1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
molecule keywords AZURIN
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
2BP8A 3T6XA 3QJVB 1HAUA 1V10A 4A2DA 4YVNA 2VN3A 2HLEB 4AKPA 3NP4A 1XB6A 1NWPA 3ERXA 2HRGA 4BXSV 3FYIB 1RCYA 1PLBA 5I6MA 5IY5B 3AZUA 2XX1A 1AAJA 2QPDB 3PAUA 2PPFA 2GIMA 7PAZA 2FQGA 1RKRA 3WG7B 3T6WA 1TU2A 2BP0B 2PPDA 4GY4A 3QJSB 2XU9A 3WIAA 2VM3A 3FSZA 1WS8A 2OCCB 1ID2A 3FPXA 3T71A 3OMNB 4DP7X 3TU6A 4YSDA 4AI7A 1NTDA 5I5JA 2EIKB 2CUAA 1ET5A 2CAKA 4E9SA 2P80A 3DTUB 1ET7A 4PCYA 2GC4C 2UX6A 2XV2A 1AS6A 3EH5B 4YSAA 2VMJA 1IUZA 1RZPA 1JERA 4HALA 4M3HA 2BZ7A 2MTAA 2EINB 2PPCA 4KNSA 4AZUA 4E9TA 1A4CA 1ZV2A 4DP2X 2HRHA 4AX3A 1QNIA 1MDAA 2PP8A 3T6ZA 2QPEB 1MG2C 1URIA 3QQXA 4W9ZA 2FWLB 2Q9OA 3WI9A 3CG8A 2PPEA 5E9NA 3QJUB 3ZBMA 4WTQA 2ZWNA 2VM4A 3NJFA 3NP3A 1L9RA 1JOIA 1L9TA 3V9EA 2GI0A 1E67A 2YAQA 3PCYA 4RH4A 7PCYA 1M9WA 4CSZA 1RZQA 4GP8B 1PF3A 1NIFA 1A3ZA 1WA0X 2FJSA 3FSVA 1BQKA 4L0PB 2YAHA 6PAZA 1PCSA 1NZRA 2E86A 3NJMA 1L9OA 1ASPA 5D4HA 2UXVA 1OCZB 9PCYA 1OV8A 1N70A 3FU7B 2CJ3A 2R7EB 1KCBA 2FQFA 2VSKB 3ABLB 1BQRA 4HHGA 1A65A 1T5KA 1NIDA 2YQBA 4W1TA 1IBZA 5D4IA 2PCFA 4YSPA 3NSCA 1ETJA 2HX8A 4GP5B 4PAZA 2X87A 4DP4X 2YARA 3IN2A 1PNCA 1ASOA 3BVDB 1JVOA 1NPJA 5PAZA 1I53A 1TEGA 1ZPUA 1QHQA 1V55B 1AG0A 1XB8A 1E65A 1W8EA 2XLLA 4KNUA 3ABGA 2Y1AA 3S3CB 3T9WA 1JVLA 2TSBA 3N55A 2XVBA 4N8UA 3ABKB 3NJNA 2P80D 1TEFA 5PCYA 2CCWA 3ZIYA 1J9QA 2DWSA 1BAWA 2BP0A 2ZXWB 3FQ1A 5F7AA 1L9PA 4E9XA 4DPAX 1MZYA 2I7OA 1ZIBA 4BWUA 4AKOA 3AG1B 3D12B 4JHVA 1OCCB 2IDUA 1JXDA 5FC9A 4A2HA 2I7SA 1J5CA 3ASOB 3S3BB 4YSCA 2YAEA 4UANA 3X1NA 1J9SA 2GSMB 1GS8A 3G5WA 1ILUA 1SHWA 3GXUB 1FA4A 2H5UA 2R7EA 4E9YA 1M56B 1NPNA 2XUWA 2JKWA 1SJMA 4X4KA 1GS6X 3X1GA 5TK2A 2QT6A 1JZGA 2AFNA 2PLTA 1J5DA 3U25A 4KNTA 5AFAA 1NIEA 1BYPA 2BWDA 2WO2B 3EH4B 1BQ5A 1JZJA 3UACA 3WKPA 5I6OA 1BXVA 4YSRA 1KV7A 4E9QA 3TA4D 2IWKA 4KO7A 1A8ZA 1WAEA 1AIZA 5AZUA 3WKQA 2ZONA 2PP7A 4GP4B 1TKWA 2XX0A 1GYCA 3EF4A 2DWTA 2XXFA 1NIBA 3TBCA 3UAAA 2FQDA 3EH3B 4TXVB 1PMYA 4F7KA 4G71B 3OMIB 4YSSA 3EHBB 2DYRB 3KW7A 1CYXA 3IN0A 1AQ8A 1PLAA 1L9QA 4F2FA 2ZOOA 4P5SA 3WNIA 2IDQA 4QKTA 4HZ1A 3ABMB 1QLEB 3AY2A 4HCIA 1OE1A 1A4AA 5B1JC 1CYWA 1BXUA 1SF3A 2AVFA 4DPCX 1E5YA 4G7RB 1JZFA 2IH9A 1J9TA 2AZAA 2GC7C 4YSTA 4BWTA 2FT7A 3FQYA 2QDVA 2YAFA 2YAMA 4GXFA 4HCGA 5ANHA 3TASA 3FSWA 4DP8X 2IDSA 5B7FA 5B1KA 2MRYA 4HAKA 4HHWA 5I28A 2FT6A 3ZDWA 4G7SB 2FT8A 1IKOP 4E9RA 1AS7A 1MG3C 1JXFA 4YSEA 4A68A 1OF0A 1ET8A 1E5ZA 1BXAA 1AZNA 4Q8BA 1ZIAA 3MBWB 2J55A 2I85A 4BWWA 3NJHA 1UATA 2HX7A 5I5MA 1NDTA 4BDVA 3C75A 4DP0X 4FA7B 3PAZA 3AW5A 1CC3A 4M4RB 5TK4A 4A66A 1HAWA 4DP5X 1SHXA 2HXAA 1IC0A 2CALA 2UXTA 3QPKA 1KBWA 3UADA 4NB7A 1J9RA 1B3IA 3H4HA 3PXLA 1EHKB 2W88A 5B1JA 3S8GB 1ZDQA 2FNWA 4A2FA 1SDDB 3GDCA 3NSYA 3ZX1A 1EZLA 3FT0A 4HIPA 1PNDA 1PLCA 3IE9A 2JXMA 4QLWA 2Q5BA 3DIVA 1OE2A 2JFCA 3HEIB 3X1FA 2VW6A 1AOZA 5AKRA 1GR7A 1GY2A 3NJJA 2OV0A 3AG4B 5B1AB 3CVCA 3FYEB 4DP6X 3V9CA 1MZZA 4G7QB 1NINA 2W8CA 1X9RA 5B3SB 5I6NA 2BHFA 3NJLA 5D4JA 4G72B 2J5WA 1SNRA 4DP9X 1AANA 5I26A 3X2QB 3X1BA 2FTAA 1FFTB 5LDUA 2IH8A 4BXVA 3FQ2A 3NJGA 1SFDA 2WSDA 2YAPA 2YXWA 1WA2X 2HX9A 3AG3B 4MFHA 3NT0A 3OD3A 2BW4A 3OMAB 3CZUB 4DP1X 4AKQA 3QJRB 1WA1X 1FWXA 1HFUA 2BWIA 1AZUA 4KO5A 3KW8A 4UAHA 1L9SA 2H3XC 4YVUA 1SF5A 2X88A 1A4BA 3NYKA 1GY1A 3FPYA 4E9VA 3N2JA 4JHUA 4KOCA 3UAEA 2UXGA 2YXVA 3PPSA 1OCOB 3CVDA 3X1EA 2UX7A 4F2EA 5I6KA 5EHFA 3CDZA 1F56A 2GB2A 1IBYA 3S8FB 2J57A 4UF7C 1SDDA 1DYZA 1XB3A 1AZRA 2IDTA 2CBPA 2IWEA 3S3DB 2B3IA 3FU9A 2PPAA 1N68A 2B08A 4A2GA 2AZUA 5A7EA 1KBVA 3FS9A 3SBRA 1OE3A 2VW4A 3T6VA 3RYMA 2DY2A 2NRDA 2XWZA 3NSDA 3HB3B 3H56A 4NAJA 3OQRA 3SBQA 2DYSB 4BDVB 4FAAB 2TSAA 3PAVA 5I6PA 2BP8B 1M57B 1OOWA 2IWFA 2VW7A 2H47C 1JZHA 1NWOA 2AANA 2N0MA 3GYRA 3QJTB 4A67A 1GW0A 4YSUA 1KCWA 2FQEA 3JTBA 2J56A 5I6LA 2QDWA 3AG2B 1ILSA 1PZCA 1VLXA 4Q89A 4KO6A 1AG6A 1CURA 1KYAA 4G70B 4KOBA 5B7EA 3L45A 1YLBB 1ADWA 1PY0A 1KDJA 2IAAC 2LLNA 1AZCA 4ZK8A 4K9JA 1AR1B 2HZHA 2UXFA 3MX0B 2RACA 3UABA 2XV3A 4YL4A 4JKNA 1AACA 1OCRB 4A2EA 1E30A 1BEXA 2GHZA 1CUOA 1W6LA 2VSMB 3ASNB 1AS8A 3OM3B 2EILB 3H4FA 3SQRA 2IDFA 4NERA 2EIJB 1AZBA 1GSKA 2XXGA 1W6WA 1NICA 2YAOA 3NJKA 2EIMB 5I5IA 1XMEB 1GS7A 2GBAA 4YSOA 1KGYE 3UGEA 3FU7A 5B1BB 3PLYA 1JXGA 4GYBA 1ASQA 2XV0A 3DKHA 2A3TA 5F7BA 4E9WA 3WNJA 2DV6A 3FSAA 4N4YB 3IEAA 3SBPA 4CSPA 3NSFA 1V54B 3FU8A 1SFHA 2WO3B 4DPBX 3QJQB 4EF3A 8PAZA 1DZ0A 4YSQA 2Y69B 1ZDSA 1WS7A 4WKXA 2BO0A 2PCYA 1BYOA 4KO9A 1NIAA 1PZBA 3JT2A 1X9UA 1PZAA 3BQVA 1JZEA 4P5RA 1KDIA 4HCFA 5B7MA 2PP9A 3NJIA 2BW5A 2BZCA 3CDZB 6PCYA 2OJ1A 1PAZA 1JZIA 3CVBA 3TBBA 4ENZA 2XYBA 4BK5C 3IBOA 1R1CA
chains in the Genus database with same CATH superfamily
