3RVWC

Crystal structure of der p 1 complexed with fab 4c1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Peptidase 1
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvwC01
1H3WM 2OM5A 1KELH 5IHZA 5HI4D 1NCBL 4P23D 3KPMB 1NAML 3QUYB 1NGQL 4K7FB 2E8ZA 3IS1X 3VXOA 5IESL 3QIWB 3QISA 5MHSD 2B4CC 3GI9L 4ELKA 5GISH 4MA1C 1BZQK 1ADQL 1CFSB 1HKLL 3HE7B 3VCLB 4O02H 1C5BL 2VLME 4JRYA 4RAVB 1B0RB 4OLEA 4RFEB 1F90H 1I9RL 1A6VL 4HKJB 1W0VB 5HYJD 3MRDB 5CD5D 4NKMB 1TXKA 3HG1D 2W92A 4JDTL 4KVCL 4WO4A 3WJLA 4ODWB 4X8JB 3CVHA 4X9BA 3K2UL 5DYOA 1SBSH 4Z7OF 5BZWA 2CLZB 4YO0B 5TQ0L 3OKOA 4EIGB 1X4ZA 5DVKA 2GJZB 3KR3L 4OQTL 4OTXL 4OLVL 3KNBB 3MGTA 5EBMA 3OG6B 2MNUA 4WTWA 3SKOB 2HJLB 1A5FL 1JI2A 3ZE0E 5K9OA 4H5SA 5J4MA 4QRUB 4PB9L 5LBSH 4JFFB 3DSNA 1MLBB 1MWAH 4M7LT 5EC2B 4LPWA 3U2SB 1C1EL 1IL1A 3ECBB 3HPLA 3FTGB 3EOTL 4YLQT 1CLZH 3ZE1E 2VOTA 4KMLB 3F65A 3FQNA 2HTLC 4FQLH 4DFIA 2X4RA 3BT2L 4HZLA 4PJCB 4KJQC 4RCAA 3EOYG 3LEYL 4FQHA 4IRSA 5KVEL 3DUUA 1T7ZA 1C7TA 3H9HB 1Q0YH 1QP1A 4AL8L 3GIVB 4PD4K 3RVVD 1RU9L 1DCLA 4QXTB 2EDFA 4K8RD 5F7UA 4X7FC 2B1HH 2Y36L 2CKBL 4V2BA 5BRZE 3IVKA 1G9ML 4MVBC 1T1ZA 1JZ2A 3W0WE 3PGDA 3DMMC 1UH3A 5IROA 1YYLH 4PTTB 5F1IB 3WNNA 4GRWE 1KB9J 1U8HA 4KPHL 5JR1L 5IV2A 2I9TA 5MENA 4P2OA 4LLDB 4PJ5B 2A6DB 3LV3B 4JM4L 2EICA 2IBBA 4B5EA 1F4HA 1HSBA 1QBMH 1E28B 5D7JB 1YN6A 1A7OH 3KXFA 4UI2A 1JBJA 5IB3A 5IMLB 1I1AA 4P9HL 4PJBB 2ZSWB 1S7TB 4QTHA 4M7LL 3S35X 3VXQB 5SWZA 4C57C 3ZMRA 1K2DB 2ZSVB 3GNMH 5DTFB 5T1LB 6FABL 5JUEL 1UZ6F 4OZFA 3G6JE 3BSZL 2R0WH 1HSAA 5D1XB 4KK5D 5FDYA 3MRHB 2E3VA 4KK6D 3S5LG 5JORB 4XWOC 4TQEH 1UXWA 5KAQG 3RL2B 3LS4L 1R5IA 4Z0BH 1RJZA 3WUWG 43CAB 1G9NH 1N59A 4K2UH 4JDVA 3MV8A 2RQ8A 5F97E 2LQRA 2KQNA 2DQJH 1B0GB 3WKMH 5ISZE 4C54A 5TE6L 3ZKSD 1T4KA 4R7NA 4CMHB 5FDWA 3KPRE 1K9TA 5D1ZB 1K8IA 1Y0LB 3WO4C 1KACB 1KGCD 4M7KH 4OZHB 1QFUH 3SDCC 1DQDL 2W0PA 4GW5A 2NR6C 3IFOA 1MCWM 5I1LA 4AG4L 1TETL 2OTWA 4JRYD 4YNYB 4NNXB 1HYSC 2LFGA 2V5SA 2OMBA 4AENB 25C8H 3C5SA 5IEKB 3R06A 4X98B 5E0QA 4ZS6C 2V17L 1J11A 1SY6H 4XRCB 3E6FA 4L3AA 5IW1B 3ILQC 1IQDA 3WDIA 1KC5H 2AJVL 1RFDH 1MVFA 1YMMD 4ZYKB 2VLKA 4JAMB 2AJSL 5KN5A 1JGLH 3CFJA 4TNVF 4ZD3L 3SY0B 1J8HB 3TBYB 1I1YB 4Z7QE 2D7QA 5JNYB 1U92A 1K3IA 5EOTA 3SE3A 3BPOB 2EZ0D 1PX4A 2PYEA 4R2GC 5FUCE 4D0BB 3NCJH 1KCUL 4XCCL 3R8QA 5AZEH 5D2NA 3K2MC 4JZOB 2Q7YB 5ABDE 1K85A 2FEEL 4WDIB 4IMLA 1YJDH 4GQ9H 3NBNA 4Q9BA 5J89A 3U4AA 4ONGH 4U7KA 3FN9A 4DKFL 2BSSB 1WSST 1AH1A 4BZ1L 4ERSL 2GSIA 4DN3H 2R23B 4F7EA 2YN5A 3DSFH 1DSFH 2G2RB 4F7MA 2ZOLB 4Q74A 4OLUL 1BWWA 1XAUA 4FXKA 4HGMA 3HZVB 2DQTL 5F89B 4X5XB 4WNQA 1BLNA 1KPUB 2AQ3A 3DX9A 1NBZB 2R0LH 5A2FA 3FQTA 3FAWA 5JW3L 2BHUA 3T2QA 4F7CB 3BP7A 1FVEA 5MEND 1CF8H 4F8TA 3RWGB 2R1WB 4GAGH 5ENWA 3TC9A 1FP5A 4ETYA 4PJ8A 4KRPB 3WN5B 5GRJL 2UYLB 2EDJA 1WUNT 3D0VA 1C16A 3WO3B 1HHIB 3BPNC 3LN5B 3LH2L 1I1AD 1I7ZA 1U36A 4WGWB 4WUUB 1B90A 4GW1A 1RV6X 3VG9C 1MUJA 4JFXB 3GGWB 1MCNA 2BNUB 5EULV 1NGWA 3NA9H 2HFEB 4F33A 1UB6B 1V5JA 5E8DH 3GKZA 5F1NB 3C60B 3VWKB 4QGYA 1DUZB 3DNKA 3RWDA 1A4KB 2JIXA 2QQNL 3EJYC 1MCIA 5EZOL 3GK8L 1B4JH 3SKJH 5DUBB 3MV8D 2ATPB 1R5VA 3MV11 5CP3H 3VXSE 4JZJA 2YK1H 4U1SA 4X6FB 5DHVB 2CXGA 1BQHG 4YBQC 2JK5A 4P2RD 1FL5B 2NY1C 4WY7L 1NCCL 1PBYA 3IKCA 1IE5A 5L8JB 5F6HJ 3U4EB 3L3HB 1ZGLA 4M6OH 4PJ7A 2F58H 1IEAA 1Q9KB 3MRLA 2UVEA 1EHLL 3HN3A 3JWDL 5IQ7H 1OAXL 2WANA 3R8BB 5IM7A 4KROC 4OIIH 3DIFB 2EDWA 2PW1B 1GXEA 4E9LA 4ZNEE 1ED3A 1MAML 3W11D 3FHAA 3LKNA 1MFAL 1N26A 5DRWA 1JF1B 2D7TH 3O6FB 1T89A 3D69B 4Y88A 3N1MC 1M6OA 3M8OL 4NFBA 4X7TB 3RNQA 5DLMH 4DN4H 2XACC 1NL0H 4XCFL 4BFEA 2ITCB 2X4OB 3EDJA 4JANA 5HYSB 1RZFH 2YWYA 1UKTA 4I0PA 4ONHB 4P5TA 4PBVC 5E7FA 2QSTA 3D25B 2OP4L 4C56E 3SGEI 1I1FB 5CMAB 2HRLA 1XIWC 1R3HB 5C0GB 3L3DA 1DQLH 4JFZH 3LMJL 5EU3B 4RMSA 5F88A 3PV7A 2YD6A 3NN8B 3MJ7B 4BSVA 1RZGB 1AJ7H 1F4AA 1BZ7B 3HFML 4KJWC 3DVFA 3IDJA 2XOTA 3N1QC 2VYRE 5J12B 3RUGA 1YQVH 4Y5YC 4AEEA 4M61A 4YH6A 2GTWB 2VQTA 4LRNL 1ONQB 1G6RB 3QUMB 4XXDB 1RI8A 4Y19A 1FNFA 2DM2A 3PGFH 3WE6B 1G9NC 4PR5B 2EECA 2OQJA 4X5LA 4PRPA 2YXMA 1S9WB 2XA8L 3KPPA 4IDJL 3PHOA 1RZJH 1DL7H 4HJJL 2I9LA 5KSVB 4OCWH 4U1NA 4BQCA 4FOMA 4CW1A 3HE6C 1NMAH 1ORQB 4PJEE 4Z7VE 1JHLL 5HJ3A 2YUVA 1RUPL 1GOGA 5IMMA 4PGJA 1RAMA 3G5YA 3D3VE 1AGCB 5CILH 3MGOB 4PJ8D 3BP4B 4BA8A 3Q3GA 3T8XA 4UUJB 2FLBT 3GEWB 4NSKA 5DUML 1F4XL 4OJFL 3RGVA 4HGWB 4LSRH 1LEIA 3QQ3A 2YUWA 1IAMA 3L5XL 4U1LB 5MEPA 4Q58C 3BQUB 4WHTA 1F3JA 1KELL 2OR9H 5B3JF 2YA0A 1HNFA 5FKPA 5JA8B 3OJMB 5IW6A 4XVJH 3V4PH 1NBQA 2X4QB 3C6LA 2A9MH 1KJ2A 2D4DA 4YDJB 4NZDA 4U3HA 2W0KA 5GISL 3S96A 2CIKB 3MLXH 5INDA 3N85H 1YQ2A 1L0YA 4O02L 3ZE2F 3VXPB 1GOFA 4JQXC 2HJKA 4OZGF 1M05B 5FK9B 1KPRA 3KYMA 3L3JA 1QBLH 2CIIB 3OR6B 3G08A 5K59E 1UZ6E 3RIAF 2HMIC 32C2A 1JV5B 4IRZH 3RDTA 3CCHB 4AT6A 1SBSL 1R5WB 4FQJH 1NCUA 1PG7H 3ARBD 3IJHB 5TF1H 5F71A 1YJDC 1IAIM 1ZANH 4R90H 1IGIL 1T66C 5FYJD 1N8ZB 5C08A 3FQRB 1FCGA 1AD0B 3KPSB 2HRPH 4Z77A 1Z9LA 2EH7H 3WXWH 3VA2C 4EIZC 4MA3B 5C7XH 4YR6B 3U7AA 1MF2H 3REWA 1WC7A 