1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
molecule keywords AZURIN
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
2UXVA 4GP4B 3X1FA 3EF4A 4KO7A 1A4CA 1EZLA 2XV3A 3NJGA 3FPXA 1AS7A 1OV8A 2FWLB 1BEXA 4P5SA 2BZ7A 1BQ5A 2YAOA 1GY1A 2PP9A 3BVDB 1KBVA 1CUOA 1MG2C 1ET7A 2H5UA 1VLXA 2P80A 5I6PA 2XV2A 1FWXA 1NDTA 2EINB 4HCGA 4KOBA 4BK5C 4KO9A 3SQRA 4EF3A 2XYBA 5IY5B 4G7SB 1NIEA 3IBOA 1OOWA 1WA0X 1CC3A 3UACA 5B1AB 3GXUB 1JXFA 3D12B 3N55A 2B3IA 2QDWA 4AKOA 2IWFA 4E9WA 2YAHA 3QQXA 3GDCA 1SFHA 2HRHA 3RYMA 3TASA 5A7EA 4F2EA 1EHKB 1AZNA 1QHQA 4E9RA 1BYOA 3TBCA 3N2JA 4E9YA 3FQ2A 4WKXA 4A68A 2OV0A 2FQFA 3FYIB 1A4AA 4G72B 2DWTA 1A4BA 1PF3A 3WI9A 2DWSA 1N68A 2AFNA 3S3BB 2VSMB 1AZRA 9PCYA 4CSZA 2EIJB 1JZJA 1KBWA 2UXGA 3FSZA 3T6ZA 3SBRA 2PP8A 2XV0A 4GXFA 1ASPA 4ZK8A 2GC4C 2EIMB 4UF7C 1X9RA 3ABMB 3C75A 4P5RA 2FT8A 1ILUA 3T6WA 3U25A 3NSDA 4Q89A 1V55B 1OCOB 3SBQA 5B1JC 1SFDA 3NJMA 2FQDA 1PY0A 1JZHA 3OM3B 1R1CA 5B7FA 1I53A 1PAZA 2VW4A 2MTAA 1BYPA 1NIDA 3QJSB 3OMIB 4HALA 2W88A 1PNDA 2MRYA 3CG8A 3PAZA 2J5WA 1AZCA 1SDDA 3ASNB 1HAUA 4M4RB 1E5YA 3PAUA 2IWEA 4YSSA 4HIPA 3ZIYA 1J9TA 2DY2A 2CALA 2HX8A 2PCFA 3AG4B 4N8UA 5D4JA 3X1BA 5I6OA 5FC9A 3OQRA 1J9QA 3AZUA 2Y69B 3DKHA 1SJMA 2OJ1A 1HAWA 3QJVB 3FT0A 1TKWA 2R7EA 4E9XA 2CCWA 1ETJA 4YSDA 1GW0A 2BP8A 3NSCA 2BW4A 4N4YB 4FAAB 5I6MA 4JHVA 3TU6A 2Y1AA 1AG0A 1N70A 5E9NA 3ZDWA 2RACA 2BO0A 1URIA 4BDVA 3QJUB 5I5JA 1MZYA 3ERXA 2ZXWB 3CVCA 1OF0A 2XX1A 4E9QA 1MZZA 1BXUA 1XMEB 2P80D 5I6NA 2QDVA 4AKPA 2BZCA 2GI0A 2E86A 1MG3C 1KYAA 3WKQA 3AG3B 2PPFA 3IEAA 3CVDA 2PP7A 2GHZA 3EH5B 3ZBMA 1AIZA 1WAEA 4BWUA 1E67A 3NYKA 7PAZA 4MFHA 3PXLA 2IDUA 4RH4A 1KDJA 3NJNA 2IDSA 4DP6X 1DYZA 3T6XA 4W1TA 1QNIA 4E9VA 3DTUB 1UATA 2B08A 4DP0X 1L9TA 3KW7A 1PNCA 1M9WA 2QPDB 1TEFA 3PCYA 4DP4X 3X2QB 3UAEA 2W8CA 3T9WA 4A67A 5ANHA 5PAZA 2BP0B 4YSCA 3NJLA 3AG1B 1OE2A 1W8EA 4E9TA 4KNSA 1XB8A 3IN2A 2R7EB 1AANA 4HHWA 1E5ZA 1NTDA 4G70B 6PAZA 1NINA 2DYRB 2WO2B 1RKRA 5LDUA 2YAQA 4DP7X 2BHFA 5D4HA 3WKPA 2YXVA 1IBZA 4K9JA 2H3XC 3CVBA 2CAKA 3FU7A 3L45A 1V54B 2N0MA 4A2GA 1KV7A 2FT6A 2XXFA 2YXWA 1WA2X 2FT7A 3FU7B 3TA4D 3UABA 4A2FA 3S8FB 3PPSA 1NZRA 2YAFA 2JXMA 2HXAA 1SHWA 1KDIA 4G7QB 4AZUA 3HEIB 1IUZA 3JT2A 4PCYA 3EHBB 2VSKB 3T6VA 2FQEA 1X9UA 1FA4A 1KGYE 4JKNA 1BAWA 4BWTA 1HFUA 1ILSA 1PLBA 5F7BA 3PLYA 5AKRA 1CYWA 2BP0A 1W6LA 3PAVA 2IH8A 5I6KA 2DV6A 4BXVA 2XU9A 4G71B 1KCBA 4YSTA 3V9EA 4HCFA 1PCSA 3FQYA 1M56B 1SNRA 1ZIAA 5AFAA 2PPEA 1L9PA 1RCYA 1J5CA 1ID2A 1L9OA 1JXDA 1NIBA 4A2EA 3WIAA 1NWOA 2PCYA 2WO3B 1ASOA 4BWWA 4E9SA 5F7AA 1AZUA 2BWIA 5B7EA 1JOIA 2PPCA 1NICA 1PZCA 4NERA 2UXTA 2J56A 1JZIA 3NP4A 3JTBA 2WSDA 2XUWA 1DZ0A 2FJSA 2FQGA 2EILB 3ABLB 3G5WA 2VN3A 3FYEB 5EHFA 1PZBA 4GYBA 4YVNA 1PMYA 4FA7B 2PLTA 2UX6A 2Q5BA 1OCZB 2GBAA 2GC7C 2EIKB 2UXFA 4HCIA 2QT6A 1E30A 4ENZA 3QJQB 2I7SA 3NJIA 3FSAA 2UX7A 4YVUA 3X1NA 4BDVB 1IKOP 1PLAA 1L9SA 2YAMA 4YSRA 1GS7A 3FSVA 5B7MA 1AQ8A 5I5IA 3AW5A 4CSPA 4QKTA 3ABKB 3QPKA 4M3HA 5I5MA 2IDFA 3T71A 1AZBA 2BP8B 1B3IA 3WG7B 1AS8A 1JVOA 1IBYA 4A66A 4DP5X 1V10A 3ZX1A 4AX3A 4DP8X 3ASOB 1F56A 1OCRB 4L0PB 4UANA 1CYXA 1JERA 1OCCB 3QJTB 4AKQA 2CJ3A 1GYCA 1SHXA 1W6WA 4HZ1A 3NSFA 4YSOA 5I26A 2FTAA 2JKWA 2GIMA 1BQRA 1BXAA 1MDAA 1L9RA 2XLLA 1GY2A 4QLWA 1CURA 2YQBA 1SDDB 1YLBB 5B1KA 1NIFA 4JHUA 1TEGA 2NRDA 3H4HA 2VW6A 3S3CB 1OE3A 3AG2B 1IC0A 4TXVB 3OD3A 5B1JA 1NPNA 4UAHA 2QPEB 3V9CA 1J9RA 3CZUB 2JFCA 4DPCX 2ZONA 3KW8A 1ZDSA 2YAPA 4KNUA 1T5KA 1J5DA 4YSPA 4PAZA 1A65A 3GYRA 4NAJA 1GS8A 3FSWA 3FS9A 2BWDA 1M57B 2VM4A 3FU8A 2CUAA 1QLEB 1ZIBA 2A3TA 2XX0A 3H4FA 3IE9A 1WS7A 4G7RB 2IWKA 3NJJA 1A3ZA 1AS6A 4DPBX 2IAAC 3CDZA 3NP3A 2IH9A 5TK4A 1GR7A 3H56A 4KO6A 8PAZA 1E65A 2H47C 2Q9OA 3TBBA 2PPDA 5TK2A 2XXGA 4YSUA 2HX7A 4GY4A 2AANA 2AZUA 2I7OA 3OMAB 6PCYA 3SBPA 4KOCA 4YL4A 2PPAA 4F2FA 2XWZA 4AI7A 7PCYA 4GP8B 1TU2A 1BQKA 2HX9A 4A2HA 3ABGA 3HB3B 3IN0A 1FFTB 2DYSB 2ZWNA 4DP9X 2FNWA 1L9QA 1OE1A 2HZHA 1GS6X 1JVLA 1WS8A 2YAEA 2AZAA 3NJFA 2X88A 2VM3A 4YSAA 1AG6A 3X1GA 2OCCB 2LLNA 1JZEA 1NPJA 4DP2X 3X1EA 3WNJA 5AZUA 1ET5A 3FU9A 1JXGA 1WA1X 3WNIA 1ZPUA 3CDZB 5B3SB 4DPAX 1SF5A 3EH4B 3EH3B 1KCWA 1BXVA 3MBWB 1AACA 4W9ZA 4YSEA 4YSQA 5I6LA 3DIVA 1AAJA 1A8ZA 3UAAA 5I28A 3OMNB 4NB7A 1GSKA 3QJRB 1XB6A 5B1BB 2I85A 3NSYA 3NJHA 3FQ1A 1PZAA 3NJKA 2CBPA 1J9SA 1RZQA 3NT0A 1ZV2A 2XVBA 4WTQA 1SF3A 4GP5B 3UGEA 2VW7A 1RZPA 2IDQA 3AY2A 3MX0B 1ADWA 2J55A 2HRGA 1AOZA 1NWPA 1JZGA 2HLEB 4HHGA 4Q8BA 4HAKA 1ET8A 3S3DB 2GSMB 1PLCA 4KO5A 2TSBA 1NIAA 2AVFA 2ZOOA 4F7KA 3UADA 2BW5A 4DP1X 2IDTA 4X4KA 2VMJA 1JZFA 1ZDQA 1ASQA 1XB3A 4A2DA 2GB2A 2TSAA 3S8GB 4KNTA 2J57A 2X87A 3BQVA 4BXSV 5PCYA 3FPYA 1AR1B 2YARA 5D4IA
chains in the Genus database with same CATH superfamily
