3O8XD

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xD02
1MWAB 3EFDH 5HGBB 1HXMB 2F54E 3HR5A 4NM4L 3VFTA 4JDVA 2IFFH 1K4CB 5I6XC 4M00A 1T0NB 2MTPA 3TT1L 1GOGA 1NUGA 4BFGA 1OGTA 1T7VA 2P8MA 5JW4R 1P7KB 4Z0BL 5FFLA 4OLWL 4KXZH 1VGEL 2BVPB 3TGXA 4ZTPL 3P4LA 3DV4B 1GGIL 1WZKA 1PY4A 2I24N 3ARFC 3QUXA 4PBXA 3TT3L 5B21A 4O2EB 5LBSH 5DK2B 4F33A 3HR6A 3EOBA 3L3OA 3HNTH 1DZBA 4PLKD 5DD6A 3RKPA 4Y4HC 1LP9F 4PRNB 3DBXA 4DUXA 4LSUH 4CL7A 2R0WH 1BPVA 3F65A 1CK0L 4ODWB 1R5WB 3CPLB 2VH5H 1I8IB 3QUYA 1FE8L 1AKJA 4N0RA 3DMMA 2ILLA 3OAUL 4X6CA 4ZS7H 5CZVL 4RQQB 5EC2B 5J9PB 4MQSB 3IDMB 4YO0A 3BKYH 2IH3B 4XCCH 3RU8H 4G6FD 2W65B 5I9QC 3HZVB 2EKJA 4XCEA 2DLHA 4YFDB 3K2UH 5IV2B 4FTVE 1I8KB 1B0RA 1JGEA 3HC4L 4LGPB 3DUSB 3QFDA 5EZLA 1L0YA 4X4ZA 2IPUK 5I66B 4ISVB 3HFML 5I1HL 5D1QA 2WLYA 2UUDH 3DNKA 1TQCB 4JFHD 1YEDA 2O5ZH 2CXGA 2Q7YA 3VXTB 4YBQD 5J3HD 2Q76A 2FEDD 4QTIL 1ZA6A 3G5YA 3WUWB 3RWDA 1IGCH 3IYLW 1T1XA 3PIQA 5BMFH 2B0SL 4KROB 1RHFA 5DZNA 2Q7NA 4NC2B 1BQUA 1EGJA 4NM4H 3QQ9C 3VI3E 4AEEA 1U58A 3QRGL 3ZTJG 5C0BA 4YBLC 1J86A 3TT1H 4EOWL 4O9HH 3PNWA 2GHWB 4Z0BH 4OLWH 2I5YL 3X14A 5D2LF 1DN0B 1VGEH 4P46D 4ZTPH 5IMOA 5JR1L 1GGIH 3O4LE 5ICYA 3K8MA 2EO1A 1RULL 2NY7L 4NQCD 4W4OC 4YHNA 3R8BB 2HT4C 4U7MA 4PJBE 1CK0H 1ZVSA 2YRZA 1FE8H 1QO3A 5HJ3B 3VG9B 3LCYA 3OAUH 4U6HB 4G6JL 5CZVH 2KQMA 2FJFA 1MCRA 3MRMA 2H45A 1BM3L 3F7PC 2EYSB 5CFHA 4HIEA 4N5EC 3ZE0F 4WV1B 4M1DL 2B1AL 2VXVL 3NVQA 4N90E 3EHBC 3HC4H 4P2QD 5HPMB 3RPIA 4PRDA 3H3BC 1YMHA 2ZUUA 4L4VE 1QBBA 4QTHB 5KZCB 4XAKD 5C0RL 4L3AA 1KXQE 2QKIB 3HFMH 4ZYKB 4UIKL 2X4TB 2EIZA 3W9EA 2JF1A 2XQYG 1F97A 2GAZB 4MJIE 1JRHL 2EXWC 2DQIH 2WMPA 1F2XK 2ZSVA 4IJ3C 4L3EA 4QTIH 1YPZB 5ERWA 1I1YA 4KJQD 4PRBA 2DAVA 3QIBA 4BA8A 2B0SH 3OG6B 4OF8A 5KSVA 1AGBB 4LCUA 5CWSB 4QCIA 4OZFH 3FT4A 1A6AA 4OZ4B 1F3DH 2FSEB 3QRGH 4OCYL 3MRQB 3OHXA 1OF2A 1IQDB 1HHGB 4EOWH 4OIAA 5HHOE 3QXDA 2I5YH 4NOBA 1QFWM 5BXFB 3P2TA 2EDXA 1ONQB 5JR1H 1LK2B 3VRJA 2UWEB 4GQPH 4G42B 4J3UA 2KPNA 1RULH 2NY7H 4MD4A 1BJ8A 2IBZY 3VFOA 4TQEL 4FS0A 4KJYA 3DV6A 3JTSB 4GKZB 3HNVL 4KROD 2YPVL 3WJLC 4DZBA 4ZFOB 4M5ZL 1HKLL 4Z7VB 4G6JH 4PRPB 3CC5B 2IJ0C 1CCZA 4LKCA 1BM3H 3N1MC 4M7KL 4YHML 3FRUB 3SDCB 4M1DH 2B1AH 2VXVH 1J7VR 5DI8B 1B4RA 3U0PB 1MHHB 2QSVA 3UPAA 4CNIA 3BP6A 4LSQL 1C8PA 3S97C 1BJ1H 1FL5B 3VXOA 4EUPH 5C0RH 3O8XC 3VA6A 2E8ZA 3O0RL 4UIKH 3WUWG 2WM0A 5D7IF 3LKNA 1JRHH 5DMYA 1Q72L 3VW3L 2VOTA 5EB9A 2MQ0A 2CDEB 3BRDA 3LD8B 1GPOL 4NQTA 5J0BA 4LVHB 3MGOB 3ARBA 4C83B 1HSAB 4RBPK 3HPJA 2VAAA 3CXHK 4PGCB 4Z7WA 2BC4A 4X5WB 2HTLD 1MQ8A 3RUGB 4B53A 4JQXC 1AI1L 4OCYH 4PJXA 4R4BA 3V5HA 1GOHA 5KZCD 3MSPA 3DO7A 1PJ9A 5I75C 1OW0A 3DX9A 4WEBL 2AQ1A 5T3XE 1I8MB 2P44B 3QWRA 3RDTB 5JW3L 3BKJL 3BWAA 1I4FB 2FIKA 2D4FA 3TYFA 1CG9A 3OQ3B 1XGUA 4PGEA 4WFHE 5FB8B 4TQEH 4XCNB 3HS0B 3VD5A 2J88L 4MD5A 4I18A 2H9GB 4NUJA 1U9KA 3HNVH 2YPVH 4XX1G 4QOKD 5TJWK 3SGEI 4DJMA 3W39B 1HKLH 1YEIL 4WW2B 1C08A 2F58L 3MV8E 2GJ6E 4DWHA 2ENSA 2JK5B 4M7KH 2CLRA 4YHMH 1F11A 3MRRA 5KOMC 1A1MA 1AXIB 4N68A 3EBAA 1W0YT 3SBWC 1RIUH 5FYKU 4LSQH 2XT1B 4NN5C 1MCEA 4QGYA 4X7EC 3RZWA 2Z92B 5DJYB 1UWXH 3VG0L 5GZNC 4FN0A 1DR9A 3O0RH 5J3HC 3IU4L 1NGWB 5TFSH 4LCCA 2FEDC 2Z93A 4RFOL 5DD5L 5GS1A 3VA2C 5GGSY 1U3YA 3VW3H 1Q72H 3H0TB 4R4ND 4HFWB 3KPMA 4WHTA 1GPOH 1LEKA 3BGMA 4PRPD 2UVEA 5I30L 2EDEA 1KYOJ 4K3JL 4J3OC 3SDCD 1X5JA 3FQWA 1KIRB 4ELKA 3BPLC 1EHNA 4KUCF 4X80L 1HDMB 1UG9A 1UKTA 5SV3A 1AI1H 5EU3B 3FKUS 3S96A 5C9JA 4P46C 4HAGA 3HAEB 4XNUL 4ZS6D 2HJKA 2H32H 2YKLL 3D3VA 4G6ML 4GBXB 4JJ5B 4KRMB 4WEBH 3BDBA 4RRPA 2NY3B 1YJDC 3ULVF 3PWVB 1OP3H 5JW3H 1NCTA 4KV5E 3HTLX 3BKJH 5J56B 2XZQL 2VZVA 5GRVK 3L1OL 2IAMC 1YY8A 1TDQA 4XBEL 3CX5K 4PTUB 4JPIA 1I7UB 4KI5C 4U1GC 5F9AC 5IHBA 3P4OA 4GW4B 2KL6A 2XTJE 1U91B 2LTQB 2GUOA 1AD0B 2I9LA 5CIPH 1YEIH 2BNRB 2NY5L 3TV3L 3QAZB 3VGBA 2F58H 2JCCE 4P2RB 1DE4A 4OLZL 1T1WA 2JTDA 4ODUB 3IDGB 4GG6E 5J1AA 2BXZA 4HUUB 2WQ8A 1EVUA 2GK0B 3FO1B 3OX8B 4BM7A 4Q9BA 2FR4B 4OFYD 3P0GB 5C09E 3RDTD 4JLRB 2ESVE 3E6FA 1Q0XL 3CDCA 3VG0H 5FO8A 1CFNB 1JWMB 4RFOH 5DD5H 2C1OB 5HYJE 3G5VB 2DWDA 2BHUA 1MVUB 1JGUH 4NRXB 1YNLL 3T09A 3I6KA 3BH8B 2BSSB 3OKDB 5I30H 3VXMB 4K3JH 4NHUB 3FJTA 1TNMA 4YHPA 2YUXA 5DEGB 2VABA 4DOHB 1R24B 2I07A 3HMXA 4I2XA 4X80H 2YC1B 1IZJA 4KHXL 1HN1A 2D0GA 5IB4A 1KJ3L 5GS2H 3BDXA 1F4AA 4IOFD 4U7KA 1FZKB 4XNUH 4G6MH 2YKLH 3ARGC 5I1GL 1TQCC 1BMGA 1KV3A 3X12B 5K59E 5M95B 3GJEB 4JPVL 2XZQH 4Z5RA 1DUYB 1EPFA 3BP5B 3H2WA 1DCLA 3L1OH 1NJ9A 4XBEH 5D70L 5IVXA 5E8OB 4LRNL 1KN2L 4JQVA 5T1KA 3UTTB 4CN1A 4PJDF 3CFBA 5KAQF 2BMKA 2XYCA 1M7DA 3FO9B 2P47B 2NY5H 3FONA 3TV3H 1XGQA 4MHHG 4X7FC 3QDJB 5FA4A 4OLZH 1IVLA 5IK3A 3C2AL 3QDAA 4ZODA 1CICA 4MAUL 4OUUB 4ELMA 1OTTD 4GBXD 3WIFB 4BSJA 2ID5A 4PRAA 2NY3D 4X9BA 1N5AB 1TLKA 2G5RA 3T2PA 5MENE 1XF2B 4M4RA 5FHBL 4F9LA 1Q0XH 1N26A 4YPGB 4O5LL 2DQEL 3NFPA 4Y0GA 3FTGB 4HKBB 4YHIB 3VG9C 2ICES 4O58L 3E8UL 3C09B 5FYJE 4U3CA 3PHOA 4NQDB 2AJXL 4G3YL 3DRTB 1IAKA 1YNLH 4JN2A 2VQ1A 5H2BA 2BNRD 3FQTB 4KGLA 4WV1C 