1OARL

Fv ige spe-7 in complex with alizarin red
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 108
sequence length 108
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oarL00
4FOMA 5IMMB 1OAKL 3RVVC 3G5VA 2GT9A 4XP4H 5K59F 4NM8H 3K81A 1M05A 4XP5L 3EOTL 5ADPH 5GGVY 4KROC 3FB7A 3MLVH 3H9ZA 5D7JA 1JYXA 2V2TB 4APQB 5JORB 5F3BA 2VR5A 2JJWA 3I6KA 4YPGB 4LIQL 4RQQB 3RU8L 1K6QL 3N06B 3VXQA 3S35L 3LMJH 4F37K 4N90D 2MQ0A 3MZTA 5ILTH 1YUHA 5JW5B 4P3CL 2AJVH 3V4UH 5FGCB 3P73A 1HINH 4LAQH 2XRAH 2JJVA 3L7EA 3ZE2F 2A38A 3MACL 5I1CL 4LBEB 3C09C 3QNYA 1BLNA 1HHIB 3QJFB 5C0RH 2Q3AA 4PJXB 1I9IH 1JBJA 2X7LA 4ODSL 4ZD3L 1C08B 1ROWA 1V7NL 5DR5H 4OM1L 4YLQT 3T4YA 5D7IA 2DMBA 3MTRA 3QBTB 1YMMA 4PJIB 1H3TA 4HAGA 35C8L 5F6HJ 2EZ0D 4N9OB 4QTHA 2I07B 3KPQB 1I1YB 4LCUA 4XPGH 2G9HA 1EV2E 1FL6B 2ID5A 2Q6WB 1T04B 3JSSA 2AV7B 2O5XH 3V5HB 3U2SB 1JF1B 3CUPA 3C87A 2X9YA 1PKQE 1XGUB 1IAKB 5GISL 4X9GA 1Y0LB 1UACH 2ZOLA 5T5FH 3Q6FB 1MUJA 5I1JL 4FZEH 1X5HA 3HCVB 1KN2L 1T7VA 5T3ZD 3MRIB 1I3UA 1ZAGA 3BMWA 1KELL 4JPIA 3IDXH 4LCWE 3F7VB 4OLXL 3NPSB 3QRFM 1FN4B 2H3NA 5KSAA 5CD3B 5ID1B 3MOAL 4WWID 3CSGA 3HMXL 3UX9B 5FF6A 5CILL 4GOSA 1KN4H 3UP1A 3KYAA 5TGBA 1I3GH 4N8VB 1QD0A 1ZVYA 1NKRA 2BSRB 5E1AA 1L9NA 4UOW0 3DXAA 4Q6YA 4RISL 4FQJH 1IAMA 4R26L 4DUXA 4QF1A 1GC1H 2A1WH 2C5DC 4JLRB 4ZSOB 4JHZA 3WLWC 1OT2A 4YQXH 1JHLL 1ES0B 4GG6E 1QACA 3GSQA 3P4LA 1AY1H 1KJMB 2EDHA 4LLVB 5EPMB 2J12B 3KJ6H 4ZO7A 4KRLB 4TVSa 5K33A 3MRRB 5ESVB 4XPBL 1BD2B 3V5KA 2R39A 1QNZL 3GSNA 4OLUH 1Z6JT 4YIQA 1TNMA 5C0BE 1HHHB 5EUOE 1D5BA 3QEHB 1E27A 2M1KA 4MVBD 2IAND 1IEBA 3KPRA 4CNIA 4I0KA 3V0VB 5JUEH 2I5YL 5GZOC 4OCNC 2A9MH 1KSRA 4LCIL 2HJFB 4BSWB 5DRNB 5J1TC 3ME0A 2QSCL 4MCYA 3EO9H 2R2HA 1RMFH 2QQNH 2ZCKL 2AAVA 2K1MA 1KCRH 1QSFA 5JNYA 4BZYA 1MHEA 2QSTA 2F5BH 4F2MA 1VFUA 1MJ7H 2OCFD 2HFEA 4LCCA 4APQC 3CMOL 3WD5L 4PRHB 1X5LA 2H1PL 4NC0B 5EU6B 1RJLA 1O0VA 2WUCL 1KEMH 1QSFD 2Y6SC 1DBKL 1OY3B 2BHZA 2CK2A 5GXBB 5IOPA 4ZAKB 3TIDB 2VRAA 3VE0B 1MCKA 2CIKB 3SDXB 3V6BR 3IJYA 5C0AB 1MFAL 3DVFA 2XV6B 1Q0XL 3DX6B 4OGYL 4XVUD 5DQ9B 4S2SA 4HPOH 2BOBA 4NHUA 2VYRE 4LDOB 2BNUB 1A6ZB 4MD0B 4WFFE 5GGQH 1IM9D 2AK1L 3JV6A 1MH5A 4R96A 4ZS6C 4M5YH 3KPSD 2IF7A 4X6BB 1XF3A 4BQ9A 3ARGA 3KAAA 4FFYH 3VCLB 4NFBA 5J12B 4OZHF 4FFZH 2BVOB 5F7EH 2ADGB 4F7CA 1J1OH 1K8DA 5DYOB 1U8QB 2Y36L 5I1GL 1U41A 4NPYB 3OX8A 5CSBA 1BZ7B 2EDJA 4GMTL 5HJ3B 2VC2H 4K8RH 3PGFH 5F6IB 3LQAC 4OCSH 1WAAA 1A1MA 2HT4D 4HV8B 1FYTA 1AD9B 5JW4R 2R1WB 3VXRE 1U36A 1LNUB 2VR9A 5ITFB 5ISZA 4GKSA 1E6OH 4ZFGH 5EUKA 3NPSC 2GUOB 3V4PL 3O2VH 2FBOJ 2R23B 4PS4L 4G80A 1FYTD 4NNPL 1QFWI 1OAYL 3ZE1E 3IDNB 3S4SA 1BEYH 3MO1B 1RJYB 4MWFA 5ISZD 3MJ9H 1ZGLA 4P2OB 5L0QB 1KPUA 3D85B 2ATKA 3STLA 3F7PC 2EC8A 1D5XB 4M6MH 2E6PA 1IT9L 2X4QA 3L7FB 2P5EE 3TV3H 4ZQKB 2HJLB 1MQKL 4QHNB 5CD5C 2HN7B 3JTSA 4OF8A 1ODAA 1NCCL 3PV7A 2CDEA 2Z92A 3MNWB 4NQVA 1C12A 5ID0A 1I1FB 4GQ9H 2V2WA 4XX1E 3X12B 2AK4E 2OMBA 4BK4A 3CD4A 1I7UA 3MV9D 2VZ1A 3O41B 3ZHLA 4A6YH 4LNRB 2Z4QA 5T1LA 1JPTH 4KKAC 5DD5L 2IGFL 3KPMB 1DQQB 3S5LB 5I6XB 4XMLL 5IT2H 1KC5H 3RAJH 3WDJA 4E42A 2OP4H 4LRNL 4UU9B 3T08A 4MS8C 5T1LD 2CLVA 4P5TD 3VDAA 1F4WH 4M7JL 2IPTH 2X10A 1DANT 3FFCA 3IETB 2F8OA 1KB5L 5BO1H 1NFKA 4ZAKC 1HHGB 3CVHH 5FYKU 3TNNA 2LQRA 1JUFA 4B50A 3BI9X 3T0EB 1FNEB 4MB4A 4EDXB 1WAAF 3FQXA 3LB6D 2Q8BH 4EUPA 3WNPA 1DLFL 1LO5B 2GSGA 5BV7L 1CLZL 3I2CH 1DQJA 2QQLH 5F1SA 3FFCD 4CL7A 4Y5XB 3H9HB 2ITDB 1DE4B 3TM6A 1G7HB 1A4KA 2XZZA 5DUPH 4NQXA 4ODBD 4XCCL 2CR6A 1CFSA 3BD4A 3K8KA 5T33H 3UBXI 4LLDB 1OTUC 3QFDA 1MLBB 1K2DA 4GW1A 1T2XA 4P46B 5FYKL 1J0HA 3HNSH 5C0GA 1V3MA 4Z7VA 5J3HD 5J12C 3I85A 1A6TB 2WBJD 2BJMH 2XNAA 4XCFL 5L2KE 1OLLA 4YDKH 2ERJB 1N6QL 3LV3B 3MBEA 3PWUB 4QCIB 3RX7A 4EI6A 3C8KB 1EEZA 2VQUA 4JM2B 3C5SA 5F6IC 2VDKH 3MX0A 4MA3B 2Y7QA 3VD9A 5LGHL 1CVRA 4W4NA 2VTFA 3MLSH 1MOEA 5EO1A 1PZ5A 4K94H 3PL6A 5HGDA 2X4RA 5DMYA 1P4IL 1SJHA 3O0RH 4NKMB 4U1NA 4LLMB 3UYRL 4G8IB 4MNGB 4MA8H 2HVKB 1FVDA 4M6NL 4I4WA 4XBPA 1SY6L 4WENB 2DYPB 1OM3L 1L0XA 3N85L 4JFEB 2A6IA 2ZCLL 1XIWB 2YXFA 3IAPA 3IFPA 2C7UB 3I6LD 2XQBH 4LDEB 4P2OC 5L0QC 5HHOD 4G6JL 3SKMB 2EIZB 1KCSL 5F7UA 4ZODA 1QUNA 2I24N 4R3SB 5ECJE 3G6JB 3FZUC 5C09D 4Z78A 3DMMB 3KPNA 1CDHA 5TQ2H 3FT2B 4J3OC 5ADOH 3MGTB 5HYQB 3TYFB 5FGCE 5EFIA 1B4RA 2FJGB 3BXNA 1J10A 5TE7H 4K3DH 4R4FL 1SEQL 3NCYS 5IB3B 3QNZA 2VLRB 5IBLC 4KUZH 4JO3L 4LEXL 4PJXE 1MRDL 2I26N 1OB1B 3MRMB 3GUTB 1FV1A 4KHTH 5J13B 3NMEA 4MQ7B 1YPZA 5FUZL 3L3OA 1DZBA 3D0VA 4PJIE 5I6XC 3MRKB 1X3DA 5B3JE 4RA3A 4RAUA 4YNYA 4RDQF 4NQCB 4YEEA 5DK2A 3FCTA 3WLBA 4JB9H 1R0AH 3ZKQD 3I75A 4F8QA 4Z7VF 5F1IA 3LKSA 5KVGL 3EO1A 3T65A 2C3VB 4PRDA 5JHDB 3LHPL 3OMZA 5D1ZA 3DHMA 3KPLB 1TCRA 2FJHB 2HG5A 3OKLB 4RWYL 4PV8B 5GRVK 4UT6H 1EXUA 1CL7I 2ATPB 15C8L 4PG2A 1OARH 1RVFH 2XTLA 4P5MB 3TVMD 3T0EC 3S6CA 1TTFA 3U4BL 3M1BA 4FMFA 4PREB 3HLAA 4Z77B 1A47A 5CBEA 3O45A 3GSUA 3K80A 4Y5XC 1C7TA 1MCOH 1BOYA 4LHUA 5LWYH 3KR3H 3S88H 2PUQT 1F90H 3HPLA 3FN9A 4WEBH 3CFKB 1RK1B 3OKOB 1S8DA 4L3CA 4Y88A 3W5MA 5DDHB 