1HZHL 2G2PA 4KRNA 2A74A 2Y7QA 3C8KA 3T1FB 1A4CA 2BP5M 2XVKA 2ZSVA 5IEKB 3K1KC 5C7ZA 1AS7A 3B2UD 1ZK9A 3O3AB 5J6SA 1I1FB 2ADGA 4MJ2A 1QEWB 5IB1A 3I3DA 1GY1A 3D9AL 2QHRL 1CUOA 4B53A 1MG2C 3ATAA 2F19H 1EIBA 3W39B 4N1EA 1QMUA 1AGFA 3DIFA 4JCMA 1AHWC 4N9GB 4KO9A 4PVNA 3KPPA 5BO1L 4AUUA 3OKKA 1VEOA 3UMTA 1GCFA 1ETZB 5D7IF 4M93B 1WZKA 4TQEL 5BNXD 1A1NB 3PIQA 3RIKA 4I9XA 4M7JH 5DEJA 3AREB 2WNXA 1MJ7L 3AXHA 3SOBH 4ES8A 2AJ3A 5C2BH 3L4TA 5G4OA 1NCTA 1QHQA 4G8EB 1CVRA 4WEUD 1U8MB 1WBXB 4PD4J 5JQIB 1OAZL 4O58L 3BXNA 4WFEE 3JV5A 1RHHB 4YJZL 1E2WA 5FIEA 5T1MB 4MJ6B 4ZMPA 3HG3A 5C0BD 1XR8B 3L1GA 3HPJB 3Q8BA 4CNIA 3MRMA 3MJ8A 4XH2B 3H42H 4ABUA 5HY9B 2X89D 4JMNA 2OCJA 3VXUD 1JXKA 4NRYA 5LGHH 5BS0E 1NGZA 1E5AA 5ELIA 1ITCA 1DBKL 3WTYA 1E28A 5DHMC 2DIAA 3PP3H 1D5MA 3FN0H 2CSPA 4I0PB 3P40A 1ASPA 3H9SB 3Q1EA 1JHKL 4RGOL 2QZQA 5D96C 2XPGB 1A4JB 3ZZ1A 4PHZA 2EDXA 4CC4A 5EEYA 1DCEA 2MPAL 4NPJA 1MHPH 3UC0L 1ANUA 1VEMA 5TD4A 3V0GA 1A4KA 3QJHA 1TTRA 4F7CA 1XCTB 2ZOKA 2VZUA 1QATA 2TRHA 2Z1PA 5DHYB 3TBWA 1CMOA 3OX8A 1BD2A 1BYPA 5A1AA 1H0DA 2ZWSA 4UU9B 2Z0BA 5DA0B 4AEIL 3OMZA 3L2LA 2BMKB 5EUOE 1RULH 4AV5A 5ICZA 2EDLA 5LNDA 3DA0A 5KJRL 2CD0A 1P7QB 4UT9L 1J8RA 3MCYA 5D5ME 3T3MF 1JI2A 1SJXA 1PDKB 5D4JA 5A2LH 1AGCA 1OOAA 2FJGA 3BW9A 5FC9A 1MNNA 4HJSA 5I1DA 3MXVH 4K7PH 3VWJA 5BS0B 4X7TA 1TKWA 3VWKD 1AFVH 5HHMB 4BZ1L 5FYLE 4E9XA 4NZUH 1IEHA 3NSCA 4AV0A 5C6TH 2XPGA 2R1WB 1R5IA 2XQYA 4AVIA 4KXBA 4OGYL 1YYLL 3G6JB 4XPFH 4NHCH 4Y16B 3VFWB 4YLQT 3L54A 4G3YL 3A0OA 5IMKA 3D85D 3S0PA 2Y3NA 1YEJL 5FF6B 3APNA 4ELME 4A7QA 1RU9L 8FABB 4WLCA 3CPLA 3FO9A 3QWRD 1HHIB 1MPAH 2DB8A 1FIGH 4JZJB 1QBML 1GAFH 1AO7B 1JD9A 1FZMA 1LM8V 3PP3K 4D0CA 5CJQH 2PWDA 1W16A 1RK7A 1CR9L 3NEEA 2P1YA 3NYKA 2FGWL 1Q94B 4LDCA 3QDHA 4ZOBA 1AZVA 4BFBD 4WI0B 4ODBD 3LKRB 4PPTA 3RY6C 5TQ0L 4N0YH 5JTWA 3VFNB 3E1ZA 1MCRA 2R2HB 3EJUA 3KYOB 1UATA 4I85A 1QPXA 2C9VA 4NQCB 4B9JA 5C0EA 3V10A 5GGUB 4M1DH 1FLRL 4UYPA 4TNWK 5AB1A 3SY0A 3VXRE 1TEFA 3EBHA 1IARB 3PL6D 5DFTA 3SDXE 1BW8A 1KXQA 4EO5A 4FZEL 1UVQA 3P4MB 3U1SL 5DZVA 2X44D 4X5LA 1MAMH 1CDGA 3B9AA 4NKDB 1FSKC 1XFPA 4PTTA 3C6LB 4QYOB 4PWIA 5T3XD 3QZWG 1XB8A 4BSVB 1AD0A 1AQDA 2HYMA 4LHUB 2BSSB 1IM9B 1FPTL 4G2AA 3O4LE 2ESVE 4YX2H 1JRHH 2V3FA 1U92A 5JIHA 3RL1A 1GZQA 4EMZA 2OZ4H 4HZLA 4P57A 2P8MA 3VFGL 3RZCD 4B9PA 1CT8B 3NCWA 3MRCA 1LQSR 1YEHH 1D7BA 5D2NC 1BOYA 3GI9L 3VAEA 2I9TB 3MRHA 4JLRB 3ZHLA 4GT7A 1NC2D 2EO7A 4NQEA 1I8IA 3H2QA 4UU9A 5DRZA 4EQ2A 3STBA 1Q72H 3GSNH 1MSPA 2HXAA 3HCVB 2GI7A 4U1SB 4F33B 5I1IH 1CLVA 1I8LC 3FFOA 3B2UC 3WY2A 3QYCA 3T2PA 3ZIMA 4KI5F 4DKTA 1CG9B 3ZU8A 4JHAL 3L3KB 2IGFH 3A4EA 1G5AA 3KGTA 3ZTDC 1ILSA 2IQAB 4R90L 3GI8L 2P5WB 1ED3A 3QVAA 2IH8A 3JZ7A 3QXAA 5E1AA 1M71B 5TE6H 2G0KA 3OAZK 4KZEL 3S96A 1TG8A 4HGKC 2L0DA 4U7SA 1KJVA 3K7UA 5AW8B 4Z5RB 1TVBB 5T1KB 2PPEA 5E6IB 5DS2A 4GG8A 3FUEA 4ZODA 1U8HB 4DEPC 1UWXK 2DEXX 3HRZA 3S35X 2WWKT 3MUHL 1LEGB 3BFWA 2J6EA 1E8YA 5FYKU 5HHOA 3QEQB 3IDNB 2VLJB 3BH9B 3CBKB 1XMWA 3FB6A 3GEWB 4FXGA 5FGSA 1JZ3A 4JZOA 4MDIB 2F1EA 5DZ9A 3F7VB 2IG2H 1WICA 1X5HA 3PFQA 4XO8A 5GS1B 5A6LA 1NDMB 5HYJD 3V6OE 1QA9A 1CE6B 4QJ4B 1H3WM 3QNYA 4PWJA 5EPMA 5EV7A 5IJKA 4NZRH 5CHNB 1QFWL 5I66B 1AQMA 4NKDA 4ZG1A 2OMZB 5F9WC 4P07A 1SYSB 1TJHL 1KELL 2UX7A 2G2RA 5BZWA 1U8NA 4X9GA 1BQUA 1RMFH 3BH4A 4P49A 1GYWA 1EEYB 3UP1A 1NFKA 4PW9A 5IHUH 4X9HA 4KKZA 2L3BA 4KK5D 5IMMA 4HAFA 1F1AA 1EO5A 3STZB 5EU7E 4BRVA 3QHFL 3C60D 3LD8B 2R83A 4IYKA 4PU2A 4UANA 1QPPA 1XO8A 4BFNA 5I18H 2D3NA 5AAWC 4PJHB 3QJTB 2NMSA 4M1DL 5DLML 3RVTD 3RWJA 5DUPL 4DUVA 3T1FA 3SIKA 4KITB 2GIMA 4P3WA 1N64H 5ACZA 4CU7A 3CZFA 3PDOA 4EBQL 4TVPE 3KGUA 5F88B 5B1KA 4JO8A 5J9PA 1BOGA 2Z31D 1HL5A 4IHBA 5C08A 3KWWB 1TO4A 1IC0A 5F7HA 3GS4A 2Z92B 3BSZH 5ADOH 3DV4B 2O5ZH 3CHSA 3LRMA 3US0A 4GAYB 1JK8A 4G80B 4Z3FA 4NI6A 2VLRA 4HUXA 2A9ML 3K2UL 2X4SA 3EH1A 4DPCX 5TJWK 1PJWA 2DICA 3TBTB 2A9DA 3SE9L 1G6VK 5LWYH 1QSEE 1FV1B 4KNUA 3GRWL 3CXDH 3MRRA 4OU3A 3QORA 3VXOB 3PL6B 3ES6A 2ROXA 4OGYH 4QRBA 4ILDA 4QI3A 3QA3B 2YN5A 1M57B 4Y4KB 1JGEB 4UB0H 2A3TA 5C0DA 3SYQA 1MFEL 3FQNA 5GGSA 2QJDA 2EC9U 3T2LA 1ETB1 4Y5YA 2VAJA 2P48B 1YMMA 3ZDYB 5F71A 3S36H 1YAIA 1BECA 3T8XA 2Q9OA 1WHPA 3MV01 2WVTA 4TULL 4HH8A 4OZHF 3NACL 3GMPA 1Z0MA 4FG0A 2WY3B 3Q3GB 3GGWA 3IDMB 3TO4B 4HKZA 4YLBA 4XPHH 4UV7L 1LO4L 3VGGA 1XGUA 3MNZA 2HT4D 4FFZA 4JFSA 1XCTA 4PVLA 3HC0B 3GMOB 5D7KD 3MLWL 3MNVA 3MXWH 1BQKA 3FCSB 3QDJB 4RZCA 3AT0A 1M6UA 3HB3B 5FK9A 3BIBX 2DYSB 3FT4B 3PFUA 1Q9WB 2H32H 4XBGA 2XWRA 1WZMA 2BRRL 3GSOA 1FVEA 1MY7A 1NOFA 2L4OA 2DS4A 4XX5A 5D1XA 5KVGE 3IU3A 2AQNA 4WGWB 3LZPA 2UY7B 5CJ8A 3VWKC 4GRLA 2CRYA 5J3HD 5E6UB 3WNJA 2ISDA 1JHKH 4EI6B 4L8SC 4XAWL 5T3ZD 3VFUB 4GUCA 3L4WA 4ELKA 4NBXB 4S0SD 3POHA 4OZ4A 1NMCC 4RMQA 5HDWA 3GXTA 1G9NH 2YA2A 3ZHFA 1MXDA 5CSZB 1HHKB 2BIHA 1D6EB 4APQD 4KJWC 1HWWA 2C9RA 1YNKL 1KIUB 3O41A 4FQCH 2MQ3A 1IKFH 2XZQL 2WJ5A 4DF9A 1FE8H 3V4PB 4FTDA 3R8BB 2BOBA 2R0LL 5DMIH 3MV7E 3QDMB 3FTZA 2D7PA 1RAMA 3LQZB 5DJDB 4MZ2A 3FQ1A 1LK2A 1UENA 5E8NA 3SKNA 4XXCC 3TBVB 4BYHA 1WAAF 5C9KA 5ID0A 2BCKA 1VF5C 2NPLX 4LLDB 2LU3A 3KPLB 3MX0B 1NEZA 5KUMA 3WIFB 2DIEA 1MCCA 1OTTC 2F8OA 3VXTA 2LE9A 2P5WE 3T3PB 3MYZA 4QRPD 3GSQA 4MD0B 5DJ2B 5HHQA 3GBLA 1ET8A 1XSIA 4WI5A 4TQEH 4WSJA 4NC1C 3RX5A 4HIXH 2WHVA 3BEVB 3VQMA 3D51A 3JTTB 2W60B 2DQFB 