3O8XD

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
total genus 61
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xD02
4BH7A 4JHAL 3PUCA 1CL7H 5DUBA 5E8OA 3QXVA 1VEOA 1AJ7L 1SEQH 2EDQA 3RPKA 2VXQH 3B5TA 4OGAD 2ICWI 4UB0L 4X4YB 4EDXA 3WFDL 1NC2B 2BSED 2NY6C 4GMSL 1T83C 3T2NH 1S9YB 2DL9A 5F9OH 1DTUA 4E0RA 1F6AB 2MKWA 4KK6D 5EDXA 3REWB 2PTTB 3O3AB 2P5EE 4M7KL 1PDKA 1KTKE 3SQOH 2R1WA 2AXFA 3MBEA 3RU8H 2P7TB 3H3PL 2ED9A 1ZANL 2ZPKH 1ZA6B 3B8YA 3D0LB 5EOQL 3JBG7 5I1GH 5CEZE 3ZYZA 5C6TH 3KDMA 1D5IL 3KYKH 2MHAB 2ATKA 4CNIA 5KTEH 4OJFL 3M45A 5F71A 4GXUM 4UV7L 1TZIB 3B9KB 1UB6B 4PJ7F 2P1YA 1QRNA 2LAGB 4P2QD 3HE6B 5DA0B 1RJYA 1GOHA 3T77A 5HHNB 2AV7A 3FQWA 2PETA 1J1PH 1WITA 4KKNA 4OZGA 4LHUB 3R06A 5IB1B 4Q0XH 5BS0D 5DEZA 3WO3B 5JPNB 1Y0LB 1IM9D 1HILB 1QO3B 4HS8L 4OUUA 4UAOB 4HK3N 5MEQA 1RJZB 1T66D 3HUJE 2BRRH 3KAAA 3ZYIA 5DT1L 2BNUB 2W59A 3L3GB 2WWKT 5HGDA 4E41B 2X4NA 1K4DA 1A0QH 4P46C 4HUUA 5FV2A 1JGUL 1FYTB 3B6SB 1MNUH 3PP4H 4NOFA 3C60B 5FGSA 4GW4B 3TBYA 3DRTA 4FXKB 4LGRB 2EXYC 4HV8A 2HP4A 3EIFA 5T1DL 3K74B 2WANA 4P46A 8FABB 1S7UB 4PGCA 1JNHA 2V9QA 3HLAB 1IC4H 3BZ4A 3WKNA 3TP4A 1IL1A 1EGJH 3G9AB 1XCTA 5CZXD 5IIEA 1I1RA 1LO0L 4QXTA 2PCPB 1UJ3C 2VDRH 1NFIA 4GAYB 3QJFA 1UWGH 1RD6A 4S2SA 3K4ZA 3EYQD 2QHRH 4OZFB 1A6VH 4PJCE 1RZJC 3MRHB 4Q2ZA 5T3ZH 1YEIH 4P2OB 3GB7A 1J5OL 2R0KH 1BF2A 1UJ3A 2RJMA 1KPVB 3TBSA 1J8HE 1RZIA 5FUOL 1D6VH 4PD4J 5LG1A 4EI6B 1DQQB 3H2WA 2VH5H 3P30H 2QQLH 1RHHA 1FPTL 1U41A 3NZHL 3VXSE 1JGEA 4PGDB 2EC8A 2DQGL 3FZUD 1BVLA 4RQQB 3KWWB 3ROOA 3RWGB 4OKVA 2X44D 3LZFL 3FFCD 4KKBD 1MCKA 3UTSB 5ITFB 3N1MC 1XZ0B 4N0UE 2JLLA 5C09E 3O6FC 4NQED 4NKMB 2ZUQB 5GRJL 5EU3B 3O6ML 1KCSH 4QHNA 4Y1AA 5IHLB 1RFDH 1OGTB 3MCG1 4YHYB 1QFPA 1WGOA 3O6FA 4KRNA 3MA9L 2AQ1A 4YHOH 2EH7L 3Q6FA 5F9JA 1FE8L 4HUMB 4ZS7L 5BVPL 3LH2L 4PJCF 1CQYA 4JFZL 4XCYA 4PJ5D 1J05A 5E00B 1BIIA 3L5WA 4ALAL 3U9PH 2NY3D 4I0PD 1MVUB 4KKLD 3QUYC 4JDTL 3CFCH 5D5MA 3TZVC 3ZSTA 5DMGD 3U4EB 3RIAF 1MPAL 3VXUB 4FQJL 3TWCH 4PJ5B 3QUYA 3QAZC 4L9LB 1ZE3C 4JKPL 1N7MH 1ZT7B 4ZUWA 5E4EC 3L6FB 5J4MA 4HIJA 4X5LA 3IDIA 1BWWA 4KTYA 3V4UH 4UNVA 1AGDA 1AKJB 4L4VD 4ODVH 1NCWL 1TZGH 3HMXA 3H9SB 1IEBB 1KYOK 5B39A 2BRQA 2V2TB 4Q9QL 1IQDA 3LN9A 4MLIA 4IS6A 3MC0A 5IB3A 1YEFL 3LKSB 4Y4FA 4C59B 4NO0B 2EO1A 3KPNB 4WHCA 5FK9A 2EE3A 1A7NH 2A83A 3PGDB 5JOPD 1EERB 1A7RH 1OPGH 1T4KA 1MCCA 1NCDL 5CJOL 5TE7L 1SBSH 3BP6A 3Q3GB 4ZO6A 3U4AA 3JWDH 1G7IB 3GGWA 9CGTA 2CXKA 2OZ4H 5F7FA 3QPQD 4NQCA 4PTTB 2DQEH 3B2VH 4TSAH 3OG6B 2GJJA 2QJDA 5F6IB 5CBAA 3LD8B 4NNYA 5E4IA 4OM1H 1YEGH 1AFVH 1TCRA 3UZEA 2G5BB 4HFUL 3H9ZA 5KSUA 3QDMA 4OBRA 4MDIB 4G3YH 1A5FL 1YJDH 4D9RD 2RHEA 5HYEA 1CFVL 2XG5A 3D39E 4P2CG 3LQAC 2J8UF 3K81A 4KK9D 4L3CA 1QFOA 4GW5A 4J1UB 4G7YH 4WW2C 3DV6A 3VXME 4X5XA 2EYSA 3LKQB 2H2SC 3RZWA 3IXAB 4G8GD 4WEUD 4MS8D 1UXSA 3W39A 5F3BB 5DVMA 1D5XA 2NZIA 3S6CA 3VE0B 4WW2A 4G7VL 1F4YL 2C1OA 3RWIB 2KBGA 1IC1A 4RNRA 4ONFL 5I8CA 4WNQB 5DVKA 1R3IH 3MUZ1 1UFUA 1TCMA 4OD1L 1SJEB 1KJ3L 4G8GB 4HD9A 4TSCH 1H3PH 4OT1H 3WXVL 4UTBH 5GS0D 2BSRB 1UYWL 1ED3A 3QSKB 1FGNL 3D2UD 5T5NG 1OTSC 1MCIA 4KRPC 5F7KC 4ODBD 3WNKA 1M7IB 4PR5B 4NRXB 4PRPB 4LHJB 1DDHB 2QQNL 4XNZB 4HK0A 5F1KC 3L5HA 5M95B 1DQJB 1OTUD 3SEPA 1B0GB 1ZLWK 5H35A 4RRPA 4P3CL 2I07B 3S34H 2O5XH 5J57B 3AU1B 3DO7A 3RVXD 1EVTC 5C0IB 1F4WH 5LXGH 1I3VA 1YECL 4P4RB 4L4TD 2BVYA 3C8HA 4J4PA 5EZJB 2A1WH 2OMNA 4JO3H 4NDMA 3PWJA 2FCBA 3VFVB 2VUOA 4JZOA 2FB4L 2CKBH 4YZFE 1A3RH 4HGWB 4QXUL 1C5DB 3GIZH 4PBVC 3ULUE 1G7LB 4ESKA 5TE4H 1BD2B 5C08D 2G75B 2A0LC 4OQTH 4QTIL 2W0LA 3HRZB 3VXPA 1E4JA 2P5WB 4XNXH 3DHMA 4J23A 5KOVC 2APBA 3TNMA 3F7VB 1QVOB 3D18B 3QXDB 5IOPB 2ZG3A 3NBNA 5EU6E 3TN0C 1IFHL 4QXGL 5IJKC 3P3YA 4FQXB 4MD5B 2P8PA 8CGTA 1LHZA 2VLLB 5J9PA 3DWTA 1RIUH 1LNUB 2FYYA 4KXZH 3U7AA 5DEFB 1F2XK 3TN0A 4MCYB 5C92A 3VXOA 1YMMD 5IJKA 3MR9B 4FFZH 1QEWA 3V2AR 2EKSB 2FX7H 2X4QA 2XKSA 4P2RA 5E2UL 3RX5A 1H0DA 1KCVH 4YBHA 4L8BB 3BP7A 3IKKA 2BNRD 2EDJA 3HC4H 5CEYB 1OQXA 1AQDB 3QCVL 2XQBH 4MJIE 4OGYH 1QUNA 3OXRB 1RZGB 4OI7A 1OSZB 5LWYL 4HWEH 5KS9B 3PHOA 2F58H 2XN9D 4LSPL 1U8IB 3ARGC 5DVOA 2CRYA 1JP5A 2VDML 4YZFF 2C1PA 3NZ8B 2BNRB 2XWJA 4QXWA 4X7TB 4YHPA 5HHPB 3MLPA 1I4FB 3AB0C 5GJSH 2A74A 3L3KA 2C3XA 2IMMA 3ARGA 4M6OH 4RMWA 2DBLL 4X7CC 2XN9B 3FAXA 1E4WH 2EDFA 4JVUA 3L9RA 3QHZH 1A7QL 4U1JA 1XR8B 4DQOH 4K7FA 4LL9A 4IHOB 1T2JA 2IG2H 3ARBC 5ENWA 3QIBB 5HJ3A 4NFBA 3EJZD 2PR4L 1JGDA 1S7TA 2XZZA 2ATPB 4K7PL 4D3CH 3CVIL 1JK8B 1FJ1B 2BVUA 4XH2B 4DGIH 1A3LL 3ARBA 1ND0A 4UDUA 3MRGB 3PHQA 1IGYB 3NTCH 1IAII 4HWBL 1LO2H 2H45A 2IBGA 2LTQC 4X7FC 5E8NA 4HXAL 3MRQA 4WI5A 2ICWB 1H3GA 1CZ8L 2B4CL 3FQWB 3GUTA 1RJLB 1YYLL 5B39G 2Y6SD 3BZEA 2AJYL 3F58H 3QDJE 1N5YL 5IB2B 2BFVL 1FL3A 1OHQA 1R5IB 5E1AA 4DKDC 5GZNC 4WGVB 2JIXD 4OUUB 4TVPH 4PRIE 1JPFB 4GKZB 5MEQB 1U58B 3QZWA 3BQUB 2DMCA 3MJ6A 4KVNH 4KQ4H 3ZDZE 3OKMB 4PRHE 4PJ9A 3KJ6L 5I18H 1QPPA 1KB5L 4KQ3L 1IAKB 4K23H 4JKMA 5KSVA 4D0CB 1HIML 5CJ5A 2JIXB 4KKCC 3OKNA 5C0JA 1N5AB 2RIKA 4WFFE 4J3SA 3F6IA 