1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
3JTBA 4A67A 1JXDA 1AZNA 3EF4A 1MG3C 3S3CB 5D4IA 4UAHA 4HAKA 1XB3A 3X1GA 1L9OA 1A8ZA 3NJKA 2XX1A 4DPCX 1MZYA 2FQEA 2BZ7A 1ASOA 5B3SB 2UXTA 4NB7A 3WI9A 3U25A 3PAZA 4DP0X 3H4HA 1NZRA 4A2FA 2DY2A 1AZUA 1OF0A 4A66A 2UXGA 3PAVA 1AZCA 2A3TA 2BWIA 2Y1AA 3NSDA 4GYBA 5I6KA 4BXVA 4E9XA 1SF3A 2EINB 1L9SA 4YSAA 2QDWA 1NINA 4YSRA 2GBAA 1EHKB 2BP8A 3NSFA 2BZCA 4YSUA 1I53A 3QJTB 3X1BA 3UACA 2Q5BA 2VW7A 3ZIYA 1SFDA 1RZQA 3OMNB 2QPEB 1KYAA 4DPAX 3X2QB 1PLCA 2QT6A 3IE9A 4BDVB 1NWPA 2VN3A 4F2EA 3PCYA 3SBRA 1NPNA 3ABMB 3ERXA 4PCYA 3QQXA 2XV3A 4YSCA 1L9TA 2CBPA 1GW0A 2BP0B 2WO3B 3CVDA 2BW4A 1AR1B 2HX8A 4CSPA 2PPAA 2DWSA 1PCSA 1NIBA 3ASOB 1J5DA 5F7BA 4YVNA 2NRDA 1AACA 4JKNA 2GHZA 3TU6A 3ABKB 5D4JA 3TBBA 3OMAB 1L9QA 4BWTA 3QJQB 4HCGA 1ETJA 2FWLB 1BXVA 3WNIA 2YAEA 2EIKB 3MX0B 3NJHA 2FQDA 1PLBA 3X1NA 5A7EA 1QHQA 3GDCA 1JVOA 1RKRA 1JXFA 2DYSB 1CYWA 1GR7A 3EH5B 1WA1X 4NERA 2J57A 1ZIAA 1X9UA 4E9WA 2JFCA 2FT8A 8PAZA 2JXMA 3NJGA 1CYXA 1ZV2A 1NIEA 3S3BB 3FS9A 1BEXA 4NAJA 1BQ5A 1NTDA 3WIAA 1PAZA 2VSMB 2XV0A 3NJJA 1AS7A 3KW8A 2DV6A 4BK5C 4N4YB 5LDUA 2BHFA 1AOZA 3UAAA 1V54B 1CC3A 4HHWA 3QJSB 2Y69B 1W6WA 4JHUA 4AX3A 1KDIA 1AZBA 1B3IA 3H56A 7PCYA 4MFHA 4GP5B 4YSEA 3NJIA 1R1CA 3NJLA 2JKWA 4YSTA 2ZONA 3CVBA 3ZX1A 4AI7A 3FU7A 1ADWA 1XB6A 2XXGA 4DP1X 2R7EA 1JZGA 1AG6A 1RZPA 9PCYA 2YAOA 1JZFA 2ZOOA 1BXUA 3BQVA 1TEFA 4RH4A 4E9RA 3S3DB 2GI0A 1URIA 2J55A 1JZHA 2FT7A 4E9SA 1MZZA 4G70B 1AS6A 1IUZA 4KO9A 3AG1B 2VSKB 2XV2A 4WTQA 2QPDB 3EH3B 1XMEB 3WKPA 2QDVA 2TSAA 4P5SA 3CDZB 2AVFA 3T6WA 2IDSA 1AIZA 3T6ZA 1ET7A 1KBVA 1KBWA 1F56A 4M3HA 3FSVA 2IDTA 3FU8A 3SBPA 3GXUB 4E9QA 1ZDQA 4G7SB 2H5UA 1JZEA 1J9SA 3JT2A 4YSDA 4HZ1A 3NJNA 2HZHA 3TASA 5AFAA 1JXGA 5PCYA 1OV8A 4QLWA 2I7OA 5B7EA 1AANA 4ENZA 3AY2A 2VW6A 1AG0A 3ZBMA 2EIJB 2VMJA 1OCCB 1PY0A 3NSCA 1GYCA 2YAHA 5B7FA 1IBYA 1ID2A 1NIDA 2DYRB 3ASNB 3QJRB 5B1KA 3DIVA 2H3XC 1M57B 3QJUB 6PCYA 4YSOA 3PLYA 4F2FA 1TU2A 3DTUB 3FQYA 2PP7A 1GS6X 4Q89A 2LLNA 1NDTA 1JOIA 4AZUA 3AG3B 1AQ8A 3S8GB 2GSMB 2BW5A 1A4CA 2CCWA 5PAZA 1HAWA 3OM3B 1AS8A 1JZIA 1WA0X 4GXFA 1MG2C 2PPFA 4KO5A 2XU9A 2YAMA 3CZUB 1GY2A 2GIMA 5AZUA 2IDFA 2PPEA 4KO6A 2UXFA 3ABLB 3FT0A 1JVLA 2EILB 1SJMA 2BP8B 2RACA 3PAUA 2E86A 2ZXWB 4A2EA 1ET5A 3FYIB 1SHWA 1N68A 1W6LA 5E9NA 2B3IA 1BQRA 2VW4A 1ET8A 1L9RA 1SHXA 4KO7A 3T6XA 4UF7C 3KW7A 1PZBA 1HAUA 1YLBB 2J56A 5I6PA 5I6LA 1E5ZA 5B1JC 2IDQA 1ZPUA 2UXVA 2IH9A 1IBZA 2PLTA 1KDJA 1V10A 1WA2X 1WAEA 4WKXA 2IWEA 3AG4B 2I85A 3TBCA 2EIMB 3TA4D 1SDDA 1W8EA 1IC0A 4E9VA 4X4KA 3PXLA 1E65A 1J9RA 1FWXA 2TSBA 1VLXA 4A68A 3ZDWA 1FA4A 1X9RA 2MRYA 3FU9A 2PPCA 4P5RA 4TXVB 5F7AA 2BO0A 1OE1A 3NP4A 1IKOP 3NJFA 4KOCA 3IBOA 5B7MA 3BVDB 3G5WA 1ILUA 1OCOB 2H47C 4BWWA 3CVCA 2OJ1A 1AAJA 4E9YA 1JZJA 4L0PB 3EH4B 5I5IA 3OD3A 5I6OA 1BYPA 1KCBA 2YARA 4DP4X 2XUWA 3PPSA 3T9WA 4KNSA 1SF5A 2CAKA 1XB8A 2YXVA 3D12B 2AFNA 3FSZA 2GB2A 4G7QB 4F7KA 5I6MA 1NWOA 4A2DA 4G72B 4DP9X 2HLEB 2YXWA 1SDDB 1T5KA 2B08A 2MTAA 2X88A 1BXAA 1GY1A 3CG8A 1E30A 4KNUA 5TK2A 4W9ZA 1BYOA 2CALA 2PP8A 2W88A 4DP7X 3H4FA 3UAEA 1BQKA 4BDVA 1E5YA 2HX7A 2HXAA 3FU7B 1KCWA 3SQRA 1A4AA 2IH8A 2R7EB 1J9TA 4YL4A 2PP9A 4ZK8A 1OE2A 1J9QA 4BXSV 3UGEA 3UABA 5B1AB 2BP0A 1ILSA 1SFHA 2BWDA 1PNCA 2YAPA 4EF3A 3WNJA 3ABGA 4N8UA 4AKPA 2XXFA 1NIFA 1E67A 1V55B 3QJVB 2FT6A 5D4HA 4A2GA 2UX7A 4DP2X 2N0MA 5AKRA 1A3ZA 1DZ0A 4YSPA 4YVUA 1ASQA 1WS8A 2UX6A 1UATA 3FPYA 2XLLA 4GP8B 3FSWA 3T6VA 5TK4A 1HFUA 4W1TA 3T71A 5I26A 4JHVA 3AG2B 2GC4C 1OOWA 5IY5B 2PCYA 2P80D 2OCCB 4KNTA 2CUAA 3IN2A 1MDAA 1M9WA 3SBQA 3NT0A 3X1FA 4FAAB 4HCIA 3AZUA 4AKQA 2GC7C 1ASPA 1PNDA 1FFTB 7PAZA 1KV7A 4GP4B 2FTAA 4DP6X 1NIAA 1QNIA 3GYRA 5I28A 3EHBB 4YSSA 3IN0A 3HEIB 2VM3A 3FPXA 1JERA 5I5MA 3FSAA 1N70A 2X87A 1BAWA 3QPKA 1M56B 4UANA 1NPJA 1RCYA 2XX0A 2Q9OA 3MBWB 3X1EA 5I5JA 3RYMA 1J5CA 3UADA 2OV0A 2IWKA 1PZCA 4FA7B 2HRHA 1PZAA 2WO2B 1GS8A 1TKWA 1NICA 2HX9A 2VM4A 3NP3A 2FQFA 4DPBX 1KGYE 2YQBA 1A4BA 2P80A 4QKTA 2PCFA 2XWZA 4HIPA 3FYEB 5EHFA 3OQRA 3FQ2A 1TEGA 1ZIBA 2XVBA 1ZDSA 2YAFA 3WKQA 4HHGA 2WSDA 4AKOA 4DP5X 1GSKA 3C75A 4HCFA 3N55A 1PMYA 4Q8BA 4K9JA 4G71B 1PF3A 2IAAC 1GS7A 2FQGA 1QLEB 3NSYA 3WG7B 3V9CA 4E9TA 2AZAA 6PAZA 1AZRA 2HRGA 3V9EA 5B1JA 2FNWA 1PLAA 1OCZB 2ZWNA 3CDZA 1DYZA 1OCRB 2DWTA 3AW5A 4KOBA 2IDUA 5ANHA 2I7SA 4PAZA 3IEAA 3NJMA 1WS7A 2XYBA 2AANA 4GY4A 3NYKA 2YAQA 3N2JA 4CSZA 2CJ3A 2FJSA 3S8FB 3L45A 2PPDA 2W8CA 3DKHA 4HALA 3FQ1A 2AZUA 2IWFA 5FC9A 4BWUA 1CUOA 1CURA 2J5WA 1A65A 1EZLA 4G7RB 5I6NA 4DP8X 1SNRA 3HB3B 4A2HA 4M4RB 1L9PA 4YSQA 3OMIB 5B1BB 1OE3A
chains in the Genus database with same CATH superfamily