3ETTA 4BZ1H 3HMWH 4FQCH 4LLAA 2L7UA 1GOHA 5KZCB 1MXGA 4YR6A 1OP5K 4N2BA 5EZOH 2NYYD 3F7QA 1FDLL 2VO5A 1QA9B 4HWNA 4JRYD 3UYPB 4C56A 4LQ1A 1IKFH 3OZLA 4ONHA 2QPDB 3FOLA 3MV01 4ODTH 2QPFA 4PW3A 1YCSA 3PPEA 3WG7B 3T2LA 3KYMA 3DNKA 3D52A 5FOBA 4M8QB 1IEBB 4V33A 3QE5A 2QGBA 3H3KA 1UWGH 4XWGH 4UINH 3HA0A 3NDYE 5EIIG 2Y0SA 3IFLL 1KY7A 4X6DF 4R97B 5E5MA 4Z7IA 4IK6A 1T2JA 1JWUA 3DLQR 5K93A 3ARDD 3KWXA 4YE0A 5FYLL 2XV2A 4WWNA 2X42A 3EH5B 3WJJC 4MJ4A 3PWUB 1N19A 4KK6C 1RJZA 2OMWA 4R0LA 5DT1L 4PCTA 2VZUA 2G2RB 4H8UA 1OT2A 3RTQA 1SY6A 5FM5O 2OMVA 3FQWA 5CU9A 2ZPKL 4ELMA 5D2LB 1T22A 2XZQH 5C0ND 1LNUA 4BZ2A 5C8JA 1WF5A 3VNZA 5HBBA 1A22B 1A6WL 3IJYA 4WTQA 5IMOA 1MNNA 1P7HL 5CWSB 4XO5A 3WFBL 3KR3H 1JOIA 2WP3O 1FL6A 3VXUE 5GZNA 4U1NA 4YBQD 3PWUA 2NXZC 2JF1A 2VISA 4P48A 3SDAD 1BQKA 1S9KC 1PCSA 4DUWA 4WDIB 3WFCL 1VRSA 4OCRL 2F9BT 2WKOA 1S4IA 2EH8H 3BEWB 4PCKA 4Z95L 5E4IA 4OZHF 5J13B 1AR1D 5I1EH 1A1OA 1ZMYA 5F71A 3RGVD 5IVXE 2F1AA 3I02B 3TTSA 2YZ8A 3ARDC 5BPPA 1KCBA 4P46C 1WH0A 4JFPA 1JWSB 4Q9QH 1OK0A 3EJCA 3BPOB 3MRFA 5BRPA 1Z5LA 2PCFA 3DK2A 4A37A 1IT9L 5AAWA 4EMZA 4DH2A 1BLIA 3DECA 4QJ5B 3DDGA 3A4AA 2QFPA 4BELD 5F7NC 5A3IC 4MDIA 4P04A 1CGTA 2BVYA 1NPJA 2QKIB 3FT9A 1NGQH 2F19L 3THMH 1U8KB 3LPOA 4HDIA 1V55B 1NDMB 1OAQL 2B2XH 4FGMA 4I4WA 1E65A 5E8PA 4M6AA 4KFZC 3JVGC 4HS6A 1XBDA 3FU6A 4XBPA 4PRPD 3K80A 3MNMA 3INUH 3GHBH 3QQ3A 4I2XE 4G8EB 5LWYH 1YYLH 3SYAA 2D7PA 3D4ZA 3SDAC 2JKNA 5DEZA 4K3EL 3OR7A 4DEWA 3KHQA 1I75A 1QABA 4LCYA 4HK3J 4EDXA 4OV5A 2JJUA 1BVOA 4OR1A 3QJFB 2P8MA 4S0HA 1KB3A 1UOKA 3AWGA 4S1SL 3A6CH 4E9XA 2BZDA 4A2MA 1LDPH 1LO5B 4GG6B 3LN5B 4FQ2L 5JW3L 3JWNC 4PJ5D 3SDXB 4Z5RA 3JV6A 4Y1AD 2NY2D 4PJBE 5IQOA 3OPZH 4U3SA 4XMWA 1ILUA 1JK9A 1O9ZA 2V9TA 1CDIA 4IU2A 5ENWB 4KVNL 1MY5A 4J3VA 4XNZC 3VFVB 3V0VA 3CFCL 3TV8A 1ZAGA 2IH1B 3BD3A 1FYTE 1U93B 1AQDB 5TK2A 5CEZE 1I9EA 3P4LA 4IS6B 3UPRB 4X6BA 4AEEA 3P4MA 2WIMA 1I8KA 3QC6X 3F7YB 2PYEA 3AT9A 1BZ9B 4KPHL 4R7DA 4LSPL 5SX5H 3VFTB 4AV5A 3QT2A 4MVBC 3QYNA 3LVTA 3EH1A 4KJYA 5HYJB 3O6LL 4FKHA 4OLVH 4QF1A 3UYRL 1KB9K 5JR1H 5JW4Q 4UIKL 1Y6KR 1BQSA 2BNRA 5ETUA 1N5AB 3N44F 3WHXB 3B9KA 3UFIA 3LAFA 2CLVA 3MYJA 1A6AA 4G8GE 1BIIB 4KXCA 5SWZD 3AMLA 3EF7A 4FQJL 5TGBA 3A67H 1PG7W 4FMVA 4JDVB 5CIPB 1WE5A 3PUUA 2VDNB 3WFHA 1E0OB 2XWRA 3ZE2F 1N2RA 2CDGA 4IW4C 3RTQC 4YS4A 1BJ8A 4KJPC 5JHDE 4XB3A 3KPRB 4TQPA 3ECVA 1ZK5A 1LE5B 4LGRB 2R4RL 3GBDA 5HHMB 1UVQA 1QLEB 3W39B 2AEQH 3BP6A 1NANI 4M8RA 4XO3A 1FVCB 2J25A 4ZO9A 3BFWA 4KROB 5EOTB 3FQYA 3D08A 4FABH 3WIHH 3FQWB 5DGQA 3ZL2A 5ANHA 4X0KB 5HPOA 2MNJB 1SJHB 1AKJA 2FT6A 2AV7B 2D4FA 4G9FA 4HHWA 5CILL 1XH2A 3N43F 2O6FA 2ZPKH 1EUUA 4HYTB 1RIHH 2AQTA 5D93C 3O2WH 4B53A 5EOCJ 4JGJA 1M05A 1E42A 4FEMA 5FUCC 1SBSH 4BDVA 2R51A 2ZOLB 1I8MA 1CWVA 1DFXA 4YWGH 2YWYA 5TDPA 3RU8L 2VQ1A 4UB0L 1RIUH 4P06A 4QYAA 3BQUC 4M1CC 1HTYA 1NFKA 4TTDC 1O7DC 3MDJA 2HTLC 4CC4A 5BCAA 2FJHA 2AV7A 3PXLA 3WFDL 3SPGA 3N42F 1I8UA 2ZCLH 3MNWB 3ZTJH 4AJVA 4JPSA 1E8WA 2WLNA 3IF1B 1MCCA 3MRCA 4XPFH 5TPWL 3ZUCA 4Z23A 2DQMA 1AE6H 2GAZB 1M9SA 1X44A 2KZ1B 2X4OB 2EDEA 1XZ0B 4J3XA 5AKSA 3F83A 3SJVB 3IBEA 2OMZB 4U1SA 5GRYA 4HLJA 1GY2A 3BO8A 3VFNB 1U8OB 2DQEL 1NEPA 2HT4C 3V0VB 3JQOB 1R3HB 3FONA 4G43B 5EU3B 2FYYA 3W5NA 4U6VH 1XSOA 1AGFB 1X9RA 1JK9B 5ENWA 3MMEB 4DN3L 5B3JF 3HFFA 3HMWL 4LDCA 4H88H 4U33A 4R4ND 1AO7E 1VHPA 5I18L 2APBA 5EPMB 2F7RA 2HX9A 3N41B 1A7OL 2VDLB 1OSPH 3WKMH 1J1XL 1UCBH 4ODVH 4AKQA 4I18B 3FQTB 5EBLB 4MKMA 3LZQA 5E2WH 2BVQA 5DO8A 3F84A 2VKXA 4OV5B 4JRFA 2BWIA 1ZHBB 3ZTDC 1WJ3A 5I8CB 3US0A 3BDYL 4RMUA 4YH6A 2BNRB 3KW8A 4AJYV 2LHAA 3PDOA 3F5WB 4KH2A 5ELIA 4DTGH 1XGYH 3BN9C 3IFLH 5CJOL 3MQIA 2X09A 5SX4I 4RGNB 2MPAH 1EJ8A 2GQHA 5DFVC 5FOJA 3VYNA 5L88H 2AQQA 4U7SA 2YA2A 12E8H 5DK3A 5JUEL 5TH2A 4G8GA 1NJ9A 3L3OC 5GS3A 1ZTXH 4Z7NF 2G0KA 4MMYA 2EKSA 1XB3A 1UB5B 4GUPB 3EDDA 1IAIL 4Q14A 4Y2DC 4R90L 4Y4FB 3B5GA 2OTPA 3SDYH 3MRKB 1K4CB 4BD4A 5DD6A 4A2GA 4WNQA 4XE0A 1E9QB 2ENQA 4GQRA 3D39B 5I8KL 5L4FA 5IOPB 3OSKA 1I9RH 5JPNB 2WHVA 3ZE2B 1TG8A 3BN3B 1SLUA 4Z7VE 1G0YR 4ALAH 2R2EA 2PTTB 1C5BL 1AD9A 3WTWA 2EH7H 1CFSB 2F58L 4K23L 3H56A 2DQ6A 4UT7L 4A2LA 5CCKL 2ZOWA 2OMXA 1A1MB 4I0PC 4J1UA 2WVUA 2X53A 4FD0A 3ULSA 2ED7A 4YSUA 1MRDH 2BCKA 1A6PA 5JOEA 2DYPD 1B88A 3QRLA 5C2BL 5I1AB 4FL4B 1Q0YL 3S36H 2A73B 2BSRA 2N3JA 4M3JA 3QIWD 2R1XB 4HG4J 3IDJA 3WFCH 1F2QA 4I1PA 1RK7A 5JW4R 5D7JD 4U7KA 5HD8D 4Y5YB 4L3ED 5IF0B 1HIML 4G8FB 1MRFL 2G5BB 3AU1A 3P40A 3X13B 3FT2B 1GIGL 1O6SB 5ISZB 1TJHH 4OJFL 4NQCA 1E27B 3EJZC 5HPMA 3W9DA 1P5UC 2MIZA 4FQIH 4LT7A 1T22B 4L05A 3O3AA 1G6RL 1E30A 1O5DT 2NNFA 3VFPA 3ASNB 2VMEA 4WEMB 5EEVA 4H1LA 4UM9A 4MX7A 4OZFB 5DMJB 1SY6L 1IGFH 1CD8A 1ROWA 3G9AB 2EDFA 1U8IA 2A74B 2M83A 3ASWA 5IQNA 3UJIL 3MV8D 5B1BB 3UG4A 2C9RA 3X11B 3R0MA 5J9PA 5L7XH 1T03H 4GYBA 2YC1A 1FAIL 2GY7B 4PD4J 1CFMA 1QLEH 2ATKB 4CSPA 1U8MA 3EJUA 1YYLL 5CP7B 2VQTA 1BAGA 1SFHA 5IQ7H 1WFUA 4K3EH 5LBVA 3ZTNL 2NQCA 2FZ3B 3W37A 3BUQA 5MENE 3NCBB 2F68X 4YDJB 5DHYB 4XP1H 1RK1B 4UTBL 5CFHA 3D05A 4PJAF 1DVXA 2B0SH 4FHJA 5TE7H 4H26B 1BX2B 4GXVL 2RD0A 5DRNA 2ZUQB 3C5XA 1XR8A 1KDIA 3FK3A 4Q7DA 1U91B 4R4FH 4XI5C 4KZDH 5CSZA 1TQVA 1VERA 1NGYA 4QTIL 1QRNA 1P0SE 3C6LD 1RIUL 3QYMA 1JK8B 4OFQA 4BM7A 5D2LA 5H37A 1JN6A 3CFEA 5J4MA 1Q0EA 5F7LB 2VDOH 3TBBA 4OM1H 2X40A 2EXWC 3WFDH 5D1ZI 