3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
2HKHL 4FQ2L 2DI8A 1RIVL 3DETC 3GHEH 3SKUD 4Y4KC 4U0QB 3INUH 4I2XE 1KJMA 1WWBX 3S5LG 4MA1B 2R0WL 3RBGA 2IGFH 4MAUH 3IYLW 1EV2E 2GW5A 4AEFA 2FD6H 3MBED 3IVKB 3AAZB 1CTOA 5DJ0A 4HEME 5SWZB 5SX4I 4UTBL 3EYFB 1BJ8A 4OI9A 3WEXA 1CZ8L 3OKOA 4AEHL 2CKBA 2Y36H 4NUJA 2GT9A 4G6JH 3V5KA 1LO4H 1VENA 2Z92A 1AC6A 5DD1H 1JF5A 2HT4C 3SE4C 3UAJC 4P49A 3MCKA 1GVIA 2JJTA 4K2UL 5JW4Q 4NYLB 4GXUM 3V0VB 4P23D 3HAEH 3UO1H 1HXYA 4FQ1L 1LDPL 2NY2B 1CG9B 4G3YL 4JCLA 3C2AH 1A21A 3SBWA 5HVHB 3H3BC 2Q8AL 5IW1A 4NQUA 1WBYA 5D5MB 2WSKA 4PS4H 3O3DA 1LK2B 4GSDH 1IAIH 3GIVA 5C07D 4WI2A 4HWZB 4Z8FH 4Z7WF 2DTML 3MRDB 5CINH 1RJLA 4OUUA 1GJIA 3KXFD 5ERWA 3MC0A 5EOQH 5EIIA 3MLSH 1MWAL 3F6IA 3S6CA 3LAFA 3WSQH 4GW5B 4OFYA 5TE7H 4P57A 1AY1L 5DVOA 3CPLB 4HS6A 1A4KB 2X42A 3A6CH 3HG1E 2NY0B 3WFDL 4PJHE 2YRPA 2OZ4A 2PXYD 1FC1A 1I8LC 3MV01 1KXVC 1S9WA 2GSGB 5KAQG 4JG1H 4NO3B 3QULB 4JO3L 4P5MB 3LKRB 4UQ3A 3B5GA 1VEPA 1NUNB 2BVPA 4XNYH 1UKQA 3QQ3B 4HUXA 1CICC 5F1OB 3UTOA 4IRZL 3QO1A 4HG4J 3QIUA 1MFEH 2OL3L 3RU8L 2NYYD 4F3FB 2VXSH 1L0YA 4BELD 4FTVD 5AAWA 4Y2DB 1C16B 4HK3N 1YPZE 4NC1C 4UT6L 4MX7A 4PD4J 3VXNA 5I1IL 4ZDHB 4HK0B 2E6QA 5T1DL 2IBZX 1KCUH 3CVIH 4X7EC 3T4AB 3QPXL 3GBNL 4F57L 5D6CA 1KG0A 1HK6A 3BHBA 4OGXL 1DBBH 2VDLH 3VFMB 4P2OD 4PRPD 5HYSB 2IC2A 2UY6A 3WIHH 1KEGL 3DVIA 3QUZC 1EVUA 4R7NA 3BUYB 2EH7L 5H94A 2AK4E 5FHBH 4HJJL 4PBWD 3RWDA 1U8JB 4XNUH 3LB6C 4UIMB 3EYUL 1CE6A 2DIBA 2QQKL 3F7VA 5DD6A 4H0IA 4MJ5A 1REIA 2MFNA 3VWKB 4L9LA 3S4SG 1CR9L 2R4SH 2PR4H 4ISVA 2QKIB 5C0GB 3DIFB 2YC1A 1NC2A 2IG2H 4N0YH 1EFXD 4OCRL 1NEZA 2K1MA 3TH4T 1CE1L 1AGBA 5DYOA 3QP3A 3D48R 4Y5XA 1IT9H 1MCQA 4RBPK 5DJDA 2ZUQC 3LN4A 4FZ8L 3V6OC 2EECA 4X99A 1QBMH 3DMMB 4FQXA 3DVGB 5BZWA 4ZPVA 3VMPA 4DW2L 1XR8B 2R0KH 3LHPH 4NQDD 1I3RA 3VW3H 4NDMB 3AY4A 3GMNA 4PJ7E 3UJIH 1HHKB 4MCYB 1AQKH 3L1OH 1T03H 4X6EB 5TQ2H 3WFEL 4Q2ZA 4OSUL 4QHUA 3GUTA 5BZDA 1HQRA 1RIHL 5C7XL 2VH5L 1LK3L 1MCCA 4H1LG 5F1NA 2PO6C 3L3JB 3W5NA 3DSNA 2VXQH 5ICXA 2MWCA 4X6CA 3ZKNC 4JFQB 4TSAL 4YBHA 35C8H 2X40A 4ALAH 5B39A 3ELAT 5I66A 5B38A 4YEEA 3HMXH 1DVFA 1YN6A 2ZG2A 1DN2A 1WSST 3G5YB 1YEEH 2A6JB 3NPSB 1BMGA 5D93B 1IM9D 4LHQB 4O2FA 3MV11 3PHQB 3OHXB 5I18L 1S7SA 3CGTA 3LKOA 3MRJA 3RVVC 1JNHB 3L3GA 3QB7C 3MBEB 4HKBA 3MA7B 4IHOA 4ZFFA 1RAMA 3MR9A 1CFBA 1Z5LA 1VGEH 3LDBB 4LCUB 3FAXA 3TNNB 1QYGH 3AM8A 4L3EB 1JZ6A 1SEBA 4R2GB 4LSTL 4PTUB 3N50A 3QEGH 4HIHA 3GO1H 1KTKE 2FJFB 2BSSB 4KXZI 2XKNB 1J1PL 4GW1A 1F97A 4P23B 5KVFL 1P2CA 43CAB 4FQQA 5DHVH 1FZJA 3Q5OA 4Y5YB 1SJEA 3CCHB 2XA3A 4CRPA 4KRPB 1V05A 3FN0L 1R5WA 1VERA 2X4PB 4UQ2A 5BJTA 4PG2C 2BJML 1G7HA 1TZHA 1KJ2A 3BPCB 3PV6A 2IH1B 2RFXA 2IWGA 1WAAA 2VLKA 4Z7UE 1TNMA 1JTOA 1UJTA 2AEWA 4R0LB 3MACL 2C9AA 4NHUA 3ZDXF 5HGHB 1JGVL 5CMAB 4HS8L 4UTAL 3OR6A 5J6HB 15C8L 3VXOB 3ZL4H 3CFJA 1S3KL 4S1DD 3QG7H 4Z7VA 1RZIB 3JV5A 4MB3A 3MJ9L 4XNXH 5I75C 3LKPB 4L8SC 3U36B 1KLUA 5F72S 3C60D 1JZ7A 2CSPA 3TNMB 4OZFH 5F96L 3I6GB 1T4KA 4LRNL 1J8HA 5CZVL 4XH2B 3BAEL 4LSSL 4PRAA 2NY4B 2X44D 4XGZA 4FTVB 5D2LB 1QHPA 3O81A 2B1HL 1SMOA 3KYMB 3IJYA 2DQHL 1KB5B 1MY7A 2VDMH 5DK2A 5IB4B 4P9MH 5CP3H 1I8MB 4X6BA 1U8MB 4M8VA 5FYJL 1PYWA 4M7KL 5HHXH 1CLOH 2M26A 1IVLA 4MGXA 1IILE 4NJAL 4PJ8B 2W38A 4ONFH 2W60B 4OV6F 1K5NB 2LAGB 3GI9L 1PGRB 2R4RH 3B3IB 3TCLB 3MRLA 4HCRH 1MHPL 4Y8AA 3WO3B 4R26H 4M5ZL 1A6VL 4H0GA 5F3HA 2D0GA 1NBVH 3DARA 4DGYL 4G6KH 1FIGH 1YMHB 5F6IB 1WFUA 1IGMH 2P5WE 5GS0H 3GB7B 1HI6A 1NAMB 3VXRE 4WFEE 4PB0L 5EU3B 2F74B 4FNLL 1ZSDA 3DX6A 4WENB 4XAWH 4FQLL 3OKDA 2DQJH 4NSKA 1YECL 5KSAC 4LLUB 4MD4A 4U7SA 3G6AA 3BKCL 3WHXB 5EN2A 4NC0B 1U9KA 5MENE 5E94B 1I8IA 1MFBH 3TO4D 5IB5B 2FO1A 1C5CL 2EDYA 1H15A 4EBQL 3P0VH 3W0WA 1FGNH 3HE7D 5C70A 3FONB 2FEDD 1NCCH 1VADB 4MD0A 1CDBA 1QKZH 4X4YB 3U7AA 3FFCD 3L7EB 3BD4A 3OAZK 4ZUUA 4LVHC 5HVFB 1IBGH 2XWJA 3BZFA 3QUXD 5MP6H 1AHWC 3VFVA 4XVSL 4NP4H 3B5HA 1GPOH 4LRIA 3JSSA 4P46D 3H3PL 1F3JB 2F8XC 4NFBA 4JFHE 4LCCA 2HP4A 3ECBB 4LCYA 3DO7A 2X4TA 1H5BC 4NQEA 3M8OL 3VRLF 4AM0A 5IJKC 4OZHE 4JR9H 2FH6A 4DEPB 2A9NL 4LSQH 5I8OL 1N4XL 3DNKA 1B0GB 1CFTA 2EE2A 3D0LB 1JN6A 1F42A 3VA2C 3F5WA 4WNQA 4XXDA 2GAZB 3RIAK 3T0BA 5IFJA 2V5TA 1P5UA 2XICA 3KGRA 4ZXBA 5D8JL 3ARWA 3N85H 1ZA6A 1N0XH 1Q0XL 2OSLB 4M93C 4MLSA 4P0DA 1KT2B 4YEFA 2DJUA 3ORJA 3OZ9H 3PWJB 3THMH 2F5AH 5IF0A 5ECJE 1BZ9B 4LMQI 4PRNB 1MJ8L 4IOFC 1N7MH 3NFPB 1J7VR 5C8JA 1KCVL 2VAAA 3DVNB 2PF6A 2I24N 4U1GC 3S7GA 5C0NC 3FQNA 3VRJA 4GG6E 1BQLH 1W72A 1VESA 4PJIA 3QRFM 5KBNC 3UTSE 1GC1H 1ES0B 1S7QB 1T20B 2VZSA 1HCFX 1OWRM 3PWVA 3L5WA 5C0CA 2VYRE 3C8KB 4M6NL 3FB8A 4PG9A 4MWFA 3GJFA 5EBLB 3IJHA 3KAAA 5HDLA 5INCB 3DXAD 5GISH 1WC7B 2C5DC 2CJUL 2CIIB 3HAEB 1B0RA 1AD0B 1P69B 2HFFB 1T2XA 3WYRA 5D7SL 4ONHB 2VDNL 1A1MB 3QCTL 3TF7C 1BQSA 1KXQE 4R6UA 4YFDB 3TO2B 1NDGA 1X5ZA 2ZSVA 4KMQA 4KK6D 2NXZB 5LGKA 4GKNA 5CJXC 2FSEB 3TVMC 3WE6A 2Z35A 3BP4A 3VFOA 4KROD 1I1AD 3WFCH 5F9DC 1UH4A 1YEHL 1F3RB 4OCYH 5HDBF 3LQAL 5FECB 1UQSA 3DGGA 1T3FB 3Q6GH 3SDDC 