1GTNA 5AALA 1F41A 1FG2B 4RMRA 1HE7A 2OMXB 4FFWD 3CH1B 3K8LA 35C8L 1M2VB 4F7MB 2FEDC 4HA1A 3BYTA 4X9YA 3LSOB 3CH1A 3O6KL 2X1OA 2YEQA 1NOAA 2UUDK 4ZUTB 4I88A 1BVNT 2IADB 2H2SC 1E43A 1NUNB 2Q20A 3LNGA 1Z3GH 1KCKA 1WFJA 5JW4N 3GMOA 3QW9A 4AQ1C 2V9TA 3QEGH 4LASH 2VDRB 4M3KB 2H2SD 3HS9A 4CW1A 1HHHA 2F54A 4ODTL 3SDYH 2ZSWB 5IM7B 4MJIE 1P69B 3BVDB 3QJXA 5KJ4A 3SKNB 1OD9A 1QO3B 5I9QB 3G9AB 5JIMA 2JCCB 2AJXL 4P2RE 2P3YA 2A4ZA 4P2AA 5DVOA 3DO7A 4K8RD 2DOCA 5IB5B 5IJVA 4NNPL 1XGPA 1KEMH 3B9EA 3LDBC 1BLNB 2CDFB 4WNSA 4AQ1A 1R9FA 1U2HA 2AEPL 1OOWA 3BGMA 5LJYH 2VQ1A 4BM7A 1SJHA 2VT0A 4NQUA 3O81A 3D8MA 3ECUA 2LFGA 4LMQI 1HHKA 4KNQA 3ZVVA 1QFPA 2Q8BL 1K72A 3F7KA 3MLZL 1BQHA 3MREA 4NQVB 5CU5A 3SDAB 5AZEH 1HCFX 4QRSA 3H0TB 4KI1A 4TNEA 5BS0D 3MGTA 3SE8L 4E9RA 4ZX4A 5I1JH 1KPRB 1XEDA 3IDIA 2FR4B 3GO1H 5L2JA 3BUQA 4HV8B 3MV8E 5D7HA 1CGTA 4QHKI 2Y7MA 4LCCA 5D2NA 2DF3A 5BVJA 5IFJA 3MUUA 2YPKB 3OKMB 4K3DH 5EBLB 2ZICA 5FUCC 4F58H 3KWWA 3EGSA 5EORH 1WBZA 2A6IB 4FFVD 2AKRA 4ODSL 5J6HB 2I60L 1X3DA 1S7RA 2WNKA 3BLBA 2HVJB 4UI2A 4NO3A 2QGEA 1CGXA 5EDSA 1MCSA 4MCYB 3VG9B 5IWLC 1JF1B 4HIHA 3MOAL 1RUMH 4PLKD 3EIFA 4X5PA 2EDWA 1TO5A 3WGUB 5LBSL 4GPVA 1VZGA 1FJ1B 2O6EA 2YEZB 3GSXB 3FQUA 4FQHA 4L4TD 4JGJA 5LCVH 5J11B 1UASA 2JJUA 1ZSDB 5DC2A 3RY5A 1GMIA 5AZ2H 4ABQA 2R8SH 4OZIF 5I16B 2WXPA 4HWEH 3OJVC 4M8QA 2YRPA 2X09A 4P23D 2OMZA 2V7NB 3EKCA 4J3VA 5I6XC 4JFHE 2V7HA 1FG2A 3RVUD 1IC5H 3VXUA 1MCWM 3DTXB 1JCKA 3PAZA 4YK4B 5HDLA 3ZKMD 2GEEA 5A3IC 2YKKA 4HT1L 5B38G 4G6KL 1AZCA 3F7LA 1NDMA 2D0FA 3SPHA 1U3JA 1H8OA 1KFAH 4UINL 3QNZB 3MUGA 4RMUA 4LGRB 4OF3A 3GKZA 1FL3B 3T8VA 1D9KD 3H6JA 3ZIYA 2DRUA 3DXAB 4N3UA 3PHSA 2ED7A 1QVOA 2VDNB 3VSVA 4EUPB 3GZOA 3QUZC 2M8XA 3STLA 3VMPA 4NUMA 1G7HB 3DKHA 5FGBC 3WY1A 1YG9A 1IBFA 5AL8A 5CILH 1DVFB 5DMIL 1KLGB 3LKSB 5C0BB 3VD9A 2CHZA 1FFPA 1LO3H 2JCCA 4PV1C 4HJEA 1MCQA 4UZGA 3UDWC 4A7GF 2VC2H 4IIQB 3Q6FB 1P5UC 2RACA 3BN3B 1FCGA 4JFYA 4GXVH 4JREC 4CKVX 2E27L 1T1ZB 3RP1A 2N01B 3ZRCC 4LCIL 3ROOA 2BH0A 3SODB 2BSTA 1F58H 1H8LA 3K81A 3EOTH 4HIQA 4IKLA 5KBLA 4W93A 3MVSA 3AG3B 2HJLB 3BP4B 2OX5B 1I1AA 3OQ3B 3S97C 2ZWYA 3G6JA 3VFWA 5JHLH 1JNHA 4HEPA 2UYLB 4PS8A 5DD5L 5BZWB 3U4AA 2GKIA 4BZYA 1I7UB 4PJGB 3VFRA 3VGHA 4XB8A 3WO3B 2KC0A 1QNIA 1M7IB 1JF5A 4ZQKA 3CMOL 3TBSB 3FCSA 5L8JB 3SE4C 3L17A 3I50L 1ZE3C 1GRWA 1X9QA 4IOIA 2YOCA 1Q9LB 4TQIA 1PNCA 2HFFA 2HKFL 2O5XH 3TTSA 4YHYB 2DI9A 2HVBA 1UXSB 1NBVL 4Q4IA 5ANME 2VCOA 5D71L 5FM5M 5C0FA 1WFNA 1YMHA 2D3LA 2VLJA 2BMKA 3FB6B 4FG4A 4IOFD 5SX4I 2HFGH 4YEFA 4KHTH 4U2YA 3PXHA 1IIKA 3PUUA 4X4MA 1AGDB 5EWIH 5KVEH 1A5FL 2ZCLH 5AEAA 5ESAA 3CFUA 2BIMA 4NCDA 1FG9C 2JCCF 2VDRH 3C09B 5FHBL 1HH9B 3L95A 5KSUB 4BFGA 1INQB 2DMGA 2CLZB 3PP4H 4CMMA 4GRWH 4FQXC 4HKJA 4FZ8H 1GGIH 1Q9KB 1IBZA 2BY0A 4G5ZL 3RUGE 2W91A 5E99H 3RGVB 3I2CH 3CVBA 5A2JH 5C0AE 4I9WE 5IROC 2WZPD 3UZQA 3SDDC 4OLYL 4YHLL 3VNYA 1XH0A 2C1OA 2CGRL 2BNRB 4JVPA 2O4EA 2BS9A 5GRXG 4QAWA 5D7JD 3DUHA 4XRCA 2YD2A 5D93B 1U93A 5LQBL 3T6VA 4OCXH 4N28A 4KUZL 4L4VD 2M2DA 4CADB 1G84A 2XICA 4X42A 1CYWA 2UZYA 3M1BA 3QIBC 1XIWA 4IRZH 3SQBA 5J5EA 1LMIA 5HDBF 1NCJA 2DLHA 3D09A 4N20A 5JIKA 3OJDA 1RHHA 4F92B 4X80H 1S8DA 5KBNC 1A6PA 4G71B 1KCBA 4NBZB 1NGXA 1XF4B 1KTLA 1YN7B 5AAMA 2ESVA 4WI3A 1ID2A 3D69B 2ADIA 4HJIA 4E9SA 2NSMA 1KB9J 5FHAL 3WIAA 2GIYA 3GLDA 4X9BA 1J12A 1MUJA 2D7TL 3IT8D 1KLUA 1NLDL 1UB5A 3NAAL 2ICWB 4S0HA 1UOWA 4FYRA 4M5YH 1KN4H 1GH7A 2O26U 1LDPH 1QSZA 4UQEA 2DMCA 2LGNA 2VISB 4Y4KD 5CEXB 4NDMB 5GRVK 5IQ9A 4IGBA 4PB9L 3FTGA 4JGMA 1JTTA 4KQ3L 3P9WB 4NAQA 1I1AB 4JQXA 5F0LB 4NHUA 2VN5A 1GJIA 4L4JA 3UAJC 3QS3A 4BKTC 3MLVL 3QG7L 5FM8A 4IIZA 2AEOA 5BVPH 4QY8A 3IMTA 4P4RB 1A7PH 3W9EB 2K6WA 4KQ3H 3X1NA 2R59A 2R9HD 2F7RA 1RUPH 3DI3B 1M1XA 2X1PA 1CLOL 2X4RB 3M88A 4MZ3A 2X9YA 3NH7H 3V7AE 2C3VA 4UUJA 3QPKA 3QQ4A 3T0EC 2YK1L 1DUZB 4FHJA 3ARGC 1CL7H 4FQJL 3CHXA 2NSQA 3H7LA 5I73C 4QRUA 3FUFA 1CYXA 1T1WA 5J06A 1CTOA 4RMWA 3IE4A 1ECZA 3FTSA 2LTQC 1G9ML 3QHZH 3S96B 1IVLA 4LDEB 2OFQA 3ILEA 1JXJA 2C1OB 2Z1KA 3UL4A 4XBEL 4Z7NE 3CHRA 3MA7A 4R84A 1L9RA 2XLLA 1ACXA 3CH8A 3JV6A 1FCCA 4QLWA 4H0LC 1YLBB 1V7NH 3IPFA 4N1CA 4OZHB 2YGVA 4P5KA 4P4KB 5K93A 5T5FH 5T1KD 3NCXA 4ZDHA 1PSKL 4KVNH 1UA7A 4FA6A 3GM8A 4PEEA 3STZA 5JPNC 2WLKA 2Y9RT 1NKRA 2Z4QA 4M1GH 2JELL 1F97A 2HB0A 2WANA 4DK3A 4BV1A 2ZNWA 4X7EC 2QKIC 1LXMA 3CX5K 1T66D 1U8QA 3D39B 4JGNA 4M8QB 3FZUD 4ZUSB 3FL7A 2EH8L 2X6BA 3WTWA 1GGBH 2YQ2A 2JKXA 4TL4A 4ELDA 3L3HB 4OCWL 2XQBL 1J5DA 1KJ3H 3ARZA 3E8UH 4YSPA 4JRXA 3QC6X 4PAZA 1T83A 3ROLA 4AGLA 3K6SB 1VPOL 3LXCA 3OR6B 3BMVA 3BWUC 4QNPF 4YAQB 5E2VH 3ZLQC 1PZSA 5GRWA 1XR9A 1E9QA 3FCTA 1GJUA 2DTSA 3TIDB 1D7FA 1H3UA 4LIQH 4MCYA 1YJDH 2F1BA 4GSXA 3OF6D 1AQDB 1NBZA 1PPIA 1M7IA 3F58L 3BDYH 3CHOA 3HZ3A 4MXWL 4N0CC 2DJSA 1IB5A 4OUUB 4S1SL 2N0KA 1CCZA 4WAFA 1QEWA 1CD0A 4JN2A 5HDOA 2DWDB 3D4CA 3FO2A 2RCSH 4NI3A 1ZJBA 4JL1A 1SVBA 3HI1A 1J8HE 3SBWC 2CIIB 2EJ1A 2I7OA 2NR6D 2Z8RA 4N2NA 3QFJD 4FQQB 2CIKA 2YRBA 3GBNH 3MMEA 1Z1WA 3BCFA 3BRFA 1UXWA 1HXMA 4Q14A 2PN5A 