2EH8H 4JRWA 4M62H 3BIKB 2VO5A 1A7RL 1AO7A 4NZDA 1KLUB 2MHAA 1OPGH 4ZO6A 4JPVL 2NW2B 4ZSOE 1YEFH 1JYWA 5I0DA 5AZ2H 4FFVD 3MJ7B 2WP3O 3D39B 1IGJA 5B38B 1E4WL 1HN1A 5B39G 5ACMA 2ERJC 5C2BL 3O8XA 3JWDL 4RGMB 5B4MD 3T3PE 4GFTB 3TBTA 4XGZB 4GRWB 1UFUA 4JM2C 3RI5K 1JNLL 1LD9A 3VXUB 3RZWA 2R4SL 4WUKL 1BD2E 4B7IA 4F80A 1MCDA 1HZHH 1WV7T 2NZIA 4HUXA 3QNXA 3CC5B 3O8XD 3BDYL 3V7AE 2VLLB 3MRPB 1MWAA 5EO9A 2FO4B 3HC3L 3ARXA 1U3JA 3D6GA 4O02H 1S9VB 2VLJA 4HLJA 4O4YL 3MLTB 3SPVB 1A3RH 4KUCF 1G7QA 4JHAH 1KCKA 4I0PB 5I1IH 4LSPH 3SKOA 4TSAH 3C08H 3PNWA 3IDMA 4LPWA 4JDTL 3W11D 5DLML 1XIWC 1RULH 3DX7B 1H3PH 1YPZF 3D2UA 1Z9LA 5DJAB 4P5KA 2DM4A 1BVLA 4YHIB 2VLJD 3ECBB 5HDQH 1TLKA 2VH5H 5EU4B 4IM8A 4PRHE 4G6FB 5SWQB 5CKAA 5EU6E 3E0GA 2OZ4A 1QBBA 3DMMC 1MJJA 4HUWB 4JE4B 2EEAA 5ACZB 3QIBC 5E94A 3MRQA 1VB9A 4XBEH 3SDXE 2BERA 1KTLB 2UY7A 2CUIA 5DI8B 5C0AE 2FLRT 4TSCH 3RVXC 12E8L 2EKSB 5AG9A 1JE6A 3A67H 3NIFE 1HH9A 4IOFC 5DMIH 2ICCA 4QRQA 2XG5A 1GCFA 4K9EC 1CXKA 5DMGC 2DBLL 4EI5A 4YR6A 1VCAA 3AU1B 1FIEA 2VJXA 1FAKT 3W39A 4OLYL 1NCAH 5H94A 4W81A 3CDYA 5J13C 1P1ZB 5HGGS 3VFMB 1YY8A 3I50H 1I9RH 3RWHA 1J0ZA 1KXQE 2UVEA 5DZLA 2RQ8A 1N6UA 4NWTH 1RY7B 2F19L 5F96H 3GI8L 5IV2B 25C8L 4K7PY 5IR1A 3U4AA 2ZOKB 4CAGA 5D7LA 1U95A 4IEFB 4MAYA 3MLXH 2HT3D 2G2RA 4MAUL 5HYJB 5I75B 1U8NA 5DO2D 3QULB 4XI5D 5T3XD 3BRDA 3ZTNH 4L29B 3ARPA 5BJTB 1RHHA 2JJTC 4FQIH 3VFNB 5C0ND 1RURL 1PKOA 2N7AA 5D7LD 4HPYH 1GGCH 4MAYD 1DP0A 5IF0B 1S7XB 5GGVH 3TJEH 2WV3A 3EOAB 1RIUH 3GHBL 3V79C 3MOQA 1F4YL 5J9PA 3PHQA 2YA2A 3ARRA 2G5BB 1DEEA 4O9HH 2XWBA 1QLFB 1BQSA 4J3XA 3QO0B 3VFUB 3UBXB 2MFNA 1R6VA 2XWTB 4TNWF 4X98A 4L5FL 3BZEB 1OAZH 3N1FC 1N8ZA 4ZO8A 2ZUXA 4HMEA 3AFLA 3GMPA 4G9FB 5F7FA 4GJTB 4RGMC 2DWDA 3M8OH 4LSSL 1BFTA 4KV5E 2H2PD 4H25B 1MAKA 1ZHNB 1N59B 1INEH 1MY7A 2ED8A 4NKDA 1QLEL 4L9DA 1HOCB 2E5EA 4R8WL 1XGQA 3RWIB 3G04B 3M17A 2NXYD 3F7RA 3IAGC 4PBXA 5LCVH 2AJXH 1U8IA 3DBXB 4RBPH 3PP4L 4J4PC 4CVXB 1CU4L 1PKQA 4I0PC 4TYUA 5DJDA 4B0MM 3AS2A 1VADB 1YYLH 2NY4D 3K1DA 2P42B 4MYWB 3C6LA 2QQQA 4FXKA 2EIDA 1CIDA 1Q0YL 1F5WA 2BP3A 5J11B 2VDNH 4LCWA 4UDUA 3V2AR 4HJ0D 3MR9A 1LEIA 3ETBF 1OF2A 5FCSH 4NT6A 1CLCA 1S7TB 1ZEAH 2CRIA 4J3VA 1A2YB 4Y5VB 1HIML 2XT1B 3TO4A 1NSNL 3GMOB 5ADPL 3CFBB 4TNVF 3T0EE 2VZSA 4LCWD 2I9TA 2QHLA 2VZOA 2UY6A 4HXBH 5DJYB 2NZ9D 3MLWH 4IJ3B 4W6YB 3QQNA 1D3CA 4HIXL 2P8LA 1G6RA 3TO4D 4GG6A 3UJJH 2CR3A 2YZ1A 4DN3L 5K9JL 4LLYA 1ZTXH 1Q72H 4FP8L 3WS3A 5AUMB 1KPRB 1NCBL 2KH2B 3ESUF 4M1CD 5HPOA 4X6EA 2BK8A 4ZNCD 5C0BA 2OR9H 4MLSA 5EUOA 4DGIH 2BMKA 2X1OA 1YEKH 4XVJH 5HHPA 4XPTL 4AEEA 1F11B 4J8RA 4WEMB 2NY6B 1PG7H 3V6OE 3EGSA 4U1JB 1T5WA 4MQSB 4WHYH 1Y18B 2AJUH 4M6OL 3VXPA 4HWUA 1MHHA 5I75C 4HF5H 4JZJC 5CCKL 5F72S 3LEVL 1IGFH 3FT3A 4JPKH 3DRQA 5L9DL 1I9EA 3CU7A 1AQDB 4KXZI 1A6VH 1DQLH 2XKNB 1G7LA 4X4YB 1FVEB 4JZOB 1MFCL 4XXDA 4MNGE 3T09A 4KY1L 3OR7B 3DVGB 3LPFA 4OKDA 5GHWL 1GVIA 4K3EH 2DJUA 4J23A 1TTUA 5CGYC 5T3ZL 3SOBL 1UYWL 2ZSVA 5J0BA 3MLPA 4JFEE 2NTFA 2JIXA 5IQ7L 4Y19B 5HHNA 3MNVA 4LEOA 4ISVA 1DBBL 1EBPA 3D18B 4I77L 4JFYA 4OCXL 2AP2A 4MX7A 2PTTB 3G6JE 2F54D 1I4FB 4DEPC 2JIXD 4GW4A 2NLJB 1MCWW 5EIIA 1FNGA 3DOSA 3EOBB 1N2RB 4GSDL 4OD1L 3HNTL 3BN3B 5AWNL 1EMTH 4IIQA 3L9RA 1CDBA 4G6AD 3QHZL 2V9QA 4ZOCA 2EDLA 4WFFD 4XNXL 4XPHH 2ARJQ 2VLRE 2OR8A 4KTDH 3BQUA 4XT1C 4JJ5A 5T1MB 4Y16B 1AI1L 2X9WA 3RIAK 1BAFH 1OTSC 4KQ3L 4CJ0A 2DL2A 5E8PB 4GG6F 5CEZD 3L3DA 1J5OL 4LSRH 1DUZA 1I1CA 1R3KA 5KVDL 3B6SA 1Q94B 3QUXD 4HKJA 3DTXA 2G75B 2HRLA 3BQUD 5IFHL 3VXRA 4NRZA 4PLKC 1C1EH 4NQCE 1XR9B 1XF5B 4U1IA 1RD6A 5CP3H 4ODVH 2X4SB 1G9NH 1MEXL 5ITBL 5J11C 3MV01 4AH2B 3FMGH 2BOCB 4LGSB 4D0DB 3SGDH 3B3IA 4LK4A 5JHDE 5DGRA 1I7TB 4HC1L 3BKJL 1EPFA 3F6IA 3VXRD 1S78C 3R8QA 3R1GH 1EK3A 4PRNB 4Y5VC 4PY8J 2BNRB 2MOVA 4ODTL 3TT1L 3W0WD 3FO0H 1FZOB 4YHLH 5CAYB 5DEGA 5C9JA 1RZFL 1EHLL 4WVRA 3D5OF 5E8DL 5TE4H 1BFSA 4IJ3C 3RVVD 3GMLB 3R06B 1G7JA 2FX7L 2DJ4A 2P5EA 4W4OC 1I8MB 5MP6H 5TH2A 2UYLA 2PW1B 4X7SL 2DQCH 1GZQB 4R7DA 1KYOK 4XXCC 3FQNA 1JPFB 2XY2A 3PWLA 1WC7A 4FN0A 1UM5L 4ZXBD 1JV5B 3IF1A 1KACB 3QXAB 2JCCB 1TJHL 2IH3B 4EN3B 2GSIA 2AK4A 4NWUL 3BP5A 1Z9OA 3GO1H 4FTVD 1NDGB 3IGAB 3LQZA 1KIRA 4RZCA 3OB0K 3D39E 4FNLH 4OQTL 4S1QH 1C16B 3ULVE 2NY6C 5GGUA 4M5YL 3C8DA 3GKWH 4G7YH 1P5VA 3GBNL 3WS6C 1MFBL 3MJ8B 4JN2A 4S0TD 4PLNC 5IFJA 4GRWE 2IWGA 1NMAL 4Q9RL 4PJ8D 3RUGF 4H1LA 3VXUE 3P77B 4MXWL 3BW9B 2FYYA 2OSLB 3BESR 2GHWB 2H6PB 4FFZL 4AENA 1QG3A 1T1WB 4NGHL 4WCYL 1K8IA 1NAKH 3HE7D 3U1SH 1YEGH 1JWSB 3T2NH 1KJVA 2WBWB 4W68A 3UTTB 3RY6C 1HQ4B 3BD5A 1HXMB 4L4VD 2D7OA 4CW1A 2DQIL 5E99L 1NC4B 1V7ML 5LGJB 1T89C 3UC0H 4K2UH 3VI3F 5GRJL 1MVUB 4PJHB 1NFDF 5DF0A 1LO2H 1BIIA 2JKXA 1NAMH 4RRPA 4U2ZA 3BKYH 4FFWC 1HNFA 1QKZL 2DDQL 4XWOC 3DLQR 1MFEH 4JVUA 4G3YL 3OR6A 1Z9SA 4OTXH 3QUYC 4Z7UF 1S7RB 3MJ9L 2VAJA 1G7PB 3QDHA 1A1NA 3F62A 1OWWA 4LARH 4IHOA 5CJQL 1NCNA 3QG6A 4JFXA 3BP6B 3Q6GH 4WFHD 5SWZB 5LAXA 2GTZA 1OP5K 2O5ZH 1AR1C 2PXYB 4GXVL 5HSFA 1K4DA 5FM5M 3NFNB 5L2KA 5FGSA 4O58H 1NLBH 4LF3B 4ONHA 