1BFSA 1HSAA 4YNYB 1WEJL 3L3DA 1TJGH 1JI1A 4KQ4L 1EO8H 4M1GL 1CT8A 3V5DA 4JG0L 2CDGB 1RUAL 3RUGB 4U3CA 3VXMB 1JMXA 1I1RA 1JWUA 1RIUL 3CNKA 2X05A 1OF2B 2VZTA 1DBML 1R3IH 5C0DA 4FABH 3ZYIA 1BFVL 3OWEA 4GRLD 4UT7L 4MNQD 5EU6B 1HWHB 2PTVA 2ITCA 2CRIA 4QCIB 1GGIH 2BFVH 1GH7A 2OI9B 1H3PH 4MQ7B 3SE3C 3QQ4A 1FNSH 4KVCH 1JTTA 1J1OL 1S7RB 5I9QC 1VACB 5JMRA 4UINH 4TRPH 4UILH 4I8DA 5DUBB 4LLDB 2RAMA 3TV3L 1RMFH 4KK5C 4X4XB 3T65A 5KSBA 5ITFA 3GMPA 4J8RA 4HPYL 1F4HA 4LLVA 4EEEA 1XF1A 4RQQA 3UROR 2DWDA 4WHTA 4KHXL 4BSVB 2NY7H 4PJDE 4JLRA 2YMXH 4WO4B 3FO9B 1IKFL 2VABB 4P5TD 1F4WL 4HWEL 1CD1B 4JFFE 5D7JD 2ATKA 4YDLC 3PIQA 4FQJH 5C0AE 1J86A 2AK1L 2CKNA 5D1XC 3BN3B 2QSVA 1CIDA 4HW6A 4JDVB 4J12A 1EUTA 4Q6IB 2BVYA 1RHHA 2A6IA 5EUOE 1A9BA 4J3UA 3SE4A 1OT1A 1CU4H 3RHWK 2AW2A 3QNYA 4P2QB 3KPRE 3P4OA 4XPGL 1KIUA 2PUQT 5EPMA 3NAAL 2CMRH 4HF5H 3TYGL 4CMMB 4OLZH 3W81A 4JFZH 4FOMA 2OR8A 4X5LA 5I1AA 4N0FA 5GS0D 5IQ7L 1QA9A 1B6DA 1YNLH 3H9SA 4MDIB 1L0QA 2JIXB 2W9EH 3BZ4A 4PBVC 1F90H 3GKWL 1XZ0A 3QDJA 1RJYA 2ORBL 5FUOL 5GGTA 2IFGA 5IM7A 1FDLH 4EQ2A 1MCWW 3SE8L 2EYTB 4P46B 5DD0H 1UYWH 4TSCH 1GOGA 3V6FA 5IG7A 3KLDA 3PNWA 4JZJB 5E8OA 5HYFA 5IBTL 3JUYA 4FQCH 3HUJE 4HIXH 1Y6NR 1ACYH 2NY6C 3LRSA 4OZGF 3RA7H 4YC2B 4ZOCA 4NO5A 1JGEA 4PJ5A 5ICYA 1J0IA 3BDYH 3NGBC 2W9DL 4OKVA 5DQDH 3WS3B 5C07E 2UWEE 1PSKL 4OAWA 1P9MC 1HN1A 3U30B 2DF3A 4BFEA 3KXFE 3BKYL 4YHML 3GHEL 3QHTC 2A1WH 5IBLD 2XT1B 1KOAA 3G5XB 1A6ZA 3INUL 3QI9D 3TBWA 4AIZB 5D2NC 1MQKH 5SWSA 4NZJA 5KOMC 1AXSB 5MEQB 5HHQA 5ENWA 5DHYB 4NQSA 5LQBL 4KVNL 2FD6L 4ZUSB 5E56A 2DQCH 1AC0A 4GW4B 2A74A 4JGUA 4NWUH 3BZEB 2Y36L 2UYLA 4OD1H 4U1NB 3D3VA 3TBYA 2PTTB 1QRKA 4JO2H 4B50A 1G7PA 4YHKH 3UO1L 5CEXA 3KPMA 4NRYB 4JZOB 2H9GA 3QXVA 4G8GD 3BP5B 1EXUB 3C2AL 4JFXA 2IQ9H 4XI5D 1ZHNB 2Y7QB 4FP8L 1JF1A 2P8PB 3WLWC 5EU4B 5DHVB 2P42B 3ZT6A 3ULUH 1OGAD 1ZTXH 4J4PD 2OTWB 1QLFB 5GJSL 4Z8FL 5CINL 2XYCA 2VRAA 1K4DA 3HAEG 3UTTA 4R96B 1BAFL 3MLSL 4OIIH 2UZYB 4HV8A 5C0JB 3V6OA 1FFNA 1BVLB 4TTGA 3HS0B 4KROB 1I1AB 4K3JL 1MJ7L 3EDFA 3STZA 4MXWH 4PRPE 3A6CL 1ZK9A 3WV0A 4POYA 3ME0A 4NRXA 1JGLH 4KK9C 2GK2A 1ORSB 4WFHE 2DTSA 4WFGD 4UAOC 2JCCE 4GUPA 7CGTA 3GSRA 3B2VL 3O3AB 4YHIA 3DYPA 4OD2B 1MHCA 5CIPB 5DEFA 3O6FC 1JYWA 4WUKH 1OP5H 1MHHA 3TN0C 1UWEL 4MNQB 4D9RE 1I9RL 1EZVY 2PO6A 5DC9B 3RVUD 1IE5A 2VISB 4F80A 4X5WB 3KPQB 2HJKB 2DWEB 2OP4L 4R3SA 1MFEL 2WUBL 4LCIH 3IU3B 1XMWA 5BRZA 2VXSL 5FO7A 2IAMC 5FV2A 2VTFA 4U1MB 3MUHL 3HPJA 3HTLX 4NZDA 1FO0A 2DKSA 5J13C 4G9FD 5SX5K 3CLEL 1T5WB 2X9XA 4K94C 4NQDE 3TC9A 4NO2B 1PW3A 2H2PC 5DR5H 1BQHB 3I50H 4P59H 3S34H 5BS0B 1AIFA 1WWCA 3AS2A 3HZKB 3IS1X 3FAWA 3RL1A 2R2CA 5ISZB 1YEKH 3WIHL 3SKOB 1NC4A 4IS6B 5IB2B 4Y4HD 1J8KA 3IDIB 4APQA 1QSZA 3WFBH 4GRMB 3BXNA 3QUML 1IEAA 1MJJB 1BM3H 1T0PB 1KLGA 3S35X 1BZQK 1DL7H 1YMMD 4PYGA 4JFDD 1NBZA 2IG2L 5BXFB 2ZUTA 2F58H 5I16B 3S35H 4PY8J 3CSBA 1IT9L 3V4VL 2FZ3B 4J6RH 2FGWL 1K8DA 1ONQA 1MAMH 4JFYA 2X9WA 2LTQC 4XVTH 5DJXA 2A0LC 1T1XB 4U49A 4WFFD 5HDBE 3ZT7A 3L7FA 2B1AL 1EEQA 1QBML 4UIKL 1I7ZA 1RUKH 3U0TA 2NX5A 4PGEA 5EFIB 4P4KD 1NCAH 5TDOB 4E41A 2CK0L 1GL4B 2GJ6D 2BY0A 5C09A 1B2WH 2DQGH 2IH3A 5D72H 5FXCH 1D9KB 2Z91B 3QNXA 1U8IA 5JORB 5HYEA 5TQ2L 4X0KA 1QQDA 3BMVA 2VLRD 1WQVT 3TJHD 5IVXE 3QHFH 4PJFE 4QHLB 4UNVA 4R4FL 1XR9B 2GFBB 3MJ8A 4MJID 43C9A 3IJSA 3T3PE 4YO0A 5JW4R 3RFZC 1EAPB 3UTZB 1DDHA 3O9WD 2VUYA 4WY7L 1MNUL 2VXQL 5CSGA 2NW3A 1T7YA 4IRSD 4LLWB 2JK5B 4XPTH 5ACZA 4ZOEA 1H3VA 2G5BB 3I02A 4HWBL 4WV1A 3CFDA 3VWJB 3GFUA 3WN5C 4JN1H 3TWCL 1H3UA 4DVRH 2FIRT 3MRHB 4PJAF 3RDTC 3VFSA 1N5AB 1G7IB 3ZTNL 4U6VH 1CFQB 1HHJA 1P6FA 3GNMH 1NLDL 3G6JF 4LSVH 1OB1B 2WP3O 4NNPH 4WGVB 1VGEL 2DS4A 1OAYH 1Q1JH 4XWOD 3P4MB 2BNUB 4NWTH 1E6JH 4EUPH 3OKMA 1E0OB 5GS1A 3FN9A 3HA0A 2OBGA 1I1YB 1AP2B 3FCTB 4CMHC 5KG9B 4CBPA 5E9DB 3WDIA 1U3ZA 1JFQH 3KPPB 2FDBP 5IQ9B 3LKSB 1Z3GH 1ZT7B 4U1JB 5AEAA 1J05A 1NFDB 4G8GB 1MLCB 2EDEA 1VFBB 4LPCA 3VGAC 4NJ9H 4P48A 4RGNB 3O3EB 3HR6A 4YR6B 1CTNA 1EA9C 1Q9OB 5FO8B 3FN3A 4BH8A 3GSOB 3O0RH 4LSPH 1SY6L 3BWAA 2ESVA 3RWGB 2FWOA 2IALA 1MRFL 2GK0B 1S7VB 1JUFA 3VXUB 4D0CA 1RUQH 3BISA 3L95B 4D0BB 4EI6B 4WEMB 3RX5A 1T1ZA 3HRPA 3QEHA 2BVUA 3ZSSA 5IHLB 2F53D 1QOKA 4WCYH 2BSRB 4F7TA 1K3IA 2D03H 4LKXA 3SCMC 2NTSP 3QG7L 1HKFA 3REVB 3CVHL 1CLCA 5F89B 4YJZL 1T83A 4GG8A 4HT1H 4FXKA 4C4KT 4HS3B 2X4OA 4H88L 5EUKB 5GS3A 4WJ5A 4Y7MA 5I1DB 4I18B 5KAQF 2QQLH 3T4YA 5CSZB 2FECI 1BPVA 2NY2C 4JVWA 2PW2A 3VA6A 5DJCB 5DMYA 1F2XK 4X7FC 3WKNA 3CSYA 1MIMH 3RPIB 1H5BA 1EHAA 3KVQA 4U3XA 3JWOC 4OZIB 1I9JH 4G9FB 4HC1L 4L4TD 4XMPL 4Y8DC 4HUUB 2VDML 3C8DA 2VLJB 1DQQA 1EGJL 4HH9A 2Z8RA 2ZG3A 3QIWD 4M5YH 4WW1A 5CZXC 3T2OA 1ADQH 4ONFL 4BSWA 2QSCL 1KN4H 1TTGA 3ULSA 3RNQB 3ROOA 5CJOL 2NY0C 1BZ7A 3FOMB 3QIUD 4YZFF 1KC5L 1R3JB 2ZKHH 2Q6WB 4HCRL 1JBJA 1BQHG 3FFCE 2H8PB 4Z76B 1NBVL 3C87A 2GTZB 1RK1A 1HDMB 3DROB 1LO3H 4YWGH 3KDMB 4BZ1H 2EYSB 5F9OH 4QRTA 4OFDA 4Y1AD 1NMAH 1RZFL 2V2XB 1UEYA 5EO9B 2C3HA 1TQCB 4C4KO 4FXGA 4NQCA 1Q0YH 2BDNH 2AJUL 5DI8B 4G8IA 1K2DA 