3BIKA 1FO0H 4O02B 2HWZL 4IEFB 5EOQH 4JREB 3B2XA 4O4YH 4PTUB 3VXUA 5B22A 3NN8B 1EFXA 2YGQA 3IXTA 5HDLA 3FQNA 4J8QA 4X80L 4WEBH 1AGEA 4P5TA 2F7PA 4PJDE 1M6OB 4AE0A 4JRWA 2XX1A 3VI4E 2FWOA 2WCSA 4OZFH 4GQPH 4F58L 2VYRE 4G8GB 3T6WA 4QXGL 4B9GA 2XIBA 2HLFC 1E4XH 5G4MA 1MNUL 4CVZB 1J8SA 3V5KA 1UFGA 2A9MH 1SEBB 2L4OA 4GINA 4KUZH 3T71A 3TT1L 4GW4B 5D7SH 3H0TB 5C0CE 2Z9TA 2TRYA 2A9AA 2DWYA 2OSXA 1RZFH 3DRTB 1E9OB 1SRDA 3G5XB 5HVHB 1JYNA 1GL4B 3OXSB 1OP3H 5K39B 3UH8A 4X5RA 3LS4L 2OX5A 2YFNA 5HHME 3WIFA 3DX1A 5KS9E 1C5DA 5GRUL 1Q0XH 6TAAA 2VMDA 1HEZA 3C6LC 5H4YA 5GZNC 2MCG1 4HBCH 4OD2B 4H4NA 1Q38A 2NYZA 1DVTA 2QPEB 1MG2C 1R46A 1URIA 4OFYA 2FWLB 3O45B 4E42B 4LPTA 2SEBA 3EOBA 3HG0A 3HZVB 4TUJA 4AQAA 1NAML 4LHUB 1D7BA 1HL4A 2GT9B 3CZSA 3I9AA 3V2AR 3BE1H 1NCWL 4WU7B 3NP3A 5D8JL 1KJ2H 4ERSL 3VGAB 3BXNB 3DHUA 5EN2B 1BBJA 3QDHA 4RH4A 2BWQA 3VXPA 1ETA1 1FGNL 1TCMA 1H5BB 3DC0A 4TVPL 4OSUH 1YEFH 1M6UA 4Y4KB 3LZLA 3LEXA 2GK2A 1OT4A 4FLSA 2X44D 1LM8V 3NABL 5ID1A 5D4HA 4WKZA 4K7PL 4UM8B 1RZJL 1BQUA 2FHCA 4K23H 5GGRB 2OZ4L 3P30H 4X7DC 4M5SA 3SGKC 1U95B 5DEFB 5D1XE 5T3ZE 3RU8H 3D3VE 1YEGL 5CXPA 2X4QA 4OGYH 3GMRA 1UA3A 3BH4A 5DDHB 2HX8A 3PP3H 3X12A 1M4KA 4ZOEA 2VDMB 1KWKA 3E0GA 1QSED 3P0VL 3BMWA 4NQCD 3RUGA 4WCYH 3N3EA 2I60L 1V3KA 1HS6A 2ZXBA 5CEYA 2ZUTA 5IBTL 4NO0A 2XQYA 4WKZB 1N0LA 4K3HA 4PH8A 3EZJB 4GW1A 3E7JA 4L3AA 1XB8A 3ARUA 4ZNCD 5KUKA 1D5IL 1W8EA 2XN9B 2ZWZA 5DD1L 1YNLL 2G2RA 3SOBH 3V6OC 1BD2B 1CFBA 4FQXD 1QYGL 4HS3A 3OAYK 4F5CA 1I9IH 5FW7A 4J3SA 1CD0A 4B9PA 3IDXL 4P57B 4HA1A 2W0PA 1H8OA 3UC0L 2BNUB 2JIXD 2BP0A 1BREA 1ED3A 1PJ9A 3QIWB 3TF4A 2OCJA 2Y5QA 3KGRA 1GAFL 3KYKH 3LHPL 5FDYA 3UJJL 4C55A 1J10A 1SY6H 2V8LA 2YUWA 5HYEA 1NM4A 1UJTA 1YC7A 3RFZC 1X7SA 2R69L 1KB5L 2J88H 4M43H 1FZKA 2AK4D 2Z3FA 3OJMB 4JM2B 3UTZA 2X1PA 3V7AG 2BVPB 2GTQA 3RY4A 4QI3A 1OOAA 1QVOA 1T20A 4OZGF 2X4RA 2H5UA 3SO3C 4N0UB 3D2TA 2Z0BA 4FOMA 3GM0A 1ZE3C 3Q6FB 3QDGB 1AXIB 2WQXA 2UZPA 3VH8A 2A83A 3I9IA 4FQQB 4JAMA 4HIXH 1SEBA 4YXLH 1MFDL 4PLOB 4PJGE 1JZGA 3CFIC 1YNKH 2LAGB 4FYQA 5JQHC 2DQGL 3QDJA 2W92A 3HNSH 2LE9A 2P47B 3CFBB 2DMHA 4PRPE 2FEDC 4Z8FH 1RH8A 3IFOA 5EUKB 3UACA 3TURA 5TD4A 1LP9B 3OJ2C 1ANUA 1KPRB 1WFNA 4FQCL 5EA0H 1CVRA 1LO0H 2NUTA 1FG2B 5E8NA 1RHHB 4PB9H 3SDDB 1QSZA 1K4DB 1CFNA 3LKPB 2WLJA 1JVKA 4IEFA 3WKQA 4B27A 4OGXL 1KXTA 3ESNA 4ANUA 2DWTA 3N85H 4PVLA 3L95A 4GJTB 1NIBA 3N1MC 4CVXA 1M2VB 1SJVA 4ALAL 2BS8A 2BX5A 4TXVB 4KH9A 4QR7A 5DD3H 1NCBL 3TVMC 2YRPA 2GJ6D 3WJMB 3ISWA 3JWDC 1A7NL 2FGZA 2JI3A 4S2SB 1QPPA 2WQRA 5BW7A 5AWNH 2ENPA 3P9MA 3BWAB 4AIZA 1AQ8A 3OKLB 2EDDA 4X6FB 3ALPA 4CDHA 3V0EA 2NNCA 4S2SA 3T2NH 2GI7A 3IAGC 3H0TA 3W1ZA 1TLMA 1KCRL 3AACA 1CVSC 3NSXA 5TDNA 3UPAA 4BQCA 3TCLB 5MEOB 3FQTA 3L8QA 4G6JH 5EBLA 3D85D 2MTPA 4HIQA 5CZXC 1KTDB 4JZOB 3K71A 4C8XA 3LQMA 3HMXL 4AL8L 3GUTA 4BWTA 4F7EA 4Z9KB 5GGSY 2F7IA 2PR4L 4KHTH 5HDQH 2AXGB 5KN5B 1EO5A 2BFVL 4S0TD 5DRXA 5B1KA 2MRYA 4HAKA 1RUAH 4JUSA 4ZOBA 4N85A 5IMMB 4YZWA 1KC5H 1MH5B 1RSFA 2XV6B 4TUKH 1JI1A 1NMAL 4GXUN 4Y1AE 1BSIA 4HWBA 3OZKA 1F11A 4DEUA 1E5ZA 3G04A 3AS3A 2B9AA 1T5WB 1AZNA 2KZBA 4JM2C 4ZFQA 4CU8A 5C86A 1DQQA 4WEUD 3QZBA 4Y9GA 2J4WL 4XWOC 4MD5B 5IJVB 3FB6A 3KLHD 4KROD 3ZO9A 1RZ7L 1ODAA 2R83A 4DP0X 3Q5TA 2YHGA 1NEZB 3ZDZB 5DJ8A 3TVMD 1SHXA 2BNQE 1YMMA 1UCTA 3VWKA 3QPKA 1KBWA 1P84K 2FNBA 3QG7H 1CQKA 2C3XA 3V5DA 4K8RL 2D9CA 1E3FA 4U1MB 3S8GB 4XP9H 1WAAE 2IDCA 1IC4H 2AERT 3WIFB 1Y7VA 4N9GA 1FNEA 3HG1A 3APCA 4N8CH 1S7VA 3GDCA 3QIWA 2B0SL 4Y2NA 5E6SB 1GHFH 4Y16D 2BY3A 3WS6C 2BRRL 2AJUL 3RWFA 4QLWA 4AGPA 5IROD 3P2DA 2R8SL 5ID1B 4YHLL 3IDMB 3IWVA 3BYTA 3CHQA 3S35L 3EJSA 3NRFA 1CFSA 5FUOL 2GFBA 3HHSA 2C1PA 1JV5A 1NBCA 1PX3A 1TJGH 4TL4A 4Q9BA 1DVFB 2ESVD 3GHPA 2C8NA 4Z7QE 3BT2H 4YDNA 4YQXH 1MCJA 1F4AA 2Y36H 3U7YL 3GSRA 1YNLH 5LN4A 3GHBL 1MREH 4M00A 2KL6A 1T5XA 2B9BA 1YJDH 3ES6B 4XCNB 4JO3L 4PGCA 3FTZA 3VVVA 5GS0C 2E76C 1MCSA 3KMDA 1SLXA 1A47A 1PZ5B 3QUYC 3VYPA 1BQHB 2M26A 2IGFL 1UM5L 3HNVL 2WIIB 3O0RH 3FPYA 3HZMB 3SD2A 3WELA 2HKFL 3ZDXE 3DRTA 5CLTA 2AV1B 1I3RA 4L9LB 2P4AB 1OCOB 2H26B 2W65B 4ZXBB 5F96L 3OPZL 3BAYA 3CU7A 1U3JA 2GJ6E 2EJ1A 4ZW3A 1DYZA 1KPVB 1SEQH 3BKCL 4ZYKA 5D71H 5C0AE 1WBXA 2B08A 1UG9A 2X2YA 3QHZL 1YZZA 1EAOA 4D0DB 2V5RA 4JO4H 1KBVA 1B0IA 4XHQA 4JFSA 4OLYL 4F9LA 3OKNB 3FFCD 2MQ3A 3FKUS 4D0DA 3EG9A 1AGFA 2DY2A 3JSSA 1J8RA 2Z7ZA 3IGUA 5B38B 5CJXA 3OQRA 2XVLA 3UYRH 5BW7C 4DGIH 5I2IB 2VLRE 1GGIH 5E51A 2AEPL 4IS6A 4PLJC 5ECJE 3VFNA 5I6PA 2IWFA 5LB1A 2WWOA 2JKSA 2VDNL 3D85B 2J12B 4QRQA 1FQ9C 4OGQC 4HCRA 1DQIA 1D5RA 1GYUA 2AANA 2CIIA 4JO5A 2P45B 3TO2A 4ZO8A 1CDCA 3BEVA 3NFNB 2QQNH 3RWCB 1WTGT 3TBWA 1TTUA 4PJ7F 4MBOA 2NR6C 2CLRA 3MBXH 5EFIA 5CD5C 3HE7D 3QEQA 4FI8A 1KCSL 1PZCA 4HMDA 4FQ1L 4X5WB 4ABWA 5I1JL 2WVSA 3P3RA 4XCFH 5DRNB 4YXKH 1J11A 3L1OL 4MA8H 4PJCA 5E2WL 1YVLA 3PJLA 4OVUA 2VL5A 4IBLT 1IFHH 2WJ7A 1P69B 4MQXC 2EYTA 5DVKA 3UPCA 4GOSA 4ZK8A 3S97C 1NGWB 2G2PA 3LH2H 1XF5B 1TJMA 2WXQA 1AR1B 1YEIL 2RGSA 4PR5B 3T3PB 4GUCA 1DO6A 3VWJC 4JKNA 1OCRB 4ISVB 1QKZL 