1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
1WA0X 4NB7A 1W6WA 4A2HA 1GS8A 2JXMA 2BP0A 2BZ7A 1L9OA 1MG2C 1JERA 1E67A 1CUOA 4DPBX 4BXVA 3QQXA 4GP5B 1RZPA 1A65A 2GHZA 3ZIYA 1SF3A 2AANA 2FT6A 3NP3A 4BK5C 1PLCA 4YSDA 4DP6X 2CCWA 3NSYA 1CYXA 3WNIA 5LDUA 3X1NA 4RH4A 1R1CA 3PAZA 4YSPA 2TSBA 4BWWA 1JZIA 1IBYA 2Y69B 2FWLB 5I5JA 1BAWA 4G7QB 1JXFA 1HFUA 2UXGA 1AQ8A 1OOWA 3MBWB 1PY0A 1KYAA 1ILSA 1IC0A 4G71B 4KNTA 1A8ZA 3CG8A 1ET5A 1L9TA 2A3TA 3X1EA 4KNUA 2FQEA 1JZFA 2YAPA 3FPYA 1XMEB 4P5SA 5IY5B 1NWPA 3JTBA 2CALA 3S3DB 4E9WA 2PPCA 5I6KA 1FA4A 3IBOA 2IH9A 1AZNA 4G70B 2FTAA 3ZBMA 2XX1A 2IH8A 2J5WA 1M56B 1PZBA 1XB3A 2MTAA 3H4FA 1E5ZA 3QJUB 4UAHA 3X2QB 5E9NA 4AX3A 1IUZA 4WTQA 3GYRA 4A2EA 3ZDWA 4W1TA 4A2GA 2WO2B 3V9CA 1MZYA 4A66A 4KO7A 1A4CA 1OCRB 3FQYA 2IDQA 1PNDA 2PPFA 3EHBB 2PP8A 1L9PA 4TXVB 3TA4D 3ERXA 1RZQA 2YARA 3JT2A 1KBWA 4KO9A 3TU6A 2IWKA 1ZDSA 3NJKA 4YSCA 2IWFA 2YAOA 4DPAX 1ZPUA 2IDFA 3AG4B 3KW8A 2YAMA 4HIPA 1AANA 1WAEA 3PPSA 2YQBA 4UANA 2FT7A 2HX9A 1PLBA 4HALA 3C75A 3SBRA 1BXVA 3AZUA 1ASOA 2PPDA 4E9QA 2XLLA 1B3IA 2H5UA 4PAZA 1JXDA 4W9ZA 4A67A 2BW5A 5ANHA 2X87A 5B1JA 4KOCA 1BXUA 4BWUA 5I5MA 3UAAA 3PXLA 4PCYA 1CURA 5FC9A 2HRHA 4F2FA 1YLBB 3V9EA 3ASOB 1BQ5A 4EF3A 2BW4A 1ZDQA 2FJSA 1QHQA 1DYZA 2IDUA 4AI7A 1AZUA 4DPCX 1RCYA 5D4JA 2BHFA 5B7MA 2GBAA 3OQRA 3X1GA 2BWIA 1JOIA 1M57B 1TKWA 1ZIAA 1QNIA 3AW5A 4YVUA 3FU7B 2HLEB 2YXVA 1PF3A 2FQGA 1JXGA 5B7EA 2AZAA 2ZONA 2RACA 1PLAA 1NPNA 3G5WA 2OV0A 1WA2X 2GB2A 1FFTB 2I85A 1X9UA 4ENZA 5I6LA 1A4BA 2QPEB 2BP8A 3NJMA 3U25A 2FT8A 5PAZA 5I5IA 2H3XC 3GDCA 3IEAA 3KW7A 3DIVA 4Q89A 4DP7X 1SNRA 3EH5B 4KO5A 1AS8A 3NJFA 1AACA 3NJJA 