1Q9LA 3HZKA 5FUCC 1K9TA 4K3DL 1TQCB 4JPWH 2APWA 5EZLB 5I6XC 4DEPC 1G7JA 3C8DA 3BZ4B 3PL6C 4R3SB 4XC3L 4HFWB 5C0CB 2VOTA 4RWYL 2DQIL 3DUHA 5ICYB 4ODXB 4Z77B 3EDFA 3VCLB 5JW5A 2P8LB 2ZUSA 3ZKND 1WEJH 3MJ9A 4S2SB 3T09A 2G2RB 2PYFB 3ILQC 1FRGH 2K7QA 3PL6A 5T3XH 3E6HB 1EAPA 4WEBH 3EDEA 4P23B 4XPAH 5MEOA 3UPCA 4KWUA 1INQA 3V0WL 1HZHL 1P4BL 2CK0H 3G6DH 5J1TC 5HVFB 1YN6B 4LK4A 3NCEB 4C56B 4D0DA 2IH3A 4KI1A 3UROR 3QULB 1JGEB 3O3DA 4FQHB 3QPXH 4LRIC 5ICXA 4Y4KA 5TQ2H 5FKAB 4UOJA 2ADFL 3GSXA 3EYUH 3QEQB 5FYJU 1BLNA 2RAMA 5BW7C 2HTKD 3ARZA 5IBUB 3QI9D 2K3TA 5C0BD 5DMJB 5TPWH 5MHSE 5GXBB 4GXVL 1NCBL 2E9WA 4P57A 5E6IB 5BW7A 3MBXH 1EJOH 1EUTA 3VFTB 3CFKB 2H6PB 3FFDB 3UTOA 1HYSD 2AJSL 4IJ3B 4FTVE 5C0BB 5EUOE 2JJWA 5JA9A 4IDJL 1WT5C 2ADGB 2IMNA 1ZGLA 5CS7A 5F9WC 4RRPG 2L0DA 3DX9B 1ETZB 3VMNA 4AL8H 4GS7C 3RWFB 1MLCB 3O45A 1LP9E 4XMKL 1WT5A 3X3FL 4MXWH 3RTQC 4N0FB 1QR1A 2A6KA 1Q72H 2I27N 3F12A 4UV4L 5IMOB 1KJVB 2R0LH 2VLKD 1JN6A 3FN3A 1CTNA 3D85D 4ZNEA 2KQNA 4N0RA 1T7VA 2PTUA 4MNGA 3RTQA 2BHZA 4QCIB 1YN7B 4O51B 3QIWD 4Z7WB 4ONOA 1GYAA 4NQVA 4H8WH 5J56B 1ONQB 3GBNH 3D85B 3TPKA 1K2DA 2XPGB 3OR7B 2BCKA 2CJUL 3ARFC 2VIRB 3IU4L 3U0WL 2CKBB 2F74B 1HQRA 5I19L 4PJAB 3GM0A 4YXKL 3AAZB 1Z0NA 1X4YA 3DLQR 1HKLH 1UJTA 3ARFA 3N1FC 3VD7A 2DM7A 1OAUL 4OGAC 4FP8L 1IAIH 1NGPL 4MHHG 4XVSH 5CJQH 5AAWA 5J13C 5BZWA 1NGZB 5BCAA 1JWUB 2UZIH 1Z5LB 2XA3A 3W0WE 2FJGA 3VXRE 2W0PA 3BE1H 3MNZB 5C0EB 3PGFH 5EO9B 1X5JA 5GRZA 3S97C 4KK6C 5A16B 3LCYA 4U3XA 1B0WA 3UJIL 2WWKO 1LP9F 3GEWB 5IR1B 2WV3A 5CCKH 1KPRB 3VFMA 3QCTH 3MQIA 1RUAL 3IYLW 1X7QB 4KAQL 5J3HD 2BNQA 2FHCA 5C07D 2I60H 3Q5YA 5GGRY 1G1YA 3CFJA 2P5ED 3VRLE 3VGFA 2NXYD 3GJEA 3VFRB 4OI9A 5GGSB 1NCTA 4IOIB 1T1WA 1K3ZA 3I3DA 5C07B 1EMTH 2NW3A 4O5LH 1HXMA 3BSZL 5J11B 4KZEH 3BDYH 1A6UH 5CEZD 3GSUA 3LAFA 4K3EH 3I6LD 2UUDH 1RUKH 5ALCL 2KZ1B 4BQ6A 2EYSB 5IKCA 2YSSA 4P2QA 1P4IH 4QHLB 5KSAD 3EDJA 4YC2B 4RFOH 5BXFA 1T66C 4HWZA 4UOW0 43C9A 5BS0A 2GAZB 2C1OB 4ODHH 3LSOA 1IM9A 5J8OA 1VEMA 2RFXB 3F5WB 2JJSC 1U8LA 4LU5H 5ETUA 2H26B 2WW8A 3EBAA 3HC0B 1URLA 2WUBL 3ME0A 4EI5D 1FNGA 3KPQB 4DFHA 1WBYB 3WFCH 2CLZA 2JJSA 4Z0BH 2DI9A 3V5DA 5FCUH 1WZ1H 3GNMH 5HGGS 5FHBL 4TVPD 4DGYL 1MCRA 3VRLF 1OAZL 4KI5E 4U0QB 5JZ7D 5AZ2L 5EC1A 4OCLC 4M1CD 5KVFL 3EYQC 2OR8A 4K9EL 1LK3H 1FVCB 3QZWG 4XPGH 2I9TA 2ZCHL 4KHXH 3BN3B 4GAFB 5CMAB 3VGGA 1B0RA 5CBEB 4PJDE 5JW4R 5KJRL 2ED8A 3B9VA 1RPQA 1QBAA 2O5ZL 5GISL 2CIIA 4GSDH 1Y6KR 2YK1L 3O2VH 1BJMA 4RGMC 4NBZB 4M3JA 1L7TH 3NCJH 5IG7A 1L0XA 3OB0H 3WLBB 4JR9H 1JYWA 4WI3A 4LPTA 2ZG2A 1FFOB 4OIAA 4ZTOH 5FGCB 1E6OL 5I16B 4L4JA 3FZUC 3FQUA 3U83A 5J0BA 3QISA 1I8MB 1TVDA 3EO0B 4JZNA 1DBKH 2DMBA 5MENA 5T1KA 3MRLB 1ADQA 1J8HD 1OSPL 5GJTH 1JGLL 5DJ0A 3FCTB 1TVHB 4PG2C 3MRMA 5T3XD 4AEIH 1K3IA 3BKML 2VERN 3FFCA 4U1NA 2DQHH 1EXUB 2GEEA 3IJYA 4LVOB 2AI0H 4TSBH 4DCQB 5KW9H 3FQRA 4NQEA 4GG6A 1P1ZA 1SJVA 1S7RA 3GRWL 4PG2A 1A7PL 1MRFH 5J9PB 5ILTL 2E27L 2PW2B 4LAJH 4BH8A 4HK3J 3CZFB 3L3HA 4KI5F 5FOBB 1HSAB 1P7KB 1ZV5A 3QCUL 4Z7UE 1KEML 4U33A 3W81A 5DHVA 3ES6B 4KVCL 5GGUA 4PJDF 1LO5A 2NY3C 4I0PC 3TIEB 1JHLL 4KKLC 4ZSOA 5EFIA 4BKLB 3ARPA 1X5LA 4Y16D 3ZLQC 3L3JB 1JNNL 5DMGC 1FBIH 4JN2A 4OFVA 2DLHA 4Y5VC 1F11B 1F97A 1AE6L 4RIRB 4FQ1L 4I0PA 4TQEL 3MZGB 4WV1C 3QUZB 1DBAL 2J4WL 3PV6A 3QUXB 1EPFA 1X6NA 2CLVB 2YD1A 1P9MC 1K6QL 2R39A 3P2TA 4Y5VA 1QBLL 3D48R 3MRPA 5INDB 1AO7E 4LSQL 2HYMA 4WV1A 3FKUS 1MJUL 3QRFM 2CD0A 1V05A 1TZHA 3MA7B 1P9MA 4R97B 2OK0H 4GLRI 2VDOL 5FO9B 5DMKB 4L4VA 4PGBB 1SM3L 2QTEA 3VGAB 2FEEI 3P0VH 1MCJA 1KB9J 4RFNC 3HFMH 3ILPB 5J12B 3CVHH 3Q1SL 3T0VA 3DNKA 3FQNA 4WY7L 4PJGB 4JHBA 5IW6B 4NZRL 3PWLA 4YE4L 4Z7UF 4UDUB 1NLBL 3PHQB 3GMMA 4YFLF 3D9AL 4QRUB 2NY7H 2YS4A 1IEHA 5C2UB 1CDYA 4YGVA 2WINB 1A14L 5I1CL 5CHNA 3L3IA 3X14A 2P45B 4EDWL 4XPHH 1JYXA 5IQ7H 3ROLA 4WWID 5I8EA 4PUBH 1PYWB 4J6RL 1Q1JL 2LABA 4N8CL 1M4KA 4ETQB 3CK0H 1TFHA 1R5WB 2AV1A 4WI8A 5AZEH 1AD9A 4GKNA 4QYOA 1JTOA 2ICEA 5F44A 3BW9A 4WHTB 3QT2A 3ZZ1A 4KK9C 4X6CA 1TNMA 4EZMA 4FQPA 5E03A 4ZUVB 5CZKA 2X4SA 4HH9B 2Z8RA 4MS8C 4RFEA 5BMFH 1ZHNA 5LCVL 3KR3H 4DZBA 1JF1B 4L1HA 1N64L 1V7NH 5F1NB 4ZFOB 5J1AB 5BO1L 4QRRE 1X5IA 2LU4A 5K93A 1PEZA 3B5HA 1U3ZA 4I3SH 4L29A 5IHBA 2BY1A 3WIHL 1FNAA 1FNLA 4XBPB 2HJLB 3MLXH 5GS0C 2GT9A 4LLQB 3FMGL 4PY7B 1JPTH 3BEVA 4NHCH 4HUVA 4X9HA 4UDTB 4IDLA 2AJ3B 4JO2H 5K9KB 3FB7A 1H3UA 1X5AA 2N7AA 3CXHK 3LRHA 2AP2A 5I30H 1OTUC 3RVWD 3D2UA 3BMVA 1LE9B 2IGFH 1TVBA 4OLYH 1MUJA 3G5XB 3V6ZB 1CLYH 3F7YB 4JHWL 4GRLD 4I18B 3W2DH 3T2QA 5I75B 1CF8H 3DVGB 4HX1B 3U9UB 1KEGH 4HUKB 3RGHA 3IU3B 4KZDL 5D1XD 2Y36H 5EN2B 4OFDA 4HC1A 3BGFB 1HH6B 5DS8B 2ZUVA 4AQ1B 4UU9B 3V7AE 5FOJA 3TBWB 5JQ6H 3C5ZB 4M6ML 5D70L 4L4TA 4CW1A 1I8IB 3N9GH 3HG1A 5FYJH 3BHBA 4OI8A 1HINL 2OJZH 4A6YA 2HRLA 1S5IL 3R1GH 4WDIA 1FO0A 5FCSH 4O02H 3MRJA 4PV8A 5CP3H 3MGOA 4X4XA 1OP3K 3RIFK 4K55A 5I2IA 2X70A 5IESL 2VXSH 3VMPA 3MRCA 4TVSa 3ZO0A 5C08A 4LVNC 4UBDD 4PG9A 3IVKA 3D25A 3O3BA 1A6ZA 2R2EB 4Z78B 5EOCH 5EORL 5IV2B 3ULUD 2O61B 2Q8AH 1X5GA 