2EVGA 1BOYA 4MBRA 4TOYH 2K4WA 4OFQA 4UAHA 3IBEA 1XB3A 4MNHA 5MP6H 2PO6B 3WGVB 1MWOA 1XL6A 1C7TA 3BPCA 3O9WD 1SBSH 4GKSA 3EH2A 5F0LB 5I1HL 5E2JA 1N0XH 2VQ4A 4FTVD 3RFZC 1L9MA 3WO4C 1PEZA 4M5YL 4OIIL 3MLWH 2O30A 4RIRA 3ESUF 1SOKA 1DANT 5JW3H 1NCCL 2HWZH 4A2FA 2BHZA 3DMMC 4Z7WA 3BXNB 3JTSB 3BAXA 4BRJA 3AU1B 4UM8A 1VKXA 1EDYA 1MFVA 3DUSB 1U2YA 4R4FH 4XNYL 1UTDA 3WENA 4NUJA 3KR3L 4JHWL 5CIPB 2QPFA 3UACA 1RZQA 4K4KA 5C70A 4OGXL 5F7WC 5T3XH 1DSYA 1NCOA 3CXDL 5ICXB 3V6FB 1S78C 3FCBA 2GCYA 1IRAY 3ZHDA 1J1OL 3R1GL 1DBBH 3OZ9H 3V4VB 4YHPB 4QRBA 4ZAKA 3HNTL 4M03A 2FGWH 3QNZA 5FKAA 1QVOA 2X4QB 1KT2B 5CZVH 3RKDD 3HN8A 1DFXA 1I8AA 1L9TA 4ADJA 5JW4M 1WK0A 1GOHA 4FQ2H 2BW4A 5HD8D 3RZCC 1JNNL 3D0VB 1E9OA 1TJHL 3IETB 1NCTA 3BVNA 1J5DA 4QPEA 3BDBA 2HTLC 5HXMA 1G7LB 2PMZA 3MLTB 3RY6C 2HG5B 1DUZA 2BVQA 4LFHG 3H7BA 3QAQA 2XWBB 3TBVA 4FMFA 5CF3A 2DQTL 3QZWG 2QQQA 1TG8A 4PJ7B 1Q38A 2I32A 1DLFH 2EIKB 1HXMA 1LO4H 1QWUA 1D9KA 1HXYA 5D1QC 5DK3A 1RKRA 5FGCB 1OM3L 1GR7A 3HB3C 4EI0A 2J57A 1GCYA 2BOBA 5EU6E 5GS3A 3VX1A 3AQYA 4JM2C 2XKNB 4LCYA 1NCDL 3WKMH 2AJYH 3L16A 5CMAA 4RSVA 1TO4A 1HQ4B 2GFBB 5F0MB 1CYXA 1J05A 1RUMH 2UZXB 3UOAB 4HSAC 2PO6C 1IAKA 1KOAA 3IVKA 1BIIB 3EO1A 2XV0A 3DA0A 3FU5A 1VADB 5E9AA 4XP6L 3IGKA 3S48A 3ZLQC 1ZJAA 3Q01A 5DJ2A 4ZUSA 1M6UA 3PHSA 1CC3A 1CD1A 1MCCA 5DRNA 1V05A 3FH5A 1J0HA 4PJXB 4FXKA 1RJLB 1VPOL 5HHXL 2MHAA 4QYAA 3ENEA 3S7GA 3MRIA 5JXEA 2ZUTA 1QW8A 2QQKL 4NT6A 5F9JA 4DZBA 3PABA 4EI5D 4GB9A 5CP7B 5C0JA 3F04A 5JHDE 4UQ2B 5SWQB 2ID5A 4H5SA 3RI5F 4GQPH 1T6WA 5JOEA 5IMOA 3EO9H 5E6IC 4PWKA 4LVHC 3HAEH 3STBA 5I1GH 3VB8A 4OM0L 2BPBA 2BRQA 1TZIB 2XWXA 5K5YA 4JDTH 2BSDA 4ZOBA 5EH1A 3CDYA 4ALAL 4PU2A 4U6XA 4AEEA 4XO9A 4PR5B 2NSXA 5JPNB 5D7IE 3QEQE 1MCOL 2ZWYA 3GSVA 1WFIA 3LKRA 2VLLB 3MBED 4PG2C 2QDVA 3X13B 4FFWD 3QJZA 2VLKD 4Q4IA 5J11B 3UEZA 2W9EL 4LSPL 3UPCA 3LPFA 2C4FT 3GMOB 2NTSP 4QXGH 2AGJH 2ZXQA 3Q2CA 3RL1B 3HC4L 4G59C 4AGPA 1AD0B 2VLJA 2H1PL 3GXPA 3MTRA 4U1SB 5EEVA 5EF1A 2KPWA 3P73B 3SBPA 4B27A 1F4WH 2F7IA 3MROA 2BNRB 1UASA 4Z7OE 5LQBH 1T7XA 3KVPA 4X6FA 2V17H 5KTEL 4UIMA 3CVHB 5PCYA 3CLEH 1OV8A 3UAJD 2B4CH 5FO7A 4J3VA 3VI3F 2X4RA 4X8XA 4C57C 2P8LA 5KG9B 3D30A 4P5KB 1KB5A 4KKCD 5E2WH 3OR7A 3Q5YA 3O9WC 5AD0B 5K9OA 1I1AA 2DLFL 2I26N 2YAHA 1T1YA 4YDJB 5GSRB 1FLRH 3I6LE 4OJEH 1QEWB 4U3XA 4FD0A 4AQEB 1TO5A 4JUSA 3BZFB 3EOBA 4MHHI 2F19L 3SOBH 4M8VA 3BAYA 3V6BR 3VRIA 4JG1H 1NFDB 4NWUH 3ZKXC 3V5HA 4YSOA 3EO0A 4DGIL 2CHWA 3A6BH 3DRTA 4M29A 1D5ZB 5T1JA 2EJ1A 4FXLA 2PP7A 4W9LC 1MHCA 4OD1L 1A2YB 1WHPA 2VDKH 3AG3B 5DVMA 4EI5B 3CFBA 4FQJH 1A1MA 3DVGB 5AZUA 2GIMA 3X12A 4D0BA 1QBML 4V33A 2QTVA 1CG9A 3OPZL 1JHKL 4XP5H 3ULUF 2IANA 1J8HA 2Y7SA 4OCXL 4OF7A 1EGJH 2EILB 4S1DD 4IJTA 1NC4D 4A2EA 1A22B 2F15A 5CZKA 5E4AA 1MFAL 1W6LA 5E9NA 4Z0BL 2R69L 3B2VL 4H88L 3QDJD 5GGVL 4HH9B 5SWSD 3RKDC 3NIGE 3MBEB 4OZIB 2XCMC 5HD8C 4UOZA 1AHKA 2VLKB 4KK9D 5KVEL 2DJUA 3E6HA 4KITB 2AJUH 2VJXA 1CGYA 2DQUL 5I6LA 3FAWA 2H32B 4Q52A 5A6IA 3AUWB 5J11C 2B9BA 1NCUA 2H9GA 1WTGT 2OMTB 2WQAA 2QGCA 2EXWD 2R23A 1HHJA 4AUJA 4NZDA 2GJZA 4K3JL 1SDDA 1SUJA 5DGRA 1GGBL 1TPXB 4KTEH 1C8PA 4FQXD 1S9YA 2G9HA 1J9RA 3REWA 3VGBA 5IEKB 4A68A 4MDJA 1BJMA 2IBGA 4F7EA 2CKNA 4Y5YB 1FNGA 3APNA 2Z65C 3UXFA 1BVKA 5CCJA 1LEGA 3HMXH 4LL4A 3MOAH 4KHXL 4HCRA 4F2MB 4BA0A 1HKFA 3QJFA 4I7ZC 3GSNL 5HHOE 2EDYA 4AV4A 5D4QA 4IBWA 3FL7A 4BQ6A 4I4WA 1PIFA 3Q9QA 3IFPB 1ADQL 3MA9H 3Q1EA 1EUUA 1HKLH 1R3LB 2RCSH 3A21A 5EOTA 5FF6B 2BCKA 2VR8A 3EHBD 5I6OA 4OJDH 4JAMB 1KCBA 1AY1L 2ZOKB 2HYMA 1KG0B 2XUWA 4BFOA 5AVYB 5E94A 1TTFA 3VRJA 3WUWA 1LO5B 4ONFH 4BGLA 1YEFL 1A4JA 2XVGA 1FFPB 2CGRL 1Z3GL 2R8SH 2HLEB 4CBZA 3C5XA 4N1HB 4BQ9A 1OAXH 3TVMD 2WV3A 4EI5C 1ZHNB 2CHZA 2X12A 5EZLB 5SX4H 3F6IA 3MNZA 3NEOA 1KCUL 4N90D 4BK8A 3ECVA 1TCRB 1BA9A 4DAGH 3O3EA 4KAQL 3MRRB 1NC4B 4XOCA 2EKSA 2ZICA 5DJDA 4XCNA 2Y0SA 3D4YA 3TTYA 1E5YA 3GZKA 3SIKA 4XWOC 1XCQB 2VAAA 2BP5M 2YC1B 4BUHA 4DEUA 2IH8A 3SOTA 2FJHA 3QDJB 5SWSB 1KGIA 4WGVB 2PP9A 4ZK8A 1OE2A 2C1OB 3VXSA 3A24A 1RIUL 3ZDYB 2G30A 1WISA 5J6GB 3MBEC 1AIFB 3P4NB 1Z5LA 4GNKB 4FFWC 4NKIL 4B7LA 4M6OH 3P77B 1JI2A 4LSVH 5TTRA 5I1IH 2VQTA 4FFYA 1WAAF 3DUHA 3EJCA 3GJFA 5ABAA 2AKRA 2N0MA 5L2JB 4DWHA 4FI8A 3ZYIA 4DERA 1U8OA 5CJ5A 5AL8A 2XV6B 1NCIA 1E8ZA 3FPYA 2WMPA 1R3IL 3RDJA 4A6YL 3Q43A 3RE0A 3GHBL 3BHBB 4H8HA 4RDBA 1TPXC 2WSPA 5I26A 4JHVA 4CA4A 1R5WA 3WJMB 3ARQA 3BZEA 4A7GF 4RQQA 3UAJC 3P3RA 5KVGH 1ANUA 1HS6A 3LIUA 2ITDA 4Y5YC 1UJTA 4ZMQA 3MLPA 1MPAH 1HIML 3K71B 4MD0B 1UZ6E 5EZIH 5FIEA 4KKCC 5KSBF 3ELAT 5E4OA 3PGCB 4JKPH 5JZ7D 1GW6A 3RIKA 2BRRL 1P7HL 5I28A 1Q1PA 4O2CA 2VDQL 2Q7AA 1U58B 3EHBB 3FKUS 1E2ZA 3IWVA 2EAEA 3OSKA 3FPXA 4MA7H 4G6KH 1JERA 2ZP8A 3LKQA 5F89A 1HHKB 1N70A 1ZHLB 2X4NA 4NKMB 4NM4L 4L8CA 4GIOA 5FOBB 3US1A 2GEQA 1DQDL 1GGCH 4X80L 4TLUA 5M94B 4GSDH 1NCWL 1S46A 3O6MH 3QFJE 5CZRA 1WV7T 2DDQL 2IWKA 3TVMB 2NY7H 3K4AA 1LHZA 4TNVK 3VFTA 1KEGL 1G7PA 2AK4D 1CPUA 1CFVH 1FBIL 4MKTA 3ZQWA 4U6YB 1MOEA 1JI1A 4TQEL 3OKOA 1FZKB 3K3QA 4FA8A 1UADC 1JG9A 1NAMH 4S1DC 3IGAB 1M9SA 1LJMA 4YGVA 4M93C 2HCZX 4DH2A 4BUGA 3QQ9C 5IQ7L 4YBHA 1EJOL 5IROD 2NY1D 4L1SA 3W9EA 4HLJA 1H6UA 4L1TA 2Z8RA 4QYOB 3M8OL 1OSPL 1ROWA 4OJAA 4OV5A 1F45A 4LRNH 2GPZA 3RIFF 2MMXA 1MCKA 5IFHH 4KK9C 5A43C 3MLZH 2A6JB 4ANKA 4MVBD 3FO1A 3CSYB 5BZWA 3GIZL 3CZJA 4N2OA 5FYLL 4MX7A 5L2KA 2EXWC 2PYEE 3RNQA 1OWRM 3WJLA 1CDCA 