4KKAC 1CU4H 4H88H 5LBSL 1B0WA 4OCRH 2GKIA 1BJ8A 1MWAL 4FMKA 2O61B 4PJDB 4MWFB 4PG9A 2IANA 2OCFD 5CSGA 3U6RB 3MRQA 5BV7C 5TDPB 3UYRH 2PR4L 2ADJB 5HI3C 4EXKA 3KGRA 1B3JA 4EZMA 3K8KA 4HUKB 5JZ7D 3QUYC 4I0PD 1Z2KA 2VZUA 5IMKA 3TT1L 1TCRA 2Z8SA 3DETD 4HBQA 4MJID 1OW0A 1Q0YL 3S37X 2FJHB 1QOKA 3HE7C 4RBPK 1RD6A 5DMKB 3QIUD 3CXDL 1QLRB 2B1HL 1HXMB 4JY5H 4MGXA 3QFJE 2CLRA 5IHBA 3AREA 5I1KH 1YYLL 4OI7A 2R9HD 5CS7A 3QUXB 1NC4A 1DLHB 1JRHH 3V5DB 3KWWA 5H35B 3WIIL 2X70B 3L3GB 4FQXB 1U0QA 3AUVA 4KKLD 3S4SB 4M8QA 5H8DA 3DGGA 5I74B 1QBML 4YFEA 3X11A 5CSBA 1I85C 1AP2A 5C0JB 4R97C 4BFIB 1H3GA 1RZIA 1D9KB 3N06B 4PRHB 2BRRH 2CGRH 1FLRH 4PRIB 4QRQA 2WWKT 3ZDZF 1P9MC 2W9DL 3GNML 4L4JA 4Y4KD 1I8LA 4K55A 4DZ8A 2ADGA 2OBGA 3GMMA 2WAHA 2R0WL 1KTLB 5K9QG 2NY6D 4H1LH 3KYOB 4HK0B 5L6YH 4MNGA 4JM2F 4TQEL 3QFDB 4L5FL 2ED7A 2D03H 1P69B 4Z0BL 2UY6A 1JWUB 4J8RB 3L95B 4YXLH 1S7XB 4K2UL 2EDRA 3TJHC 3WHXA 1EFXB 3FFCE 2F54A 3AVEA 3CFIC 4L4TB 2DQJL 3WKML 2WBJA 1IAIH 4JDZB 1SJHB 2DMCA 1ZA3B 3TO2A 4QRSA 1IVLA 4Q9CA 1FC2D 4M7KL 1DUYA 1QFUL 4APQB 4RMUA 2JJTA 2EE3A 4WWID 3UMTA 1OGAB 1KXQE 2G5BA 1QYGH 2CPCA 3SN6N 3V0WH 5EC1B 5DJ0A 25C8L 3ALXA 3QNYA 1WTGT 4X0KA 1PX3A 2BVQA 4RISH 5FF6A 5D7JC 5I18H 1VFUA 3M45A 3AY4C 3K74B 4GUPB 2R4RH 3QXVA 1KC5L 2QTEA 3T4AB 4HSQA 3ULSA 5CKAA 4CN6A 1LMKA 5KBNC 5E1AA 1TMCB 3BWUC 4ALAH 1JGLL 5C08D 1JHTB 4A2MA 4Y0GA 5HDBF 4LCCA 2VE6B 4K94L 4PYHA 5C0EA 2G9HB 3C8DA 5D1XC 3ZYZA 3L7EB 5L9DH 4MD0A 1FVCA 5ACZA 3OKNB 2DN7A 1XGRB 3F7PC 5HHME 2CUIA 5I1JH 4H25B 2DM3A 3NCJL 3VE0A 1RY7B 1NUNB 1URLA 5AZEL 1QSFB 1EBAA 5F7DB 3FO0H 4YXHH 4Z7UE 4A6YB 4GG8B 3SKNA 5I0DA 1A21A 2P5WE 2VR9A 3MLUL 5AZ2H 2ZJSL 4M02A 4GG6E 1C12A 3VFMB 3B9KA 3O6LH 3ZL4H 1ZA6A 3CDCA 5BO1H 4CMHC 5CIPH 3DXAE 3ARWA 5D1ZC 1QR1B 4NPYA 1UB5A 1DSFL 5FYKH 2YEZB 2FBJH 4J12A 1D6EA 5CEZD 4IBLT 5FM8A 1RIVH 4P23B 4EI5A 2CUMA 4JREC 1FN4A 1WISA 2C3WA 3HCVB 3NCYP 4NYLB 2JCCB 1IGTA 1Y6KR 2R0LL 3H2WA 4PJGF 3HZYA 1NC4D 2NY2B 1CF8L 4UIKH 5IJKC 3T0ED 4NQED 1KCVL 4GAGL 4QF1A 4PLKD 3VXRB 5LGJB 3VH8A 4OGZA 3MJ9H 5FO9A 5DMGC 3LKPA 3DYMA 4KDTC 3CLEH 1P7QB 1YEGH 1DEEA 3UC0H 3HG1B 5IVNA 3PQYE 3TLRA 3HC3H 4MA8H 1U8QB 5D70H 1T20A 1RZKC 2JB6A 4JGUA 1EX0A 3MV7B 3T3MF 2OJEB 3U7WH 3FN3A 5HHXL 1CGTA 3P9MB 4X9HA 4XBGB 3NIDE 4HKBB 1A6ZB 3NA9L 3EO1A 2V2WB 4QOKA 4LL9A 3KDMA 5E8DL 4JQVA 5T3XH 5K9JH 4UNUA 3FB8A 3PWVA 1KUMA 2GJ6B 3FAXA 3V5KB 3ZDYF 4WFHD 4WFEE 3VMPA 1PKQB 1XEDA 5FGCB 5BRZA 2QSCL 1B4JL 3W0WA 4X99B 4FZ8L 2YK1L 4PY7B 4JHAH 3MA9H 1VFAA 3MBED 2F54D 5IIEB 5IKCB 1EUUA 1CQKA 1HWHB 2WBJD 2P48B 2ZNWA 2P49B 4I0KA 4WUKH 3QH3A 2F8OA 3HNSH 4M6OL 3C5ZA 2F58L 4MNQA 4Z95H 4KH2A 4HIIB 5IQ7L 4D9QE 5KS9E 4UB0H 1EXUA 5D1QD 5GGSY 3HMXH 2ICWA 4OIIL 1R3IH 3O2VH 4RGND 1WEJH 4JRXE 1AHWB 1U9KA 1IAOB 3MZTA 3ZSSA 4KRPC 1U93B 2G75B 3WN5C 1CZ8H 1I3GL 2D7TL 3HZKB 5ALBH 3T65A 4JEGB 4KAQH 1E4KC 3WIFA 4YHZH 2J8UF 1QVOB 4L4VA 4XHJC 3M07A 5DLML 4DN4L 1G7LA 1UJ3A 1NL0L 3O3AB 4XNUH 2O5ZH 2FR4B 4W4OC 3P4NA 1JGUH 1KCRL 3GHBH 5F9AC 5C1MB 3BGFC 4NDMB 5D7SH 3D39E 2WWMD 2FECI 3C60C 3IDGB 3SBWA 4GKSA 1J1XH 1Z9OA 3U36A 5F9OH 3EKCA 3P77B 1DQLL 1KIQB 4JFZL 5BS0E 1LK2B 4PGEA 5INCA 4K7PL 3PF2A 4JZNA 1AJ7L 3EYQC 2Q76B 4QCIA 5GGUB 3QXAA 5C09E 5B38B 2XPGA 2VLMD 2VXQH 1YQVL 1NCNA 2DLFH 4CL7A 1UADC 5I1HH 4K3DL 5F3HA 2VXUH 4YHOH 5HGGS 2ZCKH 3H0TA 5JMRA 3DGCR 5LAXA 3I6GA 3PGFL 1M7DB 3MV01 4GKNA 3PJSA 5IHZB 2ESVE 4U7MA 4EI5D 2GI7A 2HJFA 1RZJL 1DL7L 3VXOB 2WBWB 1L4IA 1BBJA 4NBXB 4ELKB 1ETZA 4ELMF 3O6FC 5JOFA 4PJFF 5CILL 5A2LH 7CGTA 4JRYB 1JK8A 4YUEH 5D9SA 1WAAA 3BIAX 2A0LD 1MCQA 5EU5A 1VEOA 3PP4H 4LCYA 4WO4B 4R6UA 2VSDA 1NKRA 2EDHA 2ORBH 3CVHB 2NY0D 4N0CC 5DYOB 4QRRE 5BZWB 4P4RA 2OR9L 3OKOB 1FNSH 3GBNH 3BPLB 4K71B 1OTTC 5GS3A 4XVJL 3V4PL 3C5JA 2B8OT 1AGDA 1MAKA 5J3HD 1BM3H 3JWOH 4G7YL 3MGTB 3WFEH 3DI3B 2V7HB 3OHXA 2VLLA 3MLXL 5C0BE 4H5SB 5K9OB 4LMQI 5J12C 3N85L 1HEZA 5BRZD 1VDGA 5HYSG 4PLNC 1JZ5A 3C87A 4YPJA 3W0WD 1MCCA 5FGBA 5IHUH 1IL1B 2ZKHH 1CLOH 4YDLB 3HPLB 5GSVA 5BXFA 1QBLL 4U2ZA 4QGTA 2DQEL 3FQNB 2FB4L 4Q9RH 4IRZL 2X4RB 2FX9H 4HZLB 4HWNA 3QPQC 4FQJL 1PG7L 4X6CA 3C5ZD 3BAEH 5TF1L 4FQHB 4IRSB 1ZANL 4R90L 3DUUB 1I7RA 5DD5H 3NA4A 2DJSA 2NYYD 3I50H 1FNEA 2YPKA 5JW4Q 5LJYH 2EH7L 3WXWL 3IVKB 3HZMA 5DMJB 1T1ZB 1MF2L 4MB3A 4EN3A 3DECA 2DAVA 3PGDB 4J23A 1CU4L 4H88L 1U8HB 4OCRL 4GO6B 4DVBA 5IV2B 2I9TB 5MENB 4P2OB 2KKQA 3BMVA 4YFLF 4OGXH 3VFOA 4DKDC 4Z78A 1U8KA 5DQJA 2X4PA 3UYRL 1IMHC 1JYNA 3UTZB 1PDKA 5E6IA 1HSBB 4OD3H 4XPGH 5LGHH 1H8SA 1YN6B 4LEXH 1D3CA 3KXFB 4AQOA 1NUFA 3SJVE 5IB3B 5HPMA 1CCZA 1I1AB 4NZTL 4D2NA 5ISZD 4QTHB 4KXZI 1EHXA 1FYTE 4QWWC 3HAEA 2PN5A 5SWZB 3KPRD 4XNYL 2A6JA 4G6AC 3HUJF 4JY5L 4OZFB 2XQBL 5I1KL 1HSAB 4IMKA 2LABA 3D0LA 4F2MA 1ZVSA 1BJ1J 4JG1L 1YPZF 4F58L 1UXWB 4G5ZL 4ZNEA 1JRHL 4G3YL 2UVFA 4LSPH 1R5IB 2XKNA 1RJZB 3S9DB 1AQKH 4HH9A 1MCEA 1N59B 2XKSA 4JDVB 3MV8B 2O5XH 4EDXA 2VIRA 1JJUA 4GT7A 1NCTA 5TPWH 4MXVF 5I76A 5HVWA 1CFVH 3QDHA 1T4KB 1KCLA 4R7NB 1MCWW 5HHOE 5FDWB 1KB5A 2VITA 1K8IB 1FLRL 2KL6A 3ZYOA 5BW7A 