4Y16C 3VMPA 4Y4KD 2ZPKL 1MF2H 5F9OH 1JZ3A 3BPLB 5GRXG 5ICXB 5E2WH 1IGML 2RJMA 5I71B 3WLWD 4KK9C 4NQUA 3ARWA 1JHKH 1XFPA 1VGEH 1CD1B 2R1YB 2YHGA 3QXDB 4RFOH 5TPWL 1FAIL 4JRYA 2QQKH 3G5YB 4P49A 3QZWG 2DLIA 1OD9A 3MLZH 1EO7A 1GHFL 5HYJE 5IMMA 1P7KB 2IMNA 3QQ3B 4OFIA 4JRYD 5FHBH 2B4CL 1C8PA 3LS5H 4TVPE 3VMNA 2XQYG 3AUVA 1AIFB 4E0RB 3C2AH 3MJGX 4JFQB 2V2TA 5FO7A 4APQA 5JORA 4K23L 4JQXC 4YPGA 2X70B 3INUH 4RQQA 4XP6L 3CVHL 4NM4H 4HFWB 5CZKA 4OBRA 4GLRI 2X44D 5CSGA 5JW5A 3QHFL 5DQDL 5EA0L 5CEYB 4APQD 5D7KE 3E6FB 2H45A 1CXLA 4EN3C 4MDJB 4NCC2 1A6WL 3U0WL 2NY7L 4KZEL 4LBEA 1HHIA 3QJFA 1KGCD 1J11A 5FM4A 4PJXA 4MJ4A 4G9FE 2B20A 2PETA 5FHAH 1IQDA 1C08A 2HKHH 3G6AB 1NUDA 4KAQH 4Y2DD 3ZT7A 3G5XB 4G8GD 5E2UL 4FQLH 4Z76B 3T8XB 3MJ6A 3TH3T 3MBXL 4PJIA 4HG4K 3DV6B 2B1AH 1WCBB 2I07A 3KPQA 3K4DA 1I1YA 4XAWH 1EEYB 1P6AB 1P4BL 3FOMB 2FIRT 4ZS6D 2ZUUA 1FL6A 2Q6WA 4G43B 1T04A 4MJ6B 2AV7A 4AL8H 4N9GB 3U2SA 5E8NB 1JF1A 2YN3A 1XGUA 1IAKA 1OP3H 1ZLSH 4DZ8B 1OSPH 4P9HH 1Y0LA 3Q6FA 1RZJL 2B2XH 4LAJH 4KK8D 3HCVA 3GK8L 3GSVB 5E4EC 5HHVH 3CVIH 3BYTA 3F7VA 4M48L 2P48B 1FN4A 1B9ZA 5CGTA 5CD3A 5ESAB 5ID1A 4LVHB 3MV11 5FA3B 1T1ZB 2OK0L 2BSRA 2KQNA 1ZLWK 3PGCB 3HUJB 5F7LB 5C0JA 3F8UB 5EBMB 2D2OA 1MHPL 4ZSOA 1LK2B 1XCQB 4JLRA 2FX9H 4QTIL 2PXYC 4WUUD 3HAEG 2MNUA 1NFIB 1ES0A 4WY7H 4IRSB 3DRTB 1IL1B 1KJMA 4LLVA 1I8IB 4OFPA 3ZKXB 5MEOB 1QBLL 1K4CB 2ICES 2XACC 3WFBH 4IRZL 5ESVA 1BD2A 3GFUA 1H5BB 3QEHA 3FFDB 3V0VA 1F3JB 1IGCL 4TTDD 4WTZA 4U7MA 4FMKA 4XHJC 4XMKL 4BSWA 5DRNA 2MKWA 1NL0L 4R90H 3BIAX 2F5AL 4FG6C 4I18C 5IESH 2FECI 5J6HB 1NGQH 5BMFH 1V3LA 4MXQD 1FORH 4L9LB 3WUZA 1AGDB 2YS4A 2H41A 3DI2B 1CZ8H 4NNXB 1RU9H 5BV7B 2P49B 5DT1H 4YFDB 4PRHA 1U6AH 5EU6A 1G0XA 4UT6L 1VHPA 3RHWF 1KJ2H 2ZG3A 2PR4L 4UTAH 4JKPL 4F3FA 4PJ9D 2B39A 4ZAKA 1HYRC 1NBVL 3RVUC 3TIDA 3K2UH 1UXWB 3VE0A 4MS8D 2CIKA 4Y19E 1BZ9B 1FBIH 3SDXA 4X5XB 5AYQA 4OJFL 3BT2L 2FX8L 1ED3B 2Z31B 4LASH 5C0AA 4F58H 5GSRB 5EU6D 4DFHA 4KWUA 5GS0H 3DX6A 3KR3L 5DQ9A 5FIEA 2EDDA 1F8TH 2BNUA 4HMCA 5D4QA 1A6ZA 4KKLD 4MD0A 2BHYA 2QBWA 1G1CA 2EH8L 2HMID 1YNLL 3U36B 7CGTA 3ZL4H 2N56A 1JF5A 2V17H 3WL9B 4MNQB 43CAA 4X6BA 3TBVB 1FNLA 1YEFL 4NUGH 5EULV 3S35X 1NDMB 5HI3C 1RJZB 1A7PH 4H8WH 3VCLA 5F7YC 5INDB 4S1SH 2P45B 2Q86B 3HA0A 3IFNH 1FG2B 2BVOA 4E5XB 4BFBD 2ADGA 3ZTJH 2R2CA 4BFEA 5DYOA 3Q1SH 4FXGB 1U8QA 4K7PH 5F21B 4NPYA 4UINH 4QNPE 1BZ7A 5HJ3A 4JY5H 5A16B 1WQVT 3VGDA 4HV8A 3T3PF 3JBG7 4H20H 1AD9A 1H15B 1LK3H 3OKKB 3RL2B 3TZVB 2R1WA 3RNQB 3C5ZC 1LNUA 4PGCB 5ITFA 2GUOA 4UI2A 4X80L 3CLFL 3IDUA 1W0WB 2R15A 4NZTH 2R23A 2GKIA 3IDNA 1BF8A 4LIQE 4JHBA 5HYSG 3MO1A 1RJYA 2CLRB 2DLHA 1MVFA 3GBML 2BNRE 3H42H 3MRJB 4YPJA 3QQ4B 4P23D 5JDSA 4F9PA 4P2OA 2YPLD 3HRZB 4HXAL 1YEIL 4JQVA 1OW0C 1P53A 4KK6C 3VW3H 4RSVA 5KSBF 5AG8A 3ZDXE 3D85A 1WCQA 1ADQA 4GAYA 1RZ8B 1D5XA 4ONFH 4ZQKA 4IRSC 4P2OD 4QHNA 2HN7A 1SBSH 4TSBL 4FQ1L 3ZKXC 4QRPE 5I18H 4TSCL 3GHEH 3UAJD 3D85D 3MNWA 2IBBA 4JR9L 4QLRA 2OZ4L 1I1FA 4OCLC 2JCCE 3MUJA 3ROOB 1H5BC 3X12A 3SDXF 1B2WL 1B0RB 3QCVH 5IB2A 1QHPA 3GI9L 4G6KL 3EYUH 2HA1A 3QG7H 1JI2A 4UOJA 4JHWH 3T1WA 2VDRL 4LNRA 2QADB 1Q1JL 2ICEB 3I02B 3UXFA 5JW3H 4LVOB 2R0ZH 2RFXA 3KPMA 4UBDC 1DQQA 2D0HA 3S5LA 4AYFA 4JREB 2BVTA 4JO2H 3ULUF 2CRMA 1ZGLM 2R2EB 4UU9A 4YHYB 3AMKA 2BX5A 5BV7C 5GRUH 2XTJB 2VXVH 3F7YB 2CRZA 1X5ZA 1ACYL 3UTTE 5T3XL 1KCUL 2C4FU 5IK3A 5IVZB 1N0XL 3IETA 3O2WH 3O6KL 1RI8A 1UM6L 1DEDA 4HKBB 1HHGA 4XC3L 3LRHA 1I3VA 4XMPL 4PJHE 1NC2D 3T0EA 1FNEA 1AE6H 4EDXA 2FEDC 1LO5A 2Z31C 2UZIH 4N0UB 1RZIB 4Y5XA 3ZLQC 3SBWC 3H9HA 5H2BB 2ITDA 1G6VK 2AKRA 3RWFB 1DE4A 2PW2B 1G7HA 4OZIB 3PP3K 2AV1B 1ND0B 3GGWB 3I3DA 4PD4K 3CXHK 3CK0L 2WQ8A 1FLRL 5IHZB 4R97B 1CCZA 5H35B 1MLBA 4GMSH 4JEGB 3A6BL 4NZUH 4ENEC 1BFVH 4P46A 1CFQB 3QXWA 4PFEA 5SWZE 5FM5O 2DOCA 2R69H 1A6TA 4JGUA 5DFTA 3H8NA 3V6OA 4XPFH 3QT2A 4IRJB 3LV3A 3PWUA 4QCIA 1FZKB 2K7PA 5L8LB 5GZNC 3C8KA 4JM2A 3CGTA 5FECB 4HGKC 1T4KB 1A7NL 4EKXA 4MA3A 2GW5A 3GSOB 3TZVC 4KV5F 4DN4H 2IG2L 4WHTB 5CKGA 4D2NA 2X1QA 4OI8A 1S7QB 3UTPD 4YBLB 3SJVB 1TMCB 3LEXB 1BGXL 4NKMA 1CG9B 3OF6D 1KOAA 4J6RH 2FATH 1RZKL 2ZSWB 4MNGA 3WIIH 2HVKA 1BECA 1U0QA 2Y07H 3SE9H 4YHZH 2GAZB 4GKZB 1D7FA 4KTEH 5DUML 3VXMB 1MCIA 1UWGH 5AZEH 2DYPA 4UILL 4JFEA 1XIWA 2C7UA 1LQSR 4P2CG 2AERT 3VGFA 5I1DB 3SKMA 1T83C 2EIZA 4GBXB 5I8OL 1AFVH 1UA6L 1UH4A 3G6JA 2DYPD 4LKXB 2Q7YB 4JFED 5BCAA 1XIWD 3V4VL 5C6WH 5DFVD 3DMMA 5JIHA 1CGSH 4S1DD 3FT2A 1MIML 3MGTA 5HYQA 3TYFA 3HNVL 2FWOB 1MJUH 3EJYC 3WIHL 3OAYK 2FJGA 2J6EA 4H0HB 4OBSA 3RY4A 4EBQH 3ARFD 4CGTA 5I1EH 6CGTA 4XTRC 5IB3A 1EDQA 2VLRA 1EZVY 4MQXC 3MGOB 4L4TB 2C1PB 3QIBD 1VFOA 3S36H 5GGTA 3CH1B 3TA3B 1A4JB 3UZQA 5FYJH 1OB1A 2V7NB 3MRMA 1ORSB 3GUTA 3QR2A 4MQ7A 1G6RL 5M94B 3BD3A 1QYGL 4IOFD 3MRKA 4GO6B 1MNUL 1CLYH 2XZAL 4JREC 3MGAA 3MV8B 4DQOL 4UT9H 1CDJA 1DTUA 4RGOH 5BS0B 4NQCA 4YHYC 1I3RB 1ORQB 1CXFA 5DURB 1WITA 2ARJB 2XTJC 3SKJH 3OL2A 3WJJC 2C3VA 3E1F1 5JHDA 4ZUUB 3KPLA 2FJHA 3OKLA 4M7ZB 4PV8A 4NQCD 1MRFL 5IW1B 3U0PB 4OIIH 2ATPA 4JM2F 4P5MA 4ZUWB 