2GK2A 3GJFB 3SD5A 1TF4A 1WCBB 5TPWH 1S9KC 4X4ZA 4M8RA 1BQHB 1UM6L 3HBQA 2EIDA 3K0YA 2OMVA 4DP9X 1GS6X 4I1PA 2IBZY 3HPJA 4BUQA 4CNIB 1CD1B 4MD4A 3WLWD 4GH7B 3LXBA 5HHNA 4C4BA 4TNVF 5BRZB 1H9DA 1RK1B 2LLNA 5I1KH 2E59A 2EEAA 5T3ZL 2QHLA 4DP2X 3QI9C 1AE6H 4HWZB 1I8MA 4J4PC 1QRNE 3QDGE 2VXSH 4JO3H 2VLJD 3HE6D 1G7HA 3UYOD 3EOTL 3K6OA 3U30B 2X28A 1Z5LB 2J2ZB 1QI5A 2JB6B 3GSUB 2GJ6B 1REIA 2NYYD 5IMKB 3HMXL 2WUBL 3LN4B 1AGEA 4EZMA 5JR1H 4QNPE 2P8MB 4IGBB 2WSKA 1VIWA 5CJBA 1AAJA 3BO8A 2MHAA 1HINH 1M4KA 1R5VB 2JQZA 4NO5B 4FXKA 1I1YA 1HQRB 1LWJA 1HK6A 2JJWA 5I71B 4J3BA 1P4IL 3QJRB 2DWXA 5CLXA 4Z6AT 4X2UA 3LZLA 4QXVA 3VXSD 1I9JH 5HHVH 1BV8A 5CJXA 1JZ5A 2FX8L 4S0TD 4ZPVA 5GRUL 1YRKA 2ICWJ 1I1AD 1N3NB 1O9WA 2XVBA 4M7KL 1SF3A 3JXAA 1G7IA 4HFWB 2IPUK 4UT9H 1WYJA 3MACL 2QL1A 3IU4L 4U1JA 4ODWB 3THMH 1HC1A 3WY4A 1KCVL 5SWZA 3SY0B 5D7KE 2EO9A 3A4AA 4Q0XH 5MERA 1W72L 2HRPL 3I3EA 3MSPA 1H8SA 2WWKO 2HN7A 1T7XA 4WFHD 4KO5A 4DUWA 1KWKA 4IOSA 1CICB 4EDWL 1CFBA 3DX7B 4Z5RA 2XIBA 4A6YH 3QR1A 3MRNA 4O02L 4GG6E 5JMRA 3WTVA 4KKAC 1V3LA 4XMPH 2J57A 5FUZH 4LOVA 3FB7B 4JFFD 4J39A 4GRLC 5F9DC 3CU1A 3FPYA 4P4KA 1AR1B 1V7ML 1TR7A 1XT5A 3CVHH 1EO8H 2NY6C 3REVB 2ZWLT 3X1FA 2YBRA 1A7OL 4MJIB 3SGDH 3V52L 4I18A 3FFDA 4EUPG 3WDJA 3FPXA 5KWYC 3FN3A 5TE7H 1BEXA 4FXLA 4X8JA 1CS6A 2P5EE 4JY5H 2P49B 3NZ8B 1T22A 2YOAA 4JQVA 3O4LD 3SB3A 1HZKA 4LQFL 2H5UA 4PWEA 1EAJA 3VDCA 5HDQL 1ID5I 1FO0B 2YPVL 3D06A 5H35B 4PGEA 3HHSA 4ODSH 4L8DA 1NDTA 5KVMC 3VFVA 2M1KA 2QQKH 2XYBA 4FL4B 2EDHA 1KPVA 2CLRB 5E5MA 5HGAB 1JBJA 1NIEA 2WUCL 4IQHA 4PUBH 4F58L 5JO5A 2IPUG 4F7TA 2ITFA 3INOA 4OBRA 3KBEA 4Z7VF 2EIBA 5JPMB 3BVUA 5J3HC 2H6PB 3QULB 3PWLB 4JM2F 1R3IL 3CFCL 3EZJB 5EO1B 2Q8AL 5DT1L 3WIHA 4B50A 3QCTH 3WTXA 2MTPA 3BSZA 5I74C 1L7IH 1R75A 2WXRA 1Q0YH 4FGMA 4J8QA 3TX4A 3UTPD 1NLBL 4WZ9A 3QO0B 4LO9A 3V4LA 3GSNA 2J1KA 4U4IA 1PD1A 3E9TA 2R39A 1F8TL 2E6JA 5L8LB 2YKLH 2F19L 5CSGA 3SDDD 5A2KH 4CJ1A 4YBLB 3FSZA 5B39A 1WIUA 1QG3A 1EVTC 3Q2LA 1JFHA 1AC6A 4IEFA 4LAQH 4NQXB 5I0XA 4WWKC 1T5XA 3B2XA 5AG8A 3SDYL 2GFBB 2YFOA 3GMNA 5C09B 3UO1L 3VU2A 1FFNB 2WLLA 3KR3H 3U1PA 1WFIA 5EOCJ 4P5RA 2E47A 1ILUA 2A6JB 2XWBB 1ZT1B 5F6HJ 5J6GA 4YZFF 5DWUH 2WVSA 2J8UF 4LVHC 4P9ML 5GRZA 4PJAB 3R06A 4LAQL 1ZLDA 3KL5A 4XZ4A 3WCYA 1FH5L 1JYNA 1UJ3B 1FNSL 1U3HD 1Z32X 4RDQG 4XWOC 5C6WH 3LN4A 5CEZD 5FGCE 1FVDB 3MCG1 3MR9A 4PJBA 4K7PY 3WKYA 2Y1ZA 4LESA 2IIJA 3BXNB 4HMDA 1WFOA 3UZEA 2XIDA 2IAMA 2MOQA 4ALAL 1NFDB 1LD9B 1OWWA 1PD6A 1E5YA 3P4NB 4YXKL 2MSPA 2VXQL 4WENB 2ZCKH 5C97A 2XV6B 1CD9B 4UT7L 3B2DC 2VR3A 3UBXA 1P6WA 3VW3H 4NFCA 3UJIH 1KB5A 4JRYE 2FVNA 1RIUH 5I6OA 3OG4B 2V7NA 5KG9B 5E4IA 3U9PH 2BJML 4UDUA 3DROA 3RDTA 2J1WA 1NGWA 2JK5B 5HVWA 1D5ZB 1GW0A 1HHJA 2BW4A 2XG5B 1MUJB 3BUTA 4Z95H 3H9ZA 2XVLA 3PHOB 3WE6B 1U95B 5D1XB 3BIKA 3SJVB 3EADA 3L16A 5I8CB 1URIA 5HDQH 2F7OA 3PJSA 3FTXA 4GBXC 4IRJC 3QPQD 2Z91A 1JF1A 3US9A 4NQSB 1EUTA 3CVCA 5DC9B 5TTRA 3QNFA 1A4KB 3QJHB 4NO3B 5FK9B 2AS5M 4XPGH 3J8F7 4KU1A 5IW3A 2VR7A 2CJUL 4F9LA 2NSXA 3WS3A 1F1GA 4ONFH 5A40E 3B2MA 4YDVB 2HFEB 3LVTA 5JHAA 3CVDA 4XAWH 2QTEA 3JQOB 3PREA 3L6FB 2CRMA 4LNRB 4N8VA 5TFSH 3VH8A 5DJCA 3F3HA 1J5IA 3VI4E 5DWPA 3CVHL 4OF8A 4Q6YA 3TP4A 3CN3A 4Y5VC 3PXLA 1HWGB 2H8PA 2CLVB 3BIAX 1IQWH 3O6FD 5KOMC 3T6XA 3SGJC 3IGLA 4YIQB 4PGEB 4UDUB 1JWUA 3OC8A 4YS4A 1JK9B 1A6WL 3VO0A 1F90L 2DM2A 1C5DA 3K72A 1W8NA 3HE7C 1AIFA 3WHXA 5LKNA 1DQTA 2XA8L 3K74B 4ABWA 2NQCA 3DTDA 3CX2A 1XSKA 1AIFB 1L0QA 2I9LB 5DZOA 3NJLA 1ZVSB 3NACH 2DD8L 1HL9A 1USQA 3MACH 4LKCA 2F8XC 3MRRB 4OKVB 2X7LA 4G1EA 3X3GH 4G8EA 5KYUB 3VYNA 1UM5L 2ODHA 5EZIH 4M6AA 3UCQA 4CDHA 1SEBA 5E2WH 2D3VA 4Z77A 2DYRB 5B39G 4KUCF 3ARFC 1C16B 1M6OA 2HPOA 4PJEF 4DZBA 3LNFA 4QR7A 2P52A 3OBAA 5C08B 5KVDH 3ULVD 4JFED 1MCPL 1V54B 4G43B 1E4XL 5AUMB 3RQ3A 3LKQB 4OLZL 3X13A 2VN7A 1N6QH 1OT1A 4FI7A 3T8MA 4XVTH 3L48A 5D70L 3R7QA 3MODH 2CK2A 3IB4A 4FDWA 1TPXB 3HEIB 2A9AA 1UB6B 3BIKB 1MAKA 3SJVA 2VLLA 1JHTA 3QZWB 3QUZA 4F8QA 4JFDD 2FYYB 4I0PC 5C7XH 2F18A 3BGAA 3K6DA 3V7MA 2BP0A 3FOLA 5SX5K 2YZ1A 1I85A 1UM6H 4NCC2 4ZO9A 1ROCA 1U8OB 4EIZC 2A73A 2F53E 3KPLA 4LEXL 3ZKQD 1DN0B 5SX4H 2WBKA 3CIQA 3KBHE 5IIEB 1Z9LA 3QZNA 4XC1H 1IBDA 1NIBA 4WUUB 2PCYA 4N85A 1PD0A 1QSFA 3ML8A 2R1XB 2G30A 3NSJA 3S3PA 3ZZLA 3P4NA 1WWWX 3KPOB 3KPMA 1DBAH 1A6AB 4NUGH 5IHHA 5LBSA 2FHCA 3GXFA 4O9HL 1IGCH 1UUNA 2CLRA 2WTOA 3GDBA 3ORJA 3FULA 4GBXD 5FYLD 3VWJC 5KEZA 2E7DA 4M48L 1B90A 1EBAA 5IGXL 2DTML 3ARDA 3QNZA 2IOIA 4PS7A 4F2MA 4E42B 2RD0A 4B0MB 4IMLB 3Q9PA 2Q5BA 2GAZB 1MLBA 4X98B 4KFZC 4ZZFA 2EYRA 3FB5A 3CCHB 2BOCA 1E30A 3C5JB 3N1PC 2WQVA 4JFOB 4PYGA 1I8KB 3UPCA 2HA1A 4JFUA 1KJ3L 4BDVB 1IKOP 3TT1H 4KZCA 4YSRA 5DSCA 4YHML 4JM0A 3RLSA 4MJIA 1R24A 3QEUA 4PJDF 3OJMB 2P44B 2Q6WB 32C2B 2RA1A 5D1QD 1OAYH 3ASWA 4X5WA 1I9RH 4XVSH 3F85A 4A66A 1S7QA 1TT6A 3DDFA 3FB7A 3NFSH 3KPTA 4D0DB 2DQTH 2ICCA 3LN5B 4L0PB 4PSPA 1BWWA 4QLRA 1U8JB 4G8IA 4UNIA 5LAXA 3UGUA 1HOCA 5L2KB 2R56H 3QEHA 2C7UB 4H8HA 2MCMA 4FCHA 1KXQE 1VA9A 3HS0A 1YHPA 1CFSA 2PR9A 3IDJA 