4HJ0D 5IB5A 3QNYB 1BZ7A 3EDJA 4V1DA 3U2SB 2HTLC 4TRPL 4K7PL 3V5KB 4P2RD 5FECA 1DBBL 3Q1SL 4WO4A 4CMMA 3HAEG 2O93L 4U49A 4KHXH 3LY6A 2CIKA 3RWJB 1KJ3H 3RWHB 1WK0A 2C7UB 4OKVB 5DJ8B 1LILA 5I1GH 3WXVL 1RD6A 2YMXL 1RK0B 4NCDA 4ZUSA 4JDTL 3AY4C 3SGDI 3Q48A 3HRPA 3E2HB 4JPVH 4TSAL 1HI6A 4PJ7A 5ANME 5D70H 5LJYH 1QLRB 3U4EA 4R0LB 5FK9A 5DQJA 4F7MB 4HUNB 4LRNH 1KN2H 2Y36L 3MXWL 4ZFFA 3VXMD 3PWNA 1NFDB 4Y2DA 1A6WL 3SKMA 1FVCB 1OL0A 3T4YA 5I18L 1JNHA 1QNZL 5I74B 1U8IA 2BY2A 4L3CB 3QXWA 2NZ9D 4WEMB 3WFDL 4MNGA 4CU6A 4J1UB 5ISZE 3C2AH 1KB5L 2HP4A 4MAUH 2QR0B 2NMSA 3L3HA 5IHUL 4D0DA 3GGWB 1DQJA 5CSBA 2XY1A 4GQ9L 2N56A 4A6YA 3MODL 5FHBH 2C1PB 1ZOXA 2YEZB 43CAA 1DQML 4O5LH 4G6AD 4RAVA 2DQEH 4R4NC 5EWIL 4BZ1L 4O58H 3E8UH 1JV5A 4K7FA 5CAYB 1WZLA 4GRWH 3UTTD 3FOMA 1WWWX 2AJXH 3ARXA 1Q38A 4G3YH 3VI4F 2GT9B 4GMSL 3PQYB 2R1WA 2DTML 1J05A 1ZHLB 4YGAB 3SDCC 1J0ZA 3T65A 4F7TA 2P5EE 4TRPH 4K7PH 3QDJD 3VXSE 1G0YR 1DBBH 4NC0B 3Q1SH 4G80B 1T83A 3ILQD 1FNEB 1GZPA 1NAML 2V2WA 1DUZA 3VD3A 5JHDA 3QO1A 1D5XB 3RAJL 3MBEA 4J4PA 1QFWL 3NCYS 1Q0YL 3WXVH 3D9AL 1KJVB 2YMXH 5EPMA 3JV0A 4JDTH 4HHAA 3ZE2F 1JHTB 3BFOA 4TSAH 3LD8C 3GMMB 4NQDD 5DRNA 4LVHC 1TZIB 4CVZB 4FFZH 3IDXL 4K94L 5LKNA 3U6RA 2Y36H 3UPRA 4GXVL 3MXWH 1A21A 1I3RB 2MKLC 3NGBB 4WI9A 4JRYB 3RL2A 1A6WH 2BNUA 1V3KA 2W38A 3MO1A 4NZJA 4O4YL 1XGRA 4I1NB 1QNZH 4MQXD 3G04B 3UYRL 3U83A 3WFDH 5GXBB 4PP1D 1IFHL 2H8PA 1KB5H 4ZPTB 1JP5A 3TN0A 3EO1B 5SWSA 1PVHA 5IHUH 1ZXQA 2AJSL 3C9NA 5CP3H 2HFTA 2KQNA 5GGRB 4KPHL 3R06B 3C6SA 4GQ9H 3TESA 2D03L 3TZVB 1QSEE 2CDGB 3MODH 2X42A 2QJDA 1DQMH 4MNHB 1LNUA 1M05A 3K74B 5EWIH 4BZ1H 2RFXA 5E00B 1K2DB 1X5HA 3G08B 4WW2C 4Q2ZA 5HYIA 2E6QA 3MUJA 4QXTA 3RZCA 4TUKL 2OJEB 3HC3L 3IKCB 3QWOB 1G6RL 4IIQA 3I3EA 4GMSH 1UXWA 2DTMH 4Y4KB 3AGVA 4RFNB 2WBJA 3TBSA 4KRNA 5MI0B 2P48B 5I16A 3UZEA 3SDDD 3MLUL 5H37G 4IOFC 1NAMH 1A9BA 1VEMA 3RAJH 2Q6WA 1QFWH 4NSKB 2WINB 1Q0YH 3ZDZF 3D9AH 2W59A 4CJ1A 3T1FA 4YAQB 4QWWD 5C08A 5HDQL 4YDJB 4LEXL 5C0BE 1CFBA 5EU4A 1CXLA 5JO5B 2PCPB 3RJDA 2W1NA 1P84J 3IDXH 3V6OC 1UH4A 5ETUA 4GXVH 1X5KA 4ZPVB 2ZSWB 5IB2B 2V2XB 1VFUA 4O4YH 5T33L 3GMQA 4P2CG 4LVEA 1IL1B 3RWIB 1SYSA 1S7RB 3ZHDA 2YOCA 3UYRH 4GBXC 5I1LA 1WAAF 1IFHH 1S8DB 4I3SL 2NY3C 2P5WA 1XZ0B 2A74A 2DLIA 3U9UB 3CVHB 3MJ8B 2AJSH 1DDHA 1XR8B 5T3ZD 2D03H 3DURA 3NPSB 4MCZB 5T1LA 1H0DB 2DM3A 3O6LL 1UVQB 5IUSA 1HXYA 2OSLB 1CVSC 2EZ0D 3FQXB 3P73A 4U1JA 2XWBB 2GCYB 3SE4A 4D9RE 4HJ0C 3QAZC 3CMGA 1S7UA 3MRKA 3BP4B 2X4PA 1ED3B 1FC1A 3HC3H 4TUKH 5JZ7D 3OR6B 4MGXA 1G6RH 5E5UB 4WUKL 5GHWL 1SY6L 1BZ9B 2Z8VC 2R2HA 1OWWA 1JPGB 3B9KB 4HAFA 1AE6L 5CHNA 5BQ7B 2OCFD 3D0VB 3VXRB 3QUZA 3MLUH 3N50A 1MCQA 1RQ5A 2VTFA 4L3EE 4NOFA 1FFPB 4FQCL 2ORBL 2DYPA 2DM2A 4DVRL 1H8OA 1L7IL 3TZVD 1Q94A 4HBCL 3VH8B 4P5TB 1A6ZB 2X2YA 2HLAB 3L6FA 5HDQH 4LEXH 4CADA 1HH9B 1UACL 1J8HB 4HIXL 2VZUA 3BH9A 4JHAL 2RGSA 2ICWB 3LN5A 5GRZA 3AREA 4Y4KD 5GSRA 5K9KB 3HLAA 3WEXB 3ELAT 5C0AB 1X7QA 1WCBA 5T33H 3BVNB 3MV7A 4XVSL 3PDOA 4ZQKA 5EU7C 4CW1A 3ZO0A 3JV5A 3W9DA 4ZSOE 1J1OL 4MJ6B 4I3SH 5DT1L 2A73B 4P2QE 4E42B 2VLMD 1R3JB 3ARYA 4JY4A 3WFHB 4I3RL 3IAQA 3AVEA 4G6AC 1S7XA 5BS0B 2MPAL 3O6LH 3C5JA 1EEYA 3EDDA 4P3WA 4OF7A 3TNMA 4PJIF 1VEOA 5D4QA 1IEBA 4RGOH 4HZAA 3CCHB 3ULUD 3S35X 3L3IA 4WUKH 5GHWH 1SY6H 3LKOB 4U1NB 2OL3L 1AD9B 2YUZA 3ARRA 1AE6H 5DJAB 4NO3B 5E8PA 4UBDD 2A6KA 3TJEL 1SQ2N 1TNNA 3MOQA 5K9JL 5D2LB 4ZUVB 2AJYL 1Q9KB 2CH8A 3BT2L 3T3PE 1KJ2A 1KCUL 2ORBH 4FQCH 1FYTA 2VITA 1T1ZB 1MFDL 3FFCB 4EI6B 3QZWA 4JREC 4DVRH 2BVQA 6FABL 5DJ2A 1L7IH 1S7VB 2BZDA 2CJUL 4HBCH 2YA1A 3MRNB 2VLLA 4NCC1 5I2IA 3BEVB 2RJMA 4YBHA 1ZVHA 4PJXE 1UACH 1XCQA 1OAQL 3KLAB 2A9NL 3ARFA 3EO0A 1QVOA 1HQ4B 4GLRI 4JCMA 1A7NH 1VPOL 2Z31B 3B9KD 5EO1A 5C0IB 2GITB 4MQXC 4HKJB 4Y4HA 1LVEA 4PY7B 1BD2A 4PJCA 5FCUL 3VXRD 4PP1C 4X4YA 4XVSH 4Z18A 1A5FL 2Q20A 2BX5A 2R2EB 4Z6AT 1D7FA 2WIIB 5IBLD 1J1OH 4OD3L 4QHKI 5DT1H 5EBLB 2XICA 1KYOK 2ICEB 2VB5A 4I4WA 3E2HC 1T20B 4I3RH 2YHGA 4P5TD 1RJZB 1QA9B 5A43C 1KCLA 1T21A 4R0LC 4XMPH 1KGCD 2GSIA 2MPAH 1KLGB 1J8HD 1MCIA 1EA9C 1UADC 4S1SH 4LLMB 3T1WA 2YA2A 3V79C 3MLWL 3X13B 1I9RL 1TQBC 3MLVL 4QT5A 3V7AG 5EUOA 2BVTA 3NA9L 2OL3H 5IR1A 5BZDB 3F7QA 4TTDC 2APTA 3TJEH 1LEIB 1F6LL 1OAZL 2A9ML 2W0PA 4YPJA 5K9JH 5FKAB 3FB7B 2AJYH 3BT2H 3BI9X 3MRPA 4LLQB 4LU5L 3B5HA 2Q3ZA 4AM0B 5I8EB 1KCUH 3VH8G 1P1ZB 5B22A 4G43B 5IWLC 1MFDH 3U30B 6FABH 2CJUH 1DBML 4QWWC 2FH8A 4PJGA 5BS0D 4U7SA 4P48A 1NLDL 1S9WA 1S7WA 2B4CL 1EO8L 1NCWL 4ZOAA 4QHNB 3LEYL 5JIKA 3LVEA 4JB9H 2A9NH 1NQBA 4R4FL 4DFIA 5EZIL 3C60B 3I75A 2JJSC 3MQIA 1G7PB 1VPOH 4QOKE 4W4OA 5DURB 1QRNB 5SWZB 4KUZL 5FCUH 3KPSA 2IQAB 3QULB 4G9FE 1FZJA 1A5FH 4PJEB 3TC9A 3UPCA 5HHNA 3CXDL 5E5RB 3V6ZA 4M7LT 4DEPB 1P4BL 4AEFA 5E8EA 1CXHA 4OD3H 1TJIH 5E2VL 3GSNB 3LB6D 4HS6A 4JFEB 4U1MB 4GT7A 5JMOC 3LKSB 4UIMB 1PEWA 3VGAB 2EZ0C 2ZCLL 5D7IB 4UDTB 4X6DA 3QJFB 4JZJB 1OT2A 5C0CB 1EEZB 2E9JA 2P4AB 5DA0B 3NGBC 5F89A 5HHPA 4LGSB 5JZ7C 4P4KB 1UCTA 1YNKL 1UEYA 3D5OF 4XBGB 1M6OA 1V3JA 5J06A 2Z31D 