1UXWA 4S0SD 3GM8A 4WHYH 2H32A 1KCSH 2BCKB 3MLRL 2DQJL 2D2OA 3MOQA 2OLDA 4NKOA 1QLRB 1XF3B 4P4KB 1QR1B 2AJ3A 3QWRD 5DMIH 2HLAB 1J10A 5CJQH 1MFBL 3VFTB 5AYUL 3KYKL 1CVRA 4NZTH 2CD0A 1BFTA 1LHZA 3ULVC 4HKJB 1LNUA 2IADB 2F54D 3RP1A 1I7RA 1KJVA 2EIBA 5IB3B 3IKCB 5CJXA 5CUSL 5DVMA 4OCSH 1AQDA 2WK2A 4LIQH 3VWKC 1GPOL 1A02N 2W0FA 3AU1B 4ZAKB 3SDDA 4LGPB 4LEOB 2ZG1A 1NGXA 2O5ZH 3OKLB 4UDTA 3MRIB 3RL2B 1RUML 3VJ6B 2W91A 1DSFL 4HD9A 5TGBA 4DN3H 4LSQL 2VZ1A 3DXAE 3BRDA 2AI0H 5EB9A 1MI5D 1K6QH 3O8XD 3SE9L 4V1DD 3DMMC 4ENED 1VCAA 5BMFL 3MRCB 2R2EA 1G7MA 4H26A 3SE3A 1G84A 3N85L 3BPLB 1KACB 4C83A 1DUZB 3MV7E 4I2XA 4KKNA 4JGJA 4YHZH 2AGJL 3OZ9L 4PJCB 4GBXC 1AGEA 3ALWA 3QDGE 4NKDB 3T8XB 3Q3GA 1RK0A 1DVFD 3G9AB 4QHNA 1YEIL 5E00B 4LAQH 1NGQH 5L8KB 1PKOA 4RAVA 3RWIA 5E6IA 5I1GH 1BBDH 5EOCH 1F6LL 1X6LA 1NMBH 2O5XH 1BJ1J 1BVZA 4ODUA 1S78C 2R1XA 4OLWL 5DJ0B 5K9OA 4L3CA 4G8EA 3WEXB 5A3ID 1IGYA 2DBLL 1OPGH 3SDYH 1S7TA 5BOZG 3OKOB 1IKNC 2CKBB 4NUJB 1ZGLA 2GT9B 5EULV 2AABL 3QSKB 4PY7A 1CDIA 5BW7C 3V5KB 5J12B 1BGXH 5C0EA 1EJ6A 1ZS8A 3NPSC 3FMGH 2WIIA 3MCKB 1YEJH 3PGFL 1HXYB 2YN3A 3ALXA 1J0KA 3NZHL 3BPNB 2SEBA 1UH3A 5J1SC 3MBEC 2HN7A 3QUYA 4L4VD 3ZO0A 4ODXA 1T6WA 5IW1B 3LDBC 1WBYB 3SJVD 1G9NH 4OF5A 2WLYA 3O3DB 3GIVB 1Z6JT 4R2GC 1K8IA 2NTFA 1RJLB 3HG1A 3WFCL 4PJHA 4OUUB 4GQ9L 3T1FB 1FNAA 5ERWB 4XCFL 1A6UL 5EIIB 2VLKD 4NUGL 4J7RA 4DUWA 5LGJA 3BW9A 3I9GH 4P23C 1HIMH 2DM3A 4P57B 4DTGH 4PLJC 4YHPA 4Y5YC 5IVOA 4HS6B 2ZWLT 4PJAE 3RAJH 2RCSH 3QWOA 5H35A 2C26A 4Q9QL 1LE5A 5D7KD 5F8RC 4KQ3L 1S9WB 4X5XA 1T1YA 3VD5A 4MMXC 1WGOA 1A0QL 4L4TB 2VL5A 4UQ3B 3BGFB 2A6KA 2BVPB 4TSBH 2G9HB 3AB0B 3O6ML 1YPZA 4R0LC 4TRPL 4UILL 1J8HD 4DUVA 3KYAA 3QO1B 3VXTA 2CRZA 3UJJL 2ZCHL 3GSNH 3EYVA 4RIRB 3WNLA 4RZCA 5CSBA 3C5JA 3QIUB 1KULA 1HYRC 2V9QA 4PJXF 4FFYL 4LPTA 3LN5B 3WJJA 1YDPA 4NZRH 4XPFH 4BM7A 5HYJA 5E70A 1T0MA 5EO0A 3H7BA 1RZJC 3RI5F 5J0BA 1MCJA 5KW9H 4MX7B 2DDQL 3VXNB 4LSUH 2AK4A 2VDRL 3QXAA 1B4JH 2R39A 1MCIA 1E4KC 3ARDD 1A1NA 3OG4B 2YD4A 3DPBA 4FQJL 3ULVF 3U6RA 4BZ2H 3BI9X 2UZIL 5DUMH 5D6CB 1KG0B 3BHBB 5F88A 4ZS6D 3V4UL 3IXTA 2AEIT 3O2DH 3G9VA 2NYYC 4LLYA 4NKIH 4R7NB 5H94B 3ULUF 3PQYE 4NT6A 1N5YH 1FBIH 3NH7H 3RWDB 1ZVSA 4P9HH 2E27H 4YBLB 4BFIA 3T09A 1CE6B 4KDTC 3F7VB 4K23H 4HF5L 5DD6B 4UV4H 4L9LB 3TLRA 4F9LA 3EFFB 2WBJA 3MGOA 2K7QA 3CXHJ 2BY3A 1I7TA 3T0EE 4ISVB 3MLUL 3FB5A 1E4JA 2YC1B 1NC2B 4TUOA 2FBJH 4HUMB 3FFDA 1NEZB 3I75A 1YNLL 3QJHA 4Y0GA 4IDJH 4XC3L 5ID1A 1AGBB 5DYOB 4J3VA 2Q76A 1T21A 3O2VH 4Y5XB 5DJDB 3LN4B 4PJ7A 2FLRT 1EO5A 1N2RA 2JJVA 4WTZA 1IC4H 1SM3L 4X99B 3DSFL 4X4ME 5HVGB 3E3QC 4FQXB 4FS0A 4Q0XL 5BZWB 1G0XA 2PCPA 1J12A 5F6IC 4N1CA 4DKDC 1KB9K 4K8RC 1CS6A 3MV8A 1I3RB 1FC2D 4ZUTA 2PETA 3GMNB 4D9LH 5FKAA 1L6ZA 4HIXL 4K3DH 1OCWH 2KZ1B 1U42A 4Q2ZB 3MLYL 3CSPA 5T1LD 4QHUB 4ZNEE 1IQWL 5BZDB 3GUTB 2VQ1A 1F4XL 1HQRB 1G7LB 4O02H 4YIQA 3TN0A 3QQNA 5BQ7A 1UEMA 5HHVH 3VFPA 1A9EA 3O8XB 3K46A 3JWDC 3VD3A 3L3IA 5DFVD 1OGAE 1WUNT 1PLGL 1T04B 5LWYH 4Q97A 2JLLA 5I66B 1JJUA 5B38B 3BZDA 1LQSR 3R1GH 1MQKL 1DVFB 1YN6B 2WWMD 2H26A 2CLZA 1R0AH 4NKMA 5FUZH 2VQUA 2J4WL 4X9GA 1SHMA 3O6KL 2VSCA 1DQDH 1EMTL 1GOFA 4U1KA 2XKSA 4O2FB 3L5HA 4HUWA 3C9NA 2DKUA 3IETA 4X9IA 1S7SB 5HGAA 1GYAA 3STLA 4WWKD 3MRJB 2ED7A 1A5FL 3LKOB 4KJQD 5DJ6A 3L3GB 2FECL 4ZXBD 4HKBB 4WFGE 1KBGL 4IHOB 1ROWA 3TP4A 4ZFFB 1ZKAA 1Z5LB 4X9HA 2X7LA 4W4OA 1BEYL 1SEBB 4FFWC 4YHKL 3RY4A 1G6VK 3BH8A 2G5RA 1HOCB 3ULVL 4R4BA 4EUPB 4DEPC 3IAQA 4GW1B 1INQA 2IQ9L 3BWUC 1U95A 3CXDL 1A14H 4NO0A 4I9WD 2JB5L 1P2CB 2ADJA 3SHSA 4FQQB 3ULUL 3F62A 1SJEB 3D2UD 1DTUA 4HGKC 4Z7UA 4L4VB 1R5WB 1MCPL 1JZ4A 3EZJB 4QRQA 1AD9A 4UQ2B 3SJVB 5LG1A 4OIIL 1G7HB 1TZHB 1KJ2B 4OI7A 4OQTH 2Y4SA 4ELMF 3R8BB 4M9PA 1U8LA 1ZHLA 1L4IA 2VLKB 4MXWL 4HBCH 5C0RH 4JJ5A 3HLAA 3MRQA 5DS8A 1KPRA 4NHUB 1NAKL 1JGLL 4LLMA 3DBXA 2X89A 3ES6A 3VH8A 2R2BA 1N6QL 3KPSA 3CFJB 1UZ6F 1WTLA 3A6BL 3BEVA 2L4OA 4WUKL 3X3GL 1YMME 4Z7VB 4LASH 4JFDE 4UOW0 4TOYL 4WUUE 4PRHD 3RY5A 1HH6A 1KLUB 1DFBL 1TVDA 1OTUD 1WIPA 5EORL 4LEXH 3HI6L 2C4FT 1CFVL 2IFFH 4NGHL 4WFFE 1J8HB 1O7VA 3W2DL 5IHBA 1QP1A 3PP3K 4YUEH 4POZC 2GYSA 4PRAB 1IAKA 4XGZB 1J18A 4M8QA 2GJ6E 2NXZC 4K71B 4S1DC 5DWUH 1FNGA 4OT1H 1F2QA 1VEOA 5DR5L 2J5LB 2PNDA 4H20H 3IJYB 4MXVF 4D2NA 3C60C 3IFOA 5DK2B 2VLRE 3B9KA 3MCLH 4X6BB 2XN9D 4EIGB 1PYWB 5ACMA 3I85A 3WFHA 4ZNCD 4MJIE 1DN0A 2P5WA 4S1QH 5D7IF 4Q9RL 2YOCA 3MRLB 5ACLA 5F3HB 4RGOH 3UTPD 1XF5A 3VXRA 3ZKQD 3OKEA 1NCBL 4NNXA 1MFAL 1FZMB 1PVHA 2OI9C 3GRWA 3GKZA 2D7TL 1E4WL 1FE8H 3SDXF 1HI6B 4DGIH 1GGCH 3B2UC 5MENA 1P84K 3BMWA 3CMGA 4NBYB 4U1HA 4KTEH 1NCAL 3A6OA 1NEZG 4Z0XA 3RVWD 2YD2A 1CQYA 1ZSDB 3DX6B 1ZLUK 3OKDB 5GS2H 4NSKB 2VDKL 2VDPH 1U3YA 2IJ0C 3OL2A 3EOYG 4MD4B 2FR4A 4NOBA 3JWNC 4WO4C 4PLKD 5EN2B 3FJTA 1F02I 5ALBL 3QHFL 1I8IB 1KJ3L 4CNIA 1WCBA 1EIBA 1KENH 1H15B 3SCMA 2XIDA 2XG4A 4OGYH 3W0WB 2MOVA 1OW0C 3LKNA 4MD0B 4Q6IC 2B5IB 4UI2A 4RMVA 3QIBD 5TF0A 2BVQA 3MGTA 1GXEA 4GS7B 4ZUUB 1RZJL 2XWJB 4IMKC 2Q3ZA 8FABA 4OZHA 4PJXE 2A77H 