4AKOA 4M3HA 2GI0A 1JZHA 2BZCA 2HZHA 1SFHA 1WS7A 4HZ1A 2XV3A 3FU7A 4NERA 5AZUA 1NDTA 1PNCA 1PZAA 4DP8X 1NIBA 1KBVA 4AKQA 2WSDA 2H47C 1A3ZA 2LLNA 1GY2A 2HRGA 1J9SA 1JZEA 3NSFA 2QDVA 4CSZA 1TEFA 4DP1X 3OM3B 1OE3A 3NJIA 2XYBA 3T6ZA 3UACA 5I6NA 2EIJB 2DYSB 5I6MA 4YSEA 4KNSA 4F2EA 4DP5X 4E9TA 3RYMA 1E65A 1NIFA 2QDWA 1ETJA 4BXSV 2W8CA 1CC3A 3H4HA 2Q9OA 3X1FA 2XU9A 5B3SB 3T6VA 2GC7C 3FU8A 4G72B 1ET8A 1BYOA 4HAKA 3PAUA 3NSCA 1HAUA 2DV6A 3UAEA 1NIAA 2PCYA 3N2JA 2EIMB 4YVNA 1JZGA 3FYIB 2VW4A 1GS6X 3ABMB 4YSQA 2B08A 1E5YA 1V55B 1SF5A 3FS9A 1N68A 4E9XA 1DZ0A 5TK2A 1KCBA 4E9RA 1GW0A 3ABLB 3T6XA 2HXAA 1UATA 2QPDB 5F7BA 3D12B 4BDVB 4N4YB 3QJQB 3FSVA 5D4HA 2EILB 1MG3C 5AKRA 5B7FA 4GXFA 3SBPA 4DP4X 4HCIA 4L0PB 4NAJA 3OMIB 4UF7C 3EF4A 2EIKB 4DP2X 1J5DA 4X4KA 2VM3A 4YL4A 3CVDA 1GYCA 4ZK8A 1X9RA 1ID2A 1J9QA 3OD3A 2I7SA 5D4IA 3IE9A 3IN0A 1AS6A 1AAJA 3QJVB 7PAZA 3WI9A 2OCCB 2JKWA 2J56A 1N70A 2HX8A 1AIZA 4DP0X 2BP8B 3L45A 3QPKA 4BDVA 2WO3B 2IAAC 1SDDB 3CVCA 3X1BA 1JZJA 3PAVA 1L9SA 2ZWNA 4HCFA 4HHGA 2TSAA 5B1JC 2PCFA 1AZCA 1BYPA 1SFDA 4YSSA 3DTUB 3EH3B 3NT0A 8PAZA 4KO6A 4JHUA 1GR7A 3OMAB 2X88A 2P80A 3IN2A 1JVOA 1IKOP 4HHWA 4A2DA 1IBZA 1E30A 2CJ3A 2IDTA 2W88A 4YSUA 3TBCA 4YSTA 4AZUA 1GY1A 3H56A 3NJGA 2FQFA 3TASA 1SDDA 5I6PA 9PCYA 3QJSB 2CBPA 3HB3B 4G7SB 3S3CB 2MRYA 3S8FB 4KOBA 3TBBA 3S3BB 3UABA 5B1AB 2DY2A 2UX7A 3ASNB 3AG2B 2XXFA 2I7OA 1ASQA 1NIEA 4BWTA 3ABKB 3CDZB 4K9JA 1V10A 1QLEB 3FQ1A 1OE2A 2DYRB 1GS7A 1WA1X 2AFNA 4MFHA 2VW6A 1NIDA 2B3IA 2VSKB 1ASPA 1OCOB 3UGEA 3OMNB 3T9WA 1NWOA 2AVFA 4GP8B 3T71A 2PP7A 2PPAA 3FT0A 1OV8A 2YAFA 4M4RB 1OCZB 1OF0A 2FQDA 2QT6A 2ZOOA 4FA7B 3WKQA 