1JPSH 3WUWA 5E24E 2JJTA 3WHE1 4AY0A 4M7LL 5F88B 2G5RA 4PREA 2OBGA 2OJEB 1XF4B 4Z77A 3SGEH 5JHDD 3GRWH 3ZYZA 3EDEA 5ENWB 2YRLA 2FD6H 1RK1A 2CK0H 1I7ZB 3CFKA 4P2RD 3OKOA 3GIVB 4WWKB 5DDHA 3JWDC 1J86A 3BIKA 3P11L 3CZJA 1KLUA 3HUJE 3RZCB 2NW2A 2VDLH 4KJPC 5KW9H 1EO5A 1LO4L 3VWJD 4F57L 3D9AL 3MJ7A 4LMQI 3D39A 2M26A 1KCLA 2ESVD 3HRPA 3CX2A 4I3SL 2EDYA 5IJKC 5F1KC 4XGZA 4P3DB 4OF6A 1J0JA 4RMVA 1XF1A 3P0VH 4Z0XB 1LVEA 2AABL 3HE6D 2ZUTA 3VXUA 5HYIA 3BIBX 4P4KC 4HWNA 1H3GA 4KPHH 4OT1L 4Z8FL 3D39D 3CC5A 4ZTOL 1FG9C 1HDMB 1AGEB 4YBLC 1F00I 3MRPA 2FO4A 1J88A 2B0SH 2RCSH 5CEZL 3MFFB 2NX5B 1P7HL 4QXUH 2HKFH 1S9VA 5E5RB 5FKPB 3MLTA 3SPVA 3KPPB 2IJ0C 1YNKL 4J4PA 4LSRL 5DJ0B 4Z0BH 4I0PA 2AXFB 1VGKB 4QXGH 4YBQD 5GJSH 5D8JH 1JWMB 4M9OA 3DX7A 1K3IA 3SGJC 1MWAH 5DJAA 5LBSH 4YHIA 5C6TH 4GBXC 4XNMB 3ECBA 1A22B 3HC4L 3U7YL 3NCJH 4J4PD 1PLGL 4O5LH 5EU4A 3LRGA 5SWQA 3L3HB 2DM7A 4I3RL 1F4AA 4KRPD 4HJJH 1QQDB 1S7WB 5GGSB 4HUWA 5ACZA 4EDWL 1FLTX 3QEGH 2F58L 4ACPA 1V3KA 5I8EB 1KTLA 5DI8A 4X7DC 4G6FD 3RWEB 2EKSA 2R4RL 1FIGL 1Z3GL 5FYKE 5E2VL 3UYPA 3P4NB 5E2JA 1BBDL 1JGVH 2Q87A 4N0RA 5A2JH 3TA3C 3AU1A 2UVFA 4U1KB 1P1ZA 3HI6H 4MNQE 4QXTB 4RMWA 3VFMA 5EU3B 1B4JL 4NSKB 4QRTB 2UZYB 5FYLH 4PUBL 4UNTA 5DQJB 5IV2A 3B5GA 2DQDL 1KBGH 3TYGH 1ZANH 2ZOKA 3ZDYE 4L3ED 4U3XA 3SE3C 1FH5L 3CZFB 2DN7A 3T4AA 4QTHB 5BVPH 2ZP0T 4UAOB 3ULVF 4M7ZC 5TE6L 5HYJA 1JYNA 4KKCD 5L88L 1S5IL 3QULA 4MA7L 4L29A 4GRWF 2GQHA 1IC1A 5BJTA 4JM4L 4MD5B 4HBQA 4NQDD 3DUUB 3VFNA 4TPRH 4HWEH 3DROB 1GIGL 3LN5A 2BRRL 5TJWK 5IF0A 1S7XA 1P9MC 2Q20A 3EOAA 5D5MF 1M4KA 5IKCB 1QO3B 1WTGT 1PDKA 5FOJA 3DVNB 4ALAL 4DFIA 5IEHB 3MYJB 4WWKC 1XAUA 2GYSA 2G5BA 2W92A 1QLFA 4M61B 4TQEH 3AMLA 3QO0A 2D31B 4YHOH 1VKXA 3RZCC 2E3VA 3DO7B 4XNZB 3UBXA 3VFUA 5I8KH 4X6CB 3X3FL 2XWTA 3BZEA 2ADFH 1TDQA 5CGYD 2WK2A 4G9FA 5FFLA 3NAAH 5L6YH 2P8PB 3ARZA 4PB0L 4RFNB 4RX4A 1RZ7H 1BQLL 4H25A 4BQ6A 4HLZH 1ZHNA 4WHYG 1N59A 3LS4L 2WP3T 4LQ1A 4OZGB 2IANB 4ERSH 1JTOA 3QXTA 2P8MB 2NY5H 5ALBL 1HOCA 1JTPA 5I9QB 2VL4A 3QEQB 3G04A 5CLWA 5KS9F 4KJQC 1HK6A 4PGDB 3DBXA 4Q9BA 4CVXA 1A5FH 4UB0H 2WBKA 4TUKL 2WIMA 4QRSB 3FTGB 1CYGA 1A9EB 4YDIH 1VADA 3X3GL 5IMLB 5TFSL 2IPKB 4YO0B 4LLQB 4PJ5D 4AG4H 3KLAB 2XTJE 1UVQB 1PSKL 5A2KH 4PJFB 3HPJB 2P24B 1S7TA 4CN4A 1A2YA 2CMRL 1NMBL 5EORH 3MQIA 4OF3A 4Y5VA 3WXWL 5IGXH 3GMOA 3CFBA 2BY2A 3PABB 3QSKB 5F1OB 1FFOB 4DJMA 1RJLB 5KTEL 4Z9KB 2VXTL 4YHMH 4OGXL 1DFBL 5DJYA 2CSPA 4N0UE 4MGXA 4PJAF 1S78D 2PN5A 3DVIA 1IM9B 1FFRA 1WWCA 1OAXL 3H7BB 5J1AB 1ZA3B 2MTPA 3DWTA 4W4OA 1GAFL 4CRPA 4OZIE 1ZV5A 2JJSC 4Z7QE 5HY9A 5K93A 1JNHA 1ZLVK 1ULVA 4F8TA 3KPSB 5ESQB 4XXCA 1U58B 4ORZC 3HAEB 1J8HB 5AUMA 1KPRA 4N5ED 1Q9LB 2BNQB 1I1RA 3WFCH 1A3LL 1CGYA 5E8EB 4R96B 1HCFX 3NPZB 5E2TL 3QUMH 4N0FB 1DQDL 4PYHA 2WM0A 3QP3A 3AXLB 1QLRB 1FGVL 2PYFB 3WS6A 1Y18A 2PNDA 4UAOC 1BWMA 2HFGL 3BH8B 4XRCB 1UJ3B 5D6CB 2E7MA 2HAZA 4F7CB 5GS2H 4NZRH 4C4KO 4I1NB 2ENYA 2X89A 1NEZG 4XWGH 2NY6D 4ZNEE 5AD0B 1AQDA 2XKNA 3ESVF 4MZ2A 3SJVE 4X4YA 1FVEA 5D6DC 1FYTB 2CKNA 4JZOA 4TUJB 5JW4M 4HCRA 3RPIA 4WDIB 3RY6A 3OR7A 3DVGA 5I1LB 5CS7A 4Y89A 1X5FA 3DECA 2R2BB 5CIPH 1T89A 2SEBB 1IAIH 2W59A 3BZ4B 5EZJB 4DUWA 4ORGA 4Y19A 4DKFH 1CD9B 3H3PH 3O3BB 1UEMA 4NNYB 3D18A 3HB3C 4XNZC 4MWFB 3SGKC 2YKLH 3QUYA 3B2UD 1I4FA 3B9KD 3U9PL 1S9WB 5EO0B 3QIWD 2NLJA 3KLDA 1R5IB 2XYCA 3EOBA 4RFNC 1N2RA 3OKMA 4DGYL 4XAKE 4XWOD 4TRPH 3GBLA 3L3JB 5DXWA 2X4QB 2ZKHH 3QUYD 1YDPB 4KVCH 4BZ2L 4MVBC 1HKLH 2AEPL 3MV9B 2C3XA 4L4TE 3LOWA 4NJ9L 1IAIM 3FQRB 5I9QC 1IC7H 4BZ1L 5K9QG 4I5BA 3NA4A 4Y16A 2VSCA 3ILQD 3B2VH 4LVEA 5E8PA 2OR7A 2VKWA 2LV4A 3TCLB 4QHMB 4MXVE 1N5YL 2CJUL 1EGJH 1Q94A 1MFNA 2G75A 5T1LB 2NXZD 4P5TB 5BS0E 5KN5A 4IDJL 1XF5A 3FHAA 3K8MA 4BUHA 2X4SA 4AH2A 2EO9A 2BOCA 3JTTB 2QHRL 1GH7A 4D0DA 3EBAA 1I7TA 1R3LB 3D0LB 1BX2B 3CVHB 3BRFA 1ERNA 4WI4A 4PRNA 2BNRA 4Y0GA 1FZOA 4X7TB 4O51B 3RDTD 4XVUC 3JV0A 5F8RC 4E9LA 5HYSB 2I60L 4F7MB 3GMLA 4JQXA 3R06A 2YD9A 3WJLC 4JN1L 1I8MA 2J5LB 2APBA 4PBVC 1ZHLB 2YD1A 2PW1A 4P9ML 1GZQA 3W9DB 4QRPA 1L6ZA 1JPFA 1UH2A 2J2ZA 4XNUH 4LPCA 1OVZA 1HYSD 1NLDH 1JV5A 3WNOA 3QXAA 2JCCA 3TWCL 2IH3A 4EN3A 3S34H 3VG0L 1IARB 4PTUB 2ADJB 2IMMA 3OPZL 2WBJB 4AIXA 4LSQL 1NDGA 3IGAA 1NGPH 1PAMA 2R1XB 1C16A 4QRPD 2YPVH 1K2DB 3HZVA 4NQEB 4W6XB 1A64A 3MJ8A 3MFGB 2HT4C 4EN3D 1QFUL 1UJ3C 5DK3A 3H2WA 5HDOA 2PYED 1RUAL 3P77A 3PGDB 3BW9A 2OSLA 4OF0A 2Y1VA 5JIPA 2H6PA 1QPPA 2DQEH 4LPYA 4LSVH 1T1WA 2DQTH 4JVPA 4V1DD 1FO0H 5HGHB 4EVNB 4UV4H 3VG9B 1JWSA 1IQWL 2NX5E 1FJ1B 2E9BA 3EYSL 4N8CH 3UTTA 4H1LH 1HQ4A 1HXMA 1TVBB 2NYYD 3TO2B 4D94A 4H20L 3WFZA 3HMXA 1BQUA 1NC4A 2AEQL 5LGJA 5HHOB 3E6HA 1MVUA 4PJHA 1QBML 1HILB 1B0WA 2CDFB 3UJIH 2WUBL 2XZCL 4LSUH 4XP1L 5C09B 3IFPB 5BXFB 1NC4D 4M5ZH 1TZGH 1DANU 1CS6A 1S7RA 3KDMB 1G7PA 4Z7OE 5JXAL 3O6ML 5ETUB 4XB8A 3BP6A 2Q3ZA 5I1KH 1N64H 3HFML 3MXWH 1U9KA 5SWZA 3NABH 5EC2A 3Q5TA 2PXYA 3V9FA 3GIZL 4FQ2H 2FEEL 2BHUA 3DUHA 3NFNA 3ZDXF 1L4IA 5IVOA 4LF3A 3F6LA 1ADQL 3QCTH 3HI1A 4JG1H 2EDTA 4EZMA 2DLTA 1QR4A 5SWZD 2Q1EA 5ICXA 