3VFVB 5EZLA 4HLZG 4LHUA 1UXSA 4L8CA 5GRVL 1RZ7H 3OJVC 2HT2D 2VN7A 4U7KA 4WTWA 1ODAA 2V17L 4JN1L 4LCCB 4DVRL 1WF5A 2X1XR 4LCYB 3DO7B 1NANH 2X4TB 1C12A 2FEDC 2NZ9C 3MRDA 4JFPA 3IF1B 5I8KL 5K93A 5B38G 4CDHA 1URLA 3I3BA 2APFA 1CFTB 1S9VB 2F53E 4PJ5D 1JN6B 2R15A 4H0HB 3QUXC 3F5WB 5IHUH 4WNQB 4XXDB 3ULUE 5IFJB 1CXHA 5F7DA 1D5ZB 4ZXBB 4P46C 3LIZH 4PGDA 1E6JL 2NZIA 1OP3K 1OAXL 4GG6A 1GIGL 4JZJC 4UMGA 3GSXB 3BDBA 3CZFA 5IF0B 4K7PX 3UTSA 5KVGL 2GSGA 4XHJD 3GEWB 4DKAA 3NACH 3P2TA 4K7PH 3TZVA 2VAAB 2OTUA 4YC2C 3O6LH 1EPFA 3FQNB 3VRJB 4RBPH 1W72B 1E28A 1YN7B 4CN1A 4EUPG 4PJIB 2X4NA 4YPJA 2R1WB 3BP7A 5IWLA 2R8SH 2C1PB 3U30C 5INDB 1CGVA 3DUSA 3L5WB 3PWVB 2IPUK 5C0CB 1LO0L 1MRDL 5DEGA 5F7YC 3FB8B 4PG9B 1NAML 4MWFB 3GJFB 1C8PA 3FRUB 3CZJA 2J8UB 3IJHB 5CBEA 1CL7I 2RQ8A 3OF6A 1CF8H 1UFUA 3KHOA 1B0RB 2D03L 2WV3A 4WI8A 1DP0A 5CHNA 2ZP0T 3MXVH 5MEPA 4F7CA 5MI0B 3RGHA 5HYSA 3P0YH 1MCOH 4AEIL 3SGEH 4XB8A 4HT1L 1NDGB 2ZSVB 5DZOA 4YHOH 3A67H 4H8WH 4Y1AE 4GKNB 3WE6B 2HJLA 4UIMA 2W1NA 3BP4B 3VFOB 3OB0K 2Z9TA 3A0OA 4G9DA 3VWKA 4PRHB 4XNZB 3FO0H 4BK5A 4QKXB 1E6OH 3T1WA 1UQSB 3DGGB 4MA8H 4TTDD 5FA3A 1VHPA 1TJIH 1KCRL 3UX9B 1HSAB 3L3DB 1V3LA 1MF2L 4KKBD 1MIML 2DQIH 2EO1A 2J12B 3DX7A 1JWUB 2O61A 1MVUB 3MRMA 1BWWA 5TDNA 3EOBB 2N7BA 5C0DB 2ZZUT 4C56D 2ITCB 1I1AC 3DVGA 4KROC 4OFIA 5C0BD 3OV6A 4CVZA 3QFJD 3ILQD 3QQ4B 5J56B 1JK8A 5KZCB 2XN9B 1IC1A 5DT1L 3KWWA 4G7YH 1U58A 1HHKA 2F54E 4PJDA 4RCAA 4GBXA 4RX4A 4AMKH 3WDJA 4MXQD 3JV6A 4X6FA 1ZANH 5ELIA 5JOPD 3MNVA 4JFFA 1PG7H 3T65B 5C0AA 3F7YA 2E6JA 4XBPA 4YWGL 5KSBB 5ITFB 5F9OL 4GRLC 4OCWL 4J8RB 1JHKL 5DO2D 4LLVB 4RQQB 2DWDB 4WHTB 3BKJH 5EUOA 4JLRB 3B5TA 2OS7A 1BREA 4KUZH 1Q0YL 4JRXE 5B4MD 1G6RH 5HY9A 2ATKB 3F12A 4ELME 3PIQB 4XP6L 4ETQA 1IKNA 4F58L 2I5YH 1KCSL 1CLZH 2XY2A 1MI5E 4ZS7H 4V1DE 4APQD 5TE4L 2A6IB 1H3TA 4KRLB 4NQXB 1A2YA 1PKQB 3P4OB 5JO5A 5CD5D 1R3LA 5EPMB 2V7HA 1AO7D 5HHOD 4WHYG 4PP2A 3UC0H 1A7OH 3GMQA 3MNWA 2MHAA 3HC4L 3CH8A 4BK4A 4YDKH 3MA9H 5JXEC 5I1AB 4N0FB 4WDIA 1QA9B 3H9SB 4JHAL 3BZ4B 3NPZB 1R24A 1XZ0B 3LH2H 5T3ZD 2A9MH 4LIQL 2XKNA 3QIBB 1RJYB 4P5KA 3DV6B 1FNFA 3HUJA 5GS2D 4ODVL 2VDQL 5IM7B 4OJFH 3VGEA 1NCUA 1NFIA 4GKOA 2YPVL 2EE9A 2B0SL 5JHDE 5F1SA 3V6FB 3D18A 5GS0C 1ZT4B 5IG7B 4YBQD 3PNWB 5E8OB 1BX2A 1LEGA 1PBYA 5C07A 2DJSA 2AI0L 2UWEA 3STBA 1K6QL 1D6VL 4EI5D 4PB9L 3JXAA 3KXFA 3BRGC 2VE6A 1FORH 4OLVH 4S10A 4NO5B 1JGEB 1IC7L 4PJ5B 5ICYB 1OHQA 4QRPE 5D7IE 4K3EL 2R0LH 1D9KC 4N8VB 4OKVB 4XBGA 3TBSA 1Z9LA 5ITBH 3KYOA 4OAWB 5J3HD 5C0FA 3OJDA 4EDWH 3NFNA 3O4LD 2PXYA 3H9ZA 1A6ZB 1BP3B 3AS0A 2DQDH 3TBWB 1CD0A 4LCWD 4NNYA 1A7PH 3IU4L 4JDTH 1ZMYA 5HHQB 3LKPA 4QRUB 5ENWB 1NEUA 1HNFA 3SDXE 4NQSB 3ZTJG 3OGCA 4Y16A 4YPGB 3LS4L 1VFOA 4YFEA 1QEWA 3AVEA 1TMCB 2A74B 3SDYL 2ID5A 2DQFA 4KI5C 2UYLB 1CXLA 4ONGH 3RNKA 1FG9C 3D3VB 1BGXL 3VWJC 1V3JA 3TBYB 4I3SH 4ODSL 1P1ZA 5EU5A 4AL8L 2MNUA 1N6VA 3SGJA 1PJ9A 1RU9H 4FTVA 1YEJL 4Z7NF 2V2WA 5EG6C 1G7PB 4Z0BL 2KPNA 1V3KA 3QYCA 4AIXA 2H9GB 1CDHA 3TA3D 4NM8H 1VPOL 4HZLA 4XAKD 4XP9H 1MJUL 4JFXB 2EDRA 5FGCE 5FYKH 5ADOH 1I8MA 1U8MA 2VDOL 1JF1B 3NCBB 4OM1H 3J8F7 3X3FL 4RWYL 3IAGC 3OAZH 3P0GB 3MJ6A 3BJLA 4P2OA 4PRPA 4PGBB 2V5MA 3VD9A 1K4DB 5T33H 4OLUH 3UTTB 2YEZA 1OOAA 3EDEA 4BH7A 5F9AC 5FGBC 3B83A 4HV8B 1FFNB 4PLOB 5ILTH 4M48H 1JHLH 2JCCA 1F45A 2Y07L 5F3BA 2P24A 3N1MC 2N1KA 5F70A 3STZB 4M1CD 3VI4F 2J88H 1OM3L 5L9DH 1JRHI 3QH3A 3GB7A 1EFXA 1MFDH 1JZ8A 4NRXB 2F5BL 1AXTH 1XIWD 4RGNC 1GC1C 3K4ZA 5EU3A 4GUPB 2W0PA 1CK0H 3GSRB 1MHCB 4TSBL 4DKFH 5L6YH 3RI5K 5DUPL 3VDCA 1QLEL 5DD5H 3ARQA 4DN4H 3WCYA 4XX1G 3GSNL 5DMKA 3G5VA 4NQDA 4R3SB 3SDCA 2QHRH 5T3XL 2F15A 5BRZB 5FO7B 1NDMB 4OZ4A 4XPFL 3K74B 1QZ1A 4MQSB 3HPJB 4QTHA 2HH0H 1KYOJ 5KW9L 5D71H 4Z7OE 4KJYB 4JQIL 4X4YA 4JDZB 2EDHA 2MPAH 3BX7C 5EIVA 4OLXH 4BZ2L 2N4IA 2AEPL 5GZNC 1AIFB 3EFDH 4WU7B 3RL1B 2LAAA 4RFOH 3O2DL 3QCVH 1NC4B 4NKIL 3OTTA 1N5YL 2E7HA 3LVEA 1ZEAL 2E27L 4APQB 5HHPA 5FYLH 3QAZB 5TF1H 4LIQE 1J88A 3BXNB 1IEAB 1IM9A 3O3UN 3W9DA 2VMFA 1KLGB 3WXVH 4P2RD 1NBZB 1OTSD 2GAZA 4IDJL 1V7NH 1XGQA 2VLLA 3OPZH 3IDYB 5C71A 4NN5B 1FAIL 1J0JA 4M9OA 1KT2A 3EO0A 3O2VL 1TJHH 1K8DB 1ONQB 4N8CH 1VSCA 4JFYB 5A2FA 5DJXB 1C5DA 3ROLB 4XC1L 3FHQA 3L7FB 4ZD3L 2OX5A 4JQVC 5IVXA 1I7ZB 2ZCKL 3U0TB 4I77H 2NX5B 4PGEB 4PJFA 2HKHH 4FQ2H 4E41B 1JVKA 3DVNA 2PYFA 3SO3C 1OLZA 4LVNB 4UV7H 2R0WH 1CFNA 1TPXB 3QNXB 4MQXD 1U8IB 5DTFB 3MLXH 4X0KB 1QQDB 4XP1H 4F7EA 5JQ6L 3I6LD 2VERN 3FO1A 1BOGA 4O02L 2FX8L 1W8NA 2W59A 3MJ8B 2R69H 43C9B 4MVBC 3IJSB 2C3GA 4YO0B 1DDHB 1T2JA 5I75B 4P4KC 5CBAA 2NW3B 3D6GA 2Z31D 2ZNWA 1CL7L 4KI5F 5ESQA 5ESAA 1H3WM 4PP1D 5ACZB 2OMBA 4FQ1H 4CVXA 3IDXL 4U31A 5KANG 4WV1B 3TJHC 3CFDB 1R0AL 1QBLL 4U1IA 5DGRA 4N8VG 5IMMA 1T7XA 4XMLH 1GZQA 4RFNB 4WGWB 3VFSB 3O9WC 3IDNA 3RVTD 3UYRH 1HHJB 2AXJA 5EZOH 3QNZA 2JELL 3C60A 1MWAH 1U41A 2X4UA 5IGXL 3NIDE 3TH2T 5HVWA 4G6AD 5F44A 1AY1H 4QLRA 1WTGT 1GHFL 4M43L 3LEXA 3WFDH 5A2IH 1L6XA 3OKMB 5GS1B 1NFDF 3FB6A 5E6ID 3RGVD 5TH2A 5I8CA 1J05B 4JO3H 3TA3B 3MRKB 