2O5YL 3RFZB 4H8QA 1CXIA 3H4FA 5KVEH 3QEQE 3SQRA 1BD2E 2VE6B 2HJLA 2VH5H 2ZKHH 3OJDB 2BIIA 2PCXA 1A6VL 5A43C 5K59F 2NNAA 5DQ9A 3LRHA 4XNMA 2DIBA 4DZ8A 3DKHA 2EO7A 2FL5B 3IPEA 4R26H 2ROXA 5HVFB 5CJQL 3DMMA 5BRZE 3GZOA 4BIKA 1IQWL 3BHBB 1GC1H 2EVJA 4DQOH 4K73A 4JO1L 1UB6B 4DPBX 8PAZA 5DI8A 3RGHA 3UIZA 4PW4A 2FO4A 5JDSA 5E9DA 3GIZL 3NIDF 5A6LA 2XN1A 4J3UA 1DJWA 4UU9B 4ZZFA 3JT2A 4Y8DC 1TQBB 4WJ5A 5CD5D 4HC1H 4XHJC 1PSKL 5JXAL 2X2HA 2A2QT 1JZEA 4UB0H 2V17L 2OJEB 2ICWJ 1ID5I 1ODUA 3Q8EA 2BW5A 2GJ6A 3DVNA 1L7IL 4MQXD 3CDZB 2ATKA 1QQDA 2YUVA 2EUVA 4WNJA 4YAQA 1U36A 1BW8A 3CZFB 1KENL 1ZSDA 5KZCD 3LQAH 4WI0A 2XYBA 1ACYH 3UTSE 3C5ZD 3L2LA 2BY0A 1C1EL 4U1NB 4WQOA 2G75A 1NBYB 3CPLA 3ARPA 4PV8A 3UAJA 3FW6A 1WAAA 1CBVH 3CBJB 3EUUA 4IHBA 4B3EA 1RCYA 4PG9B 2ZICA 4YFLF 2IALB 1GC1C 2IFGA 4NRZB 4OF7A 1GZHA 1TYJA 5DR5H 3SE8L 4ODWA 4RMRA 3RDTA 2ED8A 1S5IH 2FRGP 4HXBL 5INDA 1GH7A 3S35H 4JQIA 3N91A 3GM8A 1YAZA 4NZTH 4WTWA 4EIBA 4ZNEE 5I1IL 5FUZH 1HXKA 1NMBH 3CHRA 1TJGL 3PABB 3I3EA 4MRCA 1YHPA 5F7DB 3HRZB 3I9PA 3VG0H 4MXVE 3L6FA 4UV4H 4ESKA 4E9SA 4I7ZC 1OSYA 1JZDC 4GS7C 1LEIB 3IRPX 5HHNB 3QA3B 2YOAA 5HHOA 3PDGA 3QRFM 4GH7B 2AW2A 3BSZL 3NCJL 4OIIH 4BGLA 2PPCA 3BP7A 4QYOB 4AX3A 1L5GB 5T1DH 3T2NL 3HUJF 4OLXH 2G4EA 4HUXA 4MJIE 2HJKB 1OAZL 4KK6D 3MKGA 4GXVH 2OK0H 4U1GC 5G4OA 4FQHB 2HKFH 1BXXA 1UGKA 5KSBE 5F8QC 3H2QA 3RPBA 3LEVL 2WSKA 5F21B 3ETBF 4GEJA 4LF3A 2DLIA 4IOIA 1IAIH 1PCXA 3W57A 1PF3A 4JB9L 3FQNB 1IGIL 1WA0X 4HS6B 2ZXAA 1A6TA 3SY0A 2M1KA 2DZEA 6PAZA 4BKLB 1I9RL 3MV7B 2BPBA 4YLCA 2ZX5A 3NJMA 4K5PA 2Y5EA 3L7EB 5T5FA 1ASPA 5D7LE 1UACH 4TQEH 3K6SB 4JPKH 5DEGB 1QAWA 3EYUH 4PJFF 5CCKH 2BNQB 2UZXB 4DOHE 5BJTB 3C8DA 3TBVA 3TCXA 4AK1A 4C54A 4G9FD 1GGIL 4JQVC 3N9GH 1TTBA 2A74C 4KHXH 5AKTA 2OP4H 4F8PA 5LNGA 1A65A 15C8H 2O5ZH 3BW9A 3FFCB 2YQBA 4QXUL 1MNUH 1IBZA 3CZNA 2KDGA 2IADB 4L0ZA 1HI6A 3TT1H 2H6UA 3MNZA 1ETJA 4I18A 3BH9B 1YY8B 4TSBL 2YARA 1Z2KA 4ZX4A 4JDZA 3AB0C 3GBMH 4HGMA 4MQ7B 4P46D 3RUGF 2MEJB 1UUSA 4PBXA 5I1JH 4LIQL 2OQJA 2D0GA 5G55A 5K33A 4QPEA 3DVNB 5I17A 3I9GH 4UM9D 2HKHL 2AJUH 4JFDE 4LRIA 4MGXA 4DN4L 1JWMA 2GKIA 3ABGA 4PY7B 1WBYA 4KMTH 5I1DB 5ITFA 1E5CA 5LAXB 4KXAA 5IREA 3SZKC 2MCPL 1T80A 4RVBA 3AXIA 2CRYA 2CGRH 2DN7A 4NUJA 1OT1A 5ESQB 3DMMD 2O5YH 1I7ZA 4F57H 5DI8B 4X6DB 4M03A 4WI4A 5D5MF 3H3PL 2B7DT 3G5VB 2RJMA 5HHQB 1MIEH 3M1OA 4HKXB 2PCPB 4AEHL 1L9PA 4XN9A 2A4EA 4XXDB 1I8IA 1A6VH 1WFTA 2AABL 3AG1B 2B39A 5D1XA 2JKRM 4OZFG 5FYKD 2O72A 2OM5A 4XVTH 4PGDA 5KYWA 4ZS6C 1GS8A 3VWKD 5LVEA 4MBRA 2EEBA 4S1RL 1HINL 2AEWA 1VZHA 5CZRA 1DJSA 2N7AA 2Y5TA 3TNNB 4LEOB 2ZOLA 2IGFH 3ZQ9A 1R3IL 1RZKH 4IHOB 4UMGA 3X1GA 4O5LL 2E27H 4GRWH 5AVVB 3DV4A 1I3VA 1U8NA 4UI2A 1D6VL 5DUBB 5KJRL 1IVLA 4HMEA 1P5UA 1XR9B 3L4CA 4PB0H 2WZ5A 1BDYA 4LVOB 5FHAH 3BZEB 4QO1B 2KLSA 1GZHC 3A4FA 4JCMA 1OP9A 1BVNT 6CGTA 3VXSD 1HHIA 1EDQA 2CGZA 3MRIB 3MRNA 4MA3B 4R7NA 4TYUA 3KYAA 1YNTF 2LLLA 4HPHA 3DXAE 3IXAA 4X0KA 4LEBA 1AZVA 1I1YB 1JPEA 3RJOA 1OAXH 4ICXA 3HW7A 3LRMA 3PHOB 4LSVL 1DO5A 4DO5A 1UYWL 2Y6TE 2YLHA 4KJYB 4XPBL 4JFQB 4NQXA 2XXCB 2C9XA 3BAWA 3CQFA 4GP4B 2F6AA 4JG9A 2VC2B 4W68A 2KQMA 2OMVB 1ZA3B 4UBDD 1I1RA 4XCYA 1W0WB 4ZMNA 2CSPA 3I50H 3BPCA 3KYNA 1IAKB 4F58H 2GTWA 2R4SH 3UYOD 4Z7OF 4QXGH 4JFEE 4LOUC 3FB8B 3JV5A 2OXHB 5BVPH 3SE8H 3R1GL 1D3CA 1L9QA 5KBMA 5E03A 3OAZK 3T3MF 1IAMA 1S7WB 2YPVL 3FF7A 5ALCL 2QQNL 1NGQL 5ERWA 3V4VB 4GRLB 2VT0A 4ZW6A 2NXYD 3BWUF 4PW9A 1CYWA 2YD6A 3HE6C 1KELH 4NSKB 4XAWH 4HJ1A 3TXAA 4WO4A 2BVQB 1UGNA 5I0VA 4KJPD 3V5KB 2ETWA 4POZC 3O11B 5CUSH 4AUUA 2GK0B 3POHA 1UM6H 4HCGA 3NEEA 4PIRF 2XCMC 3RVUD 2NX5B 2K7PA 3UBXG 3V4VA 1P7QB 4IKNA 4EVNB 2SODB 3MV11 5F3BB 4FA8A 1AI1L 1MG3C 3HFMH 7FABH 4OF3A 4R7DB 2Y72A 4TQHA 3B3IA 5DGRA 2VDRL 4ZFOB 4PRAB 2WUBH 4PGBB 4PUBL 4WGVB 4O00A 4P59L 1WCQA 3KEDA 4WRLA 3QGVA 1U8KA 1HH6A 4BH8A 1NDTA 5I2IA 5E2TH 4UBDC 1FGNH 3V4VH 3BVWA 1XZ0A 1HHJA 3QIWC 4RRPM 2J72A 2EYRB 4CBPA 3TS8A 4M4RB 1H6FA 3N44B 1TU2B 2EECA 5DS1A 1QZ1A 3LN4A 4KC3B 3VH8G 5KG9B 1H6UA 3LVEA 2K9UA 4L23A 1QWNA 2EC8A 4FG6D 4W9KC 3VFRA 1K3IA 3WJJA 1BFVL 2P5WD 3QFGA 1NOFA 3HE7A 2OCFD 3KBPA 4FFWD 4FLQA 4Z7AA 4M1CD 3NSYA 2AAVA 1I1AD 3V6OE 3C60C 3CDGB 2YK1H 3IE9A 1YEGH 3ZHFA 1GYWA 1XDTT 4R7LA 1FNFA 4NPYA 2J2ZB 2ALWA 5FO7A 3NJJA 4L3FA 1XD0A 5EBWB 5HGGS 4JRYE 1WAPA 1JGIA 4IMKA 2DD8L 3WL9B 1EXUB 4RQQA 1EHNA 3LQAL 4G7QB 4BCZA 1BZ8A 2BHFA 4P2OA 3MUJA 4M02A 3IFNL 4ZMVA 3TESA 1PKOA 5JYMA 2FTAA 1AKJB 3VWKB 1UJ3A 3TA3B 4GAJH 4HPYH 3QULA 1Q8MA 2BFVH 4BZYA 1UB6A 2V5MA 2Q3AA 1NCGA 1DBKH 4NRXB 5IB4A 3O8XB 1DQQB 3S7GA 1EIBA 1EMTL 5ICYA 1BFOA 1SN2A 1F11B 1G9ML 3SGKA 2X88A 3FTWA 4X4YB 2EDJA 2YGPA 2ORBH 3KPNA 2Y6SD 2XKSA 3GMPB 3STBA 4FULA 1DBJH 1HL9A 2BOLA 3VXQA 3M7FB 1EFQA 3MRBB 2EDTA 3SEPA 3VI4F 1YYCA 4X5LA 4AIXA 2A73A 1QW8A 1XV8A 4F2EA 5D2LE 3UZEC 2ADGB 3CDZA 3DHJA 1WQVT 2PKDA 1S7VB 1N8ZB 5GGUB 2J57A 3BN9D 4XNXL 1AZZC 1IM9D 4JDVA 4ONFL 1AZRA 1JHTB 2IWEA 2AMUA 1XBRA 1NLBL 2DL2A 4U1MA 4XB7A 2K45A 5FB8B 1EXHA 3MV9E 2ZZUT 2E27L 2WM0A 2G60H 4MDJA 4CRPA 