4ODSH 1GPOL 1JZ6A 1C08A 3GSQA 4ZOEA 2DDQH 3FO1B 4P9HL 4J3OC 1AGFB 1BVZA 4P9MH 5DDHB 1QRKA 3K2MC 5I1DA 5EU6D 2A9NL 2VRAA 3H7BA 4JEGB 3DXAE 1UH3A 4IOSD 4NNPH 2OR9H 1YMMA 3SPVA 2BCKB 4Q9BA 2VL4A 4JPVH 4BUGA 2YOCA 2XOTA 1G7PB 3WYRA 2PYED 1IQWL 2GY7B 4KJYB 1L7IH 3RY5A 4X6DE 1BWMA 3QG6A 4MQ7A 3LPWA 3EO1A 3ELAT 1N2RB 3EZ8A 3GMOA 4JFPA 4Z0XA 1LEKB 3UXFA 3ARQA 3CMOL 4L8DB 3HAEA 1NAML 5FYLL 1JTTA 3SGJC 4YX2H 1Q38A 1U92B 2PYEB 1S7SB 4MCZB 5JW3H 4WU7A 2XTJB 3L3DB 3CFBB 3IDNA 4YLQT 5HYJD 3I3EA 3SGJA 4N8PA 1PY9A 2HVJB 2EIZB 3LKOA 4Y5YB 3QUKA 1G6RH 3PQYD 4EXKA 5DQDH 4Z95H 3EJZC 4G9FD 3R0NA 5IVNA 4PJHA 3S35H 2LFGA 5HYJB 4XRCB 2LU7A 4CU7A 3WJLC 3LOWA 2EDRA 1X6LA 5C0FA 2W92A 1JMZA 3PQYB 1FLTX 3CLFL 4PJBE 5SWQB 3MOAL 5F89A 1G0YR 2YEZB 3WJLA 2ZUYA 4HT1H 2Z4QA 3UYRL 3TC9A 2Y6SC 2RR3A 3F65A 3WD5L 4XAWH 4E42B 3O6KL 5KVGL 4MJ4A 1CYGA 3QEUA 5IB4B 5I66A 4LSVL 4OGXH 4N90D 1I7RB 1KNOB 5BZDB 3Q48A 5L2JA 1TPXC 1U8QB 3MCLL 3FTGB 4LCUA 5I1KH 1GZQB 1QBMH 4HGMA 4M48L 1RVFL 1TQCC 3LSOB 3S37X 1JTPA 3VFSA 4AK1A 2X4UB 3QDJD 5GRUL 3D69B 3BX7C 1T5XB 3IAPA 3F8UB 2F54B 1TQBC 4NO2A 4JDZB 3CVHB 5DQJA 4PRID 3RWEB 1OWRM 1ACYH 3FHAA 1WIOA 4YDKL 1V5JA 2NLJA 2V2XA 3QO1B 3MJ7B 4PRHD 1NFDE 3DROB 5DLML 1S3KL 3T0EE 3UAJD 2VDLH 2D31B 2EC9U 3KYNB 1I8KA 1MFDH 1XGUA 3WEXB 5GS1B 3T08A 1R3HB 3SKJH 1CICD 3P9LA 3ZKNC 4CN6A 1FH5L 4XZUB 4OD3L 4PJBF 1KT2B 3JTTA 1TJHH 2GJZB 4ZTPL 2QSCH 2G60L 4WFFD 1YY8A 2IFGA 3CD4A 2A2QT 1FNEA 4XNQB 4OKDA 1KTDA 2X4OB 2AJUH 5CEXA 1CICB 2PO6A 4NO5A 5DRNA 5HY9A 2X89A 1D5BB 3S9DB 5FV1L 5SWSA 4IRJB 4NQSA 5IMKB 2HJKA 1OT1A 4JZNB 5MP6L 1F8TL 2ESVE 1F02I 5T1KB 2HTKC 1CGSH 1C12A 2P44B 3F7QA 3GSWA 3QI9C 3ZTJH 5EBWA 2HVKA 2MMXA 1NMCC 4ZD3H 1FVDA 1HH9B 2DWEA 4W6WB 1J11A 1IGML 1QLEL 4JKLA 5KAQF 4JM2A 3U6RA 2AS5M 4KMQA 3KPLA 3SO5A 4NKOA 1HYSC 1FVEA 3H9YA 1PLGH 4M4RA 3L7FB 1AGCA 2VDQH 1MIMH 2GCYB 2JCCE 5H94A 3ZTNH 5MHSD 3HMXL 4RAUA 2QR0B 3MV11 4NQDB 2D7TH 4P3DB 1K8IB 2OP4H 4OF3A 3TGXA 2YPLB 2VLJE 5KANI 3WNPA 3HNVH 1FCGA 4FTVD 3FB6A 3H0TA 2SEBB 1KIRB 1JE6A 1EEYA 3EFDH 5DK3A 1XGYH 1B3JA 3KNBA 3WNLA 1W72A 2IF7A 4OM0H 1ZSDA 5C9JB 3DGGB 1YZZA 5IF0B 1KULA 4Y4HD 1FV1A 4BFEA 2FBJH 2Z0BA 1GZPA 2HFGH 4XP4L 2VLKA 1TJGH 2DS4A 3QIWC 4U2ZA 4NYLA 1YNTB 4HIEA 2E6JA 4LARH 4GKOA 3RX7A 3STZB 2VLME 1F5WA 2V2WA 4J8RA 4OLZH 5SV3A 2UWEE 5HVWA 1S9WB 2EYTB 3QIWA 4KDTC 1A4JA 5D1ZD 3WIFA 15C8H 3UTTB 1SHMA 1WBXA 3JWNC 1KCUH 5DUPH 3CU1A 3G6JB 1ITBB 5SWZE 3ZKQD 3OSKA 5DJ6B 5FDWA 3QQNA 1KIPB 2F5BL 1XGPA 4KDTA 2R1XA 1JPGA 1QA9B 1CDJA 5D8JL 4FQIL 2JCCF 3HN3A 4QF1B 3PWLB 5DFVD 3HS0A 5ALBL 2MWCA 1Q8MA 4FQLL 2HT3D 2CK2A 3KG5A 4DW2L 2FL5B 2DKMA 3BP5A 1J0HA 1RUMH 3SCMD 4PB9L 1DEEB 4O00A 4APQB 4PJ7A 1GHFL 3FO0H 4X6BA 4ZUSB 3MNVA 2GJ6D 2ZNWA 3QQ4A 5I17B 3KXFD 3ZE2E 5DD0H 3R0MA 3IGAB 4NCDA 4I8DA 1T1ZB 4DTGL 2DJSA 4TULH 1VHPA 3DTXA 3QDGD 5HDLA 3CFEA 5J3HC 1A8JH 1M1SA 1YDPB 3W0WD 3BKCH 3SCMB 1EA9C 3BXNB 4NJAH 3N50A 1ORSB 4JFEE 2GJ6B 4CMMB 3V6BR 2NXYC 3WKMH 1I1FB 3HAEG 3QDGB 5L8KB 2VDNL 2AQ2A 4YC2C 3KHOA 1XH3B 5ESQB 1I85C 1AXTH 3TBVA 2P5EA 1ZS8B 3PDOA 2AAVA 1FL6B 1PY4A 2YMXH 5KN5B 3NFNB 2L4OA 2D0FA 5IW1A 2DQTH 2VQUA 3OKKA 4FMKA 1NUDA 1I85A 3ALXA 5KSAC 4Y19E 4MVBD 1G9NH 3MXVL 3V6OE 2AKRB 3VFNA 4DAGL 2Y4SA 1HHHA 5CSZA 4N5EC 5D7SL 1G0DA 2B1AL 4QHUA 5I71B 5HHOB 2N4IA 4M1DH 2OI9C 5KSAA 1G6RB 2VABA 4HJGA 5E5MB 1MCWW 1F4AA 5C0AD 1AIFA 5I74C 2GT9B 2DM4A 3BUYA 4EI5C 1IGCL 1UB5A 4BSVB 4DUWA 3I6GA 1R5VA 1MQKH 1FG2B 4Z76A 1VGKA 5INCB 2UYLA 4I0KA 3D3VD 5C0AB 1FAKT 2EDLA 3HUJA 1MREH 5JZ7C 3VFOA 1A3QA 4JFOA 2ADJA 4XPTH 4JREC 5DI8A 1BVKB 1OB1A 1R0AL 3NAAH 3D3VB 2XZAL 1HYRC 3X11A 2B0SL 2E6PA 2V5TA 2HFFB 3Q6GL 1NGWB 4NNXB 4UIMA 5SX4I 2OLDA 1G7MA 5FYLE 2QV2A 5ADPL 2X41A 3V5HA 1H3TA 2UUDK 4JE4B 5MERA 4KI5D 1JCKA 1RIVL 1N59B 4L5FH 5JNYB 4DVBB 2GHWB 4E9LA 1NJ9A 4U6YA 1CS6A 3HG1B 4U6XB 1CVRA 5GRWA 3OHXA 4LP4A 4ZPVA 4BK5A 4HS3A 1U0QA 3N85L 4ZFFB 2VO5A 1HQ4A 4J7RA 4XNYL 3NN8B 3IAQA 3MGOB 5HYFA 1NANI 4PJCA 2OQJB 1WVZA 4OV5A 2R4SH 2X09A 2XWBB 1MCDA 4CMHB 1GOFA 2YC1B 1J88A 2NX5D 3MLUL 1SEBA 3FN0L 2CXGA 3WNNA 2PUQT 2OL3A 1J8HA 1ZTXL 1PZ5B 4NC0B 3ULSA 5HHMB 3WN5B 3OBAA 2X4PA 3QQ3A 5JORB 4HPOH 3UYPA 3VXSA 1OAXL 1FFQA 4QEGA 1S5HA 3V5KB 2NX5B 1U8MB 3U4BL 3RI5K 1ZMYA 3WSQL 1KG0B 2R1YA 1OARH 4N0UA 3BPNB 5C09A 1PQZB 4NHUA 3KYMB 5AYUL 1MAKA 1FC2D 3SPVB 3NFSL 4QRTB 3FN9A 4Y16C 4JM4H 1UA6L 3LN5A 5C71A 1S7XA 4QRQA 1IRAY 3UTZA 3RBGA 2R0ZL 3OB0K 2Q86A 4Z7VB 4M43H 3OJDA 3H9HB 4Y16A 3MLVH 4Q9RL 2AJXL 5I1EL 2APXA 1CXFA 4C54A 1J0YA 1RUQL 4DUVA 2IFFH 3RA7H 1NGQL 2IANE 1S7VA 4KUCF 3A67L 2DB8A 2IQAA 1ZHLA 5D71L 5LVEA 2FH6A 5GSVB 2XWTB 1MCWM 4JY5L 3IFLH 5F8RC 1WTGT 2JELH 5I15L 1HHKA 5DD1H 1ORQB 5CUSH 5LKNA 4WI9A 3ZT5A 3QFJE 4LLYB 4BZ2H 4QLRA 1QBBA 1AO7D 3SKMA 1XF3A 3TJEH 4EIGB 4MAYC 4LKXA 1U2HA 5E5RB 1W2KT 5L9DH 4KTEL 5DRWA 5IW3A 4FG6D 1CE1H 4NZUL 1EEZA 1I7ZA 2Y5TA 3HNTL 4I1NB 5BV7C 4MAYA 3MRDA 4AT6A 1YYMH 3MJ8A 2A73B 2Z4QB 1E4XH 5F1IA 3SKUD 2R0WH 4AY0A 3ULVL 4L3EE 1M05A 1BGXH 2FJFB 1T89C 4EUPB 1AGBA 1NBZA 2KKQA 