3MLWH 3MRHB 1UB5A 3IDUA 3MLVH 3B9DA 5CILL 2OJZL 4PRPE 1V05A 3QIUB 4NQSA 4YIQB 2EKSB 5F8QC 4Y8DC 2ADIB 3B8SA 1XGPA 5MEPB 1FZMA 1YMMA 1ZVYA 3D18A 1OAZH 2A9MH 4TOYL 4U3HA 2KBGA 4LU5H 3TZVC 5IW6B 1A7OL 3GSUB 3QCUL 3W82A 2NX5A 1N8ZA 1CT8B 1DBMH 4G9DA 1TCMA 1C12A 1L7TL 1MLCB 1KPVA 1P7HL 2XV6B 1JZ5A 3EDKA 1NLDH 2B4CH 4I5BA 1EO8H 1XF3B 2VR5A 1NCWH 3DXAB 3LEYH 4Y4KC 4QKXB 4RFNC 4R4FH 5EZIH 5MI0C 4NKIL 4PGZA 3C6LB 4KUZH 3LKPA 3KNBA 4FA8A 4AQOA 3CXDH 4GW1B 3HPLA 3KXFA 3GUTA 1P4BH 3BW9A 3WLWD 3KR3L 3PHSA 1FZOA 3HC0A 5E2VH 3V4VL 2GTZA 3VRLE 4N1HB 2J1KA 1GL4B 2CK0L 3D85B 4X6EA 2AK4E 4FFWD 2AJ3A 2ZCLH 3MJ7A 3TLRA 2OZ4A 5J1SC 4ELME 1QSFA 3FB8B 3C60D 1FJ1B 1YQVL 3HKFA 3ULUC 3JUZA 3Q3GB 1GAFL 1I85C 2BHZA 4LRIC 5JDJA 3AAZA 3O8XA 5ICZB 4OLXL 4A2MA 5DURD 1L9MA 4Y16B 5SWZD 2HT3C 1MCLA 3MR9A 5CILH 4G5ZL 2OJZH 1JNJA 3RIAF 4FHBD 3LHPL 4PG2C 1WBXB 1R3LA 4DKFL 4TNWF 1F6AB 2YS4A 4TOYH 1JYNA 4P9HH 2D7TL 4W4NA 5BW7C 1K4DA 3NPSC 2OS7A 1A7OH 4KDWA 3QCUH 4V1DE 4R7DA 1K8IB 2VNCA 4JQXA 4YC2B 3OKOA 1L7TH 5C0CD 5FYKE 5CJOL 5IEHB 4AH2B 4P4KD 1RSFA 2IBBA 1WWAX 3BPNB 4GXUN 4WCYL 3MRCB 4R96A 4XNMB 4XZUA 5GISL 1WIOA 1LD9A 1TTFA 5D1XB 3B9KC 3JTTA 4C59B 3IJSB 4NKIH 3QIUD 2WBKA 3O3AB 4I0PB 1NFKA 2V7NA 4EDXA 2AV1B 3IXAB 3LEXA 4UUJA 1GZQB 4NNXB 5IBLC 3CFDB 1W8OA 5DRWA 3O3DB 4HWBA 2OK0L 4CBPA 1SEBB 3WO4B 5EBWB 3GFUA 2CKNA 2GTWB 5SX4I 1LO4L 2XWTB 2VQTA 3WLBB 4PLNC 1NMCB 1T1YA 3V4VH 2AEWA 5K9OA 2CK0H 3D0LA 1NH6A 3IFPB 4HH9B 4L4JA 4ONOA 3DXAD 3SBWA 5EIVA 2IEPA 2A6JA 4PJ9B 4UQ3A 5KBNC 3JUYA 4ZNEA 3BZEA 1HCFX 2KUTA 1YQVH 3DI3B 3DIFB 4HUVB 1GAFH 5EC1A 4OLXH 2HN7A 3C6LD 2ZG3A 4G5ZH 1ZLVK 2ADJA 2H6PB 1KNOB 4P2RE 5LGKA 3LHPH 3BE1L 5ESQB 1DVFB 1HEZB 4F7EB 1AGFA 4Y19B 4DKFH 2IF7A 1X5AA 2DBLL 3QHTC 2D7TH 3GSWB 1CE6A 4KXZI 3QG6B 3D85D 2AQ3A 3VDBA 3NN8B 4KY1L 5TQ2L 2LQRA 5T5NF 5CBEB 5F7UA 2EE6A 4KZEH 4JGJA 5CJOH 3QFJE 4K3GA 5E2WL 3VRIA 43C9B 4EQ3A 4WCYH 2E6JA 5DJ6B 3F5WA 5GISH 3RVUD 2R2BA 4Y16D 4NQCA 3CFEB 3KPLA 4KUCD 1AC6A 3O3BB 1LO0L 4NQVA 2IAMA 1AHWA 4RMWA 4Y7MA 5AZ2L 3VD4A 3HMXL 4HIHA 4L8BA 1WZMA 5HGBA 1TCRB 4OFDA 1NKOA 2OK0H 3ULVD 4XHQA 4WDIA 1KEML 4BUHA 1LO4H 1D5BA 4KKCD 3LV3B 3EAKA 1P7KA 5ELIA 2P42B 5HHME 3MA9L 4KK8C 2X6MA 1PFCA 4DVBB 5JOPE 2XQYK 1EHLL 2R0KL 1F2QA 4GG8B 1B0WA 5IVZB 5JLZB 4DKAA 2M1KA 5IQ7L 5D1XD 2Z31C 1E4XL 2D2OA 2XXMB 1BQHB 4PRNA 5F1KC 5TE7L 4I0PD 4Z7OE 4Q6IC 5DHYB 2DM7A 1I8IA 5HYSA 4EVNB 1VADB 4NC1C 4RQQA 5J9PA 3MNWB 1CTNA 3IDMA 3BE1H 3WE6B 2R23B 1J0JA 2W65A 3U36A 2C3GA 4HIJB 1TITA 5C6PB 5IV2A 2OP4L 4XCYB 4XRCA 4BKLB 1ZA3A 2Y5EA 5SX5H 4XI5D 4KY1H 3OXRB 5DJDA 5TQ2H 4BK5A 2I9TA 3T8XB 4K8RL 5I66A 2ITDA 4ISVA 3FFDA 4XHJD 4PJ9D 4JRWA 5E2WH 4F7CB 2GK2A 3ARGA 3AM8C 4R3SB 2Y4SA 1PZ5B 1D5MB 1DEEB 3VXTA 3TA3C 3T0EA 5ACMA 3T0XA 1U8JB 3G6JA 5F72S 3P77B 5TDPB 3U79A 2HAZA 3X11A 1LO0H 3WUWA 1S7TB 2H2SC 1R3HB 5C08E 1DVFD 5DRZA 5AZ2H 1QKZL 3MC0A 5FYKL 3HMXH 4Y19D 4V2CB 5D1ZB 1FHGA 3B2UD 1YECL 3GJFB 4M3JA 1KEMH 3BHBB 4JVUA 1ZANL 2X4OB 3BP7A 4HC1A 1A02N 2P7TB 3CU1A 3MA9H 4Y5XB 3TCLA 4OBSA 3TVMA 3C60C 3C8KB 1EHLH 2R0KH 3N0PB 5IKCB 5KG9B 2P5WE 5DTFB 3OV6A 4K7PX 1E4XH 2ATKB 4ODTL 1LE5B 5C92A 3LQAC 5TE7H 4XH2B 2CKBB 4I3GA 2NY6B 1H8NA 4QRRE 3H8NA 2WAHA 1EK3A 3ZKMD 5HJ3A 4DEPC 2VWEC 1BVZA 1Y0LB 4U6HA 3PGDA 4DW2L 1AH1A 1BVLB 3KDMA 4NKDB 1UWGH 4WV1A 3AS1A 3VGAC 5GGUB 4HCRL 1FFQA 2OP4H 3W5NA 4XC3L 3CSYB 5GJTL 2XIDA 4JY6B 3PF2A 1CQKA 5KAQG 4K8RH 1KPRB 1ZV5A 2YR3A 1RZKC 3WJJC 2X4UB 4WENB 3OB0K 4HBQA 5J12B 5MEOB 4ZYKA 1K5NA 2X4TA 2DJUA 4LLDA 3PDDA 3QH3B 4GRWF 2GAZA 4JO1L 3VFRA 1YPZA 1A4JB 2BDNL 2YWYA 3KWWA 2BK8A 1JNLL 1U3HB 3QPQC 4FMKA 3WHXA 1EHAA 1QKZH 1Z2KA 5FYKH 1MRDL 3M8OL 4LBEB 1AGBA 4WUUE 1UB6B 1S78D 1YECH 2EXYC 3MRQA 1AGDB 2CDFB 1ZANH 1IQDA 4HX1A 4JKWA 3QP3A 1G9EA 4MX7A 3R8QA 3FRPG 2J5LB 2DKMA 4LPYA 1BQHG 4GS7B 4XPGL 3V95A 4PUBL 4I48A 1XF4A 3VCLB 1A3QA 2R1YA 3FO2B 4ODTH 1RI8A 3NCCB 2NTFA 2EEDA 1WEJL 3UZQA 2VDKL 4IHOB 4JANA 2IALA 3VFPB 5GRUH 3O6FB 4PGDB 1JPST 4X8XA 5D1ZD 4KV5F 4DW2H 2JE8A 1WFNA 4XGZA 1CE1L 4N0UB 4EDWH 2CRYA 5ESAA 2OR7A 3JV6A 3FRUA 3K46A 3OXSB 3OTTA 2LVCA 4HCRH 2X05A 5DI8A 2EIBA 4XC3H 3U0PA 3DRQB 5GJTH 1UH3A 1FL5A 4AMKL 4DUVA 1FBIL 5C9KA 4JM2F 1ADQA 5FGBC 3VXUA 4DTGL 1ETZB 1FYTE 4GG6F 3MOAL 3B43A 2JJUA 1DQQB 1BOYA 1RZGA 2IPKB 2NY6D 2GKIA 4JO1H 2J4WL 3KLHC 3WFEL 2CDEA 4FNLL 1QACA 1N0LA 2BDNH 4C83A 1JNLH 3S5LB 1HSAA 4NRZB 1MRDH 3M8OH 4OLEA 4PGCA 3OAZK 1E4JA 4X5WA 3W0WA 4KKCC 1UH2A 3RUGA 4N8CL 3QRFM 3MYZA 3DX6B 4YC2C 1VFOA 5E1HB 3VWJB 5DHVB 1CFVL 2DWEB 4ZFGL 1IC7L 1A9EA 5F7NC 4N9GA 3VXQB 1CTOA 3L7FA 1QD0A 4OUOA 1J87A 5F88A 1IAOA 5D1XC 3EW3B 4HWZB 4X4XA 4XPGH 1PX4A 1I4FA 4PUBH 3UP1A 2QTEA 5HDOA 1TENA 2B20A 3TYGL 4XNZC 1D6VL 4XCNA 2HJLA 3HS0A 1QHPA 1WEJH 2CUHA 1U3HD 3QNZB 1H3XA 4JFFB 2VDKH 2BHYA 3WO4C 5K59F 5GS0L 3W39A 3B9AA 4WW2A 4JRXB 4H26A 3EYFA 4JCLA 1KJMA 5CJXA 1CE1H 3VJ6A 2VDML 4IRJB 3LZFL 3MREB 2APWA 4MMZC 4AJ0A 3V9FA 1P2CA 5EUOE 4XI5C 2FECL 4BSWB 4Z0XA 4XHJC 4PJ9C 5L2JB 4AMKH 3EZ8A 2BRRL 3SGKC 1FBIH 2Z92A 