2QR0B 3KPMB 3EO1B 3LKOB 3MLVL 4X0NA 4KTGA 2DW5A 4QHKJ 3C5ZA 4WWID 1HWHB 2ZOKA 3IDIA 4FAAB 5BV7C 3GT6A 3HCVA 3NH7H 4LEXL 4QMEA 5FUOH 1P4IH 3P11H 3GGWB 1ORSB 4GSUA 4KKQA 1KG0B 4Q74A 4OZHA 2HH0L 2IG2L 2L04A 3O4OB 4FEIA 1NKGA 2Y7QA 2NY2B 4LLQA 4Y2LA 5DYOB 2BNQD 5I6LA 4GAFB 4HUUB 3PL6D 1MIMH 3EIFA 5ESAB 3C6SB 4G70B 1NOAA 2Y1ZA 1VGKB 8FABB 2X4SB 2OL3H 4QIRA 2WQ8A 5E6ZA 3UZVA 4LMQE 3FN3A 4JHWL 5HGDA 3O3BB 2HZHA 1SYVA 4R2GB 3V6ZA 3HNVH 3D50A 1AACA 1OK8A 4LCYB 1SMDA 3OB8A 2EIZB 1QFUH 2J71A 2O26U 3H9SE 3PWPB 4GRLA 4H0GA 1LJMA 1VCAA 5F1NB 4XAWL 4IRSD 4FG0A 3ARBA 6FABH 1WYJA 4ETQB 3F7LA 4GI6A 4GW5B 1AY1L 3BIAX 2HKHH 3FUIA 1PZ5A 4CVZA 1G43A 3BUDA 4HDIB 3BO8B 2GEEA 5HGDB 1NM9A 3F7PC 2DKUA 4JY5L 3VTAA 1FL5A 1BECA 2AQSA 3DOSB 4EKJA 1VGEH 3DTXA 3ETBJ 5DTFA 4R3SA 1M6OA 3VA2C 4ZX5A 5F7MC 3SBWA 2VDRH 2ZKMX 1RMFL 3FN0H 5IFHL 1Z5HA 2AEPH 4EPSA 4PJ7B 4UTAH 1B9ZA 1OPGL 2F5BL 3T5WA 4Z76B 1ZTXL 5CIPH 4ZYKB 3MLRL 2QADD 1QPKA 3JVFC 1F42A 1JNLL 1SZNA 3HC0A 4ZJ9A 5A6IA 1X9LA 2K6YA 3EGXA 2WYTA 1ZT7A 3KPSE 4M7LL 4X9GA 1ZHLA 1SOQA 3CZEA 5GRZA 3QNYA 3HZKA 4WU5A 2UY7B 1QNZH 2NPLX 3VD2A 5I75C 5HYJE 2XIIA 1G7LB 3FRUB 3MSPA 2C3VB 1RJYB 1HNYA 1PD1A 1CGVA 4NAQA 5E9DD 1UWGL 4H44C 5DHDA 4EDWL 3VRLE 5IT2L 1DQMH 5EUOA 4XC3L 2PPFA 4NZRL 4XMPL 4C4UA 1B4LA 2C7FA 5KVEE 3IGAA 1UURA 1IGTA 2VLKB 4GG8A 2PCPA 4UT6H 3KWTA 3B2VL 3DGCR 4XTRC 4OQ1A 3H7BB 5F89B 3V55A 3AY4A 4X6DA 4AGLA 5D7IE 2EDYA 3KYOA 1X7TA 1OGSA 1ET5A 1GPOH 5J89A 3LNIA 4K9EH 5C6WH 5H4ZA 4A04A 3MOBH 1MCPH 3L4UA 3P2TA 2VITA 4D9RE 1FNGB 3S5LA 4ODHH 3GSVA 4JO3H 5F0JB 1QBAA 1VAHA 3QAZC 3P3TA 1KFGA 4M7KH 1BZEA 5GISH 5JW5A 4OJDH 5GGTA 4FTVD 4JO1H 2CHZA 4E9TA 1N5YL 3QO1A 1G6RH 1K6QL 4UT9H 1ZOXA 4NQCB 1N2RB 2CDGB 1EEUA 4OCLC 2YPVH 3D18B 3D4YA 2GJ6B 1COBA 3PWLB 2I24N 1GGCH 1QR4A 2R1WB 5E24E 5EBMA 3ZBMA 3CGTA 3PJSA 1HEZB 3HBZA 4P9HC 5FGRA 3ATBA 5L7XL 5I66A 2P8LA 3AM8C 2RCSH 3L5WA 1LE9A 1EAPB 4PJ9B 3V9EA 1AKJD 1E67A 3LYRA 1JPST 2OYMA 1QLEL 1M9WA 1RZQA 1NIFA 1ACYL 4TNWF 5C08A 3V9FA 1ZK9A 4ZUSB 4A7GF 3GK8L 3E2HB 3CXDH 5D9SB 5J6GB 1E3ZA 4GO6B 2Y9RT 1S78D 4PRDB 3SGEH 7FABL 2E9WA 2EVFA 1H3WM 4LSQH 2UZIH 3QJHA 3B9EA 5K9JL 2IEPA 1A7RH 4PJXA 3D87B 4D8PB 4N2EA 2AK4E 2WUCL 4XVJH 5G5DA 1J5OL 3ZZ1A 1DE4B 5H2BA 1FV1A 3D2UB 4HH9A 2NW3A 4ONGH 3BWSA 1X5ZA 3VXRB 1A7QH 2NUTB 2VSKB 3CFNA 2UUDH 4IBUA 1X5KA 3B2MA 3AAZB 1XGRA 2DQFA 4PREA 4ZO6A 3B56A 3MV9A 3SKNB 1BPLB 5DTFB 4XP6H 1EFXB 5ACZB 1NFDB 5D1ZC 3WNLA 3KWUA 1AP2B 2NZ1A 2ZOUA 3VG0L 4PJIB 3K0YA 2X4PA 1M7XA 5D6CB 4PJBF 4PJXB 2DMBA 1N67A 3WDIA 5T1MB 4PM1A 5GIRB 1N6QH 4GPVA 1BWWA 3I6LE 4PGBA 2NYKA 3MGTA 4FQQA 4JAMB 3BSZH 3NCJH 3QWOB 2M2DA 4Z7WF 2XA3A 2WN3A 3FC8A 3QEQB 4K71B 4FTVB 1JDCA 4WWKC 2AMGA 5IEKB 2ERJB 2FECL 3ZZSA 4I9WD 4JKKA 2A9ML 4Z78A 1NEUA 2DD8H 5CEZH 4YN3A 4AENA 1JCKA 2IANA 1RY7B 4E41A 2WO4A 3U9UB 1RZFL 5CP7A 5HYQA 1X7QB 4WI9A 1RXLA 2JJWA 1J7VR 1G7PB 2NY5H 1ZIBA 2NR6A 1CLCA 4ZOCA 2IV9A 3PWJA 2BNRE 2K3HA 2E59A 2J1ZA 4LARH 4GO8A 3V0DA 4XCEB 4YSCA 5AB9A 1JYWA 3BUBA 4N20A 2GSMB 4AT6A 2VDKL 4LBAA 1SHWA 1SLWA 3MPCA 4JPIA 5KAQF 1VGEL 3GJEB 4X42A 1U6AL 1CF1A 5SWZB 1T7XA 4IDLA 2VDRB 4F7MB 3BEWA 2V17H 1V7NL 4NI6A 1EGJA 4N0FA 4UTAL 4PIBA 2P42B 1FNLA 4GQ9H 3V6OA 3WEOA 3K6FA 3DYOA 3OKMA 1RZIB 1UT9A 5DK2A 3PRZA 5F93C 3SCMA 1KENH 2DI9A 4YXHH 1KGJA 1BA9A 1X4YA 1RL1A 1YN7A 4PS8A 5HYSG 4CILA 3CK0L 2AJYL 5J6HA 2E9JA 3IDJB 2VGLM 4FX5A 2AAAA 2KPNA 5E99L 2HFGL 5F9JB 1OTUC 2DS4A 5F70A 5C8JB 1FLRL 4JRXE 2JE8A 4AYFA 3FCBA 3A3YB 3EH3B 1X3DA 2D3LA 4RFNC 3TPUA 2PW2A 4JY4A 3RVVD 4XC3H 3ULVH 4RWHA 1DCEA 1NANH 1P4IL 4LCCC 3O3EA 3TEXA 4A7SA 5C0DB 2DQJL 3DUSB 1EO7A 1BFOB 2CR3A 4QWWD 4OLWH 4K71C 5IOPA 4AOFA 2QV2A 3ABMB 5HHQA 1OE1A 5IB4B 4AYFB 1KEGH 4AK2A 1G1KA 4DW2L 1L6PA 4YDKL 3TOPA 3GWJA 4EAEA 5F9JA 1E4KA 2DWEB 2F15A 4P2RB 3SKOA 4XR8C 3ILPA 4NLHA 1DP0A 3JZYA 1G4MA 3BH8B 4NKMA 4S1RH 2KPWA 3I6SA 4MJ5B 1U58A 5IKCB 5I24A 4UT9L 1CT8A 4LLDB 5DJYB 5ANMB 5A2AA 1BWMA 4HIJA 2VM9A 2FHFA 2NDGA 4K94C 3EDFA 4IRSB 5T3XE 3EGDB 4WFGD 4MNQB 5E4OA 4PLJD 5KANI 4LEEA 4PYHA 2MNUA 1ZLUH 3D0LA 1E5UI 3MBWB 5JIHA 4XP5H 2XWTA 2XPGA 4BWWA 3EYOB 2E7DA 4XXWA 1ETZA 2IGTA 1G5GA 2GTZB 5D4QA 2XTLA 5D72H 2HJFB 4OBRA 4WUUD 3SE4C 5MENB 4AWJC 4GKNB 5FO9B 1RJLA 2E5EA 2UXTA 5INCB 1B3IA 3IJSA 3HLAA 4ACTA 4C56E 2CKBL 3WEMA 2EDLA 1MFDH 1RFDH 2W88A 4QWWC 1I8LA 2H0JA 2AGJH 1G7PA 4IJTA 1U41A 3IFOB 3UBXB 2PTUA 3SKJL 4FNTA 1DJZA 3L4TA 4ELME 1J0HA 1J8HD 4OZ4B 2CLZB 3SE9L 3QWRA 4CKQA 1FN4A 3DIVA 2JFCA 3N40P 1H0DB 4XO9A 1HZHH 3PE9A 1UXSA 4U1IA 4U1HA 5EA0L 1K8DB 2ADYA 4FTVA 4LP8A 3A67L 2ADFL 3TO4C 3BZ4A 3Q2NA 4LQFH 4D2NA 2B8OT 5IR1B 4LIQH 2RTTA 4NWUL 2RHEA 3F62A 4PJDB 4JM2A 2CHDA 3UTZB 1TVBB 1NDGB 4F8LA 4BXVA 3HZ3A 3IKCA 3V6ZB 1MJ8H 2P8MB 2XOTA 1A9EB 3BSHA 2IBZX 1QO3B 3GMMA 4DN4H 3DX2A 1SXCA 2EAEA 2PW1B 1K85A 5KEZA 3WTUA 1CTMA 2LFEA 1EA9C 5F6IB 3D30A 3HG1D 3PAYA 3P9WB 2Z31A 3BP4B 1Z3GH 3N50A 5ERWB 2Z4QA 1UC6A 2GEQA 3B83A 2EADA 4G1MA 1TT6A 3VXOB 4F7CA 2QQQA 1UWXH 1JZ7A 1JAEA 2XY2A 1A7PH 4PTUA 5EU6E 2K9FB 5E2TL 3V4VL 