3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
4ZS7L 4HIIA 2H26A 1TZHB 4QWWD 3V95A 4WEBL 3TNMB 2Q86B 5AAWA 2CKNA 3K8MA 2B4CH 4FZEL 1IC1A 4ISVB 2FD6H 4W68A 4BELD 2XQBH 4NUGL 4L29B 2ZKHL 2WP3T 4CNIB 4G9FD 5EG6C 3BRGC 4F7PA 2XNAA 1R5WA 1MCNA 1OOAA 2GFBB 4MNQB 4L3CA 4ZFZA 3GKWH 1CE1H 3S37L 3VCLA 2WBJC 2AJ3B 4PJGB 3IDXL 3TBVB 4YDVA 5EORH 4JCMA 5C86A 5D7SL 3NCJL 2R1WA 1FSKC 4IHOA 4DKFH 4D9LH 3L3OB 1X6LA 2E27H 3X11A 4GAJH 1JIBA 4R3SB 5C2UB 3U4BH 4LCWB 1JRHH 4TNWK 1ACYH 3DHJA 4PRDA 5MERA 1JHTA 4NO3B 3B5GA 1CFNA 2G60L 2YC1A 3U46A 1UEMA 3T77A 1FL5A 4GG8A 3VFUB 3ZYOA 1S9XA 4K23L 1JPSL 3TZVC 4XNQA 1KJ3H 3G5YA 1H9VA 5EU6A 5BZDB 4UAOC 4X9BA 4G6JL 4CKVX 4FQ2H 4GBXD 1M05A 3WO3B 4GAYA 1BOGB 4G9FA 4MDJA 3QWOB 5D72L 1GGBL 5T3XH 2I07B 3F12A 4RFEB 2ZUQB 1DFBL 5AD0A 3ARGD 3D0LA 4EVNA 1LEIA 3EOTH 4WTZG 1KC5L 4Y5VB 3ULUC 1VA9A 2HFFA 1HQ4A 1TPXB 2W0LA 4X6CA 3CXHK 1FAKT 3BHBB 5FYLE 4NYLA 1F3JB 3V6ZA 1CTNA 2EDRA 3UTZA 2WM0A 1KTRL 2VXVL 4LPXA 3WNOA 3DUUB 3I50H 4P9HC 1L7TL 5K93A 4ODWB 3O0RH 5HYFA 1REIA 2F9BT 5CGYD 5C0AB 3DO7A 2AJSH 2VDLL 4HG4K 4OGYL 5HDQL 4BH7B 1XGPB 5DEGA 4TVPH 3QNXB 5IBLC 5E5MA 3IFLH 1IL1A 4TVSa 2NTSP 3MJ7A 3G6JA 3WFDL 2IANA 1DBJH 4PJ7F 4OCRH 3NIGF 3FHQA 2XFXB 3DX6A 4GBXA 2VDOH 4PJDA 3D3VE 1NFDA 4G6AC 4HKJB 4EKXA 4JZJC 1UC6A 5LKNA 5I1LB 4FQXD 1K2DA 2DTMH 2NLJA 1QYGL 1KEML 1RIUL 43CAA 1G7PA 3O4LA 4M6OL 4MZ3A 5LXGH 3MOQA 4JKKA 4I5BA 3Q0HA 2V9RA 4C56E 3LEYL 4WJ5A 1FO0H 1Q9KB 3FN9A 2C3VB 3CFJA 3WFBL 4AQ1B 4XC3H 1NDMB 5K9JH 1T7ZA 4CMHB 4MD4A 3ZE0E 3QQ9C 2YMXH 2H8PB 4AZ8A 4Q0XH 3O11B 4EDXB 4NUJB 3P11L 2FSEA 1GC1H 4N0FB 1A6ZA 5C0JB 5JIKA 1NDGA 1AXTH 2P46B 2Q8BL 4KAQH 1T1WB 5CWSB 4KJPD 1FORL 1RZ8A 1A9BB 1DQDH 3FB8B 1DJSA 3KPMA 5D2NA 4XCCH 1WFTA 1RUKL 2FECI 2XA8H 4H8WC 2HH0L 3GMOA 3S3SA 1ZHLA 2B8OT 2Z8SA 5FUCE 4JO3L 4FQXA 4NWUH 3JWNC 3CMOH 2BSTB 2PW2B 2VLRD 1DSFL 1JI1A 5JW5A 1IAOB 4LASH 3WN5B 1AKJB 3GO1H 1U3JA 3SJVD 3RY4A 5LBSL 2MTPA 3W9DA 4B53A 1FAIL 4JRXD 3UC0H 5IEHA 2G2RA 3EFDL 1NL0H 4MYWB 3MRIB 3LB6D 1IFHL 4P2OD 2DQTH 3LKOA 5SWZD 5FM8A 3DUSB 2F8OA 3HZMA 3O3EA 3O6LH 1CDJA 3RL1A 3ZE2F 1EA9C 4Y8AA 5DRZA 4Q9CA 3NZHL 2JIXA 4LRNL 3C08L 3HPLB 2R9HD 3N85L 1CE6A 2ZUQC 4G6FD 1QR1B 4HC1L 5F3BB 4AEHH 1ZE3C 2X89D 2YPVL 4Y5VC 5I30L 4HFUH 1TPXC 4RISH 2VLRA 1MUJB 3ULVH 4NQEE 1MHPL 1A7PH 3MLZH 3O3BA 3R1GH 3MRFA 1C5BH 1PW3A 2YK1L 2VSCA 3CCHB 2WQRA 2NY1B 1PSKH 1KB5L 4JRXA 2UYLB 1UA6L 4LLYA 2VSDA 1LK3L 1CFVH 3SDCB 4P3CL 4MB4A 4PLJD 4C4KT 4YC2B 3K8KA 4P2OA 5SWZA 3F7VA 3T4AA 2PYEB 1CK0L 5DMJB 3U48A 1TZIA 3QIUD 1ONQA 2HTLC 2ATPB 5DWUH 4NHUB 5KS9E 2DM2A 5HDLA 3F58H 3HI6L 4YHPB 5C0GB 5IF0B 3MV7B 4XPBL 2WAHA 4HHAB 2MPAH 3QZWA 4XTRC 4X6DA 2YUWA 2I26N 4WHYG 1DN0A 3BAEH 4KGLA 1YEEL 4JO1H 3C8DA 4G8FB 4NKMB 4CMHC 3PNWB 3VRLE 2HMID 1OARL 1MFEL 1N4XH 2YWYA 4OIIL 3GMRA 1T5XB 3QUMA 3S35H 1U92A 4AY0A 1UCBH 3ROLB 3G5VB 2NW2B 1HIMH 3CUPB 2I60L 4LLQA 1UFUA 1WBYA 2DN7A 4PREB 2ATKB 4MXVE 4NHCL 2A6KB 5DRWB 4D9QD 1W8NA 1XF4B 4IS6B 5J6GA 2FLBT 3BP4B 2RCSL 3ISWA 3KYOA 5IQ9A 1YMMB 3HNSL 4KRMB 3L3IB 4NCDA 4L9DA 5A2LH 1X5IA 2XG5A 1QSZA 4FABL 1VADB 3RFZC 3THMH 4LMQI 5ENWA 2PO6D 3U9PH 3WN5C 1T3FA 3O2DL 2ZG2A 1XH3B 2UWEE 3ZT7A 8FABA 2VLKD 3DGCR 2EDDA 5IFJA 4HJGB 1A6AA 4H26A 4Y19A 4ZO9A 2EDQA 3BP7B 4YAQA 4HK3J 3WHXA 2X9XA 2DI7A 3HC3L 4FQIL 5SWQB 1IQWL 3FAXA 4AEIL 4JG0H 2B5IB 2BK8A 3MRDB 5KSBA 3CFCL 2BOCB 3TBWA 1CZ8H 3WD5L 4JLRA 4X6BB 5L6YH 1JWMA 3T0EB 1LD9A 4QRRD 4NKDB 3TVMB 5FGSA 5A2FA 5D1QD 4Y1AD 4LLMB 2FR4B 2ZJSH 1YNLL 2Z31B 4QRQA 2MKWA 1OD9A 3MYJB 1A4KA 4DFHA 4OCYL 5HJ3A 5TDPA 3CFBB 4E41B 5E8DH 2H45A 3EJZC 1S9YB 3P4MA 1QRNA 3G5ZB 3ULUH 2V5YA 2F15A 5GZND 4PRPB 5TGBA 1HSBB 5DVOA 1CDUA 4KZDH 2WINA 3MRBA 2VLKA 3O6KH 2QQLL 3HB3C 5GJSL 5BV7B 2NY1C 4V1DD 2MKLC 1WIUA 4JKLA 4NQDB 5FYLL 1HHGA 3V0AC 1JGDB 4JQXC 1RZKL 2FX7L 4JFOB 5F7NC 3SDCC 3QIBD 5HPMB 4TTDD 4J3OC 4YC2C 4YHNB 1VGKA 1S78D 1IC5L 1WAAF 2FATH 2V2WA 2O93L 1IEBA 3DTXB 5FYKE 1CGTA 3C2AH 3U0WL 1SM3H 5EOQH 3NPSB 1LE5B 2YUZA 1FH5H 4KTEL 1KLGB 2MCPL 5D1QA 4Y1AA 3K2UH 4J2XA 1MCDA 3LKNA 2X4RA 3RA7L 4MLSA 2A74B 5F1NA 3U79A 4YDJB 5D5MB 3DXAA 1Y6NR 4X4XA 4QRTB 4ONFL 3FOMA 2XWBA 2P42B 1CLYL 1MRDL 4NBXB 5C6TL 1L7IL 1NCBH 3GSQA 3HE6D 5HYJE 1WCBB 2FL5A 4MMXC 3IAGC 5ITBH 3KPQB 3F7YA 3BGMA 4X7TB 5L9DH 1CFQB 5I74B 2XRAH 2EIBA 3LIZH 4V1DA 2JLLA 3EHBC 3O81A 5E6YA 4QXUH 4RAUB 5AWNH 1ZA3B 3HG1D 5CMAA 3IXAA 3OKMA 5EZOL 3QIBA 3RY5A 3PXJA 1BFOA 3RWGB 1AJ7H 1RVFL 5C08E 1ZV5A 2VLJE 4GXUN 3L5IA 2IH3B 4YPJA 3QUYD 1IILE 4H8WH 5EZLB 4G43B 1WWCA 2P48B 3GJFA 5GGSY 3ARGB 5J1AA 2BX5A 1A0QL 3B9KD 3LKSB 3UTOA 1D5IL 1X7QB 1KFAH 3ZYIA 5GGTA 2RQ8A 1HZHH 4JB9L 4MXQC 3MV8A 5TQ2L 4WNQB 3VFVB 1MAML 4EDWH 1VENA 1BPVA 5TH2A 5BVPL 1CGYA 2CO7B 2EECA 2GSIB 3F6IA 5EFIA 3RWHB 2VL5A 3H0TB 5J89A 3IS1X 1EAJA 4M5ZH 4Z5RB 2DWEB 2B5IC 1T5WA 1ZHNB 5A2JH 4BQCA 7CGTA 2AEIT 5D6DA 3VXRB 4PS4L 1KENH 2EDHA 1RJYA 1B3JA 3DX7B 2R0ZL 1EHLL 3TVMC 2FDBP 3BW9B 1Q9OB 5IVXF 2J2ZA 5FHBL 3BD3A 5C0BA 5ESVA 3H9SD 1YYLH 2Z31C 4NJ9L 1HINH 4PJBF 