA 5E6IC 3P4MA 4NOFA 3H9SD 1JL8A 3G6DL 4X6DE 3FRUB 4HWBL 1GYAA 3ARWA 2X5PA 2J8UA 1WEJL 4I1NB 3MA9L 3U4BH 2I9TB 2DLFL 1QP1A 3N9GL 3QG7L 1I9RL 2OTWA 4L4TE 4NNYA 3P4OA 1X6NA 3Q5OA 4MLIA 5I1DB 3TO4B 3OB8A 5J06A 4RMTA 2EH7H 5BV7H 2AV7B 2OTUB 2GTWA 1AR2A 3Q1SL 5DMIH 1R3HA 3B5HA 4IEFB 4HWZB 3H9ZA 2HMID 2BVTA 3VFWB 3SQOH 1OARH 2O5YL 2ZSWA 3U7WH 5E6IA 4FTVE 4G42A 5DMIL 4HF5L 3ZO0A 5DSCA 1WZLA 1GXEA 4YLQT 5D1ZD 1I4FB 2DIJA 2OYPA 2GJJA 4H0IA 1TTFA 1FLRL 3AC0A 4X7DC 2AK1H 3UYPA 3QFDB 2ORBH 5DUML 1Z3GH 1S7XB 3MRPA 2A6JB 1XGUB 3L3OA 5ELIA 1AE6L 4XNYL 1IILE 1HH6B 1RUAL 4P9MH 5JW5B 4WNQB 3LKNB 4R0LC 3OKYA 3W0WE 3WN5A 5L2KD 1Q94A 4X4XB 3QCTH 1T83C 3GSNL 1JN6B 2XRAH 5EOTB 2R69H 1AR1D 2UWEF 2ZUWA 4MJ5B 4LAQH 2A9NL 5HYQB 3BDXA 2MHAB 4F3FB 3RGHA 3E2HC 1JI1A 5J9PB 2QADD 3ZTNH 3CDGB 3RJQB 4NQDD 1EEYA 5FB8A 5DVKA 1V7MH 3T1WA 2ED8A 4NNPL 2A77L 2MJWA 3QDMB 5C6TL 1QVOB 1P84J 2X4QA 4F57H 5IB1A 2XQYG 4MZ3A 5EU7C 2VXTH 5I66B 2F19H 5F6IB 2X44D 2DKUA 3OR7A 4M7ZB 3LEVH 3FCTB 4OLZL 4BH8B 3PIQB 3L3GB 2ZUTA 2JIXA 4JZNB 1JWUA 3TA3A 5L2JB 4LOUD 1BZQK 2A6DA 4Y16D 3TCXA 5C07A 3ES6B 4M7JH 3O6KL 2AI0L 4Y1AD 2XY2A 4Z7WB 1TJGH 1TQBB 3MRCB 4TQEL 4X5XB 2R4SH 4PBVC 4G7VH 1TQCC 3WS6C 5HGGS 3OF6A 4NJAH 3S5LA 4N5ED 4RFEA 3P77B 2O61B 1XGQB 5DQJA 3LEYL 3MXWH 2HN7A 3OXSB 4NCC1 4HULB 1F42A 3ULVF 3MRLB 1MFDL 2P46B 4G8GB 4M5YL 4OCYL 3RU8H 4JKPH 5E2WH 1LK3L 4JPVH 3LN4B 3TBWA 1VDGA 2P8LB 3HPJA 1RFDH 4LIQE 1LHZA 1MFDH 4KQ4H 4U1HB 2PO6B 3QHZL 3SGDI 4NQXB 2QQNL 1X5GA 3ZYIA 1G9ML 3E0GA 3PV6A 2QR0A 5MEQA 1EHLH 1NQBA 1JGLL 3BX7C 1WBZB 1AIFA 5KOMC 3QFDA 1CLOL 5CZVL 3ZTNL 4P9HL 2C3GA 5KVDL 3OG4B 3ZYZA 4H25A 4BKLB 3B2VL 4PR5A 3O4OB 3O6LL 5C0DA 3H42H 2V5TA 3I75A 5AD0B 2OXGA 2W38A 4MA8L 1FZOB 4P3CH 1T2XA 5ISZE 5HHPA 4ZS6D 3LY6A 4G42B 4LU5L 2HT3C 1NSNH 2XWJB 2O5ZL 4D0BB 