1FDLH 3O6ML 4GW5B 3IFOB 4NWTL 5I1LB 2E7MA 2W0FA 2EXYC 2JE8A 2OTWB 4XHQA 4LDEB 2B39A 3SGJC 5L6YL 1SM3L 4KWUA 5DJ2A 5HPOA 1T03H 1OTUD 1ZHKA 2DWEA 1G84A 3P9LA 2D03L 3C5SB 4TVSa 4UBDC 3R06B 2XZZA 1H15A 1I75A 4OCXH 2XWBA 2YUXA 3E6FB 5JXAH 2FH8A 5F1OB 1IQDB 2ZG3A 4YZFF 3RTQD 4K8RH 3V0VB 3ULUF 3IKKA 4E42A 3H9SE 2AI0H 2VLKB 5KN5B 3CFJB 4WI7A 4K9EC 5J1SC 1HOCA 4U6HA 1FGVH 2RFXA 1U92B 5EOTB 3QUXC 3RZWA 2DQUH 2QSQA 2PYEB 1QYGL 3P40A 4FQXC 3V0WL 5D2NB 5I74C 1F4YH 2HP4A 4RISL 4IMLB 5I18L 4NQCE 4ZO8A 2DLIA 2R4RL 3CH1A 2X6MA 1D9KC 3KPQA 5DF0A 2GSIB 1CTNA 1KTDA 4F7EB 4OSUH 3A6CH 3R0MA 4ALAL 4F7MB 4FXKB 3U7YH 1D5BA 4WNQB 1DZBA 3DRTA 2Q87A 3S4SG 2BZDA 3CSBA 1BLNB 4N8VA 3WFDH 3DX9B 5ICYA 1AE6L 3VFRA 4KJPC 3FQTB 5I1JL 3BP7B 1FVEB 3N1FC 5IFHH 5F70A 4XB8A 1UKQA 4PJAF 3OB0K 1GHFL 4YXHL 3FO0L 1FG9C 5D4QA 5ENWB 4N0FA 3LKSA 4PJ8B 1WFNA 5AZ2L 5T33H 5E6ID 3D0VB 1C16B 5KOVC 3VXSD 3O3BA 4OBSA 2FHBA 3O6LL 1ZS8A 2WLYA 3ZL4L 4HXBH 3V79C 1I7ZB 4GW1B 1F3DJ 4P3CH 1A1NA 4APQC 1MUJB 2FBJL 3IFNH 4POZD 2DWDA 1DTUA 3SE4C 1NGWB 4F33B 1YY8B 2EEDA 1K8DA 3RX7A 3EZ8A 1CXFA 3RI5K 2FBOJ 2NY3D 4HG4K 3W82A 5M94B 1AXSA 4WW2F 1I9JL 3CVHH 3RWDB 2GFBA 4UIKL 2JIXB 3REVA 3KG5A 4PBWD 2C7UA 5DZOA 2L7UA 5FXCH 3UPAA 2KBGA 2FX7L 5CSZA 4KJYA 1R5VB 3MJ9L 1IKFH 4JZJB 4CJ1A 4U1SB 1V3MA 2WLZA 1YEGL 3UC0L 2JK5B 3HC3L 4MA8L 5D70L 4XXCA 1T1XA 2IALA 3O3UN 4MDIA 3UP1A 3IKCB 4MAUH 3U7WL 1FO0B 1A1OB 4WTXA 3IFPA 2CR3A 1ZGLB 4PJ7B 3TIDA 4GXUN 3MRLB 2X1WL 5IW3A 2UZIL 4OF8A 3V5HA 1K5NA 3DX6A 4C56D 4WU5B 4FABH 5IM7B 1TVBA 5K9JL 1KT2A 2BDNH 2DM7A 4KK9C 1ED3B 1DVFA 2D7PA 3LKNB 3VXNA 1CGWA 3MTRA 1KENH 2Y6SC 4HQQH 4YHPA 5DRWB 2WINA 1M6OB 4U0RB 2XXMB 1XGUA 1CDHA 3MA9L 2OR8A 1QPXA 2MCPH 3IT8D 4M4PA 5C6TH 4HFWA 4Y16A 5HI4C 1CFBA 1RVFH 2BOBB 1N2RA 4H0HB 4LLYA 4QNPF 4RRPA 4XX1G 4P23C 4I0PB 4WUKL 4JFFE 4P5TB 3MLSH 4BELD 1MRDH 4LLWA 4Z95L 2EC8A 2GSGA 5D8JH 1DANT 5GS1A 2OSLA 4UB0L 3RWJA 3L3DB 3HMXL 2NY2C 4LU5H 4X80H 1R3IL 3O2VL 3ARGA 1WEJL 4MB5A 5ELIA 5F88B 2K9UA 4OB5H 4ZTPH 5ETUA 1ZHBA 4BSVB 1Q9LA 1R3JA 1AXTL 1CZ8L 4LNRA 4KTEH 4CVZA 3QDGA 5D93B 5CD5C 3IDJB 3D18A 4PJXE 2H8PA 4KAQL 3RUGB 4YHZL 3GIZH 4M61B 2QQQA 4PLJD 5HGBA 3GBLA 4GBXA 5CAYB 4XNUL 2VLJA 4D0CA 2O5ZL 1NMCB 1WZKA 1JGUL 3GHBL 5C9JA 1VERA 2OQJB 1WF5A 3ES6A 2LU7A 4PRPB 4OFPA 5D7SL 1LDSA 3KPPB 3K8MA 5DGQA 3TJEL 3PHOB 5C0RH 5FO8A 3RZCA 5FYLE 1J1XL 2D7OA 2H3NA 4OUOA 5F9OL 4S0TD 4U1NB 3KLHC 4PJ5E 4CW1B 1UWEL 2IBZX 5HJ3B 1AKJA 5EORH 5IMMB 4HLZH 5TDOA 5L7XH 1IGCH 3EFDH 3G5YB 1J0IA 3LSOA 4F9LC 2NY6B 2VR4A 4I0CC 4OKVA 2CDGA 3Q3GB 3T8XB 2IMNA 2VXQL 1NKOA 3OB0H 3KJ6H 2DLFL 2X4SA 1YEDA 4NSKB 1XGYH 2VXUL 3B4NA 4YHOL 2ZCKL 3RGVB 3MREA 1E6JH 2E6PA 3QQ3B 3S34L 1LEIB 5D7LE 5MEPB 1MJ7H 2CUHA 1FRGH 4WHTB 1F3JB 5JIKA 4NC1C 5FKPB 2H2PD 1NH6A 5IB2A 3RVVC 5IMOA 5IW6B 2VKWA 3C6LB 1QSVA 2EDLA 2LU3A 2YRLA 1ZHLA 1KJ2B 3FQXA 1AHWC 3K46A 2F5AH 1XGPA 5E9DE 4M03A 1SBBA 2ZUYA 4KUCF 3S96B 3VFWA 5INDB 4XGZA 5GRYA 5ACMA 5CINH 4F7TA 2AVGA 4YUEL 5FCUH 2HJKB 1SJVA 3Q6FA 4P2QE 1KPRB 3KYMB 3FZUD 3L3JB 4J3WA 3C09B 3G08B 4LSVH 1DJSA 1KLFA 1DBBL 4XC1H 2ORBL 2L0DA 32C2B 2C3XA 5DFWH 3RDTB 2ZNXA 4AT6B 5LXGL 1YPZE 2CRMA 3DXAA 2A74A 5EU6E 5C08B 5JPMA 1BM3L 3JWOL 4NN5C 4Z77B 3WFEL 2ZUQB 4U6XA 3FB6A 5EOQH 5EBGA 1HQ4B 3REWB 4KK6C 1WC7B 3ARUA 3QFJD 3ROOA 1A3RH 1SMAA 1I8KA 4CGTA 4N5ED 5IHUL 3IDXH 4PG9B 2IANB 2ZKHL 1CLOL 2R0ZL 4X6EA 3MRQB 3QUZA 1T7WA 5E2UH 1J8HE 5E2WL 1RIHH 5FFLA 4Q9RL 1NFIA 1KLUA 3ARDA 3T2OA 5B4MD 2FX9L 4M6NL 1CGVA 1II4E 5IMKB 4IIQB 1TCRB 3BAEL 3JVGA 5B38G 2QHLA 4QKXB 4WEMB 1VA9A 5DD5L 4TULL 1KB9K 2BVEA 3I50L 5HI5D 3ARGD 4LHUA 3GRWA 3I6LE 4IEFB 1BJ1H 2CLRB 3AREB 3QDGD 5GS0H 4Q6YA 4N68A 1NC4B 5AUMA 1KFAH 4WO4C 1NC2A 3KWWB 3ME0A 3RVXD 3WJLC 4GBXD 2VLJD 5IBLD 2DICA 3B2VL 4M43H 4M8QB 5IHLB 1X5FA 3V6OC 3DGGB 4OD3L 1IM9D 3BPLC 3VXME 4XPGL 3F7YB 2MQ3A 1W72H 4K71C 3X11B 5LGHL 4LEXL 1T0NA 3LRHA 1A9BA 3FFCD 3DLQR 3IAGC 1FAIL 2EIDA 3P30H 5I71B 1AP2B 1F3RB 5ICZA 1YNTA 2EDKA 2AS5M 1RZIB 1P4BH 4P4KA 5KSBE 4G8IA 4QRQB 2KQMA 2EZ0C 3RHWF 2Q8AH 1U6AH 1NQBA 4LLMA 3BKML 5ICXA 4DZ8B 4MD4A 2ADGB 3GMMB 3QA3A 3MJ8A 2DOCA 4YDLC 2GAZA 4MNGB 2FGWH 1FO0H 4NN7B 2D0FA 3ZKXB 5J57B 2MQCA 4LSUH 3WXVH 5FYJH 2O5XL 3WHXB 4IRSC 4RGOH 3G6AA 2F54B 5TPWL 1FPTH 2WBJB 3CFDA 1CFVL 1CE6A 2D4FA 1EK3A 4JKPH 1S7RA 3TO2B 5JMOC 4QRSB 4LIQH 2BX5A 5EO9A 3I75A 5IROC 1DUYB 3I02A 1Z3GH 3D39A 2J88H 1Q9OA 4OLXH 4OZGA 4LVOB 4P2OC 4WI5A 2G5BB 1P6FA 3U1SH 2EH8H 5CWSA 1T03L 1BFOB 4UQ2A 3VW3L 2C9AA 5DJ0B 3QNYB 5JW4N 4X0KB 2BVQB 4HV8A 5GRZA 5FF6B 5JHDA 4GS7B 1RK1A 2P5WD 5JXAL 1I1AC 3ULSB 5AWNH 4K8RL 4P46D 4M7JH 1WT5A 5E1AB 2AI0L 3DXAD 5K93A 4EOWH 5C0EB 3BEWA 1C5CH 4JQIH 2ESVA 3S36H 4ZUWA 4MD0B 1S8DA 3HI1A 1FVCB 2DQUL 4JHWH 1T7XA 5ACZB 4HXAH 5IBTH 2JELH 4NNYA 1LO3H 3VE0B 3SO5A 3BH8A 4L8CA 2GYSA 5B39A 3MNWA 3QUZD 4XVTH 3SKNB 1F4YL 5I8OH 2OXGA 4HKZA 1G7PA 2E27H 4GMTH 1C12B 3ARDD 4KJQD 5DO2C 5F7NC 1R6VA 3B9KB 1YEFH 4NQXA 1F3DH 4OZFG 4GH7B 4LMQE 1CD1A 4OM1H 3SEPA 3TBTA 4NPYB 4WJ5A 1UB5B 3PQYD 4YQXL 3A6CL 4JN1H 