4RMUA 3NGBC 1INDL 3E8UL 4LSRL 4UT7L 5H2BB 3HZYA 2HT2D 2EDNA 4JPIA 5E99H 2DQJL 2B1HL 5ISZB 5T33H 4X9GA 1DUZB 4JAMA 1BZ7A 1T89A 2E7BA 2EE9A 4HIHA 4BK4A 3PP3H 6FABH 1NLDL 2YD6A 3T8XA 3BZFB 5KZCD 1C16B 4XP9H 3MYJB 1I7TB 4I4WA 1CWVA 5KVEL 3W82A 4GBXB 3EOYG 2AK4E 1DUYA 1ZHBB 1QFUH 1T7WA 5KZCB 3KLHD 1A1NB 3ZKXB 3QIUB 4TUKH 1J7VR 4TYUA 1AQKL 1GAFL 2QADB 5D7LB 4OZIE 4MQSB 1OP5H 2YD4A 4O9HL 1UEYA 4KROD 1QD0A 4QHMA 3S88L 1UM5L 4XVUD 3D39A 5DYOB 2ERJC 1JHKH 1OOAA 2FO4A 3VRIB 3HR5A 5DRXA 1CLOL 5TFSH 3BAEH 2BVOA 3HPJB 2MPAH 4I18C 4HEPG 3VXMA 2CGRL 2FZ3A 2PO6B 4M6NL 5DRNB 4QRRD 2Z93B 3K0WA 5L7XH 2W9DL 1S9VA 2O26U 3RVWC 4PJXB 5F7DB 4G6KL 4QHKJ 3ZL4L 4F7PA 4OTXL 2IPKB 4RBPH 3WLWD 1A6WH 3IJHA 1LD9A 1GGIL 3IDJA 1NANH 1U8HB 4GRLC 4LQFH 3O0RH 2VQ1B 3O9WC 5DJCA 3O6LL 3IKCB 5LBSH 4LBEA 1F90L 2XI9A 5D1XC 1JHTA 4CDHA 3P73B 4GRLA 1U3JA 4MNHB 3O9WA 1FFNA 4JM2B 3U6RB 4JJ5A 1OVZA 1MHPH 3KPLB 3T0WA 1XF4B 5CIPH 2V5MA 1OT2A 1MWAH 1NDGA 5D1XA 2D9CA 4M9OA 2C7UB 4YQXH 5EIIB 4FQ2L 2Q6WA 4TNWF 1WCBA 3IFNH 4TUOA 1T2XA 3O3EB 3TPUB 1CLCA 4YK4B 4JB9L 3QNXB 3FT2A 4G8IA 4NP4L 1E27B 4N8VB 4UBDC 1A1OA 3O4OB 2W0KA 5K9OB 4CVXA 1R3KA 1JRHL 4KHTH 1FHGA 4AM0A 3ULUC 4M5ZH 4R96A 5MI0B 3BMWA 3O11A 5E6YA 4I9WD 1ZLUH 3HZVB 1T1XA 3G08B 4ZDHB 5F7NC 1FGVL 4QHKI 3HPLA 1NEZB 2VITA 3V0VB 1GZPB 4JY6A 1BREA 5HXMA 3SE8L 4YNYA 3DETD 1MF2H 1A2YA 1AP2A 1R24A 4Q6YA 5JIKA 4HDIB 2ZUUA 1KENH 5IMMA 4X5WA 5EU6A 2NY5L 3TBTA 3OAYK 1QFWM 4U0RB 5FHAL 3HC3L 1SJHA 4JJHA 3LKNB 4RAVB 1BQLL 1QHPA 3TVMB 1XF5B 3DXAD 1DVFB 1KBGH 4YHNA 1JPGB 4XNUL 3WL9A 4AJ0A 2BC4B 4QRSB 3UO1H 1WZKA 2HN7A 4BZ1L 5F96H 4YFEA 4M00A 3ALWA 4ZS6D 1XR9A 3TT1L 1D9KB 2XA8L 3L7EA 5IBTL 3CCHA 5KG9A 3MLRL 4X6BB 1IILE 4H26B 4P59L 5C0GB 1MJJA 4MJIA 3TA3B 4V1DB 3U46A 2XNAB 2EICA 3SKOA 4GW1B 4H0HB 3LVEA 1UQSB 3JWOH 4D94A 3CSBA 1I1YA 1MJ8L 3VG0L 1QFHA 1DEDA 5GGQH 4H20H 4YHKH 3PGCA 4UIKH 4UQ2B 5T1LB 4X4ME 4OD2B 3U30B 3K2UL 4PLJD 2C4FU 3REVA 3G5YB 1S7WA 4LEOA 1J18A 5JDSB 3U0TA 4JZJB 3FO2B 1C5CL 5DWUL 4B0MM 4LIQL 3P11L 4NT6A 1YNLH 2FIKB 3SDYL 3SN6N 3VG9B 1KF9B 4G6ML 1SYVA 4QKXB 4DK3A 1NMBL 4NO3A 5IFAH 3G04A 3PWVB 3DIFB 1J1OH 1RZKH 1V7MH 3RWHB 1E28B 2MSPA 2ED7A 5JQHC 1LEIA 4YEEA 2HAZA 2LVEA 3DUSB 4HLZG 4LCCC 1RMFH 1WWAX 4LPXA 3VXTB 4OLVL 3NPSB 4G6JL 3UJJH 3I50H 1CG9B 1I3GH 5HYSB 4HMEA 1VFAA 2CQVA 1RAMA 2D03L 1KTRL 1X44A 4GUPA 4LCCA 4O2EB 2NNAA 5LAXB 5F88A 4PJEB 3QDJA 2R2HA 2EYRB 3CFDA 3KPSB 4M61B 4YJZL 3LQZA 2YUZA 5FUZL 3TNNB 1NC4D 3UAJC 5JIHA 1HNGA 4K94H 1TITA 5EWIH 4PRIA 5D6CA 2DJ4A 4R4BA 4YBLB 3WFDH 1ADQL 1CICC 3BPOB 1Q9KA 4PRHA 4ZAKD 5DJ2A 4S0TD 4N1EA 1T04A 3NVQA 4HKBB 4U1LB 5GGVL 4DWHA 4NQXB 4GMTL 2R2BA 3KLAA 4HPYL 4ELKA 4JO4L 1RZFL 2QQQA 4X7SH 3C09B 3O2WH 1OGAE 1QLFB 3SDXE 4ZAKB 1KB9K 4ZUUB 2NQCA 4F7TA 4WO4D 1NJ9B 3MLWH 4R8WH 4RISL 3VXQA 2C3VA 2A9ML 1D5IH 4EN3B 3GJFH 2IH1A 3OHXB 3BEWA 2A6DB 3O2DL 5D2LF 4WJ5A 1B4JL 3ARWA 2P46B 3C8KB 4UV7H 1C5BH 4QWWD 4HBCH 5E2TL 5D6DC 3QYCA 4WFEE 1VADB 5ADOL 5I1AB 3RP1A 1NBVH 2ZWLT 1MLBA 4LMQE 3IDGB 3DYMA 3MUGA 2BVPB 3A0OA 3SOBL 2FLBT 5D6DA 2GIYA 4AEHL 3TIDA 4ZFZB 3KPMA 2ESVD 2ORBH 4XHJD 1EBAA 4M62L 2ZSVA 3VFWA 3K8KA 3VXSB 4K07A 5E9DE 3MV8D 2JB5L 3C5JA 4NWUL 3UCRA 3ULVE 5ITBH 1ZHKA 2OYPA 1IC5L 1P5VA 1JGUH 2OMBA 4RX4D 2XXCB 2GSGB 3BKJL 4X80H 4LNRA 1M6OA 4XXCC 3TM6A 5J6GB 2ZOKA 2WSKA 4NM4H 4OLWL 2NTSP 3SDXF 1T22A 5C2BL 2YXMA 1XCQA 1UM4H 2IAMD 2XKNA 3CDGA 4XXCA 4Y4HC 3NIDF 4FTVA 4NRYB 1UWEH 1BBDL 4PRAB 1LO0H 5F3HA 2VLJD 5EUOA 1T2QH 5L8JB 2UVFA 3NCBB 1CT8B 4MA7H 1HKFA 3C6LD 1OD9A 1UC6A 3LMJH 4UTAH 3VI3E 1CE6A 2Y06H 5CIPB 4X98A 4U7KA 4XCCH 3CXDL 2Z35B 4QRPA 2K9UA 1MWAB 4TOYL 5D1ZC 2XRAH 1LP9A 4OB5H 3WHXA 2WZPD 3GSNH 4XP5H 5EPMB 4LLAA 4ZOAA 3HI6L 1UXWA 4DZ8B 1CDUA 5D1QC 1MRDH 4FXGB 5D1ZA 2EDWA 2H9GA 4LHQB 1UVQA 4F7MB 4PRDA 2VLMD 2I5YH 2W0FB 3LZFH 4KPHL 4O2CB 5DFVC 3ULVF 1DR9A 4NQUA 1CL7L 4QY8B 2HT3C 3DMMA 4JQIH 5D1QA 3DVFA 1SEQL 3SCMC 1JWSB 4GQPH 4QO1A 4H25B 5SWZD 2HFEA 3T2NL 3M8OH 4K71B 5BVJB 1YUHA 3GIVB 4IRSD 5DJZB 2J8UB 3V52H 5A2KH 4BSWB 4HS6B 3T65A 1FN4A 3SQOL 1T3FA 3ZHLA 5LGHL 3S4SG 1AGEA 3ARDD 1U8PA 1J9CT 3RVTD 3VWJD 2ZPKL 1IGTB 3THMH 4IRSB 3OGCA 2EDTA 2Q76A 1KJMB 2YZ1A 4ZS7H 5BVPH 3SY0A 3W0WA 3VXRA 5EO1A 5FO7B 3LEYH 4JFZH 4PREA 5CJXC 3T3PE 3L95A 3O41A 1JV5B 3VI3F 3KYKL 4ALAH 1XF2B 1YQVL 4UNUA 4JLRA 1JIBA 4PRBA 4JDTH 1EBPA 3DI3B 4JFDB 3IJSA 3E6FB 2OXGA 3B3IA 3QG7L 1YPZB 4XMPH 1HDMB 5CJXA 3NFPA 1JZ8A 1JWMA 2OTPA 1XEDA 2C3WA 4M6AA 3OKLA 2FSEB 5DRZB 4MD4B 5EBMB 1J1PL 5ESVB 1NCCH 1ZVSB 1MFEH 3HA0A 1CD1B 3GFUA 3MACL 4MWFA 1WBZA 5AUMA 5F9AC 5J89A 1MCLA 4U6HA 2FGWL 3ARRA 3I6KA 5E94A 1JGVH 1Q0XL 3PV7A 5GGVY 1CFQB 4WUKL 5DRXB 1T0MB 4HKZB 3RWCA 4XNMA 3BP4B 3OKDB 2FECL 2AQ3A 2HKFL 1FFPA 1NGXB 4LDOB 5GRVK 1A1MB 2IALB 1IM3A 4X6EA 4TNVK 4TTDC 3R8QA 3SDAD 1CIDA 1IC4L 2OSLB 3IFPB 1WCQA 4U1SB 3M17B 5EA0H 4PBXA 5BRZD 4Y2DA 1EGJL 3T3PF 4S0SD 5EB9A 3MV7B 4XB8A 1KXTB 3LKPB 2VDRL 1VFOA 1OY3B 2Z8VC 4ZG1A 3QEGH 1P7QD 4KI5C 4P2YA 5E2JA 3SDAB 5BJTA 5BRZB 3IXTA 1BF8A 5T3ZL 1YEIL 