1EHNA 4MYWB 1UG9A 2HKFL 3BN9D 3BPLC 1VACA 3RWJB 3CD4A 1ZWIA 5E5MA 4LLDA 4DK3A 5FOBA 4XWOC 4IRZH 3DI3B 2GI7A 4OQTL 4X4XA 4HGMA 3MGAA 5MHSD 3F8UB 2OL3H 3RU8H 4BH8B 3ARZA 5FKPB 5BCAA 3VXSE 1E27A 3BWAB 1K4CA 5IOPA 2FWOB 4HKXA 4HBCL 5GRVK 4YH6A 1JUFB 1D5MB 2XTJD 4D0CB 4Y19E 4UT6H 5I1IH 1T1ZB 5GJTL 2VABA 2VITA 5T1DH 5FYKD 5IK3B 4MJ6A 4CGTA 3UPCA 5GSVA 3SDAD 5F7FA 1VKXA 4F7TB 1X4ZA 6CGTA 4A2MA 4F57H 4R7DB 3UTPE 5BV7B 4LU5L 4LPXA 4OGXH 1OW0A 5J12C 3FB7A 1JNLL 2B4CL 1KEGH 3WIHA 1JPGA 2YWYA 4GG8B 4FXKB 4HJJH 2VZ3A 2JJTC 2CO6B 2LVEA 2X4OB 4MSWA 4WJ5B 2X6MA 3EYUH 2QQKH 4M61B 2D31A 1VEMA 3T4YB 4CVUA 7FABH 1E4XI 5JDJA 2D9CA 4JM2F 2CUIA 3GBML 1YQVH 3HZYB 4YUEL 3TO4A 3KPOA 2VJXA 3VI3F 4OZIF 1FYTE 4OCRH 3CSYB 3J7HA 3HE7A 3KPNA 1H5BB 4HH8A 1CE1H 4D3CL 3K2UH 4GAJL 4CAGA 3T0VA 3ALPA 3FFCA 2DL2A 1QSFD 3RZCA 1Z9MA 1DQQB 4HH9B 1LGVA 1A64A 3QUXA 4WW1B 3ZDYE 5K9QG 1AFVL 4BSWB 4DW2H 3ULSB 4Z7NE 3ROOB 1BZ7B 3D9AL 1UM5H 2EYRA 1HSBA 3OG6B 3U7WL 5GGSA 4RRPA 1RK1B 3WFEH 5J11C 3LEVL 1ZA3A 3ARED 3BGFC 2VH5H 1LK3H 4QRTB 1WISA 1ZHBA 1CGTA 3BQUD 3AB0C 3QIWC 3AMLA 1IFHH 3AS3A 5MERA 2JJSC 1F4YL 1PZUB 4FXGB 2BXYA 4WVRA 4NQCB 4DGIL 1DUYA 3SKJL 1GGCL 4TSAH 4JHBA 3QIUC 4G8IB 1I85A 1K2DB 1UXWB 2HWZL 4YHLL 2B39A 4FMKA 3SY0A 5IV2A 5BOPA 4OD3L 2H32B 3HMXA 1AXIB 3QXUA 4DFIA 2VDPL 1IEBA 5FYLD 4NKOB 4PJEE 3GJEA 2AJ3B 3SPVB 3LSOA 3VMOA 1Q72L 2WBJD 3VFNA 2M8XA 5I18H 1KENL 4OGYL 1S5IL 1Y18A 5DVNA 3PP4L 3HI5L 5DZNA 2PTTA 1LNUB 1DLHB 3GI8L 1LO5B 1YEDA 1I7RB 4QNPF 1KJVB 1CDJA 4YBLC 4LPVA 2E5EA 2P44B 2Y6SC 5J7CC 4L9LC 1AGCA 2W0FB 3DXAA 2Z8WC 1XGTA 1ITBB 5KVFH 4E5XB 4BJLA 2WBWB 1U2HA 5SX5H 1NGXB 5IMLB 4PJGB 4X8XA 4MQTB 1T7ZA 3C6LD 1DBJH 4UDTB 5FOJA 1FN4A 3FN0H 3MV7A 1TVBB 4R96A 1FLRL 4Y5XC 5DD3L 1I3VA 4YK4B 2EDLA 2BJMH 3GGWA 3QDGA 1BVLA 1TETL 2VR5A 4UNUA 4FQXC 4EXKA 2RIKA 2R2EB 1P4LA 1G7MB 4H26B 4PV9A 1CYGA 2WQ8A 4C83B 2YKLL 4I2XB 1CDUA 5L88L 2YA2A 1T1WA 3MACH 1JRHL 3AY4C 4LL9A 4S2SA 1JGVH 4XBEL 4XCEA 1U92B 3Q3GB 1RK0B 4HS8H 1GGUA 4QHNB 3R0MA 1LMKA 2D7MA 3ARBD 2X2YA 4RAVB 3MPCA 4K7PL 3RWIB 5E6IB 4GRLA 2BSTB 2XNAA 3ARSA 1UZ8A 3O6LL 2LVCA 3OJMB 3O8XC 4MNQA 3PGDA 1MCDA 3MJ9H 4ODUB 5T1KD 2R1XB 5HGGS 5K9OB 2A83A 3IU3A 4OZFA 4L3CB 4G8EB 3X11A 4EVNA 1YC8A 4IOSD 1IGYB 5F96H 1O0VA 4LRNH 1ZGLB 1EHLL 3Q1SL 3BAEH 4J3WA 1DVFC 1FG2A 3MUY1 3E2HB 4C56E 3U9PH 5C0BE 4KRNA 1VB9A 1ZS8B 2R9HD 3U0PA 3QFJE 2WIIB 1ETZA 1HXMA 2I60L 1OD7A 1S9KC 4F7MA 3EDKA 1CF8L 2DM2A 4PTTA 4BSJA 4HC1A 4DKEH 2SEBB 2OYPA 3MXVL 2HN7B 4P5TA 3QUYB 5JOPE 3ZZ1A 5CP3A 4QEGA 5D7JA 3MFGB 4ODXB 5F7EL 5FYJH 5A3IC 2HMID 4OIBA 3ARGD 4YHOL 4H8WL 1L7TL 1K8IB 4MAYD 2NTFB 3HG1B 4PJHB 4HCRA 1MHPH 2EDWA 5FB8A 4KKCC 3V52L 4M5ZH 1A6VH 3VDBA 4MA8L 5LGJB 3BW9B 2HFEA 4B53A 5A1AA 5IKCA 4YHPB 5I16A 3T0DA 3ARFD 4M7ZB 1HZHL 4KFZC 2OM5A 2GITA 3QWOB 4J3TA 3V4PL 1T1XA 1LE5B 4XHQA 3LPGA 2AV7A 1NGPL 4X5XB 4E42A 2VUOA 1T1YB 4PB0H 2BRRH 1AO7E 4U0RB 5HHOE 5EFIA 4FNLH 2VXVH 3TBTB 5K33A 3VG9B 2VL5B 5HSFA 2FB4H 2A6KB 3EJYD 4Z9KB 1YECH 2ZOLA 4U6HA 5CGYC 5JIIA 4QOKD 1YPZB 4G7YL 2DLFH 5DSCA 4LKCA 2BNQD 5JORA 3BKCH 3VXTB 1X5KA 3N06B 4XNMA 2ZCLL 3EYVB 4RZCB 3C5JB 3C5ZA 1MY5A 2ILLA 3BIBX 3WNMA 5DURD 1C5CH 4EBQH 1YDPB 1XR9A 1J5OL 2EDDA 1T0MB 5EO0B 3H7BB 1G9MC 3BKJL 3UXFA 1YJDC 2AK4B 4JVUA 3PQYA 3QXAB 1G6RL 2XA8L 1WZLA 4YX2L 5DK3A 4HAGA 2Q20A 3HC3L 1A1NB 2WINA 5T5FL 3U6RB 4JPVL 2CUHA 2EIZA 4XVSH 1BLNA 3RKDD 5F88B 1DQJA 1XGUA 3IXTB 4ODBD 1BD2E 3H3PH 4XCYA 4B0MM 5TE6H 3T0EA 2P5WD 4LLYB 2NPLX 1G7JA 4NT6B 1X7QA 1CFSA 3QI9A 4K71C 4RGMB 2ED8A 5IBUB 1ZVSB 2H6PA 3M8OH 3CMOL 3ZKMC 4KUCF 4W68A 5GZOD 3MLVL 2A9NH 5I8OH 4CADB 1N4XH 2WBJB 3C09B 1I7TB 3OXRA 3FB5B 4TUOB 4X4MA 3MSPA 3O4LE 3QJHB 1P4BH 4ZS6C 3BSZL 4LCWE 2EXYD 5MEND 5ID1B 4XT1C 1C1EL 1Q0XH 2A9ML 3MMEA 2Q76B 1T21B 4PJ7B 4FQHA 3BDXA 3IFPA 3VFWA 3FCTA 1N2RB 5E8EA 5KG9A 4NQVA 4U1JA 4GMSL 3VI3E 4X7SL 3KHQA 3OB8A 3AC0A 4FG6D 2XZQH 3QDMD 3I3EA 4ZNEA 1KCVH 2PCPB 4WW2A 2AJXL 4HXAL 4DCQA 3KR3L 3JV0A 4ZUTB 2YUXA 3C6LB 1OGAA 4J4PA 5E2TL 3NA9L 5FKAB 3LZFL 1HWGB 4QYOA 1WIOA 1Q9OA 5JOFA 3PV7A 1BJMA 2OZ4L 4XAKE 2VQ1B 3JVGC 1FORL 4M6NH 2EIEA 4YIQB 4OLVL 4X6CF 3TN0B 4O9HL 3VFPB 3WS6A 2GK0A 5BQ7B 1A9EB 3UJTL 2NY1D 1XF2A 3BP6A 3KYNA 5ITBL 3T0AA 3DWTA 8CGTA 3M17B 4OCLC 5E7BA 1UWXH 2VDNH 2DQDL 2I26N 1SJXA 2OQJA 2P1YA 5KSUA 3REVA 4JDTL 3KJ4B 2B5IC 2H26B 2CLZB 3O45A 3ARBB 5JIKA 5J13B 4NKMB 2HFGH 3GDBA 4GS7C 1OARL 5EUKA 2IBZY 3C8HA 4U1KB 5K59F 4HUWB 3C9NB 4GAYA 5HGAB 1VFMA 2Z93A 3STLB 5JXAH 3MJ7A 1YEHH 4LRIC 5GGUA 3KLSA 3LQAH 4G7VL 3DUUA 1E4XL 4I3SL 1WEJH 1D3CA 3U48A 4KQ4H 4M1GH 5FAAA 2X7LB 4LCCC 4GMTL 1ZT1A 3TESA 4JG0H 1MFCH 1RUAH 4XPAL 4V2BA 2WWMC 1RIUH 1TZGL 3BH8B 2E7LA 4JZNB 4R4BB 3H3KA 3T0XA 2BOCA 4HUUA 5FO9A 5FYKL 1BFVH 1INQB 1U95B 4UT7H 2ADJB 4R90L 3K1DA 4KJQC 2HG5A 1BOYA 4ZXBC 4TQEL 4Z7UB 4Y4KD 1J1OH 3FOMA 1X5HA 4X7TA 2KQNA 1XGYH 2Q6WA 4QRQB 1WBZA 4Y4HA 4E0RA 3TV3H 4LLQA 1CGYA 4A6YH 4L4JA 1WAAF 4HHAA 4CW1A 1HDMA 3BD5A 1FFPA 4I0KA 1U6AL 2OL3B 1U8LB 1ZHLB 4M6ML 1X5XA 1YMMA 2NXYD 3OF6D 