5CJBA 4OFPA 1CDHA 1WFTA 3MZTA 5DF0A 4DTGH 1DL7L 1JTTA 3MOAH 1CZ8L 2UVFA 3TBTB 3MLZL 3GKWL 2BOCB 1QEWB 1S5IL 4PJGE 2G5BB 1R5VB 3TBWB 2J4WH 4GW5B 5JPMB 3WFEH 4FNLH 4HFWA 3O6FD 1XR9B 2A6IB 4QLRA 5DC4B 3V7AE 3P4MB 1G6VK 3CDGA 4WTXA 3V6OA 4M4PA 4ODXB 1C7SA 3L95A 2BY3A 3QUKB 1HDMA 4G8GA 5EU3A 4KDTC 1CFVH 4ZFGH 1IC7H 4ODBD 3MA7B 3HAEA 3KPSE 1LP9E 4GBXA 4JJ5A 4LLUB 4PJIB 2XPGB 1DBAL 1YY9D 1FLRL 4Q7DA 1N2RB 5DWUL 4GAYB 4LOUD 4FABL 1MCCA 1DQDL 4MXQC 1F8TL 4MB4A 2YBRB 1I7UA 3GSVB 3ZKMC 3TYGH 5TH2B 3THML 4BELD 1D6VH 1P4LB 5A1AA 4MAYC 4X6DE 5I8OH 1PW3A 1UM4L 4R6UA 1AD0A 3PV6B 2WW8A 4XPTL 5GS0H 1A6TB 2XN9A 1U8PA 1AY1L 2YUVA 5F3BB 3IT8D 3VWJD 3QO0A 2VDMH 3IDGA 3LZFH 1B3JA 2ZOKB 3K1KC 3B3IA 4HUUA 3MPCA 1VSCA 3P9WB 1YN7B 3BOVA 2QQLL 2Y9RT 2FATL 4OF3A 4L8DA 5BS0E 3OKEB 1VGKB 2H26B 1X4YA 4YDVA 1PQZA 4C56B 1CFNA 1JWMA 1DL7H 1CZ8H 2NX5E 3VWKB 3MLZH 1XF5A 3GKWH 4JFFD 1S5IH 3S5LG 1JCKA 2F15A 4PJ5B 4NRXA 2ZKHL 2C3WA 2APVA 3P40A 2ZP0T 3KLSA 4JRXD 5D9SA 3BH8A 5IHLB 3VXMA 1H9VA 2EE2A 5KVFL 4NHUA 3L5XL 3VFVA 3CDYA 4IRJD 2IGFL 3QI9B 4APQA 3WDHA 3H3KA 1EXUB 1FNAA 1AIFA 1MSPA 4YK4C 5DLML 3BWUC 3MV9A 3FT3B 5CEZE 1FZKA 1HNFA 1KT2B 4L8CB 1C16A 4NN7B 1DBAH 3X12A 3KXFE 1FLRH 2MHAA 5DWUH 4LPTA 1CDUA 4HK3N 4FABH 1DQDH 1DUYA 1F8TH 4IMLB 5GZOC 4F37K 1FL6B 5ALCL 5BZWB 3JSSA 1FQ9C 5E8OA 4L1DA 1LO5B 3HZKA 3THMH 3U46A 2PTVA 4RGNB 2WANA 1FN4B 1ZEAL 4H25A 1UM4H 5GGTA 3QJHA 1A14L 1QSFE 4XPTH 3CUPB 3SKOA 1AY1H 4LPVA 4WRLA 4JY5L 4M5YL 1RUKL 4U0RB 3TNNA 1KEGL 4Y5XC 1HCVA 4OUUA 4LF3A 3KPPA 2W92A 1T03L 4NQXB 2DI8A 2QQLH 2VLKD 3FAXA 3G9AB 5F97E 3BISA 1MHEA 1I3GL 4YPGA 4OV6F 3ZE1E 4HKBA 5C0JA 4DKEL 4GJTB 3BN3B 2FGWL 3D48R 3FL7A 4NQDA 4XNYL 1JK8A 2XRAL 5FM5O 4PRHE 1ORQA 2ZKHH 4OZFB 3FQTA 1IMHC 3OR7B 2NQCA 5C0EA 1YNTA 2P24A 3T2NL 1DEDA 3L5XH 1TVBA 1SM3L 2K7QA 5MEQB 2IGFH 2V7HB 3EIFA 3O81A 4ACPA 3I2CL 5BVJA 4TUOB 2IANB 5DLMH 1GOFA 5I1DA 1B6UA 1JGDB 5IMKB 1AQDA 1E27B 3RWHA 8FABB 4D9QD 4MJ5B 1JF1B 5DJ8A 1HYSD 1WV7T 5J12C 1BWWA 3RHWK 4Q58C 1RK0A 4K3DL 1F00I 1CGYA 4C56D 2W91A 4LDLB 5F7EL 5L0QC 1MFBL 1W0WA 3VWKD 3GNML 3OJMB 2K3TA 1QLRA 5ALCH 4UILH 1U3HC 2BNQA 4PJ5D 2NNAA 4R0LA 4F7MA 5IP4A 5SWZE 2DRUA 5SWQB 4U1LB 5HD8D 1ZEAH 1JHKL 2JB6B 5T5FL 1A14H 1FVCA 2G75B 3QI9D 4ZNEE 4PPTA 1JWSB 2DMKA 4L3CA 5F71A 4J1UA 1CD1A 1KENL 4M5YH 4EUPB 1RUKH 1FNGB 2J5LC 4KRLB 1JI2A 1KEGH 1Z9MA 2QR0A 2VXUL 1T03H 5EBMB 5FF6A 5F1OB 5H94A 4GS7C 5DS8A 3H42L 1R5IA 2XNAA 5HHVL 4Z7UA 3J7HA 3BQUB 4LKXB 2NY1B 3WNMA 4N5UA 2C1PA 1I3GH 2OI9C 4DKEH 3O6FC 4P5MB 4RGND 1QBAA 2FGWH 4OZGE 3QDHA 4XNYH 1MI5A 2XRAH 2ICCA 3SDXE 3QIWD 3PQYA 1ZHLA 2RAMA 4N0CC 3I3DA 2OYPA 5DA4A 3T2NH 2JJSA 1SM3H 4G80A 1FNEA 2BY1A 1F58L 3I2CH 3SE3C 1ZGLP 2MQCA 2DQUL 1F3JA 2F54B 4OF0A 4KI5E 1JGLL 3BUYA 4UDUB 3MFFB 4LOUC 3RWEB 1KJVA 3DTXB 4K3DH 4M6AA 3TBYA 1JHTA 5F7EH 2X4QB 1MFBH 3GNMH 4OD2A 3GMMA 1G7QB 1TZIA 4JFPB 2ZWLT 4NPYA 1SVCP 3MCKB 1GXEA 2HA1A 5CEZL 1REIA 3PP3K 1I3RA 4QRPD 4JRYA 5JIPA 1JHKH 3ES6B 5T5FH 3VWJC 4PG9B 1NLBL 3ESVF 5T1MA 5IBTL 1BQLL 2IAND 1SHMA 1WFOA 1KENH 2R1XB 1NCAL 3EO1A 2VXUH 4HLZG 1FSKB 1HHKA 2F5AL 3H42H 2VISA 5GGRA 1OY3B 5HHVH 3R06A 2OZ4L 3FHQA 4FTVB 3MUY1 1G84A 3QEHA 3BPCA 2CDGA 5FDWA 4LLVB 3PWJB 4MNHA 5L88L 4OZFG 4KKBD 3BIKB 3JWNC 1ZT7B 5JDSB 4P59L 1WBZB 3H9SB 5HI3D 1G7LB 3MRJB 1ZHKA 5EUKB 5MHSD 5JXED 5A16A 4IRJC 4Y4KA 3O3EB 3O2DA 1OTUD 1EZVX 2WSKA 3NCJL 1KBGL 3T0EE 1YA5A 4WFFE 3ULVE 3G6JE 1F58H 4N0YL 5GS3A 1T3FB 1UJTA 4CJ0A 5I1KL 3MJGX 3HUJA 1HIML 2Z8SA 3GSOB 5ADOL 1BBJA 1YC8A 5IIEB 3BQUD 4LHUB 2WINA 5D7JA 2NY1D 2FZ3B 2CLZB 1RJYA 1IM9B 5F44A 1JWUB 4DZ8B 5CD3B 1FGNL 4AT6B 2DDQL 3T3PF 3RWGB 1OQOA 5CIPB 5JO5A 4QHLA 1A22B 3O4LB 2VUYA 3NFNA 4OQTA 5CEZH 3EYOB 2YK1L 4ZPVA 2ZSWA 5IB2A 5D7SH 1F4YL 4Z7WF 1N6QL 5DEFB 4HWBL 5GRYA 2A6DA 4EUPG 4PJBB 1I85A 1IL1A 4LRIA 4WI2A 1I7RA 1TZGL 4PJXF 1NLBH 1S7RA 5IG7A 5IBTH 4QRTB 1BQLH 1NBZB 2AEPL 2F54D 4PYGA 1XMWA 2QLVB 4UAOB 4AIXA 4PG2A 4ONGL 4HIHB 2F5AH 1VACB 1XR8A 2OZ4H 5BW7A 4MCZA 2E9WA 4WGVB 5DFVD 1OP5H 2OSLA 1P7QB 4L4VB 5L88H 4N8VB 1HH6A 3FB5B 1H15B 2COQA 3H6JA 4P59H 3BXNB 1UJ3B 3BP4A 2GFBB 1G0XA 2XKNB 4UU9B 1WBYB 4NBZB 4FQXB 3QEUA 4FZEL 4MJIB 1FORL 1AP2B 2VDQL 3B9KA 4LMQE 5F1NB 2C26A 1YDPB 4KJPD 5BQ7A 4U6VL 3AB0B 3D0VA 3NCJH 3VXRA 5FOBB 1KBGH 4MDJB 2F8XC 1HYSC 2EDJA 1MQKH 4N0YH 3IF1B 3RBGA 1FFPA 5I1KH 4JFDA 1HIMH 5JA8B 2ED8A 4W81A 4FTVD 5ADOH 1CWVA 1GGYA 3CAFA 2G2RB 3RY6C 1CIUA 1IGFL 3VWKC 1A6ZA 2YZ1A 5DSCA 1JZ4A 4PJDE 5HHOB 5F7LB 2ENYA 1FGNH 2YD3A 3STZB 2Y7QB 2DDQH 1PDKA 3T0AA 2Z8RA 3H9SD 2HKHL 1BOGB 3ROOA 5HD8C 2Z8WC 1JBJA 3MGAA 4KH2A 5DO2D 3CMOL 5FCSH 2YPKA 2AW2A 5K9KA 2YK1H 3QI9C 4U6XA 1F4YH 1N6QH 4HWBH 1AFVL 5C0AA 2DBJA 3NCBB 3DYPA 3G5ZB 1EAPB 1OTSD 1RHHA 1TZGH 2MSPA 5DDHA 3OGCB 2AEPH 4P3DA 1FCGA 2A73A 1MFCL 2FB4L 4ONGH 4XXDB 1IM9D 4YE4L 4C4KT 1JHLL 4NO0A 5T1DL 4CGTA 1C1EL 3AXLB 5C07A 5IJKC 5E95B 4YQXL 3O4LD 4EI5C 4NNYB 3NCFB 1GGTA 4YFLF 3CCHA 1JN6B 3LKOA 4LNRB 4FZEH 1P4IL 4U0RC 4U1NA 1FORH 2VDQH 2YA0A 5DJAA 3PUCA 1TMCB 4U6VH 