3FQTA 4ISVB 2WV3A 3FO9B 1KEMH 3L7FA 2ZUSA 4IJ3B 4KKCD 1MFCL 1DSFL 3KPLB 5MP6L 5K9JH 3MZGB 4ORGA 5LCVL 1S5IH 4XBEL 4S11A 3JWDC 1A14L 3F7PC 5K9QG 3GI8H 2COQA 1GZQB 3EYVB 1WF5A 1U91B 4OCXL 1TJGL 3D3VB 5EUOA 2BNQD 3KYKH 25C8L 5C92A 4FXKB 1RURL 3W0WA 3RKDC 4DKFL 1T21A 1KJ2A 4O9HL 2QSVA 1L0XA 4OF5A 3DROB 2IJ0C 5EU4A 2IH1B 1J0IA 4Z78A 3QI9A 4W68A 4JKPL 5E2WL 5IVXF 2FX9H 5KJRH 3HMXA 4XCFH 4XNQB 2YBRA 3UC0L 3CIQA 3PF2A 5KN5B 3T0VA 1ZLSH 4XGZB 1M7IB 3BKCL 3MLXH 2J6EA 1OSZA 3AMLA 1J0KA 4QOKA 4XXDB 3QEQE 3QISA 3VRJB 2FR4A 1BFOA 1N8ZA 1CFTB 3BT2H 5IQ9A 1AFVL 2O26U 4JREB 1AXSA 3ULVL 4MNGA 4LGRB 3HMWH 2NTFB 5FAAA 2MKLC 4PJ5B 1YMMD 2Z31B 4ELMA 5D7LB 1UWXK 4NSKA 4ISVA 1IT9L 3SJVD 5E24E 5T1LA 1ZE3C 3KAAA 1J5OH 4O2EB 3NGBB 3NZ8A 2VH5H 3QEQB 1IGTB 5B39A 5T1KA 2DLFH 1X9QA 4WUUB 4POZD 3WJJC 5I75C 1A9EA 2DLGA 4I4WA 3BVNA 4IRSB 3CU1A 4Y16B 1AGCA 2YRLA 4HDIB 1U58A 3LV3B 3TVMB 5F88A 2OBGA 1MF2H 3PV6B 4YGVB 5J6HA 2FDBP 4KDVA 3VDBA 5SWQA 1GGUA 4APQD 3BH8B 4U1HA 3KLAB 4XP6L 2V2TA 3FO9A 3HE7B 3VWKB 3HNSH 5HBBA 3RUGF 2F54D 4CU8A 4X6DB 1QBML 3IXAA 2QKIA 2H1PL 4XMKL 5ADOL 2VE6B 1CD1A 5B8CC 1BD2A 3P11H 5JW4Q 2BOCB 4FFVC 1PLGL 4FZ8H 1U8IB 3BDYH 3QFJB 4XCCH 1H3TA 4B50A 4ODSL 2PYED 1Q9KB 1KPVB 1T20A 4TPRH 2VAAA 1FZKA 2P8PA 4YC2C 1BM3L 1SEBB 3LQAC 5DJDA 3CVIH 2DL2A 2FJFB 3UAJD 3DTXA 3NCJH 3VD7A 3MOAL 1ADQH 1JPFB 3LS5L 5L7XL 3BT2L 2NPLX 4NP4H 2XOTA 2DYPA 5GZOC 1AC6A 1T1ZB 3SKOA 1I7RB 4X6BB 2HFEA 3I75B 3X13A 5LAXA 1BIHA 4PV8A 4NZUL 4MHHG 3WSQL 4X4YA 5J12B 5IV2B 2C5DC 5DEFB 2G9HB 4TUJA 5K9OA 4F7TB 5HHQB 1T5WA 2HJLB 3HE6A 1TITA 3HI1A 3VW3H 2IG2L 4RGNB 5ID1A 1U3HD 4MQTB 3QIUB 5E0QA 4OF8A 4AIXA 3DROA 3ZKSD 5DQ9B 4MLSA 1UKSA 5CGYD 1U42A 3GSVB 3IAPA 5F7DA 4FNLH 3D3VA 3G6JB 1A7QL 1FGNH 3IDNA 1L6ZA 3F58H 1A6VH 2P5WA 3ULUF 1KIRA 1PG7X 3K81A 3TJHC 3HAEH 