3QUYA 3G6DL 5E8OA 3JV6B 1JPTL 1W72L 3QFJD 5FECB 5E2UH 3B9KA 5D7JB 4TSCH 1EO8H 5BXFB 4CVXB 4XRCB 4M8VA 2DAVA 4RFNB 3U30C 1TJGH 2ESVD 3WFZA 5FKPB 2G9HA 4NC1C 5BV7C 4K07A 3I85A 1MREH 5I75B 4I3RH 3P9MB 2QQNH 1LO4L 1DVFD 1OCWL 1W0WB 5FOBB 3L3HB 1FN4A 1CGXA 4Y5YB 4JRYD 4KMTH 4Z7WF 1I7TB 1A7OH 3V79C 1G7JA 3NPSC 1UZ6E 5HY9A 1I1YA 1N6QH 4P57B 2OBGA 1G0DA 3TBYB 4OD2B 4PD4J 3ZE2E 4IM8A 5IM7A 4ELMB 1FVDB 2Y07L 3H9SA 5T1DH 2Z8WC 4X98B 4OLXH 1KNOB 3NA9L 2MCG1 1PZ5B 4FOMA 4L4TE 3CD4A 3QFJA 2NW3B 3S97C 4EOWL 4TUOB 5K9OA 4YLQT 1NKOA 4NQVB 1RZIB 1CVSC 1TIUA 5ICYB 4I3SH 3HRZA 3SJVB 1M4KA 2ESVA 4X0KA 1WEJL 5I74C 5H35A 5F96H 2XKSA 4Z6AT 2DLGA 2NTFA 1YEHL 5DO2D 1DVFA 1JGLH 4OLVL 4N0UB 3V0VB 1T22A 1ZSDB 3OKLB 3PWUA 2W0FA 3FQTA 2EC9T 5F71A 2B2XL 3H42H 1HHJA 1T2XA 3JV4B 1CLOL 4J7RA 1ONQB 3EO0A 5I1EH 3I6GB 5B39A 5BO1L 4UNVA 1CDCA 3RNQA 3NFNB 1EEZB 2AK4D 1BFTA 3IETB 4PJHE 5I6XB 4OV6F 5EBMA 2HKFL 4X83A 5B21A 5HPOA 3X12A 3QDJB 4XPGL 2QHRL 1IZJA 1YY8A 4HCRL 1AD0A 1FNGB 4N0YH 2GYSA 3NBNA 2AJXL 2DKUA 5CS7A 5E99H 5TDOB 3QXUA 4TTGA 1MAKA 1G7IA 4XMLL 5GPRA 4DK3A 3EFFB 1UJTA 2HLAA 1IM9B 3HI5H 1OAZL 1LP9A 5BQ7B 4KZEL 2NPLX 1KIPB 4TOYL 3ARUA 3V8CA 3S4SB 1CWVA 1F6FB 4NT6A 3P30L 5EA0H 3E8UL 4J1UB 1CYGA 1CXFA 2CJUH 3QIUB 4RNRA 5IVOA 5IB1B 1IEHA 5CJBA 1DL7L 2QADD 1AGEB 3RTQD 1J1XL 3LS5L 4DTGL 1KPUB 2ZUUA 3SBWA 5D7JC 2DIBA 1BHGA 5FXCH 4Z18A 3AM8C 2YA2A 5DK0B 2YA1A 1I1FA 4RFNC 1S7WB 3LH2H 3DV6A 2OZ4L 4ZUSA 5I75C 3ZZ1A 1NJ9A 1UVQB 4XH2B 3O2WL 4DVBA 3AROA 3GSUA 2P7TB 3RY6A 3LQAL 2HLFD 5GGUB 4YGVB 2B1AH 4Y5YC 5EZJB 3RHWK 5ADOL 4Q9RL 2IG2H 1N0XL 1CLZH 3OR6B 1BVKB 4WHDA 3C2SA 3M1BB 1NCAH 2FCBA 3BUTA 1JWUB 5CJQL 4TRPL 2VQ1A 1ZEAL 3SCMD 1BQHG 3BWAA 5FYKL 3WUWG 5KTEL 4UB0H 5C8JB 3RWCA 1JGUH 1IAII 1C7TA 3P4MB 2YRPA 5JXED 2X10A 4M61B 4LPTA 4PJEB 2XTJE 3GBML 1ZS8B 1R24A 1XF5B 4ZFOL 2PO6B 5ESQB 3ARDD 4KI5F 3BE1H 4LQFH 5JUEL 4G8GD 1C1EH 1N7MH 5F97E 4AMKL 1G0YR 2VH5H 3DRTA 3PDOA 5ITFA 4OGAD 1XT5A 5GSRB 2Z8VC 5D2LE 3EOBA 4FQCL 4F37F 2Z93A 4HWUA 4BSJA 3MGAA 1UZ8B 4CADB 3LB6C 4LBEB 3OAUH 3CVHH 1UACL 3CC5A 4H0GA 1AP2B 3ZTJG 2BJMH 3MNWA 3VXSB 4W70A 3WFCH 2VDNL 35C8H 4QRRB 1PYWA 1X5HA 3RAJL 2GJ6E 2VXSL 4X4YA 3SQOH 1H0DA 3MBEA 1I9RL 1U8IB 1S5IL 2R9HC 3E6HA 5FKAB 4RMWA 5GRVK 1ZLWK 1U42A 3SCMA 2HJLB 4WW1A 1M7DA 3KPRD 3UTTE 3VXPA 2DLFH 5KSUB 5I6XC 3TCLA 4NRZB 3GSNB 1XGRB 1J18A 1QBLH 4E42B 5EU7C 3TFKD 4L4JA 3MUGB 5JXEA 5E70A 4P2QD 4K8RL 3VXMA 1E4JA 3WJJC 4H20L 2ZUWA 4M7LH 2CGRL 2PTTA 2BVPB 1M71B 32C2B 4HGWB 4YXHL 1H3PL 1N64L 1OW0A 1UH4A 4YHMH 3LN9A 4DZBA 1P4IL 3UJIL 4OGXH 5EBGA 4DAGL 5J1SC 3L5WB 3ULVF 4YXKL 3KJ6H 4H5SB 4B0MM 2IQAA 3RI5K 3WIHL 4HMDA 3TA3D 5C70A 4JJ5B 5CJOL 1ZLVK 1FVCA 2I9TA 4U1JA 3QIUC 1SYSA 4WI4A 1CT8B 4LAQH 4R26L 2VAJA 1D9KA 3CU1A 5DFWH 4KUZL 4JZNB 2ENYA 5DDHB 1MQKH 2VE6A 3BVNA 1FZMA 3STZA 5GXBB 3S34L 1RZGA 4F9LC 1PGRB 4P2QA 1T7WA 3VXNB 3EYQD 3IKCA 4MD5A 4AG4L 5TH2B 3HAEA 5IMKA 1QA9A 1YDPA 1C08A 3HE6B 1INEH 2R0LL 1U91B 5MP6H 3LN5A 3VH8B 3W5NA 2VN4A 3NOIA 1OAXH 3HG1B 3OHXB 4LVEA 4Y88A 5SV4A 1X5AA 5IB4B 4ZQKA 3JVGA 2DQEL 2BCKB 4NZUL 5TF1H 4HUVB 4NO0D 3HUJE 4I2XB 4O58H 4UTBL 2F54D 3GHEL 4YBHA 2XY2A 3S3JA 1U8QB 1TVHA 3U7YL 5I1IH 2DL2A 2MJWA 4O51A 1IGIL 3PL6B 5MENE 1KCVL 1NGYA 2OXHA 1OTTD 4OZ4B 2PO6C 2EYSB 4Q9QH 2AKRA 4C55A 5GISH 3T2QA 4HEPG 5JNYB 5HGDA 5CUSL 2IQ9L 3OQ3B 4PJCB 1RZFL 2A38A 4LSUL 4MCZB 4JR9L 1D6EA 3F8UB 4FTVD 1B4JL 5HI3D 3V7AE 4K3HA 4NDMB 3GKZA 3WLWC 2ARWA 1XIWA 4F33B 4PTTA 1KN2H 1AO7D 1AI1L 4KC3B 4BZ1L 3UDWC 4Z7WE 5TE4L 4L5FL 1FNAA 4NO0A 2A9NH 5GS2H 2F54A 2ZG3A 1X6NA 2Q8AL 1T89A 1GVIA 3MRHB 3OR7B 4K55A 4CUCA 1IEAB 1NBZB 1V7NL 4GRWB 1INQA 3UCRA 1PLGL 1T66C 3GMMB 1WWAX 4YNYA 4HKXB 5GZNC 2GAZB 1WISA 3ZKMD 3FFCE 1MCRA 5KANI 4BSWA 1U6AL 2KKQA 3IU4H 3MZGB 4LP4A 4M8QA 1FV1A 4O4YL 3EZJB 4V2CB 3EDKA 1J0KA 4MJ5B 4KK8D 4UDTB 3MUHL 5HHVH 3TIEA 3FQXA 3X13A 2JCCE 2V5TA 3ULUF 3BI9X 2W60A 5J6HB 1UCTA 5HHMD 1OP3H 1IKFL 5ID0A 5GIRB 3ILQC 1KIRB 4HPYH 4TTDC 4LCUA 5I8CA 1YPZF 1QRKA 5T33L 4JRYB 2OCFD 3CU7A 3DX8A 1U8MA 3D0VB 3MLTA 3QI9A 4P59H 1AO7A 3HE7D 3L3DA 3KPOB 3SDXE 4Z76A 4WW2A 3QH3B 2BDNL 4GQ9H 4Z7QF 2EDBA 4Z7UA 5DD1H 3SDYL 4R9HA 1WT5A 1D6VH 3QJHA 4M6AA 4XBEL 3OXRA 1CD0A 3DURB 2GI7A 1ZANH 4ZOAA 2BNQE 5FHAH 2LQRA 5D71H 4XNMA 3R8BB 2W9EH 4JM2D 2VDPL 3EOAA 5DJZA 4YHZH 4PG9A 1D5ZA 1EJOH 1MJ7H 4PJFB 1RK1A 4QRPE 4AT6B 4CW1A 5J12B 1HQRB 4YFLI 1LEGB 4YPGA 4LF3B 4YQXH 3HE6C 4GLRI 5T3XE 1F11B 2NXYB 4WWID 3MR9A 3NCYS 1JJUA 1EEQA 1P1ZB 3MOAH 3ZKQD 2YPKA 5DJYB 1OTUD 4OT1H 5C2BL 4PGCA 1N26A 3Q1SL 4ODVH 2IADA 3H9YA 5IHZA 4HC1A 1A3LH 3ORJA 2FJGA 3AXLB 1N0LA 1SEQH 1KYOJ 1XF2B 4D0BA 1JL8A 4NN5B 5F7UA 2CK2A 1LEKA 4C57C 1QBMH 2AK4B 5D93B 3PL6C 2O5XH 1IM3B 1FDLH 4TVPE 4LRIA 1JMXA 2Q6WA 4ESKA 3BEWA 4ZXBA 5ICZB 5KVEL 3IRPX 4LKCB 4M1DL 1IQDB 3BRFA 4G8IB 1KTLB 3E2HB 3VA6A 3OKNA 1DQMH 3EIFA 4PJGF 1AXIB 3A0OA 3A6CL 1GCFA 3IGAA 3KR3L 1UM6L 5I1JL 1BFVL 5DT1L 4G6MH 5CZVH 1YA5A 3MV9E 1UM4H 3ARXA 5AZ2L 3L5HA 3SKMB 3O4OB 3AAZB 5ETUB 3L1OH 2OQJA 1SY6L 2DMBA 