2WLIB 5KVEE 3TJPA 5ABDE 4HOZA 2JKJA 1UACL 2I7SA 4KPHL 5JDSA 4TUUA 3IJSB 4PAZA 5IHUH 1OGSA 3ZKQD 3VU2A 1D5MA 4K7PX 4P2OC 4N28A 2AJSL 4FQXC 5E8PA 1J1XL 3STZA 3NYKA 4M02A 5T1LA 2Y7QB 4HWZB 5BVJA 3CZFA 1AD9B 4IGBA 1QSEA 5HBBA 4HK3N 2DQGL 4UT9L 4LSQH 4M1DL 2WHVA 4K3EL 3BFQG 1BJ1J 2X1OA 2HKFH 3BAEH 3JZ7A 4NQTA 4X42A 4Z0XA 1YC8A 3RWCB 5M7QA 3O6FD 4GW5B 4IOIA 4EKXA 1DO6A 1T3FB 4A67A 4G9FE 3PXHA 3F12A 4OZGF 5K9JL 3EHBC 1QR1A 2KI6A 1I8MA 3O6LL 3UZVB 3PQYA 5AYUH 4Z7WF 3RWIA 4UUJA 3GMMA 3B9VA 3L5IA 5HGHB 3FO0H 4MMYA 3OKLA 1E4WH 1JV2A 3GSXA 1BDYA 4Y4KD 1O75A 3QC6X 1Z2KA 4HLEA 2AK4B 1YYLH 1A5FL 1GGUA 1VCBC 2WZAA 3TVMC 3V4VL 1KCSL 4NBZB 1F4YH 1LEKB 1NZRA 4FN0A 5LGJB 4A66A 4O2FB 5I5RA 3MRBB 2YD7A 1B6UA 3ARTA 3GKWL 1ETZB 4NJ9L 1FFQA 1W0VB 3MR9B 1HQRB 1NGQH 2B77A 4GMTH 2NY1B 2XHNA 4NRYA 3KWWB 1A7BA 1NGWB 4KV5E 1OGTA 1XXDC 2IOOA 1EFXD 5MEQB 4OUOA 5EPMB 2Q6WB 3TPUB 4MAYA 5H94B 1T1XB 3FF7A 3TESA 2D7OA 1KY7A 3ABMB 1BZ8A 1R5IA 2ADYA 1IBBA 1YMHB 4OGYH 1EXHA 4YSCA 2GITA 2BP0B 5T33H 1ZA6B 2HX8A 3LN9A 4KMLB 4X50A 3L81A 3FB5B 3LRSA 1OP4A 2IBZY 4PI0A 1CK0H 4KI5D 4E5XB 4JKNA 4X99B 1MJ8H 3OLIA 1GMEA 1YNLL 5D4JA 2R1XB 5DEFA 2HJKB 1L9QA 2Y5TA 3VD4A 3A23A 3MUHL 1MXGA 3CC5B 5CILL 2MTPA 1YG9A 4IRSA 5K1VA 5IW1A 3HIZA 2ATPA 1LNUA 4TUJB 1F4HA 5TDPA 1LK3H 3BAJA 3T2NH 5D6DA 3O6FB 2XQYK 5E03A 5JZ7C 2LU7A 4MQ7A 5CSZB 3OHXB 3FB7B 5E00B 3QIUA 2NNCA 2ZCHL 1OCWH 1ZIAA 4JHZA 1H5BB 4Y8DC 1EJ6A 1FVEB 4NO0D 3PL6A 1TMQA 3NJGA 3BH9A 2HVJA 4NZJA 5C0CD 1M1XA 4FMVA 4X5PA 2DBLH 2JKTM 1E5UI 3PNWA 1G1CA 3FFDA 2LU4A 4Y4KB 3VRLF 3ZDZF 1XSJA 1J0ZA 1HZHL 3QDHA 1QFOA 4XRCB 5DVNA 1EANA 3G6JB 1MFEL 5BJTB 5GS2H 1FE8H 1T2JA 2DWEB 2QKIA 2CDFB 3VDCA 3TBYB 4MCYB 1F1GA 3QJSB 1Z9MA 5IV2A 5JIKA 5E5MA 3HC2A 4Q9QL 1FNEB 4JM0A 5CFAA 3S5ZA 5IVZA 2YD1A 3CC1A 2UYLA 4OD2A 1HOEA 5IROC 2NY1C 2WIIA 3N43B 2WLYA 2YGVA 4TSCL 3RTLA 1EFXB 3N41B 2DI7A 1AH1A 2R1YA 3C5SA 5ADOL 4C47A 3SBWC 3FQNA 4HKBB 1L0PA 3WXVH 3CVHL 4MVBC 4U05A 2AABH 1BF5A 3BEWB 3GM8A 1XF3B 2J7LA 1ZAGA 3WFEL 4ZOAA 3TC9A 2O5XL 1RK7A 3EYOB 1E28A 2OI9B 1JK9B 5DJ6A 4Q9BA 3V0AC 2IDSA 3DETC 1RK1B 4PRHE 2R1WB 1ZSDA 5HDBE 1IZJA 3DIDA 3K91A 1SMOA 5EIIB 3IK2A 3U4AA 2BIPA 3CK0L 1JD9A 3MRQA 2FX7L 3QIBA 2AJXH 3QULB 3VFMA 5GISH 1I1CA 2A73A 2R83A 2X0UA 3H3BC 3OC8A 3BOVA 1TT6A 4ZZKA 1QD0A 3MRJA 1WC7B 2NY6C 2Q7YA 4NCC2 3O6FC 4JRYD 4K23L 4OH2A 4TUKL 4NO0B 4QRQB 3OHXC 2Q87A 4QO1A 5C0CB 2ZPKH 1H5BC 4OT1L 3A67L 1U8HA 4LOUC 1OCCB 1UZ8B 1SLUA 3O8XD 3V52H 5TF1L 1GYCA 2F08A 4KZDL 5AZ2L 3D0AA 3SGKA 1C5BL 4M7LH 4MZIA 4WWKA 4F9PC 5L8JB 1LEIB 4Y4KC 3HMWH 4YR6B 3VI4A 1INEL 5E08H 5A2FA 4FFZA 4RFOL 1S5HB 3FQYA 4XODA 3RGBA 4G42A 5EU3B 2OP4H 4AYFB 5L88L 4Y5VA 3OKMA 4OLWL 1A4CA 1AMYA 4XVSH 5LWYH 4IOFC 4BSWB 1JYVA 5IVNA 1U8MB 4OJFL 1DQQA 1AO7D 2B2XH 4DFIA 3BRFA 2GW5A 3FONB 3IU3A 1CE6A 2B7DT 3K2IA 1KLGB 1QFWI 2HTKD 4ODUB 5C6TL 2HFGH 1IGFL 4M1GL 4YDIH 1BQSA 1VJSA 4YWGH 4IEFB 4PRAB 5B39G 1MLBB 1FNLA 1BM3H 3C8KA 1WIPA 1YUHB 4IBLT 4NQEA 3TNMB 4NGHL 5EUOE 1S3KH 3V8OA 3CXHJ 3QHTC 4WY7H 2H4EA 4H26B 3RVVD 2EUVA 3NFPB 4GT7A 2X4SA 2A6KA 5B1JC 1MHHA 2OI9C 2UXVA 2K45A 3L4ZA 4KI5C 2XOTA 2VWEE 3VSTA 3KCPB 1CGWA 1FNFA 2I85A 2FZ3B 1WD8A 4B97A 4WF7A 5ECJE 5AKTA 4N2KA 5IWLA 1JNHB 2AXJA 2IIJA 4ZW8A 2O61A 4NUPA 1K5NA 1B2YA 3GEWB 2RMNA 4OZHF 1X9RA 1PAMA 4JRYB 3NOIA 2W5PA 1BX2A 5AVWB 2RH0A 1QEXA 1KLFB 4B9JA 3DX6A 2YRPA 3CFCL 4R84A 1X7QB 4RRPG 2UV3A 3ULSA 2K78A 5F72S 3H2PA 4OFYD 4LOFA 2J21A 3O8XB 1P4IH 3V6OA 5ESAB 1FYTA 4QOKB 2ATKB 1HH9B 1XVSA 3PGDA 1WDAA 4A55A 4B3VA 1G6RA 3BRGC 1X5JA 1BFSA 2A9DA 4ODSL 2YQ2A 4FXGA 2JSFA 3QGVA 3AU0A 2H26B 2YXFA 1MHEB 4HYTB 4KNSA 4J1UB 3SYPA 2F5AL 2J6EA 3L5XL 5FUZH 2RAMA 4YXKH 1NOFA 2DH2A 1NWOA 4HWNA 4EZLA 5C71A 3T77B 4JLRA 1I9RH 2G4GA 1QLEH 1HHHA 1E5AA 2SODB 3O2VL 2IBBA 5C09D 5BOJA 1LK2A 3BFWA 4LPXA 1P1ZB 2WXPA 3H9SA 4WNQA 3WMPA 2IMMA 2PTTB 1PIGA 4JRXD 1UKTA 3WN6A 1WCBA 4O2EA 5KVDL 5E0QA 3UAEA 5HJBA 3PREA 1BQKA 2X4PA 3MXWH 4M6NL 3V4UH 1SJHA 1JGDA 1MCEA 2Y36H 3LH9A 4AIEA 1EEZB 4UTBA 2WBXA 3ETTA 1KCRL 4U2ZA 5DO2D 2BNRE 3EUDA 3KXFA 4P23B 1E3FA 3MRGA 3VB9A 1SY6L 1ILSA 1CFTB 2WLJA 4C59B 3ARPA 3NFSH 4ONGH 2K8QA 3QWOA 4PIRF 5EORL 3ARGD 4J12A 4OFIA 4F58H 5LVEA 2UX7A 3DTXA 3CXHK 3RL2A 5F7NC 3OXRB 1TSHA 3SDYL 1A3ZA 2YPVA 1WAPA 5F8QC 4N87A 2NCMA 1YSOA 1OOAA 2V7NA 4X6BA 4YHIB 4U3HA 3TBTB 3WCYA 3HPJA 2MKWA 1GJUA 2P28B 1D3CA 1Z6JT 4JPWH 2HPOA 3MUGB 3ETBF 1T2QL 2VE6A 4RGNE 4ZMTA 1YEKH 4OTXH 3AFLA 5JO5B 4KQ0A 5DK0A 5EBWB 1MCPH 2C9XA 1DBAL 4AKQA 2AVGA 2BVOA 2F68X 3CFDA 4JDEA 1AC6A 1FFTB 4GP4B 1TNNA 3O8XC 1RPUA 1Z9SB 2C9RA 3QVAA 3FT2B 3FFCD 4OU3A 4CU6A 4MYWB 2CR0A 3S0PA 4I8DA 1J7VR 3G5XA 1KBPA 2CRZA 4JR9L 1EZUA 2X5PA 1RMFH 3BO8A 3GS7A 2X87A 1PZ2A 1UH4A 4Y4HC 1JAEA 3PIQA 5BW7C 5I5JA 5C09B 2GVYA 3UADA 3DO3A 2MOQA 3P2DA 4F8PA 4CC1A 4NO2A 1DEEA 1E2WA 2VM4A 5AYQA 4AOFA 4JRXB 3TV3H 3D48R 4PJCA 4H20H 5TFSL 3T09A 2Q1EA 3VSUA 4Z76B 4MJ6A 5JORA 3G08B 2ICCA 3QQDB 2X7LA 2HTKC 1RU9H 2XZQL 3FUFA 4RGOL 2JMRA 5JLZB 3O3BB 2FVNA 4FQ1L 1CBJA 1ZTMA 4ODXA 