4OV5B 3VXPB 2CO7B 1Q9KA 1J0KA 2C5DC 2PW1A 5INDA 5D8JL 2F53A 3FFCA 4WGWB 4EI6A 4N90D 3UJIL 2X7LB 4PY8I 5GGVL 4PS4L 4PJHA 3SDYL 2K9UA 1AO7E 1IGFH 3B9EA 1P7QD 2P8PA 3W0WE 5LXGL 5DYOB 4L4VD 5IB1A 3BEVA 4RZCA 3T0WA 1H3VA 4X8JA 3KYKL 1JJUA 1X9QA 3BAEL 2IPTL 3KLAA 4HJJL 1A7RL 2N4IA 3RVTD 1I7ZB 1T4KB 3TPUB 5CCKH 4FQXD 1N59B 1HQ4A 4G8IB 4MJID 3CMOH 3S4SB 2PUQT 5GS2D 3HI6L 1AFVH 4Q6IA 1UT9A 3Q6FB 1BX2B 4XTRD 4PJFE 2R2EA 2VR4A 4YJZL 2WIIA 4HC1L 2ICEA 3V5DA 1MFCH 2FB4H 2GJ6B 3QHFL 3ARWA 1HHIB 1RJZA 4YE4H 1JHLH 1KB9J 2I25N 1BVKA 5T1DH 1QA9A 2LU4A 3IFOB 4GRWB 1C1EH 4N8VG 5IVXF 1R0AL 5IMLA 2NY0B 3ARDB 4KKBC 2VLJD 3QYCA 1C5BL 4YQXH 3MROA 5I76B 2V5SA 3NH7L 1PEZA 1KTLB 3VRLF 3X13A 2HKFL 4U1SB 4FFVC 2VXQL 5B3JF 3TA3A 5BZDA 3KPRA 4MJ2A 4ELMF 4F8QA 1J8KA 1VKXB 1HHJB 3FB7A 5CSZB 3BUTA 5EU5B 1KCKA 1P1ZA 2NY1C 5D8JH 1ZS8B 4PTTA 1ZSDB 3UJIH 1I1CA 5L8KB 5LAXB 3V6OE 2R4SH 4NYLA 4BYHA 4M8QB 5GGVH 4I9WE 4PS4H 3DUUB 3SDYH 4ZDHA 5K9QG 4C4KO 5LXGH 4GH7B 5EN2A 4YHZL 1P6FA 4AYFA 3KYKH 4JO4L 3BAEH 1FV1B 1NANI 2HFFB 2IPTH 4HJJH 1A7RH 3GSXB 4PR5A 3QXAB 4YHOH 2XFXB 1KB5B 3HI6H 1SMOA 1QRNA 5H8DA 5TDNA 2XTJB 2E9BA 1YN6B 2C3VB 4PJEA 2YD7A 3E6HB 1G7IB 4HC1H 5D5MA 1AR1D 1NCUA 4AEIL 5L7XL 4JM2B 2FIRT 3B5GA 2JCCB 1FIEA 3ZDXE 3QHFH 5C0GB 4JFEA 4U1MA 4GG6B 3EFFB 4OM0L 1MREL 4UIMA 5DFVC 4PV9B 3TIDB 3WHE0 1D9KB 4YHYB 1YC7A 1R0AH 3HCVB 1A1OA 2EYRB 1YEJH 5C09B 1C5BH 5EORH 2ESVB 1BHGA 4XBGA 2D7OA 1IGTB 5JW5A 4J23A 3NH7H 3MRHA 2HKFH 4UNTA 4XP4L 4WFHD 1NAMB 1KSRA 5HYJB 4KJPC 2VXQH 3WNNA 1Z9LA 3EOAA 5CGTA 5B39B 1FSKC 2G60L 2A1WL 2X70B 5IW6A 3T2OA 1PYWB 2J3SA 3TBVB 2ADFL 1ADQL 5E9DA 2NY0D 2PW2B 3ARDD 5L6YL 3DROB 4YHZH 5H35B 4B7LA 4JO4H 2X9YA 3S4SG 5DO2C 1XGTB 3QUMA 3IRPX 3RNKA 5E8NB 1NDGB 4UOJA 4OM1L 4XWGL 3STLB 3OAYH 2R0LL 5IB3A 3HRZA 1SBSL 4O51B 3LPGA 2Z35A 5JMRA 3V8CA 2YRPA 32C2A 1FFOA 4AEIH 1H3PL 5L7XH 1LEGB 3MRDB 3ET9F 4NN6C 3JWDL 4TUJB 4OTXL 1ZLUH 1JPFB 3D85A 4OM0H 5D96B 1MREH 4HQQH 3X3GL 2F74B 3GMRB 3R0MA 4QXUL 4LEOA 1HILB 1UM6L 2VLRE 1G6RB 5F93C 5FAAA 1PLGL 5GRXG 5J8OA 3GBLA 2X1PA 4UB0L 3GMOA 5MENB 5F96L 3LAFA 3NTCL 4HKZB 4WWKB 2E7BA 5J89A 4HPOL 1RK1B 3BD4A 3GI8H 4U3XA 2VDNL 1X5FA 2YSSA 1SJHB 2N1KA 4BSVA 2UYLB 5E4IA 2VZTA 3FB6B 2ADGA 5F6IB 4JM2D 4QHUB 4ZOCA 2A1WH 1NBVL 2W60B 4Z7OF 4D0CB 3CLFL 5HYEA 3OKKA 4HK3J 4OGAC 3VMNA 1EBAA 4ZAKB 2ADFH 1ADQH 2EDOA 1D9KD 4NDMB 3FQUB 4YR6B 5C09D 5L6YH 5IEHA 5HHXL 2ESVD 5GSVB 3SQOL 2AS5M 2X4RB 4NGHL 1P6AB 3H3PL 4FQXC 4XNMA 3MRIB 3T77B 3GSRB 4R90L 5HYJD 4JFYB 4ENED 4OM1H 4XWGH 5ANMB 1OSZB 4P49A 2L0DA 3IU3B 1N64L 3IXAA 4FQIL 2AEQL 4XTRC 2ZCHL 2LAGB 4NNXA 1SBSH 4HGKC 3CFDA 5KS9E 3MRFB 2BNQE 3UROR 1KXVC 3O3DA 4IM8A 4JFQB 1U8HA 3DX7B 1SEBA 2AXJA 5FUCC 4TSCL 2CMRL 1A7PL 1H3PH 4HS3B 2OXGA 5EBGA 1F6FB 3JWDH 4OTXH 4R9HA 5ISZB 2HVKA 2VLKE 3WFZA 1JZ2A 2AJUH 1JVKA 2VE6A 3HB3C 2ZUQB 3LDBB 1UM6H 2OBGA 5IVNA 1PLGH 5HY9B 4UB0H 3GMLB 1K85A 5F96H 1U95A 3NTCH 2LU3A 3SGKA 1CL7L 5BO1L 1YYLL 2DQDL 3DIFA 4QO1A 5CGYC 4Z7UE 3WD5L 4HPOH 3MYJB 5B39G 5AUMB 2XZAL 2VDNH 1T6VN 2Z4QB 1IEAA 2PTTB 2H6PA 2D31B 1PZUB 4PGBB 5ECJE 5TGBB 5ID0B 1T5WB 5HGHB 1XIWB 3QCTL 1MI5E 4QF1A 2P5EB 4LPWA 3AS2A 1NBVH 1YUHB 3GSWA 3VXSB 4M1CD 5CLTA 1QP1A 3ZKND 3BN9D 3TO4B 3CLFH 1SYVB 3NN8A 4YLQT 3ZYOA 5D72H 4ZXBB 2WV3A 5DUBB 4WJ5A 4S11A 1K8DB 1TTGA 4KDTA 3CX5J 4Y1AE 2RHEA 4N8PA 5GGSB 1SJEB 4E41A 5HHXH 5MEND 1ORSA 3P4NB 2DLTA 3K8KA 4WWKD 3I84A 3SQOH 3HR5B 3HE6B 43C9A 5BRZA 5ITBL 3VFTB 3H3PH 1T5XB 4YFLI 4JDVB 4X83A 3RA7L 4CDHA 2FWOA 2BVUA 2W0FA 4ZUUA 1OGTB 2P8MB 4LAQL 2BFVL 4MNQA 1N64H 5KW9L 4FQIH 2AEQH 2ZCHH 2JJWA 3FN9A 3LRGA 2FX9L 1AR1C 1TCRA 5CMAB 2DIJA 4MAYA 5E1AA 3HAEH 3L3OB 4TSCH 2CMRH 4RISL 5DD6B 1A7PH 2IG2L 4ZAKD 4ODHH 3LV3A 1Z6JT 5J57B 2VAJA 5DMKA 1MCJA 4LSVL 1AKJB 1BJ1J 3N1FC 2HJFA 3VFSA 4DVBA 1KIPA 4JO2L 4GG8A 5IVZA 4YO0B 5F7HA 5EU6D 1ITCA 2OL3B 4FQ2L 2OLDA 4KK5D 4XCEB 1LE9A 1CL7H 5BO1H 1YYLH 2DQDH 5HI5C 3WD5H 5DHYA 4EBQL 1B0RB 1HSBA 2CK2A 3GBML 1CDCA 4X9HA 2XZAH 3QFDB 1VADA 5I15L 7CGTA 2QQNL 3UYPA 3ME0A 3WE6A 1N5YL 5DVNA 2R23A 1IZKA 3MLTB 4H5SA 5D1QB 1AXSA 3QCTH 4DCQB 5E08L 4QYOB 1YEDB 2Q7YB 5D93B 5ISZD 5DQ9A 1A7BA 1WTGT 5EZJA 3ARDC 3CZJA 2Q76B 1TTUA 4F3FB 2V5TA 5F1SA 5ACLA 4E5XA 5D7LA 3T8XA 5A2IH 3RWDB 4KK9D 4OIIL 1T1XB 3PIQB 3IFNL 3R0NA 3MLYL 4JM4L 3FN3A 3O9WA 4RWHA 1JGVL 4Z9KB 4UZGA 3HE7B 1X4ZA 5ITBH 4W6YB 2H1PL 1OAUL 1X5GA 4XAWL 3RA7H 5C0BB 3F58L 1U8JA 2IH1A 3CH1A 3P77A 5TDPA 4LSRH 3V4PL 4QRPE 3PNWB 3GRWA 3B5TA 4LAQH 3X14B 5KW9H 2HMID 1D5ZA 5IMOB 2XA8L 3L3JA 4ZD3H 4YX2L 2FX9H 3AMLA 2P5ED 3BO8A 3U48A 3LH2L 3VXSD 5ICYB 5E6ZA 2NW3B 1RURL 1T22A 3GJFA 3TO4D 4XPFL 4RISH 4YHNB 2IG2H 2X4OA 4BFBD 5B38A 4ZXBD 3FHAA 1WSST 5LG1A 2P7TA 1T2XA 4LLWB 2B7DT 4Y5XA 1T89C 3A6OA 3WNOA 1BBDL 3HE6D 5FUZL 2FJFB 4JO2H 3MRMB 5DTFA 2ITCA 3ZSTA 1WISA 4LFHD 2ATKA 1MH5B 2OMBA 2Q1EA 1ROWA 4FQ2H 4UINL 1LE5A 2XTJC 1ACYL 5GGTH 4PJCF 3UTQA 5LGJB 3GJFK 3S9DB 2FL5A 3GBMH 3JV4A 2IQ9L 4XC1L 1G9NC 1H5BA 1Y0LA 5I15H 4JM2C 2QQNH 4XP5H 4Z95L 1N5YH 5IEKA 4X99A 