4GSDH 5IJVB 4UT7L 1EUUA 5F1IB 1OF2A 2F58H 2GTWA 4NKOA 3H7BB 2SEBB 4HLZG 2QADB 1P7QD 3NACL 3S98A 3RTQB 4U2ZA 3LN4A 3MYZA 3TPUA 3GMNB 4MAYD 1OGAB 2CK0L 3VFNB 3QUXD 3GSRB 4JO2L 1DQQB 4D94A 4IRZH 1R3LA 4I77L 4EI6A 4F58L 1BX2B 3TO2B 4HLJA 2E7LA 1Z6JT 2P8MA 2VXQL 4MGXA 4U1MB 4XCFL 3BKYL 4XVUD 4K2UL 4DK6A 4Y7MA 4Y4FD 4OFPA 5EUKA 1GHFL 1ZWIA 2Y7QB 3EKCA 3O6MH 1YMHA 1B2WH 1NAMH 2O5ZH 5J11B 1UWXH 1SJHB 1JNLL 2AV1A 1Z2KA 1RD6A 1AHWA 1UWEH 4ZUVB 2FB4L 4XNYL 3UBXI 1ITCA 4HKBB 1T6VN 3U7WL 3EDFA 2CIIA 4IRSB 3I9GL 3TT1H 1P9MC 2PKDA 3G04A 4JN1H 1FE8L 3W0WA 1CFSB 2HJKA 5FYLD 5MEOB 4K9EL 3IXTB 3TN0B 4MAYA 2BSSB 1QP1A 5J12C 3M45A 3ARDB 4Z8FL 3RWFA 4LEOB 1G9NL 2NXYC 4G8GB 1U0QA 2V5SA 1RHFA 3DUHA 5C07E 1N5AB 2BVQA 5ALBH 3VFRA 4BSVA 1MF2H 5IOPB 2GT9B 3BN9D 4P9ML 5DRNB 4HUNB 4JGUA 2FJFB 5ACLA 1V3MA 1JPFA 4UQ2B 2A6JB 5J06A 5EBWA 5FO9B 4X99A 5GGVY 3ULVE 4Y4FA 1OB1B 2DQGL 2XTLA 2BNUB 5T1LD 3LS4H 5I1AA 2ICEA 1V7MH 4DQOL 5KSVA 5CIPH 1JZ2A 3E3QE 1A7QL 1TZGH 1ZA6A 1S3KL 1MFBL 4NN5C 1RULL 3WHE0 1CR9H 5D93C 3KPRB 5IHUL 5D1XB 1A64A 1JHLH 3I3BA 3FQWB 2VABB 3DHMA 2CLRA 4C56D 3CH1B 4R0LB 1UXWA 4L4VE 3QXVA 4ETQB 5BRZD 4QCIA 3E2HC 3VFGH 4P2YA 1OPGL 1ORSB 4Q2ZA 4GMTH 5I1DB 1I9JH 4XZUB 1VHPA 3Q6FA 1P7KB 5HHOE 5D8JH 1RJZB 1A2YB 2BVOA 2VXUL 1PFCA 4PR5B 3O4OC 2YA0A 5EC1B 3TA3B 5IUSA 4M6MH 5T1LA 4G5ZL 1KIQB 3FMGL 1T7YA 5EOCJ 3WIFA 4H1LH 4U1NA 1N2RA 3MRNB 2QADC 4PJIA 1AR2A 3KPSE 3U0PB 2NR6C 2MHAB 2LVCA 3RTQC 4IIQA 2AXFB 4HJ0D 4AEEA 2XG4A 4JY6B 4URTB 3NCBB 5C0ND 5E1HB 4R90H 2MFNA 4I9WD 3GRWH 4OBRA 1I3RB 1I7UA 1N5YL 2EDTA 4IRJA 5BRZA 3L5XH 4Z7VE 4PJAA 3ABZA 4O2FA 1ND0A 3QHTC 2AQ1A 4GKNA 1FFPB 1BD2B 2AXJA 2BZDA 4P2RA 3GKWL 5F7DA 1CE1L 3WS3B 4P2CG 1IT9H 1LK2B 3QJFA 2X4QB 5J11C 5DA0B 2YPLE 1DQTA 3DARA 2R2BB 3GM8A 1M7XA 4DKFL 2KPNA 1EVUA 1UXSA 4D9LL 4QRSB 3BKCH 3L7EB 2E27L 3HMXH 5LGHL 4IRSC 1R0AL 3FCTB 3C6SA 3PHQA 1K3ZA 4NC0B 1JRHL 1ACYL 15C8H 2E9BA 4NQED 1QBAA 3LKPA 1WZLA 3TN0C 2NQCA 3IDYC 4PUBH 1XGQA 3EYOB 3MMEB 4PFEA 3ARDC 2NXZC 4S10A 5DYOA 1JUFB 3MRGB 4NFCA 1KJ3L 3DGGB 2J8UE 4NNPH 4FQ2L 5EO1B 3A6OA 4FTVB 1TVDA 2XWTB 5INDB 3ULUE 5T3XL 1JVKA 3T04D 5JA9A 1KTDB 5A3ID 4PJXB 4DW2L 3T1FB 2VJXA 4R4BB 3TH3T 4I0CC 4O5LL 3S35X 2WQ8A 3HMWH 1HDMA 1JF1A 4APQD 4KKLD 1K4CA 1RJCA 3KPPB 4P5TA 3MLWL 3W39B 4KPHH 5JHDE 3WE6B 2GJZA 4L8DB 5D1XC 4MNGE 3EBAA 5B38A 3I50L 1U93A 5ILTH 4UT6H 2VTFA 4FXGB 3KYMA 4JQIH 4O02H 4R0LC 3MRJA 2F53E 5I18H 1UM5H 3ALWA 1T03H 4GKZA 1V8HA 4HWZB 4TVPL 3NIDF 3B3IB 1V3KA 2G5BA 3BWUC 1DBJL 3P40A 4NCC1 3C5SA 2XI9A 3WKMH 1U9KA 5IFHH 5IB2A 4L9LB 3V0WH 2EE2A 3HS0B 3RWIA 3IDIA 1CG9A 4W4OC 3TA3C 1JGEB 1FJ1B 1G9MH 3TV3L 1ZT4A 2GEEA 1S7XA 2Q7YA 3HE7B 5LXGL 2AV7A 4XHJD 4OD3L 5KS9A 1FO0L 4TSBH 3HC0A 3GMQB 4JPWH 4XC3L 3RQ3A 3NVQA 4D8PA 5ANMB 2IBZX 2YMXL 4Q0XL 3IU3B 2EYRB 4Z0XB 1KB5B 4UOJA 1Q94B 3I2CH 4JM2B 3CDGA 4LDOB 1GC1L 3TIDA 3BGAA 1A6TA 4P5MB 1JTTA 4KAQL 1G7HB 5BS0B 1DQDL 1GZPA 4OZIE 1F3RB 3ARBD 3BXNA 1FL3A 3IF1B 4ZNEE 5IQ7L 3SO5A 3W9EA 4XCCL 1K5NA 1IKNC 2QJDA 2XA8L 3TBTA 3LEXA 4DKEL 5HHPA 4YHIB 4QHKJ 3UTSA 2WMPA 3MNZA 4HUWA 1UJ3A 1YN7B 1WIOA 4NWUL 2AERT 1G9EA 4E9LA 1R3JB 3CMOL 1BAFL 1BP3B 2ILLA 4LASL 5BW7C 3V4VH 3P4NA 3ZHLA 4ZS6C 1HHHA 4FMFA 4JZOA 1MCOL 3UC0L 3D39A 3CPLB 3BUYA 1OTTC 3DV4B 2X4UB 3QZWG 3O45A 4PP2A 5CHNA 3LCYA 4JFQB 1Q0XH 4TNVF 5D4QA 3O6LL 1DCLA 4KKAC 2F74B 1GGTA 5D5MF 1XZ0A 1MPAH 5JPMB 2P4AB 3L95A 5FYKD 1D7FA 1J1PH 1YUHB 3CDYA 5HVFB 4S1RH 1XF3A 1G84A 1JGVH 4HFUL 2C4XA 1FHGA 3ULVL 3DMMD 1A7PL 3MLZL 3QPQC 1T04A 5C6PB 5J7CC 2DQCH 3D9AH 1P7QB 5DSCB 3QUKB 3R1GL 2EDLA 3EYVA 3MA7A 1MHCB 4MA1B 1R3KA 5IROA 1OSZA 5FGRA 1N8ZB 3FHAA 2JJWA 5FYJH 1UKTA 3V4PL 2HT3C 1G6RH 1CFVL 4PRBA 3V4UH 3QUXB 4CBPA 5GGRA 2BMKA 3DRQB 4IMLB 4YDIH 1MRFH 4MJ6B 1G7LA 3FQRB 2JK5A 1N6UA 1E28A 3V2AR 4ERSH 5DJ2B 3V5KA 4L9LC 3VMPA 1NBYB 4ZOBA 1BJ8A 5I16A 1LO0L 2JJVA 2X4SA 3I6KA 4ORGA 5EIQA 2JJTC 5C08D 1FG2B 4GXVL 4KVCH 5DHVB 4ZSOB 3F7QA 4JFFE 2EYTB 1FZJA 3CLFH 2MPAL 3HE7C 1JTOA 3OTTA 5DJCB 2ZOKA 1AGFA 3TJHC 2XZCH 5FCUH 2P5EE 4HKZB 1KJVA 3PV6A 4NNYB 2I5YH 3BDYH 1I9IH 3BAEL 5ACZA 4M62H 3DMMA 4JO1L 4N1EA 1A6UH 1MLBA 3AU1B 2VITB 4JM2C 2V7NB 3S35L 1P4BH 5DJ0B 3VJ6A 4LHQB 1HCFX 2VDKH 1NUFA 1UCBL 3RZCD 3DVGA 4XWOD 3F5WB 3QIWA 1ZLSH 5F6IC 3PQYA 4HK3N 1QKZH 3RDTD 4S2SB 3D85D 3LMJH 1E27A 3B6SA 4WU5A 5E2JA 5ID1A 3B9EA 4F2MA 1OTUC 3QO1A 2IBBA 1SBSH 3AY4A 5KVMC 1MH5A 3KAAA 4HWBH 4HD9A 3IAPA 3TESA 1ZVYA 3THML 4PJ7A 1EFXA 2AEPL 3D3VB 1L9NA 4MQ7B 3HZKA 4OF3A 2E7BA 1FFRA 5IB3A 5EZIH 3D18B 4JO4H 3BGFB 4PBVC 5H37H 1NCCH 4LKXB 4LHUB 4C56B 2AJUH 3MRCB 1VFUA 4G3YH 3V5DA 3IJHB 4ELMF 2WIMA 1OP5K 1A4JB 3PWVA 2BSRA 5BZWA 1KPRA 2VYRE 4ZPTB 1UYWL 3FO2B 4FZEH 5J8OA 4XP1L 2MQ0A 4NUGH 1MHEB 3RPIA 4U2YA 1O0VA 4D9RE 1KB9K 2ZJSL 3Q5TA 1CICD 2YXFA 3QT2A 3GGWA 3KDMA 1T4KA 5DD5L 4F8TA 3EZ8A 3CSYB 5F89B 4ZAKD 5JDJA 3ULUL 5E8EA 1T0MB 5D7SH 4KZDL 4L4TD 3QXDA 4X6FB 4LSPH 1CI5A 4MA1C 4IMKA 1DUYA 3WXVH 4F7TA 2A2QT 4KJQD 2YD2A 3KXFD 4KDTC 2EIZA 3QUXC 3L3JB 3SE9H 1F4WH 2RFXB 5E6ZA 