1WSST 5AVRB 1RV6X 1IEBA 4H1LA 2HFFA 1S8DA 3GMNB 4HUUB 4A04A 2XN9E 5IGXH 1RZJL 3TIDB 2NUTB 4RESB 4RWHA 2YBRB 3RVVC 5I23A 4KKAD 1I8LA 1J0JA 2MPAL 1IKNA 3ARGB 3M1BB 4JZNB 2BSTB 4HFWB 3CDZA 3TNNA 2ZOTA 3DHMA 1CCZA 1D7FA 1DBKH 3ARRA 1MJUL 4OAWB 1DQMH 4Y2NA 5GJTL 3IF1B 4L4TD 1AGBB 2VSDA 2E9WA 3NZ8B 3ROLB 2CK0H 4PTTB 3WU1A 4L5FH 2VDLH 2O6DA 2ICES 5DYOB 4B9YA 2HT3D 5DXWA 4FQIL 4NNXB 5E8DH 3CIAA 1FL5B 2X70B 4FXTA 3F6LA 4HKXB 3V0FA 3SSGA 2GG1A 4PWFA 5I1CL 3LKSA 2VXUL 2E56A 1CUOA 5FW8A 4HU2A 4W6WB 2J5WA 1VZIA 1CTOA 2NXZD 2HJLA 3AS0A 4HJGA 3ZGIA 1D5IH 5E9DD 3QQNA 3FFCB 4P2YA 2FJGA 4KXZI 2I9LB 4RMUA 3MJ9A 2NNFA 3VXUE 5I18L 3JTBA 5EN3A 4P5TA 3CLFH 5GGSB 1XCTB 4AC4A 4CMMB 3IAPA 1JWMA 2OMZA 1GKOA 3D3VE 3LS4H 4M5ZL 4PJIA 4AMXA 4NQCD 3EAKA 5EEZA 1XGRB 4A63A 1N67A 3NJKA 4Q6KA 3A6OA 4KY1L 3I85A 3MOBL 3QQ3B 3WHXA 2Q3XA 4LESA 5DWUL 3CPLB 5TE6H 4NB7A 5C2UB 4X9GA 3BKCL 3EJRA 1L5GA 5SWSE 3PP3H 1B3JA 4MD4A 4WO4A 4X5QA 1KFAH 4IU3A 1U92B 1W8OA 4B9KC 2Q3AA 1AZCA 3LEYH 1UM5H 2WQRA 1X44A 3ZYZA 4GYBA 2ENQA 1DR9A 1EZVY 1QI3A 1FVCB 1KPUA 3BE1L 4LSSH 1IJ9A 5IMLA 2DZEA 2GBAA 1PX8A 2ORBL 2YD5A 5HGBB 4E2OA 5KBKA 2V5RA 4JN1L 5BVPH 1IQWH 3T0BA 5D8JH 3C09B 1VFOA 2KLSA 2OMUB 2IG2H 5IB2A 4HS3A 3ZT5A 5DO2C 1E4XH 1LWRA 3FB6B 3X3GH 4E68A 4ONHA 3GMPA 5B4MD 4Q6IB 1IEAB 2YJQA 4NHUB 4NENB 2WZPA 4MJIE 4NOFA 3U0PB 3P54A 4F57L 4L4TB 3LKPA 1DJZA 4ZNCD 2A9CA 1FAIH 1E90A 3FQWB 3SDXA 5H4YA 2OTWB 4LGPB 4P2QE 4EI6A 1J48A 4I2XA 1OHZA 4HLZG 5F1KC 1CICD 2YMXL 2PCPB 3OMAB 1LE5B 2AV1B 2B4CC 1J0IA 2GUOB 4GG8A 4O02B 4KROC 2MOVA 2B14A 2NXZB 4F8NA 4LMQE 3SE8L 2VT0A 1BMGA 4G8EB 3MX0B 5E9DB 3WNIA 2VC2H 3SE6A 5FR3A 3EH5B 1UWGH 1DSFL 4LASH 4AH2A 3REVA 4P5MA 4NKOB 2HP4A 3U7AA 4NQCB 8PAZA 4AMKH 4LGSB 3DDFA 2QHRL 3I84A 3EOAA 1IAMA 3FNKA 1ZT1B 4MA1B 3B7SA 2YK1H 4J3TA 4UMSA 3VJ6B 1E6OL 4G6AD 5DMIL 5IT2H 1C16A 3GRWH 5JW5A 5LDUA 1WPCA 2I5YH 1GMIA 3ES6B 4AL8C 2AXGB 4Y8AA 4OIAA 3H9YA 1QZ1A 4F15B 4FABH 4JHUA 3L3JB 5CEYA 1G9NH 2I25N 3ECBA 3LNFA 5LBSL 2FWOB 5FO8B 4MFHA 4NQXA 2DQCH 1U3HD 3KWVA 4JVPA 5IIEB 4RAVA 3MLUL 3L3GB 5HYQB 1V8HA 4QKXB 4U1KB 4D9LL 5CEZH 5DHVH 1JPTL 3ZKMD 2VDOH 2D0HA 1DDHB 2VO5A 1XB6A 3MLYH 1K3ZA 5FO9A 4DGUA 2D4DA 2QHLA 3MFGB 3L3HA 2AJZB 2DLIA 5C07D 2YAOA 1KBGH 1W2KT 1FRGL 1SZNA 2KZKA 3BPOB 4KKAC 3I75B 4PS4L 1PVHA 3JWNG 1IJNA 5AL0A 2Y7MA 3EYVA 5DMYA 5ESVB 1IAIL 2NQCA 3L1EA 1UKSA 4LCUA 1HCFX 4Q6IC 4YDVB 1ZLUH 5A2AA 4PJFF 2OKMA 4YAQA 1U8IA 4GSRA 2IFFL 4MA8L 4UIKH 3RAJH 2TSAA 2BVEA 3UTZA 2BNQD 3C5ZC 2CR6A 4JKLA 3OHMB 4UOQA 2XJKA 1G7MA 1N5AB 4NBYB 4QRPA 2VDRB 1CICB 1DLHA 2XY2A 4AJYV 1KBVA 4M61B 1C08B 5CU5A 3ULUH 1M71B 2VLRA 2P52A 4G43B 4XVTL 5ALBL 1I3RA 5C3LD 2NCEA 3D51A 5C08E 3QCVL 3QZNA 3IU4L 1JPSL 2VB5A 1A7RL 3U7YL 5BRZD 4IRZL 3PJSB 2O4EA 4XGZB 5E95B 4YMPA 4GQZA 5F9WB 5KWYC 4GG6A 3I6KA 3DC0A 3GSOA 4QHNB 1RD6A 2IMNA 1Y0LB 4CL7A 3BH4A 4LCWE 1G7HB 2D03H 4DZ8B 3MODH 5FDWA 1H9VA 4HUXA 1IBYA 4MA1C 5CGYD 3KPLA 5I16B 5J13B 2ZKHL 3S5YA 1BYNA 3VFWA 3M46A 3QEHA 4LPWA 4JO3L 5C7XH 4MSWA 1YJDH 3FT9A 3TN0A 3WNNA 3WLWD 4EVNB 3ARBA 3ARED 3NACL 5SV4A 2LLNA 1U3HB 4F15C 4P2AA 3JVFC 5CZXD 1HWGB 2JCCF 4P4RA 3FUNA 5TE7H 4OB5L 4IBUA 2BW5A 3ZL4L 3GBMH 3EH1A 1UWFA 2UZYB 4LU5L 2QZ5A 4I88A 4KO5A 5F7FA 3VX0A 1FVDA 2VGLM 5EDXA 3O2WL 4HG4J 3LJ3A 5C07B 3CNKA 1CGSH 3ABLB 4K3DL 3R7RA 4M8QA 4DNLA 2KPNA 5I0VA 4I77L 4ATTA 4L9LC 4TNGA 3SDAD 4DGWC 5B4MC 3CBJB 3CWGA 4YQXH 3H42L 3KPSD 1PX3A 3BPOC 4CUCA 3LHAA 4P0DA 2PW1B 1BG9A 1MFBH 1T22B 4JJHA 1BQRA 3BWUC 3LIZH 2VL5A 3GBDA 1FZMA 2BNQB 3KW7A 5FPIA 3QDMA 1D6VH 3AT8A 5DUBA 1CFNB 1JIBA 1S7WA 5I6XB 4PWIA 4AENA 5DJCB 5IKCB 2ED8A 4RX4D 4DTGL 2WLNA 5HDWA 2GJ6D 2EIMB 4FG6C 5BXFB 5CEZE 2D2CC 4OI9A 1YN7B 4UQDA 3VI3E 1ZE3C 3OGCB 1E9QB 1ZEAL 1IFRA 3Q06A 5BRZB 1LO0L 4BFNA 4IQHA 4X7CC 4OM1H 4P2RA 1J9CT 1YMMD 3JV4A 4QLRA 5J12B 3G6JE 5D6CA 1IVLA 4ENED 2P4AB 4XN7A 1DCEA 2BS8A 1QNZL 2N59A 3P11H 4X9HA 5F9WC 4WTWA 2V3EA 1C12A 2D7QA 1SMAA 1SOSA 3INUL 4MHHG 4ODVL 1U8LB 2D3NA 4LLUB 3TBWB 5GZOA 3K6IA 2DEWX 1AAJA 4G6AC 1A25A 4XXWC 4L4VE 4O5LH 5J13C 2W65A 2LU5A 3HE7A 3OZ9L 1JRHH 5I1AA 3DX9A 3PP4H 2FGWL 5B38A 1WZ1L 3OAYK 1NEZG 4DP4X 3WDIA 2J88H 2JTDA 3AREB 1UM6L 3PPSA 3CFTA 5FLUA 2W0KA 3D12B 2COQA 1HHGB 2Z8SA 4X7SL 3HRPA 3T65A 2A4ZA 2VDMH 4DK3A 4ZPTA 3OTTA 1YRKA 3CJJA 1H8LA 3MA7B 4GLRH 3ULUE 5BV7H 1VF5C 5DEZA 3ZRSA 4XO4A 2MTAA 1WFTA 2XWTA 2YZ8A 4ZXBD 4EZMA 3ZKMC 2OMYA 1INDH 2WWOA 1BQHG 2F9BT 1CQKA 4R96A 2WXHA 3ESMA 5F8RC 3ARVA 1ED3A 4JRFA 1BYOA 3MV9E 4KI5E 5ILTL 4LEBA 4BZ1H 1U95B 1LO4L 3FU7B 4MJ5A 4EZKA 3A47A 4HWBH 1KYDA 1FIGH 4PW3A 4HG4K 1CFQB 1L3WA 3AROA 5G55A 3GK8H 3PWJA 5D7LA 3N1GC 1IAOB 1YVLA 4M43H 5EZJA 1U30A 2ZXAA 4FG2A 3BUYB 1JZ6A 2BSCA 5IM7B 1I8IA 1PNCA 3FU6A 5LBVA 3BKYL 3MUJA 3SY0B 5C0ND 2DJSA 3KPMB 4FERA 2YJLA 2GJ6B 2DIAA 2K7PA 5I6XC 1KGUA 4A2GA 5C0CE 2FB4H 3II1A 1WS8A 5GZND 2UY6A 4OZFA 4P3DB 5E8EA 3UPAA 3X11A 5C8JB 1MI5A 2IBZX 4BZ2H 1YMMB 4MA3B 2CH8A 1CDHA 4ZMLA 5JDJA 4YEEA 1X7SA 5J12C 2MNJB 3IJYA 1A9EA 5DI8B 4I48B 5GSVB 3MGAA 3GSUA 1B0WA 