2PXYD 5MEND 1CD1A 2R1YA 2QKIB 4P5TC 3H6JA 3QXDA 2B4CC 1IC4L 2OL3L 4XCYB 2ZCHL 5IP4A 3G5YA 2R9HD 5KJRH 3X11B 3KPTA 1JYVA 3VFTB 3OSKA 4GAJH 5KZCD 1XH3B 5DD3L 1P7KA 4I18A 2WZPD 5E6ID 3TVMB 2VXQL 3QQ3A 5D1XB 5T3ZE 3OWEA 3LB6C 1T1XB 3ZMRA 3RWDB 1T2JA 4E0RA 1AIFA 4XHJD 1KENL 1UJTA 4JFQA 5EH1A 1KG0B 1DLHB 1N7MH 4O2CB 2X70A 2BDNL 3NCYP 4HFWA 4NO3B 2J5LC 2DIJA 1AE6L 1T2QH 4LU5L 1EVTC 2A77L 4QRUB 1R3JB 3E6FA 3S98A 4N1CA 1NUNB 1S8DB 4MDJA 4X6CE 2WBJC 4ZYKB 3RVUD 1QP1A 4R6UA 2BFVL 5DVOA 4YHNB 5JPNB 1PD6A 4KZDL 3G6AA 4ODHH 3G5XA 4JKWA 1CR9H 4DWHA 1JRHH 4NZUL 1GGBL 4PPTA 3MLUH 5IHUH 3T8XA 4Z76A 3T1FB 4X9HA 1U3ZA 1NCDH 4OZGE 2IANE 1WCBA 4DVRH 3IDYB 1GGIH 1EEYA 3ARED 3LEYH 3MRNB 1HSAB 1TJIH 4XPFL 4WRLA 1SMAA 3VG9C 3QEQE 1G7MB 4PJEB 4G43A 3BP7B 4MJ6A 4N9GA 5E8NA 3AROA 5DHYB 1KYOJ 5DMJB 4NKOB 1JGEB 3KVQA 5HI3D 5FCUH 4DZ8A 5EO9B 1KFAH 4QY8B 5F71A 1X5YA 3GSVA 3CSPA 3T2OA 3U6RB 1PEZA 1S9XB 3VDCA 2I27N 4QHUB 4ODUB 4W6WB 4YHZL 2VDOH 3LQAH 5FM8A 3IU4H 5CZVH 5ESAA 4PJFE 1A6UH 3C5ZD 2FIKA 3UCRA 3IFLH 5FA3A 3CLEH 2CGRL 1T1ZA 1NCWH 2Z8SA 3W2DH 1G9ML 1B6UA 3HUJA 4RA0C 5EBMA 1OW0A 2YD7A 3T0BA 5IBTL 1LK2A 1XCQA 4GS7B 4U0RB 4M7KH 2PO6D 1B3JA 3O3DB 5CSZA 5IW6B 5LJYH 3TIEA 4NO0A 4NKQB 2VDPL 4IRSA 4PJDF 3DRTA 3V52L 4U1MB 3W9EA 3KPSE 1IL1A 3TH2T 4L8SB 1I8IA 5MEOA 2UWEB 1K4CA 3ZTJG 4FZ8H 1J8HE 1E4JA 3TT3L 3UO1H 4NN5B 2BNQE 2DLFH 5KANI 2COQA 1H5BA 1MIEL 4G7VH 5DZOA 5T1DH 5B39A 4HT1L 4NO0D 4NYLB 5D7SH 4YXHH 3FFDA 3GZKA 1F3JA 4OB5H 2IFFH 1A1OB 3G6DH 3RA7L 1CFVH 1W8NA 5BZDA 1CE1H 4WV1B 4OLZL 5K9QI 3HR6A 4K9EL 3IDGB 5IM7B 5J6HA 3TVMC 3GM8A 5D2LB 5D1XC 1FL5B 3QQ9C 5KVFL 1IC5L 5F7MC 3LN9A 4NCC1 1F58H 5D7LB 1AGDA 4MAYB 4DKEH 1OAUH 5EZIL 2D03H 5DC4B 3F12A 4NNXA 5HTSA 4KMTH 1INDL 2C4XA 1FYTE 4J3SA 2F9BT 3B83A 2OXGA 4DGVL 5EOTA 3HG1D 2W9DL 4J7RA 1MCCA 3S4SG 1JTTA 3FT4B 4XH2B 1UXWA 1IBGH 1UZ6E 1UWXK 2FGWH 5GJTL 4X5XA 4M9PA 1P7QB 5EU7C 1ED3A 2Z31A 3JV4B 3GRWL 3V8CA 2DQHH 5GSRA 5J6GB 4FFVC 5HVHB 4X5LA 3BPOC 3U7WH 1EAPB 3SBWA 1FGNH 2FD6L 2CK0L 2XWBB 2W60B 5E7FA 5I73B 5B4MC 2F15A 3U36A 4ZFZB 4KHXL 4WI5A 1LILA 3WL9A 4MNQA 3AM8C 3ZE0F 5DD0H 1IEAB 3TBVA 3BKMH 3K74B 2V7HB 1U8OA 1NDMA 4L8CB 5F7KC 3CH8A 1RJZA 5INDA 3IDYC 3MV9E 3SDCD 2Q86A 2CDGB 4Z7WF 1JGLL 1FG2A 2IBZX 3NIGF 4OSUL 5H8DA 4E5XA 3O6LL 2NXYB 3HI5H 4FXGA 5JQ6H 3ULUH 4OCYL 2H26B 1RQ5A 4NKDB 4ZS7H 4PY7B 2DQUL 5A16A 3W11C 2NY4B 1GJIA 4P57B 1EJOL 1SY6A 4KQ4L 3MUGB 4I13B 1H15A 3OKKA 2ED7A 3PG2A 3RL2A 3TZVA 3RNQA 2YUZA 4Z95L 4M1GL 5IUSA 4K3JH 4PGCA 4OLWL 4DAGH 2Q8AL 3MRFB 2WLYA 1VEPA 5DSCB 1W0WA 5SX5H 2CD0A 4FXKB 1DBJH 2CLRA 1DSFH 4HG4J 3MRJA 3QQ4A 2AJSL 3BEVB 5DMKB 2APTA 1T83A 4S1RL 3VU2A 4FQHB 5AEAA 1MPAL 4GS7C 4U0RC 5CUSL 1AJ7L 5HI4C 1RZ8A 4NCDA 3OAZK 1IKNC 3G9VA 1MCPH 4L8SC 1WIUA 4OLVH 4MDIB 3AAZB 4NN5C 4M4RA 1RUPL 3ROOA 5EBLB 4WW2B 4RDQG 1DN2A 1EIBA 1B0RA 2CO6B 2NY2D 3VFVB 4P4RB 4JFDB 4JQIL 3HMWH 7FABL 2IQ9L 4NQEE 2E9JA 2GJ6D 1MAMH 4X6EB 3HI6L 4E41B 5MEQA 2ICEA 3I02A 1D5IH 2HRPH 5DO2C 4WV1C 4HZAA 2J3SA 2AI0H 1ZLWH 1GYAA 4XTRD 1JP5A 4J8RB 1E4XL 4ESKA 4D0CB 4MQXD 2DD8L 5C0NC 2EO1A 3V6ZB 4PBWD 5EDXA 3ZO0A 3I3BA 3OJ2C 2P47B 4OV5A 2R2EA 4AMKL 1U8PB 2AJZB 2GY5A 1WBYB 3F7YA 3WJJA 3ALPA 4Q9CA 4ONGL 1AXTL 3DRQB 1RUQL 5IVZA 3Q5YA 3D3VD 1PX3A 4HKBA 3LH2H 4QRRD 2D7TH 4UIKH 5HHOE 1CGUA 4KVNL 1RUML 1WT5C 4TULH 4MNHB 4P59L 2IPUG 2F54B 5HVHC 4N0UA 1URLA 1RZIA 5H2BA 5C09E 2JIXB 3RWFA 1RIHH 2PW2A 5I73C 2YRZA 3ARBD 4DK6A 1GZPB 4OZIA 2AV1A 1ND0A 3QA3B 2PTVA 2H2PC 3GGWA 3DARA 2BVPB 1KJ3H 2QTEA 5IHZA 5H35A 1IKFL 3BAEL 4D9LH 2NW3B 1LDPL 3I6GB 4ZUSB 5B21A 4YXLH 3M45A 4NP4H 1HXYB 2DTML 2M8XA 3EYQD 1C5BL 5AYUL 2JF1A 2RAMA 4NZJA 2NXYC 3HZMB 3OZ9L 3VJ6B 2O5YL 5KSVB 1HI6B 4IRJA 1JMZA 32C2B 1RZKC 1FZKA 4KMQA 1CQKA 3QUXB 5FECA 1T4KA 2NY4C 4X8JA 3DGGB 2BSSB 4P4KA 2FBJL 3GSOA 2AJYL 4LSTH 4YE4L 4WHTA 1IZJA 1F97A 4RAHA 3ARDD 4RNRB 3ZYJA 4ZNEA 4HJ0C 1S7QA 1NCUA 4IMLB 4OCWL 3SJVA 3BP4B 2XFXB 1CG9A 1DBAL 4DTGH 2ZSWA 2FB4L 2P46B 4JRXD 4P4KD 3KPOB 3T2QA 4U1SB 2A9NH 1NEZB 2GAZA 2VUYA 3W0WB 2A2QT 4HWBH 2XN9D 1D6VH 5C08D 3SJVD 2V9RA 5D72H 1Z9MA 3SGJA 2DBJA 5I1DA 4GBXA 3J8F7 1BM3H 2VDQH 5F8QC 5E6ZA 3VI4F 2DICA 5JDJA 2ORBH 4LKXA 2Q7YA 4LHUG 1SJEB 4NHCL 1GGTA 1T6WA 4GXUN 5A2FA 3JWOL 4ZXBB 1KEGH 3FO2B 2FWOA 4M1CC 1T7XA 2GITA 4U0QB 2W9LA 5EU7E 4FTVB 4WW2C 1UT9A 2XPGB 5LQBL 1IILE 1W72L 3WKMH 4HD9A 4FQCH 3UTSD 1G9EA 3MGOA 3PWLB 4L4TA 5I1HH 1UB6B 2C1PA 1U8JB 1BFOB 3CH1A 5F70A 3TA3A 1A4JA 3MOBL 3P9WB 4PJ8B 2V7NA 1ORSA 2MQ3A 3DSFH 2J6EH 3BE1H 4PRPB 2YD6A 4Z7QF 4RZCB 3CFCL 2DQJL 1OAQH 4UUJB 3MCLH 2FRGP 4JPWH 3HE7B 5BS0A 3QUML 5EOCL 2Z8WC 5GGTH 5FUOH 1WBXB 4JANB 1CLOH 1I3RA 3MREB 3LDBB 1ORQA 2V5TA 1DUYB 4M43L 4PJEE 2ARJA 5IB1A 4L4VB 5DJXB 1SM3L 4XVSL 3SE3A 2XQYK 3DX8B 4ZUUA 4XZUB 1SJVA 2ARWA 4GAGL 1J1XL 1X9QA 4MCZB 2R0KH 1KCVL 1OD7A 4PGBB 5IW1A 1IGYB 3U0PA 4G42B 4XWGL 4ZUWA 5DURD 5F88A 2OJEA 1X4ZA 1REIA 3RL1B 1TITA 1P9MA 2XZQL 3IJSA 1EHNA 5C3TA 1UGNA 5ENWA 5IHBA 4ZTPL 1CL7L 3OKDA 1RFDL 1I7ZA 3GIVA 4WWKA 3X14B 1JN6B 1HQRB 4LFHG 4HJGB 