5GGSY 5IFAL 5MEOA 2V2XA 4JJ5B 3HLAB 2EE6A 3MRQB 4JFDA 4KHXH 5DS8B 3X17A 1MFDL 1KPRB 3BIKA 3DBXB 1IKFH 2J6EH 3QO0A 2BNRD 2EDTA 4RAHA 3HRZA 3VH8B 1F4WH 2LV4A 2R2BB 2R2HA 1G1CA 4HWEH 1FYHB 3CSGA 1CK0L 5FYJD 1D5IL 4HWNA 4BQ9A 4MJ2A 3QEQE 5FUCC 5L6YL 4P2RE 4GAGH 1F11A 3WFZA 2WUCL 3CFKA 1R6VA 2GUOA 1XF4A 5DD5L 4DN4L 1HH6B 2GJ6A 1WZMA 1HEZA 1RZ8B 3N1GC 4XPGH 3VFTA 2QHRL 1P4IH 3NAAH 4RA0C 3TYGH 1U93A 3AXLA 2ZOKA 2EXWC 3CDGA 4PREA 2X1QA 2HH0L 2NCMA 2VLRA 4ZFGH 1XGPA 3LKQA 5F6HJ 2LFGA 3AGVA 3E8UH 2FJHA 1IAKB 2VR4A 5IQ7H 2V5YA 4M8QB 1FNGB 5CJBA 3V7AE 2IF7A 5HI5D 4MJIA 4DQOL 2C1OA 3GKWH 3O9WA 3GSUA 1FSKC 2P8MA 4XNZC 2FBOJ 2ORBH 5FUOH 3IFOB 1OTUC 4KXZH 4JCMA 4RFOL 3B9KB 4IRSA 3QEUA 1UCBL 3I6LE 1DANT 3EYOA 2Q87A 2OJZL 2QTEA 3WIFB 3WFHB 3SE8H 3MRIA 4JHWL 3TBVA 3RL2A 2NY5C 1MRCL 2P5WB 3OAYK 4R4ND 2EDXA 1YC7A 2ICCA 5IBTH 1XF5B 3WXVL 3VXRB 3LMJL 3BGMA 3OKEB 1J0HA 1V7NL 5EOTA 1UB5A 4OGAD 3OPZL 5IBUG 3EAKA 4Q6YA 4WI3A 3KPRD 3S3SA 1TCMA 4OKDA 5D1ZA 5CZKA 2YUZA 1WFNA 3KNBA 4PJCA 2W9DH 3SOBL 2J8HA 5HGDA 5AD0A 5MENB 2FX9L 1PSKH 4OB5H 4U1HB 2ZPKL 4Z0XB 3BKYH 1FH5H 4YHMH 1M6OA 5C08D 2OK0L 4UV7L 2FR4B 3QUZD 5LQBH 4KVNH 3UDWA 3MLXL 3MRBA 4WTZG 4XP1L 3RVXC 4CNIB 1WCBB 2XI9A 2WMPA 3PWPD 4KZEL 1EUUA 1Q9LA 4PJXA 1HYSC 2EICA 4P3DB 4OLEA 3SCMB 3ZHDA 2DIAA 5JUEL 2R69L 5JW3L 2CPCA 3LKNB 3MLZL 1A6TA 2BVQB 3MGTB 5C92A 4XNQA 5FCUH 4P9HC 1G9ML 4HIEA 8FABB 4OZHB 5EZLB 1YJDL 3WIIH 3GHBH 4LHUB 1UXSB 2GEEA 5DRNA 4L8CB 1QFHA 4K3GA 1GOHA 2F53A 5MHSE 4FP8H 4TUJA 1UVQA 1H0DA 4I0PD 1A6WH 3VGDA 2PYED 3RBSA 4XMLL 5GJSH 5C9KA 4V2CB 1C12B 5CEYB 3OBAA 2XTJE 4JFPB 3V9FA 3UYRL 4YAQA 2QV2A 3T1FA 1BAFH 5EZOL 3QIBC 5FYKE 3U7YL 5EZIL 3L3KA 1MJ7H 4K3JH 4LPWA 4KKLC 4QHMA 5DMGD 1A3LH 5I1LA 1AH1A 4WIQA 4O00A 5F7DB 3T04D 4PGDB 2HT2C 1UH2A 4QXUL 3FT2A 3WO4C 5A2KH 4GG6B 2UV3A 4KV5E 3CZFB 3UTSB 4NN6B 1YYLL 4L4TA 3B2VH 3TZVB 1G0DA 2OTUB 4Y16D 2G9HA 1MIEH 1UWEH 3QIWA 1I9RH 4UB0L 2JJSA 1E28B 4OF7A 2X4NB 3BP7B 4PY8I 4RIRA 2OP4H 3WJLA 1A8JH 2WUBH 1A3QA 3DUSB 3LN5A 4YHNA 1QSFE 4YXLL 5DEGB 1N26A 2HTLC 4NHCL 4GRWF 4XHJC 1PZ5A 2KDGA 5C2BH 3CX5K 5L8LB 3CK0L 3JV4A 3QDAA 3CLEH 5CBEB 4LGRB 3UZEA 4BFBD 2NXYB 4L1HA 4Y1AA 2MSPA 1OAKL 3DRTA 3B6SA 4M4RA 3QT2A 1EHXA 5CHNB 4X6CE 5MEPB 4F7CB 2VKXA 1MCKA 2A73A 1QTYT 3NCMA 3QDHA 5CILL 3EJJX 3VH8G 4WFHD 5ID0A 2HJLB 3OAUL 3GMMA 1U8KB 4G9DB 2FX7L 4KHTH 1X5IA 3QWRA 1MSPA 3QUMH 3R4DA 7FABL 3EFFA 4DZ8B 1RVFH 2AKRA 2CLRA 4RMTA 1DQLL 5FA3B 1YQVL 4D9RD 1M05A 2KKQA 3EZ8A 4RAUA 2VZVA 1RFDL 1GGBH 3DX7B 3SQOL 2O61B 5FYLE 1N64L 3K2UL 5K59E 3MRMB 1BBJA 2CK2A 5TDNB 3V4VH 3VXQB 3WUZA 4DUXA 2FGWH 4B41A 2F54A 4JY4A 4W81A 5KN5A 2B1AH 3RWEB 2BXZA 3MUZ1 4UIKH 4K9EL 4HULB 4KTDH 4CVZB 4LVOB 4MHHG 3GMRA 4P2YA 2CK0H 1JK8B 4OFKA 4NCC2 4TTDC 4XXCA 3SDCD 4HIJA 4N9GA 5HI3C 3KWWB 4JRYD 1QO3A 3HC0A 1UM5L 2KBGA 1IGTA 1U58B 3GK8L 4PJDB 4GBXB 3V8CA 1TQBC 5KSBF 3JV6B 2EZ0C 4JRXA 2X4RA 4PJBE 1KPVA 3C08L 3H0TA 4X6FB 1YNTA 2OR7A 2EE3A 3MNVB 4JFOA 4JFFB 4ELMA 5C0AB 3F7YB 4XBPB 4R4FH 2O26U 1G7LA 1DZBA 1MI5A 2DLTA 3O8XA 2DIJA 2Y06L 4V1DA 1IFHL 4N0UE 4WY7H 5EUOB 1MNUH 3VRIA 3UZVB 1T04A 4QRSB 2MQ3A 2EDOA 5HY9B 3KPRB 5D96C 3F12B 4IJ3B 1W72L 5JW4N 1RZKL 5LVEA 4ETQB 2VB5A 4MXQC 4HWBH 2Z8VC 3CFBA 4X6DE 1UJ3B 3TWCH 1OGTB 3VMNA 4E9LA 3WNKA 2EKSB 1B0WA 1A2YB 1NUFA 4ODTL 3R06A 5JO5B 1R3LB 3ZTNH 2V7HB 3U83A 4AENA 4F9PA 4PP2B 1JI2A 3EYQC 2W65A 5F97E 1N3NA 3GMQB 3MNWB 2MHAB 1NLDH 2NW2A 5C9JB 4X80H 3PL6D 4WDIB 2OCFD 5T1MA 3H42L 5FGRA 3VE0A 3P9WB 3WKML 4APQC 5JHDA 1HOCA 1R24B 5JDSB 5F9WC 1CVSC 3QAZC 4EUPA 4U6XB 3NIGF 1Q9WA 4P5KB 3JTSA 1K85A 5E03A 3HUJB 5L2JA 3BO8A 1VGKB 3PP3H 3PWUB 1QSVA 5LXGH 4NRZB 1DBJL 1NFIB 2YS4A 4W4NA 3IDYC 4NN5C 4L4VA 2QQNL 2E8YA 3OX8A 5KSAD 4I0PB 4QRPA 5D7IA 3SJVA 1UC6A 3D18B 1ZOXA 4LHUG 1BX2B 1LEGB 4UT9L 3NIFF 5C07B 3ARRA 2UWEB 2VXUL 3KXFB 1SY6H 5D7LD 2VE6B 1JPFA 1MRFH 2MKLC 4HG4K 4FZEL 4LVNC 1TPXC 5IIEA 4XBGB 3TBSB 4LNRB 2X5PA 5CEZL 3KYOB 3IXAA 5C0FB 3WL9A 3OJDB 4PD4K 3NFNB 4YE4L 1LILA 4YBQC 4ZSOE 5B3JF 2PXYB 3I6KA 3QXWA 3BE1H 3HZVA 1S7WA 1TCRB 4NNYB 5EIQA 3CVHH 5DJZA 1I1FA 3IB4A 4ELKB 3OGCB 4CU7A 3FQXA 1U8HA 4Y16B 4M3JA 4H88H 4B5EA 1QEWB 5EU7E 2KL6A 1ZLUH 2DQFB 4G5ZL 3RNKB 4WV1C 1P6AB 5J3HC 3U9PL 1MHEA 3FQWA 1P1ZB 5EU5B 4HIIA 1TXKA 4XCNA 4JY6A 4WEUD 1DQMH 4RFNC 2AAVA 2V2WB 4GLRI 4QOKE 2VO5A 3RWCA 2YHGA 3P40A 5CP7A 4QTIL 2BNQE 4HC1H 2D4DA 4XMPH 2YPLD 4DKEL 4HZLB 2CGRL 1EGJH 3ARDA 4NOFA 2I25N 4IIQA 4KZDH 1ADQA 2QSCH 5AZ2H 1JZ2A 4P2OB 4PRPB 4MDJA 5CJOH 1OL0A 5GRUL 2CXKA 1EH9A 1KC5H 5GS1C 2YEZB 5C0ND 4ZO7A 4BH7B 1JYNA 1MELA 1EAJA 4NQEE 5HYSG 3IDUA 4KPHL 5IESL 5JA8B 2JCCB 5F3BB 2P24B 3TA3C 1FZMA 2V5SA 2ZUSA 5GGTL 2ADIA 4Y5VA 5I8EA 1OAQL 4Z7WE 5LJYH 1RZFH 3QH3B 1EFXB 3O2WH 4G6FD 1T22A 3I3DA 5ANME 3GMLA 2WW8A 1J87A 2AJUH 1HE7A 1KLFA 2BRRL 2VXVL 5KS9F 1BIIA 3NABH 3JVGA 3L9RA 2XXCB 3MLRH 2FB4L 1QVOA 1OP3H 2DLFL 3O41A 1VFAB 4KH2A 4M1CC 3LS5H 1FL5A 5DMKB 3G5VB 4NQDB 3SDCB 1UA6L 3TVMD 4JREB 4AZ8A 5AYUH 3WHE1 3KYKH 4DAGL 4OZ4B 3ARYA 5BV7C 3IDJA 