2EINB 1EHKB 5A7EA 1GSKA 2ZXWB 1F56A 1V54B 3NSDA 1PAZA 3QJTB 3BQVA 2J55A 1L9RA 3HEIB 4JHVA 1BQRA 2Q5BA 1EZLA 1AG6A 1W6LA 1KCWA 1PZCA 2CUAA 3CDZA 3NJHA 4Q8BA 2BWDA 4F7KA 1VLXA 2AZUA 1ZIBA 3N55A 1CYWA 5TK4A 1URIA 1XB8A 2E86A 4WKXA 5AFAA 1W8EA 2XVBA 2VN3A 3PLYA 1I53A 1TEGA 2PPEA 2YAHA 2UXFA 2DWTA 2HX7A 2GSMB 3S8GB 3ABGA 2BO0A 3AG1B 3FSZA 5I26A 3NJNA 4HCGA 2XXGA 2YAQA 5B1KA 3SQRA 1NZRA 1OE1A 2CAKA 2XV2A 2GIMA 2N0MA 4P5RA 4QKTA 3WIAA 2UX6A 4CSPA 1AS7A 5I28A 1KDJA 4YSOA 1NPJA 2PLTA 1BEXA 5EHFA 3AG3B 1JVLA 3EH4B 1PMYA 3NP4A 1SHXA 1KV7A 2VM4A 2FNWA 1NICA 1KGYE 3AY2A 2P80D 1T5KA 2UXTA 4AKPA 1ILUA 2R7EB 2UXVA 2NRDA 2JFCA 2XX0A 2PP9A 1PCSA 2IWEA 4A68A 5PCYA 1AZRA 3WKPA 3DKHA 1L9QA 1AZBA 2GC4C 3FSAA 1TU2A 1MDAA 3T6WA 1OCCB 2VSMB 3CVBA 3FU9A 3CZUB 3FQ2A 1J5CA 2XV0A 3GXUB 4QLWA 1SJMA 3PCYA 3BVDB 4GYBA 1AOZA 3SBQA 3WNJA 1XB6A 2DWSA 4N8UA 1FWXA 1BXAA 3NJLA 1KDIA 4A2FA 2VMJA 1NTDA 4GY4A 1BQKA 1NINA 1WS8A 2BP0B 1AG0A 2OJ1A 4YSRA 3FPXA 1M9WA 4FAAB 1SHWA 6PAZA 1ET7A 1ZV2A 2R7EA 3MX0B 1RKRA 4E9SA 1ADWA 3WG7B 2J57A 2Y1AA 2IDSA 1A4AA 4E9VA 2YAEA 4GP4B 1HAWA 4JKNA 4YSAA 2XWZA 4E9YA 2YXWA 1MZZA 4G7RB 5F7AA 7PCYA 3UADA 3FSWA 3NYKA 4DP9X 1J9RA 5B1BB 3ZX1A 1J9TA 2XUWA 5I6OA 2VW7A 3QJRB 3FYEB 6PCYA 1AR1B
chains in the Genus database with same CATH superfamily
1O7DE 4NQCE 5CBEA 1J0ZA 2AJ3A 4D0BB 4EPSA 1TNMA 1O6SB 2Y1ZA 1CMOA 4ONFL 2KPWA 2V2WA 3SKNA 4Z5RA 1LMIA 1H5BC 3S37L 4RMWA 1JK9B 3S96B 1FO0L 1UD5A 4LVOB 1YNTA 5F21B 3EOBA 3BP6A 1KCRH 1KYOK 4JFDB 4TV3A 5HYJA 4TS6A 4JAMA 5CM1A 4BSVA 3OF6D 1N2RB 2OI9C 3UZVB 3RZCD 3WE1A 4G7VL 1BD2B 2G2NA 3D4ZA 1CYXA 2OQJB 3TURA 3R19A 2X40A 4MJ4A 3BD4A 1NCDL 