4YWGL 1BVLA 3BKYL 5A2LH 1T0MA 5GGUA 3GSQA 1U8QB 5E08H 3REWA 1T7ZA 3K2UL 1AKJD 3CSYA 1MFNA 2ZSVB 4L3EB 4OI8A 5ERWB 1I1YB 4I0KA 1MUJA 4ZO9A 1KPRA 1LWRA 3QIBB 4OIIH 3IFNH 3MLYH 4JM4H 4QRUB 2X4UA 5DVLA 4LFHG 1JGVH 1U8MB 4JFDE 4QCIB 3DPBA 1FVDB 3FT4B 2H1PH 1OAUH 5EUOF 2P45B 4N9OB 4NT6B 4XAWH 1OF2B 3F58H 2OX5A 3V4PH 5F7DB 1A4JA 3MZGB 3QXDB 1U3HA 4NQEA 5D1QD 1K3ZA 3QA3A 4LBEA 4YX2H 1BZQK 3LH2H 3EYQD 4DGYL 1RURH 1NBYA 4XPFH 1AGDA 4K94C 4RFEA 4PJGF 3UAJC 3TO2A 5E2TL 3VFOB 3P11L 1KTRL 1JF5A 4KJYB 3RPKA 3DHMA 1JF6A 4ZSOB 4O9HL 4AENB 4P2QB 1RZJC 4U1IA 5DUML 3HE7D 2WBWB 1BBDH 2NW2A 5FUZH 1F13A 4LKCB 4D0BA 5C0BD 5E03A 4UNUA 4M7LL 3DO3A 3FO2A 4UINH 3T3ME 5EO0A 1ACYH 2FNBA 3CFKB 1LHZA 3E3QE 5C07E 2IQ9H 4XC1H 4CNIB 3ROLA 3CZFA 3OKNA 1P5UA 3O6FA 3VXOB 4K7PY 4Z95H 3ZKNC 4M1CC 4L4TE 4YWGH 3BN9C 3QEQE 5D96C 2FGZA 3OXSA 5D2NC 4HK0A 3BJLA 3HG1A 1GGUA 5IF0B 4X6DF 1QSZA 1TVHB 1NGYA 2J12B 3CFJB 3SE3A 2QV2A 4WWKC 2XTLA 3ARBB 4OZHA 3HPJB 1FC2D 3ETBF 3F7YA 1MHPL 2VAAB 4ZO6A 1ETZA 2F53E 3PWPA 4Z7WB 2BC4B 3H9SE 1DQQA 4WHYH 1KB9K 1II4E 5C8JB 1BGXL 1WUNT 3MRLA 4PJXB 1S7SB 4PJHE 3O2DL 4YGVA 4J2XA 3DVNB 4D9RD 5FHAL 3SKUD 2DQIL 1ES0A 5F6IC 3SO3B 1NPUA 4HXAL 1BWMA 2GEEA 3S5LA 3JWOC 3PP3H 4GXUM 5HVWA 1KLUA 3MBXL 3U9PL 5I8KL 3U7YH 4ZAKC 4UT7L 2FIKB 4DGYH 1JFQL 3DX6A 2NY2B 1CG9B 5E2TH 4L3ED 1XGUB 4PGEB 3P11H 1KN4L 4MD5B 3VXQA 1WWCA 3QIBD 4NUJB 1ND0B 2FO1A 2ZUYA 1KCRL 1CFTA 5DUMH 1IM3B 3LEVL 3LN9A 3MJ9L 4KK5C 3Q0HA 5F1IB 4OQTL 3PDGA 4M7LH 4GKSB 1F11B 3GMNB 4MB5A 1A1MB 5FV2A 2C3HA 3K4AA 3QNZA 4JFFA 4RAUA 3FQNA 1QQDA 3KHQA 3KPOA 4JRXA 1SVZA 2XI9A 4NZUL 2E3VA 3MMEA 4IRJA 4EQ2A 2PXYC 3RI5F 1QLFA 3TIEB 5GS1B 4KMQA 2ZUQC 4MDIB 3LDBC 1JE6A 1T80A 4KK9C 4WU7B 1FNSH 5E6YA 3IS1X 3KPRE 3S3PA 3KPMB 3I9GL 3BGMB 5I1AB 4TVPL 3QQ3B 3OKMB 1V3MA 4QNPE 1MHPH 4CKVX 3SGEH 2EDQA 1PX3A 1OB1A 4FXKB 2R15A 3EO9L 2FH6A 4ELKB 2NXZC 4DN4L 1P9MC 1BGXH 4X4MA 1ZWIA 2BOCA 1S9YB 5JPMA 2FBOJ 4GW5A 3O2DH 3FO0L 5FHAH 1XIWC 1XR9A 3BEWA 2BSRA 4HXAH 4S2SB 1WIPA 1A2YB 1RIVL 3TO4C 1E6OL 3UTOA 3MBXH 3U9PH 4QOKB 3ZE1F 5I8KH 1JZ6A 3I6GA 4UT7H 4YDLB 1JFQH 1YY8B 2PO6C 2EIDA 4G9FB 3L3KA 4JPIB 6CGTA 3P4OB 3T4AB 1KN4H 5CZXD 2PYEA 5GGQL 3ARBD 3HE6C 5ACZA 4PJIA 1D5IL 2GUOB 1KCRH 2I9LB 3P9MA 3L5HA 3CK0L 1PG7X 3LEVH 4GAYA 3MJ9H 5D5ME 3PL6B 3WIIL 2VLJE 3HI1A 1IGML 1Q9OA 4OQTH 1DE4B 1TVDA 1L9NA 4L29B 4HIIA 5J1AB 1DANU 5MERA 1KOAA 3MRGB 1P4LA 1CFSB 4OCWL 1HKFA 3FOLA 2Y25A 1W72A 2RB8A 4NZUH 5DEZA 2NY2D 1U2HA 1BFOA 2MMXA 2X5PA 5FO8B 4HSQA 1QTYT 1EDQA 1B4JL 1UENA 4UOW1 5HVFB 1CU4L 4PB0L 5I17B 3O2WL 2UZYB 4WI8A 1L6ZA 5FM5M 4XPHL 3ARSA 1PKQE 1HOCB 3I6KB 1RIUL 3I9GH 4TVPH 2PF6A 3MFGB 2VN4A 4EN3C 4C56A 3TH4T 2XQBL 5JOEA 3EO9H 3UEZA 2I07B 5DMGD 4PRIA 5TFSL 1RZ7L 3C5ZA 4DN4H 4M6ML 1G7MA 5E9DE 1KACB 3PWUA 5IB4B 1WT5A 3FO0H 3UYOD 5DJZA 5EA0L 1MRFH 5E7FA 5AAMA 2UUDK 4NO2A 4OLUL 4BJLA 3EYQC 1RIVH 5HGDA 2ZOLA 4RMQA 1E6OH 2J2ZA 4Z5RB 3IDYB 4MA7L 4OZGF 4UTAL 5IVXB 1FH5L 1ULVA 4LSTL 3SDXF 1IC4L 3KHOA 1WITA 4QXGL 5FO9A 5T1KB 4L8CA 3HE7C 1FVEA 5GGQH 4JPKL 1IE5A 1D5IH 3CFBB 3KYOA 3EKCA 3A6BL 1J0YA 2HLFD 3CK0H 3FONB 1VFAB 1XGQB 3WIIH 4PLKC 1IGMH 2AK4B 5FA4B 5BZWA 5IK3B 4X5LA 1I1AB 1LO5A 2V9QA 4N0FB 1CICB 4KI5F 2IADA 3DGGB 4X0KB 4ELMB 1GIGL 4OCWH 1XCTA 1DLFL 4EI5A 3ARVA 4PRAB 2EH8L 2IC2A 1KLFA 4NJ9L 3M17B 4PV8A 4HV8A 4EIGB 3VU2A 4G9FD 3LN4B 1RUQL 3NFPB 1B4JH 1RZIA 3AU1A 2ZPKL 4NKMA 1CU4H 4KKLD 4PB0H 4NQXA 3O2WH 4GRWE 5TQ0L 4XPHH 4JN2B 4IDJL 3PWLB 5H2BB 5DZLA 5CEYA 3PL6D 1D6EA 4V1DB 4J3TA 2XQBH 4K9EC 4CMMB 4YBQC 2VZ1A 2DM4A 1TJHL 4R97B 1RZ7H 4M6MH 2VQUA 3DETD 2X9XA 4RRPG 4JHWL 4JZOA 1HYRC 4OZFA 5EDXA 5AWNL 5BCAA 3N9GH 1JGUL 5EA0H 5I1IL 4OLUH 4AIZA 4ZUSB 2C4XA 5KTEL 4OCRL 5J11B 3SDAA 1IAMA 3EZJB 4TUOA 2IANA 4MA7H 4UTAH 1JGDA 3QIBC 3U4EB 5FK9B 1FH5H 5DQJB 4CN6A 4UV4L 4KRPB 4LSTH 4MJ5A 8FABA 1IC4H 1W0VA 4HWUA 4QXGH 4PJAA 3PWNB 4JPKH 3KGRA 3LRSA 3SKMB 1S9XA 3A6BH 5DVKA 1JNHB 4CVUA 1OT1A 4RNRA 3RTQB 3G6JF 1FGVL 3MCG1 4UQ2B 1W2KT 4WWID 2N7AA 3GI9L 2M26A 4NBYB 4DKDC 3WKNA 3M07A 4YHKL 1GIGH 3OSKA 3L3HB 2QQQA 1DLFH 3MLRL 4D0DB 2ZUTA 2EH8H 1CS6A 4UTBL 2G75A 4RA3A 4NJ9H 3UTSA 4M48L 3MV01 1OM3L 4U1HB 2LV4A 2K7PA 43CAB 1RUQH 4RAVB 1FNGA 3SGDH 4HDIB 2ZPKH 4X98B 1JV5B 4K7FB 5T1KD 3RGVA 2EE3A 2UZXB 4K3EL 5IJVB 4XP1L 5TQ0H 4IDJH 4MVBD 2R1WB 4YNYB 3T65B 2LFGA 5BV7L 2AK4D 1I1AD 3EOYG 1X5ZA 1CICD 3MNVA 1TJHH 4P5MA 1DUZB 3EDEA 3QFJB 5JW4N 5JHDB 3QO1B 4ZOBA 1NEZA 4F9PC 4ZG1A 1IQWL 4JHWH 5AWNH 1BFTA 1IGYB 4F15B 3MBEB 4KJQC 3I02A 5C3LD 2OQJB 4E41E 4KJWD 2X40A 5I1IH 5I8CA 4GOSA 4ZFZB 1M7IB 3GIVA 2PYFA 1VENA 5BRZE 5EPMB 5KTEH 3Q6GL 4OCRH 4K8RD 2ICWI 4LCYA 4HHAB 3IDIA 3NCMA 5DRNB 1SBBA 2BSTB 1NC4A 1M1SA 1RV6X 4MNQE 4OGZA 3CSGA 4WI3A 1OAXL 4UV4H 3RX7A 3UBXI 3U6RB 1U93B 4UDUA 3MFFA 4NRYA 3WDJA 1UA6H 4V1DD 3RWEA 2BNUB 3MO1B 1OD9A 1XGRB 3B8YA 4LNVA 3QUML 5HHMB 5FYKD 1ZT1A 2ZZUT 1FGVH 1G7QA 3SO3C 1IC5L 4JFPA 2X4SB 3GI9H 2NLJA 1KCSL 3TN0B 3LQAH 4KROC 4ZUTB 4YHKH 1A1NB 3VFGL 4MA3A 3MLRH 3ES6A 3GM8A 1CIDA 4UTBH 5IQ9A 