5JIHA 4QTHB 3SGKC 3ZE2F 5DGQA 1Q38A 3E1F1 1T83C 5T1LA 3QDME 5IVNA 5D6DA 2BVEA 3RZCD 1EO7A 5CUSH 1CLYH 2L0DA 1IAMA 1ZLSL 1M7XA 1T7WA 5E2VL 4GRWE 4K94H 5TE6L 5LCVL 2X1WL 3ARXA 1JPSH 2DI7A 5EO1A 1RUMH 1T2QH 2VZUA 5HHPB 1EEYA 3TIEB 3IF1A 1DSFH 1QSED 1IM9B 3W9DB 3V5HA 1S9VA 3CFEA 4M62H 4KK5D 1W0VA 3C5SA 3SE9H 3CU1A 4WWKA 5BMFH 5IP4A 5JLZA 1P4BL 3D85A 1D5ZA 4ERSL 1XGQB 2VLLB 4Q9BA 1CGSH 1A3RH 3U0WH 2V9RA 3EUUA 3KPLB 5ESVB 3OB0H 3EO0B 1JE6A 2AGJH 1DBKL 1C5DB 1FRGL 3GSXA 2HVKA 1B4RA 1MCBA 3T77A 2ICEA 1YEIH 5IVXB 1U91A 2XZQL 4PJFB 5HI4D 4NBZB 4PLNC 5D1XD 2PYFB 3WNNA 1L9NA 4ZFOA 2HAZA 1R5VA 4HPOH 1YN7A 1CFNB 3D2UA 2R1WA 3HE6D 3MZTA 4F7EB 2C1PA 4OLWH 5INDA 1JNNL 4GT7A 4KU1A 2DBLH 4S1SH 2XQBH 3FO1B 5J1AA 4N5UA 1BOGB 1F5WA 2IPTL 2AABH 2FJGA 5HPMA 3FRUA 4EOWH 2J8UA 1UENA 3OMZA 4LQ1A 1FVEA 1G7QB 3HFMH 2KH2B 5CBAB 2L7JA 5E8DL 5L7XL 1BECA 3CDFA 5ESQB 3KPTA 5ESAB 3PGFH 3S97C 1CBVH 1IEHA 1V8HA 2O5YH 1FFOA 3NZHH 4MQXC 4CVXB 5DA0B 2XPGA 2J1KA 4N8PA 2ICWI 2WNGA 4LVEA 3MV7D 4U1IB 2JE8A 1KUMA 2HFGL 4TVPL 5IMMB 3QDGD 1GZQB 2FEEI 4U7MA 4D0DA 1CXFA 1FO0L 4G80A 3TYFA 4OV5A 4UDUA 3IDNB 1WZ1L 3QZWA 4GQ9H 2FCBA 5JXAL 4PRHA 3RY6A 1BF8A 4Z5RA 2B7DT 2BNRE 4XCFH 1A6UH 3QNZB 3C60B 4NUGH 2ZUXA 2X4UB 5JR1H 5FYJE 5L2KD 2CDEA 4PP1C 5BO1L 1MFCL 1LD9A 2IAND 3PABA 3LEXB 3Q2CA 1MVUA 2AJSL 2MQ0A 1P7KA 1UGNA 3EOBA 4YK4C 3MO1A 4Q9QH 3FB6B 5I8CB 5TH2B 4KQ3H 1V5JA 1LEKA 1PEWA 1A0QH 3VXSA 4N68A 1I75A 5EOCJ 2XN9A 4EN3D 4M7JL 1XGYL 3O6MH 1ZWIB 4W6YB 5E5MB 1D5XB 4G6AC 3WD5H 5FOBB 5DA4A 4XMKL 4R8WL 3SQBA 4A6YL 3VU2A 2ITDA 1KPUB 3UJJH 2ZCHH 3GSNA 1JHTA 1KF9B 4XPBH 2FL5A 4FFYH 1E27B 1L9MA 1K4CB 1Q94A 5E6IC 5IOPB 2YD8A 4QRRD 4HKXB 2YPKB 2OMNA 4Z78A 3U82B 2DDQH 3ZDZF 3IKKA 4I4WB 3RWFA 4YXKH 2VDRH 2J6EL 4TYUA 2VITB 3BN9C 5IEKA 4B7LA 4MJ6B 5GSVB 1VKXB 1TFHA 3EDDA 4G6FB 3L5IA 2UZIH 2E8ZA 3AROA 4GAGL 3V4UH 3E2HC 3M45A 3FB7B 3RTQD 5I17B 2JJWA 3ZDXE 3O2DA 4MLIA 4RISL 1JPGB 1UB6A 2WM0A 3QRGL 2JF1A 3T2NL 4MS8C 4NQXA 1PKQA 4MSWB 5SWSE 2XTJC 1P4IL 4XWGL 4NC1E 1DEEA 2C7UB 2D31B 2ATPB 5B3JE 3QUMB 1RJZA 2IBGA 3EO1B 3QUYC 4ZFGL 3UBXA 3SDAC 3TO4B 3MLUH 3E8UL 3KPOB 2WZPD 3HE7B 3KPNB 1QFUL 5C08E 3DO3A 4XC3H 4WTXA 5GRZA 3C2SA 5CWSA 1IM3A 1C08B 2EDNA 3FFCB 3QIBA 4NCC1 3EO9H 4J1UB 3RZCB 3DV6A 4LDLB 1SM3H 1FHGA 3DSFH 3PWPE 3HNTL 3JWOH 5DRXA 3D39D 3QUXB 4Q0XH 1NGWA 1OY3B 5F1KC 4HDIA 2R0ZL 4M7ZC 2PTUA 4Z95L 3C5ZD 1ZT4A 4LQFH 2EYRB 1HSBB 3HHRB 4F7PA 5GGSB 3U79A 2A38A 4U0RC 1DLFL 3MLYH 4S11A 3VG9C 1IQWH 1ZA3B 3PQYD 5E8NA 1F4XH 3BFOA 4MMZC 3V6OE 1ZHBB 1UM6H 4Y4FA 5MERB 2PYEE 4PJEA 4N8VA 2P5EE 3VGBA 1PLGH 1DUYB 1X4YA 4OB5L 4HEPG 5E4EC 4MNGB 1NSNH 3T0ED 1Y0LA 4LF3A 3ARTA 1FH5L 3SY0B 3WJJC 5IV2B 5E2UH 2ERJB 4F2MA 3GSQA 1IEBB 2R56H 2AJVL 4QRUA 4PJ9D 3ET9F 4NFDA 4GKSA 3GJEB 1DBAH 3LSOB 2J4WH 5SWQA 3O6KH 4YPGA 5EDXA 1RULL 1EMTH 3VFNB 4ZO8A 1F6AA 5KS9E 1FV1A 4EXPX 1A5FH 3MREB 4HZAA 4P4RA 3UEZA 3HE6B 1KBGH 1Y18B 1FPTL 5DJYA 4LPUA 2FYYA 3KS0J 5GGRA 1U3HD 1YEDB 4OIAA 4RGMC 4XP4H 4TVPE 1OSPL 1BEYH 5FCUL 3ULVH 3M1BA 1U0QA 3WIIL 3GHBL 2BC4A 4F9LC 1AGCB 4DWHA 3DXAB 1XGTB 3CXDH 1XFPA 1A4JA 2WBJC 3C09C 2IPKA 1WJ3A 1X4XA 2JB5H 5E1AB 1ZVYA 1A6WL 2KZWA 3ZYOA 1LP9F 4PGBA 1FN4B 1MCPH 3MV7B 1WVZA 2HLFC 1WCQA 3GGWB 3QDGB 1VA9A 4M1DL 3BGAA 4ACPA 4OQTA 2ZUYA 1A3LL 5B21A 5F7KC 1P4LB 2FHBA 1WV7T 4PV9B 2UY7A 1T66D 3VRLE 1T1WB 3MODL 4N1EA 3V6BR 1SBSL 1NAKH 4S2SB 2VSDA 3C6LC 5JHLL 4XCEB 1GCFA 3GJFK 1T7VA 1N6QH 3LEYL 3A6BH 4M6OH 5I0ZA 4WHCA 3WNOA 4GRLB 2MJWA 3X3GH 4HFWA 2XNAB 3P11L 5KJRH 1MIEL 1UZ8B 4XRCA 5HGBA 4C56A 3PGDB 3EOTL 2EO9A 5C0BA 4TOYH 4XP5L 5GHWH 1NUGA 1PQZA 5H2BA 3QFJA 1DFBH 5FF6A 4EN3B 5EORH 5J89A 2A83B 3QPQC 4YDVA 4OZFB 5C09E 3VG0H 3HI6H 3X11B 4EVNB 1CFVH 1NDMA 2XFXA 4NGHH 2JTDA 3W2DH 4JKPL 1S7UA 1FG2B 1EDQA 1NCWH 3KJ4C 5C2BL 3EJZC 4KJYA 2OJEA 1F00I 3ARBC 2DYPD 4JDZA 3U0PB 1ETZB 5GRJH 1HXMB 2K9UA 4F7MB 4PTTB 4JRYE 4F8QA 2VXTH 2XRAH 1RZGA 2XZCL 1JL8A 2PKDA 4HJGA 4WU7A 4P5TB 5D7JB 4GXUN 5I73C 2PW1A 2X1PA 3B9AA 4PJHF 4W4OC 4WI6A 3QISA 4PJAB 3D5OF 2W9LA 4J2XA 4KHTL 4Q9RH 2R9HC 4AQOA 1QNZL 4MHHI 4BA8A 5FB8B 1RVFL 1CDCA 2HFEB 1XH3B 5C86A 5GIRA 4OCXL 2BK8A 5IKCB 1AO7A 4WUUD 1NCBH 5HHOA 4JGMA 1MFAH 4HUNB 1GGBL 5DZLA 2GITB 2D7TH 1E4WH 3ARGC 5JW5A 3ROLA 4KKAC 2YK1H 2AV7B 5I1KH 4E42B 1RD6A 4KTDL 5SWZD 1YPZF 4YDJB 3JZ7A 1J9CT 1QRNE 3ABZA 2ZOLB 4U6HB 2VDKH 1GAFH 3CH1A 3B9VA 1FVDA 5DSCB 4LKCB 3TT1L 5DTFA 1OSZB 3W5MA 1Q9KB 3ARFC 4XNMB 5ALBH 1KJ3H 3C5ZB 4QT5A 5IFHL 5GRWA 2NY2D 1NH6A 1MH5B 4KAQL 4EI5A 2V6HA 5EZJB 1EERB 3PQYB 2ESVE 3PF2A 4I13B 4RRPG 1RZJH 1IZJA 4LK4A 2WINB 5FDWA 4RDQG 2EIZB 3B4NA 1BLNB 1DQJB 1XGUB 3FL7A 4XCYB 1J1XL 3T0EB 2ZSWA 2V17H 5D7LE 2M2DA 3O4LA 3ZDZE 1G7JB 2MCPH 1X7QB 1CFSB 3FO2B 3QI9B 4NM4H 4N5EC 3RWHA 4LCWA 2H6PB 1R3HA 2CXGA 2FEEL 3MOAL 4ODHL 2WIMA 5I8KH 4PJ9B 3U9UA 4MJ4A 1YY8B 2YD3A 3B9KC 3OXRB 5D1ZD 3SKMA 4X80L 2BHUA 4K3HA 1OTTC 4PJ7F 1KB5H 2KQMA 3OJ2C 4QY8B 3MNZA 4NKQB 4NZUH 3MMEB 4I1NB 4MA3A 1OAXH 4RA3A 1HILA 4FQHB 1U3HB 1GIGH 2GIYA 5KSVA 3IFPB 3VFWB 