4PVNA 2ENSA 1TZGL 5AQ0A 3VFNB 2X3BA 3B6SA 2JKIS 1Z9OA 2HJFA 2F54A 3NGBB 1OGAE 1JSYA 5CGYC 3A4AA 2DQDL 3NIFF 3HI6H 5D72H 3DPDA 5I8KH 1M2OA 4XCYB 3T1FA 1JPST 5ES4B 4L37B 4OF5A 5I71B 1T5WA 4PJCF 3U83A 1NGXA 1MJJA 3L3KA 1SYSA 2R2EA 3WLWC 3AREC 4Y5XA 3WAJA 4AW4A 2FAUA 3LN5B 2UZIH 4PG9B 4R90L 5HGDA 5HDQH 5KBPA 1KC5H 3CZSA 3F7PC 5E2VH 1R0AL 5FYJH 2FJFB 2DM4A 1Z7JA 4ZXBB 3F6JA 4JK0D 5A7BA 1IVTA 2BS9A 2NX5A 2D8KA 2Z7YA 3M1OA 1JNJA 4ABUA 5LQBL 4NO3A 3QWQB 3K6SB 3SGJA 2V17L 2C34A 2UWEA 5I15H 1DO5A 3SDAC 1P5UB 2H0JA 4QNPF 2EH7L 4TVSa 2ZOLB 1WAAE 3AVEA 3ZZ1A 4XCCL 2JE8A 2F8VA 2NNRA 3BYTA 4KJPC 2BOLA 2WLHA 32C2B 1Q9KB 5F71A 1DN0A 1SLVA 3OBAA 1QX1A 2A83A 1T0MA 5I1DA 1GTNA 3GM0A 4JRYE 2OBGA 5H8DA 3QUMA 2HLAB 2FDBP 2DLEA 4UB0H 5DS1A 3SOBL 4AYGA 2DL9A 2V5MA 5SWZD 2QMJA 4Z7QF 1YYMH 3GNMH 3HZKA 5D7EA 1AR1D 3QZLA 1NDGA 4DQOL 3H7LA 3OKKA 4QOKE 1L6PA 5E2TL 1FFNB 4Z7UF 1TTUA 3S96B 1JXJA 5E56A 1L3NA 3ZMNA 1IQDA 4AL8L 1MN4A 4MJ4A 1VGEL 1WIUA 4ENEC 1N64L 2P1YA 3HR5B 3ISWA 4JFQB 4N8PA 4QTIH 4XVUC 1CURA 1MFCH 3KLKA 3Q8AA 4POYA 4H0LC 2X38A 5GGTA 3MRKB 2MQ3A 3NPZB 1K8DA 3I6GA 1F8TH 4W6YB 5FM8A 3NGBC 3ZYJA 2FYYB 4LARL 5INDB 2FE0A 2XPYA 1N59B 5EA0H 1EV2E 4PV8A 5D9SB 4XN9A 4AQ1B 3WIFB 5I71C 5IEHB 3LMJH 4JZOA 1RJYB 3HBQA 4DCQA 3MVSA 3LS5H 1DJGA 1PG7H 1N6VA 3VQMA 2X1PA 2ROYA 1WEJH 2XIDA 2Z35B 5FUCE 3QUGA 2I24N 3S36H 3K6NA 1GYWA 4G7YL 2VDPB 4G6MH 3I9AA 5KS9B 4ZXBC 2DY2A 1AZUA 3SQBB 5LXGH 2PNDA 1K4CB 4R0LA 1A6ZA 1T1WA 1OSZA 2Z7UA 3U1QA 4JPIB 2H7WA 1Q72L 1AE6H 1L9SA 4LCCC 2VDNH 1FNSH 3D4CA 2Y24A 2YGOA 4FS0A 3DX8A 4ZD3H 1P5UC 3OXSB 3PFQA 3UG3A 2Y9RT 5JHLL 1BQLH 3CSGA 4RFEA 4O02L 4KKRA 4PRBA 3EFOB 4FQLL 5D2NA 2VERN 3DIFB 4M5TA 4PJ5A 3SDXF 3SPIA 1N6UA 2V2XA 4A38A 3IGFA 2Z92B 2G2RB 3N40F 2ADFL 3P30H 4LGRB 3SBRA 4PGBA 1HKLL 4Y16D 2L7UA 5C0NC 1AGEA 3ZTNL 5LDSA 5SWZB 3LSOA 5E1AA 1BF2A 1UENA 2FIRT 4ZRGA 1AR1B 3WELA 1E40A 1WD9A 2F53E 2XXMB 5I1EH 3NQIA 2X1XR 5FYJE 1ONQB 4X6CA 1BWMA 2VXVH 2L0DA 4PJEF 5DQ9A 2NW3A 3FH8A 3R06A 1UA6L 2Z93B 4A39A 3U0WH 4TLKA 2P47B 5J6HA 5IW3A 3TBBA 1FZJA 2YLKA 4G1MA 5EF0A 3I9GL 4OZGE 4OUUB 4WW1B 3SE9L 3H2QA 1TVDA 4LK4A 5C09E 1S7TB 1GIGL 5GGQL 1G4RA 4LLMB 4QGTA 2D31B 2R2BB 3F7YA 3TZVA 1ZWIB 2OAAA 2X2IA 3C9NA 2I9TA 5FHAH 1DE4A 2YSSB 2ZSWB 2JXMA 2KLTA 4N20A 5F1OB 4XNMA 2IH3B 1ZGLM 2NDGA 1IBGL 1MFMA 3SPGA 1D6EA 4Z23A 2TAAA 1QA9A 2ZXBA 3DBXA 4J5VA 4M6OL 4D94A 2IEPA 4E42A 1A0QH 2B1HH 5FM5O 5KANG 1JN6A 1FZOA 4KGLA 4N2IA 2ZT9C 4Y9EA 1HXKA 3ESVF 3U6RB 2ALAA 4DEPB 3DYPA 4B9GA 2MNUA 4OGZA 4XPAH 1CT8A 5EBMA 4JVWA 3FBKA 3BH8B 4GP5B 5L7XL 3KLHD 4D0DA 1GZPA 2JB6A 2AEQL 1SYVA 3LHPH 4N2AA 1EEYB 1F3DH 1F97A 4AVKA 5JPMA 5GIRA 1TTAA 2EEXA 2OCJA 2VDRL 2CDEA 2ESVA 1YC7A 1ADWA 4J3OG 4WNJA 3MLVH 2G60H 4N0FA 2P5EB 3WNPA 2CXGA 1AG6A 2MCAA 3O41B 4NKQB 1SVBA 2YKKA 4WEEA 4IK6A 2A0LD 4E9RA 3S3DB 1H15A 3P3TA 1DJXA 1P6WA 4Y16B 4FLQA 3ZHNA 2WPGA 3DXAD 3P4OA 4G70B 1HILA 1EWHA 2Y3NA 1BAFL 3TWCL 4MA7L 1U0QA 2MPVA 4H0GA 4W6XB 2N1TE 3IDXH 3L9EA 1F00I 5FOJA 1KXTB 4ZUUB 4EDWH 3BKML 1FL3A 1GSMA 3Q2VA 3KBPA 4AYMC 4YHOH 3T6ZA 3HBZA 5F3BB 4RBPK 4HJJH 1NCJA 5FWQA 2OMVB 3ZE1F 3LX9A 4ODHL 4APQA 1JTTA 4NM8L 1SM3L 2W95A 5CWSA 3FSVA 4GIAA 5DHYA 4CKQA 2X6MA 4YO0B 4QTHA 3CSTA 3P0YH 1H6EA 4QRSB 1YCSA 2VXQL 3JT2A 3IJ9A 5AFAA 2WN2A 2I27N 3ZQXA 3MV7D 1Z3RA 3KPRA 5T1DH 3K6DA 1I85A 3GINA 5G5DB 3OWRA 3VRLE 4KC3B 1BBJB 2D0GA 3D9AH 4PVMA 3RUGA 5CHNB 4UCFA 4JY4B 1Q9WA 3QJOA 4HISA 3GTTA 4LRNL 1T20B 1RK0B 1INQA 2A9MH 4X8GA 5SX4I 4I1RA 3MLZL 3RDTC 4XBPB 2DIJA 3RA7H 5B8CA 4HCRH 1ECYA 2FK9A 4PRNA 4NP4L 1YPZB 1TU2A 1RZFL 1QP1A 4C83A 1OQOA 2FL5A 2F58H 5IHZB 4JPKH 1M7IA 3BUIA 2J8HA 5CCHE 5IHUL 3IJHB 1ZVNA 1JGEB 2XTJD 1U8CA 1WA0X 5TH2A 1FV1A 1O7DE 1MW1A 1U8JB 1NOAA 1XBDA 3QJHA 2GJRA 3WFCL 2NZ9C 3U2SB 4U1JB 1JMZA 1UXMA 3I02B 1QATA 4LP5A 4KO6A 4RLDA 5FA4B 2XQYA 4LSQL 2MWCA 4MB5A 1YQ2A 1GGTA 3SDDD 4ES8A 3DXAB 1G9HA 3PDOA 1AHWA 1TQCB 4Y16C 3F7KA 2AI0L 4KO7A 1ODAA 1DVFA 3T6XA 5DTFA 1KTRL 4L1BA 4WU7A 5E9DE 2VZUA 3LH2H 1ZA3A 2VH5H 2E3VA 1E5ZA 1RIVH 4ZS6C 1L6ZA 3P9MA 1L0XA 5I9QC 3M7FB 1FCCA 4FYTA 1ICTA 1SJVA 3PRZA 4RMSA 1KJVA 3WLBA 4YLQT 4HZLA 2Y3AA 3F8UB 3TA4D 4PV9B 4F1ZA 5EEXA 2EDLA 5AZEL 3RU8H 3SKUD 1JGLH 2B59A 2F61A 1LD9B 3OLGA 4ACTA 3EGSA 3MV7B 4LE8A 4BKSC 4ZJ9A 4PTUA 2Z3FA 4C56B 2FUQA 3GJFH 3Q5TA 1V7NH 5EV7A 3X3FL 3WEBA 2BO0A 4J39A 2PWEA 2YMTA 3ATDA 4R5TA 5FKPA 4LHUA 1IKOP 4G8IA 3PP3K 5EFIB 1X6NA 2C1PA 3LCYA 2QZQA 3TCLB 1J10A 4R83A 5CLWA 4NXSA 2GAZB 1QI5A 2YEQA 4AK2A 4CDHA 2ZG3A 1P84J 2D3LA 1Q8MA 5DUML 2Y07H 3NVQA 1BYPA 3D4ZA 2JQMA 1IC7H 1Q1JL 4JEGB 2E74C 1CS6A 3CSBA 3UTSD 5I6MA 2W59A 1M3JA 3IYLW 4WI0A 3ZE2B 4F7KA 2G2NA 4JCLA 2XTJB 1NGPL 2FYVA 3KLHC 1UFUA 1CK0L 2VOTA 1WZAA 2X9YA 2JQZA 3DTDA 1KMGA 3QFDA 2J1KA 4QUOA 2CKBB 3L3IB 5SX5K 3SKJL 1EO8L 4OGAD 3EBHA 4PJAB 5H2BA 3MACH 1Q0XL 2NY2D 4K7PL 4NKDA 3SDDB 5HYJD 1EZVX 2EYRB 4MDIA 1HZKA 2A0LC 3GQFA 1VSCA 4H2CA 4M62H 4PGEB 4PRPD 2Z8WC 2R7EB 1HI6B 1OCWL 2JJTC 5ERWA 4KUCD 3RI5K 3FQXA 2CO4A 1ZCRA 1TQCC 3PHQA 2F18A 