1I1RA 1JPSH 2LU4A 4PJ5D 4S0SD 4WFHE 2HT4D 5CEXA 2OTUA 4G6JH 4MAUL 1IRAY 3LV3B 3VH8G 3K2UL 1A9EB 4XVUC 5D72H 1BJ1H 1GGBH 2FZ3B 1DFBH 4BUHA 2ZCLH 4G80A 2O61A 4JJHA 2ADJA 3C8KA 3EO1B 1MI5E 5LGJA 3BO8B 3OKYA 1W72B 1OAQH 1KC5H 5F9JB 4PTUA 5FDWA 4ZAKA 2R1XB 5DTFB 4XP4H 1ZGLP 1JNHA 5E03A 3LRSA 2EC9U 1NCBL 5B3JE 2R2CA 4OZFB 3C6LA 2PETA 5FO7B 4KMQA 1JCKA 1L7TH 4XXDA 1NBVL 2XRAL 1T21A 4KRNA 1U8PB 4NQEB 4QXUL 5E8PA 5AWNL 1RZKC 2P8LB 2DI8A 1ZHKA 2VC2L 3KXFA 4OGYH 5HDQH 1L6XA 4NSKB 1K8DA 3TBSB 5E00B 3FRUA 2NY6B 5CKGA 3WFDH 3V6FB 4XXCA 4PJ5A 1T1ZB 3BZFA 3VFTA 4F37K 5F9OL 3BN9C 3GMPB 3ULSB 4H8WL 4H25A 5IT2H 5AG8A 1S9WA 1EXUA 5CSZB 4X5LA 4Q6IB 4I0KA 3P77B 1RIUH 4KHXH 4PLKC 1OTSD 5E2WH 1IAIM 4RGNE 4B5EA 1K6QH 3Q3GA 4M6OH 5DQ9A 3U0TB 3VGHA 3CSBA 4HS6A 2V9QA 4APQB 4LLUB 3LEYH 1AQDB 2CO6B 2GK0A 3T65B 4EDWL 3BGFC 5IWLC 3CH8A 1RHHB 5IMLB 2CDFA 1A3RH 2P24A 2B7DT 4M5ZL 4YEEA 3IDNA 3P4OA 4N5UA 1ZVSA 4G9DA 1LQSR 1W8OA 2Q8BH 5KSAD 4NRXB 3IAQA 1KENL 4R7NB 4WTZA 4KU1A 2Y6SC 5L2JA 4PJEF 4Q74A 4WFFE 1FORH 3H6JA 3RIAF 3P0GB 5C9JB 3HA0A 1Q0YL 1RZJL 1TTFA 3ARFD 3SDDD 1YYLL 3OKKA 5C6WH 1HINL 3IDGB 5CAYB 2OTWB 3D2UD 4MA8H 1DP0A 2R1YB 5E2UL 5JHLH 2R0WL 4GW1B 1EO8L 4H88L 4NQDE 1SYVA 1DSFH 1YEDA 5FUCC 1J8HB 5FO8A 5B39G 3MJ9A 1BVLA 2CLVA 3OSKA 1OM3H 2Q76A 4UTAH 1FAIH 2XTJD 5M7QA 3FJTA 1FC2D 3ILPA 5C0NC 5EOTA 2G75A 3BIBX 2UWEB 5IV2B 4WI6A 1IFHH 1S7VB 2GUOA 2EC8A 5M94B 1N6QL 4GW5B 2PN5A 1KTKE 3ARBB 3ARFA 4KDWA 5D5ME 3QEUA 1FIEA 4XI5D 3SDDA 5T1DL 2OI9B 2E8YA 4QT5A 4OLXL 3W11C 3OMZA 1EIBA 3FTGB 1DDHB 2BNRA 4JDZB 5DURD 2YWZA 2GJ6D 5IVZA 3T2PA 3V9FA 3KYNA 2YPVH 1VKXA 5I30H 3UTTD 2LVEA 1DQJB 4QHMA 4XCYA 25C8L 1AFVH 1MHPH 2O5YL 5F3HA 4EUPA 4I3SL 3U2SA 3GUTA 3DIFA 4OZGB 4GS7B 5F8RC 4CRPA 2C5DC 2PR4H 4HIEA 3EYVB 2IGFH 4CU7A 1U8KB 5L8JB 5F96L 4KV5F 3M8OH 2ZOLB 1KB5H 3FO1B 1H3VA 1UA6H 1P4LB 1KJ2A 4JE4B 1T0NB 5D7IA 1BZ9B 3QQ4A 2NY6C 4MJIE 3H42L 5MEPA 4MSWB 1CK0H 5DJDA 1U8HA 2DJSA 4QY8A 4RMQA 4X6EA 5I1EL 1S7QA 3UMTA 4OI8A 1XEDA 2HFGL 5DQJA 4U1HB 2L4OA 4LNVA 4UIMB 5C3LD 5E9DA 1S7RA 4HUMB 3NFPB 4Q6IC 1WAAA 4ZO8A 4KJWD 4XPBH 2GJ6A 4PGZA 4YDLB 4LCIH 3GDBA 2VZ1A 4APQC 3FONA 4N0YL 5E08H 4ZFOB 2V7HA 4RAVB 4QHUA 5E99L 1AH1A 1UB5A 3QDME 3QCTH 1I1AD 1OARH 3HI5L 3OAYK 1MFEH 4QRUA 4XNZB 5J57B 3MRPA 2J6EH 2I27N 3HRPA 3GSWA 4MX7B 5HYJB 4GG6F 3C87A 3W2DL 1OAUH 4HMEA 5T5FH 2I60H 2Z9TA 5EA0L 4NO2A 1K4DB 2D0HA 2CJUL 1I3UA 5I76B 4Y0GA 1J0IA 2COQA 2OL3A 2DMKA 3DJ9A 3WNLA 1ZHBA 5TE7H 5TQ0H 5DJAA 1A1MB 4PJCF 5C08B 1TMCB 2VLJB 3BH8B 4PP1C 4MQXC 3BD4A 3AREA 3CAFA 3CFDB 1Z9SA 4XHJC 4LLVA 1F00I 2X4OA 1FYTD 3O2DH 2HG5A 3PJSB 3MACH 5MEND 3BYTA 1RMFL 3FT4A 2WUCH 5T1MA 1I1AA 5CLWA 1WC7A 4FQIH 3EJYD 1IQWH 1CD9B 4HK0A 5L2KA 3BYYA 2L0DA 4JY5H 3SE4C 3RZCB 3CFCH 5CBEA 4XB7A 3WD5H 3PWNA 5DQDL 3ME0A 1NCAL 3GSOA 4GRMA 2P44B 4MDIA 3RDTB 3ARBC 3D85B 3S36L 1HI6B 2CKBL 5H2BA 2BY2A 1ZK9A 2OI9C 3BD5A 1QACA 4UB0L 3RVWD 3ZHDA 2VAAB 2A0LD 3ES6B 3RGVB 2D7PA 4LCCA 5IVXA 1FYTA 4Z78B 4LQFL 4JFED 1M7IB 4GS7C 4N0UE 4PJBA 3SE3A 1C1EL 1N7ML 2VH5L 1NCUA 5F70A 1J0YA 5GJSH 5MENA 4NQUA 2P5WE 5EN2A 3MLXL 4ONOA 1RZKH 2FX7H 3WXWH 4XMKH 3UTQB 3WNPA 3FQNB 3CVHL 3QEQD 4GH7B 1IC5H 4M9OA 5HGBA 3CFEB 3GSVB 4PJ8D 2BJML 3WFCL 1JWSB 4LNRA 2BXZA 3C09B 35C8L 4NFBA 1FC1A 4UUJA 1MCCA 2VKXA 3R06B 3QDJE 1JPGA 3SQOL 3QG7H 4PJFF 3DROA 5JZ7C 1CICB 5ERWA 1H8NA 4Y4KB 3RA7H 6FABH 4X5XA 3RUGB 4MQTB 4N0CD 3QSKB 3HFMH 1QBLL 4Z7WA 4UINH 1UKSA 1G7QB 2QL1A 2CIKB 4OLZH 4XP5H 4ONFH 4M7LL 5IBUB 1KJMA 3B9AA 4LSTH 1CLYH 1WWWX 1MRDH 2BNQD 4L4TB 1NH6A 4JFEA 1I8IB 5EO9B 3ZMRA 1U3HD 4XNZC 1P2CA 4OGXL 1A6WH 5F7WC 1RUPL 3FT2A 3LAFA 4QRPD 2VZSA 4MD0B 4NQTA 5D9SB 1EJ6A 5T3XD 4WI7A 5EZOH 4X8JB 1NGZB 3NIFE 3QEQA 4DZ8A 3WSQH 2BC4B 4WTWA 4CMMA 2EH7L 4LAQL 1QSFE 5IKCB 1ES0A 2A77H 2K7QA 1UADC 5HI5D 2EKSA 1MQKL 3LHPH 3PP3H 3WLBB 3C5ZD 4ZUTA 2NY4D 3EYSL 4ZFFB 4K8RC 4ZYKA 4JB9H 12E8L 2HVJB 4L8BB 1UB6B 1E4KA 4PJHB 1NCTA 4TVPD 2X05A 3WV0A 3BOVA 4YR6B 2BNQA 1INEL 5MP6L 1FVEB 1U3HA 4E5XA 3EYFB 4MWFA 4QRPA 4P5KA 3RZCC 2XIDA 5A2KH 5AUMB 5GZOC 1KLFA 1DLHA 1GPOL 1DLFH 2NMSA 2ZP0T 3RDTC 2R0ZH 1T80A 3MV9D 1XCTB 3L7FA 5D96B 1WIPA 3H9HB 3VDCA 1U58B 2WV3A 1C12B 4NJ9H 3GK8H 1I8LA 1O7SA 5I1IL 1N59A 3G6DH 3VXUE 4I0PB 2H41A 3QNZA 5TDNB 3WEXA 1A3QA 4YXLH 2H9GB 1W72H 4HDIB 1PX3A 2BVEA 2X4PB 4MNHA 5KJRL 2FEDC 3RGVC 1SVZA 3C5ZA 3CFIC 1FZOA 5IGXH 2WK2A 4AIZA 1RK0B 5D7LE 5GISL 1N3NB 1CD1A 5FF6A 1ZGLB 3WO4B 4QHNA 4K3DH 1EZVY 3QCUH 3VXSE 3WDHA 1XGTA 4BZYA 3SDAB 4JANA 4FHBD 1FYHB 5CJ8A 4KI5D 3PHOA 2OLDA 3DBXB 5FA4A 5E94B 3PGCA 4CVWA 1KN2L 4X9IA 5KSAB 1S9VA 3C09C 4RMUA 3HR5B 2A9NL 3J7HA 3MV9A 3QHZL 1IE5A 1CICC 4Y4KC 2B39A 2Y07H 5I8KL 3D2UB 3VD7A 3SKUD 3BEVB 4C54A 1KG0B 2OJZH 2YOCA 4K7PY 5DHYA 4N8VB 1T7XA 4EOWH 3VFWA 4NPYA 5E6IA 1NGWB 4X8XA 3QFDA 2Y36L 2HFEA 1J11A 2Z4QB 4HUXA 1JI2A 3LRGA 2X4NA 3IFOB 1WFUA 5HHVL 4X5WA 4OCXH 4PY7B 5DMKA 1HHKA 2GY7B 3TO4B 1WEJH 5FGBC 5E5UB 3MRKB 3LKRB 3K80A 3TF7C 4UV7H 1AD9B 3GB7B 4BK4A 3IYLW 2C3WA 5EUOA 1FL6A 1T1YB 4HPYL 