4R97B 5ANMA 4DZBB 2FATH 1N3NA 2YEZA 3E8UL 5I30H 4I3GA 1S5IL 3R1GH 5I1HH 3AFLA 1I1YB 3IRPX 5C0FA 2D7TH 1QR4A 4M6OH 2J5LB 4HQQH 1NBVL 2NY0B 3SN6N 2FJGB 1T04B 4NN6B 1KB9J 4Q9RH 1RY7B 2WAHA 4ELMB 5JR1L 3PQYE 3WE6A 1SJHA 1R5WA 4GKSA 2R2HB 5D93C 3DVNA 5HGBA 2WZPD 3CPLA 4HIHA 3G5VA 1A4JB 5HVFB 5DT1H 5E08L 5BS0A 1FO0H 3VRLF 2BVUA 1ZT4A 4LRNH 4ZSOA 5CP3A 3IJSB 3BHBB 5BOZG 2YK1L 3V7MA 3IDYB 3MNVA 3DO7A 3GM0A 5HDBE 1DLFH 4U1IB 4WI6A 1YECH 1TJIL 5TQ0L 1XF4B 1YNKL 1P4LB 4X4ZA 3BN3B 2G2RA 2KUTA 5DXWA 2EXYC 2NX5B 1Q8MA 1OF2B 3OKKA 3O4LE 3TWCH 1OLLA 2ATPA 4OT1H 2BHUA 1T21B 4KKBC 3HG1A 3UBXG 4G9FE 1NUFA 1G7IA 2EDDA 2JKXA 1LO0H 1MWAH 2Z92A 4MZ2A 5F3BA 3AS3A 4Z95L 5HGAB 1I3UA 5D7JD 5GS0D 4TNWK 5EU6B 1ZA6B 2VXUL 4K8RL 1J0YA 1R24A 3QUYC 4WU5B 3EYFA 3BPCB 3QEHA 2NY7L 2Y23A 5IMLA 1TZIB 3KJ4C 1S9XB 3KPSD 1HKLH 3BPNC 3KYNB 4L8SA 5H8DA 5A16B 5CP7A 1MCEA 1ZLSL 3FQXB 4GRWF 3MO1A 4PRBB 1RZFH 1JWMA 3B2UD 3FO2B 1D5ZA 2XWBB 4LARL 5I8CB 1X5LA 5E6IB 1ZHNA 1U8HB 3K1KC 4LAJH 1KJ3H 4J2XA 3G6JA 1MAKA 3CDYA 2AP2A 1RK0B 1ZT7B 3CSGA 2CK0H 3MA9H 1BIIB 1OP9A 3KPPA 3EFDH 4HKBA 5IGXL 1KCVL 2R4RL 3DIFA 1N0XH 2BY0A 5C0AB 5T3XH 3CNKA 4NRYA 1IAIH 2YA0A 4OQ1A 5CCKL 5F8QC 1KXTB 3L95B 4PD4J 4JFPB 5E4IA 5DUPL 3QZWB 4G6ML 3IDNB 3LSOB 3JVGC 1MELA 3LEXB 4QT5A 4QF1B 5ACZB 5LQBH 3IVKB 5GGVY 2VYRE 4G7YL 5GIRA 1J5OL 2ARJB 1FRGH 2P24B 1IAKB 5IWLA 4LL9A 3BH8A 1PG7W 3GSWB 3VFMB 3K8LA 4WW1B 2YMXL 5HHNA 4ESKA 5KAQG 4HH9B 3T8XB 3SKUD 1WIPA 1J86A 3PG2A 2PW1A 4LKCB 4D94A 5C1MB 1LP9F 5DJCB 1JHKH 2P8LA 5F97E 5B38B 1DN0B 2ICEB 4LCCB 3UAJC 3DUHA 4XXCC 3TT1L 5JOPD 4WI4A 1U3JA 4XHJC 1TVHA 1G7LA 2MPAL 2CDFB 4RFOL 1IVLA 1JF1A 5JPNB 5HYSG 2BNRD 1MI5B 1ZLVK 4GW5B 1H3XA 3M1BB 5KVGH 4O51A 5F7KC 2XTJD 2NY5H 3NPSC 3P0GB 3QFJA 3PABB 2Y5TA 3VXMD 2EDBA 4O2FB 4O2EA 2JIXB 5DD5H 3VD3A 3ESUF 