2R2BA 2XG5A 4W9GC 4F3FA 2QVTA 2JVUA 4K9EL 1MOEA 1D7FA 1W0VA 2PXYA 5E5UB 3PYCA 5C9JA 3ZUNC 3WAJA 3L3GB 4M7KL 4JBSA 3FULA 3APMA 4K8RC 5B38G 2IQAB 3O8XD 1N5YH 1CU4H 3VSVA 3GINA 4PGEB 4XMKH 5CBEA 2X89A 5LCVA 3DYMA 4CVWA 2WLKA 3PV6A 2CD0A 4LLYA 3T09A 4BJLA 2D31B 4FFZL 2F58H 3ECQA 3S4SG 2Z1PA 1H5BC 3QCVL 3U2IA 1T2XA 1T7ZA 4FQLL 4JE0A 2YK1L 3PJSB 5HDRA 4XVUD 3I3BA 3OR6B 5B3NA 1EO8H 1DJGA 2DB8A 1UEYA 4J6IA 3EOYG 4NAJA 1E2VA 3SBQA 2ADGA 4LB8A 1U8NB 1DFBH 1OTTD 35C8L 3GRWA 3T4YB 5CBEB 1XCQA 2KUTA 4YHNB 2YA1A 3QNZB 4NO2B 2H47C 2Z7YA 5AOJA 3QO1B 5TF0A 1URLA 5TPWH 3X3FH 4F7MA 1BVNP 4PJ6A 5L2KA 4JG5A 3VX0A 2AK4B 1OW0A 4LSDA 4N2CA 4ZPTA 4OQTL 4LLUB 5D1XC 3GMPA 4ZSOA 1OLZA 4ZTPH 3S5LB 2H0FA 1B0GA 2QDWA 1ITCA 3ZRSA 2R2EB 1ONQA 4HPYL 4PRHA 3TN0A 1UXWA 4P3WA 5D1XB 1TQSA 4F2ME 5GSVB 2N01B 3HKZA 3DJRA 2VABA 4ZMAT 4AYEC 3H7BA 4NO0B 4U3CA 3ALWA 1QSVA 2W80C 4HIEB 1R6VA 2W9DL 1YUHB 5BV7L 3ULVL 5A2IH 3R06A 3ARBC 2A9CA 2VDML 3QUXD 1HHGA 2DQUL 4MJIA 4C59B 1YEJH 3H6JA 3QDMA 2JWYA 4HLEA 4WGKA 3KL0A 2V7NB 5F9DC 3ZKXC 1SVCP 4HWBL 4OLWL 3MI6A 5FW8A 3QPXL 2A1WL 3BAKA 4LAJH 3LRLA 4MB4A 4NQEB 2XFGB 2PO6D 4ODVL 1D2OA 1TTGA 4XXWC 1USQA 3L2NA 1TSHA 3W82A 4ISVA 4MNGA 1JXGA 4YPGA 3IMBA 2AJZB 3QIUB 4G11A 3QI9C 2P52A 4HG4K 2D73A 4K3JL 1FPTL 4LCWA 5I6XC 4POYA 3NCEB 4WO4B 2EDWA 5D6CA 1PIGA 3GKWL 3QIBB 1M7UA 4L1HA 2H9GA 2ZYSA 1TZGH 1VFOA 1KLFA 3DGGA 2BC4B 2HB0A 4U1JB 4ZTOH 2F61A 5ACMA 2Z91A 2K3TA 1NAMA 5J56B 3BQVA 4TUUA 2EDQA 3IAPA 5JYLA 1HHHB 2B4CC 5DVLA 2CPCA 3CFDA 1A9VA 3QBTB 4URKA 1E7VA 5AL0A 3GUFA 2KYIA 4KZEL 4S1DC 1O6VA 3BKCH 1ZXQA 1FO0L 1IARB 1ZVSA 4G8GD 4LNVA 3RGVA 2O61B 2EZ0D 3GSWB 3QDJB 4XPTH 5DWUH 4U4BA 5KSUA 3MTRA 1QBLL 2BINA 4TPRH 3ZYZA 2O61A 3QNFA 4ETQA 3EYOA 5EZIH 2HFEB 3FO2A 1GJIA 4JRYB 2XPZA 4YVNA 1XF4A 2V9QA 2VXQH 3R4RA 4N0UA 4ZUSA 1FLTX 5CSZB 3V7AE 1KYOJ 3CZJA 4NQTA 1UUNA 1MRDL 1Y6MR 2HLAB 3LN5A 1ZCRA 2DQIL 4JE4B 1AO7B 1FFNB 3GMOB 1Z9SB 3O11A 2ENYA 3OZ9L 3WY4A 1HSAA 5EB9A 4GY4A 1A1OB 4U1LB 4GBXD 2BSSA 5CR1A 9CGTA 2H26A 2W65A 1L5GA 4P5KA 3AREC 5EPMA 3HUJB 4FQ1H 1DQDH 1FZOB 2X3BA 1QFWM 1QTSA 5E2VL 4EOWH 2VXVH 4MA8L 4QT5A 2P7TB 3L4YA 2R0LL 3FT4B 2UWEF 3BWZA 1KBGL 2WINA 2GC4C 4Z6AT 5B3JE 1RZ8A 2XZQL 3NN8A 4QHLB 4AW7A 2CJTA 2VRAA 1IFGA 5HHOE 5IESL 4BFIB 4GLRH 4I3RH 2MTAA 2IVFC 4ZQKA 2FH6A 2EINB 3PHQB 1ZRUA 1N3NA 4NI3A 4DP2X 4JZNA 2JELL 2QSCL 4BK5A 3GLZA 3EJQA 4HLZG 3PWVB 3O8XA 4UQDA 4FG2A 1X5IA 2KZKA 1MEXL 5TJWK 5IB1A 3CG8A 4ZNEA 1W15A 2EE2A 1H3XA 2VABB 1I1FA 1KF9B 3C60B 1AGCA 1Z9PA 3T3PF 3WD5H 1HSBB 1KN4H 2J6WA 1EBPA 1P9MA 2WY3B 2Z8VC 2YGOA 3Q6GH 3U4BH 1DVUA 2QELA 4F7TB 3MRGB 3HVNA 4UAOB 5JPNC 1SDYA 1UJ3C 3RKDD 3RWEB 1OZUA 1G9EA 1BGXL 4N8PA 5E5MB 4RMWA 4ZS7H 2Z7WA 1XCTA 2OZ4H 3P30L 3ATAA 2QQKL 3EGXB 4DKDC 3L3JA 4XMUA 1S7XB 1DQML 2Y4SA 2OKMA 3BSZA 4PRHD 1TMQA 4Z0BL 2BIQA 4Z7OB 3PP3K 4YHPB 3NIDE 4UU9A 1VKXB 5GGRY 4I8DA 1T5KA 3RBSA 2GG1A 2RA1A 5KSAD 4U31A 4OW6A 3I75A 3T3MB 5HVWA 1LNUB 2D3JA 4BZ2L 3WIIL 1LO4L 2X2UA 3QC5X 4L8SC 5J8OA 1D6EB 3NIFE 4QRFA 1ASOA 2XPYA 1IL1A 4NT6B 3BVDB 1FC1A 1GCYA 1I9JH 1TPXC 2XXMB 3NOIA 4NUJB 5ESQA 3REVA 4I48B 5F1IA 3FT2A 2V37A 2XTJB 3HG2A 1LD9A 2VR9A 2C3HA 3SKJH 4QXTB 5L0QB 3FTXA 5IFAH 3EJPA 4HJJH 3NZSA 1T3FB 4L1BA 1ZLWH 4QRPD 4E9LA 4KI5C 5E4AA 3H9SA 4JKMA 1IGJA 1JVLA 2BIMA 1KTKE 2ZUUA 2F53A 4KQ0A 2PNDA 3FFDA 1OAQH 3G6JB 5KANG 4FXTA 3GBEA 5E8OB 4KK9C 4KV5E 3ZKSD 3AWFA 3ML8A 4EI6B 1F4XL 3AU0A 1LO3L 3TF7C 2ZWLT 1UZ8B 2BOCB 3EOAA 1M3IA 4UT9A 2HUEA 4PJIA 2WAQA 4BWUA 3FRPB 1EZUA 1AGDB 4N0YL 2B3RA 2HLAA 4A2HA 4X4ZA 1R3LB 3SO3B 5ABDE 4UYQA 4U6HA 4M6MH 1E6JH 1TNMA 4EN3C 5I5RA 2YO3A 3CXHK 4BSVB 1IM3D 5D7JB 4YIQA 4PRIB 1S7UA 1J5OH 3WLBB 4UIKH 4LSTH 2X9ZA 4I77H 3LEVH 5BQ7B 5E6YA 4W9JC 5BO0D 2HUHA 1A7QL 2LU5A 1K4DA 1WZ1H 1UEMA 1L6XA 3IYLW 3RGVB 2CGYA 3VQLA 3MLRH 4LRIC 1TKWB 4X7CC 1O5PA 4POUB 3VWJA 1LO0L 3OV6A 3PGFH 4DT2A 4EUPH 2AXJA 1MVFA 3DUHA 4G7YL 2E7CA 4K94H 5LAPA 5CR8A 5I6OA 5FLVA 2KC0A 1XHHA 3L3OA 1Z0MA 1R17A 4XMKL 3BFQG 4OCSL 1CTNA 1XAKA 2ADJA 4N5EC 3RWDB 1J0YA 1WAEA 2WLLB 5E5LA 4W93A 4KZ0A 2H2SD 1QMUA 2XWTB 4P9MH 3TBCA 3LPFA 2XTSA 4HKZA 1F1AA 3HZYB 3BWUC 4UUJB 2FB4H 2EIDA 3SBWC 1LWJA 5EEYA 1Q9OA 1D5XA 4R7XA 2Q1EA 5BNXD 3A22A 3TZVD 3WMPA 2IQ9L 5IBTH 2MQCA 5EU3A 4Q6YA 2Y22A 3FFOA 1N9PA 5AYUL 4MKTA 4HZ1A 4Q4EA 3D48R 1NC2B 1I1AB 5B1JC 1SF3A 4AVIA 4NO0D 5C3LD 5HJBA 3A24A 1AOHA 2QHLA 3BLBA 2GYSA 3L3GA 5IB3B 2BIPA 4V2BA 2YAMA 1I7ZB 4HUVB 4DP8X 1CXLA 1CLZL 4JFOA 1CDUA 4HJGA 2XG5B 4XC1L 2IPKB 2EVIA 4OJYA 4ZSOB 4YSEA 2AQRA 2NY4D 2Y1YA 3DVGA 3P3SA 2Q0ZX 5GGQL 5FR3A 1IBFA 1P7QD 4RQQB 1X5MA 3OX8A 1H19A 4Q4IA 2VAJA 4PS7A 1ULVA 1AJ7H 5CEYB 1IKNA 1BXAA 3NZHH 4UIMA 4AQ1C 1YDPB 3NJHA 2BCKB 1O0VA 3IT8D 1INDL 1UA6L 2F5AH 4JLRA 2JI1A 4MXWH 5AB1A 3CDGA 1MHCA 3L48A 3IU4L 1X5YA 4Z0XA 4DP5X 4EQ3A 4YL9A 5CN2A 2VL5B 3VXSE 1RURL 4TM9A 5BMFH 1HI6B 5KYNA 2C5DC 1R5WB 2H8PA 3KPPA 4HJGB 4NB7A 1PW3A 1HSBA 2OAAA 3OB0H 3AREB 2FATL 4FYSA 3VAEA 3CHOA 4UM8A 2QQKH 5F3FA 2VC2H 2NY5C 4UZSA 2E9GA 4L37B 3B4NA 1JNNH 4XN4A 4PWEA 5HJ3B 