2OX5A 2AS5M 2VZTA 5GS0H 5C07D 3GJEA 1BLNB 5D2LB 3NPZB 1G0XA 3VWJB 1HNFA 2FGWH 1S7TA 1CLOH 1U8LA 2HT4C 5E1AA 3C60D 3D69B 2D31B 1L6ZA 4NQCE 4KTYA 5EH1A 3FAWA 3ULVD 5DD1L 4OBSA 4Y2OA 3FZUD 2Y72A 4PY8I 3QUMH 3MV01 4NNXA 2HKFH 1XGYH 5D71L 1MVUA 2W9EL 2AP2A 1PAMA 1NFIA 3VDBA 5HYSA 4HCRH 4AM0A 3UTTB 3EW3B 2DF3A 5FM4A 4YHZL 5LWYL 2VR5A 3DWTA 3L3GA 4XBPA 4UOW1 1F02I 1UENA 3RL2A 4YQXL 3IVKB 1NUGA 4PRHE 4U1SA 5JR1H 4F57H 3BKMH 1WZ1H 3MOAL 4KZEH 3OKOA 4TPRH 2H3NA 4I2XE 1TVBA 2IC2A 4OT1L 5J13B 4WU7B 1BZ7A 2C1OA 4P23D 5BJTA 4OFVA 3ZHKA 4ODVL 5KVDH 5C07A 4GG6E 2X7LA 4UQ3A 3O6FA 1A3LL 1QLRA 1NC2D 5GS1A 4PV9B 5D96C 3C60A 1SEQL 5IR1A 1PKQE 2Y06H 5LAXB 2IWGA 4XCNA 3KLHD 4J4PD 4I0PC 3HZVB 1QBML 3KYAA 2O5XL 3LS5H 1FDLL 2CDGB 4TULH 4Z77A 3RIFF 3KPSD 5DJ8A 3SGKC 4G42B 2XA3A 4OM0L 5C0FB 1F8TL 2ZSVB 3BP5A 2YRZA 4HZAA 1DQML 3O8XA 3WO4C 4R8WH 3P73A 5T1MB 4DN4H 3L9RB 1B4RA 4ODXA 2A73A 3SDAC 1D3CA 3NMEA 3U6RB 2RIKA 3TEUA 5ADOH 4WRLA 3IJSB 3L1OL 5KSAC 2WBJD 2W59A 3PGDB 4GSDL 4GRMB 5E2VH 4I13B 2YEZA 5EBLB 2FGZA 3RWJB 5CJQH 3I6LE 4U7MA 2F58L 1NC2A 3REWA 2A6IA 1Y18A 4J4PA 1JYVA 2JB6A 3BISA 4NCC2 4WO4A 4YZFE 2YPLD 1UWGH 2BY0A 3HUJB 3J8F7 5KAQG 1J8KA 5A16A 2J12B 4ACPA 4CVZA 5CJ5A 1I4FA 1RPQA 3PWPD 3BT2L 4PJXF 4R96A 4HIHA 3BQUB 5FB8A 5JUEH 5EPMA 1G7MA 3TZVD 1I7RA 3TO4C 1QFUH 4QYOA 4GMSH 3U7AA 4QOKE 2E9IA 2FO4B 1MEXH 5FYJU 2VLLA 1U95B 3O41A 4OZHE 3ZDZF 5C09B 5L7XL 3N1GC 3UBXB 3VWJC 4UDUA 3IS0X 4I48B 3O6ML 4LLWB 2WBJA 1B2WL 1NAML 2VDNH 3JTTB 3ULUD 3QULB 1EHXA 3VGAB 4QXTA 1BBJB 1UWEL 4QF1A 4W81A 3ZE1F 1AGDA 3MRQA 3TT1L 1HEZA 5EC2B 4HS8L 5C0CE 5E8NB 4LCYB 5I66B 4LSQH 5JDSA 1H5BB 4KQ4L 2ICCA 5JHDD 4K8RH 5B8CB 2IAMB 4H20H 3ROOA 3INUL 4WUUE 5IBLD 1RSFA 1X44A 3PWPA 2R2HA 1D5MB 1YN6B 2F53D 1T6WA 4UV4H 3TZVA 4RQQA 2C4FT 3FFCB 4MS8C 1MF2L 4HSQA 1HWGB 1PQZB 5J13C 1DBML 4G6AD 1KCRH 2MNUA 3KHOA 3WIHH 1BIIA 2ZCKH 2N4IA 4J3SA 4KK6C 3CXDL 4R4FH 2JCCB 3FFDB 3EGSB 3WMSA 3LS4L 4PJ8B 1V7ML 1IAIH 3FB7B 1EH9A 1OQXA 2W91A 4JM2F 4RZCA 2AABH 1TZGL 4RRPA 2RHEA 1HILB 2VZVA 4YGAB 2ERJB 1CR9L 3MRMA 5KVGH 2GY5A 5TPWL 4Z7OF 1YPZA 4G8EA 2YXMA 3QQ3B 3SDXB 4WDIA 3TNNB 3G9VA 3SHSA 2YBRB 1DEEA 4CGTA 4ELKA 3JUYA 4K9EC 4JFYB 2BFVL 3DLQR 4MNGA 3VFGL 4OF5A 1ZT7B 3UPRB 4AENB 3MXWH 2GIYA 2R0LH 5ICXA 5DD0H 4Y8DC 4DCQA 1WITA 4QRPB 4OQ1A 4ZDHA 5KVFL 4MNQD 2ITDA 2XPGB 2PW1A 4JZJA 4XB8A 5FGCE 1BQLL 3UAJC 1HKFA 4YEFA 4UBDC 4M6ML 3DVNB 4U6HB 3RWEB 5F9DC 1AC6A 4XGZA 4FQPA 1GGYA 3TYFA 1KCUH 3B2UC 3C5JA 1C5DB 1YNTA 1HOCA 3TT3H 5JO5A 1EVTC 1P84J 3RBGA 1OGAE 1W0VA 5D6CA 2W65B 1J05A 1FNEB 2CSPA 4OAWA 1AY1L 4J3WA 4K3JL 3HR6A 4P4KD 2IPKB 5DI8B 3MRLA 4CJ0A 3KPLB 3S5LB 4R90L 4MJ2A 1TCRB 1TZHA 4D2NA 2X40A 3TNMA 3BQUC 2Q86A 3L5XL 1J86A 3GHBH 2YSSB 4ISVA 5B38G 4OZFG 4L29A 4CNIA 2XWJB 4LLDB 2GFBA 1V05A 4MNQA 1J0HA 5I19L 4X9HA 3LPGA 3LQMA 1ZMYA 3ZLQC 1IT9L 2R2EB 2W0PA 2AJ3A 4PJGA 3TBVA 5SX5K 2VWEC 4UMGA 2CDEB 3VGAC 5FK9B 5B22A 4C83B 2P1YA 4HAFA 3MPCA 3WUZA 1FO0B 3HMXL 2J8OA 3L3OA 3WL9B 4R3SA 15C8L 4LCWA 1XIWC 1H5BC 1GJIA 5B8CC 2IAMC 4PUBL 4DGVH 4NO3A 4U0QB 2D4FA 4PRIE 1U6AH 4O4YH 5C0IB 1Z5LB 1YQVL 1WFOA 3VFUA 3N1MC 2BVUA 1DUZB 5BZDA 1G1CA 2YD9A 2HTLD 2EO9A 4GFTB 1YY9C 3LEVL 1BOGA 3KLSA 5IG7B 3QWOA 4HF5L 5T1KB 2I07A 4RFEA 4U6VH 2ICES 5T33H 3FO9B 1EBAA 5ALCL 3QG6B 4PJ8C 3IJYB 2WBWB 3MCKB 3HMWL 5IMOB 4Y5VA 3S96B 2HKHH 4GKOA 3U1SH 4KPHL 1MCHA 4KQ3L 2ERJC 3BHBA 4JFFD 1F3JA 2X4TB 3DUUA 3RX8A 2P5ED 4JQIL 4O02L 2VDMH 4ODWA 4NWTH 2YUXA 1UM5L 5I18L 5C0AA 5J0BA 1T03L 2E5EA 1XGPA 4BH7A 3ZSTA 1WWBX 3QNXA 4FQLH 4Y2DB 4K3GA 1Z0NA 1NANI 3V6OE 3WKML 5IFHL 2XFXA 3AFLA 1A5FH 2DI9A 2DQDH 2NY5H 4HKJA 1BGXH 3Q1SH 5I1LA 4FP8H 3LDBB 1G9ML 4S11A 3BIAX 1HYRC 2AI0L 1CDBA 5GGSB 1Q72H 4RX4D 3G9AB 1KACB 4TSBL 4JPWL 3CMGA 5HI5C 1Q9KA 3QEGH 2C3VA 1IAMA 1NDMA 1MSPA 2JJUA 4Y16B 2H8PA 3RJDA 3I3EA 3O11A 3WJLC 4EDXA 4NUJA 4N0FA 4RMSA 5C0JA 4RBPK 1BD2E 1T1WA 4RCAA 3JWDL 1I75A 5CJXA 5CWSA 1NMAL 5KZCD 5IW6B 1A9BA 4HUUB 4L4VB 3FB8A 1KUMA 1MIEL 3WNKA 3KR3H 4NKIH 4J6RH 2ITCB 3BMVA 5AZ2H 1UQSB 1MRCH 1QNZH 3RVXC 4P23B 1IGYB 2ICWI 4LVHB 3OX8B 4D9RD 1SY6H 3UZEA 4FFZH 2V2XB 5HHOB 4IOIB 2BSTA 2PW2A 3VFMB 2RGSA 4R4NC 5I17B 1IAOA 3MROB 3WN5A 3PWJB 1AKJA 4RX4A 4XX1E 4LHJB 2HT2C 3HB3D 2HYMA 5LWYH 4GLRH 5FV2A 1NEUA 1MNUL 2J4WH 4YHOH 4IOSD 3DYOA 3IDJB 3KPSB 5DRXB 3D1MC 1GC1C 3MRIA 1A1NB 4MQSB 2PYED 2Z92B 2CLZB 3DUSA 4I77H 1II4E 1CL7H 5E4EB 1MPAL 2YRLA 2ZUVA 4PJ9B 4NP4L 3HPLA 1I7ZB 2I9LB 4X4ME 2DL9A 4Z7VB 1WFNA 4HXBH 4WFHD 3O3DB 5HVWA 1QR1A 1GHFH 1IC4H 2WUBH 5F3BA 2VN7A 3RIAK 2XACC 4EZMA 3BP6B 5JPNB 2M1KA 1ETZB 2AJYH 1MUJA 4HH9B 4DN3H 43C9B 1U3YA 2DM4A 4XNYH 2DQCL 3D9AL 3HTLX 1VSCA 1YYML 4FFWD 2YPLB 3CCHA 4OCSL 3BPCA 2UYLA 3EHBD 4K9EH 4F8QA 1G6RL 2D4DA 4JQXA 3SDCA 4LGPB 4OI7A 4OD1H 3VMOA 4Y2DC 1I8KB 4YDIL 5D1ZB 4TSAH 2ZUXA 4FQHB 2CXKA 2PYEA 3MREB 2X70B 4ERSL 5CSBA 3SOBH 3EJJX 3NH7H 4NHUA 4U3XA 1QG3A 1QQDB 5C0GA 4YHPA 2J8UB 2QSCL 4RGMB 5IF0A 4NM4H 1S8DB 1OVZA 3MV7A 4L8SB 4HHAA 4DQOH 5C0DB 3HAEH 3Q6GH 3MUJA 1A7QH 2I5YL 5JW4M 