4L4VB 1N3NB 5D7IB 5FA3A 1UM6H 3JWDL 3HG1E 5ESAA 3D39E 4BUHA 4I0KA 1YEEL 4LARH 1QVOA 1A7PL 1MLBB 1L7TH 5CIPH 3X3FH 3TGXA 5KSBA 1FG2A 4L8CA 1FFOA 4NDMB 2DKMA 3JV6A 3BESR 2X7LA 1T03H 1GSMA 1PJ9A 4ZUTA 4OB5H 2FD6L 1FZMA 4DEPB 4N0FA 5IBLD 4OZ4B 3OHXA 2EDFA 2X9WA 4HUWB 5D9SA 4M43H 3RVTC 5GZND 5ICYB 2BVQA 3HE6D 2J8UE 5LBSH 2ED7A 1FNEA 4XB8A 3WDIA 1ZGLA 2YPKA 2ZG3A 2ZNXA 5I74C 3Q3GB 5SX4I 4LSVL 3TZVC 4AT6B 1WIOA 4PRNA 4YHKL 4ONGL 1JN6A 5HDBF 4RA0C 5I6XC 4P2QA 1IBGH 4QWWD 3JTTB 4OGXH 4EOWH 5C0CA 4WI7A 3O11B 4CMHC 5J13C 4DVRL 4OZFB 1EO8L 1KG0A 4LU5H 1H0DB 4FTVD 1IM9D 1UM4L 4MDJB 1QPXA 4GKOA 3ROOB 5DJ0B 1NCCH 2D31A 1N5AB 2H9GB 2YS4A 4KHXH 1ITBB 1OAYH 1OTUC 2O93L 1NPUA 3GMNA 3EOTH 5D71L 1WBYA 3VDCA 1NAMB 4HFUH 2BSED 2HT4D 5C08D 3TZVA 2DD8H 4U1NA 2A73A 4QNPF 1KC5H 5F1OB 1X5KA 4QRQA 2AK4B 2F53A 2QQLH 5DRXB 3MXWL 3PHQB 2DAVA 3V4UL 1MOEA 1RULL 3NFNA 3E1F1 4FQHB 2X4PB 1NBZB 2GJ6A 2B5IB 1DCLA 4Y4KD 1NBQA 5FM5M 3W0WB 1GAFL 1SBSL 2XNAA 4DW2H 3UPRB 1RUPL 2Q20A 3BW9B 5T3ZE 4POZC 2VOTA 1CXLA 4JHBA 4NKIL 1KCLA 1UYWH 5IFAL 1QSFE 4HCRL 5ILTH 4IMLA 5EFIA 4NJ9L 1FH5H 4WI8A 5A2IH 3HG1B 5IR1B 3HC4H 3MMEA 3MRLA 4JGJA 2OX5A 2M2DA 3UROR 1TNNA 2WBKA 3V95A 2WP3T 2RAMA 2GK0B 3U2SB 5E94A 3FONB 4G8FA 5A43C 4FQPA 3VWJA 3TFKD 1MCLA 1OTTC 3A6CL 1HSBA 5JNYB 4WDIB 2AJYL 2Z31C 3TNMB 4GAYB 2BDNH 3PNWA 4G3YL 3MGOA 1FG2B 4XNXL 4YEEA 4WFGE 1NCAH 1AGEB 3IFPB 3KPNB 3WS6A 3P11L 2JCCF 4ZOCA 1SEBA 3VFUA 4GS7C 2FH8A 3MV8D 1CS6A 4Y16C 4K2UL 2E9WA 3D0VB 1VFBA 4Q0XL 2X41A 4QCIB 3VWJC 4KI5E 5IB2B 4FZEL 3PWLB 4QRUA 3C5ZA 5LKNA 1FIEA 5TF0A 4X7TB 2D0FA 3UXFA 2X89A 5GJSL 3IAQA 4HC1H 2LFGA 1GGCH 1M7DA 5J0BA 4MHHI 3U4EA 4YEFA 5EBMB 5IJKA 3HE7C 1SEQH 4XX1G 1GZQA 1ODAA 3HI5L 4FRWA 2YC1B 4ZO6A 3GMRA 2ERJC 4WWKA 1T22B 4XHJD 3EYSL 4JHWL 5DHYA 5D1ZB 3S97C 3S3PA 4PTTB 1AXSB 