1QP1A 3VFSA 4K5LA 4XX5A 1NOLA 3ZDXF 3GS0A 3T08A 3CN0A 1GR7A 3OLGA 1H6EA 2L7EA 3GSWA 2P3YA 5FGBC 3CVCA 5B1AB 4HWEH 1S7UB 1RJZB 1UYWH 1XMWA 4FJ6A 4GKZA 1NINA 5MP6L 1P53A 4KUCF 3V4LA 1CD9B 3ZZLA 2OBGA 2I9LB 2VLLB 5IB2B 3ZE0B 4DKFL 2WXJA 3N1PC 3O6FC 5GS1B 2VN6A 4KJWC 1ZS2A 1PEZA 4MHHI 1UH2A 1FYTD 1XF3A 4FNUA 4M8QA 3ZPDA 4M6OL 4PRBA 4DZBA 5AG8A 1U8PA 3GMOA 1JV2A 2JB6B 4IDJH 3JT0A 3US9A 3S34H 5IG7A 1OAYH 4X50A 1W72H 3DSNA 4HSQA 3DI3B 3QHFH 1H3PH 4UAHA 4KK5C 4MNQA 4MNGB 1E3XA 3HE7C 2HVJA 4HKBB 4HLZH 5E1AA 2VJ8A 4JQVA 4JRYA 2ZX9A 4WV1A 4KOCA 1CLVA 4P46B 5T1LB 5D71L 5FA3B 3L95B 2IAMB 4J4PA 5C09D 1U92B 2GTWB 4RISL 1N6UA 4JG1H 4N3TA 1IGCL 3S5LG 2GB2A 1KYFA 2MKWA 4MJIB 3QUGA 3T65B 5BUAA 1ZA3A 2NTSP 1A6TB 2EH7L 1I7RA 3MLUL 4WW2A 3N1GC 1WUNT 1G7IA 3RDTB 4YHIB 5D2LF 1AGEB 4E2OA 4M5ZL 3SYCA 2EYSB 3VXUB 3IXAB 2X12A 5E56A 2V2XB 3EBGA 2HRLA 1SN0A 2CHWA 2A7BA 4PJ8D 2ZAHA 5BVJA 4PI2A 3D51A 3D69A 2HT3C 4JL2A 3Q6GL 4HFWA 5I8KH 1J05B 2VW7A 2ADFH 4MA7L 3QDGA 3U1PA 3O9WC 1J86A 3Q06A 2AJYH 2DKMA 4GBXA 3AUWB 1J0JA 4PJFA 1T20B 3WS3B 1XR8B 4QOKD 2XT1B 1KGCD 1CE6A 4DOHB 1BV8A 4X8XA 2D3VA 4GAAA 4DAGH 2A77H 3MACH 3DVGB 1P1ZA 5LBSL 3APFA 4KO6A 4DK6A 5FKPA 1E4WH 3KWWA 4EI5C 2FGWH 2UVFA 3FZUD 4HIIA 4X6EA 3UOAB 2WLIB 1FVEB 3T3ME 4GAYB 4LK4A 1KLGB 1TYEB 2EDMA 2G3XA 5F8RC 4G9DB 1Z9OA 1T0NA 3C5JB 3KH3A 4HKXA 3EYFB 2JSFA 3P69A 5KSVA 5T3XH 2WXGA 2MHAB 5J0BA 3ARTA 4BZ2H 1BHGA 1BEXA 3H42L 3RB5A 5HTSA 1KFAL 3GSQB 4F8NA 2BHUA 5A2KH 3BKML 3TZVB 4F3FB 3PHQA 4NXKA 3NZUA 2ZXCA 1GTNA 3LB6D 4MB1A 1NUGA 2APWA 4JFEA 4IOSA 5DUPH 1IQWH 1GS7A 2VE6A 2XWBA 3DX4A 1S78C 4HF5H 5KSVB 4LLVA 2VXUH 1Z9MA 4RAUA 4W70A 4B9JA 5LXVA 2DV6A 1ZY9A 4N4YB 1FZMA 1JI2A 3ULUC 3RGVC 4MQ7A 2YPLB 5FOBB 5LQBH 3NIFF 4NQDB 1ZDSA 3IGFA 4JMXA 5EDXA 4M6NH 3LNDA 1LO3H 3IVKB 4R97C 1ZLEA 1UOLA 4IBTA 35C8H 1X5AA 3S37H 4P5RA 4CMMB 4OVVA 1ZVHA 4FI7A 4UOQA 2EXYC 5IB1B 1QZNA 3DSFH 3Q1SH 1XCXA 4JM4L 3RFRA 1Q72H 4PEEA 4PJFE 4XNYH 4QRUB 2FL5A 4UTBH 2V33A 2CU9A 2ROYA 2QZ5A 5A16B 1R1CA 3BIBX 3ARGA 4N24A 5K1JA 4A7UA 5FFGA 2FE0A 3T6XA 1UASA 3WLBA 4NNXB 3GZKA 3JXAA 2Y07H 4AKPA 4KUCD 3PJNA 4JQXA 25C8H 3ERXA 4WWKD 4JFFD 1MQ8A 3OMZA 32C2B 2B4CL 1H3TA 5FUZL 3FF8A 3IRCA 2Z91B 1RSYA 3Q2VA 2HWZH 4HOWA 3DRQB 3LKSA 3VJ6A 4NC1C 2ZF9A 1DEDA 1KPVA 3EOAB 3FSZA 4LXFA 3T8XA 1MCIA 5DS8A 1YEKH 3ULUD 2BSEA 2XPGB 1VZGA 2A83B 4MHHG 1I3UA 2F53D 2WBKA 2P5WB 3VXRD 2NY2C 4P9ML 3LH2L 4PP1C 5IR1A 5KS9A 3EGDA 1QVOB 2OW6A 4LGPB 5JHLL 4N2AA 5JPMC 2R27A 2FSEA 2EIZA 3HBGA 3SDXF 1LEIA 3OLDA 2EXYD 1JV2B 2JB6A 4OFPA 2EP6A 5G2NA 3DIDA 4BQ8A 1JFHA 1KGIA 2H3NB 4F8OA 2NXYB 4RMBA 5DSCA 1FF5A 2NTFB 3E6FA 3FB5B 4JO2L 2YPLD 1MJ7L 5F1IB 1RVFL 3ZDZF 4CBZA 3O2VL 3QJUB 4JN1L 4EN3B 4TQIA 3CFDB 3SSGA 4KVNH 1H8NA 3OKNA 1OIOA 4JPWL 4NN6B 2WMPA 5CLZA 2UWEB 2CO6A 1GJUA 2J43A 3WNKA 1BIHA 4AE1A 3PCYA 1MUJA 2H1PH 3GXIA 1FE8H 1WZKA 2WC7A 3OWRA 4K4KA 4M5YL 4OZHB 5AALA 3OKKA 4OAWA 2YAHA 2WD0A 4BSWB 4KI1A 4HIHB 1RMFH 3HCVB 1G7MB 4HWZA 5LN8A 4FQLH 1AHKA 3RTQD 4KHXL 4PS4H 2DQCL 4ZMWA 1D7DA 4L8SA 3IGAB 5DEJA 5LCVL 2EC9T 4AH2B 3ZY7A 3VQ2C 4AY0A 4PP1D 1FZKB 5AW5B 4AVKA 5SX5K 3DVIA 5HGHA 4M7LH 5DC2A 5KSBA 4TLTA 5E9DE 3EDJA 4JFXB 4ZO7A 4KDWA 4ZW8A 1CE1H 2WZPA 4FS0A 1RURH 4YSPA 1CF8L 4F24A 2EC9U 5DJ2B 4YUEH 5CEXA 5BRZA 4L4TD 1PNCA 4KKBD 5BS0B 3EJRA 4OLUH 4P2YA 2RQEA 3UZEA 1U30A 1UH3A 5AVZB 3HTLX 1MPAL 3DV6A 3AB0B 2ICEA 5GGVY 4KXBA 4NIKB 1INQA 2MQ0A 4NM8L 1F3RB 1YY9C 4PRHB 3BJ91 1H5BA 5L6YH 1EHLL 5CINH 2KKQA 2Y1AA 4IOSD 4CADA 4HJ0D 1GCFA 2G3NA 3B8SA 4HFUL 1PS3A 2MSPA 2W60B 2BRQA 4FABL 3WUWG 2UV3A 3DARA 2MOQA 4M43L 4WTZG 3T0AA 4CGTA 4L1TA 4RX4D 5BRZB 5D5MA 1FL5B 3AXLB 3F04A 3QWRD 5F7AA 1XF5A 4TKWA 2CHXA 3VSUA 4P2RD 3O2WL 4AENB 4AKOA 4BGDA 3V5DB 5FC9A 3RHWF 4UQ9A 1BGXH 4UANA 5E4EC 1GMIA 3WEBA 2AXWA 4KGLA 4X8CA 1HKLH 1FZJA 4YDVB 3GXUB 1QI5A 4ODUB 4HGWA 3VFUA 3WFHB 2NXYC 2CLRB 1RZJC 4L8DA 4D3CH 3IK2A 1RI8A 2AK1L 2VLRD 3EFDL 4HMCA 1GS6X 4QOKA 4JFTA 1FSKC 3POCA 5KVDE 1VENA 5AUMB 2AFNA 1RK0B 2EXSA 2HT4D 4H13C 4YZFE 1UXMA 3G08A 2E74C 3QW9A 1CI3M 4B9FA 1OAXL 1CIDA 1QLFA 3E3QE 3ZYJA 3MTXA 1MHHB 4WWKA 2K1MA 1S7SB 2ZD0A 3CXDL 1VPOH 3C6SA 3MLZH 5TE6L 1ZWIA 5GGTH 4Z7VB 4F33B 2A0LC 4G6AC 1Q9WA 3EZ8A 4JVWA 4XX1G 1ESOA 3O9WB 1M7DA 2WUCH 4Y9FA 2J1WA 4YK4B 2OK0L 4KBPA 3ULUF 2BOBB 3OLIA 1WK0A 4F9LC 5T1LA 5AUMA 3UAAA 2R23A 2XKUA 5DJXA 1DQKA 4P3CL 3MRDA 3K4DA 4EUPA 4RDBA 2WAHA 5E1AB 4MA7H 3KW7A 1CYXA 1XF2B 5DFVD 2ZP8A 3IJEB 1MHEB 3SCMD 2H0PA 2E6QA 3AY2A 4OQTA 2J8UF 3P0YL 3U0TA 5ES4B 3MOAH 3CC1A 4KVPA 2VLJD 5KJ7E 2BXYA 5KW9H 4NUGL 2C9PA 3OR7B 3KVDD 1HEHC 2ICWA 1IKNC 2QVFB 2BNUA 2J1YA 4FFYH 5K9QG 2VTFA 4DO4A 2WKGA 3PQYE 1XGRB 2DQFB 4PREB 4WVRA 5F7HA 3JWNE 5FFLA 3F7KA 4ODWB 2LQRA 3ZRFC 3EADA 2F53E 5D2NB 3NZ8B 3V0HA 3IAQA 1S7QA 1CN4A 4JPVL 1RJLB 1RZ7H 4R5XA 4HT1L 3FRPG 2YKLL 4G6ML 3TT3H 4HK3N 4G6AD 2AABH 4O2FA 5MEQA 3TZVA 4NNPH 1MWAL 3MV7E 2Z1KA 3B1UA 1K3ZA 2XDHA 1JNHA 1UATA 3MRMB 3K8LA 4FZ8L 1Y1DA 3Q2WA 3AADB 2ZXDA 3FB7A 2BVUA 2Q8BH 2IIJA 2VDKH 3IF1A 4RWYL 1OB1B 5KVFL 