1D6EB 4ZOAA 2X40A 3U7YL 4HBCH 4EI5B 1E4WH 3V7AG 1FN4B 2BSTA 5EZLA 3DMMD 1JNLH 3W11C 1IGTB 4WFGE 1XF4A 5IVOA 4I5BA 3HZYB 2PUQT 5IFHL 4WFED 1NC2D 5C0BA 3MROA 1UM4H 4ODUA 4QF1B 3VH8B 4EVNA 3QHFH 2MKWA 5FO9B 3OMZA 3LKPB 5JOEA 1OP5K 1OSPH 3VWJA 2CKNA 4U33A 4OLYH 1DEEB 4X4ZA 4M3JA 2EDBA 1T20B 2JB6B 4HXBL 1DN2A 1V3KA 5H37G 4OFIA 3X3FH 5IJVA 5FV2A 3SE3C 3LRGA 1CFTA 2LVEA 3EO1B 1FZMA 4QOKB 1UZ8A 1R24A 3KDMB 4JM2A 2ERJC 3GJEA 4D9QD 3FB8B 3PWVB 4WW1A 5D2NC 5F6IB 3P11H 3OBAA 4JRXD 2IG2H 1QEWA 5BRZB 1MY5A 1A7NH 3W0WB 3A0OA 4LVNB 5EDXA 3FFDA 3PHSA 1YYMH 1K3ZA 1IKFL 2HVKA 3SGDI 3WS6C 1MCOH 3RJDA 5FHAH 1VFAB 1DFBL 4FN0A 4XC3H 4JG0H 3L5IA 2EYRA 3MLTA 5F8RC 5J1AA 3QH3B 4HWBH 4Y4FA 4EXPX 3C5ZB 4MNQB 3IETA 4HF5H 4XB7A 3SJVA 3D39D 1RIUH 1EXUB 4FABL 3VDCA 4HPYH 1G7QA 2ICWB 2BDNL 3HC0A 1HYSD 4XP4H 1QPPA 3CNKA 5BS0D 3CC5A 4HQQL 1KENL 4OGYH 4PJ8C 1BHGA 1EEYA 5ERWA 3T65B 3HKFA 3U0WL 5C09D 3WIFB 3PG2A 4AMKH 1JWSA 5CEZH 4L4VB 3RVTD 1G7LB 1UJ3B 2MCPL 5C6TL 3P4NB 1RVFL 3VD3A 3OTTA 1KEMH 3TT3L 2VDRH 3I9GH 1T83C 3NZ8A 3MLSL 1MRDL 3TBWA 1Z9MA 5D8JL 2BCKA 4PJDE 4GKSB 2ESVD 3U36B 1P7HL 1G0YR 2OS7A 1X5JA 1YEJH 5E24E 4PGEB 5INCB 3IDMB 1DQML 4WHYH 3MLRL 4FFYH 4ZTPL 1X5YA 1X6LA 4JZNB 4QRPA 4QCIB 4U2YA 1RHHA 3QXAB 4JZJC 4KTEL 3VI3F 5E2VL 2XPGB 4NJAH 3EO0A 3GIZL 1ZK9A 1CE1H 3MFFA 3O4OB 5F3HB 3ZSTA 3H0TB 1TENA 2IEPA 3ARBC 1GCFA 4ODVH 3I6GB 5LAXB 4GKNB 5FA3A 3PJSB 4X6DF 5C07E 3H9YA 2DB8A 3K4AA 1UA6H 4P9MH 5DJXA 2HJFB 4RAUA 1V3JA 5E5UB 6CGTA 1BBJB 1N4XH 4RFNB 4JKLA 2FDBP 3TVMA 1ETZB 1IKNA 1T89C 1AGFA 2DQCL 3EFDL 5JOFB 4U0RC 5C0BD 5H2BA 3N1GC 1JK8B 5D9SB 1NGPH 3NFSH 2DKMA 5DJAA 2I27N 2P8LA 3KJ6L 5EU5B 3VWJD 3BH9A 4LCYB 5JZ7C 4I0PC 1U58A 5GRVK 1X7QA 2FLRT 1E6JL 4ZSOA 4MB4A 1KN2H 3WS3B 1MIMH 1MJ7L 3DETC 1FRGL 4P4RB 2YPVH 4NQCA 5TF0A 5CBEA 3AS1A 1CG9A 3ALWA 1RUQH 3C5JB 4JM2D 1AGDB 3MRRA 4LLVA 1MFBH 2F5AL 3OHXB 5TFSH 4OZIE 3JXAA 3IU3B 2VLLB 2D31A 1HEZB 1BF8A 3PIQA 4L4TE 5CINL 4L8SA 4NJ9L 1M71A 5I6XB 1ZLVH 5FCUL 4KI5E 3S8WA 1BGXH 5CGMA 1PG7X 1NMCC 4KKLC 5I9QB 1UACH 5MI0B 4QTIH 5BXFB 2IBGA 4ZFOL 1A8JH 1P84J 4LSVL 4XWGH 1DLFH 3IU4H 4XC1L 1OGAE 4Y4FD 3FO9A 4X6CB 4S0SD 2ADFH 5L8KB 3SJVD 1I7RB 3FJTA 2Z92A 3LIZH 1CVRA 4L9LC 4KROD 1P6AB 3LPFA 4Y4KC 1FNEB 2YPKB 2Z93A 1FYTD 4ZO9A 1JI1A 1ZLWH 3D9AH 3HZMB 5EOQL 2NY6C 2Z31A 4DGYH 1CI5A 4EN3B 2J8UA 1MLCA 3STZA 3F5WA 2VDOL 1FJ1A 2VZVA 2XZCH 1FE8H 1A3RL 2OR7A 4PJIF 3EFFA 4DVBB 1GL4B 3TYFA 3IDXL 3VFOB 3RGVC 4Z78B 1U8KB 5DQJB 2X4PB 4MZ3A 5DJZB 3DHJA 1RIHL 2WIIA 2XTJE 2HFGH 5E6IB 2GW5A 1WWAX 5M95B 5T1DL 5GGTH 3C6LC 5FOBA 5HPMB 1JTPA 2CO7B 1IEHA 4GLRI 3D2UD 4MMXC 2W65A 3EJJX 3CSPA 3SCMA 2V6HA 3TFKC 3AROA 3F6IA 3QIBA 3HAEB 5HHOD 2A6JB 4E41E 3V4VL 1QUNA 3GMQA 2AJUH 3RNKB 2MCG1 2IH1A 4KJWD 3MRMA 3CMOH 3D0LB 4F2MB 4Y2DA 1ZVSB 3TH4T 5GS0L 3VD4A 4M8VA 4S1DD 4BZ2H 5KVGH 1KFAL 2YHGA 3C09C 3ZTNH 4QHMA 3TO4A 2XKNB 4OLZL 1IGYA 4HH9B 4CU8A 4M43L 4EDXB 2VIRB 3SOBH 2JCCE 4P59H 4NKQB 4XMLH 1W72L 1AR1D 4HULB 4U1JA 5I76B 2WV3A 3P30L 1JRHI 4FG6D 4BFGA 1PVHA 2ZUQC 4ELMA 4L3CA 1KB5B 2VITB 3H9SD 1BREA 3B9VA 3HE6D 4NZRH 3VXRE 3CIQA 4GRWH 1EGJA 4WI9A 2Q8AL 1U6AL 4UT7H 5F1KC 1XMWA 2EEAA 3WIHH 1JL8A 2W0FB 4OFKA 3MV7E 1GJIA 5DJ2B 4WWKA 2FGWL 2J6EH 1ZHKB 2DWEB 3P9LB 3OAYK 3FL7A 4X4XA 5C8JA 1H15B 3FONA 1GGIH 4LSUL 3RKDD 2EDYA 3WXVL 4IIQC 1LO2L 2XWBB 3I3EA 3VI4F 4G8EA 4ZAKA 4RGOL 4U6VH 3TH2T 3KLSA 3QQ9D 1H3PH 4NQCD 1OW0C 2GJ6E 5D7IE 1FPTL 2UY7A 2KZWA 1PKQE 5FGCE 3NCMA 4JKPL 2AW2A 4LQFL 3R0NA 4LIQL 5J6GA 4QYOA 1HOCB 4U6HB 1JUFA 1VENA 2RFXB 1RJLA 4OLXL 5SX5H 1OAYH 3CD4A 1P4IH 3U1SL 2EH8L 4PLKC 1CD9B 3OR7A 2AXFA 4O2CA 3JTTA 1CVSC 5T5NF 3TCLA 2HN7B 1QZ1A 5IB5A 4BZYA 5I71C 4XAWL 5DWUL 1UVQA 5I1AA 2AGJH 2XZQL 4KVNH 3BMWA 3DVGA 4NO2B 3KPQB 4FTVE 4M7JL 4J4PA 1KTDB 4JY4A 1RZ7H 5LWYH 3CSYA 1N6QH 1I8LC 5D7LA 1D5BB 2X5PA 3ARQA 1GVIA 1C5CL 3DRTB 5DD3H 3S36L 3GSOA 1Q1JH 4N8VB 5C0FA 4NN7C 4JHWL 5ICYB 3VFRB 1VKXA 4NO0D 4HXAL 3ZKXC 5IBTL 3B5HA 2MFNA 2LVCA 1LO3L 5E9DA 1H3TA 3BKCL 4EI6A 4XVTL 4N0FB 5HI3D 3OGOE 3LKSB 3W5NA 3MBEC 1T6WA 5I8OL 5JDJA 2YKLH 3LN4A 5C2BH 1J88A 3OG4B 2WBJC 2K3TA 3FCTA 3O3BB 3F7VA 1ZS8B 3QCUL 2OXHA 4P2QA 4TVPE 1X5IA 4JFEE 3QIWD 4OM1L 1CFNA 1J1OH 1UM5L 4PJBF 3HUJA 4JN1L 1A1NB 2DWDB 3QIBD 5D1QC 4FMFA 1B6DA 4HBCL 4LVOC 1E4WL 1K8DB 4RGNC 2GY5A 1YPZA 2XICA 1JNLL 5EU6A 5GJSH 1AXSB 1NDMB 2WBKA 5DD0H 4BM7A 5JW4R 2QJDA 5CZXD 1OAQH 1HDMA 2GFBB 1N7MH 3REVB 2D0HA 3TO4D 2C7UB 4N0YH 1UM4L 3T3PF 3D85A 2RJMA 4JCMA 3HC4H 4QHUA 1PSKL 2WK2A 2C4FT 4IOIA 4KZDH 5CSZB 4KJYB 3X12A 3CLFH 4YHYB 1HQRA 3RX5A 1YEHH 3V2AR 3MGAA 1OSPL 1TITA 2VDLH 5DVMA 4OLYL 5CEXA 1KGCE 1OWWA 1T1XB 2IALB 4MDIB 1OAKH 1BBDH 2WWMC 4PPTA 5L2KA 3IFPB 1O0VA 2PNDA 4WHCA 5DK3A 4LRIA 3TIDB 1J5OH 4G6FB 4JFFD 4LVEA 4NC0B 4OZHF 5BVPH 3V5HB 1K5NB 2L4OA 3DX6B 1X4XA 1TVBB 1KT2B 1YNLH 5F6HI 4QHNA 2W91A 4FXLA 3V8OA 1DVFB 2V5TA 3BGMA 3P11L 5HVHC 3VXNB 5A2JH 3RX8A 2IG2L 1HINH 3CAFA 4YHPB 1A7NL 4X6DE 2WINB 4UIMA 5I1DA 1UENA 4LGSB 3TJHD 4CDHA 1YYML 3OAYH 4MLIA 1MCOL 1XGUB 2I25N 5FHAL 3DJ9A 