5DVMA 4Q6YA 3B9VA 5SV4A 1UM5L 1B6DA 5EBLA 1YNLH 3QUZB 1TPXB 5D9SB 4JRYE 2NY6B 3R0MA 1YNTA 2XN9A 3B9KA 2IAMC 1AO7E 2VLKA 4M1CC 4YC2B 3HZKB 3WFHB 5FK9A 1V3LA 4XGZA 3OKDB 3BW9A 3SCMC 4NKOA 5D70H 3NA9H 1S7UB 2NY3B 1Y0LB 5BXFB 4HSQA 1LP9A 2Z8RA 3ULUC 1VKXA 3BKYH 4HLZG 4R3SA 4YFLI 3K46A 4LLYA 5C0FB 4YWGL 1JZ4A 4RAUA 3HZVA 3SGDH 1V05A 3GSUB 3HFMH 3TWCL 5GRXG 3H9SB 2I27N 1MIEH 2VZUA 4GKNA 4UILL 3BOVA 3SGKA 3SQOL 2XIDA 4WFGD 2BK8A 3EOAB 4KK8D 3DURA 3HTLX 1NFIA 3V0VA 3QHFL 4RGNC 43CAA 2BVOB 4XCNA 4APQB 1ETZA 2DI8A 5K93A 1U3HC 1O5DT 4TQEH 5FXCH 4IRSA 5F9DC 3PE9A 5EOCL 2EC8A 5IM7A 1JVKA 2D3VA 3PUCA 3G5XB 1M7XA 2QKIB 1ZK9A 4HT1L 2PTTA 4PY8I 4X8XA 2CPCA 3MLWL 3ZTJH 1ZSDB 5F6IC 3SPVB 5EC1B 1VEOA 3O2WL 4NBZB 1Q0XL 4OFYD 3BEVB 4HJ0C 1BAFH 5SWQB 5IJVB 2I07A 3HPLA 4KY1L 4L29B 4JPVL 4TUKH 4F7EB 4PTUB 2ZZUT 3QXWA 1FNEB 5FHAH 1I7ZB 1B2WL 4OM0L 3SKMB 1S3KL 3BN9D 5E99L 5CHNA 3QCVH 4P23C 3MGOB 4Y88A 1LWRA 3S35L 3MNWB 3H8NA 5J1SC 2ZUUA 3TNMA 1EAJA 3Q0HA 4P3CL 1F6AB 2VXSH 4G43A 4I5BB 3UJJL 5EUKA 1R0AL 2GQHA 4G8EA 2QADC 4EEEA 3C9NB 3CX5K 5BZWB 1FNAA 1RZIA 3MC0A 4FFZL 2BRRL 3MX0A 2X2YA 3VGAC 4F80A 2EDXA 4X6CA 1XF3A 1BOGB 3JV5A 3U1SL 2ZUYA 3U83A 4WIQA 4O5LL 4J3VA 4OGYH 3DBXA 1T5XB 1S7VA 3CFJA 3HHRB 5M94B 1X5XA 3F6IA 4HIXH 2BOBB 4YXHL 1JTTA 1J1XH 4XWGH 3EJJX 3OKLA 5L0QC 1J8HE 2IMMA 3MUY1 3S3JA 3MJ8B 3IXTA 4X7SH 3QHFH 1LP9B 3HKFA 1F5WA 2DKSA 4HK0A 1H15B 3IFOA 4H8WH 5B8CA 3L9RA 5C07E 1H9VA 2OJZH 4X7SL 2HLFC 3HI6H 5HHOE 1JFQL 4CL7A 2VLKB 2P5EA 1UA6H 3PDGA 3BEWA 4ZO7A 3MV9E 1YQ2A 4CN4A 5JIIA 4N0UB 3SKMA 1MUJA 4P9HC 1L0QA 4P5MB 1OF2A 4XNMB 3MRRB 1Q1JH 1OAKH 4OD1L 3G6DH 5I71C 4AM0B 5FCUH 1IFHH 1VKXB 1RZJH 2IBZX 3NACL 5SWZE 4Y1AE 1LO2L 4F9LC 5GS2D 1KJVA 4E5XA 1R3LB 1P84K 1KB5A 3QWRD 1VEMA 3VWJD 3TCLA 4C83B 4HS3A 4KI5D 3KGRA 1A1NA 4UTAH 