3L5JA 1YECH 2A0LC 2R56H 4G6AC 2GK2A 2IEPA 1NUGA 2OTUA 3RZCA 1LO3H 4OD3L 2CIIB 4NRYB 4Y5YB 4NJAH 5EOQL 4WWKD 3N9GH 4Y4KB 1JGDA 4ELMB 3VGGA 1I75A 2LAAA 3UPCA 4P3DA 2UWEE 3X13B 3QUXC 4Z0XA 3SDYL 1WFOA 4OZFG 2LAGB 1DL7H 3CIQA 5C0IB 4JFZH 2OMNA 4XVTH 3ULVH 5F7HA 1HDMA 1AGEA 5DA0B 5EZOL 5A3IC 3MFFA 4GRWH 2NX5A 4HQQL 5CMAB 1L7IH 5FKPA 3STZB 4PD4J 3KPPA 5T3XE 1RUKL 2YR3A 4WI9A 3TCXA 4GXUM 5DJ0A 1XF2B 3OTTA 1TZHA 2AXFA 1VGKA 4JRYB 5D2LE 1JWMA 2Q7NA 3RQ3A 5D7LE 4NFDA 2NX5D 4JO4H 4KJQD 4YX2H 5CINH 4XNMA 1AKJB 4BH8A 2R8SL 3MRCB 1OGTB 1VESA 3T3MF 1MREH 3L3HA 4AEHL 1QFWH 4BUGA 4EOWH 3CXDL 1QQDA 1S7WA 5GGSA 2Z93B 4WGWB 3SE8L 3HHRB 3VXNB 4CU6A 5FO7B 4Y2OA 4ZXBC 1MCHA 1DN0B 5I8EA 1YY9D 1CGVA 2J8UB 3MRGB 2XA8L 5J56B 3RWEA 5DRXB 2DQGL 1FNAA 2ZNWA 3EDFA 3P4NA 4HLZG 3WFHB 4DW2H 4EJ1C 1NH6A 4Y2DB 2JJSA 2WWKO 4G8GB 4PJ8C 1CDCA 1NBQA 2EE9A 2VXUH 1I8LC 2A6JB 4U1KA 2HWZH 4QXTA 3L1OL 5EU3A 5IFAL 4NSKA 3WSQL 3THMH 1IQDB 4QRTA 4EIGB 5I15H 1QSVA 4ZFOL 1QFWM 3HE7C 5DQJA 3EHBD 2EEBA 4GW5B 2LVEA 3MRDB 3S3PA 3LDBC 4KI5D 2X4OB 5DWUH 2ZJSH 4H26B 3CZFA 5HHXL 1JPGB 5F1NB 5JHLH 3OAYH 1CFNB 4JZNB 1JK8B 1CTNA 3IKCB 4D8PA 4G6ML 4JO1H 1IFHL 2IH1B 3ARVA 4MD5A 1KIPB 2VWEC 3DUUA 2APXA 4L4JA 3NN8B 2E9WA 2BVYA 1ZT1B 3DROA 3GNMH 4Q9QH 1T03L 4Q0XL 5IKCA 2MPAL 1QO3A 1VSCA 2YA0A 3DVNA 1PG7X 5IEHA 3MYJA 1PQZB 4TVPH 1RJCA 2HH0H 3BFOA 4JFHD 4M61A 2QSVA 1GPOL 2D31A 2KQMA 3DO7A 4WUUB 4Y5YC 4X6CA 4M5ZL 3SGKA 3WFEH 3FN0H 4UT7H 4Y4KC 1F4XH 1H8SA 1WEJL 3CSYB 5C0JB 4MMZC 2P8PA 3R8BB 1N64L 4OZHB 3K1KC 3HB3D 4PR5B 2GJZB 4Z7OF 5C7XH 1JNNH 3UROR 3OGOE 3PV6B 1KT2B 4OZGA 2IANA 3VFOA 5F7NC 1CE6B 2P8MA 4GRLB 4CBPA 1FL3B 8FABB 2C1OB 3F5WB 4LPUA 1AXSB 4YDVB 4JFDE 3QEQA 4O00A 4EXPX 1RIVH 2VXSL 1MHCB 4E41E 2EXWD 4PGDA 4MJID 1EEQA 3TJHD 5LXGL 4HC1A 4QRSA 3KLHC 3FTGA 1A9EA 1TETH 4M1DH 5IMLA 5CJOL 3QEQD 3VD4A 2IALB 5KJRL 4AK1A 2IPKA 4YO0A 3MLYL 3LN4B 3O2DH 4LLQA 1I7RB 2FZ3B 4YXKH 3KLAA 1U2CA 2K3TA 1UVQA 4PJ9B 5D7IF 4PJFA 3HPJA 2P24A 4KFZC 1JGUH 3EFFB 3SQOH 1C5CL 3FO9B 4HEME 3E2HB 2L4OA 3SGEI 4PV9B 2GI7A 3PABA 4K3GA 4Q6IB 1FYHB 4HUVB 1FFOA 3TBSB 4BM7A 1FNSH 2R0LH 1IMHC 4F3FB 4YUEL 2YOCA 2F54E 3FRUB 5KBNC 4CMMB 1WIOA 1MI5D 1IM9A 1JNJA 3H7BA 5J1AA 3IVKB 4YJZL 1ZA3A 3WJLA 2V9TA 1CF8L 4G5ZH 3QJHB 4OQTA 4Y2DC 3KPSA 5ESQA 2Y5TB 3GJEB 4RGNB 3MLRL 1I9JL 1U58A 2H32B 3HAEA 1TXKA 1J8HA 3E8UL 1Q9LA 2BNQA 3VH8G 1DQTA 3WO3B 5E8EA 3BEWB 4HIHB 3IDJB 3BSZH 2JLLA 43CAB 3L3KB 4X6CF 4JG0H 4NBYB 4N0FA 3OGCB 4ZUVB 1QZ1A 5CEZE 1J8HD 3AXLA 1QLRA 2PYFA 2BNQD 3KG5A 2G60H 2YD5A 5IHUL 1X7QB 3DJ9A 1SEBB 3U79A 3BH8A 4XRCA 3TPUB 1UJ3A 2HLAB 5D6CA 4P9HC 2H8PB 4KK8C 5T5NF 1GGIL 4LNVA 4CVZB 5AD0A 3S37L 3HKFA 5EWIH 2AQ2A 1DBML 5HI5C 4OZGF 4PB9H 5C6PB 4K8RD 1ZLUK 4TUJA 1INQB 5FO8B 2R0WH 4WDIA 4MB3A 2YD4A 1NANH 5I1LA 2EDXA 1VPOL 2DKUA 3W0WE 3MJ9A 2R2BA 4P23B 2SEBA 4NKIH 5EZJA 1IM3B 2YPLB 3BZ4A 1I8KB 2APFA 3O3BA 2W91A 4U1GB 3ZYOA 4HCRH 4NNYA 3CFJA 1EX0A 5D71H 4YDJB 1CWVA 3MV7D 5JDSB 3CMGA 4X9BA 1ZXQA 3T0VA 1S9WA 2AEIT 1AQKL 4HBCH 2E6JA 5EO0A 3OBAA 5GPRA 1R5IA 1J1PL 4ZFFB 1JFQH 1BBJB 4GAYB 3ES6B 5TQ0H 1SYVB 3L3JA 3VD7A 4FTVE 3KGRA 3O4LD 1YDPA 4CJ1A 4JJHA 4XX1G 4GRLC 1CQYA 3MV9A 3QDAA 4TTDC 1DQML 4A6YA 1JZ5A 2OL3B 2W9EH 3FQRA 5J4MA 4HAFA 1XGYH 4YGVB 5GRYA 3K0WA 3PXHA 1A0QL 3NTCL 5IB2B 4PRPE 1E4XI 4QHMA 3TCLA 4MXQC 2OJZL 4H1LG 4AIZB 4PG9A 4UV7H 1SMOA 3QDGD 4P5TA 1YZZA 2RFXB 1AGFA 2YK1H 5KVEH 1QOKA 3SHSA 5K59E 3JTTA 4L4VE 4F37F 4MD4B 4JKLA 4PJ9C 1OAKH 1R3LA 5CJXC 3D0LA 1BX2A 3CVHA 3VWKD 1NC2B 2DIAA 3E2HC 2D03L 4XP5H 5CJ5A 3EOTH 4X7TA 5ACLA 2VWEE 1UM4L 4Q6IC 4O51A 4C58B 5IROC 4QHLB 5IK3B 5GS0C 3UJTL 5HYSA 4AEFA 4F7MA 4KKLC 4LIQH 1CVSC 3RU8H 2HMIC 1K6QH 4BJLA 3S35H 1ZHLA 4P3CH 1E6JL 3W9DA 3O3EB 4RGNC 1DR9A 4AEIL 4WFHE 4YWGL 2AKRB 1UXSB 4PIRF 1Z2KA 2VQTA 4H88L 2OTWB 1UZ6F 3MACH 3REWB 4PTUA 2ADJA 2WBJA 2E27L 1PFCA 3OAUL 2VR4A 1CDUA 1FRGL 4ODSH 4ZD3H 2R1XA 1V7NH 3MODL 4ELME 4JFFD 4OM1H 4NQEA 3AY4C 2X1XR 2XY1A 2DI8A 5FAAA 3ZDZE 3PGDA 1LE9B 4AJ0A 5IVXB 5DZNA 1GGYA 3HTLX 4NQED 5HGHA 1UCBL 4EVNA 3MA7B 3P30L 3OXSB 1KXVC 1FJ1A 4WU5A 1ZLVH 5E08L 3S8WA 4TOYL 3RIFK 1TVBA 3O6FB 5GISH 3TO2A 4HS8L 4GAFB 1UWEL 4JRYE 4P23C 5I1JH 5HHOA 4K3JL 4WO4B 1IGIL 1KN2H 1XGRA 5DGQA 1HILA 2D9QB 5INCB 4U1GC 1KELH 2F74B 2CDFA 2YUXA 4OLXH 5EBGA 3WNKA 2XKUA 4LPTA 5FOBB 3GJFB 3GSXB 5C09A 5BXFA 3MOAH 2PCPB 1U3HC 5C0FB 5CILH 2EICA 4XNYL 3KDMA 5DJ8B 4LVNB 1YQVH 2KBGA 3UAJC 5ETUA 2CUMA 1U92B 4JDVB 4UTBH 3MXVL 4RISH 4R26H 5I19L 3ARFB 2J8UE 1YN7B 1WWAX 1KGCE 2EDWA 3Q3GB 5GGSY 2DWEB 1JHLH 3QIBB 3BYYA 1BMGA 1A7QL 3KXFD 3MRLB 1UKSA 4G8GE 3B8SA 3V0WL 5L7XL 1D5ZB 4XPBH 1GOFA 2JB5L 1QNZH 1VFBB 2WLZA 4JVWA 4AZ8A 2QKIA 2YBRA 4FQXB 2I5YH 4XCYA 3X11A 4LCIH 1FFQA 3EYOB 1KXTB 2MCPL 3BKCL 3VFTA 1ZK9A 2B1HL 3NFSL 1XH3A 2QSCH 2ZCKH 3TVMA 5D1XA 2JELL 3LIZL 1T1XA 4D3CL 2FH8A 3RWDA 3WNMA 4LP5A 5JR1L 4I9WE 1OT1A 3CMOH 1H8OA 3WD5H 2P4AB 2H1PH 3PQYD 1KG0A 3MRBB 1DLHA 4O2CA 2WUCH 3Q5OA 1IAII 1YJDL 3OXRB 1N4XL 4P2RB 3WUWB 1DBKH 3LH2L 5D1XD 3QQ9D 2D7TL 4NO3A 