5E8EB 2AV1A 4NQVB 5KVGH 5J9PA 5LXGL 2AQ2A 2X1OA 4LGSB 2QEJA 3MRGB 5GZOC 3TA3A 3MRKA 1AE6L 4I5BA 3W11D 4WW2B 2AXHA 3RWJA 3T2QA 4Y2DD 4A2LA 3GBLA 4DCQB 1OGAB 4QYOB 2EXYC 5EWIL 5JOFB 3ZT5A 1H8NA 6FABL 5FKPA 4K8RH 2YPLE 1B6UA 1LO0H 1MRDH 1DEDA 1NAMH 5E99H 2CDFA 1D5MA 3ULVD 3DV4A 1EFQA 1XF2B 4Z77A 1PG7W 3BP6B 3KYNB 3MV9E 4JPWL 5AZEH 5IK3A 4LBEA 1CXIA 3VFUB 3JWDH 4JQXA 4OZGE 1XIWA 3ULUD 4R7DA 2EEDA 1AJ7L 2OQJB 3BE1L 4MA7L 3SGKA 3D69A 5KSUB 1SYVA 4AEIH 3BEWA 3NCFB 3O45B 2AXFA 1ED3A 4DOHE 1TZIA 3DOSA 1UWGL 3H8NA 1LVEA 1W0WA 1KIQA 4M61A 1IL1A 4GAYB 2Z93B 4PGZA 3MJ7B 5FYKU 5GGUB 3HCVA 3S37X 5IHZA 3DUUB 3HZYA 2DI9A 1KCRH 4C55A 1FNEA 1K3ZA 2G2RA 1YY9C 1MF2H 2J3SA 1ZT1B 1MCHA 3S37H 5I15L 1CD8A 1DQML 5M94B 4MNHA 4OZFG 5DK0A 2BVTA 2R29L 2BOCB 3DRQA 3P30L 3IRZA 5FO9B 4JB9L 4OFVA 4WEBL 4K55A 2GY7B 2MMXA 4Z7UF 2HTKD 3VD7A 2J2ZA 2R23A 1CDYA 4KZDL 3DX8A 2HG5B 4M4PA 2BY2A 5AZ2L 2XQYG 3S98A 4X7TB 4QWWD 5DT1H 1WBZB 4HK3J 4Y4HB 4E0RB 3QA3A 4LLQB 1S78D 4HHAB 4NN6C 4G43A 4CW1B 3HMWL 4LMQE 1FFPB 4JM4H 5I6XB 3C6SA 1UWXK 3R0NA 5JPNA 1EJOL 2DQUL 3TZVC 3SO3B 4OCWH 3QEQA 1YMMB 1LP9E 1JHKH 5MEOB 4P2RA 1ZLWK 4JFDB 3O2WL 1W0YT 4WUUB 3BIKB 4HLJA 5I2IA 3QO0B 2NY3D 1G6RA 5IWLC 3HRZB 5DRZA 5DVLA 2R2HB 3QG6A 3SGDH 1QSEE 1T5XA 4ZTOH 3TIDA 1CCZA 3NABL 4XP6H 4F58H 2YD5A 2RBLA 1YNKL 4F15B 5AG8A 4C59B 1F11B 4DGVH 4YDIL 3CFKB 2GUOB 5TE4H 4LSRL 1XF4B 3SPVA 3Q48A 5D70L 3F58L 2GJ6B 3LS5L 5IVZA 4XVUD 4L3ED 2NXYC 2VL4A 4MNGE 1HEZB 4GXVL 5K9JL 2QR0A 1JNJA 4R2GD 2ADFL 4BKLA 3K7UA 1U93B 3AXLB 3PJSA 4KJPC 3HB3D 4RNRB 2ZOKB 5A40E 3CDGB 4OM0L 4H25B 1N0LA 4PREB 5E1HB 2VLRB 3MUGA 1XGPB 3LKQB 3HC4H 2C3XA 1JIBA 2DICA 4YXHL 2YN5A 1DLHA 3MLPA 2FJHB 3QCUL 1LO5A 4JHAH 4PLJD 3S9DB 4MJIB 4TUKL 1CLYL 1X5YA 2C1OB 3O9WB 2JKXA 4KRPD 3GSUB 5GGRY 2P8MB 3SN6N 2Z31A 2EC9U 4TNVF 3MROA 5HHME 4K94L 4IRSB 4E5XA 4ODVH 3QEUB 2VDQH 5DJ8A 5I1JH 5H37H 3EYOB 5IMLA 4PJGA 1JPSL 4JHZA 3FT4A 4X9FA 3TBVB 1OAZH 2YPVH 2YXFA 3T3MF 4JRXD 4HUKB 1KIRB 1T2QL 2B0SH 3MOBH 1TVBA 3KG5A 4Y2OA 4S0TD 2HT3D 2IPUG 4GFTB 3KJ6H 1U8QA 5HI5C 4M62L 2VR9A 1L7IL 2B8OT 1D6VH 5EC1A 4PB9H 4LDOB 3L5XL 3BGMB 5HYIA 2D7NA 4LVOC 5EOTB 1UB5B 1CGSL 1A3RL 3U0WL 4L8BA 4ORGB 2LE9A 1A7NL 1IC7H 5D1ZB 2DMCA 4K3EH 4ZMAT 3KNBB 5HGDB 1U92A 5AD0B 2X10A 3MLTA 5C6TH 3ZLQC 4U2YA 4R4NC 5FEBA 1WK0A 3AMKA 5BVJA 3RGVA 1M6OB 2BSTA 3VD4A 5L2KE 3IU4H 4HPOL 4AY0A 2FATL 4KRMB 1AI1H 2NY4D 2D0FA 2IANE 4OGAC 4W6XB 3MRBB 1B9ZA 3LS4H 4IJ3C 4S1SL 1U8PA 4PJXB 1Q9LB 2XQBL 4L5FL 4U6YA 5JHDD 5E7FA 4EOWL 3B8YA 2N56A 1TVHA 4CN4A 4ODSH 4AL8H 5IW6A 2C4FU 1UJ3C 3HFML 4OZHF 5A2JH 1A6TB 5HYJE 2BX5A 4PJ8D 4XNQB 5D2NE 4Z0BH 4HIEB 5DEZA 1CBVL 2O5YL 3ZHLA 4OTXH 5LGHL 5D5MF 5TFSL 5DRNB 1VPOH 1U8NA 2GSIA 1NCDL 1MJUH 3CAFA 3MLWL 5GXBB 2F53B 3SDAA 2VDOH 3H7LA 4TUJB 1ZAGA 1UVQB 1H0DB 4QRPD 3HR5A 3X3FH 1QPXA 4QRRE 4RWYH 2VAJA 2DD8H 1ZXQA 5E4IA 4BQ6A 2FHFA 1KELL 1FL6B 1XGRB 4YAQB 5IROA 1SBBA 4K8RD 3BT2L 1MCWM 5JR1L 3OGOE 3DHJA 2Y07H 3L3KB 5I1LB 5JTWA 4QHMB 4GG6F 3L3HA 5C6PB 1OM3H 4I0PC 3CU7A 3FT2B 3V79C 2F5BH 1V7ML 5C0IA 3TH3T 4QF1A 3G6JE 3W9EA 5J11B 3OQ3B 3TBTA 5DHXB 1AGFB 1QSFA 4Q9CA 3QIWB 1JGDA 5DUPH 5I1HL 5DMGC 3WD5L 1QLEH 3N9GH 3GRWL 3PDGA 1U8OA 4BFGA 3VXPA 1W8OA 4XPBL 5T3XH 3W82A 3MV8E 4YHNB 3X14A 2PXYC 5DF0A 4TPRL 4JO4H 3EYSL 1PZ5B 3D39E 3H9YA 4JQIH 5GGQL 4YXKL 3JV4B 3AREA 2AQ1A 2WANA 1FZOA 1Z2KA 4Y16C 3BQUA 4Y1AB 4F33B 4FFWD 3V6ZA 3DRTB 5I19L 3B6SB 2AEPH 1I4FA 1SJHA 2NY3B 3HKFA 3LQAC 5CD3A 5CGTA 4X8JA 3W39A 2A73B 3SGJC 2R1YA 4M7LH 1ZEAH 3IDGA 4P3WA 5ID0B 3HI1A 4KWUA 3QQ9D 3GMMB 1HKLL 3U4EA 4KMLB 3CC5B 4CADA 2OXGA 1D5BA 2AKRB 2CLRB 2J8OA 1BVKA 5FHAL 5D1QD 1M05B 1R5IA 2MKWA 4KK8D 2AERT 3ESVF 4L3AA 4RAUB 1KCKA 3ZKXC 2EEBA 4JPIB 2UUDK 1FAIH 4P2OC 1NBYA 5IB1A 4DJMA 1BBJB 3K4AA 2XG5A 3EO9L 2F54B 4JY4B 4PJBA 3TFKD 4XC1H 5KN5B 4ZD3H 3JWOL 1N8ZB 2ZCKH 2DQTH 4I0CC 3VFRA 3I2CH 3GMRB 4PJDF 5DQ9A 4HIJB 4N9GB 5KOVC 1QO3B 3HC0B 2Q8BH 4FQPA 1IGTB 4LQFL 5I1CL 4N0UA 5E24E 3C6LA 4TULL 4K7PY 4JRXB 2X4RB 1KPVB 3H0TB 1YNTB 5JQ6H 4JFEE 4JFOB 4ELMB 3TT3L 4LARL 5EUOF 2L7UA 4CVWA 2Q86B 2FX8H 1MCEA 1MI5B 1MREL 1UM6L 4V1DB 4YZFE 2EH8L 4POZD 4X6DA 3VRIB 2DKMA 5CIPH 1HQ4A 2NXZD 4PPTA 1CL7H 4WU5A 3SDCC 3SGDI 1NSNL 4JREC 5I0DA 2ENSA 3M17A 1ERNA 4JY5L 2P47B 5E2UL 3IDXH 3D1MC 2R56L 3ARBA 3CFBB 1QBLH 2COQA 3KPSE 3IRPX 1DBAL 1IGCL 1GGTA 1PY9A 3NFSH 3R06B 3VXMD 1S5HA 5F7UA 1NCNA 2EDFA 5T1KA 4AENB 4POUB 2MTPA 3D85D 2JELH 2W65B 2H3NA 1MWAA 1N3NB 3QUKA 5KVEL 5IGXH 2NW2B 1INDL 2P46B 5EU6D 4RMRA 1F8TL 4LAJH 4YQXL 1WT5A 4XP4L 2EC9T 2Z4QA 5T1MB 3VE0B 1GHFH 4M43H 5B22A 5JHDB 3HUJF 1UKSA 4JZNA 2F9BT 1F3DH 1M7IA 1Q9WB 3JTSB 1IAII 1S9XB 1MPAL 1NLBL 3G04B 3B2UD 3BO8B 4RWHA 5FA4B 5L2JB 1YEGL 1J11A 4JVPA 4WI7A 2HKFH 2UWEF 3M07A 5DJ2A 3OX8B 1JP5A 4QRPB 5D7IB 3RJDA 3ARGA 3PL6C 4WO4D 5ALCL 4KY1H 1YQ2A 3S96A 3NCJL 4MAYA 2FHCA 2OL3A 3GMOA 4O58L 4CUCA 4ZSOA 5ETUA 1JPFB 3T3ME 4PRIE 3OAYH 1OT2A 3SDXB 5IIEB 5GJTH 5BVPL 3ARFA 2AEQL 1OLLA 4P2QD 3IXAB 2C4XA 3QJFA 5E2WL 5AAMA 3WL9B 1A7QL 4M6OL