5KYYB 1TLKA 1O6SB 5FFOA 2DBLL 3GMQA 5HJGA 2XWJA 2XXFA 2XZCH 5F6HI 1DVSA 2BXYA 2KZBA 4H8WC 1VB9A 3VWJD 1BD2D 3WMSA 5EN2A 1PZ5A 2O5YH 2WLKA 4L3ED 5FHBH 4R3SB 2OJZH 4S1QH 1FE8L 3FCTA 4Q9CA 5DMKB 3MRCA 4F1SA 3FH7A 3RX5A 5FM5M 3WHE0 1KIRB 3KNBA 2EO1A 3EFDL 1MEXL 3FSWA 5EU6A 3KE0A 3T6VA 43CAB 4Z7VF 1W72B 2NY5C 5I1KL 1M05A 4WDIB 3HZ3A 2GC4C 3TH3T 1HU8A 5C0FB 2G5RA 1WUZA 5I1JL 4KNTA 1TQWA 4IW4C 1N18A 3FTYA 4XI5C 3S4SA 3CFJB 4HUNB 4IM8A 2QADD 5D71H 5I8EA 1X5HA 2GC7C 2E9BA 4J3OD 1WRFA 5ALCH 4MD5B 2CPUA 1CXFA 2AW2A 4G82A 5CCKH 3FU0A 4JFHD 3I50H 3L3OB 2R56H 3DRQA 4J3SA 3T2QA 3BPNB 5LCVL 4DGYH 5BOPA 3CFQA 4Z3HA 3UTSB 4OJCA 1WITA 3OF6A 1RCYA 1RULH 1PD6A 3JTTA 3EJSA 5TF0A 3N06B 5JHDA 3IDGB 1P84K 4OR1A 3QORA 3EJQA 2OV0A 3QNXA 1U2HA 1BP3B 1UWXH 2HRHA 2XTJC 4LSRL 4OZFG 1A21A 3C60A 2VDOB 3P0VL 4DN3H 2YRBA 3MRHA 1MELA 3QXDA 2GTWB 4GQQA 1B0RA 1FO0B 2XQBH 5BS0D 5EC1A 1KTBA 3NCJH 3MFFA 5FA3A 3VXRE 4JNXA 5TQ2L 2NY2B 5ETUA 5HYJB 2A9BA 3T8XB 4L2YA 4ORZC 2EDRA 5D7IA 2YO3A 3QEQA 3ILQC 3ZRCC 1ERNA 3SDDC 3M86A 2KH2B 4LVNB 4PRPB 3W0WD 3NCFB 3ZVVA 4YLCA 3F01A 1YEHH 4HCFA 5T1KD 1VEOA 4PV1C 1IM3D 4NC0B 5DLML 1NSNL 4Y4HA 3APMA 4DKFH 2X2HA 2ZPKL 2IAAC 2WUCL 4XBGA 3WKNA 3W38A 3NA9L 3U0TA 4O9HH 5DS8A 4UINL 3DURA 1AYOA 3VWJB 2FLBT 1BD2B 1JPGA 2OMXA 5C0DA 2H8PA 5IF0A 1NCBH 3Q1SH 4L3EB 3VFUA 3AW5A 5D7SL 3VFVA 4KOBA 3ARSA 3D18A 1JPFB 4F27A 4HIIA 4KK8D 4JFFD 2FD6H 4CNIA 7FABL 4XWGL 4HJEA 1B90A 2Z4QA 3B7UX 1WS7A 2ZKXA 2J1XA 5J1SC 1MCWW 3GBLA 1KCVL 3OJ2C 4C4BA 1ITBB 1IM9D 2QADB 1YNKL 2B2XL 2OSXA 2ATAA 2UY7B 2VDPL 5A40E 5HHQB 3DNKA 1B4TA 2W0LA 1EZLA 3F7VA 2ZCKL 4WFFD 5J5EA 2DWYA 3BSHA 3UBXA 2OXGA 1JXDA 4NQSA 2DM7A 3FT4B 4HAKA 3L3OC 4TN9A 4UOW1 4EIUA 3BPNC 2YR3A 3D39A 3MLXL 3ILEA 4IIQB 4UZUA 3ZE0F 1HH6A 3V0JA 4BRVA 1G9NC 2DS4A 2WKLA 4HC1L 5I66A 4LKXB 4GAJH 3M88A 5CBAA 2J1ZA 1RHHB 2MSPA 5AW8B 1ASOA 5DGQA 4WHTB 4IRJA 2OW6A 3NESA 2F1EA 5E99L 3OAWA 1UKQA 4MWFA 4OLVL 3VCLB 3BW9B 3WHE1 3R7QA 5BS0B 4GH7B 5EOQH 2IOMA 5ECGA 4PREA 3JWNH 1F41A 4XP9L 4OGAC 2EE3A 3NAAL 4WZ9A 4M48H 3H3PL 3HZMA 4B41A 3FO2A 4N0UE 4DETA 2VYRE 2EINB 2NY2C 3W0WB 3UTTD 5IMKB 5C9KA 3V5DA 1A6VL 2BP8A 3GSWA 4N2HA 2GJ6E 5T1KB 1IM3B 2N7SA 4YGAB 1KLUB 3GSQB 4KTDL 4WSJA 4EZJA 3ISRA 1ZV5A 4HEPA 1FF5A 1XH0A 3TJEH 1NBVL 4X6CF 3G5VB 3UCRA 3FDWA 4TNVF 1H6FA 2PWDA 1TUPA 5CS7A 5IJKC 3OJDB 4QJ5B 5LG6A 3MV8D 4U1HB 3VWJC 4WHYG 4BH7A 1QSFE 2CU9A 2R59A 4P9HL 4KX9A 2EIZB 2X6UA 4S0SD 4JFFB 3MRDA 3EJZD 4HDIB 5F1IA 5TGBA 3TH2T 5KUKA 5BO0D 4HGWB 3HAEA 1PCSA 5MEND 4J7RA 2Q86A 5LNGA 3A4FA 1I9RL 4DOHE 1FNAA 1F6AA 1D7BA 1IM9B 1M7UA 2L8AA 3HG1E 3QDGA 4JHBA 3SJVA 3TO4A 1J1PL 4FFVD 4WW2F 3A5VA 4ZQKA 1ETJA 1YY8A 4I13B 3ZTEA 5FX3A 3BRDA 1XGTB 2X0WA 4E0RB 1EHXA 2VITB 3X1NA 5A7EA 2BDNL 1JHLH 4HJ0D 2CJUH 4PSRA 4J27A 1JXFA 5I0WA 1WA1X 2G75B 4AYID 1F11B 5A2KH 1KSRA 1I7UA 3V4UL 1OAYH 1KIQB 3RHWF 1MNUL 1YEIH 2QL1A 5TPWL 3S3BB 2FUTA 4LBEB 4GMSL 5CEXB 1CLYH 4IIQC 1Q94A 1P9MC 2CM6A 1X7TA 3KGTA 1MCBA 2VN5A 4XCFL 2QFRA 2PYFA 3O3DB 5AAMC 5LLIC 4JO1H 1KXVA 1NJ9B 3DGCR 4PS8A 2K9FB 5IW6B 1TFPA 3MYJA 4BSVA 4MMXB 3F5WB 5C86A 4PW9A 4OF6A 2CLZB 4S1SL 3EIFA 1QFUH 3UTTB 3MXVH 1R1CA 3DOSB 3MDJA 4R26H 4U1LB 3L6FB 4HIEB 4FFZH 5LAPA 1URLA 5G4OA 4GW4B 3B5HA 2BSRB 5HYSB 4JCMA 1UJ3B 2AV7B 5ICZA 1MCPL 1LYQA 5EBLB 3F7LA 1AJ7H 1BBDL 3LQAH 5DJXA 1R9FA 1TEFA 4M7JL 4ZUTA 1GXEA 4N2MA 1TYRA 5EC2B 5LHDA 3MV8B 4E9SA 35C8L 4KO9A 4FNTA 2DWDB 2J5LB 1PY4A 2QTEA 1YN6A 1ACCA 3EDDA 3D2UA 1IGYA 4D7BA 1U8KB 4G5ZL 5MENB 3CVIH 3RIFK 1IE5A 2YWZA 3S5LG 3B2XA 3E80A 4BE6A 4ZAKD 2H1XA 1RUKL 3QYCA 4CADA 1R46A 4EUPB 3SD2A 1DJYA 3IAQA 5IG7B 3W5MA 2WM0A 5D5MB 1URZA 1ET7A 3H6JA 1NBZA 4EQ2A 1XF4B 2AQQA 4N85A 2NSQA 2KZWA 3UJIH 5JUEH 1ZDQA 4PJGB 3QUKB 3PHOB 3NJNA 4PP2B 3S97C 3QAZC 4IMLA 4I9WD 5JNYA 2H0PA 1G0DA 4Z5RB 2HAZA 3EOTH 1QKZH 1ZTXH 4Q9RH 4P49A 5KS9E 1W0WB 1C1EH 2RB8A 2OTUA 2EIJB 2VMJA 4AT6B 5DRWB 4NI3A 5A2CA 1O9WA 1ORQA 2OJEA 4JY5L 3BI9X 5EOCL 4R7NB 4MNHB 5BV7C 2WXMA 3MBWA 1BZ7B 5AW3B 4Z7AA 3BPCB 3C08L 3HMXA 4KMTL 3RIAK 4OKVA 1FPTH 5ITFA 1KACB 1DBKL 4LEEA 2XZAL 4Q0XL 2ZTBA 1G6RH 1FCGA 1QRNE 3EGXA 2OFQA 3CN0A 4AZUA 1AQ8A 3S8GB 2EEDA 4Z3FA 4L5FL 1XR8A 2CCWA 4AG4H 4H8WL 4GXFA 5HHPB 3SE3C 3B1UA 3C5JA 5DVLA 2DTMH 1ZLEA 4XPGH 4XNZC 5E8DL 2DM2A 5AW7B 1MY5A 1A7NH 4IKLA 1WBZB 1WFJA 2R69A 2XQ0A 4UM8B 4HS8L 5JXED 3GUTA 2ARJB 2UXFA 4PJFE 4RWYL 2PXYA 1VKXB 3N85H 5DR5H 2OMNA 2NY5L 3PJNA 4ICWA 5KJRL 3QI9A 5FYKL 1D5IL 2PYEA 1IC5L 1RSYA 4AJWA 1ET5A 3HUJA 5F88A 2BJML 3FMGH 1OF2A 2BSBA 4XPBH 2P49B 3THML 2HKHH 3CLFL 1PY9A 1JZ3A 4LDOB 1L9RA 2J5LC 3WJJC 1LTXA 4UF7C 2WNXA 4XNUH 3ATBA 3EJZC 3N44F 5D70L 4D0CA 2BIQA 4ZAKB 3QNZB 5FKAB 1QVOB 3VFGL 5I24A 5DJ0A 3H53A 4XN8A 3U4BL 4PGDA 1WAEA 3CTTA 4A37A 4UQEA 4ONOA 3AAZB 4CKVX 2ZX6A 4Y9GA 1E9OB 4FFVC 3BVNB 1MCLA 4X4YB 4G9FA 5KYWB 3BEVA 1E65A 4W9KC 1QACA 4DUXA 1BEYH 1DUZB 2BVQB 2JKXA 4LCIL 3CMOL 4ZFOA 3H7BB 2VLJD 1GZQA 4HJ0C 4ZFGH 1ZT7A 2F0CA 5CR1A 2X4OA 3QIWA 5A2JH 1OE1A 1IQWL 3LB6C 1EX0A 3OZKA 1RZKL 4XVOA 5DJ8A 3IFNL 