4KXCA 3HPLA 4GKSA 3TJHD 4H8QA 3BP7A 4NQCE 4P2QB 3J27A 2R69H 2VW6A 1RI8A 2XKNA 5KYYA 3L9BA 4F15C 4I3RL 4KMTH 3I85A 3LRSA 5I17A 3QIBD 1XF2B 3EYUL 4XHJD 2EADA 4HK3N 4KK5C 1RXLA 5BZXA 4UIKL 2EYSA 3PJNA 3O3UN 5F1OB 3ELQA 4WUKL 5H37H 1T0OA 1T5KA 3RI5F 4ZD3L 1T6VN 3INUH 4AYFA 1WJ3A 1ZLWH 1NFDA 3NIFB 4UAOC 3FSWA 4RA0C 4V2CB 3HG4A 1NEZB 3MRQB 2G5BB 5JXED 1H6UA 2FO8A 1DJXA 4FNPA 2XWJB 5ISZE 2BFGA 3CK0L 5IV2A 1J1OL 5DJXA 1E3FA 3TJEH 3N0AA 4PRIA 2Y36L 2AK4B 4W6YB 4Z76B 3LY6A 1S5IH 2VZ1A 2D0HA 5DS1A 2DQHL 5AVZB 5DJ6B 5K9KB 3KXFE 2EXWC 1RUQL 3O41B 3U7WL 3LKPB 4MMXC 1TCMA 5ICXB 3F5WB 2D7TH 3SSGA 2X4OB 4Q2ZB 3TV3L 1FFOB 5DMJB 2PWFA 3ABGA 3WUWB 1D7CA 1P4LB 2D7QA 3QE5A 2AJ3B 1KN2H 1QKZL 5B4MC 5DJZA 2WO4A 2NCEA 4FFYA 3U0TB 5IFAH 2WQAA 1ND0B 5C0GA 1YNTB 3ETBF 1NBCA 4OT1H 2HH0L 4YDKL 1NQBA 2PXYD 5CJQL 2V17H 3EOBB 2PUQT 2V5TA 1A6UL 1A02N 43C9A 1HEZA 4EN3D 1SQMA 1KTLB 1ONQA 3BKMH 3DK0A 4W9ZA 4B7IA 3F7VA 1PLGH 3FUNA 1ZEAL 4WWNA 4A6YA 2B0SL 1HNGA 1Q9OA 2JIXB 3H8NA 2JKLA 3HNVH 3HZVB 4KRPB 4WWID 2VDNL 3E80A 2EDBA 5FYJE 5EOTB 5D9SA 4F8PA 5DFWH 5FHBH 3S88H 4I13B 3QFDB 1HHGA 1CXLA 3BP6A 2VOTA 4LSVH 4G9DB 4POZC 5JW5B 3DYMA 1LP9B 2NZ1A 3N1QC 2HFGL 2L7JA 2HRGA 4Z0BH 4D0DA 1AOZA 7FABL 3K6FA 3RIAF 5HDBB 5F9WB 3SDCA 5EEZA 2AQ1A 4AV4A 3VMNA 5IHLB 4NZ8A 4PVBA 1V3KA 3B7SA 4XNUL 4YIQA 1PL3A 4H8WL 1TCRA 2YN3A 3G04A 5C08E 3C60B 3VFUA 3FRPG 3MN8A 1S7TB 4LSQL 3RWIB 3T1WA 1EANA 1L6PA 5IHZA 3O3EA 1B4RA 3CFDB 4ZUUA 3SCMC 4ONGH 1E28B 3S35H 1OAJA 2BIQA 3O4OC 2PO6A 2WWOA 2VERN 3A4FA 4GI6A 5T3XL 3WSQL 1F4WL 2MPAH 2EXYD 4OTXH 1LWHA 4ZSOA 1XF3A 3C9NA 4FABH 2VZSA 2JIXA 3ARBA 3UTTD 3QDJA 1EMTL 3MV9A 3MPCA 3PNWB 3RPIA 5HPMB 4K7FA 1ORQB 2H45A 4L3EE 3MJ9H 4LCIH 1IE4A 4HKZB 5DF0A 2K7PA 1QTYT 2XYCA 1YMME 4WUUA 3KBPA 1QO3A 1SJEA 4HVBA 4G7VH 4KOBA 2NY0D 2EINB 1BD2D 4PTTB 2DTMH 4BK5C 1QASA 3EOBA 3HRZC 4NO0A 3IAGC 3RWDA 4YPJA 3BWUF 3MBEB 4UT6L 3GXUB 4O9HH 3ZE0F 4JRXE 1C5BH 5EA0L 4F3FA 4JB9L 1QNZH 3DJTA 4MA1C 2HRHA 4PB0L 4MAYB 2W5PA 3V55A 5GGVH 4G9FB 2A7BA 3P3RA 4V2BA 1YO4A 3QJFB 1QSED 2DMKA 2VLRB 1X5AA 1F4HA 3OGCA 2DWSA 3KWTA 1UEYA 1G7JB 3LH2H 4JM2B 3REWB 2CDGB 4D3CH 3EJSA 5D1ZC 1DTUA 3OB8A 3NA4A 4P59H 2VWEC 4MDJA 2RQ8A 4UV4H 4BINA 4GQZA 4D9LH 1NCBH 43CAA 4X6EA 4DGYH 1YUKB 3WHE0 3FZUC 3HAEB 5DJ8A 5GRYA 3N9GH 5FF6A 3MA9H 4N2LA 3WFBH 1TCRB 3G04B 1YPZF 3MLXL 4XVTL 3SZ6A 4JG0H 3MRQA 5C2UB 3IJHB 1NMBL 1WGOA 2G9KA 1QLFA 1N18A 2GJ6D 2D7NA 4OLZH 4UNTA 2VDPH 5F44A 1OCOB 1BBJA 4K3JH 3NFPB 3V6FB 4HKJB 4H0HB 2EVGA 4OM0H 3IPBA 3QQ3A 5HGBB 4QRQB 4C47A 1I53A 2OYKA 1DO5A 1W9XA 3HCVA 5C0AB 2CO1A 4JE0A 5KS9E 3LMJL 5EORL 2W88A 2PYFB 1T20A 4F9PA 1FUNA 4R4NC 1XSOA 4OFVA 2X4UB 5F1SA 3ROLB 4JR9H 1SDDA 1OPGL 2ICWA 3DSFH 2VDKL 3F05A 1TJXA 3QNYB 4U0RC 4KJPD 3WO4C 3TA3C 4U3SB 5IG7A 5LN8A 1PG7L 2HVKA 3U7AA 2JIXD 4I1NB 1XF2A 1A6VH 3OX8B 1OP9A 2J4WL 1NUDA 3ELAT 3FHQA 4JFQA 4K3GA 4WGVB 4LHUA 4ZFFB 3MRPB 1NCDL 5MENB 1J9QA 4NN6B 3MV9B 4PCSA 5EUOA 5FFGA 4OF0A 3ULVL 1OCWL 2OJ1A 4IKNA 2EO1A 5GZOD 4CC1A 2VLME 3RVXC 1VGEH 4OAWB 3UG4A 3HMXA 4ADJA 2FLRT 3CUPB 4X5WB 2APSA 3QB7C 3RVUC 1IAMA 2RFXA 3F12B 2PO6B 1SXZA 3ZDWA 5CBEB 2OMWB 3VGDA 3GGWB 2AK4E 3IDMA 5I5JA 2WLIA 1HKLL 4AT6B 1U8JA 5IQ7H 3G5ZB 3IM1A 3ULUC 1E3ZA 4AM0B 2RQEA 3ULSB 1YPZE 3M8OL 2P80D 3EGDB 4HSAC 5MI0B 4LRIA 3U7YL 5AL0A 5E56A 3AUWB 4WEEA 1HEJC 4GRMA 3QEGL 2JI3A 4NRZA 3ARGA 1MIEL 1TZOA 4UUJB 3ZBMA 3I3BA 4BFJA 2OMUA 4X6CA 7PAZA 4Q9QL 2OKMA 3LKPA 4YGVB 2RMNA 1I8KA 5DK3A 3CDFA 4XNZB 1UD3A 2PWGA 2VMDA 3QEQE 4AQ1B 3BP6B 3AS3A 4FERA 4IHOB 4P8QA 4J2XA 3HFML 4WQOA 3IK2A 1HILA 3DHMA 4WHTA 5E4EC 3L1OL 4N2FA 4JRFA 2FJUB 2DN7A 4OM0L 1WWAX 2A0LD 4ZUWB 4OB5H 4BGDA 1F4YH 3AUVA 43CAB 3D6GA 2O5YL 2D03H 1LHZA 3OPZL 3Q01A 5IBTL 1T66C 1TQWA 3N3EA 2QPUA 1GC1C 4LCCC 2UWEE 3SDAD 3VXUB 4CVWA 1NTDA 1KY6A 4M6MH 2NT0A 2VMFA 4KDWA 3ESOA 5A2FA 1KGCD 3VXNB 1RKRA 3H9HB 2YAQA 4X7SL 2R0LH 1FP5A 1FNAA 4JKLA 4FQ2L 4DOHB 5IK3A 1FNSH 3U0TA 5IHWA 1N7ML 5C0CA 1TQVA 3MBXH 5IFHH 4WV1B 5FYKH 3S2CA 2O6DA 5IW1A 3C8HA 5ITBH 5DWUL 2X6AA 5DJYB 4LAJH 3UABA 1NZRA 3HG2A 2KLTA 2N1TE 5DMGD 3LRKA 3AGWA 4NQTA 5EU5A 5ID0B 4PY8I 4XC3H 1N0LA 3VFPA 1QNZL 4IIQA 2ZXEB 4B3VA 3TPUA 5IJKC 5SV4A 1AO7E 4JKNA 2OCFD 2ZJSH 1KBGL 1O6VA 3BZ4B 1X4YA 1X5ZA 4F8TA 3EO0B 3JUZA 3O6FB 4UM9B 2DM3A 25C8H 4ELMB 3HLAA 1OP3H 1DN2A 3H1ZA 2YMOA 2YUZA 3EJCA 2H0JA 4Y8DC 1VHPA 4Z78B 5J0BA 1IEBB 2K6ZA 4HPOH 5J11C 4IMKC 3L3JA 3IGAA 3AS1A 2ZOTA 2YPLE 1NLBH 1ZCRA 5CBEA 1JXDA 1A6VL 3ARDB 2G4EA 4KRMB 4UV7H 4IRSD 2IFFL 1IQDA 3C2SA 4LARL 1PZCA 2R4SL 4PWFA 5DT1H 4UILL 5FO8B 3S8WA 1UYWL 2VLKB 4XP5H 2WMPA 1H3GA 4TULH 4JR9L 1E7UA 1I82A 1N6VA 1U3HC 4BH8B 1TITA 5CINL 3LMJH 3QT2A 3L2MA 1RZJC 1QUNB 3FN9A 2HFEA 5EHFA 4ZW8A 3FK3A 1SXAA 4K3EH 3RFZA 3D05A 4Z3GA 1XGRB 1KB3A 3U0WH 5K39A 4JRYA 1IGTA 1H5BB 3LV3A 4LSQH 3QZBA 4UM8A 2A2QT 3PGCA 3JWOH 1S7SA 5DMKB 3BUPA 2N56A 3BSHA 1S9YB 2B7DT 1C12A 3FO0L 1BWMA 5B7MA 3VM7A 3SE9H 1DVFC 3FQTB 3Q3GA 5D4QA 2D4FA 3ABKB 3P9MB 1AZBA 1D5ZA 3EAKA 1MWAA 5E5UB 1JSYA 3ZX1A 3R18A 2AXGA 1JL8A 