3H7BB 3BHBA 1XGQB 4HFWB 3BPCA 4Y16B 4XC3L 1JNJA 4JG0L 1N2RB 4LLYB 4XBEH 4EI5C 4DW2H 1QHOA 4GAFB 5JW4M 5I8KL 3VXMA 2P5EE 5JHLH 4ZFFA 3U4BH 5GS1B 2OSLB 1RIUL 3RWJB 5F96L 5FYLD 3UAJD 4HPYL 1H3UA 4PREA 3ZLQC 1EMTH 3ARGB 4XP4L 3ZO0A 5KSBA 1A3LH 3EHBC 4PJ5D 2Y5EA 5ETUB 5HGDA 1ZHBB 1Q9LB 3FQUA 1R3JB 4OGYL 3UBXA 4LOUD 1NBVH 4LNRB 5DK0A 4CVZB 3QDGB 3KPNA 5DK2A 3EGSA 3D18B 4NM8H 2H8PB 4KTDH 2OL3A 4AMKL 1T3FA 5HGBB 4ISVA 5DSCA 4GBXB 4FA8A 5CLWA 2VLJB 4D0CB 2XYCA 2P4AB 2O26U 4XPBH 1KEML 5C9JB 5HSFA 1OSZA 4YDIL 3ES6B 5D7LD 3FFCB 4JQVC 5J3HC 1KYOJ 3RZCB 1L6ZA 1UC6A 5FO8B 5HD8D 5KZCD 3VH8G 8FABA 2H3NB 3WFHA 5F6IC 1CXLA 1YEJL 4PJAA 5IBUB 4NGHH 4Z7NE 1AKJB 4FFYL 5TDOB 5E9DD 4UINL 4CVXA 5ESQA 4XNMA 4M1CD 3KXFE 4YE4H 3LSOB 1P2CA 4OKVB 1IT9H 2CDGB 3T1FA 3OF6A 3T0VA 2NY5H 4NJAL 2X4SB 3EYFA 4X83A 1YEDB 4P2QD 4XMPH 5SWZE 3H42H 5D1ZD 4Z9KB 3MREB 3C5ZC 4ODVL 1A14H 3UPRA 3MOAL 2PF6A 3NTCL 1A7QL 5IB2B 3CFCH 3E2HB 1UA6L 4P9ML 4OFYA 4WW2A 5IMOB 1HHHA 4JO4H 3O2WH 1NAMA 1ZHLB 3FQXB 1N4XL 3V7AE 2PTTA 5EU6D 1MJUH 2H2SD 1XGPB 5HDQH 1EAPA 3H8NA 1XCTA 3VFWB 2DRUA 2GIYA 1WVZA 4XGZB 3E0GA 5FYKU 2APXA 3LRSA 4F7TB 3RIFF 3NFSL 4E5XA 1ZWIB 4G43A 3Q6FB 3Q5YA 2DQGL 4WI8A 1SVCP 1KN2L 4WRLA 2NW3A 5EA0H 3SBWC 5L2KD 4M9PA 5D6DA 4YHKL 4R4BA 1HHKA 4LF3A 1OB1B 3DXAB 2A74B 1RUQL 2W9EH 5JPMB 4G8FA 4OQTA 4DKEL 1IGJA 1MFBL 4U6XB 3FB6B 3CJJA 5LG1A 5CJQH 1OCWH 3I6LD 1P7KA 3ROOB 1I8KB 4TUOA 4YDKH 3O4OC 2VLKE 3ULUD 1BGXL 3LEXA 1UACL 4X6EB 4QTIL 5J6HA 3QUZB 4Y5VA 3PABA 2NZIA 3QQ4A 1DLFL 3IU4L 5B3NA 1NFIB 1KLUB 3ARDB 3DX7A 4H8WH 3RFZC 2PYEE 2E5EA 1MOEA 3VXMD 4JFPA 2X05A 4GW4A 2ADFL 4RFNC 3PQYB 5KSAD 3SDAA 4CVWA 5HYIA 3LIZL 5D2NE 3P2TA 4YEFA 1T22A 5B21A 4NKDB 5KVFH 4LHUB 2A6IA 3D9AL 4D0DA 4KRPD 3QWOA 4NRXA 2BMKA 1X5LA 4PB0H 4DGYL 4EKXA 1MPAH 1OTUC 2CKBA 4KU1A 1PAMA 1EBPA 2XZCL 1FE8L 5AUMB 1T04A 4XHJD 1GZPA 1NC2B 1EEUA 4RZCA 2VH5H 4NBZB 5BCAA 2BOCA 5LKNA 5IQ9A 4X9FA 1FFNA 3NMEA 1T0NB 1A9BB 5GGTL 4L8BA 3IDIA 4NC2B 3SKMA 3VWKD 3W39B 5ICZB 1YNTB 5I73B 3L9RA 3MRFA 4P4KB 4WVRA 5CBAB 4ZUUA 4LLMB 5ICXB 3WBDA 2R8SH 2AJUL 2HT4D 4MD4B 5FGBC 2GTZA 3QA3B 2SEBA 3MJ8B 3GJFA 3HI5H 5I9QC 1UEYA 3W9EA 5MI0C 2GAZB 1O5DT 3VFSA 4BZ2L 5KVGL 3ZTNL 1QFOA 2DI7A 4LLQA 1MHCA 3UTQA 4LVHC 4OF6A 3MSPA 1HILA 1Z9SA 3BIKA 5FGRA 5A16A 3G6AB 3SOBL 4P59L 2P44B 4XMLL 1KPVA 4X7EC 3CFDB 3CPLA 4OV6F 4EDWH 1CE6B 5FM5M 1JGVH 2X4TA 1S7RB 1W8OA 4NZRL 5EO9B 4G9FE 4HX1A 4WFFE 3FRPA 4UT7L 3I02B 3T0AA 5KSUA 3D39B 3IGAA 1Q9OB 1OT1A 5IB4A 4OZGB 4KMTL 4WENB 1KG0A 5CWSB 4MX7A 1BIIB 4UQ2B 3H3BC 4PJ7E 5E6IC 5DJCA 1OQXA 4HV8B 1GGIL 5DVLA 5D96B 5JHDB 2H1PH 1FNHA 1ZLSH 5DDHA 1RK1B 3TA3A 1HHJA 1ZLUH 4OCSH 4U6VL 4ZS7H 3NIGF 1J10A 1H3PL 2DJ4A 1IC7H 1QQDA 1MRFH 1HH6A 5J7CC 3L7FA 4HIEB 4LFHG 4YJZL 5EFIA 3T3PE 3L6FA 3UJJH 3IB4A 1B9ZA 3NABH 4R9HA 5IT2H 1FZKA 3BEWB 4IMKC 2ESVB 4X4MA 4ZUWB 1S8DB 3HI1B 5E99L 1CDBA 2M8XA 1G7JA 1P4IL 4WFGD 4NNYB 3SDDA 1LNUA 1S78C 3BH8B 4L8CB 4FFVD 5B39B 2XG4A 3MNWB 4BSJA 4M62H 2Q6WA 3HAEG 4HKZB 1G7PB 1XZ0A 3KLDA 4JKWA 2DBLL 1T2JA 5IFAH 2AGJL 3S3PA 3O0RH 4KVNL 4OI8A 1JTOA 4D9LL 3TBTB 3VG0H 4WJ5B 3SDAD 5BW7C 5D7KE 3BXNA 1JHKH 5LWYL 1BZ9A 4RWYH 2EXWD 1YNKH 3MODH 4HAGA 5E7BA 3WD5H 3VFUA 2BSTB 3RUGE 5EZLB 4LDLB 1Q1JL 2EDQA 2VB5A 4IHOA 3T0WA 3HS0A 3MRKA 5FUZH 2UUDK 1XF4B 4I5BB 1HXYA 4Y19E 5C0BB 3MROB 4ODUB 4PRPE 3VXTA 3BQUD 3G5ZA 4EVNB 3DPBA 4ORZC 3G5VA 4K23L 3VXUE 4J3TA 1F58H 2XQYK 4XH2A 2B4CH 3VWJB 3VFGL 1CDUA 1EO8H 2LU4A 3O8XA 1A6PA 5CJOH 3LVEA 5TE7H 1J1OL 1LP9E 5I16A 2ZUUA 2EKSA 3DARA 3RIAK 5IJVB 3UDWA 2FYYA 1CFTB 3JBG7 1FZMB 1UZ8B 1R24B 3HNTH 4JM2B 4EUPA 3GJEB 2BVYA 2AJZA 5DR5H 4WW1B 4F8QA 5DD0L 4HWEH 4FZEH 4JRWA 1N7ML 1FSKB 1QEWB 2UWEF 4OM0L 1HYRC 1LO4H 4PLJC 5HY9A 3HC4L 5EH1A 4KZDL 3FFDB 3CLFL 2HVKB 3NIFE 1YEHL 1DBAH 3ZHLA 1J87A 2GHWB 2VDLL 3AXLA 2W9LA 4AJ0A 4LLUA 3SE8L 3QI9D 5ACLA 2EYRB 3MLTB 5EUOE 5J1AB 1BBDL 2HTKD 1R3LA 2IPUK 4Y4FB 1J5OL 3DROA 3IETB 5BVPL 5IVXF 4PY8I 3SJVB 4H8WC 4RNRA 2ZG2A 5EB9A 1TTFA 3ARFD 1YNLL 5AYQA 3HC0B 1FYTB 1PQZA 4LPYA 4E41A 3CC5B 4P3WA 2XV6B 2E6QA 2Z35A 4UBDD 1S9YB 1EEYB 5ERWB 1S9VA 3RVWD 1MFNA 4MAYA 1XCQA 3B9AA 3QEQA 1JWSB 1AIFB 3WEXB 4YX2H 4N8VG 3ZT6A 4JHZA 3UPCA 5DI8A 4YHMH 1EEZA 4Y8AA 3NZ8B 4F15C 3TBWB 1FV1A 1Q94A 4W4NA 4DJMA 3KAAA 2BCKB 2Y06H 5C07D 4PD4J 2IANE 4BJLA 4TTDC 1IAKA 3LD8B 5HGAA 4PGBA 5SX4I 4KRMB 5HHOB 4IDLA 1EMTL 1MHPL 1A3LL 5EU4A 2B7DT 4FQXD 3SDDD 1MHHA 2XIDA 4QRPB 5DA4A 1NBVL 4GMSH 1RHHB 3V4UH 4YHYC 4HGKC 1A6WH 1CDYA 3O4LE 3FZUC 1BOYA 2FEDC 4NM8L 5AG8A 4KTDL 2Y1VA 1QRNA 3EO0B 1FIGH 4XXCC 4Z76A 3MFFB 4XVSH 3LOWA 4KDVA 4XPBL 2J7LA 3JWNC 1YECL 5FA3B 3C2AH 5CLTA 5HHQA 2AJYH 4UAOB 4IS6A 2F15A 5D7IA 2R2HA 2X1QA 1JNHA 3RY4A 4RAUB 3QCVH 2BXZA 1FNGA 3WNOA 3QQNA 4NGHL 2AERT 3MA7A 1AGFB 3JTSA 5EBLA 4N5EC 1W2KT 4YE4L 2NPLX 1EFXD 5H2BB 2VDPH 4L4TD 1IT9L 3QAZB 1WFOA 3ZKMD 2NY5L 2P8LB 4Y16C 3OKKA 4KI5D 3AB0C 3PXHA 5FHBL 2MTPA 3BH9B 3FB5A 3O8XD 4XMPL 1MSPA 5B4MC 3H42L 1X7QB 3LEVH 5TGBA 1LE5A 4ZSOB 3UEZA 1A14L 2IWGA 2NQCA 3BE1H 4NQCB 5GS1C 4HIXH 