1XGQA 1TTGA 2CKBL 1HXYB 2OA9A 4G9DB 4PWGA 1OTTD 1F3DJ 1ACZA 5E8NB 4GOSA 2BOBB 4PUBL 2G9KA 4IS6A 4LCYB 2XACC 1MSPA 4WUUE 3X3GL 5CMAB 2JCCE 4MXWL 1J05B 1XL4A 2EH8H 4G3YH 1H3PH 1IAKB 2B16A 3PF2A 3IVKB 4FNSA 2FNBA 3EO1B 3KPNA 1A66A 3E3QC 5K39A 1I1AD 2P5EE 1WT5A 2JK5B 3O6KL 2AFNA 1XMWA 3KPTA 1MREH 1FAIL 1N3NA 4G72B 5DJ2B 1OT1A 2VDNB 3I6SA 4LMQI 4ZUSB 1TZ8A 1CD1B 1SXNA 2CWRA 5EWIH 4JHAH 1W8NA 4FXKB 3W2DH 1NCHA 2ILLA 4AXWA 2NQDA 3HFML 2MHAB 3GLDA 3KLSA 1T1ZA 4BFIB 4R4ND 4AGOA 4LP8A 5BUGA 1ES0A 3CZNA 4NT6B 5F9JB 1AFVH 4DZBB 3BP4A 3E8VA 3LEVL 3PABB 2CALA 3LDBC 2MJWA 2ZWKA 5C0JB 12E8L 4TV3A 4H5SB 1W72L 5CU9A 4NEHB 5IMOB 3T0VA 2AJVH 1OD7A 5MI0B 2F5BL 1MCSA 4PJHF 2IAND 2QPUA 5CLYA 3CPUA 3Q2LA 4UZGA 1P7QA 5I74B 3PGFH 1SFHA 1HYSD 4U6XB 1NAMA 1IAIM 3KG5A 3L95A 3WNJA 3BUDA 5IT2L 4ZAKC 4BKLB 4H1LH 3BAWA 2CK2A 1WHOA 3GSVB 1JF5A 5I73B 3LKRB 3JVGA 1NLBL 5TDOA 3QHFH 4URTB 5E51A 3DYMA 1C5CL 4MMZA 4UQAA 3US0A 2R9HD 4FABL 1ZANH 3EG9A 5DUPL 5HHNB 3FZUD 3S8WA 2VLJB 3AG2B 3W56A 1VFAA 6TAAA 3NPSC 2VXTH 1M9WA 1F3JB 3B37A 4BFKA 1NC2B 4F7MA 1EBPA 1F18A 2W1NA 2VDOL 4MXQD 3WIIH 1UB5A 1YPZE 4X6FB 3MLYL 4QRRD 5MERA 1THCA 4UIMB 1WFNA 1MXDA 4HS6A 1FO0L 4R4BA 5ID1A 2CJSA 4N8VG 3DI3B 3F58H 4JBSA 1D9KC 3OB0H 1IGJA 5FO7B 3L5WA 5GS1C 4GAYA 5ENWA 4JFYB 2X4RB 1RPKA 5I30H 1K4DA 5A6LA 1KB5B 3U36A 3OR7B 3FSAA 1NUDA 2R29L 1I1AB 1T1YB 5KW9H 2Q9OA 2EE9A 5JIQA 3QE5A 3MJ9H 3T0AA 1FDLH 3EOBB 1BFVH 4UYQA 4B7IA 5D7IF 4ABWA 3FUDA 4IKIA 3QISA 4IBTA 3V5HB 3EO0B 1RZ8A 3EBAA 3DRTB 4Y89A 3RKPA 3AXLB 3GTNA 3NP3A 1HEJC 2HH0L 1MHCB 4FXKC 1KGYE 4QKTA 5EULV 4CILA 3ULVF 3S4SG 1A8JH 1VGKA 5JXEC 4U49A 3CFBB 4J3XA 2BFVL 3G5YB 4Q4EA 1IL1A 1ZIBA 5IFJA 3WNKA 4YUEL 2X4UB 3X12B 3ZXAC 1IARB 1XHHA 4D0BB 3UZEA 1CG9B 2GABA 4LRIA 2E9GA 2IANB 3CFEA 2Z0BA 3GO1L 4PRHA 5MI0C 5GGRA 4KI1A 1EDHA 3IMVA 4LOEA 5FYKE 5TJWK 1ZJBA 4FQHA 2D03L 2GJPA 3MODL 3MV7E 2CMRH 2XKUA 4JL2A 4AEFA 3D25A 4C56E 4FQCH 4TNWF 3LRKA 4WV1A 3TX4A 3VXSD 2X6BA 2ZAIA 4WTXA 3X14B 5IFAL 5I73C 3CU1A 3BP6A 4BZYA 2R15A 5ANHA 5BPPA 2Z6FA 4UU9A 4ZO8A 2HFEA 4XB3A 2VZ1A 2GBVA 2H9GB 4PLJC 2KERA 3FFOA 2R23B 1N5YH 5EF2A 1HHJB 3F64A 3HJ0A 2GJZB 3P2TA 1UUSA 1EHNA 2XG4A 5HGGS 3BXNA 5JMOC 2B39A 1JFHA 2ZUXA 3JTSA 3HKFA 1XWVA 2YMOA 4QRRB 2Z31B 1U3YA 3ETBJ 5CJXA 2AZUA 4XO3A 3REWB 2SEBB 4G8GE 4L8BA 3WXWH 4MDJB 4BWUA 4F7EB 3ZE2E 1OTTC 3DHJA 2EYTB 5DRWA 4YSQA 1BVKB 1LEGB 4XOAA 4KRNA 5DFWH 3QRBA 2MOGA 3ZTJG 3DO7A 3QJFB 2OL3B 3IS0X 4LSDA 15C8H 4I4WB 1L9OA 2HKAA 5DVPA 4U31A 4YHPA 3VSVA 1I1AC 3GHPA 3I74A 4PJAE 4YE4H 1U8QB 3MO1A 4IMKC 2DMCA 1KT2A 2WJ7A 3HJEA 2YA1A 5EOTB 1U21A 1UGKA 1JFQL 1TJIH 2AJ3A 3KWUA 5E94B 2OMWA 4DP0X 4N8CH 3WUWB 1YEWA 4EKJA 1A4JB 3D85A 4I3RH 1OF0A 2Q8BL 3UDWA 3BIAX 3FW6A 5DJAB 4JZJA 1CLZH 2ZXGA 3VD2A 1S7RA 2ZWZA 5IUCA 1IIKA 2X3AA 4IJ3B 5EUOA 1P1VA 3O4OB 2C9AA 3ZIYA 1TXKA 3O3EB 5B21A 2BC4A 4JQIL 3IAGC 1NL0H 2B0SH 1T0OA 5LNEA 2VLMD 3JWDH 1X4ZA 5TDNA 3T3PB 1PLCA 2QT6A 4XCNB 3AXHA 4Z7QE 4HK0B 1WG3A 3BDYH 2VAAB 3HNVH 4GEIA 4F2EA 2FJHB 1KTDA 4AZ8B 3VXSB 5C0GA 1RZ7H 2WBJA 4Z7UE 5IVXF 2IXQA 2D7MA 4JFSA 1GW0A 4ISVA 1N12A 5LGHL 5CBEB 3IXAA 1XFPA 4LLYA 5K59F 2FCBA 3BD3A 4U33A 4NZRL 4D9QD 5A1AA 1KJ2H 1MAKA 2YN3A 4YVNA 3FZUC 2AKRB 1NBYA 1LQSR 1RZIA 1U8OB 5IESL 5CR8A 1SHMA 5DQDL 1ZLSL 1TSRA 1CDUA 3OJVC 4HCGA 2WMPB 3D4GA 4MXQC 3UTOA 3ZO0A 5LGKA 4BE5A 1TQSA 1R5WB 1WZKA 5C6PB 3BZEB 5DD6A 5SWQA 2YAEA 5T1LD 1GZHA 3GDCA 2ITDB 4HZAA 1UOLA 2WNGA 3ASWA 3B2MA 4DVRL 1V3KA 1SXZA 4IGBD 1QSED 4XBEL 1X9UA 3SYCA 4RAUA 2AEPL 3AGVA 1IAII 2OR9H 4ODWA 1TZIA 2V5TA 4RETB 5IP4A 5F44A 2W60B 3M7OA 5KVFL 3D08A 1H3UA 3NJJA 4NI6A 5HYJE 4O2CB 1CLOL 5JPNA 4YDKH 3S37L 3KW8A 4JFUA 1AKJA 3LKQB 4X4XA 5F89B 4N4YB 2X4NB 3UAAA 4L8CB 1CXHA 2FX8H 1MLCB 1X5MA 4GAGH 1UXSA 3TCTA 3PQYD 2J1WA 4LPVA 4L4JA 1K72A 4ZMNA 2DI8A 3A0OA 3ARXA 3GXNA 1XO8A 3T0EE 1ZSHA 1YEEH 3VFTB 1PCXA 4NFCA 4YSEA 3TM6A 1G7PB 3OKNB 3P73A 1BD2E 5GGSY 4W93A 3SE4A 2BNRA 4IJ3C 3EJTA 4P04A 4PB9H 1T2XA 3OKOB 4NJAH 4UT6H 2IPUG 1AQDA 2O26U 5T5NG 4L8DA 2D7PA 3ZSTA 3POHA 3WFBL 5IJBC 4YGVB 4LLQA 4ANXA 1OWWA 4GBXA 2JF1A 5KG9A 5DK2B 3MC0A 1ACYL 1UZ6F 4F9LA 1EIBA 3AG1B 4OV5B 5CSBA 4B96A 4YDJA 5IBTL 3CH8A 1QEWA 1DFBH 2WKOA 1CGXA 3BZFA 4TNEA 5F7EH 3DVNA 4ZDHA 2K0RA 1PLGL 4MAYD 2YUXA 4P5SA 5BZWB 2MQGA 4JFHE 5CP3H 4DESA 1QYGH 4K3GA 4MX7B 1Z66A 3ZJAA 4KQ3H 3RNQB 1D5ZA 1SEBA 5HDQL 5BCAA 2LFEA 5JDSB 4PJBF 3O45B 1DQLL 3MJGX 4UI2A 5E8PB 3STZB 5L4MA 3QW9A 3NABL 5T1LB 4EDXA 2W81C 3WBDA 5BVJB 1JCVA 3A4EA 4IGBB 1TIUA 1QSEB 4BFEA 5DRZA 3BGMA 4ENZA 2OULB 5IMMA 2YZ1A 4IRSD 5BS0E 1AG0A 4Z0XB 4ELMF 1B9KA 2WQWA 4K8RH 4X6DF 4J2XA 1QFWH 4IOIB 1UOVA 4RISH 2NY4D 2GK2A 1NIDA 1Q0YH 2X6CA 2ICEB 3F12B 3QIUD 4HH9A 4L3AA 4L0ZA 4NIYE 1QR1B 1CZ8H 4K94H 3AWEA 1I8MB 2DKSA 3PDGA 3PL6D 3PQYB 4A2MA 3JUYA 3RWIB 5A16B 3IXTA 3GMMB 1PKQE 4MMYB 3GNML 3BT2H 1L7TH 3OKLB 1JV2B 3QNFA 4Q89A 3GSXB 2OMTA 3ATEA 3PWVA 3TBSB 3QCUL 2XN9A 4ORGA 4FHKA 1JZIA 5LG1A 1RUPL 4NN7B 1A3RH 1A6UL 6FABL 3N9GL 4NC2B 4HW6A 3MJWA 3HE6A 4YHMH 2E7DA 2IDFA 