1FZKA 3W9DA 4D8PB 4B50A 3VFGH 1FZOB 2IEPA 2X4RB 4LLDB 5EU4B 1U8NA 1HHJB 2VH5L 1YC8A 3MRFB 3WN5C 4CN4A 5I73C 4JKKA 4LPCA 3CJJA 5EC2A 1PX4A 3ZHDA 4PJDA 4E41E 3WFEH 5IHUH 5E8EB 5ANMB 3UX9B 4F7EA 3X17A 1HHIB 4M7LT 4ZQKB 5TDOA 3WUWB 2YZ8A 1FYTE 3O4LB 4ODUB 1KCSL 2X1WL 4F3FA 2F8VA 1QSFB 1K4CB 1RFDL 4YFLI 5FA4A 1HCVA 3A6CH 3SDDA 4G7VH 3RUGB 3MRIB 1BBJB 5LGJB 5A2IH 3CLEL 3T0BA 4ONFH 3LB6D 1EAJA 1Z9SA 3C08H 4FQQB 2EC9T 4Q7DA 1CIUA 4ONHB 3U36B 3T3MF 1UYWH 4FNLL 4F15B 3GJFB 3S4SB 1BZ9B 2FJHB 3U9PL 3D0VA 4JCMA 3O81A 4OIIL 4OIBA 4P5MB 4LNVA 3LKRA 4M93B 5GS2H 1H5BB 2XXMB 4W4NA 3MRBA 4P3CH 1PX3A 2NYYD 3CSYA 1ZVHA 3TWCL 5DQ9A 4Z7UA 3MLYH 3BOVA 1N7ML 4ZXBD 3MROB 1QSVA 3EFFA 5E70A 5GGRA 3UTSE 3T4AB 3W9EA 4KKAD 3C6SB 5KG9B 1T0PB 4AIZB 1RK0B 2NY0D 1TZGL 1ZGLM 4LPYA 2HA1A 2AK1H 5D93B 4LCWB 1IZJA 3QBTB 1RURH 2IAND 5I1IL 1MFBL 1U93B 3LDBC 4MX7A 3QXAA 4FG6C 1D7FA 2NY0B 4W68A 1A7NL 3WUZA 1UWXK 4EVNB 1F3JB 4BQBA 1A7RL 1AO7A 1OPGL 4K2UH 3U0TB 3DI2B 4RMVA 2GUOA 1SBSL 3BI9X 4H1LA 4I48B 4X4ZA 4KGLA 4V2BA 4QXGH 1AXIB 2DWDB 1OAYH 3B2VL 5DJYA 4TSAL 4HMCA 2MCPH 4YO0B 3CC5B 2JTDA 2MNUA 3FT3A 2A6IB 2HT2C 1VACA 3VH8B 1BAFL 3VXUE 1YEEL 1EHXA 4PJ5E 1CD8A 3T1FB 5IJVA 4GAGH 3GSNB 2W65B 3BH8B 3QXUA 5JHDB 4G3YL 1G9EA 3BJLA 4NFCA 4PPTA 3H9SE 4U1HB 4UT6H 4QT5B 5HD8D 1G7QA 1RULH 4HKJB 4WTWA 5CP7A 4LSPH 4OLXH 2NY1D 3LQZB 5L2KD 3V6FA 4G43B 3KLHC 4G7YL 1G9MH 3H42H 2YPVH 4PP2A 2H32B 2Z31B 4GG6F 4OZHB 2CMRL 5DJXB 3FRUA 4Z8FL 1WIPA 4R2GD 2V17H 3RJDA 1A9BA 2DBLH 3MRNA 4KROC 3C2AH 3EYOB 1OP9A 4JFHD 4XVUC 1U9KA 2Q7YB 5L2KB 1A7QH 1FC1A 2AK4D 1P84J 1MFNA 2AW2A 2IADA 2FDBP 4MB5A 1CXKA 4K8RD 1H3PL 2MTPA 4R2GB 2DQFB 4YIQA 4UTBL 4OQ1A 2PR4H 4TUJB 4D9QE 1OL0A 4K7PH 1FIGL 3P4MB 3ECBB 3MNWA 1EV2E 2YD7A 1BEYL 3WLWC 4AEFA 5DR5H 1A3LH 4L8CA 4BYHA 4QRRA 4HWBH 1E4KC 5D96C 4WJ5B 1P4LB 3TCLA 4MNQB 1RHFA 4OFKA 4G8FA 3TH2T 1N6QH 2J12B 1UGNA 3VRJB 3LEXA 3S34L 2O5XL 2B4CH 4YK4C 1YYLH 1GIGL 12E8H 3A6BH 3X13B 5HHQB 5LXGL 1F4WL 2BFVH 4MYWB 3NA4A 5EO0B 1DQTA 2DQCH 3O4OC 2A1WL 2EKJA 3CPLB 4D9RE 4PJ8B 1T21B 2CDEB 3OKEB 3HMWH 4LLWA 4NZTH 5JXED 1YA5A 1KB5H 1A3RL 4M1GL 1OP5K 3OKOA 2MCG1 3RIAK 3DUUB 1OF2B 4QTHA 1HIMH 2E3VA 5TE4L 1ZLWH 3DX7B 4OQTL 4NCC2 4POYA 3FO9A 3IDYB 3QA3B 3FQTB 3RY4A 4G8GE 2W9EH 2PKDA 1KCRH 2C9AA 4P4KD 1M7DA 4K3DH 4U1GB 2DKSA 3MO1B 4G6FB 5HI5C 3OZ9L 2VLRB 5JTWA 4L3AA 5HGHA 2DQIH 4OCWH 5ACZB 5I76A 1HSBA 1RIUL 4RBPK 4PRPE 3UTPD 4IIQB 3DETC 3CDYA 4YAQB 3RHWF 4AENB 2ARJB 1KLFA 3CX2A 2YA1A 4FFZL 5FA3B 3MLZL 2FX7L 3N1QC 4QRPB 3HKFA 3V0WH 4GOSA 1KCVL 1HZHH 1P4BH 3HC4L 5DSCA 3UBXA 2VQTA 2ZSWB 2XQBL 4R6UA 5IM7B 4IMKA 4F33B 1YMHB 5TF0A 3AS1A 4HWEL 3BGMB 2F58L 2YN3A 3EDKA 1DN0B 5GSRB 4NKIL 1FZMB 4ZS6C 4CADB 2QKIB 3DXAA 4AYFA 3DRQB 1F4HA 3U2SA 1BD2E 1NEUA 2K1MA 5MEPB 1MAJA 5J1SC 2RBLA 1J0KA 3UTQA 4M6OL 2P5WE 3VDBA 4LGPB 1BM3L 4GXVH 3SGKC 3WFBH 1NCBH 3LEVH 1E4WL 4HLJA 5GZOD 2BY3A 3QHZL 3TO2A 3CX5J 2DIBA 3WS6C 5EZIH 4DQOL 1ZLUK 3X12B 2VAJA 3SGKA 3EJJX 5I9QB 3G5VB 3S36H 1U8PB 3OF6D 4MJ6B 4WWKB 1DJSA 5GS2D 3TYFB 4PLJC 3AREA 4IDJH 4ZUTB 1D5MB 2OTUA 2JE8A 1K5NB 2YN5A 4D3CL 3WS6A 4JDVB 2WIIB 5T3ZE 1E6JL 3B9AA 2R29L 2VISA 4DGIL 1TTUA 2D4FA 3S36X 3RNQB 5CD3B 5D4QA 3LS4H 4PRBB 5DO2D 4NN6B 5IK3B 1EJ6A 1KLUA 4JO1H 3S5LB 2X1OA 2VXUL 4X99A 3BWAB 5DJ8B 5KS9E 1ZLSH 4S1DD 4LSTH 3AY4C 3DVNB 1DQLH 5L0QC 2BNRE 2VE6A 4X6FA 5IQ9B 1PG7W 4TVPL 3S3SA 1X4ZA 4PJBA 4KVNL 2CJUH 3G6AA 4KQ4L 2GI7A 3PABA 4S1RH 3AY4A 4XWOD 5B38B 4ZO8A 5I18L 3U0WH 5E94B 3STLA 5ELIA 2Z9TA 2XN9E 3BPOC 5C8JA 5I19H 4K23L 2XFXA 3P4OA 1P2CA 3ISWA 4YXKH 4H5SB 5FB8A 4H1LG 4F80A 4LLVA 4M4PA 1ZK9A 4JY4A 3T2OA 4ISVB 1FLRL 4J3TA 1OAUH 1RUPH 2X4TB 4FP8H 3C09C 2NXZD 1V3KA 4PY8J 4JPWL 5DTFA 2COQA 2VL5B 2BVTA 1NC4A 4PYHA 1FSKB 3GRWA 2VMFA 3AS3A 4X0KA 4XGZB 2OL3L 1I1AD 1WEJL 2P48B 1FL5B 1WUNT 1RUAH 2DTSA 4QOKB 5T3XL 5F7UA 5ICZA 4XPAL 5T1MA 5IWLC 4KAQH 5E5UB 4P5KB 4WO4C 2J8OA 1NFDA 4NSKB 1N0LA 5KS9F 4JG1L 4HZLB 3T0EA 2CK0L 4M3KB 3G6DL 4LRNH 4NRZB 5IWLA 1WZMA 5F7EH 1SBBA 2WAHA 4QWWC 2VJXA 4WO4A 1DSFH 1MCOH 3P77B 4KFZC 5HDQL 3MREA 4OV6F 1B2WH 4MA1B 2IBZY 1FZJB 3RPIB 1V8HA 4K3HA 1MHEA 3QEHB 4XHJC 2V7NA 2BSSB 5TPWL 4HUWB 2NTFB 2YHGA 2DD8H 4G6AD 4HKXB 3TO4B 1HEZA 2CUHA 3HE7D 4O58H 4PY8I 3MBXL 1EJOL 2ITDA 4LKCB 1IEAB 4HJJH 5JO5A 2ESVA 1SYSA 5C0CE 3ZE0E 4U1MA 3LRGA 3QO0B 3VWKB 5CFHA 1VPOH 3BYTA 1UZ8B 2ZP0T 2YKLH 5TE6H 1KFAH 4FQCL 43CAB 1U3HB 1XFPA 4O2FA 5E9DD 1I3UA 4AL8L 4ELMB 2IAMC 3SHSA 2EDHA 2X2YA 1VESA 3DYOA 5DFWH 1NDMA 4MXWL 3I84A 5HVHC 1HWGB 5FHBH 1Q72L 4C56E 5E08L 4BFBD 5C1MB 2YPKB 3IRZA 4JRXB 1UH4A 5ECJE 2DYPA 3UJTH 3GJFK 2JCCA 5GGSY 3CSYB 2IAMA 1WTLA 3C6LC 4K9EH 4U7SA 2MJWA 4R7DB 4BM7A 2VLJA 4XXDB 3VD9A 4URTB 5CKAA 4H8WL 3RWJA 2YK1H 3QEQE 4G80A 5BV7L 1S8DB 2FBOJ 3C6LA 3GBNL 4NJ9L 1A4KA 4PJFB 5JHLL 1XGTA 2RQ8A 4HHAA 1KB5B 3G5ZB 3VA2C 4OLUH 2G9HA 3V7AG 4NN7C 4WI2A 4WUUB 2GSIA 3WIIH 4PGEB 3LV3B 3LIZL 4ODWB 1HKLL 1CFTA 1R3JB 2WMPA 3BIKB 4PRNB 4YHMH 1OW0C 5C0BE 3ZE0F 2A38A 1JGLH 5FKPA 4XVSL 1IAMA 3VI4F 1W8NA 2UZIL 3ZYJA 