3AREA 5HYQB 1S7UB 5LCVH 1MAMH 4R3SA 1KJ3L 4U1LA 3AS3A 5I1KH 3S36H 1G5AA 2GW5A 5CUSL 3TN0C 4D0BA 4UOW0 5DMKA 3HHSB 4P2RD 1YAIA 4XB8A 4NRYA 2N7SA 4N3UA 3IMWA 4JZNB 1ZHKB 4H8QA 1IC0A 1JK9A 5LCVA 4L29A 2ZSVA 1P5VB 2YKKA 1U8LA 3CCHB 3S96A 2BS8A 4I48B 4CN1A 3VWJC 3VA2C 2BOCB 2IGFH 1NWPA 3OX8B 5I6KA 3IDYB 1E43A 2CR0A 2VN4A 1N2RA 4P2RE 4S0SD 3SDCC 3UZVA 5FHBH 3I9GH 4KJWC 1V7NL 4WEUD 3RTQA 4P59L 1I8MA 2PR4H 1BD2A 2OQJA 1ICTA 3LD8C 5DZNA 1S7UA 1EPFA 4MCYB 3O2DH 4JHAL 1EVUA 1A14L 4X8XA 1TMQA 3CVHL 2VLKA 1DVFA 3BDYH 4OZIE 4KO7A 3RWEB 4L8BA 4BFEA 5BZDB 1ORQA 2PPFA 4C4BA 5E8NB 3O2DA 3VD9A 3CCHA 4TRPL 2BOCA 3S36X 2R29L 1KBWA 5K59F 3O0RL 1KBGH 4P8QA 3WELA 4YSCA 3B7YA 2CRMA 5MEOA 4GW4B 2ESVD 1BFTA 3L9RA 4X7FC 3KWUA 4ZOAA 2ATKA 1QYGL 1WAEA 3GHBH 3P2BA 4MCYA 1BFSA 4YHYC 4M1CC 2P43B 1PLBA 5DJYA 4HVBA 5DHYB 5CEZL 2H7WA 5FA4B 3ATDA 3SCMA 3CZLA 2CSPA 2ODHA 4Y7OC 1XD0A 2AK1H 2W0FB 3TFKD 1SBSH 1YDPA 4M3KB 1MRCH 2ESVE 3RWEA 5BZDA 4P23D 5E8NA 4U2ZA 5DO2D 4KKBC 3C08L 4BKLB 2CKBB 3NN8A 2YGPA 4JPWL 5FFOA 1DQJB 2H1LM 4GQQA 3RBGA 3FQXA 1IT9L 1U30A 4NPYB 3UAAA 5SX5K 4UMSA 2YRLA 1BQ5A 3U1SH 3BQUB 4DN4L 3N41F 2ENYA 2VXSH 4HGKC 1DYZA 1BVLB 5F9WB 3W3BA 2RH0A 5DHYA 1XSIA 5K39B 4TVPH 1KB9J 1H19A 2C1OB 3QA3A 4ZAKC 1OSPL 2BDNL 3DV4A 4X9IA 3VGEA 4F5CE 3LX9A 3TXAA 5HDQL 4BH8B 4P0DA 3BWUF 3F12A 4JLRB 4X5LA 3RPIA 3SZ6A 1X5FA 4XP9L 1N67A 2AF2A 1OO2A 5I8KL 4A6YB 1PF3A 5DEFB 1JZ2A 3DJZA 4B95C 1DQJA 4G6KL 1M42A 4H4NA 3STZB 3WGUB 3KYAA 5HY9B 1EFQA 2Y24A 4WO4B 2HCZX 4NPYA 2F1AA 3MUGB 2QPEB 3HMXH 3DETD 2Z4QB 1GMIA 2IPKB 4HS6B 4I1PA 3KLHD 4A6YH 5K39A 3K6OA 3FN0H 4FXKC 3SPCA 2C1OA 2IFFH 1L0QA 5AALA 1FIEA 4ODVH 