1OGAD 4OF3A 5CBEB 3CFCL 1V7NH 1Q72H 4MNGE 3X13A 1CG9B 4RX4A 2R2EA 5HI5C 2OTUA 3ARGC 4FTVA 3RU8H 3BUTA 3MRRB 4LLVB 3LB6D 1MJUL 1B2WL 5HDQL 1JWMA 4DAGL 3GMLA 2D31B 2W0LA 5DEFA 4RRPG 3O3DB 4QT5A 3QRGH 5EU7E 2YRPA 1FBIH 4L8SB 3RVXC 1M71B 4GBXC 4PV8A 1KXTB 2BY3A 1KCSH 5IBLC 1A7PH 1LO0L 4WV1A 3ZT7A 2FWOA 3AMKA 4OCNC 3GUTA 3AAZA 2XTJD 5EA0L 4I2XA 1KEGH 4QY8A 5I8CA 1NPUA 3WL9A 4JFEA 3PNWB 2W9EL 2B20A 1XGTA 2Z93B 2WNGA 5HVGB 5GJTH 1U42A 5HYQA 2Z31B 1OTSD 4E41D 3AS2A 1LK3H 2Y7QA 3ULVE 2PW2A 1OCWL 1T7VA 2J8UB 1MLCB 5HHVL 3STZB 3F5WB 3GSRA 3NFPA 4YDKL 1U3YA 5J0BA 4N9OB 3TYFB 4PV9A 1MWAA 5FEBA 4MCZA 1Y18A 2WIIB 4QXUH 5IBUG 2BJML 3CGTA 4LKXA 3F58L 5FOBB 5J56B 15C8H 2W1NA 1QFHA 5TDNB 2W65B 3VGFA 4XCNA 2NY2D 3CX2A 3QIBB 3O11A 3EYUH 2LE9A 5KVFL 1HH9A 3VXRD 1BEYH 3GMQB 4PB0L 2HKFH 3KLAA 2IH1B 4R7DA 1MPAL 3MRMB 1LO5A 2P43B 3GMOA 4Y2DB 1P7QD 2DQIH 3U48A 3SQOL 4NWUH 4DQOH 4QHMB 3MV7D 4XNQA 3TO4B 3X14A 4AEIH 2GUOA 2VH5L 1IGYB 1P53A 3L3IA 3NAAH 1GRWA 4X6DA 3MACH 1BIHA 4M5YH 4P46C 5T5FH 3GFUA 4CAGA 3IXTA 2H32H 1CICD 4AEHH 2I07A 4U1JB 1EHNA 4KZEH 1X4YA 1XIWA 2GJ6D 2UZYB 2IPKA 5A1AA 2R29H 4ELMB 4L3CB 3KLHD 1L7TH 3O81A 1FORH 2P5EA 2R8SL 4KKNA 3TIEA 2P24A 1PLGH 1Y6MR 3LZFL 3RVUD 3QB7C 3T77A 1ROWA 3QUZC 4WWKB 4JO3H 3SDXF 4Y5YA 5ESVA 1I3RB 4X4XB 5C8JB 4YEEA 3ARDC 5GZNC 3FONB 2OZ4H 4QOKE 3JVGC 4LAQL 4G8EB 4ZAKB 5EG6C 2CRIA 5EUKA 4PJXB 1UCBH 1SJEA 1G1YA 4OT1H 4EDWL 3MX0A 1JGVL 4FTVD 4WIQA 2X9YA 5J6GB 4HPOH 1F2QA 1KNOA 3UJTH 1JUFB 1SJXA 1RJLB 4NKOA 5CEYA 3SGEH 4HWZA 2PTUA 4J1UA 5T1MA 5ID1A 2XZAH 4KTYA 2R2CA 2DD8H 3L5WA 3GSNH 1JF5A 2AXFB 2I24N 3OR7B 4O2CB 4KV5E 2VDKH 4MNQE 4XCEA 3TCLB 5I30H 2WQ8A 1NSNH 2H1PL 5IB5B 4KY1L 3TPUA 4RFOH 5FECA 5GRWA 4LHUG 5KOMC 4DK3A 3HR5A 5I1AB 1UVQB 1SY6A 1MFEH 1IC7L 2BERA 3G5XA 1MRFL 3DVGB 4TVPD 3S36X 4JFED 4JY4B 3T0XA 3CSYB 5D7LB 3UJJL 2A73A 3BW9A 4PS4H 4ZFGH 3NABL 4HD9A 1BQLH 5KZCB 4PGCA 5IT2L 5IP4A 1E4JA 1AD9A 1YY9D 4PJIA 4L4VE 3GSOB 5C0FB 1VKXB 4JQXA 4L29A 2DLGA 5HYFA 2AK4A 5E9DB 2OI9B 2CK0H 1YMHA 5ANMA 4M62L 3LN4B 3FCTB 5IFAL 3F7VB 4P2QB 3AMLA 3O0RL 1LDPH 4G42A 1JCKA 3CU1A 3VG0L 1VACA 1CFNB 5EWIH 1MRCH 3HUJB 1ZT1A 3L3OA 3CFEA 4RWYL 5DVOA 4GKZA 3BGAA 3GSUA 4Y4HA 1YNKL 3WD5L 2ICCA 1YPZB 4WGVB 3Q0HA 5CUSH 5EU6B 3VRLF 5FUZL 1HDMB 4WO4D 1A7RH 4XPFL 3ZKNC 2ED9A 5EN2A 1NJ9A 1S5IH 1T21A 5C0CA 3D85B 3LAFA 2HAZA 4QHUB 1O7SA 4IOIB 3RVTC 3X12B 1F58L 1HQRB 2EDNA 2B4CL 3ARYA 1MJJA 4UT9H 4I3RH 2XQYG 1WT5C 4NQTA 2Y07H 5CEXB 1EO8L 4O9HH 5CJOL 2VL5A 1OAUL 3PWJA 4PUBH 1J1PH 5L2KB 5FA4A 2B5IB 3HE7A 2DYPA 5GGRA 1BVLA 1WAAE 1RUMH 4YGVA 4BH8A 4RFEA 2P5ED 3MRJA 2MMXA 5E00A 3HNTL 1S3KH 5DR5L 3ARXA 4QHNB 5J06A 2O5YH 4NRYA 4HWEL 4ENED 3BGMB 4FZEL 1I1RA 3VD5A 3TWCH 4U1IA 2Z8RA 1J9CT 2HYMA 1JYWA 4UIMB 5I1DB 2CK2A 4PFEA 4IRSD 5DRZA 2GJZA 3VRIA 3G9AB 4C55A 1DBAL 1QD0A 1B6UA 3P73A 3BHBB 5CP3A 1RUKH 2RBLA 3BPCB 2IADA 3LN9A 2CDFA 4K7PY 3SKOA 4CVUA 2X42A 4MXQC 1P9MA 3VXMB 3QXTA 2IPUG 5B39G 3BJ91 4ZFFB 1JFQH 5SWQA 3VDBA 5KSAB 5FYJU 1D6VH 5BV7H 1ZMYA 3TYGL 4P2OD 5FUOH 4DZBA 2DTML 1ERNA 1RHFA 4PREB 3NVQA 5KSBB 1S5HA 1PD6A 3GSXA 4D9RE 5HGDB 3FQUB 3CK0H 4GQPH 2AK1H 3UBXB 3EJZD 1BAFH 3ARTA 4X6CE 5DK0B 3INUH 3KPNB 3EGSB 2VZ3A 3VWJC 3KXFD 1TJGH 2VISA 2OL3B 1X5ZA 1MCFA 1T3FB 4ISVB 4QXGL 5DSCB 1ZHNB 4WCYH 2XWTA 1Q0XH 2ZUWA 4YX2L 5SWZD 4IJ3B 4QXTA 7FABL 4YHML 5CFHA 5LGKA 1N6UA 1OSZB 1P1ZA 1CS6A 2YXFA 4JM2C 4ORGA 2Y06L 5J8OA 4NQUA 8FABB 3WFHB 2B1AH 5M7QA 3DVIA 1OAZH 4G9FA 5D2LF 3PWUA 4CVXB 5ESQB 4XNMB 1WBXA 3V4UL 1WZ1H 3TGXA 1A6WL 1P2CB 4U49A 3T1FB 1C8PA 3MNVA 3B9DA 3AY4A 5HTSA 5DO2D 4F7PA 4LCWA 1FIGL 3EYFB 1UWXK 4WHDA 2YC1A 2NZ9D 4S1QH 1YC8A 2HKHH 4Y4FC 1S9XA 4Z7WF 3KJ4B 2ZSVA 4U1HA 3EOBA 3KHQA 3QULA 3UPRB 3C2AL 3JSSA 1UXSA 1NAKL 4DOHE 4J3OC 4Y4HD 2AJYL 4ZMAT 4WW2B 1HHHB 3QCVL 1NAMB 4RMWA 3JZ7A 1TVDA 2LAGB 2PTTB 3GO1H 1EAPB 5A3ID 2I26N 43CAA 1XCTB 4FXGA 1FIEA 3UTTE 4ZOBA 4N0RA 3WSQH 3LRSB 2F9BT 2VDPL 3K0WA 1INEH 5E03A 3LKRA 1NCWH 1FH5H 2VLKD 4W68A 3LEVL 2PKDA 4FNLH 3P0YL 1J86A 4OZHA 5FYLH 3BZFA 3BVNA 3MZGB 1D5IH 3F12A 3BE1L 2XY1A 3MUHL 4HIXL 5ADOH 2AQ2A 2DYPD 4LHJB 3DO7A 4R4BB 3LD8C 2PYED 4YNYA 4LF3B 5AD0A 3RU8L 2UV3A 4Z7OE 1IGJB 3EDDA 4MS8C 4UQ3A 5IJKA 5IGXH 3ESVF 4S1DC 3B3IA 3KVQA 1P7KB 1A02N 1FBIL 3VJ6A 1QFWL 4NQDE 1MJ8L 4TUOB 2ZZUT 1KCSL 5E2TH 3MRCA 1A7PL 4KGLA 3LEXB 4DGIH 1IC1A 5J6HB 4FFWD 4Y5VB 3PABB 1AR1C 2ZOKA 3EOAA 4MLSA 4R4NC 3VXUA 3DX7B 4UAOC 1YEEH 4LPCA 4FG6C 4G6JH 4ZDHA 3FB7A 4I4WA 4JFPB 2ZCLH 5I75B 5EIQA 3SDAB 1RK0A 2HWZL 4DUXA 3TN0A 1LP9A 1LD9A 3BRGC 2WUCL 1T22B 2R0KH 5GJTL 2A6IB 4FRWA 4D0DB 3QWOB 4NRXB 2BMKB 1LK3L 3QAZC 2CKBB 4ZUVA 1RULH 4MJ5A 1G1CA 3K3QA 3RKDC 3G6DH 1T04B 1GZPB 2CQVA 2C4FU 4M7ZB 4RZCB 2OJZH 2ZOLA 3DURA 5JOPD 3QQ9C 1U8OA 2BOCB 1JPSH 4LPVA 4QXUL 2NY4D 3DX8A 4JO2H 3NPSB 5IQ9B 1FFQA 3RWIA 3OAZK 1FFNB 1EDQA 4F37F 4L8BB 3IDIB 1JPTH 43C9A 2ZG1A 3SKMB 2LAAA 4YBLB 2R1XB 3L9RB 4I3SH 4LPUA 5EUOA 3MRFB 2JIXD 3DO3A 4FS0A 3ZT5A 3DYPA 4ZUUB 4G9FD 1IEBB 1F90L 1BEYL 4L8SC 4WFFD 3R1GH 2GTZB 5D71H 1RZKH 2SEBB 