5FF6A 2UWEA 4IMLB 1PKQB 1AY1H 4IRSC 3PGFL 4WENB 1EHAA 1OW0A 3C9NA 3P9MB 2JB6A 5EU5A 4ZFOL 5SWZA 1D6EA 3ARDC 5ILTH 5D2NB 4CN1A 5CILL 3MOQA 3RVTC 3DBXB 4ODTH 3UBXG 3GBLA 3VWJC 1U95A 4AZ8A 3O8XD 4AH2B 4HEME 1FG9C 4S11A 2IPUG 4F2MB 1KEMH 4LLMA 2I60L 1EFQA 3ARDA 1U36A 3VFPB 3VWJA 5DGQA 2P8MB 4MA3A 5HPMA 2ADIA 1ODAA 4O4YH 4JGJA 4Z7WE 4YDVB 5IHZB 2BVEA 4XWGH 4ZO9A 5DK0A 3DURB 3I02A 2WWMC 3O8XB 4F37F 3VXNA 3GBML 3RDTD 4KJPD 2WBJB 3NPZB 3EOBB 4KZEL 3BDYL 1QQDB 1A6UL 4NPYB 4R90H 5D7IB 1MH5B 4PJAE 2J5LC 1ES0A 2R23B 3FHQA 3V6FB 3PWUA 3RGVB 1XGQB 1X9QA 4DGVL 4JFEA 2B39A 2N56A 3DSNA 1P4IL 3FOMA 2BJMH 1QBLH 2W91A 3RDTB 3HCVA 4RFOL 4LSQH 3KPOA 3GSVA 2VTFA 1B9ZA 4P3WA 1BX2A 1N8ZB 2VDOH 4OAWB 3V6OC 1MCQA 5DZLA 2IADB 3BESR 2PXYD 2J6EH 3HZMA 4OZ4B 1BOGA 3RAJH 3I75B 4LU5L 1RZKC 5ESAA 1H8SA 4Y19A 3P0GB 1HOCB 1BFTA 5GGTH 1SMOA 4C83B 2ZOLA 3V6OA 2UY7A 3Q1SH 1MCNA 3MNWB 1NC2D 3MRRA 3SDAC 4Z0BL 4NZRH 4YE4H 1JUFA 5HDOA 2OXHA 3GSOB 4FZ8L 1WZ1L 5FCUL 3FB8B 1X4XA 3MFFB 1EHNA 4UI2A 1QYGL 4JANA 4Z7WF 3KJ4B 1A14H 1JNLH 2C4FT 3CXHJ 2DMKA 4EDWH 1LK3L 3L1OH 2J1KA 4OLEA 4GRMB 1S7QA 4XPGL 5C07E 4M5YH 4PJAF 1UCTA 2EDYA 3ULUL 1L7TL 3NCJL 1ZA3B 1XGRA 1Q9OA 3WFHA 3BH9B 1P7QA 2VAAA 1T83A 3VGBA 1EHLL 2F19L 2AERT 5JLZA 4ZTOL 3B9KD 1DANU 4LLUA 5IB5B 3I6LE 3HE6D 1DBKL 2DAVA 1CBVL 4BFIB 1Q94A 4LOUD 1NAMA 4LHUD 5HYQA 2JJTC 3DYPA 3JV6B 2BSTB 4GRWH 1WC7A 4AEIL 5IVXB 3QJHB 3CUPB 1IAOA 3MV9B 3MLTB 3DVIA 4TSBL 2AI0L 3PJSB 5KW9L 1W0VB 5KAQG 2JJTA 3S98A 3IF1A 4E41D 4BQ8A 5I76B 1YEHH 3LB6C 3QUMH 1FYTD 1VKXA 1ZWIA 5EOTA 3WIHH 5IEHA 1I1CA 3C60D 1SVCP 2NPLX 2EEAA 3VFUB 5FO8A 5I8OH 3PWPB 3VDAA 4JQVC 5HGBB 3IDMB 4TVPE 5B8CC 5I1LB 2VR5A 3OR6B 5HDBE 4I2XB 1FBIL 1HHGA 3BVNB 5TH2B 4Z6AT 2NYYC 1PSKL 5FGCE 4Z5RB 1Y6MR 3RNKA 4JHWH 5B8CA 1QFWI 4ZXBC 2ZCLH 1NUNB 4P2OD 3SGDI 3GSRB 4KKAC 4CVZA 1L0QA 4ORGB 5DHXB 4U31A 2QBWA 2Q20A 1NBYA 2NY0C 5C0DA 4KZDH 1X5XA 2BDNL 2RB8A 3JVGC 4ZXBA 4NN5C 3OWEA 1MHCB 4M6MH 2OK0L 5DXWA 2D7PA 5HI4C 4PLKC 5D72H 2FATH 4NZDA 5JOEA 4AG4L 5FECA 1HINH 3SDCC 3UTSD 1Y18B 1I75A 3AREB 1K8DB 3P0VL 2OTUB 5T3XE 3CVHL 1I9RH 1DLHA 2IANA 3W11D 5DD3H 2A6JA 4WW1A 5TF1H 5EIQA 1KGCD 3HUJF 3U0PA 3SDCA 5D9SA 4D0BA 4I5BA 2JK5B 3RZCB 4AMKL 2R15A 4XCFH 4N0CD 4XMLH 2FWOA 1T1YB 2X7LB 5HDBF 3QFJA 1CLZH 1S9XB 4CVWA 4XPHL 2GK0B 5IQ7L 1RK1B 4P9HH 3TYGH 5D7JD 1EFXA 1Q9WA 2ZJSH 4UUJA 2AJZA 1A6TA 5JMOC 1XIWD 1IGIH 3S96A 1CFSB 3FOLA 3EJYD 3CK0L 3QWRD 1IBGH 5DURB 3WDHA 2P24A 2E6QA 5D7JB 5AZEL 1U8JB 5HD8C 5IMLB 3CH1A 4L3EA 5TDPA 5ERWB 4GH7B 1EX0A 3VXUD 2FR4B 2NY1C 1XIWB 1MI5D 3MTRA 2W60B 1AKJD 4R2GC 3ARUA 5BMFL 2O5YH 2VKWA 3KR3L 2UZXB 1AD0B 5EZOH 1YEDB 3H9SD 3OPZL 1I7UB 1HXYB 4PJGE 2YD2A 1V7NL 3B9DA 1MI5B 1MHHA 4JQXC 3TZVA 3SE9H 1PFCA 2CR3A 4FZEH 5A1AA 2GTWB 4I3SL 4NO0D 2BOCB 3PNWB 4LFHD 5TDNA 5E95B 4K8RC 2PF6A 3NOIA 3MLXL 2AK4A 4M7ZB 4DKEH 5KBNC 4JQXA 1JPTL 1KPUA 5T5FH 4U1IB 4HIIA 1A6PA 3NABH 3BT2H 3JTSA 4M8QA 2PW1B 5BQ7A 4JO2L 1M71B 3LQMA 3AXLB 3M1BA 4U1KA 4OZIA 3OV6A 3QNYB 4MD0B 4B7IA 5I30L 1NGYB 2H3NA 3RWDA 3SBWC 3MODH 4OLYL 1NCUA 5I0ZA 5LQBH 2HG5B 4D9QD 4N9GA 4CU6A 4CUCA 1UM6H 1OM3H 3W2DL 2VZOA 5DHYB 1KIQA 3O6KH 5K9JL 1MHEB 5KVGH 4JKWA 2VNCA 2OJEA 3ESVF 1EO5A 2Y36L 2EE6A 5DD6B 2CDFA 2YD3A 3MCLH 2YWZA 5JXEC 5KVDL 4MXVE 4XBGA 5J6HA 3MCKA 3PIQA 5AD0A 5FYJL 4FFWD 3GHEH 2AEIT 4I0CC 2CIKB 4PJGF 4U05A 2OJZL 4YHIA 3TCXA 3R1GL 2CR6A 4NFDA 1I3RB 4O02L 2H8PA 5JXEA 1DE4B 4NOBA 5CD5D 1EO7A 1GGBL 1RZJH 4IIQC 1G6VK 4LF3A 1WFTA 4P4KC 1JZ2A 2VXSL 4YDKH 3NCMA 4HUXA 3QDAA 1I9EA 1DBJH 5ID0A 2M26A 5EOCL 5DK2B 2Q8AL 4HCRA 4ODSL 1IGJA 4P4KA 3O3UN 1QFWH 1DZBA 2DYPB 2E7MA 3UPRA 1RZ8B 4LCYA 4YPGA 4OCSH 2DDQL 4P9ML 1J12A 5C6WH 5F70A 4PV9B 4IEFB 1CFNB 2BHUA 3LHPL 3SJVD 2BOBB 5ACMA 3QHTC 3LRSA 1CFBA 4G9DB 1OP3H 2OR9L 1PD6A 4MDJB 4YDJA 1A6AB 4PJIB 4PRPD 1OAQL 4G42A 3GMNB 4PLOB 5E8PB 1L7IL 3DX8A 4FN0A 3SJVB 4Y8AA 4MXVF 1QLRB 3C5SA 5MP6H 5JA8B 2F53B 4BELD 2UZYB 4MSWA 2Z92B 4GRWB 3IDUA 2D7MA 4LASL 4YX2L 2BY2A 3L3OB 5JW3L 2E7CA 1AC0A 3DECA 2GITB 3L5IA 2AABL 3DHJA 3OXSB 1IGMH 3P0YH 5GZOC 4PTUA 32C2B 3MRKA 1T03H 5JPMB 1UH2A 1EZVY 1C7TA 3QUMB 3FB5B 2AXHA 4MHHI 5ID1A 2BVQB 3CFIC 4JFYB 1NCAH 4F7CB 1G6RL 2XT1B 4JFFB 4UMGA 4TPRL 1BD2D 4YXHL 1ZT4B 5EUKB 1ZT1A 3RL2B 3QFDB 3DX6A 3V8CA 2P5WD 3WE6B 3HMXH 3DO3A 3KPRB 1G7HA 1KLGA 1TETH 3K7UA 4NKQB 3MMEA 2RGSA 1DLFH 5DO2C 4YHLH 5CSGA 5DJAA 4FQXD 1GOGA 4NKDB 2ZNXA 4HT1L 3GZKA 4CJ0A 4JRYB 2IBZX 4MQXD 1PZUB 4G8EA 5T3ZD 3T4YB 1BFOA 1A9EA 4Y89A 2YBRB 2VDKH 1LK2B 1VENA 4X4MA 5CWSA 5JUEH 3JV4B 3S37L 2VWEE 2FX8L 2Z8WC 5C7XH 4R7NA 4L8SB 4E5XB 4UQ3B 2PYEE 3IFOA 4XWOC 1HI6A 5I1KL 1BX2B 1QBML 5IVZB 1AC6A 2XTJE 3LN4B 3WDIA 5KSBB 3K4DA 5IEKA 2NY2B 5IT2H 1FSKC 5EBGA 4GG8B 3P4NA 4HSQA 4C57C 3RL1B 2F5BH 1QSEB 1U42A 4TRPH 3PXJA 2NXZC 4MZ2A 2BMKA 3QWOB 4OFYD 4DN3H 5HYJE 3K46A 5IFJA 1N3NA 5D2LA 3KYOB 2EXWD 3V79C 1W0WA 4FQLH 5GIRB 4BH7B 4MJ5A 1MFDL 4DW2H 5DUBB 1J10A 4GKSA 5E8OB 3ULUF 4PB9H 1I1AC 1VEPA 1C1EL 3PQYE 3SO3C 3OX8A 3MBED 4Y5XC 1LO3L 1T5WA 4EDXB 4G9FE 