2EO9A 4LPWA 2XZAL 1OPGH 4DN4H 1ZWIB 2FIKA 3T2QA 3EOAA 1A4JA 5M95B 3SE4C 2FHFA 5HGHA 1UQSB 3K7UA 3PHOA 4MB5A 2N7BA 4KQ3H 4MCZB 4L5FH 1KYOK 4EJ1C 1JYWA 1UZ8B 3V8OA 4PIRF 3OAYK 4EDWL 1J8KA 2IQAA 5EIVA 2DI9A 5F9OL 1T2JA 3U7WL 2EE2A 2ORBL 3QQ9D 3RA7L 4YHYC 2GSIB 4NRXA 1RJYB 3NZHH 2HRPH 3GSRA 4PJEE 4PYGA 4JFEA 3LKSA 3D69B 4PGEA 4NQDB 5EOTA 5C0JA 1FNLA 4G8FB 4KKBD 3EYUH 2WUBL 4YWGH 5IIEA 1U95A 2P43B 4S1QL 4XVSL 3GMLB 1TZHB 4XWOD 2CXGA 3M8OL 4M7LT 4B7LA 4JVPA 4D0DB 5DRNB 3VG0H 3QG6A 1KBGL 5CFHA 3PP3K 1K6QH 1ACYL 4JFHD 3BUYA 3NN8B 4JE4B 4KVNL 4MJ4A 1CFBA 3KPTA 4NFDA 3WYRA 1S7UA 4F33A 4U6HB 1MI5E 3S9DB 5CHNB 3EYFB 3QEHB 5JXEC 4WV1B 1RZGB 1SM3L 3MLYH 1JWUB 1FYTB 4JRXD 2C3VB 3BGFB 3RDTA 1NC4A 1FH5L 2PETA 4JZJA 2AXJA 4L4TB 5EORH 3MBXH 4X80L 4GBXA 4RFOH 3RWFA 2CLVB 2PF6A 1AXTL 4NGHH 3RIFK 4PJXB 3OJMB 1RVFH 2OZ4L 5EO1A 1C16A 4HIIA 1OQOA 3LKPA 4LKXA 5FUCC 4ZFZB 1P2CA 4ZD3H 1IQWL 1G6VK 1HH9B 3C87A 3DJ9A 3RZCD 3RGVD 2IALB 2BMKB 1ZVHA 5C0AA 4LGPB 5MI0C 1DL7H 4F58H 2CIIB 2F5BL 1W0VB 2FYYA 2NY1B 1FBIL 1NKOA 1H8OA 5CJOL 1ZMYA 4Z5RA 1U8LB 4P5MA 3LOWA 4FZEH 3MRBA 1A6WH 1W0WA 3MSPA 4JN2B 1LO3L 4PS4H 4DUVA 4ZUWB 4FG6C 5F7EH 1C08A 4CGTA 3S35X 2CLRB 32C2B 3MYZA 4FFYL 3BPLC 4EDXA 1EHLL 5KW9L 1KTRL 5TGBA 4KJWD 2VC2H 1VADB 5D5MB 4Y5XB 3T1FB 5F9JB 4OV5A 5FYKE 2Q7YB 1F4XL 1K2DA 4YHPB 1DVFB 2YEZB 2IC2A 3BH9B 4YBQD 2IPUK 3QULA 3MJ7A 2I9LB 1CXFA 3BP7A 1KLUB 4TSBL 4L4JA 1FO0A 2AJZB 3QXDB 3PL6C 5HI3C 4H1LG 1AD0B 4O2CA 3ARDA 4P2RD 5FKPA 2YPLB 1AI1H 4PJAF 3K0WA 1ZHKA 4PJXA 3T04D 1VHPA 3BQUC 5J3HC 5ESAB 2EKSB 1XMWA 3BUYB 3NN8A 5C0RH 5KS9B 4Y4FD 4NJ9H 3QQNA 3CK0L 3U48A 5GJTL 3SDAB 1J1XL 1MJUH 2DICA 2VLRB 3B9AA 4XXCA 5D93B 1CLYH 3O3EA 3MRJB 3CU7A 4ONGH 4ZUVB 3OF6D 1N5YL 1WFNA 5IVZA 3RNKA 2B5IC 5IW1A 2B2XH 3MCKB 4UBDD 1H8NA 4XNUH 1ZGLB 1QA9B 1FFPB 