3UO1H 3GJFB 4BQBA 1A64A 1VGEH 4LSQH 3W9EB 4HUVA 4ZUTA 2DQIL 3VFSB 4I18A 4WEBH 1H8NA 4DQOL 2CJUH 4LLQB 2V9TA 4AEIL 1JZ6A 1MHCB 3UTQB 2H26A 4FQ2H 5JA9A 3NAAL 3ESUF 1HILB 3BIKB 3MACL 3R4DA 4M5YL 1P4LA 5A16B 2GK0A 5T5FL 1QG3A 4AEHL 1KPVB 1JZ8A 2BNRA 2AEPH 3MOQA 1JN6A 4O4YH 3QI9B 4CRPA 4KZEL 1IQWH 3CPLB 3QJFA 4FQCH 2X4TB 2R29L 3P4LA 2AABH 4TOYH 3MCLH 2Z31C 4HX1B 3UZVB 3VD9A 1FORL 5KSUB 3IGAB 5MP6H 2ATPA 3ARFB 5IB4B 1CWVA 1PLGL 1CIDA 1N0LA 1KG0B 4NT6A 1WV7T 1CLZL 4MX7B 4JO3L 5ILTH 1FL5A 4H1LA 3JV6A 4FQLL 2YBRA 5DJCB 3L3HA 4P5TD 2OZ4L 3O4LA 3Q2CA 3TA3B 5DDHB 1HHJB 3QIWC 1NFDF 2YZ1A 4NBYB 3TH3T 1UCBL 2AJXH 1QQDB 1HH6B 4PJ9A 4OT1L 3QIBC 4X4YA 4NUGH 5EFIB 3O45A 4HPOL 3FO1A 3L6FB 1ZKAA 3GMNA 5D7KD 3HTLX 3OKYA 1FZKB 3AU1A 5C07B 3EZJB 4Y2DC 4HMEA 5CZXC 2DMBA 2CMRH 2BHZA 3ARVA 1KIPA 3TO4C 1G7JB 2DD8L 3GSNL 3SDDB 1LNUB 2AKRA 4OCYH 2BXYA 4Y19D 4K3JH 2VDKL 2QV2A 4JLRA 1P5UA 3CVIH 5KVMC 1X6NA 2BSRA 1A7OL 2I5YH 4PRPD 2Q6WB 5I30L 1WFTA 3K7UA 1NSNL 1XZ0B 1UGNA 4RFOL 3VXUD 4W6YB 5BVJB 1NEZA 1MFEL 4N0UA 3GJFK 1W8NA 1YN7A 2XXCB 4TUKH 3BXNB 4L3EA 1BZ9B 3MUY1 5DHVH 3TN0D 2P8PA 3QDGE 3BDYH 2VAAA 4ZFGL 1BQLL 1CK0H 1KLGA 4YDVA 3VFUB 1YEIH 1SQ2N 4WWKC 4IHOB 1WWCA 1T1WA 2BRQA 2VLJE 3HS0B 3MRKB 1A6UH 4UV4H 1G9NL 1HXYB 3RGVD 4OZIB 1TJIH 4GKOA 4RMTA 1BFVH 2OLDA 4ZAKC 1FVDA 1LHZA 3G5ZB 3QRFM 3G5VB 4XH2B 4NCC1 1J0KA 1NGQH 3OGCA 4R96A 1U8NA 3C6LD 1AGBA 3O8XB 5J9PA 1LDPL 4QLRA 3F8UB 5EWIL 5I16B 3QDJA 2EKSB 3TFKD 5CIPA 2N1KA 1KTRL 3NOIA 1ADQH 1MI5E 2FYYB 4XPHH 4PJHF 3UAJC 5DVNA 2CRYA 1BX2B 1A6VH 1RURH 3HI6H 4EUPB 2NXZD 2AJZB 4Z18A 4X5WA 1ULVA 1K6QH 4LOUC 4KVCH 3VFNA 1SY6L 1KXVC 1S5IL 3RDTD 2DQFA 3RAJH 5HY9B 3UTPE 5TQ0H 1RFDL 3NCCB 1J0HA 3KR3H 5BOPA 4OQTH 4OTXH 3PL6A 4UT9L 4I3RL 2EDTA 1ZEAH 3MJ9A 3AXLB 1A6AA 3UTSA 3I3BA 4LLUB 4O9HL 4YHNB 4PUBL 4O2EA 5F7LB 5E94A 3MRIA 1J1PL 2HH0H 2XTJB 5HD8C 3ARSA 1R3LB 3ELAT 2VDMH 3DROB 4PB9H 2X4NA 1G6RH 3QDAA 4ZUSB 3QUMH 1RUML 4RNRB 5IG7A 1S3KL 1M05A 4PG2C 2IAND 3Q6GH 2O5YL 2QSVA 4M1CC 5C0IA 1PQZB 4YFLI 3VRJA 4E41B 2DQDH 3EW3B 3PWPE 1MCBA 1YJDL 2Z35B 4GQ9L 3TWCL 4D94A 3EYOA 3BDBA 4ONGL 1S9VB 2GT9A 1XCQB 4MAYB 3O4LD 4W6XB 3QEQB 5MERA 3FOMA 4DN3L 4RDQF 3LKOA 3DSFL 4KKCD 4HIJB 1RUKL 1AD0A 4PJ9D 1WIPA 2ADIA 1IGFH 2MSPA 4GOSA 5DHXB 5DI8B 1EEZB 3PUCA 1G9MH 4PGDB 3LQAC 5E8PA 3ARED 4RBPH 4UV7H 1JFQL 3V9FA 3MUGA 1D6VL 2H2SC 5BV7L 3U0TB 1IAKB 3NFNA 5FUOL 5IUSA 5HGAB 4PGBB 2DDQH 4KXZH 3HMXA 5EU4B 3THMH 4MQSB 2YSSA 2Q3AA 3CK0L 2AK1L 1BAFL 2BNQE 3QZWA 4JFOA 3D1MC 5E5MA 3INUL 3QO1B 3SDYH 3ARPA 3DUSB 2VAJA 1QRNB 4TRPH 4Z76B 4S11A 4WCYL 1OLLA 4B7LA 2XTLA 2VXVH 2A1WH 2B5IC 4G9DA 3RP1A 3BPOC 4LRIC 5DMKA 4QRTA 3QP3A 3H3KA 4LPXA 2YWZA 1CICB 3TZVA 5F44A 1G7MA 4LIQE 5HHQB 2QBWA 1GC1C 3BSZH 4IS6B 4AEFA 4CU6A 5D7IB 2R2HB 1AXIB 1JNHB 4M6AA 3GI8H 3QUXA 2B1AL 1CT8A 1L9NA 1FNGB 3SKJL 2X70A 1OAZL 3L3GA 4XP1H 2Q86A 3MA7B 4KRNA 4KGJA 1V8HA 3JTSB 5EBLB 3ULUC 3ZE0F 1YUHA 1WZ1L 4OUUA 1QBBA 3MOBH 5T1KA 3STLA 1T6VN 3OKKB 3FB5B 1R0AH 1DBJH 4S1QL 5TGBB 4PRIA 1FGNH 3ZE1F 2O93L 4A2LA 3BDXA 1NANI 2VLRA 5KSAC 2Y4SA 1TETH 2PTVA 1F45A 3X13B 2R2EB 2OTUB 4FTVB 4HCRH 2NLJA 1YEKH 4MA7H 2UWEA 4MD5A 5B3JE 3GO1L 1JWUA 1UEMA 1OT2A 1PEZA 2V9QA 3GMLB 5DEFB 4QT5B 3ULVD 2EO1A 4I1NB 1TDQA 2AJVH 4G6MH 3VMOA 3UBXI 1INEL 1N0XH 4PV8B 2WUBH 4GRWF 4HS8H 1NCWL 1S9KC 4K9EH 1FH5L 3PL6D 4IJ3C 4WV1B 1RZFL 3ZE2E 2FWOB 4G6KH 4Y1AE 4FNLL 4DWHA 5F7EH 5IVXA 3GUTB 2N56A 4LASH 3AAZB 4OZGE 1D5IL 3VWKC 1JIBA 3TESA 4I2XB 3UBXG 5ADOL 4QY8B 5I8CB 3BZEA 3WL9B 4JFEB 3ABZA 4NHUA 2RIKA 1JPST 1ZVHA 5SV3A 1Q9WA 1XGTB 2C4XA 4JVUA 4UDTA 2HT4C 3RWFA 5J13B 3GBMH 5JHDE 5HYQB 5DHYA 2Y7QB 2YR3A 5IGXL 2PW2B 3B9KD 3QT2A 3G6JF 3GSRB 3NFPB 1J0JA 5CGYD 1UFUA 5E2TL 4PV9B 1F11A 3O2DH 5FV1L 3MRGA 1MWAB 3KJ4C 4MCZB 1Y18B 2QKIA 4OLUH 4LLAA 2PCPA 4G8GE 2DQTH 4WW2C 4LKXB 5C2UB 1L6XA 4G6JL 4OCWL 1QSEE 2E7CA 2ZCLL 3GZKA 1NMAL 2BSED 2F53A 4XCNB 1VHPA 4QEGA 1J8KA 1ZSDA 5HHNA 3O11B 3EHBD 2MWCA 1WWWX 1KF9B 1HH9B 1MCJA 3G04A 3KLAB 5T3ZH 4R7DB 1LO5B 4QXWA 3GMOB 3F7QA 4G7VH 1RULL 4XNQB 3IAQA 4LSRL 3X14B 3M17A 3QXDA 2OJZL 2GUOB 3L3IB 4X6DB 5D6DC 1JPSL 4MZ2A 4JO2L 5IB1A 3FRUA 3IXTB 4QOKD 3WV0A 2I07B 2A9ML 1JPTL 3B2UD 1XIWB 1TTGA 3RY5A 5EBMB 5F3BA 4TSCH 2IPKB 1OP3K 5TE4H 4WTZG 4I3SL 1SHMA 5C6PB 1INQA 1N5AA 2P5EB 4AYFA 3TIEB 3R1GL 2P24B 5JXEA 5HYJA 5D71L 1RZKL 1XF3A 3PE9A 3T77B 1VGEL 4LSQL 4FFVC 3ZDZE 5T1KD 4Y5YB 4WEBL 4Y5VC 5ESVB 2CJUL 2PXYA 4FQ2L 4JFQA 4MNQD 2VWEC 5I75C 5EUKB 1T2QH 2D9CA 3RBSA 3SDAC 1SJEB 2R4SH 4A6YH 2XA3A 2FIKA 1IGMH 2HRPL 3QJHA 4O4YL 3RRQA 3WHE0 2EXWC 1IQWL 1TCMA 1ZAGA 4M1GH 4FQCL 5C7XL 4KKBD 4TOYL 2AABL 4HC1H 1KNOB 1LVEA 1OD9A 5FB8A 1G9MC 1KJMA 5CEYB 4NKOB 5MP6L 4HWZB 3TBVA 4EJ1C 4F9LA 3T1WA 4J1UB 4L4VD 1CXIA 5T1MB 5ID1B 3DOSA 1CN4A 2FZ3A 3L5WB 4DUVA 2VKXA 3BQUC 4ONFH 2LTQB 5A2IH 3V6ZA 4LHQB 4FP8H 3NPSC 4XCEB 3PHQA 3P4OA 3EAKA 1FLTX 2OP4H 4RA3A 2ED8A 3TPUB 5FECB 1UQSA 2P46B 3HR5B 4YBLC 3BEVA 2AJXL 3G5XB 4UU9A 2Z8WC 4NP4H 4NUGL 2E6JA 1U93A 2A73B 2G75A 3BW9B 4ACPA 3S3JA 4PGCB 4PJIB 