4YZFF 4RMBA 2AS5M 3KL5A 3PY9A 4G11A 4KK5D 2RACA 3JT0A 4FZ8L 2FEEL 2WXFA 4RSYA 2AK1L 1F8TL 3VGFA 1OGTB 4YXHH 2HLFD 2YWYA 3B3BA 5EG6C 3RWEB 3R18A 4P3CH 1R3LA 4MAYB 4U6TA 3SKNB 4KX8A 5EZOH 4QRAA 4WFFE 1ZS2A 2ZOKA 1R5IB 2QSVA 1ZK5A 1QZNA 2WLLB 4UYPA 3UJJL 4FP8H 5D93B 1LO5A 1WEJL 1EXGA 3WJLC 1FFPA 3S36L 3DX7A 2ADGB 3LRSB 3VD3A 2DQIL 1OK0A 3LKNA 3I3EA 3VXUA 1CBVH 2FO1A 1IKFH 1ZHNA 2QGBA 3PXLA 4HD9A 5CUSL 2WZ5A 5DEFB 3D3VA 3ZDWA 2Y5TB 4TRPH 5JOPE 2R4SH 2VDNL 3KJ6L 4JANA 1F3RB 3RBGA 4UV7L 4IGBC 4IRSB 3LZFH 4APXA 1R17A 2ATPB 3JWOL 3OWEA 1LNUB 3C8HA 2IADA 3B7RL 5TDPB 1ZVHA 2JWYA 4OZFH 3QP3A 4YIQA 4MQ7B 2NY4B 1SOQA 5SWSA 3PPEA 4BM7A 4NSKA 2E6QA 2FATH 4I3SH 1WICA 2XDHA 4HUWB 4KV5F 4NZUL 3P30L 3PL6B 1MRDL 4WSGA 3BH9B 2HVJB 2K3HA 4OCYH 1M1XB 4Q2ZA 2VRKA 4RGMB 3OKDA 1KPRA 1B2WL 2K1MA 4M7KH 1ORSA 4NCC1 3PNWB 3FFDB 5KVFE 4AEHL 4TTDD 4G7QB 4ZMZA 5BZDA 1T7YA 5I1EL 1YA5A 4P4KA 4WWKD 1ZLVK 1NEPA 5L2JA 5AOMA 3II3A 2YXWA 3V0GA 2QKIB 4ODBD 4NN7C 3QZPA 3I3DA 4QAMB 1LP9B 1XDTT 1Y6KR 3BHBA 1F02I 5E5MB 4CVXA 1B4JH 4LVEA 5IVZB 4Z3JA 4HUMB 4MJIA 4YHYB 1HINL 2UYLB 4OD2B 3K71A 4IDLA 2ZWSA 4MD0A 1SY6A 1A4AA 4F8QA 3RLSA 1GGIL 3K46A 1KGWA 3UG4A 2KMWA 3BDXA 3L13A 3PGCA 3PV6A 2R1YB 3C5SB 4UQ3A 4P2QA 3VFRB 5K9QI 3UGEA 4PJGE 1U58A 4PJDF 1ZMYA 5IB5A 4MAYC 2R4RH 2R2CA 2VQUA 3FTUA 1JDDA 2OSYA 4Z7NB 3D34A 3QPXL 1E67A 4NQED 3MGTB 1E28B 5D4HA 5D93C 3VFPA 4NO5A 2WXRA 1AZVA 3FF8A 5AKRA 1KB5L 5DJ6B 4B6ZA 4JY6A 1KJMA 5E4IA 4IBQA 4HQQL 4ZS7H 1I9JH 1BV8A 3V10A 1IGML 1ZSDB 5KYUB 1QI4A 3QUMH 2NW2A 2P80D 5GHWH 3UG5A 3MRQB 3QZWA 5BNXD 3IJ7A 5AW2B 2H2PD 1RAMA 2Y1ZA 2EXYD 3KYMB 3VFMB 3BP7B 4Y2OA 4YPGA 2A73B 3T0XA 3UZQB 5LNDA 4IRSC 2AC0A 3AZUA 4OLZL 3MRJB 4EXKA 2G60L 2WINA 2APFA 4JN2B 5D6DC 4ZFZA 2KKQA 5F2FA 3I9PA 4K3HA 1RIHL 2QQNH 2VUOA 3QIUC 4QYOA 1HTYA 2K8MA 4BELD 1OB1B 1P2CA 1U8HB 5C0RH 2VM3A 3RWJA 3PL6C 4ZW7A 1BWWA 3AACA 1MAML 3OAUH 4PP1C 1FYTD 1YDPA 4RGMC 3W5NA 3B9AA 5GGTH 3JQOB 3JXAA 4WWKB 5F7KC 1GOGA 3E7JA 5DC4B 2X42A 1IC1A 1TNMA 3VI4B 3WTYA 1J5OL 2BY2A 2O6CA 3LPPA 4S1RH 3WDJA 3K1DA 1E4HA 3HN5A 1O5DT 2HX9A 2QKIC 1IEHA 3FTZA 4FX5A 4HMEA 2GY7B 3DHUA 3PV7A 4PIBA 4JM2F 5D2LB 4XVJH 2PKDA 3DSFL 4OFPA 5EHFA 2ARWA 4WHYH 4KK5C 4DW2H 1DQQB 1ZDSA 4PMFA 4YHYC 3IU3B 1YQVL 3ZMRA 1LVEA 3BUQA 2Q76B 1UA7A 2HLFC 2V5SA 3RWCA 4AE1A 3GMLB 3WFZA 1R75A 4GW5A 4H8VA 3AT9A 1MWAH 3FXIC 3V5KA 2V9QA 3NCBB 6PAZA 3N91A 3K6OA 1YECL 2FNWA 4KXZH 3C8KB 4NQEB 2ENYA 2WYTA 1DYZA 5C08A 1FN4B 4HCRL 2APTA 3KXFD 3IWUA 2IDUA 1N4XH 2OL3L 2B20A 2X4SB 2A6KB 3F7RA 1MHHB 2EDFA 3FT1A 2Y2TA 2F58L 2OR7A 4UOJA 4JPKL 5L9DL 1LEKA 3UO8B 5LGJA 2VSCA 4GY4A 2ICWB 4MNGE 3ARFA 3FRPG 3RILA 2VRAA 1I3UA 1HSAA 2HVKA 4LCWA 5ACMA 3UO1H 3DPBB 4P59L 2PPDA 2W8CA 2Y6TE 3QIBC 2WXIA 2O61B 1K5NB 3I2CH 4F7PA 4JFDA 1JGUL 3GIVA 1SNRA 3BESR 1NGWA 4YXLH 1L9NA 3DX6B 4CC4A 4LEXH 4JREB 1T0NA 3Q13A 4HIXL 4L05A 4W9CC 1KYOK 4E36A 3S3PA 1GOFA 3MHZA 4Y19E 1FYTB 2ZKWA 2YD0A 3PGDB 3H1ZA 5H94A 3S34H 1P4BL 4YHZH 2BXZA 1A8ZA 4DPCX 3ESPA 2FHCA 1PQZA 4TTDC 5D1XD 3GRGA 3SGKC 2VH5L 1CU4L 3B8SA 4FNLH 1WWBX 3QHZL 4WWKC 4POZD 3FTWA 4PJ7F 2OYLA 4D3CL 3FB5A 3NCMA 2DIEA 5GXBB 3QXTA 4F8TA 1S9VA 5I8OH 1CR9L 4PBXA 5DD3L 3ROOA 3WE6A 4JLRB 3MUZ1 3RP1A 1BW8A 1HHHB 1X3DA 1BM7A 4RCAA 3LRHA 2BWIA 2Y1AA 1C5DA 1KGCE 4Y5VC 4XNBA 3M07A 2AAAA 3T0DA 4U7KA 1IT9H 5GRJH 1AI1L 3LQAC 4FFYL 4WNQB 3NCYP 4PSPA 3DJZA 3VXTA 1WCBB 2F8OA 3E1F1 3GB7A 4O2EB 43C9A 1MH5B 4KQ4L 3Q6GH 4NUQA 4KJYA 1BLIA 2JKSA 3SEPA 2X4PB 3RVTD 1NWPA 1A7QL 1I7ZB 3SODB 2VLJE 1JGDB 3GRBA 3BPLB 4PJXF 3MRPA 1I4FB 1UCBH 2QVIA 3EYUL 5DHVA 3VI3A 1UB6B 3KXFB 1JBJA 4JPVL 4WKZA 3APDA 1K3IA 3G6JA 1ECZA 4OFKA 5BJTA 3QWOB 5IHHA 2NOYA 5E1GA 4OLYH 3MBXH 1U6AH 3CZKA 4HPOL 1MF2L 4BCZA 4EMZA 1AACA 3DTXB 3RL2B 2JELH 4U6HB 5I1LA 5AVZB 2H2PC 2EXYC 4NWTL 4X6BB 3BMVA 5IWLC 4L4VA 1XCXA 3GTVA 5E6ZA 3RBSA 1NANI 3HPJB 5LUMA 1XH3A 2AQ3A 2G2PA 3ZE0E 1DVQA 2CCLA 1RURL 5DCCA 4XCEB 2L7JA 2VE6B 3IMWA 4I1PA 2FH8A 3LYRA 5DK0B 1RJCA 2BVOB 3CFDB 1A1OA 4JDEB 3CDFA 5HVHB 3V6OC 4HKBA 5D1XB 3G5XB 4OLXL 4IOSA 4MCZA 2JLPA 2GHWB 4P5TD 4X6DB 3EYOA 4FXGC 2OTPA 3BO8B 2XZCL 4KBPA 4Q58C 2OSLB 1PL3A 3QG7L 4BBWA 4DN4H 1V54B 4N9OB 3PIQB 3MV9A 3SQOL 1XBRA 4D9RD 1DL7L 5A6MA 1XH1A 3HC3H 4P57B 2R1WA 3DX0A 1B3IA 3FHQA 3GJEA 4S11A 1G1OA 5CJOH 4Z3IA 2GTZA 5CD3A 4GRMA 2KS0A 4NO2B 1U42A 2DQEH 4YX2H 4JQXA 5DVOA 4F7TA 1DEEB 1TQUA 4X83A 2ZKMX 4DJMA 3QULA 1NFKA 4HAFA 4XX1E 4MLSA 3UAFA 3WD5H 4MJ6B 2CO7A 5JORB 4WGKA 1ZK9A 3GFUA 3VW3H 4DP1X 1RH8A 3UYOD 2A1WL 1OHQA 4ODXB 1NFDF 5ALCL 4RH4A 4ABVA 1IEBB 2JKNA 4JDZA 4M6MH 5C0CA 2HFFB 1S8DB 1D2OA 3I50L 3BPLC 3QWRA 3TURA 4JS7A 4WTQA 4QRRE 4DGYL 2EVHA 1NH6A 1SQ2N 2XN0A 3Q3GB 1LEIA 4J8RB 2GK0A 2J20A 4MLIA 4NYLA 4QF1A 1CQYA 4RMTA 4BHUA 1CF8H 3CDZB 3TNNB 5AALA 4HWEL 3E8UH 3OB0K 4JO8A 4AYFA 5ITBL 1KBWA 2FX9H 3V4PH 1OGAA 1JNLH 5BUAA 3LPGA 5D7HA 4HF5L 2A77L 3NTCL 3P9WB 4G7SB 4L3FA 1JZEA 1HE7A 1OEZW 3KGSA 4OI8A 4G7VL 3ZUCA 4JPSA 4HAGA 1XGYL 1JXGA 1P4UA 2DH3A 4OZIF 3N0AA 4IDJL 4WFEE 4YHKL 3TA3A 3BWAA