1F56A 3S4SB 4PJ5D 3BKJH 4JY4A 1YEEH 2ATKA 2BNQA 4AKQA 1MRCH 1R24B 3U46B 1E7VA 3NCBB 5FAAA 4YXLH 2Q1EA 4DFHA 2DW5A 1DBJH 1KJ2A 4KROB 4XGZA 1NBYB 3E6FB 2HRPH 1NEUA 4LLMA 4KX7A 2HT3D 4Y4FC 3V0VB 2VR6A 1C16A 2R1YB 3MJ8B 4XH2A 4QOKE 5IROD 3MOQA 1ZS2A 1RHFA 3V9CA 1J9RA 2J1XA 4BFEA 4YMPA 3G6DL 4OQTH 4YPGA 1SOSA 5KVEE 2IFGA 4TQPA 4KTEL 5D72H 1DQJB 4OT1L 3KLHC 2EDMA 4K23L 4KVPA 4MB1A 5J9PB 3HC3L 1FGNL 5IVOA 5CBAA 3RTQD 3FT2B 1BVLA 1Q0XL 4U1IA 4MMXA 5FA3B 5EOQH 4PRBB 1XIWC 5IQMA 4WTXA 4H40A 1MCOH 2ITEA 4D9RD 3DX1A 5CS7A 3CDZA 3GMQA 4L1SA 1FF5A 2Y5QA 5KVGH 2IG2L 2VKWA 2HT2D 3OJ2C 4YWGL 3FOLB 4PRAA 1OGPA 1OPOA 3OLDA 4MLIA 2GSIB 3RUGA 1EGJL 1LE5B 1N6UA 3VB8A 4HUMB 1OTUC 2WZAA 3F01A 3NOIA 3R4DA 4WCYL 4XXCA 4FABL 4MLSA 4FQXB 1P53A 3GNMH 2OK0H 2KLRA 1KB5H 4TSCH 4XMWA 5LNEA 4TSAL 4WJ5B 1WWBX 1T03H 3RWEB 1SEQL 2Y36H 4GKLA 4QXTA 2WXMA 5DMKA 5AOKA 2H3NB 4DVBB 2H1PL 5ITFA 5DRWA 4LBAA 4A38A 3TA3D 1SY6H 3HA0A 4Y5XA 2A74B 4L4VB 4K8RH 3X3FL 3RVWC 3BEVA 5BW7C 4YZFE 2UZYB 3M1BB 3RDJA 4WSKA 3SQBB 5EIIA 4N68A 3OLEA 4QEGA 2HZHA 5F9OH 1FORL 1WS8A 4LLUB 4PJBF 1F4XH 4WW1A 4BQ6A 1BSIA 5J4MA 4FNRA 1AG6A 2FLMA 4JDVA 3SGJA 4WU5B 1PQZB 2W65B 1I3RA 3QIBB 4JFHD 2PYEA 2QGDA 4UM9D 2JK5A 3CC5A 2K45A 3WNIA 3TEYA 1MIML 1SOQA 1T20B 2ZUSA 2NW2A 4Y9BA 2VUOA 4BEIA 2YR3A 4MA8H 3EH3B 2ZTBA 3VTTA 5CM1A 3GMLB 4MAZA 4HWNA 4XP1H 4GKZB 3S2AA 4YSEA 4BD4A 3DMMA 1S7UB 4L29B 4X9IA 4XBMA 4GUQA 1A3LL 4S1QH 1IAKB 3ES6B 1XDTT 2I5YH 1S7QB 3MCKA 3WY3A 3IJ9A 4LCWD 4KKPA 1RJLB 3ZSSA 4HIIB 1G7PA 3QUYB 1U3NA 5CN2A 4CVZA 4R8WH 1DEEB 3H9SA 3QIWC 2NXZC 5C86A 2X4NB 1XGQA 2DQTL 2ZUTA 3A47A 1LVEA 4W4NA 4P04A 3SPVB 2K6YA 2OMWA 1BPVA 2EVHA 4E42A 1I31A 2XJKA 3TN0C 3NMEA 1WHOA 4U1NB 3DX9A 1C5CL 4CU8A 4G42B 4YWGH 3AY4C 4HHAB 2EVFA 1XAKA 1KIRB 2ICEB 4B27A 4M5TA 2TSBA 4C4KO 1BAFH 1U41A 4Y4HC 3MNVB 5KSAD 3RJDA 1KG0A 4JFXA 3UADA 5I76A 1GYVA 5H94A 1ND0A 4N0YL 1Y0LA 1UFGA 1Q0XH 1NDGB 2TSAA 4P2QD 1UCBL 1IM9A 3WE6A 1E3XA 1QSFB 4N25A 4QXGH 5K9OB 4JM4L 3LS4H 2FH6A 2LTQB 1IGCL 2VDPB 4JNXA 4GP4B 1E4KA 2YRZA 5FA4A 4DQOL 4MRCA 5EF1A 2NUPA 2QGCA 5F7EL 3L5XH 2A73B 4FKKA 2LR4A 3OXSB 2H0FA 2ZWKA 3EFFB 4Y5YB 4IBWA 4LVNB 1TJMA 4JDEB 4HBQA 4YHZH 4JG1L 4JQIL 4U33A 2WXKA 4Y2DB 5FO2A 1OP5K 2XTJD 3CFJB 2I32A 1AGFB 4ODVL 1R5WA 3M17B 5FA3A 2BVYA 2ZQKA 4GW4B 4PVMA 1BBJB 5C0EB 1WCQA 4OF7A 5CUSL 4QWWD 3BH8B 4E41E 4J5VA 4P06A 1VAHA 1VSCA 3V4PA 5KANI 4CAGA 1AP2A 3PNWA 4PJIA 2HSIA 1S8DB 2KPWA 5IESH 1JPFA 2J2ZA 2QDWA 3VI3E 2AV1A 3S6CA 3RY4A 5A7EA 1EEZB 3QDJD 1YDPA 3K5RA 4IHOA 1TZIB 1BYOA 4KMTL 2IO5A 5I28A 1L7TH 5FHAH 3ISWA 3LPOA 1H6EA 4DEUA 4E9YA 2EYTA 4ZSOE 2PO6D 4UMGA 1S7TA 2AXHA 1TQBB 2VL5B 1U33A 4H8WC 3CLEH 1N8OE 4MZRA 4TUOA 2OMVB 4XPAL 4MB4A 4LHQB 1T0PB 2VTFA 3S3BB 1X7QB 2EIZB 1YA5A 5FYKD 5KBPA 2IPKA 2OSWA 9PCYA 5JOFA 2AEQL 1WV7T 1R3KB 3ZDZE 1AKPA 4AXWB 3Q05A 3PE9A 3WMQA 2NZ9D 2PP8A 3DSNA 3TO2A 1B88A 5T33L 2WLIB 1CIUA 1HEHC 1KENH 4HSQA 1FIEA 2HUHA 3ZKXC 3HS0C 4W9EC 1OAYL 4ZK8A 3O2DH 1E9QB 4C58B 3MFFB 5FYJD 4CVXA 4RGOH 4U1MA 2R4SH 1Z7JA 3V0FA 1RJYA 1ZD6A 2IFFH 4J1UA 4YHLH 3IRCA 4OLYH 1QLEH 3B5HA 4HKBA 3FN0L 1S7RB 5C3TA 1SFDA 2VZVA 3NJMA 1PEZA 5L2KE 5C0JB 4P57B 1PY0A 2GTWB 1KXTB 3FONB 4Z7AA 2BOLA 4H20H 1R1CA 3VRJB 2HVKB 1I3GL 2X3AA 2Q6WA 3VJ6B 1SBSL 5KSVB 3T3MB 3OMIB 1DBMH 1OTTD 4HWBL 3K0WA 3U30C 1BQLH 1P0SE 2B14A 2MOGA 2WXGA 3DMMC 1A5FH 4QMEA 5KW9H 5IT2L 1SYVB 4GIAA 1I1RA 1S9VB 4WKZB 2IPTH 5T8IA 4B3EA 1DBAL 3JVGA 3SKMA 3CSFA 3VXSB 4AW4A 3FUIA 1YNTA 1G4RA 4FJ6A 4XVJH 5I8KH 1X5XA 1F3JA 4LCWB 4AE1A 5I71C 1PG7W 4JDTL 5HDBE 2R23B 3CDGA 3LQMA 3KH3A 4NX0A 3TCLB 4R7LA 3QG6A 2VDLL 4QHNB 5ITBL 5CZVL 4GG6A 4LEXH 3DROB 3U2IA 1FQ9C 1HCVA 5DYOA 2ODIA 1A14H 3KLAA 1DE4B 3HNTH 2V5MA 2C1PA 2Y7SA 4LPWA 3HZYB 5E9NA 3F65A 3OG6B 4YL9A 3QJUB 1WK0A 1T2XA 1TYJA 1OAXH 2FK9A 4OFPA 4YHKH 4LEEA 3PWJA 2ETWA 3U9PL 3NN8A 4Y19B 5M95B 3QCUH 1GJWA 2LHAA 3CPLB 5IMMB 5TF1L 2GI0A 4KI5C 2GJZB 5C92A 2PP7A 3KM1A 3VI3B 3OGOE 5FECB 2VDQH 1JMZA 1H6TA 3MRCB 4BWUA 5KN5A 1R3LB 3V0VA 3VXSA 1MY5A 4HYTB 4NNXA 3NBNA 4UTBL 2CR6A 2AAVA 4NN5B 4R7DB 3S3SA 4MAYA 3SYPA 2DQFA 4OV6F 1VB9A 4R2GD 4RGND 1KTKE 4NPYB 1ZLSH 3MRKB 5JMOC 5IUCA 1BFOA 1EHNA 1AJ7L 1LEIB 5JQ6H 3D50A 3RVWD 4DP4X 3LH9A 2HPTA 3P3YA 1MIEH 2XKNB 5D2LA 2WLJA 3QUXD 5IB3B 5PAZA 4C55A 2X9XA 1DDHB 3JYBA 1UB5B 3C9NB 3S34L 4CMHB 3V9FA 4FQLL 3IN2A 2FD6H 4G6KH 5MEND 2WQSA 4HT1H 2A77H 1H0DB 2AABH 5GJSH 1Y0LB 4KH9A 5ALCL 4N5EC 5B8CC 4F5CE 3GRWA 5IQ7L 2C3GA 5J12B 4Y2LA 5C3IA 1NGYB 2DBJA 4WNQB 5AWNL 2B20A 5BOPA 1IQWL 4K9JA 2BSRB 2QMKA 4RSYA 5TF0A 2DI8A 3EFDH 3FU7A 5F0MB 2CNYA 4L3CA 4QRRA 2BVPA 5TFSL 2R2BB 2XXFA 2FT7A 1UXWB 1KBKA 5E8PB 1AY1H 1LMKA 5DJXB 4ZFZA 1OSPH 3ULSA 2CJUH 2OTWA 5HHPA 2OXGB 4G7QB 4XPGL 3WAJA 3KLHD 4N26A 4UWQB 1T21A 4PRDA 3GTTA 4TUKH 1MLBB 2GK0A 5DJ0B 3H0TA 3ZMEA 5KSBA 4RGNC 2H32A 1NH6A 3PV7A 1UEMA 5D2LF 5E8OA 3MFGB 2DKSA 4NS0A 1A2YA 4N8PA 3LTVA 4HUUB 1KT2A 4R26H 1U58A 2Q86A 1TIUA 4Z7NF 3IFOA 3GEFA 2CM6A 4PGCA 4WDIA 3EGXA 5EO9A 1BQSA 1JIBA 4GBXA 4K3JL 3QAZC 5MHSE 3DOSB 4K5MA 