4M48H 1OM3H 5EFIA 1KTKE 1LNUB 3KS0J 3RKDD 4KRPD 3ULSA 4HKXB 4Q2ZB 2VXSL 4X7SL 1DSFL 4K3EH 4JFXA 4XP1H 3RIAK 5E7BA 2PTUA 4IIQB 4TNWK 3NIFF 1NC2B 1ZK9A 3RTQD 5HPOA 2XOTA 1JPSL 5BV7H 2WBJB 3TBSB 4K23L 5DMGC 4LLVA 5I16B 4IOIB 1RZKH 2VDPL 2AV7B 1XAUA 3KYMA 3NACL 2EDRA 5JDSA 5C0FA 1G7LA 5D7LE 1IQWH 3ZZ1A 2Q6WB 1UWXK 5JORA 3VFWA 2D3VA 4PFEA 3QQNA 4B7IA 1A0QL 2HFEB 3O3EA 1MAKA 1ZLWH 1PAMA 3V52L 3Q6GH 5C08B 2A0LD 2BVOA 1B0GA 4RX4A 4AY0A 1ZKAA 4Q9QL 2OTPA 3GK8L 4LSDA 2FO4B 1U8KB 1OAXH 4LHUA 3IGAB 2HLFC 1K9TA 1ZLSL 2FZ3A 5CSGA 5GJSH 3ALPA 1IM9A 4GAJL 4RMVA 4OIBA 3GMQB 4PY8J 5CD3A 4FQHB 4AT6A 3QUMH 2FHBA 1SYSB 5EU6E 1EFQA 3QFJD 5JHDD 1IC5H 4XPAL 2BERA 4F58L 3O4LA 4P23B 1KCSH 3MBED 2P5WB 5AG8A 4J4PD 2ARJA 4O02L 3EYOA 1OP3K 2A74B 4FFZL 4KZDL 3VFGH 5KSBA 1F4XL 5TE4L 4YDLC 5DEFA 3D39E 3RUGF 4PJBA 3N1PC 3DURB 4UT9L 4QRRB 1E4KC 3G5XB 4FZ8H 3QR2A 1HXYB 4ONHA 1NBZA 4KKLC 3P73B 5CINL 1IKNC 1AGCA 4AK1A 2VXSH 4X7SH 3KPQA 1DSFH 3MLSL 4NFCA 3PL6C 3SDDB 1S7UB 4UNVA 2X4PB 2WP3T 4HPYL 5HHMD 2R2HB 2VO5A 3Q2CA 1JPSH 1OGAE 5CHNB 3C5SB 4K23H 1P7QA 4PJFF 2V17L 2VDPH 4L4VA 5JOPD 4U1KA 3SO5A 3NACH 1TJGL 1CXKA 4N8VA 3TN0D 1H15A 3DLQR 1D3CA 4WW2F 3DECA 3BXNA 3QDGE 2DYPB 2XKNA 4UU9A 5HHQA 2QEJA 2HT2D 4ZO8A 3V7MA 4MJIA 4OF6A 4JKPL 4D9LL 1A0QH 1LGVA 1KPUA 4V2BA 3V52H 4TPRL 3L6FB 5IM7B 3QDMA 5C1MB 4CADB 4Q9QH 3GK8H 5DRXA 4WUUB 4ZS6C 2X09A 4JDZA 3BH9B 4LCWE 1EZVY 2P43B 2R9HD 3LN5B 1NC2D 1LDPL 3AREB 3DVFA 4KAQL 1ZLSH 1OLLA 1XT5A 2WBJD 3STBA 1OCWL 4HZLB 4GAJH 3H9ZA 3MV7B 5HHOA 5HBBA 3ZTNH 2CR6A 4NBXB 4ZQKB 5IESL 3OF6A 3OKLA 4CW1B 4XBPB 1SMAA 4XPAH 1F5WA 4F58H 5L2KA 5KOVC 5JIIA 1OAYL 3P3YA 1UWEL 4O02H 4U6YB 4JY4B 4KZDH 5JOFB 1F4XH 5TE4H 3IDYC 5IVOA 5C08D 5CP7A 4UT9H 4WFEE 2EDYA 4J6RL 2EDFA 2LABA 5CKAA 4NCC2 3QNXB 1DLHB 2EIEA 1EEYB 5CINH 4WHDA 1IEBB 3MLSH 3RDTC 3WSQL 4X6CE 3G6DH 3L3IB 2DLGA 3AXLA 3KLDA 1I1AC 4HPYH 3A67L 4RIRB 1A7QL 4Z76B 1NGQL 5AD0B 5E8PB 5GS0D 3BKML 3PABB 4WY7L 2V17H 1HQRA 5IOPB 4P23D 1TJGH 4NNYA 2P5WD 1INEL 4KJWC 3NIDF 3ZDXF 1FYTB 2VITB 2A38A 3QZWB 4OZHE 2BVQB 1L4IA 4AIOA 2NZIA 4FXGA 4QRRD 4JKPH 4D9LH 5JNYB 3PWPE 3V6BR 3MUZ1 1FFRA 4YXKL 5I2IB 3IFLL 3IVKA 4TPRH 4WIQA 3U7WL 1SEQL 3MRBA 4OV5A 3VXPA 1Z9OA 2QSQA 3NPZB 5F3HB 4H1LB 3ARFB 1I1FB 1PSKL 1RIHL 1LDPH 4KAQH 1KFAL 1OCWH 4WTZA 3K2MC 5DYOA 3SKNB 2WP3O 1FNHA 1NFIB 5IESH 1N3NB 1CGSL 1JIBA 1NDMA 3GRWL 4PD4K 2DYPD 4GUPB 5FA3B 1T4KA 3QT2A 1OAYH 1UWEH 3RWCB 5I9QB 3L3DA 4MSWA 2RBLA 2B2XL 2Q86B 5KVGL 1T21B 1ZT4A 4KRPC 4J6RH 3S8WA 5FYJU 4TSBL 4WUUD 1N6VA 1OTTC 3TF7C 3MV8A 4XXCC 3ARED 5E8DL 2GJ6A 1A4KA 2W07A 1A3LL 1MELA 3RY5A 3RTQC 1HHIA 2J8UA 4OAWA 3WSQH 3IFOA 5EUOB 2Y1VA 3MV7D 2VIRB 1B9ZA 4GLRH 1JMZA 3A67H 1A7QH 1NGQH 3ARDA 4P2OB 1MHCB 3BKMH 1EFXA 4WY7H 5JA9A 2LTQC 2HWZL 4BQ8A 3GHEL 3MRPB 3UTPE 1INEH 1KTLA 2SEBA 4X9GA 3SGJC 4RGOL 4LSSL 4BFIA 1UZ8B 4JKMA 4O2FA 1A6PA 4YEEA 2A0LC 1JL8A 4PJGB 3QPXL 4YBLB 4KKAD 4YXKH 3IFLH 4LP4A 1S7WB 4X4ME 4D8PA 3U7WH 1SEQH 1L0QA 4YEFA 1N4XL 5EU5A 3D2UB 1FO0A 3M45A 3F7VA 1PSKH 3I75B 1C5DB 1RIHH 5LAXA 3JVGC 1QYGH 1T83C 1KFAH 3DUUA 2CLVB 2CR3A 4MMXC 4OLYL 5A2JH 4WFGE 5KN5A 3KPSB 1LP9B 1J1XL 1FZJB 1CDJA 4HJGA 3WNKA 4F15C 3LKRB 3D69A 1T89A 1CGSH 3GRWH 1FYTD 4IEFB 3FCTA 2PYEE 5DD3L 5E5MA 1CLOL 5FUOL 3GSXA 3QXAA 3IDNB 1GGCL 3BKCL 4HS6B 1KB5A 4HMDA 3O6KL 1A7NL 5JHLL 2B2XH 1VDGA 4F57L 3HMWL 2C3VA 2NZ9C 4X6DB 5KVGH 3ECBB 1FIGH 2VERN 1X6LA 3E6HA 3KJ6L 2DQCL 4TSBH 1G7IA 5AYQA 3UBXB 3ARFD 4JVPA 5HHPB 3REVA 1HWHB 4K55A 2JCCA 4LLYB 2D4DA 5E8DH 1F3RB 5C0GA 4LMQI 1A3LH 3FT2B 2LE9A 4GG6A 5SV4A 4B5EA 2VYRE 1UB5B 2N7BA 3TIDA 5B8CB 5KS9F 3TN0C 1T2QL 2H3NB 3ESUF 1XGPB 1FZMB 4XMPL 3D18B 3PP4L 3QZWG 2HT2C 4OLVL 2HWZH 4PREB 4S1SL 5BOZG 3GHEH 1IGTA 2MFNA 3NIGE 2AAVA 1GC1L 1VB9A 3SOBL 4LSSH 4PIRF 5EZOL 2NX5B 5HYJA 3PJSB 2DQTL 3QPXH 5B39A 5HVHB 4B41A 4H1LG 3ILQC 4D94A 1N4XH 4Z7UF 4JAMB 2X89A 1PYWA 3UX9B 3BPOB 3TBVA 2IWGA 4JFZL 3TH2T 4NFDA 4P2OD 4OLYH 4YDKL 3DROA 4R26L 3LKPB 4Z7WE 3KNBB 5L8LB 3C09C 1J1XH 3LSOA 3HPLB 3NOIA 3KXFB 2CSPA 2XZZA 1WC7A 3BW9B 5DD3H 3BD3A 2NCMA 4MXWL 5E8NA 1CLOH 2DN7A 1G9ML 1U8OA 5FUOH 5ID1A 4JB9L 2E27L 3HC0B 3QQ9D 3IJHA 5E2JA 1GGCH 5FKPB 5DC9B 3BKCH 3O6KH 4P2YA 4O51A 5JHLH 4F57H 1EGJL 3HMWH 3MJ7B 5JQHC 5INCA 5C6TL 3QEGL 4U4BA 3KJ6H 1QSFB 2DQCH 3D2UD 2VXTL 3O2VL 1LEGA 1J0HA 1OD7A 3MRDA 1FFNA 1TJIL 1AJ7L 1CN4A 4TUJA 3O8XB 5C0DA 5D2NA 5GS0C 2DIAA 4F7PA 1U8NB 1Q9LA 3KPSD 3GMRA 1BQSA 4P23C 2JJVA 1HILA 1T2QH 1U41A 4WU5A 1R3LB 3PP4H 5C0ND 4LAJH 4KI1A 1RAMA 4OLVH 3EJJX 1NMAL 4ETQB 4K71B 2EO9A 1K4DB 1O7SA 3RIFF 1GC1H 5DXWA 4EIZC 4M02A 3SOBH 5EZOH 3F12B 5DFWH 5I74C 1I8LC 1SJHA 1VEPA 3DOSA 3EHBD 2DQTH 4PRHB 1I3UA 3ORJA 1GRWA 1DQTA 3SE4C 4MQ7B 3SDDC 4HD9A 5J13B 1INQB 5I75B 5D7KD 5DK0B 4R96B 2W60A 5J6HA 4ETYA 4XZUB 4IDLA 1RVFL 3V0WL 1LD9B 3VFUB 3MACL 1L0XA 3QB7C 4J8RA 2Q8AL 2MOVA 4JFZH 4Z7QE 4NM8L 5KSUA 4FP8L 3V0VA 4CU8A 2V7NB 3LEXB 4YDKH 4UUJB 4R26H 1GHFL 5DRWB 3UTZA 2L4OA 4XVJL 3LQMA 3JXAA 3GSRA 4XVTL 3ARZA 4PJAE 3O11B 5IHZB 3ABZA 