1AD9B 4W70A 3ROLA 2FECL 5A2KH 2CMRL 1BWMA 5HDBE 3BKJH 4L29B 1XR8A 3QHZH 1QO3A 2AK4B 1FQ9C 3HB3D 4K3JL 4GFTB 1QKZH 1AC0A 1YMHB 3MXWH 5ANMB 3UTTA 1AQDA 3A67H 3CVIL 2I5YL 2XA8H 4EBQH 4IDJH 3QI9C 2M2DA 1F8TH 2HTKC 2BRRL 2CGRL 3FO2A 3ZHDA 4N1HB 1CGUA 3ETBF 1VACB 1JPFA 2RGSA 2X44D 1JHLH 1ZT1B 1RUPH 3L3OB 3CFEB 4TUKL 4QRPE 4GKZB 3GSUB 4Y4HB 3ARFC 3IYLW 2FJFA 5ALCH 4P99A 4LP4A 3KPLA 1PZUB 4UV4L 3I85A 2C1PA 4HUUA 4AM0A 4YXLL 5EN2B 1NJ9B 3RVWC 1T21B 1ES0A 1TJIL 3L5XH 3TA3C 5C0CB 1BFVL 3K1DA 1MCRA 4PJGE 1K4CA 4NQDA 3SKUD 1IAIL 5CJ8A 4AH2A 3FRPG 1MJJB 2WP3T 1N6VA 2AP2A 3DBXA 1UKSA 2VL5B 4TUJA 5DJYA 3PWJB 4F57H 5FA4B 4TSAH 2DYPB 4XPHL 5GGRB 1BVLB 1OP3H 4JN2A 4YGVB 3S6CA 4HFUH 4BH8B 3MRJB 1JGEA 5E00B 1RURL 3HI6L 3SDXA 2CLVA 3T3ME 3SDDC 5JXED 2H9GA 4GSDH 1K6QL 4NRYB 1O7VA 4ZSOE 4Z0XA 4R26H 4UZGA 3H3PH 1ZT7A 4HMCA 4D9RD 4U1IB 2HLAA 4TVPH 5E8OA 1F2XK 3RAJL 1CDGA 2PXYD 3V6OA 3ZDYE 5DRZB 1YMMA 3VRIB 1IGIH 3CFBA 3X3GH 2Y25A 3P73B 1ZEAL 3QNZA 4G80A 2FEEI 5C9KA 1OOAA 3I3DA 3GSWA 2IADB 4R97B 2D3VA 4WU7A 1GPOH 5B8CA 2CDFB 2V7HA 2HH0L 3SPVA 1NMBH 1S7UA 2VDML 4EN3D 5L9DL 1G6RL 1EHAA 5EZIH 5SWQB 4B41A 3QUML 4LFHD 3RBGA 1DBMH 4YXKH 4DZBB 4PRNA 3Q6GL 2QL1A 1S5HB 3GSXB 2PR4H 2X1XR 4PJEF 4Z7VF 2DQDL 5DRNA 5C70A 1WZMA 3ZKMC 4KI5C 4XAKE 3TT1H 3E6HA 3TCXA 5BO1L 3O8XC 2FIRT 2VISB 1OP9A 2EIZA 2P7TA 3CX5K 2XWTB 5FYKL 4HUMB 1GIGH 3B9EA 3UDWC 3UZEA 2NY4B 1RIVL 1IGFL 3CXDH 4ODTH 4JO1H 2J8UE 1P1ZB 5DZNA 4ORGB 4UV7L 1XR9A 1ND0A 3LB6C 2GQHA 2ZP0T 4J2XA 2NXYD 3WIIH 2DDQL 2Z0BA 2DLEA 4IRJA 2APBA 4G9FB 3THML 3PWUB 1S78D 3UTZA 1WBXB 2MHAA 5EIIA 2KUTA 1GAFH 2BVUA 3UTTD 3CLEL 3SDYL 3T08A 3MNVB 4F7PB 4HIHA 4LCWB 4TRPL 2EDEA 4NQSA 4H26A 4UT6H 2YC1B 4EUPG 2XTJC 2VXVL 2A1WL 1S9XB 1IEAB 2JJSA 3T4YA 2W9DH 4U1HB 5K59F 3EOBB 3WMSA 3QULB 5LQBH 1UXSB 5T3XL 3JWDC 5GGQH 4KUZH 2NTFA 3GI8L 3BESR 1H3VA 4L5FH 1OTSC 4MQTB 2V9RA 1EA9C 4XP1L 3OV6A 4FXGB 2JF1A 5A43C 4Y7MA 4MAYC 3OXSA 3RNQB 4JHAL 5C0AE 2MJWA 4JHBA 4CKVX 1JMXA 3MOBL 3QWRA 3LKRB 3E1F1 4P2RA 4NQDD 1J05A 4ELME 4JANB 3BWAA 4I8DA 4RQQA 3U0PA 4PJFE 1R0AL 1DBJL 3HNSL 5DGRA 4DTGH 5MEOA 1FGNL 3BZFB 3BVNB 4J7RA 1S7SA 1ZOXA 4UOW1 3F12B 3WYRA 4JPKH 4K3GA 3MJGX 4JREB 3DO7B 3L1OH 3P4MA 4FQ1H 5AD0B 1I4FA 2VC2H 1JZ7A 1X5GA 4HCRL 5EO0A 1YEKL 4L8DA 3O3EA 2HT2D 4MA7L 3RY6C 3U30B 4V2CB 1HK6A 5ALBL 1U41A 1U8MA 2EDOA 5C0ND 4UQ3B 4POUB 3B3IB 5JIPA 4CN1A 3VJ6B 4G6ML 3V0VA 1N0XL 1NBYA 1IFHH 2WUBL 4HS8L 3MRCB 1CDIA 4K9EL 4OZFH 3DWTA 4Y19B 5IWLA 1WIUA 4PRDA 3ZTJG 1CICC 1FYHB 4G6KL 1PKOA 2ZOKB 1X9QA 3EOAB 2VZOA 4K94H 4NQVA 5F7EL 4ZFOA 3VXUB 4LASL 1PY9A 4J3SA 3RQ3A 2I9LB 1QFWI 4M6MH 1WQVT 1NCAH 3FB7B 4I4WB 4YWGH 4ZDHB 1F6LL 1RUAH 3H9ZA 5E5RB 1RK0B 3TN0B 1LP9B 1LD9B 2F74A 1TPXB 1MI5A 3ALPA 4ONOA 3GBML 1TVHA 3RVUC 3MLUH 1KIRA 2JJWA 2ZJSH 4M48H 4ZUVB 5I17A 2FATH 4LBEA 5IVZA 1OPGH 4MJ5B 5I1HL 1D5XA 3WS6A 3O2DL 3TNMA 1F6AA 9CGTA 5GGVY 3DURB 1U8OB 2YD9A 5H37H 3DX8B 4ZXBA 3RWIB 4QHKI 2EE2A 43C9B 3AS3A 3OJVC 3T0BA 4TTDD 4OV5A 5D2LA 5EUOB 4MSWA 2MQ0A 1KCVH 5L2JA 4IRJD 2ZPKH 1IZKA 1OY3B 5E08H 1EO7A 5T3ZL 2NXZB 1ZGLM 3AS0A 1OVZA 1QLEH 4G7VL 4MJ6A 2FEDD 4HUVB 4WV1C 1NGYA 4ZUTB 3PP4L 3GM0A 2ZUXA 4I18B 3HUJE 4Z7WA 3QNXA 5HHXH 1INDH 3PWPA 5D5MF 2DJUA 2H26B 3HA0A 4DUWA 1FNSL 1GGCH 3P9WB 4LDOB 4G6FD 1P4LB 2GK0B 3GBNL 5JDSA 2X09A 1T83A 2HA1A 1YY8A 2BC4A 2WW8A 3BGFB 3WFZA 3SGDH 2BNRB 1T7YA 1YC7A 1JN6B 2R39A 1EZVX 4I13B 3QJFB 1W72A 3IFLH 4TSCL 4I9WD 5TE4L 1DVFD 3KPTA 2Q20A 4MHHI 5J13C 1YY9C 2QSCH 1A7BA 4MXVE 3K4ZA 3FHQA 4FZ8H 2R1YA 3QG6A 4C4KT 4O5LH 1XF5A 3AM8C 3OAUH 2FD6H 4V1DE 4NT6B 2BVPA 3VFPA 5AEAA 1KULA 3QWRD 3KYKH 5DC9B 4C59B 4MHHG 4Y16D 1CXEA 2F5BH 4H1LB 5L2KE 3JV6B 4UTBH 2YBRB 1PZ5A 1FO0A 1A1OA 1F97A 3ARBA 2BNQA 4Z7UF 3O4LB 5F1SA 1SEQH 4DKAA 4GRLA 1T2QL 4OZ4A 4OFVA 4WU5A 4GG6F 4LQ1A 2A77H 2R4SL 4A6YL 1ACYH 1IGML 4PJ9B 1G0XA 1OGTA 1U2HA 4X4YB 5K9KA 1VEPA 2B0SH 4M1GL 4YC2B 3WNMA 2W60A 3O45B 3BD5A 4HC1L 3FO1B 4YZFE 3GMNB 1I3GH 5CCKH 4BK5A 3AU1B 3ULUE 3B83A 4PRBA 2DM4A 1FCCA 1KIPB 4OGXL 4F80A 1QR4A 3ZZ1A 3UX9B 3K8LA 2D7MA 2AKRB 5GRXG 4ONFL 3RWHA 2J3SA 1KCRH 2BOBA 4FP8L 2C5DC 1SEBA 4JLRB 2BSRB 5D72H 1MH5A 3RZCD 4MJIA 1NEZB 4N0UB 4U31A 1DBKH 3OZ9H 1YN7B 2J8OA 3QIUA 4K7PH 2BK8A 4NP4L 1AKJD 4L3EB 3QPXH 2P8PB 2V7NA 4EQ2A 3B8YA 2VAAB 1J0YA 3C6SA 3QCTH 1MI5D 3ET9F 1KLGB 4YDVB 5CZVH 3FT2A 3NIDF 3OJ2C 1NUDA 3EIFA 1DDHA 4ENEC 4F3FA 1T1WB 4LSPL 3BKJL 3PV6A 4K3DH 1AQKL 1MELA 3QHZL 4LEOA 1X5AA 4HKXA 4M1DH 5EPMA 4GAJH 1QKZL 3MXWL 2VUOA 1FVDB 3QO0A 1WWBX 2WIMA 1ZE3C 3A67L 3T2PA 1MFCH 2AQ1A 2ILLA 4EBQL 3RIFK 3UTPD 4ZXBD 5KAQF 2NY7H 3OGCB 1QBAA 4R96B 4ZFZA 1U8NB 2BHYA 4PJAE 1AGBB 3WKNA 1F8TL 5J9PB 3QG7H 2Z9TA 1NGXA 4PP2A 1CR9H 1MNUH 4L9LA 2DMKA 3OKDA 3QDJB 1FDLL 4Y1AA 4Y4KA 5CIPB 3GMRA 5JLZA 5DC0A 1D5ZA 2OK0H 4J3VA 5ALCL 3WLWC 1REIA 5KS9F 2LTQC 4X5WB 1N5YH 1QLFA 3EJZC 3OKLA 4X6BA 5I66A 3VFNB 4OCXL 3OKMA 5GS0D 1M7IA 3WNLA 4Q6IA 3PWPD 5ITFA 1PEWA 2DQFB 4AIOA 2ICWJ 5E70A 3BIBX 1I8IA 3PL6B 5MEQA 1BVKA 3HPJA 3UTSB 1A6AB 2E8YA 2VN7A 2X4UA 1CQYA 2QHRH