3PGFL 4NT6A 4H1LA 4DN4L 1AZUA 1KPUA 3L1FA 3P77B 1JOIA 4WO4B 5L0QB 2J8OA 2JKIS 1ZGLB 2RHEA 3FQRA 3WEXB 3L3HA 1NCOA 4KZ0A 1FHNA 3RDTC 1EO8L 1ETZA 1ZTMA 2AJSH 5ESVB 2HWZH 2EVIA 4OI8A 4PRHD 3SGDI 1WD8A 2IF7A 1PMYA 3VFMB 4B6ZA 4MNQE 3LH2L 1KZYA 2AJXH 3GZKA 4R7DA 1IMHC 2EIKB 4XX1G 1RVFL 2R2HA 3KYOA 4Z7QB 1GPOL 1JNHB 3FSAA 3TBTA 4PY8J 32C2A 1Z9SB 4F1ZA 4ODTH 4HC1A 2VZ3A 2MNUA 3NZHL 4HD5A 3SJVD 3C8KB 3AW5A 3M45A 3WN5C 1KCVH 2CUHA 2GJRA 2EKJA 3AQDA 3F64A 3V4VH 3BT2L 2C4FT 4WGKA 4DZ8A 5HHQB 3NN8B 3AQYA 5JQ6L 4HMEA 4ORZC 2MCAA 1U93B 4GFTB 3VVWA 3MV7A 1L4IA 1NAKL 3X14B 4WTZA 3S5LG 3CZFB 2YKLL 2WWMC 1UACH 3MHZA 1I75A 1HVXA 1DVSA 4PJIB 2CMRL 2WBXA 2AC0A 1ADQL 3G5VA 3MO1A 4ORGA 1M3JA 2LOEA 5DDHA 2ZUYA 4FMVA 4U05A 3SD2A 3T0ED 4OM1L 3ARSA 3FH5A 3BSGA 4IGBD 5J1AA 1YQVH 1Q0YL 1EA9C 1P7QD 4TXVB 1MJ8L 4YGVA 5CN1A 3RUGF 3UROR 2QQNH 1O9VA 5HHXH 3MLPA 4HX1A 4NDMA 1QR1B 4ZW7A 1PAMA 3OAWA 2NZ9C 2WKLA 5EBWA 4HQQH 3LB6D 4M93C 1YEDB 3D0VA 4U1GC 3BQUD 5E9DD 1SJEB 5KYWA 2ZUQB 4ZFGL 2EE9A 5DD3H 3AREC 1UA6H 2Z93A 2ZYIA 1J0KA 3DOSA 1RUKH 4TLUA 3QO1B 3RZWA 2BNRD 2C3XA 4U3XA 4B0MM 1KXVA 5T3ZE 3KLKA 4G7RB 4FTVE 3RGHA 5DHYA 1A3ZA 1XQ4A 4FXGB 3OAYH 1QHPA 3TO4D 4A7VA 4DK5A 1E5BA 2C3HA 3QUMA 3GBNL 3GMRB 4L4VA 5TE7L 5FO7A 5IEHA 1QABA 2BSCA 1RJYB 1OKEA 1JZDC 4KVCL 3DX8B 4UBDD 2RCSL 5FDWA 4QKXB 1J05A 1JV5A 3KPSD 5IVNA 4OLVL 1IIIA 1U95A 1WT5C 4GUPB 3OMAB 6PCYA 5FUZL 2WZPA 2V9UA 5I23A 1UXMA 2JWYA 5L2JB 1VKXB 1TU2A 4HWBH 1JG9A 3CHQA 2H26B 3GSWA 4FTVB 1NGWB 1U8IB 2NX5A 3N41B 5DHVA 1I3GH 1NM9A 1TJGL 4JPKH 2X7LB 2G75A 3NPSC 5E4AA 1RZ8B 1T5WA 2UV3A 3L5JA 3M6DA 3MLWH 1A66A 4NM8L 4DAGH 5IVZB 3VXMA 3QRLA 1PLGL 3ARUA 1MF2H 2B9BA 1M05B 2X88A 3O6ML 3RDTD 2P42B 5E2TH 4LEOB 1USZA 1NGYA 2OCCB 3C5JA 3OSKA 4JFOA 3CDYA 4IRSB 4ETYA 1BZEA 1ZA3B 2A6KA 1E50A 1XGPB 3FF8A 1DVFA 4ALAC 2E7LC 4FA8A 3HN3A 4W4OA 2D0GA 3IF1B 4M7KH 4MBOA 3QH3B 1TQCC 4HW6A 2AV7B 1BM3L 5ID1A 1S78C 2GVYA 2IAMD 1CI3M 2I9TA 1BXVA 2WINA 2CBMA 4M62H 5C0BE 4XHJC 4QD2E 1BG1A 1H3VA 1E2ZA 1QLRA 1V7NL 4YO0B 1HINL 2CA3A 5T5FL 2IV9A 2JVUA 5GGRB 4AK2A 4OW6A 5CMAB 5AVWB 4EIGB 3IGKA 2WK2A 1EDYA 3MNDA 1CTNA 4X5RA 5AVQB 4ESKA 4WI6A 4JRWA 3PDOB 4FKEA 1QWNA 4F24A 1JJUA 3OKLB 2A9MH 1Y6NR 2VXSL 4JO3L 4L1LA 2J21A 4LB8A 1RZPA 1OT4A 3QPXL 4WJ5A 3ZDYE 1RUQH 2O5ZL 5K9JL 2AITA 5HYSB 1YC7A 3O3DA 4Y16C 4FQXA 4J8RA 5LXGH 3N5AA 2K9UA 2ZF8A 4FNLL 3PUCA 2J6WA 1J11A 2W0FB 3I84A 4G43A 5INDA 3VI4B 3HE7D 4NQCA 4Z18A 3NGBC 1HDMB 2WLHA 1A7PL 1HI6A 5JDJA 2ZOOA 5BVPL 2DI7A 5CO1A 4DP1X 2EKSB 3P1VA 3D39D 3KXFD 2QGBA 5F1IB 3FT2A 1CE1H 1G6RL 3DX9B 4NIKB 5DCCA 5F89B 1CDUA 1LEKA 1N10A 4HF5L 4KO7A 3QYNA 1D9KA 3STLB 5I1GH 5K5YA 4NZDA 5SWQA 3OKNB 1CFTB 3OKOA 4P2RB 4KZDH 3L4VA 1BQ5A 2YAOA 1LK2B 1C5DB 1VFAA 3K72B 4BSWB 5HYJB 4Y16A 4EQ3A 2JXMB 4PRHE 1MI5B 1SQ2N 2NY2D 3R06B 2WLYA 1TSRA 1WSST 3ZE1B 3SO3B 1P4BH 1EBPA 1R3HA 5HVHB 5F0PB 3IVKB 3Q43A 1SJHB 4XWGL 1JYWA 5HI3C 1U91B 3S5YA 4PHXA 2X4QA 4I87A 2E9IA 2Z9TA 3QRGH 4Y16D 5I0YA 2EXTA 3EYQC 2NOYA 3B9KA 3B3BA 3G5YA 3QQXA 3B83A 1DLHA 4KK9C 1QEXA 2G60H 2R4RL 1I4FA 4LSTH 4K94L 2R4RH 1BP3B 2KHAA 5F7DB 2JELH 3BP7B 4PV8A 1AO7D 4PJGE 2PXYC 4RGMC 4JDVB 5L8KB 1INQA 4LSRL 2VITA 4JFFA 3FYIB 1A4AA 2QSQA 3VXRA 4Q9CA 4M9PA 1G1YA 2VITB 1CB4A 5KTEH 2HN7B 3SO5A 1XXFC 3O9WD 3DIDA 4TUJA 5B38A 4FZ8L 1HYSD 1XL6A 3VX0A 4CSZA 1J5OH 1KBWA 1UM4H 4Y19D 4NT6B 2GABA 2Q76B 1CPUA 4JAMA 3WMPA 1PGRB 1QSVA 2NY0C 3Q2NA 5E1GA 4Y0GA 3ARFD 2Q2LA 2VWEE 1MOEA 4LRIC 2VDLB 1E2VA 1DQIA 2E8YA 4X4XA 2XJLA 4Y7MA 3T6WA 4FI8A 2NX5E 2P8PA 3EJPA 1G6RH 3BZDA 4GW1A 2B8OT 3O9WC 5AW3B 5EU6B 2F58H 4AL8C 2VH5L 3QXUA 2O5XL 2HKFH 3MREB 2X4PB 4P99A 4QF1B 2PKDA 5H4YA 5C0AA 5KN5B 2R27A 3W9DA 1TTUA 2X2YA 2DQJH 4MDRA 1ZLUH 5FO9B 3CMOH 1JK8B 4G80A 4LE8A 1LE9A 2OTWB 2MCPL 3VD3A 2LAAA 5IQNA 1D9KB 3QDGD 4Q6IC 2O61B 2E8ZA 3Q06A 5DD5H 3BC9A 4MD5A 1D2OA 3BUDA 4JFTA 3ESMA 4TSAH 5F88A 1ETA1 2EICA 2H4EA 4LSUH 1P5VA 3O2VL 1P5UA 3GHEL 1AQKH 4GG6F 4R7NA 4X6BB 1DVFD 2RAMA 2DY2A 2OZNA 2EXYC 3VA6A 3X1BA 4ADIA 1JGDA 3JTSA 2YWZA 3OQRA 3GJFH 4GAFB 5GRJH 1KLGA 2EDJA 1SJMA 1HXMB 2HJFB 4FADA 1FLRH 3QJVB 4OFYA 5FA4B 2ZAGA 3ISRA 5KSAB 4WIQA 1NAML 3ESUF 3RI5K 4X4XB 4N4YB 5EOQL 5AW4B 4KFMA 2NX5D 3KZ8A 3T2OA 3HI1B 4U1HA 4DH2A 3D69A 4U1JB 4XVOA 5D8JL 4FQIL 4GNKB 5KYXA 2CWRA 1SDAB 4KUZH 4KY1L 4RIRA 4ACPA 2ATPA 2DQIH 2ERJB 3TWCL 3OJDB 1PKQA 1MWAB 3V6ZA 3TYGL 4N2AA 1GC1L 4P2OC 4L3ED 3IMVA 1A3RL 3SCMB 5BMFL 4FQ1H 2WYIA 3EH5B 3FU5A 4MA3A 5CMAA 3VXQB 3FCTB 1WFTA 5BO0D 3KPRB 1T0NA 3IFLL 4R9HA 1SXSA 1DVYA 3TO4A 4L9LA 4G6ML 3ZJAA 1YYLH 2BCKB 4RMVA 5I1LA 4XODA 5E23A 4HMCA 4N5ED 4P5TB 1OGTA 1GGIL 3EZ8A 4KK9D 4YXLL 4E9VA 2BNRA 3DTUB 3UTPE 4BZ1H 2DLFL 1AFVL 2B5IC 1YMMB 2E74C 4U1KB 2ZX5A 4DGIL 4EI5B 1JZ8A 4JRXD 2YSSB 5IBUB 3BKJL 3BQUA 2IDCA 2QPDB 3FT3A 4WTWA 3TZVC 3L3OB 2X4QB 3RKDD 3C5ZD 1MI5D 2W07B 3PL6C 4OLVH 1NGPL 3KHQA 5SWSB 4EN2A 3EFOB 3HG1E 3V6FA 5LCVL 1DJGA 5ANHA 1R3KA 4OFIA 4FD0A 3HRZB 1RV6X 3KJ4C 1OARH 4KNSA 4PR5A 4BE6A 3WDHA 3RRQA 3PS6A 2OAAA 1WISA 3I50H 4L3FA 3ZDZB 