1TJHL 5B4MD 1NSNH 3QIBD 2QSCL 3B5GA 1S7QB 2CLRA 3LQAH 3FQXA 1I1AA 4E0RB 3E2HC 4Y5XA 2AJUL 1KC5L 2QL1A 3BPCA 2NY6B 2R1WB 3CSGA 2AXFB 3MBEB 2APVA 2Y25A 4LMQI 3QH3A 3JUYA 1ZAGA 3AMLA 1DQDL 3WO4B 1MQ8A 2VXVL 3V4PL 1D3CA 4X7EC 3KDMB 4DOHB 1R3LA 2AXGA 5E2WH 2ATKB 2V9RA 2ZUXA 1VFBA 1OGAA 4JGUA 4CNIB 1U91A 2F54E 3SDXA 4N90E 1KXVC 1O5DT 1UEMA 2XACC 2Y1VA 3CU7A 3PXHA 3MXVH 4FRWA 4G6AC 1QRNB 3BQUD 1RJYB 1WWCA 3T77B 3HE7C 2AV7B 4XBEH 3IS0X 3DV4A 4OZGB 2H41A 4G5ZH 3R06B 5HBBA 1FAIH 3V4VH 1PLGL 5IEHB 1K85A 1MIML 5EBLA 3EOAA 3ZTNL 3VW3L 3WS3A 2D7TL 5HGDB 4P46D 2X4NB 1XMWA 1K4DB 1LDSA 4U7MA 3ULVC 4HUUB 4LCIL 5DEGA 5C0CD 2CUMA 3TBYB 3EFDL 4XCEA 1U8KA 3DRTB 5IGXH 1XGYL 1T0NA 4HV8B 4P46B 1DBMH 1RSFA 4OM0L 4ZFGL 4PGCB 2OTWA 1P84K 1JNHB 3CIQA 2VN4A 2FBJL 4P23D 2NCMA 2VXTL 1IL1B 3S7GA 1T20A 2IPUK 2B0SH 1XCTB 3GMRA 5IIEB 1KTLA 1QP1A 2HJFA 4QXTB 5ADPH 4LARL 1NFIB 3QJFB 1CDGA 5HI3D 4C56D 7FABH 4BZYA 3NACH 1A7OL 3IETA 5L6YL 3TJHC 4LSDA 2XY2A 1QNZH 4Q2ZB 5B22A 3FT4A 3GB7B 1H3VA 1UJ3B 3DGCR 1KCUL 3TBSB 1RZIB 2GFBA 1W0YT 3QEQD 4ZPTA 1RHHB 3KPTA 3EOTL 4X8JA 4P5TC 4Y1AD 1CU4L 3BO8A 1BVLB 3EGSA 3ROOB 3ZDZF 3MLUH 4OKVB 3FN0H 4NQDE 4I5BB 1F2QA 5E6ID 2YPLE 2I9LA 2N7BA 2NW2A 3FO0L 4P5TA 4Q6IC 4BFGA 2LVCA 4LRIA 2Z91A 5DD0L 1OAXH 5F6HJ 4QHNB 4Y1AB 1P7HL 4TULL 1LE5A 3U4BH 2VZVA 4Y8DC 2E9BA 3O6FB 3BKCL 4Q6IA 4NJAL 3Q6FB 1AHWC 1S78D 3KPPA 2DQUL 4OFIA 3WKML 5F9JB 3NFSH 2AJVH 1J1XL 4K3JH 5E7FA 4RZCA 1UA6H 2P24B 4P0DA 3RDTC 4KJPC 3EYVA 1JRHI 2QHLA 3P9WB 1AHWA 2UVEA 4XCYB 5FYJE 3ZKMD 1LEGA 4OSUH 1J05B 1BIIB 2YMXL 3L5WB 3UTTE 4DK6A 35C8H 2DQTL 4LPVA 5D5MB 3G6JE 4HAGA 5E2VH 3ZE1E 1H8OA 1G9NL 1NGQH 1U8OA 1WFOA 2R8SL 3A67H 4HXBH 3QUYB 2DQDL 2FIRT 4R0LC 5D71H 3TZVB 4Y4FD 5HGAA 4M1DL 4ZUWB 1X3DA 3QNZA 4HIJB 2PXYC 3IDIB 4OF6A 1AGDB 1Z6JT 3SKNA 2ARWA 3OL2A 3QAZB 4MB4A 4R0LA 1BQHA 2HLAA 5B39B 5F6HI 1IQDB 5E4EB 4IS6B 5IB3B 2PXYA 1EO8H 4Y4FB 2GTZA 1MQKL 5BQ7B 1YNKH 1FORH 2E9JA 3ARTA 5FK9B 1QKZH 2A83B 2H3NB 4GJTB 4UINL 2GJ6E 4X4YA 3KXFE 4JFXA 1NC2A 1T4KB 4RGOH 1BJ1J 1S9YA 5EUOF 3QDGE 4XPTL 1D5ZA 3BP6B 3CX5K 1F6AA 3REWA 2PTTA 3GGWB 3NAAL 3O3AA 2NY5C 1N0XH 4NQCB 2OJEB 2P7TA 2XZCH 3E8UH 2AVGA 5SX5K 1ZA6A 4PYGA 3D0LA 4L5FL 1FNFA 2DQJH 3QDMD 2B1HH 5CBAB 3ZE1F 3MJ9H 4NNYB 3X3GL 1OTTD 3B9KC 1J0JA 4I77H 1TENA 4PFEA 3HE6C 2MHAA 5HHOE 2RCSH 1TCRB 5DD5H 4LOUC 1TZIA 2YXFA 3B9KA 5KSUB 2ID5A 3QDMB 1UB6A 1XAUA 2Y7QA 2R4SL 3HE6A 4JG0H 4KH2A 4UAOC 5HHNA 6CGTA 1C8PA 3BRGC 2DM3A 1II4E 4LHUA 5IB1A 1LDPH 2HWZH 4L3CB 1Z0MA 3ZMRA 3NCFB 5JPNA 2Q8BL 4GW5B 1Y0LA 1AQKH 1GAFH 1HILA 1QO3A 3DV6B 4KDWA 4X5XB 5C0AE 1RJZA 2L7UA 4WCYH 2LAAA 2BNUA 1UXSB 3C60C 3W39B 4FABL 1UM5H 4Z7QE 3S88H 3L3GA 4XVJH 4MMXC 4E41A 1D5XB 1H9VA 1H15A 1T7XA 4WW2B 1FYTA 4RNRB 3D3VE 4S1SH 5I8CB 4KUZL 5L88H 3WHE0 2QEJA 3C60A 2GQHA 4GW4A 4JM4L 3U79A 4FXKA 4G6KH 8FABA 5L8LB 1ED3B 1S7UA 4OTXH 1NMAH 3PDDA 3HLAA 4M43L 1GGIH 3C5SB 3MLVL 4P2OC 4MSWB 1CXLA 2AEQH 5I1HH 2PCPA 4F58L 4F57H 2DOCA 4GAYA 1LWRA 3MPCA 3RJQB 4HK0B 5CZXC 2HLFD 4UOW1 4J4PD 3CMGA 2IFFL 5H35B 4OZFA 1RY7B 3TV3H 3MRHA 4KRPB 4P2OA 3DO7B 1KPVA 1AXSA 1OLZA 4EI6A 1DQQA 5DD1L 5HHME 5CUSL 4CJ1A 4J3VA 4R26H 4NDMB 4BZ2L 4PGDA 3PWJB 3W11C 5ABDE 2ZUQC 4RQQA 3TLRA 2NX5E 3KWWA 2V5SA 1IJ9A 4JZOB 3RWGA 4Z7QF 5L9DL 2YRLA 4R4FH 2V7HA 3UTSA 1CE1L 3S3PA 5ITFA 5TJWK 1XZ0A 4YHYC 4KKBC 1JRHH 3K8MA 1KJ2L 4C58B 4N0CC 1N6UA 4NKMA 1GC1C 5EU3A 3VXPB 1T7YA 5CINL 1P53A 1YYML 1OGTA 1BFVH 3TNMB 1E4XL 1I9IH 2R0WL 1N26A 5D7JC 1BGXL 4HW6A 3H7LA 3PDGA 4Z7VE 4JHZA 4P2RD 2P8PB 3E0GA 2FYYB 3EJYC 5E99L 4YHZH 4BA8A 4AIXA 5F97E 3TN0B 5T33L 3VXOB 2X05A 1JZ4A 3UDWC 1QEWB 5FHAH 5E00A 2X4QB 3HC3H 4P2RB 3O2DA 2YD8A 1H0DB 4GFTB 1MVUA 3QWRA 4L9LC 4XP9L 3BP7B 3QUZD 4PB0H 5JMRA 3QUXD 3UDWA 5JR1H 2J8HA 3U4EA 1UACH 4XNUH 3VXUA 5DA4A 1QFUL 5SV4A 4PJ5A 4H0GA 4L9LA 2EIDA 4M7LL 3PHOB 2ENYA 1AI1H 5D2LB 3L6FA 2C1PB 2XWJB 1LO4H 4YHPB 1MAMH 1ZGLP 1AKJA 3MLRH 2A74B 3OX8B 1MEXH 3L3KB 3GMPA 2V5YA 3H9SA 1IEBA 1N4XH 3ARGB 3ETBF 2V2TA 1TTGA 2X42A 3LKSA 4FFVD 3TESA 3L9RB 1Z9LA 3AB0B 3BAEL 4U1JB 5TFSL 1VCAA 4NO0A 3KPNA 2MPAL 1MJ7L 4X9IA 4Z7VF 5FYKU 4K7FB 5JIIA 1UCBL 3PGDA 3WBDA 5L7XL 5ENWB 5HJ3B 1C5CH 5DWUH 1JGDB 1S7TB 1CL7I 4LIQH 5ISZE 3NH7H 3Q3GA 1A6WL 5F6IC 1M7XA 1G7IA 3LD8C 1R3LB 3ARBB 1ND0B 4PTTA 2P49B 3MSPA 5LBSL 3QPQC 1O7SA 4LVHB 5E8NB 2EDKA 3MRQB 5EG6C 3HNSH 1BQHG 1MHPL 3GUTB 4PJ9D 1EZVX 4WGWB 3BZEB 4KK5D 2LTQB 1FL3B 4OLVH 2EDDA 4XPFH 4YQXL 2G5BA 5E1AB 3IFNL 1CCZA 5D7LE 4MDIA 2VYRE 5CD5C 2HRPH 3QZWB 1NAKH 4PJ9B 3WDJA 3MOBH 3W5NA 1RI8A 1X5KA 1GGYA 5KSVB 5CSBA 4KHTL 4J1UA 4KKCD 2J88L 3LKQA 3OKNB 4NWTH 3IXAA 5C0JB 1ADQH 1RV6X 1RU9H 1Q9LB 4PJXE 3HZKB 5F3BA 3IAGC 3VE0A 1G7JB 3RWIA 4GMTH 4WNQA 1U6AL 5JW5B 1SJEA 4G8GA 5I6XB 3NA9H 2XG4A 4V2CB 4DEPB 1P5UA 2ARJQ 2BSRA 3PL6B 4EXPX 4XNZC 1KENL 3DSFH 1EAPB 4XP1L 5MEOB 2FECI 4Y4KD 4KY1H 1INQB 1M7IA 4PR5A 3O2DH 5DHVH 4NRXA 4PRPA 1DDHA 3RQ3A 4D0DB 3OAUH 3MYZA 2IH3B 1DQJA 3OGOE 1KBGL 1B0GA 3Q5TA 2VN7A 2I07A 5E8DH 3UO1L 5ADOH 3O3DB 5F96L 4LSUH 5HSFA 