2Y23A 1KCSL 2O26U 4MXQD 5DEFB 3VRLF 2V17L 4JFXB 1RULH 3FZUC 4POYA 3OF6A 3B9DA 4G8FA 5IHUH 5IW1B 3SEPA 4NKMA 3E3QC 1A6UL 3PNWA 4OCNC 3CDCA 1T20B 4Y16C 5BS0E 4JFDE 4Z7OE 4ZOEA 2P47B 1P4BL 5JHDB 1T5XA 1A21A 1I3GL 1KXVC 3ROLA 3G5VA 2NW2A 3CUPA 1RJLB 2YD1A 4L3EB 1QKZL 1HXYB 1H3WM 2F53B 4PREA 3IFPB 2ATKA 5TE6L 3LMJL 1XCQB 2QBWA 3BKJH 1OL0A 2A6KA 3DETC 1H3XA 5F21B 3NTCH 5DRWA 1XF4A 2IALB 2VXUH 3N1FC 4IS6A 3BP4A 2VDRH 1LVEA 4P23C 4WFFD 1YMMA 3GJFK 4KROB 4LVHC 4UNTA 2YUVA 1QLEL 3L3IA 2HN7B 1VADA 2UWEF 2VERN 3OB0K 4I18B 1XH3A 3KLHC 5SWSE 4JO4L 3ZSSA 4HJGA 1NCCL 3BP7A 3MLUH 4O2EB 4NQDD 3X14B 2AJUL 3JSSA 4G3YL 5SWQA 1JK8B 3MRDA 2JJSC 2PCPB 3VMNA 3PIQB 1N5YH 5IBUG 2BOCA 5F7LB 4X6BA 4HAGA 3T0EA 5E4EC 1MCIA 3QNYB 4NKDA 1X5JA 3TVMA 4UNUA 5T3ZH 4B7LA 4PJ9C 4LLMA 2FR4A 2JB5H 4GUPB 5F44A 4F80A 3MJ8B 4OZGF 3MNVB 2Z31A 1CXIA 1HYSC 3MYJA 4J3XA 3WNMA 4CDHA 2V5MA 3CFBA 4E41A 4OZIB 2A83B 1S9YA 3U36B 4F7MB 3G5ZA 4H0IA 2R23B 4LVOB 1FLRL 4PRPA 1HSBA 5J56B 3U4EB 4ONHB 1TNNA 4BJLA 4ZO7A 4LSPL 5LGHH 3DYPA 1R0AH 1ADQA 4P4KB 4XNUL 3WXVL 4NQDA 1JGDA 3N0PB 4JFOA 5EU5B 1CXHA 3MTRA 3SE9L 1F4WL 1SJEB 5HPMA 4YHNA 5D1ZC 1FFOB 2AAVA 1AQKL 3DTXA 4OLYH 4ZSOE 1LE5A 1QVOB 4Y5XB 1CIDA 1KLGA 5GS2D 1BWMA 2IMMA 4MJID 3RJQB 2ZCLL 5F88B 2KDGA 5EU6E 1JBJA 4DW2H 4RGMC 3MRRB 3GIVB 1FNLA 3R0MA 2A74A 4L8SC 1OAQL 1FNSH 3P0YH 4QTHB 4WV1B 3N06B 3HI1B 4O5LH 4R97B 4YDJA 5D5MA 2IEPA 4XP4L 1IGMH 4QRTA 3MLWH 1GAFL 4OF6A 3B8SA 2IFFH 1WCBA 3OJDB 3KPQA 4X7TA 3OXSB 3KHQA 1CFQA 5F6HJ 1MLCB 3MGOB 3S6CA 9CGTA 4RAUA 1ZA3A 3QDMD 3VGEA 3BIKB 3VXRD 3H3BC 4LMQE 1F4XL 1MFAH 4JFZH 4XCEB 5KG9B 3RWGA 1JZ8A 1EGJA 1QZ1A 3KLAB 3ARRA 2ORBH 2IH3A 4EQ3A 5IT2L 4MVBC 4JVWA 3G6JE 4O9HL 4KROC 2IANE 5EZLA 4K7FB 4G43A 1BJ1J 3ARGA 4HX1B 4KHXL 4XAWH 5TJWK 5E2WL 3TV3H 3LKSA 5D7JD 1K6QL 3FB6B 4PJDE 5IK3B 4AEFA 1NFDE 3FQUB 1X7QA 4I18C 4OD3H 4JPVH 2D2OA 2LTQC 2DJ4A 1MCJA 5F7MC 3HNVH 2HRLA 4WNQA 3K1DA 4JFFB 3VFVA 5DMIH 1F90L 5KANG 1J12A 3O4LE 4KUCD 2GSIA 3RWHA 3WIIL 3FB5B 3H0TA 2Y1VA 2P5EB 1A3RL 4Z5RA 4JDVB 2DWEA 4I4WB 1ZHNA 3OG6B 5MI0B 4B7IA 5I0DA 4EUPG 3VXRA 5GGQL 5DGRA 3TH2T 3DX7A 1FBIH 2WIIB 4OJFL 3UJTH 5IQ7H 3BW9A 1Q9OA 2NZIA 1QOKA 1W2KT 4DKEH 1JYNA 2VO5A 2A1WH 4JAMB 4M3KB 3T08A 1HH6B 2LAGB 2P45B 4MA8L 3JV6A 4HV8B 4D3CH 5D2NE 5FECA 1VEMA 5DVNA 5JHLL 1BAFH 2B1HH 5D7JA 4DVRH 4LVOC 5BXFA 4CVXA 3AM8A 1QTYT 4XRCA 1X5KA 5FKPA 1OM3L 4P4KC 4UTAL 1MCOH 1HSAB 3P9MA 5FUOL 3VI3F 2APBA 1YEGH 1W0WA 1RIVH 2YKLH 4L1DA 1EK3A 5FOBA 3L3HA 4MHHG 4TNWF 3VD3A 4N5ED 3RUGF 4Y5YA 1PDKA 1UZ6F 1OT1A 1I7TA 2P5WD 1NAKL 4JKMA 1B90A 4Y5XC 5KZCB 1O5DT 4P57A 1RZJC 1ROWA 1KPVB 3TBYA 3RVVC 4OD2A 4ELMA 3FN3A 3VRIB 3UXFA 1FVDA 4X98A 2BOBB 1RIHH 1KNOA 5I73B 1PZ5A 3QDJD 4GOSA 4WV1C 4R97C 2NW3A 5HHXH 5DJ6B 2DQJL 4TUOA 2GW5A 4NQVA 4M7JH 1RZIA 1AFVL 5SV3A 5ICYA 1T2QL 1ZAGA 3VFOB 2PR4L 1IBGL 2YZ8A 3SJVA 5B3NA 2IGFL 1IM9D 4TQEL 2VZUA 1HE7A 3M8OL 4HXAH 2VLRE 3T0BA 3BPCB 4U1IB 2LV4A 3V4PH 1BZQK 3V0VA 4N0UA 1B9ZA 5H94B 2FECL 1RY7B 1ZSDA 3OKLA 3PABB 4RIRB 2VUOA 3UO1H 3AUVA 3K8LA 4JRXE 3T09A 3JV4A 1F4AA 1DBAH 1WZMA 1SJXA 5AAMA 4JFHE 3I6GA 2CKBB 4PJHF 2C3HA 1LO0H 1T0PB 1EEZA 3NFNA 5DK3A 2HAZA 3IETA 4F15B 3QXAB 1RUQL 4GXVH 1SHMA 4A6YL 1EHAA 5A43C 3OKDB 1GGUA 3DX9B 3QDJA 4LCIL 1CXEA 1WJ3A 3FKUS 2X89A 5GSVB 3UJJH 5E08L 1FNGA 3X17A 3WJJA 4XPTH 3W5MA 1MI5B 3QO0B 4FQJH 2R0KH 5TDOA 1NSNH 2VQTA 3QCTL 3P2TA 3T2NH 4X6DE 3EFFA 4WFGD 1IM9A 2J6EL 5BQ7A 5KOVC 1KIPA 5MI0C 5INCB 4NM8H 1H8OA 1OAUL 1SEBB 5T5FL 3K1KC 2DMCA 3S4SA 3CVHB 4OLUL 1I3VA 3PF2A 4XAKE 1WUNT 3QR2A 2BHUA 4J1UA 2C3XA 3QIUA 2EDKA 2J1KA 4NBZB 5IB1A 3SKJL 5C3TA 5TE7L 2FWOB 4WY7H 1AGEA 5TQ0L 1VB9A 1J8HE 4QO1A 1IGTB 5IB5B 1AGBB 1T83C 4YFDB 3UBXG 1KPUA 2FIKB 2EDJA 4LL9A 2VDQH 4DGIH 1U41A 3UZQA 2AEPH 2KH2B 2XYCA 2PTUA 3OGOE 4ZPVB 3LSOB 5DK0A 3VXUD 1RFDL 4DOHE 3HPJB 4F9LA 3V7AG 3MACL 3MFFB 3ETBF 4KJYB 1S7WA 2ZUYA 5FYKU 5J3HC 1UVQA 1H8SA 4HZLB 4RGNB 4XH2A 4XPHL 2WUCL 4JFPB 5E7BA 1E6OH 1F6AB 2P7TA 2R4SL 5D7LD 2XZAH 5CILH 5JORB 3P4LA 4JY5L 5GGUA 4YGVA 1CVRA 5EZJA 4Y19E 3WLWD 2XQYG 1A1OB 1UYWH 3OR6A 3VXSD 1BVKA 4XP1H 3VXQB 5DJXB 1OQOA 3M1BA 1ZLWH 4EIGB 1JWUA 5KSBE 4LSSH 4CL7A 1E6JL 3KPNB 1U8NB 1RV6X 3F6LA 1XGUB 2IBGA 5I73C 5F7FA 1EAPB 5C8JA 4OZGE 3T0XA 1DR9A 5DD5H 2W38A 3VXTB 3N9GL 4M61A 1HH9B 1T66D 4ODHH 2Z35B 4PJEA 4UT9H 4O2CB 4XNXH 1NQBA 4WI3A 1ZS8A 4KXZI 1XF5A 2PO6A 5ESQA 1A7NH 3OJMB 1JZ6A 1QRNE 5D2LF 1AGCB 3U30B 2ED9A 4RWYL 5GSRA 2BP3A 4BQ8A 4HIJB 3WXWL 4XMKL 5J1TC 1QO3B 1GZQB 1UZ8A 4CADA 3ILQD 3T3MF 4OQTH 1RUAH 1R3HB 1IAKB 4LBEA 4J3VA 3GNML 2E9WA 1KBGL 2DQFB 1PD6A 1GOFA 3STLB 5FFLA 1AP2A 1WICA 3VXSA 4F7CB 1OGTB 4QRRA 3H3PH 5ISZB 4MAUH 4PGBB 3UDWA 3QG7L 3UTPE 1MCWM 2NY2D 1CU4H 4EN3B 1XR8B 4M7KL 1U8IA 5IW3A 5FKAA 2HJLA 5FA3B 6FABL 4F15C 5KSUA 4L8CB 3HFML 4NRZA 3GSNA 4UINL 1XGRA 2DTSA 4E42A 4YBQD 5C0EB 1U36A 3MUGA 2AW2A 4OLZL 4XP5L 3E1F1 2VR9A 3GRWA 4LSTL 4TUJB 2BVPA 1M71A 32C2A 4HGWA 4YFEA 4ODTH 4U1KB 3DXAE 4FFWC 1A6WL 2G5RA 1NBVH 4Z0BL 2JE8A 1XFPA 1AR1C 5F1KC 