1YA5A 4NN7B 1FFPB 1IE5A 2ZUWA 1SBBA 2LE9A 1PYWB 2HP4A 3L95B 3RTQB 5E5MB 4U6VL 5GS1B 4N8VG 3SDAD 4QRUA 2YMXL 1MFAH 5E6YA 1R3JA 1Q0XH 4OGYH 4WUUE 1FDLL 3BN9C 3V7MA 3VWJB 1U42A 4YFLF 3BH9B 4ZYKA 3LPWA 1ZT4A 2ESVB 5E9DD 2AK1H 3HN3A 4RBPK 1OCWL 3AS1A 4YHNA 5JPNA 3VFGL 2AS5M 4M6AA 3HE6B 3KWWA 1DVFB 3OHXB 2ZUYA 4OZHE 3LCYA 3AM8A 3NACL 2DKMA 3T1FA 1EJ6A 1JPST 1MCLA 3WMSA 3TC9A 2Y72A 2X09A 3NFPB 2EYRB 3MRNA 1HSAA 1KF9B 1I85C 1OLZA 4POUB 3LZFL 2N7BA 1G7MA 2Y36H 4PJEA 4RIRB 3V7AG 5I1GH 3BP7A 4GMTH 4N0YL 2BY3A 2BVQB 4WTZG 3F58L 5DHYA 5GRWA 3O6FC 1JGEA 4NKOA 5D70H 1JZ7A 4XCEB 1H3WM 4WO4C 1VACB 4QY8A 3WHE0 1MFDH 5C71A 3U4EB 4YHKL 3U6RA 1CDIA 1ZHKB 3TBYA 1G9MC 4KXZH 1S9XA 3BGMB 2X9XA 1G7IB 3V4PH 3P9MB 1CDYA 4PS4H 4QHUA 1WVZA 3G9AB 4NNPH 4ODUA 4Z18A 3B5TA 4KRPB 5DFVC 1Y6NR 2HYMA 4ZMAT 4GH7B 4S1DC 4K7PX 4LVNC 5DFWH 4YDLB 5BW7C 1QFOA 1R3IH 3WE6B 2FNBA 3QISA 3ARFC 5KAQF 5DA4A 1KB9J 3WV0A 2D7NA 1L7TL 1WZKA 3EFDL 2Y06L 5JXED 2FCBA 1IT9H 3N1QC 3O3DA 5IW6A 3IDIA 4OV6F 1IKNA 1MQKH 1V5JA 4MMXC 4MJ5B 1G0YR 1LO0L 1BOGB 4U1MA 1NCCH 1S3KL 1CBVL 4RGNE 4L8SA 2Y9RT 1WGOA 2UWEA 1T66D 3NZHL 3PIQB 2VN4A 5HI4D 3LKRB 3WKML 1YNTB 3MNZB 4NYLA 1M1SA 3L5XL 4FQXC 4L3EB 4BFIB 1A14L 3NH7L 1A1OA 2NMSA 4OZFB 4WGVB 3BE1L 4FABL 5DD5H 1GXEA 2IGFH 3A6OA 4WV1A 1P6FA 1OAQL 3QIUD 3IDGA 5IM7A 4XMLH 3NA9L 5D2LA 3WFDL 1EO8L 1FL5A 4NQDB 4LRNH 2DMKA 3T4AB 4OUUB 1UQSB 3D25B 1YEJL 5EZLB 4X5WB 3L3IA 4M7JH 4JZJB 2FECL 4U6HB 1KB5H 1WFUA 5MI0B 1JJUA 2Y4SA 3PJSB 4NN7C 3OJMB 5AAWA 2GK0B 4I8DA 5BRZA 1FE8L 3FT4A 2R29L 4XH2A 2CLZB 3LN5B 4LLUB 3RTQC 4LQFL 3BUYB 2YPLE 3MA9L 4QOKB 3QPXL 1WT5A 1DLFH 2YPKB 5GS1C 5BV7H 1CLZH 5HHMD 1P7QA 1MQ8A 3JV4A 1VEOA 2J88L 3VWJC 5J6GA 2FL5B 1EAPA 4GT7A 1QR1B 5BRZD 1LGVA 1F02I 1X4YA 2W60A 4KMLB 4JY6B 5C07D 1EEUA 1VKXB 4XCCH 4ZFZA 1ZVSB 2DAVA 1P7QD 3HE6C 1DVFC 5I2IB 1IEAA 3CSBA 3MPCA 5FYKH 4DEPB 2EH7L 2V7HA 3FQUB 4G8FB 4L8CA 1YC8A 2CKBL 3P0YL 3SQBA 3FB8B 2AGJL 2CDGA 4XCFH 5LVEA 2VZUA 6FABL 1QEWB 4WFED 3V8OA 1N6QH 2RB8A 3FQWB 3KYKL 2H26A 1TVHB 3OJVC 3TESA 4N68A 4PY7A 2ENSA 5CJ8A 4YBQC 3B8YA 1DL7L 2EIEA 4P57A 1EUTA 4ONOA 5EU5B 5LGHH 1Q8MA 3MUGA 5HVFB 3NZ8B 2YWZA 5SX4H 4PJ5B 2X2YA 3IFOB 1P4IH 2VLMD 3UYRH 3MRFA 5C86A 5DD1L 5DSCA 3UZEA 4M6NH 3MCKB 4KRPC 1CK0L 4OAWB 4XHQA 1SY6H 1XCTB 5BOZG 4XP9L 3MRHB 1OM3H 3N85H 4YDLC 2ZCLH 1OL0A 3BISA 3K46A 2J4WH 1TJGL 3BEVA 5DMKA 2IQAA 1KCSH 3PWPD 5D2LF 3WIHA 4XP4L 4FQHA 4C57C 3G5ZB 3LKQB 5D1QC 2X05A 4NM8L 1W72B 3MUZ1 4M3JA 2E8YA 3MLVL 3PDDA 3QI9D 4ETQB 3C6SB 4MDIA 4Q74A 3AAZA 3LMJL 2YZ8A 4XPAH 4R4FH 5EBLA 4WW2A 1SEQH 4LGRB 5ILTL 5MEPB 5C2UB 5HY9B 1JNHB 3GDBA 2AJVL 3V4UL 4JO3H 3VFVA 5JA8B 4LEXH 1HINL 4LAQL 4BFGA 3QUMB 5E95B 1MRDH 4P4RA 2XRAL 4JFDA 1JRHI 3SO3B 3RWCB 1KPVB 3EDJA 3U83A 4E41A 1BREA 5C0RL 3BVNB 4KKCC 4PRID 2KL6A 5FUZH 1I9IL 5DRZB 5DR5L 3FRPA 5IVXE 4D0CA 2QR0B 3MROB 3V6ZA 3UTPE 2NY0C 3DETC 4JFDD 1DCLA 1YMHB 3C60D 2N1KA 1QRKA 1U8PA 2AJZA 4E41D 1WBYA 1T3FB 5KVGH 2FR4B 5D2NB 3LHPH 5CGMA 4XPGL 4ZUTB 1CTOA 2BCKB 5MI0C 3S36X 4C56D 2HTKC 3VRIA 1EA9C 5CIPB 15C8H 1WZ1H 5KG9B 2O5XL 4R0LB 1NUFA 5JZ7D 3U4BH 3RPIB 2F8VA 5JMOC 2XA3A 4J3UA 5KVMC 4MNHA 1E28B 1UACL 5T5FL 1GSMA 2F54A 4FZEL 4J3WA 3B9KB 2RHEA 4F33B 4ORGB 3KYNB 3QIWB 1A6PA 2GCYB 1GZPA 3IDXL 3RI5F 5IIEB 3QA3A 1A7RH 4GLRH 5ICYB 2BVPA 5I16B 2ITCB 4P2QE 3T0WA 3QUYB 3NCFB 1KN4L 4JPVH 2NW3A 5DEFB 1I3GL 5T1KB 3I6GA 4ZUSA 3VFPB 3P40A 1S9YB 1HXYA 3BZDA 2NY5C 3RUGB 3OKMB 4FQJL 1E4WH 5C2BH 1PEWA 5I74B 1Y6KR 3HZMA 1GC1L 2A1WL 3VJ6A 3JWDH 3VH8B 5KSVA 1HI6A 2A0LD 2EDRA 4YQXL 1MRCH 32C2A 4POZC 2EC9T 1UWXH 2R4SH 3QUXA 4WUKH 4PTTB 4HGWB 2V5SA 3I9GH 3DGGA 5A43C 2BSSA 4PGEB 4C59B 1AY1L 2NXZB 4I5BB 1K5NB 3QDJD 2EEDA 4RNRA 3BDYH 3KJ6L 4KI1A 3T04D 3NCBB 3HC3H 1D6EB 3IU3B 4IMLA 5E1HB 4GUPB 3BP4A 3MMEA 1DDHB 4OLUL 2XFXA 3JWNC 4K71C 4ZOBA 1U8MB 1EFXD 1NFDB 4O4YH 3KPOA 4U1SA 4KK5D 5JOFB 5KN5B 5JUEL 1NEZA 4M1DL 2A9ML 3W0WA 2NR6D 4JDTH 5IQ9A 5DLMH 2OLDA 5EUOF 4WI8A 3RDTB 4Z7UB 3JWOC 2YA1A 3LPGA 5A3ID 4XNQB 4HUUB 3A0OA 3EO9L 1RMFL 2QQNL 3NOIA 1KCRL 1KNOB 2F5BL 3QWRA 4M02A 1NMCB 4P2RE 3WYRA 1MJ7L 1SJEA 4N5EC 4ZXBA 3FO2A 1MAJA 1KEML 12E8H 4FTVA 3QWRD 4AM0B 3DHJA 3PF2A 2XPGA 2XOTA 4OCMC 4ZFOB 2ESVE 4QRPB 2OX5A 5I76B 2DBLH 1UB6A 3O3UN 1YEEH 1MLCB 1U8JA 3SO3C 1BFOA 4OLYH 4HPOL 1OP3K 5B38G 4PJ8A 5TDNB 1I8LA 2PYEB 5GGQL 4S0SD 4PRPA 4K7FB 1CI5A 3CX5J 5EBWB 2ZG2A 1BP3B 4UUJA 2F19H 3HZVB 4V1DB 3GI8H 3HE7A 4YAQB 25C8H 2FJFB 1WBXA 4JANA 3MREA 3ZT6A 1U8HA 1DUYA 5D2NC 4FFYL 4PRPD 4L4VA 5DJXA 1XR8B 4MAUH 1UC6A 3DX8A 5F7EL 4XZUA 1BWWA 2Y5EA 1J1OL 4MCZA 4PGBA 1NCTA 1IGYA 4R0LC 4G42A 4G9DB 1OGAB 4PLJD 2EDFA 2VC2L 1RURH 4K8RL 3PGFL 5TDOB 4OCSL 2ADIB 5AAMA 4RAVB 3RL1A 4R4BB 4F7TB 3B2UC 3B9KC 3GHBH 3E6HB 4OD2B 4DZBB 5DRWB 3QIWC 1VDGA 4LDLB 1F4YH 1BF2A 5E4EB 1E6OL 3FAXA 4ZFGL 3UZVB 3GM0A 3O2VL 4LHQB 3X14A 1JN6A 1HQRA 3VRJB 3DX9B 4HJGA 5JTWA 4HZLB 4OI9A 4IMKC 1BEYL 1OHQA 3KNBB 5CWSB 2CIIA 4NRYA 4L5FH 4Y5YA 3SKNB 3ZE1F 2VN7A 1TCMA 1FCGA 1NGWB 4Y4KA 3ILQC 5I74C 4ELMA 3UTOA 5J7CC 4J3TA 