3P40A 4PP1D 5ICXB 1DANT 3AU1A 4Y4KB 1Y6NR 3SOBH 3BRFA 5A2JH 3GSXB 3C5ZD 5C0IA 3RVXC 3RVUD 4P4RA 4JVWA 4TNVF 5DUMH 1BLNB 5EZJA 3GHBL 3OAYH 2J3SA 1XF1A 5I1JH 4LEXH 3JWOL 3VFVA 4PJXF 4Z7OE 2WUCL 4P57B 4YHKL 4Z9KB 4HGWA 1C5DA 1IC5H 4UIKL 1G7LA 4CDGC 1BD2A 3L5XH 1AR1D 3HRZA 2DI8A 3BKJH 2P5WA 4I9WE 4FQXC 2OBGA 4OLWH 3F7VA 1YNLL 1QVOA 3D18A 4L8SC 5IOPA 2FO1A 1ZGLB 5F9DC 1EGJA 4MQXC 4OZFG 3BKYH 3I9GH 5IFAL 4MD5A 2JKXA 3O45B 1ZXQA 1J1OL 2VLLA 1QR1B 2BK8A 1RZKL 2A6KB 5DJDA 1NL0H 1CXIA 3F12B 4MCYA 1JN6B 1VGEL 4GS7B 3MR9A 2B2XH 2KQMA 2EKSA 3CXDH 4DVRH 4MNGB 3RTQB 1G0XA 1KN4L 3CGTA 4L8BA 5EIVA 3UJJL 5CEYA 1I3GL 4NQVB 3I2CH 3HI6H 1AQDA 1WISA 2IPTL 4GLRH 5GRXG 1K2DB 4V1DE 2WP3T 3OXRA 1RZGA 1OSZA 5KS9A 1HQRB 1I9JL 1U8IA 3AC0A 4Z7OF 4X7TA 3NZ8A 2BNRA 3EYSH 4M9PA 2CO6B 5HHPA 2XTJD 3Q2CA 4S1QH 2EXWC 4K94L 5EWIL 3H6JA 1I4FA 3ARFB 4JFXB 4OFYA 3MBEC 4W6XB 2XN9A 5BZWB 5B4MC 1D5ZB 4NUGH 3QIBC 4TNWK 4IRZL 1IARB 3WO4C 2FJGB 3MXWH 2BNQD 1XR8A 2GYSA 1WAAE 4IHOA 4YDIH 5LGHH 4NGHL 2HH0L 4XP6L 4X7SL 3O2WL 5J13B 3QIBA 5TQ0H 4KTDL 1MSPA 3F62A 3HI5H 1TXKA 3B83A 1FCCA 2ATPA 3VFMB 1NFKA 1IVLA 2D0HA 3MLWL 1JK8A 1FJ1A 4R8WL 2BNQB 4XH2A 3MRGA 1IGYA 1Z3GL 1YQVH 3CFJB 1C5BL 4HBCL 3R8BB 3QG7H 4I3RL 4MA8L 3U7YH 2Y7QB 3E3QE 3GJEB 5GS0H 3S35X 3K1DA 1BQUA 1NBVL 2ICWA 1T1WB 2YA2A 3ET9F 2NW3B 4POZD 4EBQL 1RJLA 4PJEE 1HXMB 3BQUC 3KPSE 3GSUB 5IB2A 4X6DF 1R5IA 1J0IA 2ORBL 3MACH 1JPFA 4LFHG 5IKCB 2YSSB 4GKZA 1KN2H 4N68A 1JF6A 1U58A 4P2QB 3BQUA 1LGVA 3LS5L 2F54D 2FGWH 3OKMA 5BXFB 4HC1H 4HWZB 1Q0XH 5ITBL 1IAKA 43C9B 1H15B 1UKQA 1WFUA 4WUKH 5BS0B 3JWDC 5DMIH 4D0CA 2D4DA 4WU5A 5HHXH 1IM9B 2JIXA 1WAAF 2HKFH 4X80L 1GJIA 1PG7H 1U8LB 5FGBC 4A6YH 1N5AA 4NM4L 5ETUB 3BUTA 1FO0H 4XC1L 1PEWA 3SQBA 5EZLA 1FNGB 4WEMB 1UM4L 2OZ4A 4R3SA 3V95A 4HFWA 4M8VA 1PG7X 2CLZB 5C0CA 1FP5A 4P23C 5FGBA 1UWEL 5ICYA 2A77H 3V5DB 4ODXA 4Z77A 3VCLA 2P8LA 1T2QL 5F21B 1MIEH 2G2RA 2PYFA 4MA7L 4OF0A 5HI3C 5EC1B 3LMJL 4UTAL 3E6HA 3GM8A 4N0YL 4P23A 2Y06L 1YJDC 4XCCL 3GK8L 3DARA 2I9TB 4PJEF 1AXSB 2XRAL 5C70A 1B0RB 4OB5L 1CR9H 4IRJD 2R4RL 3GSNL 4XP5L 5I8KH 1YN6A 3VDCA 2CIIB 2GK2A 4C56A 5MEND 5T1KD 5IG7B 3QULA 2QQKH 1MRDL 2HKHL 4FQHA 1KIUA 25C8H 3R4DA 3B2UD 5FKAA 2I5YL 2V7HB 3FQUB 4RGMB 4NCC1 3QEQA 4JQIL 5E6IC 5MENB 5C0RH 4EEEA 1JYNA 3MV8E 3M8OL 4IJ3C 5DJ0B 3HAEH 3MRMB 4YFDB 4YUEL 1L6ZA 4AIOA 3FFCB 4HF5L 4U1NB 3V52L 5E6IA 3IJYB 3VFTA 1PKOA 3CFKA 2H6PA 3FFDA 3FQRB 3H3KA 4NQEB 1F3RB 3CLEH 1P1ZB 4GG6B 4NQDD 1NFDF 3QI9A 1S7RB 1HK6A 5C0BA 1S78C 5BOZG 2YPLD 3QR2A 3THML 1JVKA 4BH8B 3L3HB 2ADGA 4FNLH 1PVHA 3LEYL 1FNHA 3IRPX 1IT9H 3DX9A 1ETZA 1EK3A 5DHVB 3ZKMC 2R69H 1EEUA 1MLCA 4OIIH 5GGUB 3RWFA 5CJBA 1LO5B 4N0FA 4K8RL 2NMSA 4XMPL 5EFIB 4ZSOB 5IMOA 1KJVA 3U7WH 4JN2B 2EH8H 3RVVD 1J8KA 3MLSL 4RMTA 1NCCL 2NY3B 4I0PB 1NUFA 3KYAA 1MFEL 4KXZI 3LY6A 4QCIA 1YN7A 2ZG1A 5FYJD 3PV6B 4O51A 4Y4FC 4Z7WA 3HRPA 3J8F7 1ONQA 3BDBA 2Z8SA 3UTTD 3D85A 2XPGA 3GMPB 1H3WM 3OR7A 3GMLA 4Y5VB 3MRPB 2VIRA 2AGJH 4WV1B 1OCWH 1X5YA 4XVTH 2CKBA 1JGVL 2F74A 4PJAA 2DLFH 3GO1H 2J8UE 1TZHB 3AAZA 5I1IH 2Q7NA 2MQCA 1MFBH 1BFSA 1VSCA 4OQTA 4J3UA 1KELL 4L4VB 5IROC 4YWGH 4UT9H 5JW4Q 4APQD 1NGZA 4CU8A 1JWUA 1Z5LA 5EA0L 4ERSL 1CXHA 5IROA 3FQNB 3MNZA 5C0EA 5EO9A 5FYKH 3ZYOA 5A16A 2I25N 3GMMB 4RFNB 5IR1A 4JFDE 5IBLD 1FNSL 4YGVB 1KPRA 1YPZE 4HCRL 1IGFH 4WFGE 3QEGL 2APTA 5CHNB 3L3IB 3X14B 2AEWA 1X7QA 1ZEAL 1BAFH 1NKOA 3WFZA 1EEQA 1YEEH 2BP3A 1OTTC 3ROLB 3VFGL 1REIA 5I8EB 1INEH 4J3WA 5CGTA 1C7SA 5J11C 4MAUH 1KSRA 1MCFA 4L9DA 1HWHB 3VFRA 5GGSA 3EZJB 4IOIA 2FLRT 1VA9A 4OBSA 5C07A 2AV1B 1AD9B 3WFEL 3J7HA 4GKNB 5IHUL 1DL7H 2UWEF 4QYOB 2ICEB 1SMAA 3BW9B 2VZUA 3MV01 4X6CB 4MB3A 5HHOD 4EOWH 2CMRH 4QHLA 4R4ND 4Z8FH 2X4SB 4N9OB 3HR6A 1CK0H 3A6CL 4RFEB 1ZHNB 4YDLB 5E56A 2GAZA 4DZBB 2C26A 4WRLA 1GRWA 3MV7E 3C08L 4XX1G 2RFXA 3F5WA 3UC0H 1A7BA 5F7WC 4L29B 2H26A 4CBPA 4LAQH 2FEDD 3HC0A 4WTZA 1YPZF 1FIGH 3D5OF 3KPQA 2PN5A 1WBYA 5BRZE 3ZE2F 1BEYH 3BEVB 1CGYA 1RZ7L 1EIBA 1A21A 4HUVB 1F3DJ 2QSTA 4U6VL 4GXUN 3FB7B 1NCNA 3A6OA 4U49A 1GGUA 1X5FA 2HLFC 4EI5A 3BWUC 4J4PC 5GHWH 1TJIH 3D2UB 1FVCA 3MLYL 1TVBB 3AVEA 4M1CC 1MUJB 4ONGH 1GIGH 5CMAA 5F7MC 5CBEA 1EDQA 1W72H 1MRCL 5ANME 3MGAA 2C4XA 3HG1D 3F7PC 3O4LE 3OTTA 2ZCKH 3WLBA 2AK1L 1SVZA 1QSFE 3RY6C 1FFOA 5I16A 4HBQA 1MCHA 1RURL 5JDJA 4M1GH 1I8MA 4L4TB 3RUGE 4CW1B 3EO0A 1DFBH 1IKFH 3BHBB 4LVOC 4A6YB 3MRLA 3RY6A 1GVIA 4K2UL 4WDIB 1FO0B 1WSST 5HHMD 3FCTA 1TVHA 1BZQK 3MRJB 4PV8B 4X4XB 3VD5A 2UY6A 1X5ZA 5I2IB 1EXUA 2X70B 3OB8A 4DCQA 2MFNA 3OZ9H 1WV7T 3MRCB 1OAYL 5C08B 4PG9B 3IVKB 3D25B 3O3BB 1A6ZB 2MCPL 5DJDB 2PW2A 4B41A 4NBYB 3AM8C 3CZFA 2B20A 5FOBA 2IC2A 1HSAA 4LVNB 3FRPA 1C08B 1P7KA 3GSQB 4OCRH 3MLZH 1GGCH 4GAGL 1UWXH 3ES6A 4U2YA 2YRZA 3AM8A 5I1DB 4XPBH 3TIEA 1MFAH 3K1KC 3H7BB 4BKLA 3QUZC 2MOVA 1JF5A 3QUXC 3CSPA 1YMMB 3L3JA 4UT6L 5IBUG 1RULL 1F11A 4LCWE 3K8LA 4RIRA 2BXYA 4OLXL 3QG6B 1RIHL 3QUZA 4MQ7B 2DIJA 4NKIH 3EO1B 3QUXA 2CLVA 1G9ML 3H42L 2YPVL 3RUGF 1HE7A 3GMOB 4JFPB 4Z0XB 4R97C 1QSZA 3DJ9A 5INDA