3ILQD 4N1CA 3O6KL 4WKZA 3HMXA 5AAMC 3VI3F 1KJMB 4M3HA 4BH8A 4JLRA 2WIMA 1AQDB 2DEWX 2A9NL 2DJMA 5F3HA 3VXUA 4A6YA 2BIPA 5EOQH 3KLSA 4JO3L 3STZA 5HY9A 3L5WB 3LRSA 4WUUB 1AXTL 3ATAA 1R3LA 2NY3B 4DFIA 1LP9B 2V9RA 4WFFD 1BIHA 3NJIA 2JB6B 4KTGA 3DYOA 3N6YA 2Z4QA 4S10A 1YJDL 2YPVH 1A6PA 2J25A 1JVKA 3H42H 1YUHA 3L5IA 3U4BH 2IAMC 2P5EE 3TM6A 1J0JA 3LJ3A 2I69A 1E50A 1XZ0B 3HR5B 4NLHA 5IJKC 3EJPA 1U3YA 2YUXA 1QPPA 3QORD 3AT0A 3VG0L 1KJMA 1T6VN 4RDBA 4F58L 1T89A 2YPVA 4ZUWB 2XU9A 4G72B 2Z3FA 4XN4A 1ET8A 1MCSA 1BYOA 3NOIA 3NTCH 4GW5B 1HYSD 2OP4L 3HNVL 4CN4A 1HAUA 1R3IL 5CR1A 3V0VB 1OT2A 3CZEA 3L5WA 4AVIA 4YVNA 3WDHA 1NUFA 2AEQH 1AGBB 4B3EA 8CGTA 1EDHA 4WUUA 3PGFH 2B08A 3D0LB 4N8PA 1XBRA 2XWDA 4NQVB 3V4LA 3FS9A 3VXQB 1ZANH 4EZMA 3B2MA 1GW0A 3PPEA 3SYOA 5C0NC 5C2BL 5IWLC 2BIHA 3HC3H 3T08A 1C5CL 2A6KB 1XZ0A 4Z7OE 4HETA 4LMQI 2CRZA 3LHPH 4PP1C 1IAKA 5D4HA 5EOCH 4OCSL 3NCBB 4ZUWA 2NTFA 4NI3A 2PTTB 4NRXB 1ZPLA 1S5HA 2Y9RT 2NY5H 2YD4A 3I3BA 3DTDA 4PBXA 4AC2A 1OAKH 4QJ4B 4K23H 3D2TA 3L7FB 4AV5A 4XX1E 5E6IA 3JWNC 4Z7WF 1UGNA 3V0VA 3G04A 4JPKH 3UX9B 2Z35B 1Q1JH 4JPVH 4N9GB 4X7CC 4GT0A 1QFWM 3UYPB 4XPBL 4NQVA 5D7EA 2F74A 5DUBA 2Y36H 3GSXB 5C9JA 1SXSA 5L9DL 1YAZA 2EXWD 4YAQB 4C83B 1BVNT 2QQLH 3QS3A 4WWID 1IKNC 1AIZA 4P5TD 1JNHB 5C09B 2A6KA 5F6HI 4H2CA 4YUEH 4KZEL 2O61B 3HTLX 1SJHA 3T0EB 2VQTA 1XSJA 4JGNA 2K9FB 4NRXA 3RLSA 2PXYA 1RIUL 1CD8A 4OZGE 5FM8A 3L7FA 1V7ML 2PABA 3RX7A 1Y18A 1JRHL 1RJCA 1A4KB 4N9GA 2ICWI 1H5BA 3UO1L 3MRGA 4Y1TA 3RI5F 2WK2A 3RY6A 5CGYC 2A6DA 2R8SL 4NNXB 1CI5A 1MDTA 1MRFL 3M6DA 2M1KA 3OMAB 5DVNA 4ABWA 2K4WA 4XO5A 4A7GA 1DBML 4HWZB 2K9UA 1QASA 1JNHA 5F0PB 5CEZD 