4PYHA 4KK6D 1QBMH 1A7NL 3WO4C 1WBYB 4JFYB 3CH1A 4NYLA 4HX1A 1EERB 5F72S 5D7SH 3FQRB 1UACH 1DBJL 5EH1A 1YYMH 3OPZH 4GG6F 3ELAT 4NN6C 2E6JA 2DDQH 4TPRL 4BSVB 1HNGA 1K8DB 3RQ3A 1BGXH 5JO5B 2DRUA 3O41A 3QT2A 2J8UB 5FIEA 5DRWB 4IRSD 3WKNA 3ES6A 3GZKA 3QRGL 5C9JB 1P2CB 1ZWIA 4NT6A 3IGAA 5T1LB 1C5BH 3ARDB 3RI5K 5EO1B 4TUKL 1GGCL 3FO1A 3OKNA 2ZCHL 5KVDH 4U0QB 3ISWA 5SWZA 2APWA 4X80H 4BSWB 4M9PA 3WFDH 2CO7B 4PRIB 3RKDD 4JPKL 3RDTB 1RUQH 5CD5D 4HJGB 4DWHA 3O6MH 3T77B 2FIRT 2VDQH 2O5YH 1LEGA 2X4UB 4Z7UE 4G80A 5HGDB 4X4YB 3K4AA 1INQA 5I1LB 2VUOA 5C0NC 4PBXA 3D39B 2RBLA 3RNQA 1S9WB 2CO6B 3CC5B 2X70B 3HZMB 1MJUL 3RNKB 5INDB 1XIWC 3LN4A 3QAZC 1OM3H 3DYOA 3R8QA 1W72A 3L5HA 4ZUSA 3LKNA 4FQCL 2ZKHH 1W0VA 3I3EA 4PS4L 2FGZA 1J8HD 3P77A 3STLB 1DQMH 1QACA 2EDJA 4IOSD 2D4FA 2P8MA 5BRZB 3QI9D 2X4TA 2FX8H 2OL3B 1D5MA 2Z8WC 4LAQL 4UOJA 2Y6SC 3V5DB 1JF1B 1EHXA 1MQKH 5D96B 1L7TL 2WQRA 5CMAA 5SX4H 1ZLWH 4KGLA 2J8UF 3OAUH 3QUXA 1ZT7A 3N1PC 3D25A 1L9MA 4Y8AA 3OR7B 1MI5D 4PJGF 1D5IH 4ZFFA 3UBXI 1FPTH 1V7NH 3VD4A 4HK3N 1I8KA 2F54A 5EUOB 5FYLL 5T3XL 3MRQA 3FN9A 1BD2D 4PJ8C 1I1AB 4TTDD 1FFOB 1KEGL 1A7OH 5E8NB 1RZJC 3CFBB 2CD0A 3W5NA 4MAUH 3IDXL 3B8YA 2AXGA 2YUVA 3L7FB 3UJIH 5DVOA 1U8LA 1L7IH 4ELKA 2MTPA 4JO1H 1QYGL 2Q76A 2V5YA 4NC0B 1BX2B 4KPHH 4M7KH 4PJ5E 4JN1H 1B0GB 2YN3A 1BF8A 3DXAE 1KJ2H 1YEGL 1FNGB 3UX9B 2C3HA 3UTZB 3T09A 3OKOA 1T0MB 5FOBB 1N4XL 4Y5YA 2P1YA 1KENH 3I2CL 5I17B 3FB7B 5I76A 1RSFA 1NLBL 1CLZL 2NZ9C 3RA7H 1NGXA 1BEYL 4XPAH 4LEOA 3QI9B 4WW2C 4UT6L 2HVKA 1AY1L 1EVUA 2R0LH 2X6MA 1U41A 4NQSB 4M62L 3ARUA 4XWGL 3LEXA 2ZCLL 1X4ZA 3MLTB 5FUZH 5FUOL 4AG4L 3CMGA 1MFEH 4EIZC 5FO9B 1HOCB 2AEQL 5ADOH 1IM9B 4UQ3B 3GHEL 2MCG1 5I1DA 2J4WH 5C09E 2QQLL 5DMJB 4KROD 4QHMB 4H5SB 4LVNC 5IW6A 5E00A 3ARDD 4YBLC 4P2RA 5JW4M 3V9FA 4X6FB 4OD3L 1UZ8A