2RFXB 1C5BH 5AKVA 3CBRA 4HHAB 4XE5B 3M17B 4G3YH 2QSQA 3L5XL 4HD9A 1UZ6E 4Z7OE 3OR6A 2Q6WB 5DUMH 2Y6SC 1USZA 4PN6A 1UOWA 5E6RB 2WBJC 3NIGE 3VFOA 1ZHKA 4ALAC 4DK3A 3RVXC 1P1ZB 4L4VB 4MYWB 2WNXA 3LS5H 2DQCH 3O6ML 3MCKB 4Z7UF 2DBJA 3L3HA 2XZAH 5FCSH 4TTDD 4CN1A 4KI5E 4PGEA 1TLKA 3KPSB 3O6FA 2FIKB 5I8OL 1HOCB 2JXMA 1R0AL 2Q5BA 1S9XB 2YQGA 3RWEA 2ZJSH 1IBBA 1XSJA 3BT2L 4L3CA 4C4KT 1J8HB 1J8KA 2G5RA 4EO5A 4CADB 2C26A 1EK3A 1FNGA 4U0RB 4P2OD 1XGTA 3ARDB 4JPIB 1HILA 3H9SD 4BA0A 4TSAH 5DD5H 5DWPA 1RPQA 2NY0C 1DBKL 2DQEH 3VI4B 3X14B 3D0VA 3UBGA 5GRXG 5F89A 1RUQL 5K5YA 3FQ2A 3NJGA 4U6VL 4LASL 1NA8A 3KGSA 1V8HA 4TUJB 4AQAB 1PLGH 4N6RB 3CLEH 4OLZH 1BOGB 2IXQB 5CZKA 3OMAB 5CP3H 1HZKA 4OCXH 3IJ8A 5E7FA 2NCEA 1WG3A 2Q7NA 4LBEA 4BA8A 5GGQH 2OMWB 4R0LB 3RDTC 5KAQG 2XN9D 1I8LC 3NFSL 3CVHA 1S9YA 1EXUA 3MFFA 4NOBA 5CUSL 5KWYC 5K39A 1A5FL 2Q86A 3FO1A 3L1GA 3VXTA 5E8EA 2I25N 2OR8A 2UXGA 5KS9B 5D1ZA 5DK0B 4J12A 2YXVA 3HHMA 3MRRA 1LWRA 1UWXK 3MXVH 4YHML 2CUHA 3KLLA 2R9HC 4KRNA 5BOJA 2XA8H 2ITDA 1O7VA 1JHKH 4G6KH 2ZP0T 4WW2F 5EC1A 2ZSVA 2P46B 5EZPA 1N26A 2ZUWA 1FFRA 1TTFA 4Y5XC 1Q9WB 3ARXA 3ZJAA 3FS9A 4IRSC 1RUKL 1KN2H 3P11L 1BAFL 3MXWL 4B7IA 4PG2A 4Y4FA 2AQ1A 1VB9A 2HP4A 1NMCC 2D7MA 2Q3ZA 2V5SA 2VERN 3KS0H 5GSRB 1FO0A 1CGWA 1QWHA 4L8BB 1MAMH 4M7ZB 2Z31C 2YKKA 5IVXA 4D8PA 1IAKA 4JFVA 1EJ6A 2XNAA 4PRIA 4I89A 4HC1A 2N0MA 3OG4B 2FQEA 2X4OA 4OZGB 3HNTL 2J56A 3RDTD 1O9WA 4NJ9L 2PR9A 1CZ8L 2J21A 3CX5J 3O4OC 4FRWA 3K72A 1T1ZB 3CXHJ 1CL7I 4MDJB 4TVPE 1R19A 4PJ8B 4Y9EA 1WEJH 3G6AA 4LHJB 2Q2EB 3U79A 3US1A 1KDJA 3GTNA 4GT7A 3IKKA 3F05A 4LCWE 4D94A 5D7JC 5HD8C 4DUXA 1ED3B 3HI1B 2X6VA 3GSRB 5E1HB 4EUPG 4GSDH 4XZUB 5GS1A 1BZQK 1UWYA 3VNYA 2QMKA 3QQ3B 3Q01A 1BVLA 3VFWB 1AZBA 1GSKA 3ILQD 3D2UA 3QUXC 2F8VA 4HH9B 3OGCB 1CDYA 4ZSOE 1A7BA 2GBAA 2H6PA 5HDOA 3K6OA 4MCYB 4KX7A 3II1A 3WFBH 1F3DJ 2Z31D 3HAEH 4L3CB 1N0LB 3IEAA 1KJ2A 3QDME 1EDYA 1FORL 4HFUH 5AL8A 3PHAA 1GMEA 5JXED 4KU1A 3F3HA 5FA4B 2PCFB 4GIOA 2CCVA 5CNHA 3NZHL 4MWFB 4MJHA 4ZFFA 3O4LB 2GITA 2VSCA 3DURA 3FT3A 4JJOA 1PZBA 2WLIA 2FJHB 1X9UA 1Z32X 1JNLH 4JFXA 1P5VA 5BOZG 4UQ3A 4P2QE 3CVIL 1OARL 3HAEA 2XYCA 4PRPA 3SPHA 3UO8B 3VD3A 4KTDL 1S5HA 5I1EL 2FZ3A 3Q7JA 2C3VA 3AROA 4LCVA 1TO4A 5IWLA 5HY9A 1R5VA 4P5TC 2DJSA 1X6LA 2J2ZA 2YGNA 2G60L 3MLSL 4ATTA 2Z65C 1PSKH 1UZGA 5DR5L 1ZSHA 4D3CL 2OMXB 4LSRH 3UGXA 4CW1A 2X10A 3HAEB 5EF2A 4UNVA 2QEJA 2XQBH 4I87A 4ORZC 1JTPA 2CIKB 2P28B 2ADIA 3GSQA 3J07A 4MCZB 4V1DB 4JUTA 1AAJA 3DK0A 3SQBA 5IOKA 2GIMA 4O4YL 4EI5B 2IQAA 1T6BX 4XPGL 2VERA 1TU2A 2PPDA 4GKSA 4UOJA 1N6VA 2AJ3A 2P8PB 4Y16B 3VB9A 3BPNC 4KWUA 3MOBL 5JDJA 5LWYL 1OGAE 3TA3A 4OIIL 4ZAKB 3DHMA 3C6LA 2KI6A 4EZKA 3RB7A 1YNTB 3QO0B 4U6XB 1CXFA 2OA9A 1Z3RA 4WWPA 4O58L 2QGEA 3DTUB 4RNRA 5IQ9B 4A6YA 4HXBH 2X41A 2VXUL 1JDDA 2W9DH 3FRUA 4AV0A 3TTYA 3ARQA 1G1YA 1JIBA 2Q8AL 2BZ7A 2O1AA 1GAFH 3UJJH 1CJYA 1ZXKA 3GB7B 4Z3JA 2WVTA 1MDAA 2G9HA 3TFKC 4KTEH 1SXZA 1IM9B 1CIUA 3NK4A 1E28B 2FEDD 4QHNA 2RAMA 1FAKT 5GRUH 5GRVL 5E9NA 1S7TB 4JFFE 2YN3A 2WGNB 3DRQA 3LKSB 3PQYB 3D3VA 5EC2B 3VJ6B 3FAXA 4ZMOA 1IX2A 2B5IB 4LZKA 3GK8H 5ANME 4BQBA 1C12B 1TFPA 1V3JA 4F1ZA 1VFUA 5AD0A 1TOXA 2EO9A 3EYUL 3OC5A 4GP8B 3VXRA 1CGYA 2VDPH 3FSVA 4PJ9C 3H8NA 4OZ4A 2XICA 1D9KB 4PRID 3C8KA 5IW1B 4HX1B 3EJJX 4TVSa 3VFSB 1KTBA 3QIBC 2DQHL 4TVPH 2K78A 1BVKB 4NNPL 2ITEA 5AOZA 2ESVA 1V3LA 3I84A 3ZDZE 1IGIH 1BLNA 4K2UH 3QEQD 4A55A 4X7SL 1MFAL 1DBBH 1BQRA 3FUFA 3SDCD 2ODIA 4OJEH 4GIAA 2N0KA 3K6NA 5GS1C 4UDTA 1L0YA 5CZXD 1FFPB 2GTZA 5EZIL 2LTQC 3C2SA 3L5XH 3WU1A 2A77L 1EEZA 2YFOA 1RU9H 2NDFA 2AJXL 2COVD 5JOFA 2X4SA 1QW9A 5CCJA 2CRZA 1J5HA 1OCWL 5F9WB 5KSAC 1AXTH 1GZPA 1P9MC 3QQDB 5M94B 5CFAA 1FNSH 1WEJL 2QKIC 3NCYP 1LK3H 4KNUA 4YLQT 2JQMA 3DX9A 1IB5A 2WN2A 3LRSB 3L9BA 3OQ3B 3T9WA 3LDBB 1MFBL 4PMFA 2TSBA 3BAIA 4EBQH 5KBPA 1HH9A 1X4ZA 2E75C 2PR4H 4WF7A 1PTZA 3BRGC 2PF6A 2YSSA 3EOTH 5J12C 5LXGL 3P77B 2DWSA 1DVZA 3MUUA 1VIWA 1X5LA 1C8QA 5FA4A 3VM5A 4MDIB 5IB3A 3FQUA 5LGYA 3ZDYE 2VLME 3FQ1A 3CIAA 5FYJL 3ZN6A 3SQBB 2YPLE 3MRCB 4I3RL 3CUPB 5CEXB 2FCBA 2I7OA 4X9IA 3RVVC 4NP4L 4QY8B 1HQRA 1GGCL 2V9UA 1IU1A 1NAKL 2P24B 5EU6B 3TYFA 5LG6A 5E1IA 4QHLA 1FORH 3DHPA 4F15C 4JANA 2CKNA 2R7EA 4GKLA 3GXDA 4M6NL 3VGAC 3D6GA 4NUPA 2XUWA 1L9NA 2JKWA 2ZKWA 3JWOC 5LCVH 4KQ3L 4YHNA 1E8ZA 1M2OA 2IBBA 3KCWA 4PJFB 3HZKB 3K8KA 2J8UE 4WU5B 4DGWC 2VDKB 3O6KH 4P3DB 5T33L 2F0CA 3DSFL 2BS9A 2PYFA 2RMNA 4UNUA 1KTRL 1YYMH 4OAWB 5KYWB 4FXGC 2VL4A 4YXLL 1AC6A 1AD9B 2WO2B 2X4UB 3QCUH 3GO1H 4M61B 5E2UL 2Q20A 5C0AD 1MI5E 1RZIA 4XRCA 4QNPE 4FNPA 3A21A 2IWKA 4Z7NB 2UZXA 2VLRB 5AZUA 2VLKD 4M4RA 3VG9C 3RIFF 2HN7A 5ALCH 4XOCA 3RI5F 3ZR5A 3UL4A 1WO2A 2FUQA 4M8VA 3V6FB 3U30C 4YDLB 4U05A 4XPHH 1BMWA 1MW2A 5EZJB 3A5VA 2CBOA 4UQCA 3OMIB 4YSSA 2EABA 5I1LA 4QRPE 3MLTB 5F9OL 4YO0B 3RX9A 1DJYA 2IMNA 4HOZA 4U3SB 4NO3B 1A6ZA 4U0QB 5EWIL 3VTMA 5CLWA 3L4VA 4XCCH 3T1FA 4NJ9H 1A4AA 5CIPA 3MNDA 1K8IA 1LMKA 4NQCE 1GKEA 1ZANL 3OAZH 1SUJA 1NGWA 2CCLA 3TL5A 5CJOH 2NT0A 3R1GH 2YPKA 4LCWB 1XGQB 5CGMA