3L5WA 4H5SA 2VC2H 4OGZA 4PRHD 4JJ5A 5IBTH 4V1DE 3BSZH 3WSQL 4LPWA 4QKXB 2X09A 3ZTNH 2WANA 5F9OH 3GFUA 4QXGL 1CT8A 5HD8C 2A77L 2VKWA 5CINL 4MJIB 4OFYD 1J1OL 4PIRF 3PL6D 3MSPA 4JZNA 5DDHA 5I2IB 3LHPL 1NC4D 2D9CA 3KWWB 5EULV 1R5IB 3VXNA 4LP5A 1C16B 3JXAA 4RGNC 3HE6A 3ZO0A 1U91A 3VH8A 5LG1A 5DZLA 3MV8E 3NCMA 4KKBC 3HG1A 3G6AB 1RU9L 3OHXA 3QDMB 5JW4R 5JOFB 3CZJA 3HUJF 5IB4A 1QFWI 3AGVA 1Q9WB 1DLFL 2BCKA 3RKDD 3G5XB 1TJIL 1Q0YH 1RZJH 5CD3B 4I2XA 4HUVA 5I8EB 4HFWB 1U8QA 1FFNB 3GK8L 3PWLB 5JLZB 3VGBA 2WLZA 4MA3B 4OFYA 4YXLL 5IEKB 4EI5D 5K59E 3PL6A 3OGCB 4P4RB 1BVZA 3UP1A 4WCYH 2R0WH 4PG2C 5C0BE 5JXAL 5IGXL 1K8IB 5DVMA 4H88H 4OZ4A 3PUCA 2EYSA 2XV6B 3NZ8B 4R7DB 4OKVB 5JNYA 1Y0LB 4K3DL 1FRGH 2OR8A 2C9AA 4AH2B 5HHQB 4PJCA 4MCZA 3QCUL 4HW6A 5E4IA 4YIQB 1XR9B 5HYSG 3VI3E 1JNNH 1DE4B 4O00A 4NDMA 4F33A 3DSFH 4QOKD 3RUGE 1R5VB 5IJKC 4EN3C 2P8PB 3B2VH 2DWDB 4Q6YA 1WTLA 3MRHA 3OR7A 4BKLB 1IEAA 4M7LT 1NBZA 2JTDA 1FG9C 3L3KB 4U4BA 4ALAH 2OJZL 5EIIB 1AXSB 2VNCA 5IESL 1FGNH 4ZUWB 3GMMA 4HKXA 3H9SE 2GAZA 3U9UB 3IFNH 25C8H 2O5YH 4BH8B 2JCCF 3QFJE 5C0CD 4MJ5A 2NXYD 4OCXL 1LHZA 4UDTA 1FNHA 1M6OB 4UV7L 3Q5YA 5DK2B 5J6HA 3MLSH 2ESVE 5GIRA 1KIRA 1U8JB 5GS0L 2CXGA 1MCKA 1EUTA 1IGJB 4JRYA 3SDXF 1LO5B 1MHHB 2P5WB 2M8XA 3D0VA 1UEYA 2FGWL 1NPUA 3KPOA 3QH3A 1EDQA 3NCYP 2ZZUT 2HFGH 2H2PC 2UY6A 2C1PB 3QUML 3DURA 1HHIB 2C4FU 4YE4H 4YUEH 1QBBA 1XGYL 4JY4B 2JELH 5FYJD 2OXGA 4LFHD 4PJFA 4AT6A 5J9PB 1HQRA 1LEGA 5GRWA 5EU4B 3OB8A 4LF3A 4OUUB 1E4WL 1F11A 3NN8B 4U05A 5JR1L 4F57L 3BKML 1WZ1L 1P1ZA 4TPRL 3EDEA 5DJYA 3QPXL 4G6KH 3W2DH 4U1GB 1INDH 5KVDL 4EEEA 4OB5H 2EE9A 3QRGL 1DQLH 1UKQA 4ZG1A 1NAMB 1Q9LB 4UIKL 1PKOA 2Y06L 4JVUA 1ZTXL 3AXLA 4J3TA 1XF2A 2GITB 4XC1L 2NR6D 1ZXQA 1KSRA 2DRUA 4MXWH 2AK4A 1IM3A 1TITA 2HRPH 3T1WA 4TULL 1UH3A 3HCVB 5ICZA 3TYGH 1QSFB 4XP9H 1OGAD 1S7UB 2NX5B 1X5LA 2B0SH 2DICA 2YD8A 4LKCA 4ODUB 1IQDA 4G8IA 5KW9H 1KTLA 3K7UA 5DVKA 5AYUH 4R8WL 3OKEB 4ZFGL 1RMFH 3VGFA 4DN4L 5D7KE 2R56H 1Y6KR 2UUDK 3SKMA 3AAZA 5ETUA 3IDMB 5DQDH 3FOLB 4NRYB 5E2VL 4HWEH 4NJAH 5CIPB 5IJVA 3S36H 5HYEA 2CKBH 4N9GB 5F1IA 3H7BA 2D7MA 4UOW0 2SEBA 5I0ZA 4IRSD 1H15B 3I84A 1UWGL 1X5GA 3RTQA 5HXMA 7FABH 1MJUH 8CGTA 1X5YA 3FN0L 3TN0D 3GMNA 1OGAA 3VFNA 3VXUB 4RRPG 4LOUC 2NXZD 4PGDB 1JHKL 3GSRA 3ZDXE 1DQQA 4UU9B 1KF9B 1QFUL 1BX2A 3TO2A 5BCAA 4GMSL 3MLXH 3ZYZA 1MEXL 4QGYA 4U1MA 5D7LB 3DOSA 1MIML 2R15A 2ARJB 5ADPH 4N5EC 3VE0B 4HWBA 4AJ0A 3T3ME 2Y7QA 5I1CL 4WVRA 2A6DB 5EIVA 4ZD3L 1SJHA 3QEHB 5ESAB 4H1LB 4J8RB 2PXYB 2YZ1A 5GRJH 4ZUVA 5JW3H 5D1XD 4HKBA 5GS3A 5GRUH 2EE6A 4IRSA 2R8SH 1JFQL 1SBBA 2C7UB 3SKNB 3QRFM 1CFSA 4LSQL 5MEOA 2DOCA 3IXTA 3TN0A 4NO5B 4KKNA 2L7JA 4D0DB 4JPIB 2BSSA 1FQ9C 3ARDA 3OJ2C 3SKOB 4LEOA 2APVA 4UV4L 1LE9B 4G8GA 3BZ4B 1QFOA 2FX8H 4PD4K 3VXME 1N5AA 2APXA 1PY9A 1BF8A 1RUPH 4X9GA 3GBNH 5IOPA 2GT9A 3WDJA 5DRNA 2FJFA 1KCRL 1KULA 4UQ2A 2A6JA 4XWGH 4U1GC 2FBJH 5FO9A 4EXKA 2ZCKL 5GGTL 2D7QA 1TNMA 4JDTH 4R4FL 1OB1A 1U2HA 2BNUA 1IAIL 2Y9RT 4N8CH 2OK0L 2AABL 4YO0B 2EH7H 3B9VA 2NY2B 3OAZK 5GGRY 1RQ5A 5KVGL 1NEZB 1B6UA 1O7VA 3KPRA 4M02A 1CDIA 5D1XA 3VFSB 3FQWA 2VABA 4OLEA 4NQCB 3CH1A 4R0LA 3EYSH 4ETQA 12E8H 3F62A 5DUBB 2IH1B 3PV7A 1A6VH 3MXWL 2IPUG 1ORSA 1S5HB 3P0VH 5C7XL 5DD0L 1VDGA 4P2QE 2WWKT 3BFOA 2CRIA 4PGEB 5I1DA 4XZUA 4CU8A 1P7KA 3WFEH 1BD2D 1RJZA 5J4MA 3BZEB 4BFGA 1IARB 1A2YA 4C59B 4OTXH 4HGMA 2X42A 4PR5A 3I75B 4PRHB 5EC1A 4W4OA 3TA3A 1CGSH 3CZFB 2R29H 1GPOH 4WHTA 1KIQA 3MJ9H 1KCUL 1B0GB 2VIRB 3TT3L 3MRNA 3U0PA 1BWWA 4GG6B 5HI4D 2MHAA 4ZS6D 1TXKA 2ADFH 3ALXA 4PJIF 2AXFA 3IB4A 3W81A 4JY6A 5KJRH 1PKQB 2WP3O 1NC4B 1MJJB 4Z7VF 5CP7B 3SY0B 1I3RA 1ZLUK 5IHBA 2E6JA 3EYUH 3O3UN 3GHBL 3RKPA 4NIKB 4UI2A 2ADIB 4KKAD 5C09E 4PRNB 3CVIH 3RWDB 1VFAB 2HTKC 3QBTB 1IKNA 1Q1JH 2H6PB 2VWEE 2X1XR 1FFPA 1BD2A 3JUZA 2A9MH 3WS3A 4L1HA 4N9OB 3B8YA 2DKSA 5DZNA 1LK2A 2X4QA 5CP3H 1JN6B 3QHZH 4F3FB 2PXYC 4KRLB 2R2BA 3QPQD 5BW7A 5I8KH 4QRSA 3L7EA 1KJ2H 3HNTH 4POZC 3FCTA 1JMZA 4EI5B 3EO9L 3ZKXC 4ENEC 5HYQB 2HT3D 3A6BH 4DGVL 2F8VA 2Q1EA 3EYOA 5BVJB 2Y36H 3MMEA 4OCWL 4U6YB 5T3ZE 2J8UF 2ADGB 2XN9B 1JUFA 1NCNA 3OPZH 3MRGA 4NN7B 4OV5B 3DGGA 4E0RB 2GSGB 1KT2B 5EO1A 4FTVA 3ZDYE 2PYFB 1FZKB 2XWTA 3BN3B 4P99A 5INDA 4U6VL 1KTDA 3AC0A 1QLFB 2AXGB 3B5TA 3L5JA 3QWQB 5E6IC 4PJXA 3T1FA 5SX4H 3TH4T 1KLUB 4R4BA 3RI5F 2H32B 4QOKB 4R2GB 3TJHD 2HKHL 5CEYB 3U1SL 4OZHB 4OF8A 2XKNB 3KPPA 2NY2C 3W39A 4WWKD 5DS8B 1VACB 1NGQL 4NZDA 2GHWB 3WE6A 2JKXA 2DD8H 4L8DA 5IMMB 2V2TB 2MMXA 2VQUA 2VDML 1J87A 4FXGA 4NWTL 4YBQC 1JV5B 2DQUH 4Z7UE 4HG4J 2ZNWA 1LDPH 4JG1L 4NQXB 3B4NA 1HXMB 4FFVD 3VU2A 3D25B 5IFAL 4HWZA 1FCCA 2DB8A 4FQLL 4D0CB 3B3IA 5BS0D 1LNUB 2OL3H 4JFDD 2XZQH 5C0CB 3P9LB 2F8XC 1Q38A 3VFPB 4MCYB 3EOYG 4L9LA 1A5FL 4WUUB 3HS0A 2DQDL 2NY5L 1BGXL 4U6XB 1LO2H 3JTSB 2YHGA 1JGEA 1MFDH 4FP8L 2AVGA 1CL7I 2JJTA 4JHBA 2EDYA 1FJ1A 5CGMA 1P7HL 5LVEA 5HHME 3CNKA 3HE7A 5GHWH 3WS6C 3B43A 1DANT 1Q72L 3WCYA 1PG7H 3GMQA 3QEGL 2IJ0C 3A67L 2EEAA 3HZYB 1BQHB 3WUWB 4HS3B 5ANMA 5HGHB 3CFKB 