4MXWH 2NX5D 1G9MH 3D3VE 5AEAA 1CDYA 3CJJA 2E27H 4JFYA 4X7CC 1T1YB 2PN5A 3EGSB 2FBJL 3TCXA 1NGZB 5K9OB 1OSZA 4LPXA 1QRKA 4CU7A 1RUML 3UBXG 1VERA 4ERSL 1EGJH 3MRFA 4CVXB 3HUJF 1AC0A 2GY7B 5C6TH 4R7NA 3QEGH 3AREC 2CQVA 4NN5B 2A6JB 4UQ3B 2A83B 3BZEB 2VXTH 3O2VH 4HGWA 2VL4A 4OGXL 1AJ7H 5EC1B 1OQXA 3IETB 2FDBP 3UTSE 1S7QA 2HN7B 5CEZD 2PXYA 3IRZA 2ADJB 3AS3A 4WI5A 2V5MA 2JIXB 3KXFD 1JNNL 1QFHA 1AGFB 2VRAA 2VMFA 2DI7A 1NMAH 1CE6B 4HXBL 4EEEA 5FYLE 1W72L 4HMEA 4F2MA 4OZGB 2PTTA 1P9MA 3IJYA 2D31A 1A6VL 4PGBA 4HUXA 3SDXB 3VFNA 1QSFD 4CMHB 1T5WA 5HGHA 1XIWA 3AUVA 5DJ0A 4MCYA 3ZDYE 2P5EA 1T2JA 1YUHA 3O8XD 2O61B 3F5WB 4OCSL 1RVFH 2YPLA 2R2BB 4P9HL 4JEGB 2OMNA 5D6CB 5ICXA 4W6XB 3V0WH 3KPLB 3MACH 2Q8AH 1SYVA 1HHHB 5ENWA 4NM8H 2IAMB 1AHWB 2PO6A 4FP8H 5GGSA 2QADB 3QWQB 1GHFH 3MNZA 5F6HI 1G1YA 1CL7I 3KPTA 4IS6A 4I2XE 3HE6A 1T5XA 5HGAB 4XVJH 4DAGL 4WDIB 3S35L 4XVTH 3KYNB 1TZHA 1NUNB 1D5BB 3WS6C 1MFEL 2V9RA 2FBJH 4PRHD 2VL5B 2I60L 4YUEL 1RUMH 3SJVA 3ZLQC 4ERSH 4MB3A 1KIQA 5CMAA 5IVXE 2ZG2A 5E70A 2VUOA 3WJLA 5ABDE 4Z78A 5EO9A 1SJXA 5F9JA 3BZDA 1IAII 4OGXH 5HYSB 4MJ4A 4X6BA 4H0HB 1PKOA 4GRLB 1UXSA 1MJ8H 2DD8L 1BEYH 5B3JE 1JNNH 35C8H 2OL3A 3U36B 1QSEA 4DGVL 4HXBH 5D6DC 2QQKL 4EN3A 4XRCB 25C8L 2MCPL 1ZA3B 1W72H 2AXFB 3CFCL 2W0LA 5DJDB 2I9TB 4UBDC 3RQ3A 2NR6D 1A6VH 2ITDB 4JKLA 3FFDB 2J8HA 3MLTA 1ZHBA 1BLNA 3ARGB 4DCQA 3T3MF 4QYOA 4RCAA 5GZND 4OFKA 4OCSH 1I7TB 3T0EB 4RBPH 3T2QA 1BFVL 2O5YL 4P2OC 4F3FA 5IROC 3G6JB 3X11B 4Y5VB 1BF8A 2JIXD 5DRZB 3VMOA 2AEIT 2YD6A 4KZEL 4DGIL 4OF5A 4FXLA 4CDGC 3HE7A 3EYUL 4DAGH 4F8TA 3S35H 2APXA 3BP7B 1MFEH 2G9HA 1EUTA 5GRVL 4ZUWA 3C8HA 2I60H 4YUEH 3TCLB 1ERNA 3S34L 2Y6SD 4BZYA 4HF5L 3TT3H 3TVMB 1T6WA 4PJ7E 2EDLA 1JUFA 5I1CL 1DQLL 2NW3A 4YZFE 4OI9A 1JTOA 5KSBE 4PJHF 3WN5B 3RNQA 2XWJB 4P5TC 4MLSA 4FG6D 4Q74A 2IAMD 4R8WL 4LLWA 4KI5D 4GKNA 2B8OT 2QADD 3C87A 1JZ3A 5C0NC 3PGDB 2DD8H 4GMTL 4MNGE 5E0QA 2AXGB 4OZIA 2HG5B 1I75A 3ILPA 3KDMB 4FQQB 1MH5A 4WNQA 4H0GA 5EOCJ 1LK3L 4Z8FL 3SPVB 3PE9A 4DGVH 3LPFA 5LGJA 2QQKH 25C8H 2MCPH 3LKQA 3ZKXB 1FG2A 5FO7A 4W6WB 4LDOB 1BIIB 3CFCH 1WIUA 4LL9A 3U0TA 1S9VB 1T04A 3K4DA 1P5VA 3ALXA 3GO1L 1CD9B 5I1HH 3MGTA 4X5XB 4NP4L 3RJQB 1M4KA 1K5NB 3IAGC 1U8QA 1CGXA 2C4FU 4LLDB 8CGTA 1QR1A 4ORZC 2FJGB 5B8CC 3EUUA 1PY9A 1VA9A 4HLZH 2BOBA 4JZNB 1BFVH 2O5YH 4NKOA 5FYLL 4GRLD 3VFRB 3KWWB 3QDME 5DVOA 3WHXB 4QRUA 1JMXA 5A2KH 1U8MA 4DGIH 4P46A 5KSAB 1NSNL 1FVDA 4M6OL 3EYUH 2XZCL 5JHDE 5C7XL 4C54A 4PJDB 3CSBA 4NT6A 5FUCE 3L9RB 4HX1B 2WUCL 5HVHC 5F7DA 4MX7B 1S5HA 4M7JL 1G7JA 1MPAL 4QNPF 3S34H 5F9WB 4HF5H 3ARGD 2HRLA 3BPOC 4FQLL 4ODVL 5L2KE 3D87B 1BIHA 4AL8L 1MWAA 5I1CH 2Z9TA 5B3NA 1DQLH 1HXMA 5HYSG 1UGNA 2PNDA 3D25B 4I48B 3T0ED 1XF4B 4WFFD 4Y88A 2R1YB 1K4CA 3LB6C 1V3LA 2E7HA 1T0NA 2NTFB 4R8WH 2FEEL 4ZSOA 4JANB 2IALB 1QBML 4AENA 1J9CT 3ZT6A 4P2QA 2BVPA 4GMTH 3OJDB 4HWEL 3DV4A 3OB8A 4L5FL 4XGZB 4O2EA 5ESAB 3JV6B 5DK2A 5SWSE 1LK3H 3S88L 3INUL 4Z8FH 3CFKA 3VGDA 4W68A 1JZ7A 1UC6A 4PJEF 4ODWA 1R5WA 3CPLA 1MCOL 1F4HA 3EJYD 1DP0A 2CO6B 5IMMB 3TVMD 5D5MF 3I50L 4F9PA 1WQVT 3GO1H 5EC2A 2IH3A 1N0XL 3E0GA 4KGJA 4NP4H 3VXUB 1UQSB 2DQGL 1UWGL 3HZVA 1RZGB 1Y6MR 5IF0A 5E6IB 3V6FB 1TVHA 3CFJA 1I8KA 5FYLH 3DUSA 1CI5A 4K71C 4MXVE 3WNPA 2EDNA 1J11A 1KTDB 3VD7A 3B6SB 1AO7B 1NSNH 4KTDL 4M6OH 3W0WB 1AGEB 2XZCH 2FHCA 5C7XH 5C8JA 5CJQL 5TF0A 1S7SA 2WUCH 5CUSL 5J13C 1A9EB 3DVNA 4N9GB 4M7JH 1MPAH 3L7FB 5F88B 1IAOB 2Z91B 4X4XB 4FQLH 4ODVH 2XKUA 3WLWC 4AL8H 3U30C 2KH2B 2PETA 3R1GL 2GY5A 4PJFB 2HJLB 2VDRL 4FFWC 1ND0A 1QBMH 4M5ZH 4P57B 1DN0A 1IM3A 3S98A 5KSAD 4H26B 3EYFB 4HWEH 2LAAA 1KJMB 4L5FH 1BFSA 5F1IA 3VJ6B 4XB7A 1MOEA 4GKSA 2J8UE 3S88H 1QG3A 3INUH 4POZD 3GMNA 1P2CB 5DJXB 2R56L 3G6AB 3EOTL 2NR6C 2IFGA 1TXKA 2C3XA 4Z0XB 3GB7B 1MCOH 5B4MD 5GRUL 3I50H 1Y6KR 1V5JA 2W9EL 4MS8D 4RMUA 3VGHA 1N0XH 1F4WL 4EDWL 2EYSA 2UV3A 2DQGH 3TIEA 3GKZA 4MDIA 3RL1B 3DJ9A 4WU7A 3VXNB 4JZJC 5HPMA 4H8WC 4A6YL 5I1AA 3QQ3A 4POUB 3OKMA 5IW1B 2P8LB 4QTHA 4P4KC 5KVDL 3BDYL 3CDGB 1IC1A 4FXKA 3L95B 2QKIA 2J7LA 4KTDH 1GSMA 4G8GB 5CJQH 1S9YA 3H9HB 3QIUC 4XT1C 4YXHL 2RIKA 4Q9RL 4PLOB 4C55A 3IAPA 3AY4A 5CUSH 4CMHC 2Y6SC 3CU7A 4S2SA 1FDLL 1A2YA 1GVIA 5HGGS 3V8OA 3VXUD 2GQHA 4AQ1B 4GFTB 4QOKA 1ZGLB 1Z0NA 5CWSA 4FG6C 4I77L 3OMZA 1AHWC 5E6ID 4G9FA 1AR2A 3R1GH 1E4KA 4OZ4A 3BZFB 2FSEA 4L1HA 3T4AA 2QADC 2J88H 2VDRH 1HHGA 4PBWD 5FGCE 1RJLB 3MV7E 1IKNA 3H7BB 2R2CA 2XN9B 1U8PB 4NHCL 1AO7D 3W0WD 3PL6A 5BXFA 4AG4L 1ONQA 2EH7L 1LK2A 4FQ1L 2UWEA 4NIKB 3QO0B 4G42A 4L29A 1JRHI 2XA3A 3BYYA 3B3IB 3MRGA 1CFSA 5FXCH 2LU7A 2R56H 4L9LB 3EOTH 3C6LC 5I0ZA 2FLRT 1OWRM 1P53A 3JTSA 4GKZA 4MA8L 1XF1A 1FNLA 4L8DB 4ZFOA 1IGJB 4HUMB 3SY0B 4R2GB 4Z7VA 4J3WA 4YDVB 3K81A 2W9EH 1PQZB 1LQSR 3CC5A 1CQYA 4PRPA 2EDBA 4RAHA 3IU4H 1F4WH 5E4EB 4GRLC 4XNQB 3SDCA 4HEPG 5DGQA 5ESVB 1XF5B 5I17A 3TM6A 4ALAL 3OZ9L 1HOCA 1MHHA 5D9SB 4A6YH 2GJJA 2AP2A 4NWUL 5KVDH 5F9DC 3BDYH 1KC5L 1KIUA 3VFVB 4MWFB 3RVUC 4APQB 4Y16C 5SX5K 1AIFB 4EXPX 3MV9B 4YXHH 4Q9RH 4M62L 4M43L