2XWJB 1HEZB 1MCBA 4AQOA 4LSSH 1F4HA 2KPNA 5EC2B 1AXIB 4M6ML 4UZGA 3TV3L 3X13A 1T80A 5MENB 4J2XA 1OTTC 2NXZC 5C0IA 2D7QA 1QLEH 2W0FA 3WBDA 3HI1B 3RKDC 4R8WH 1W2KT 1XGYL 3LAFA 3SE4C 4GQ9L 4L3EE 1MSPA 5E5UB 1ZVHA 2L7JA 5KZCB 5CMAA 5IG7B 3TN0D 1AGBA 4H0GA 5DHXB 5DVNA 3STZA 1CU4H 4LSDA 3ZYIA 1LMKA 2YSSB 4HW6A 4R4NC 5E6IB 3FO1B 4A6YL 1XF2A 3HZKB 4F15C 3H9SD 4NQDE 1JPTL 2VIRB 3RDTC 1EFQA 1CFTB 1Q0YH 1F42A 4D9QD 1AKJA 4DUVA 4I18B 5IT2L 1KC5L 4Y4HD 3RAJL 3MRCA 1OGTA 2OP4L 3KLHD 1AC0A 2EE6A 1NMCC 1RZGB 3GMNA 1F4WL 1HIMH 3OJDA 3LD8B 2Z93A 1NSNH 2IPTL 4OIBA 2ICWI 3FB5B 3VXNA 1HYSC 1AKJD 4QOKE 2BXYA 1DN0A 1YN6B 2DF3A 5BO1L 1CGWA 3FOLB 2J8UA 3MRGA 1FZMB 1A9BA 5DRXA 4U6YB 4HIXH 3UBXG 2Q8BL 3BOVA 1KULA 3I2CL 4DN3H 2QQLL 3WFHA 2MKLC 4Y2DA 5D7JD 5K9JH 1XGTA 4FP8H 1VFAB 4G8GA 2A6JA 1NCBH 3NBNA 5DUPL 2ED9A 5HDBE 1EUUA 3AREB 1M7DA 2VZTA 5T33L 4HIJB 4GW5A 4XPTH 5TF0A 3MRDA 3IS0X 3HNSL 3DV4A 2X4OA 4H26A 2NYYC 4M6OH 1JPGA 5F1NA 2BJML 1T5XB 2VAAB 4ELMF 5CCKH 2EDKA 4Y8DC 3QFJE 4YDKL 1CFNA 3LEVH 4JZNA 1JK8A 3IKCA 1J9CT 3IS1X 5L9DH 2IH1A 3D1MC 1KIPA 3ZDZF 4PJ5E 2VDKL 5C0CB 3NN8A 1D9KB 1MFCH 1YMMD 1ZT1A 4F7PB 2V6HA 4KY1H 1L9MA 4N1EA 2X1PA 3MLSL 5GHWH 4DVBA 4OFVA 1LWRA 3C5ZB 3JZ7A 4K94L 3MUHL 5T3ZH 3SOBH 1UYWH 3O0RL 1X6LA 1CD8A 5IQ7H 4MA8L 3FJTA 3CCHB 5GRZA 1PQZA 4I9WD 4TUOB 5HI5D 2BC4B 5HYEA 1DBBH 3QWOB 4LGPB 4I77H 4OCXH 4WUUA 3UDWC 2PO6B 2FIKB 2XQBL 3QO1A 3RIAF 4MA1C 1YQVL 4YHPB 4CN1A 4NC2B 1A21A 3CSYA 4IDLA 4GSDH 4OD1H 5FGRA 4UTBL 3HNTH 5AWNH 4OZHA 5GSVB 5KSAD 2EDOA 4PR5A 2GJZA 3EO0A 3CU1A 1AGCA 5CSZB 4HUNB 4NO0B 5TQ2L 3QHZH 3TIEB 5ADOL 3PV6A 1KT2A 4KGLA 4XNXH 3W9EB 1CE6A 3PWNB 4GRLA 2R9HC 3GB7B 1FL3A 2J8UF 1EHXA 8FABA 3D87B 2C1OA 3F5WA 2X40A 3DXAD 4UDTB 5IMOB 5TE7L 1AXSA 4K3DL 4YDVA 1AI1H 4MHHG 4KQ3H 4CMHB 2AJ3B 3DYOA 2VE6B 5B39B 1MHCA 1MCEA 4KUZL 1U8KB 4RFEB 5E6IC 1J5OH 5KVDH 1OQXA 4MLIA 4GRLD 2KZ1B 5IFHH 4KHTL 3L3GB 3GSWB 4PJXF 2IALA 3EIFA 1HKFA 1MEXH 4QXWA 1PG7W 5ITBH 2WWMC 3LN4A 1I7RA 3GSNH 2FZ3A 1X5AA 5D2NE 5MHSD 2Y25A 3GEWB 4C55A 3HG1B 3DURB 1SYSB 1RK0B 4HC1H 4JB9L 4PJ9A 1KJ2A 1R0AL 3BKJH 3KPRD 4PJIF 5CJXA 3EFFA 3F12B 5KSBB 3FO9A 3LD8C 2VISB 5B3JF 4ODTH 3TT1H 5JQHC 5HD8C 3QUKB 4PV9A 1RZFH 1EHLH 4Q6IA 4HUVA 3TBSA 5EOTB 5E8DH 5IROA 5DVLA 3TP4A 3OKEA 1QHOA 1OARL 2HJKB 1RVFL 2VDMH 3FRUA 4CMMA 4UNVA 5DC9B 2FX7H 3P2TA 2C9AA 5I0ZA 4GKNB 4Y1AE 3IVKA 1FFNB 1HNGA 5JIIA 2NNAB 3QJHA 4X7SH 4PGJA 1MCSA 1MCOL 2Y5TA 3GJEA 4LL9A 5LWYL 5GS0D 3S88L 1F90L 2H32A 1UM5H 2XI9A 4WEBL 1J05B 1TJHH 1TPXB 1BJMA 4J1UB 1VENA 4LLWB 4NWUH 1OSZB 3SDCB 1KLGB 4M62L 3AREC 3BEWA 4HIHA 3IDJA 2D0GA 3RUGE 2WWKT 4OQTH 1OPGL 1E0OB 3L3KA 4RGND 1ZA6B 4ZPTB 3OGCA 4ZUVA 3GBNH 1MFBH 1U8OB 2C3WA 3AY4A 5AZ2L 3HAEH 3MYZA 1NMAH 4Q9RH 2V5MA 1X7QA 1SEBA 1GGUA 4OGAD 2CH8A 3TPUA 2HLAA 4MXWH 2H8PA 3BDBA 4WCYH 4NGHH 4CVZA 3FONB 4Q2ZB 3BO8B 3KLSA 3RVTD 1D9KC 3RVWC 3GJFK 1HZHL 1IEHA 3VI3E 1INQA 1NFDE 1XGPB 3ARGD 5FO8A 3CDFA 3TGXA 1BHGA 5D70L 3BX7C 5A2IH 1II4E 2DQIH 5E99H 2IPUK 1V7MH 1P69B 5DVKA 3QH3B 4O02L 5GRJH 4P23A 1MFDL 2WQRA 5FK9B 1IM3A 2YPLA 1A3RL 4Z7UE 1I8KA 4ZOEA 2NTSP 4JHAL 5I1IL 2EDNA 4LSPL 4TSAL 1MELA 3L6FB 3C08L 2KKQA 1QKZH 2DDQH 1O7VA 2PO6C 1O7SA 3N1PC 1RULL 4G3YH 4YDJA 4KKNA 1H3PL 3DGCR 5CP7B 4PRBB 1BZQK 1U3HA 1Q9WB 3V5DB 5HDQL 3K7UA 2VH5L 1R3IL 5CJQH 1KV3A 1RSFA 4ZFFA 3ELAT 4P3WA 1JZ8A 1BBJA 3IJHB 4HMDA 3ES6A 2APVA 1SYVA 5JOPE 2NY2B 1U3HD 4GXVH 4XBEL 4GG8B 3UPRB 5DEZA 4QGTA 1M71B 2KUTA 4X0KB 3PWJB 2GJ6B 2OL3A 1C7SA 3ZKMD 4U7KA 5DS8B 3OB8A 3A67L 4CMHC 2ZPKH 4YGVA 5DMIL 2BSED 2PYEE 5LKNA 1IGMH 5JPMB 2J8HA 2WINB 1JHTB 3NIFF 4AIZA 3LSOB 3U0TB 3RRQA 4V1DE 1NCAL 1U8LB 5TPWH 5MEQB 1FAIH 5F6HI 4Y4FB 3I50L 1I9RL 4U1HB 1KIQB 3WIFB 3JUYA 3EUUA 4NWTL 5F96L 4MD4A 4V2BA 3D3VB 1GHFH 4QRRB 3RJDA 4X4ZA 4OV5B 2CXGA 2OTPA 4N0CD 1AC6A 4O2EB 1NC2A 1U93B 2B4CH 1OGAE 3MLXL 2DI9A 2NY1B 5CZXD 2ICWB 2Q76B 4U1LB 4X7FC 2X6MA 4QHLA 3ZTNL 4K23H 2PKDA 3ARBB 3H3BC 4FQIL 4XP6H 1J8KA 2JK5B 5HXMA 4HPYL 3BHBB 1GGCL 1XEDA 3RX5A 3BRGC 5GGVL 3TJEL 4M93B 3QHFH 5DQDH 3RJQB 1RIUL 3O3EA 4KGJA 5EA0H 2GFBB 4HS6B 4YBHA 1UXSA 1UCTA 1TPXC 3OQ3B 1A6WH 3U0WH 2OTWA 3SDCC 2NY7H 4KZEH 4KJYB 4PYGA 1NBZB 4MB5A 3REWA 4O9HL 4KRMB 5I1AB 3EZJB 4LLAA 4EUPH 1PY4A 1B0GB 2Z8RA 3PDOB 3ULUC 4JFOB 1OAZL 2OQJB 3BPCB 5E2UH 4PJCB 2W0KA 3BN9D 1WIPA 5MENE 3MBXH 4NQSA 1WF5A 1LE9A 3ARDB 5IVXA 3M8OL 4BQBA 3GMQB 1PX4A 1P4BH 3P3YA 3OF6A 3T2PA 1I85A 3IYLW 3RFZC 3MA7A 4X8JB 1INEL 4JRXB 4P4KB 3OXSA 4KKBC 2QJDA 1KLFA 4TNWK 3O6FA 1EZVX 5IMKB 2XN9B 5C08B 2EXYD 1C5DB 3IT8D 3ARTA 4PLOB 3BUTA 1RZJH 5LCVL 4JKMA 4WO4A 2AJXL 3MBED 3ARUA 5I66B 3GK8H 1O5DT 1IGTB 2JB6B 5INCA 2F74A 5EIQA 1R5VB 1YYLL 4X83A 4M48H 1LEKB 1JCKA 3O6FD 5FOBA 3GJFA 3GSXA 3W81A 4QYOB 2PCPA 4AQ1B 5C0FA 3S37X 4WO4D 3PL6D 2VDNL 4EEEA 2J4WL 5DJ8A 3S97C 4KH2A 4F9PC 3UMTA 1UB5B 3VXTB 5BW7A 2OK0H 4JQVC 1U92A 4JDVA 3C2SA 1W0VB 1ZEAL 4P2QA 2QEJA 3ARFA 1MHPH 3DIFB 3QDMB 4HWZB 1YN7A 2NY2C 4QTIH 1ZLUH 2HLFC 3Q3GA 3UTSB 2DWEA 4LCYB 5K9OB 3QIBA 3TBWB 2GITB 4HXBL 5F9JB 3MLW<