4IOFC 4OSUL 3IU3A 2EYRA 1X4YA 3DYMA 4Z0XA 1KB5A 5SWSD 1Q94A 4JM2A 5EOCH 3O6FC 1G6RB 4OM0H 3OG4B 3MODH 1F8TH 2K9UA 5D70H 4P5MA 1WBZB 4OZIF 1AIFB 4MJ4A 4WHYH 1MCLA 3UYOD 1G7HA 5BS0A 4XVJH 2ICWB 1Z9OA 3GMLB 3O9WB 1EEYB 3IF1A 5CBAB 1X5ZA 4NKIL 2FYYB 3T2OA 4J6RL 4YHIA 1MRCL 1QNZL 2E6QA 4LSVH 5CKAA 1YN7A 4WFEE 5L88L 1G9MC 4FFZL 3RKDC 2CQVA 1R3JA 4GAGH 5LCVL 3G08B 4I3GA 5FGCB 3REVB 2EDXA 2CUIA 5C1MB 4EI5C 5MEQB 2J4WL 4YHOL 3CPLA 3QDGB 5BMFH 4RAHA 3DV4A 2X4UA 3VI4E 3BT2H 3L6FB 4JFQA 3ARTA 3U4AA 3BH9B 1LWRA 4NN7C 3JWDC 1CL7L 2F74A 3KS0H 2X44D 1AE6H 5JPMA 2FEEI 2AGJH 2X6MA 4HXBL 1CXLA 5BOZG 1IC4L 5L7XH 2WUBL 1YUHA 5HGAB 1KCLA 3VG0L 4R2GC 1ED3B 3V5HB 2AJYL 2OM5A 5EU6D 4DN3L 3SGDI 1J5OL 3O2DA 1JZ5A 4C4KO 1P7QA 2HJFB 5DSCA 3QUKA 1MHCA 1WVZA 4J3UA 4HS8H 1N8ZA 4KQ4H 6CGTA 3IDYB 1QEWB 4KDTA 3QUXA 3RNKB 3INUH 4OD1L 2NXZB 2VRAA 4TSAL 4IMLA 3DRQA 4MJ6A 4PRAB 3W0WE 1NGXB 2NZ9D 3FQRA 3VW3L 5EU3B 3T8XB 5IIEB 5DJ2A 3SOBL 5K9QG 4PRIB 1WK0A 3NH7L 1EMTL 4OFDA 1NBYA 1DBMH 4RGOL 1WLHA 4P0DA 3CXDH 3ESVF 1FG2A 4NM4L 5DHVA 4ZSOA 4PLKD 2EYTA 3D3VD 4M48L 5DJCA 3Q6GL 5GJTH 4HKZA 1D5XB 2IAND 4NNYA 1BIHA 2OJEB 3SGEI 4V2BA 4YX2H 2DLTA 5TPWH 3TWCH 4YJZL 1OP5H 1R3IH 3AU1A 2XZZA 4LHUD 5GRXG 1E4XI 3MLYH 2VITA 4BZ2H 1NMBH 2V7NA 2FEEL 2BFVH 5DJ0A 3O4LD 5I1GH 5EO0B 3F5WA 3M17B 2ED8A 3F7RA 4FZ8H 2Y6SD 1CQKA 3S8WA 1T1XB 2WW8A 3O9WC 1XF1A 4S2SA 5EB9A 3BKJL 3NTCL 3LQZB 3ECBB 5KVFH 2ZSWB 2VDRL 5JIIA 2AQ2A 1BQLH 3QA3B 4M03A 2QHLA 2BRRL 2EIDA 1YZZA 2BERA 4WHTB 3D3VA 1EHNA 4MQ7A 1LO3L 4GW4B 4ZUUB 4GXUM 2EZ0D 1AY1H 3D18A 2D3VA 4GRLB 4K3JH 5IWLA 1NGPL 3MLUL 1FGVL 1MJ8H 3LKQB 4GQPH 2V5RA 4FQQB 1IZKA 1JE6A 4LHUA 4LKXA 4PJIE 4C56A 3MRCA 3IJHA 2LABA 4U7KA 1A4JA 4WTXA 4XMPH 2YD6A 4AL8H 5JW4Q 2GTZB 4CJ1A 1IGFH 4ZPTA 1QSEB 3FO2A 5DD6B 1KYOK 3QUZB 3MGTB 1MHEA 5T3ZL 1CS6A 5BRZE 2JB5L 4S1QH 1Z3GH 4PJAE 3SPVB 3N1PC 1JF5A 4U1LB 3T4YB 3W11D 3ARQA 3VD9A 5I19H 3K4ZA 1V5JA 5DHXB 3CSYA 5F89A 3B83A 1E4XL 4P2RE 2OMBA 1T0MA 4HPOH 4XBGB 2UVEA 3RBSA 1Z0MA 2JIXD 4X6FA 2F5BL 4GKSB 2BSED 2F19H 5DA4A 5FIEA 3VWKB 4MMZC 1PZUB 1VFMA 3L3JA 4Q7DA 3UEZA 2CR3A 1IGCL 1YQVH 1YEKH 2E9JA 2NY6D 2RFXA 4BFEA 2NY0D 4OLYL 1I8MA 2MSPA 4I9WE 3LV3A 2DM7A 3LEVH 1A9EA 4HF5H 3P3YA 2FZ3A 5T5NF 3KJ4B 1CFTB 3EO1A 5ALCH 4EBQH 4JFHD 1FNSL 3BO8A 3P0YL 1W72A 1WBXB 4M43H 3ZT5A 1WV7T 5F9JA 3E6FB 1IGML 2R1XA 5DTFA 1ZT1B 4QHLB 3VG9B 5B3JF 4KQ3H 1F4YH 1B88A 3UPAA 1D5BB 1U8OB 2IFFL 2FHBA 1FPTH 1EFQA 4FXKB 3O3AB 4OZFA 1MCQA 5FO7A 4L3EE 2WLYA 4CAGA 1U8PA 4NQEA 3C9NB 1L0YA 2P8LA 4BFIB 1QFHA 3VXOB 3WFHB 3HLAB 5GS0D 1EX0A 4NSKA 1B0RB 1MFAL 5E00A 3TBSA 5F72S 4JFZL 1MWAB 3V6FA 2NNAB 1T1ZA 5DFTA 2ORBL 2Y5TB 3GMPA 3QHFH 3ULSA 4Y4HB 4GAFB 2YD3A 2Y4SA 4XAKD 3QISA 5CSZA 5JOEA 3V6OC 5HHNB 4Q6IA 3S7GA 3P77A 4PP1D 3MO1B 4XAWL 4MQXD 1SJVA 2W1NA 2AI0H 3U0TA 4JPVL 1J8HD 4APQA 4LLUA 3D87B 3I02B 4WWKB 1AQDA 2NY7L 3HNVL 1ORQB 3K4DA 4GRLC 2X9WA 3T65A 5DMIL 1F97A 5DD3H 4JGMA 3GBLA 3VGDA 1ODAA 1RHHA 5IMLA 4F9PC 2EEBA 4XT1C 3KNBB 5K9KB 1A7RH 3X3GH 3VRJB 5DUPH 5KN5B 4NRXA 4R7NA 3ZKNC 4PV8B 3JWDH 4JFDB 5F6IB 4ZNCD 1NMAH 3QUZC 1FBIL 3UJTL 5C9JA 2VZOA 2EDFA 4Y19D 1MIEH 4P46B 1NMCB 5A2IH 2OSLB 3IDGA 2A1WL 2OTWA 2X2YA 2Z91B 2DYPB 4D3CL 4BQBA 2R1YA 2H32H 4A6YB 3V6BR 2GCYA 4P3DB 2B1HL 2QKIB 4GW1A 4DVRL 1OP9A 2QR0B 3UTSE 5CJXC 4HCRA 2D7TL 5ACMA 1J8HA 2FX9H 5EDXA 5HI4C 2FJHB 4MZ2A 3VWKC 1YC8A 1MNUH 1NANH 1JPST 4F7EB 1YEGL 1RIVL 2KQMA 2UWEA 2YKLL 1QRND 5SWSB 5DZOA 4RMVA 5IV2A 2VISB 5DLMH 3SE4A 3D39E 1S7VA 2EEDA 2I24N 1KN4H 1P6FA 5B4MD 5DEZA 1VCAA 4YHLL 2OR9H 4LSRH 4GW5A 3ARBA 3T0DA 5JZ7D 1S7SB 4NP4H 2HVKB 2R4RH 4NFDA 4HIIB 1RIHL 3KJ4C 3FTGA 4JDZA 1DDHA 2H26B 4JRWA 3S4SG 3UTPD 5F7HA 5HHXL 5JMRA 4RSVA 3VG9C 3MFGB 1DQJA 4M7JL 1F42A 1TETH 3T0WA 4W6YB 3OAYH 4IBLT 4OZGA 3WBDA 2OP4L 4F7PB 2XNAB 1R5WB 1YYMH 2OZ4A 4HXAL 1U8KA 4L3CB 2ZOLA 3AS3A 4OCSH 4ZFZB 3FO1A 1CDYA 1P4LA 5F9WB 3VCLB 4HBQA 5HYJD 4WGVB 1T0NA 3DXAD 1BZ9A 4G7YH 3UO1L 4YDVB 1RZ7H 4I8DA 4XPFH 4MSWA 5D7IF 5C0RL 1QFWM 2R1WB 1DBAL 4IHOB 2CUMA 4JKPL 3X11B 4Y4HC 5I71B 4P9HH 5C92A 4U1HA 3DSNA 4PRDB 2WWMC 4JKWA 4UIMA 5MERB 1JHTB 5DC0A 3Q48A 2VLJD 2X41A 3NFPA 2QSCH 1CBVL 1CFNB 2YC1B 3U46B 4KHTL 3ZTJH 3T77B 1FL5B 4GG8B 1S9XB 4K8RD 3T3PF 3UJJL 2XQYK 4XNQB 5EU6B 1KCSH 3G5YB 4WWKC 4XPTL 4ZFOA 4RAVA 4FQJL 4JCLA 2R0KL 2V17H 4KK5D 5CEZH 3OWEA 1M05B 1NSNL 4GAYB 4G9FB 4MDJB 4KVNH 3T2NL 1C5CH 2NYYC 3F12B 5AD0B 4FQ1L 1QD0A 3D0LB 4EVNB 1LEIB 1A7BA 4FFVC 1I3GH 4MX7A 4NM8L 5HYJA 5GZOD 2HFFB 1HQ4B 4X6CB 1ITBB 3MV8D 3O2VL 4CN4A 5TE6H 4NYLB 4Q9BA 1K4DA 3V6ZB 5I76A 3UTZB 4P46C 1NMCC 1I85C 4WY7L 3PQYE 3DO7B 2KZ1B 5MHSE 1A1MA 2N1KA 4KUCF 1QLEH 5C08A 2VLJA 3CX2A 2D9QB 3HKFA 3BH8A 1A47A 4L3AA 3QP3A 5DEGB 2DLEA 2VDQL 4DGIL 2FEDD 4N8PA 5E5MB 3RGVD 1IL1B 3CFDA 1OSPL 4HBCL 3MJ7B 3G6JB 4HJJL 2IANB 3PJSA 4OI9A 4H1LG 3AMLA 3DX6B 5C0BD 4GBXB 1TDQA 4PJ7E 3P9WB 4PJDB 1NFDB 3NIGE 4CDGC 1E6OL 1FIGH 1GYAA 2XZAL 1K2DB 5CILL 1HKLH 2YD7A 2NLJB 1X9QA 43CAB 4ZOCA 1G7PB 3N50A 5I1KH 3O4LB 3TJEH 3RZCA 3SGJC 4I5BB