2B4CC 2YS4A 3DVGB 4Z9KB 1Y1DA 2RALA 5DS8B 5TDOB 1AXTH 3DV4A 3IDXL 3CCHA 2VSDA 1QSEB 1UFUA 3CSTA 1UWEH 2OI9B 4N24A 3D2UD 3DUUB 1CU4L 4PWGA 5BRZE 5CEZL 3CN1A 2ZKHL 3JWNG 1F00I 4Y4HA 1WA2X 3TA4D 1R0AH 4MNQA 4Y4FD 4OD1H 1JPFB 3HB3C 1PIGA 2MNJB 3VSTA 1RIUL 4XE0A 3H9YA 4G6JL 4I2XE 3BESR 3RWEA 5BCAA 1TOXA 2VSKB 3MLZH 5IJVB 4UCFA 4ZPVB 4ZYKB 5C0IB 3BHBB 5AB9A 4GW4A 3ECQA 1S46A 3T65A 4KWUA 1J1XL 3GMMB 4YDJB 3U4BL 2D9QB 4NO2A 1GCYA 4ODWA 1FO0L 2VRAA 2VGLM 3QZOA 5D96B 1IM3D 5CILL 2G0LA 4HG4K 4YSTA 4DPRA 1PCSA 3IBEA 2CQVA 1FH5H 4P5MB 4UBDC 5AYUH 4OF6A 3D4YA 5FW7A 1TETH 3P2TA 3W39A 3AMLA 2J8HA 3IKCB 4TSBH 4ZUTA 4J27A 1EUUA 2ADIB 2QADC 2PPCA 2A4EA 5KSBF 1VESA 3NZSA 4HWZA 1I8MB 5I76B 2ESVD 2AQPA 1RQ5A 2Z31A 1DZ0A 4APXB 2FATL 3PWVA 5FKPA 3QWQB 1AH1A 1U8HA 4H0GA 1TZIA 4X7SH 4D7PA 3VXTB 3IDYC 4L3AA 5GZOC 2GC7C 2QHRH 3PGDB 3MV8A 2QT6A 4YHIA 2Y7NA 3M1CA 3K4AA 3VD5A 1COBA 4IRZA 2JQMA 3C60A 3FSVA 5GSRA 2XZAL 3RWCB 4OZHE 4CVZB 2KDGA 1CDBA 3KDPB 5I5MA 2IDFA 3MOAH 1BF8A 3PGFH 2G2NA 3EJYC 2C9XA 3N41F 4XO3A 1VKXA 1LNUA 4QRRD 4PJIE 4TTDD 3V5HA 1VACB 2R23A 3CDGB 5AYUL 5EZOL 1FH2A 1EQWA 4GUPA 2Q10A 2CJ3A 4ZO7A 2IMNA 4PJ9D 1QRND 1G7LB 2WUCH 3FRUA 4PUBL 1HHGB 2E56A 4HZ1A 1RIVH 1KCUL 4HIHB 3MC0A 4LP8A 3OPUA 2WB7A 4G8GB 4R26L 4L3EB 3L9YA 2YPVH 1HNYA 2FWUA 4MQ7A 4DTGL 4JANB 5DJAB 4FNQA 2WAQA 3EXJA 4Q9QH 1J0ZA 2Y6SC 3H4HA 4FCAA 5MENA 4GQ9H 4L1TA 4PGZA 4NLAA 4DGWC 3OD3A 1GZQB 2DMHA 2AJVL 3QUXB 4TN9A 5B1JA 4MA7L 3RU8L 2Z7WA 2V2WB 4ZFOL 4GMSL 3QUXA 4RCAA 2NYYC 3CZUB 5BVJB 1F6LL 1O7VA 1F18A 4GEJA 4OD1L 4JRXB 1HEZB 4BHUI 1YEGL 3LN9A 3GXDA 3EBIA 2APWA 4BHUA 4NAJA 1GS8A 4NQVA 2XTJC 1A1OB 3VYPA 1MKFA 3N0PB 4TMPA 3SDAC 4KK8D 5EMYA 5GGTA 3P4OB 2VL4A 1D5XA 4AOFA 1U3YA 2PCFB 4GAAA 1SRDA 5K1NA 2AQ2A 3RUGB 1JYVA 2OMNA 3LXAA 1F42A 2VDMH 1W72H 1ED3B 1T7WA 3LEYH 4J28A 4QHUB 2PPDA 3B9KC 3G3LA 3WNMA 3ZQXA 1PG7H 1S5HA 3ETBJ 1ACCA 4XCCH 1JN6B 4FNSA 3KS0J 4NN7B 3ZDZF 4G59C 1RSYA 1GYAA 1IAKA 1Z3GL 2VDKH 2R69A 1MWOA 1Q90A 1UOVA 5CNHA 3T04D 5EU5B 4FQPA 2PPAA 1NC2A 5CEZE 4C83B 3WENA 3VXPB 4A2HA 1BCIA 4OH2A 5IVXF 2ZKYA 2O61A 4AENA 3IJEA 2OM5A 2IGTA 2C3VB 4KQ4L 1DANU 1K8DA 4AVJA 3KM2A 6FABL 4WK0B 4JFZL 1FL3A 2J8UE 1KCSL 3IFLH 3CXDL 4WW1B 1JZEA 4WO4D 2AJZB 3O6FC 1CO1A 3LCYA 4ANXA 2YD0A 2FL5A 3H7BB 3WIIL 4N2IA 3DJZA 1H19A 3TBSA 5GHWL 4EAEA 3GUTA 1AKJA 3ECVA 1F4AA 3NCJL 2Q3AA 1MRDH 5E6IC 5EU6E 2APTA 4UV4L 1EV2E 5CEXA 3K6NA 1VEPA 3ARDC 1C8QA 5D8JH 3DIVA 3TS8A 4NO0B 1AGEB 2WLZA 3SEPA 4NB7A 5C3LD 4OZFH 1GSKA 1FC2D 4L8CB 2ZG3A 4JFWA 1YUHB 2VDLH 4WHTB 3HNSH 4XO4A 1OSZA 3IYLW 3VXPA 5GS1C 4JHWL 4AC2A 3IFOB 1ZE3H 4QHLA 1RFDL 4JM2D 3E6HB 3II3A 1XD0A 2IDQA 3AY2A 1S3RA 5AVRB 5GSRB 2DPKA 3RWCA 3CIAA 1XTMA 4X6CB 3VG0H 5ABZA 4Q8BA 4MD4B 1H5BC 2FZ3A 4UQAA 5GRVL 2KPNA 4EIUA 1F5WA 4JFDE 4H8VA 4KGLA 1MCLA 5IZ7A 5JUEH 3JZYA 1U4FA 3GINA 2GSMB 4ZW6A 2EE2A 2PW1B 5E2JA 1JCVA 3QG6B 4LIQL 3AM8A 4GG6B 4R96A 1HTYA 2J8UB 4JX0A 3ZTCC 1IAIH 2IDTA 4CGUB 4Z3IA 4X4KA 3IU3B 3DXAA 5M94B 3WEOA 4AUJA 4G1EB 1GZHA 2VH5H 3QRFM 1MHCA 4ZMAT 3WD5L 3VD0A 2Q0ZX 2YARA 2GSGB 4LLMB 3QDME 2X05A 3HVNA 2J5LC 3MCKB 1U3ZA 5CIPH 3U79A 5EF3A 2WLMA 3AB0B 3R19A 2QVKA 3DXAD 3ET9F 4PBDA 2K7QA 2XWDA 3U4EA 2VXVL 4KKLC 5CJ5A 1CK0H 1KBVA 3L9RB 4PJEA 4M6NH 3BVNA 2UWEB 3AROA 4K55A 5DQDH 2OZ4A 5KYYB 1VLXA 4MZIA 4OIIL 5T1DH 1J5OL 4UB0L 5BXFB 3AM8C 4KHXL 4ZTEA 4EF3A 1VCAA 5IY5B 4OCYL 3AJ7A 4U1MB 1JPGB 2E7HA 3QZMA 4JBSA 2ENQA 1CC3A 3GRWH 3OKKB 4MA3B 4R2GC 5LWYL 3D12B 5E24E 3GXIA 3UBHA 4JHAH 4QYAA 4TNGA 4TVPL 1SFHA 2A6DA 3WXWL 3D48R 3HE6C 2AQRA 5IJBC 4MAUH 4ZDHB 3NH7L 1EZVX 2D2OA 3C87A 3BUBA 3JV6B 3S48A 1K8IB 3SDDB 1ACYH 3IGUA 1RUPL 3RY6A 4G5AA 3OKEB 5F3HA 1A4BA 1DL7H 3HNVL 1KYFA 1XZWA 4N22A 4WHDA 1N68A 5F9JB 1UH2A 1YEHL 2GJZA 2X89A 4G8GE 2NY1B 3VI3F 2QVFB 5KSAA 1N2RA 1IE5A 4F9PC 5HGHB 4M56A 2K8MA 1AKJD 3ZL2A 1IL1B 1QFHA 1R5VA 4IW4C 2B1HL 5E2UH 4DZBB 5KG9A 4YHZL 3IFNL 3NIDB 3PWPB 3EOYG 4FKHA 1JFQL 3W37A 3D4ZA 2YUVA 2GC4C 1PYWB 3AACA 2GUOB 1KTBA 5C71A 4OJFH 4OJFL 4UMSA 3T2NL 2IAMC 4OCLC 3KPNA 5DUBA 3NSDA 4J3OC 4L37A 4UQDA 1XH1A 4E68A 1W80A 4M9OA 3IFNH 4HWUA 1PTZA 4FFTA 1ODAA 3UZVA 2J3SA 4LEOA 1E4JA 2VDKB 1FVDA 4HCRA 4MQXC 1FDLH 1JZHA 2NY6D 3D18A 5SWZE 2OR8A 4L8SB 1UZ6E 1RZIB 5GGSY 3R1GL 4LOEA 3CSBA 4APQA 2MRYA 1MQKL 4XNXL 4GI8A 3V4UL 3FSOA 1ACYL 1TVDA 4HIEB 2QSTA 2NXYB 1CFNA 1GKOA 5AVXB 3WL9A 2NYZA 4HIPA 3LIZL 5FOBB 3WIHH 4XMZA 3RNQA 1PFOA 3ZL4H 3QISA 4Q97A 2VIRB 4R8WL 4GLRI 5D1XD 4QXUL 3IDNA 4AYID 3EYQD 5JORA 1YQ2A 5DTFB 5I1DB 3C5XA 3P9MA 2HTKC 4OCYH 1Z5HA 4PGDA 3TT3L 3B4NA 1TYEB 3F6LA 3WN6A 1UZ8B 3MV9E 3ZTJG 7TAAA 1XZ0B 3EGSB 3WIFA 2IANB 2MQGA 3W38A 1MZYA 4Z7QF 4TKWA 1TXKA 3NIDF 4OI7A 5I6NA 1X5JA 4X6FA 2ZCLL 3VM5A 3CGTA 1M71A 1T04A 5DJDA 1TZGL 4I2XB 4AQEB 2AMUA 2JTYA 1QUNA 5GISH 2UZPA 2BVQA 4K2UL 5FYKE 5D71H 4ZFQA 4P4KC 1YPZA 3ZTNH 3P9LA 2IDUA 5SWSA 4OCSL 2FWOB 4AEIH 4WWKD 1KGJA 4R4FL 1SXCA 2XFXB 1QRNA 2C9QA 4KXZH 4BJLA 4PJFA 4OZIE 3MGTB 5DDHB 1L0PA 3RBSA 2BK8A 2B08A 3FUDA 2DWEA 5D7LD 5IVXE 2H1PH 2WC7A 4V1DD 4WNJA