5F1NB 3P1VA 1YYCA 4PRAB 5IHHA 4X5QA 2HKFL 1P4BH 1TJIL 2DQCL 3B5TA 3P4NB 2DJUA 5A16B 5JXAH 1Q94A 1NMAL 3IWVA 1N59B 1QFHA 2AJVL 5H35B 3TN0A 2H1XA 3TEZA 2PCPB 3KPTA 1X7SA 3L3OB 3ZE2B 4NP9A 1A4KA 2YD6A 3QISA 1KPRB 5CEZE 4GG6F 2BK8A 5B21A 3BP4B 3NCEB 2MJWA 4NNXA 1UQSB 2F0CA 3OAWA 4N1HB 5CMAA 4UOQA 3VWJA 3COOA 1NIDA 2JCWA 2VSKB 2ZUUA 3NIDF 4YHPB 2JMRA 3SDCA 3T77B 5KBKA 4PRAA 1UEYA 1CBJA 5F7HA 1FYTD 5JQ6H 4HKZB 1P7KA 5ALCL 5HDBF 4HSQA 4JL1A 4WI2A 2QBWA 5H35A 1TQVA 5GGSY 3U4EB 2ARJB 5DHVB 4DKEL 2PCPA 5LXGL 3ZKMD 4D2NA 1HIMH 2B4CL 3BQVA 3C9NB 4FXGB 4OFVA 1CXKA 1GYUA 4X9GA 3GZQA 4Y2LA 4EVNB 3FONB 1XSOA 5F7UA 1PZCA 2GK2A 1IGML 1FYTE 3NESA 2AV7B 1VLXA 3HBGA 1J05A 1XT5A 5DURD 4BBWA 3MJGX 3GF8A 4HH9A 2E86A 1W8EA 1OK0A 3LIZH 3QWRD 5I24A 3QRGL 5DHVH 2YAHA 2FL5B 2UXFA 3KWWA 3ULVL 2DM4A 2HKHL 3S8GB 3ESUF 3MSPA 4M5TA 3OPUA 2WTOA 3VD5A 3VXNA 5I15H 4KHTH 4K7PX 3QIWC 1F11A 1MCEA 4UTBH 3L3DA 3LIZA 3AXLB 2N0MA 3U4EA 2ARJA 5DHVA 5DS1A 4UV4H 1NBZA 1AO7D 4FABH 3PFUA 3QE5A 2ZG1A 5EBMB 2HFGH 4FXGA 5ICUA 2G2RA 1YQVH 4C54A 2WVTA 4JHWL 3AS2A 1BBJB 3FONA 4IRSD 5C3LD 1JMXA 4UTBA 1UD3A 3JV4B 1A5FH 4PRHD 3F7RA 3HI5L 2V2XB 3CMOH 3DO4A 3ARPA 3L2NA 5K5YA 1AO7E 1CDUA 4YR6B 4LQFL 2DIBA 3VNZA 3D1MC 3APDA 3F7LA 5C7XH 2J88H 4WW1B 6CGTA 2VR3A 3QUXC 1AKJD 4FA6A 4RMBA 1CFNB 5FFGA 4NUMA 3F64A 4NBXB 1V3LA 4C4KO 4TQ8A 4PJ9C 4X8CA 5J06A 5KJRL 5LHDA 4ONHB 3WTXA 4EUPB 4OJFH 4UAOB 1U93A 2WWNA 3AXLA 4GSQA 1LEGB 4PRHE 1ADQH 4ZAKA 2DOCA 3G9VA 5EBMA 1LE9B 3L1OL 2X0UA 3QG7L 4FAAB 1YEKH 4TPRH 1BBJA 3BIKB 1A6VL 3L3JB 4LPXA 4G9DA 4BFRA 3FB5A 4ZZKA 3JV4A 2RGSA 3EIFA 2RB8A 1REIA 5GS0D 1ADQA 4EUPH 2GVYA 3VXOB 4CU6A 4OZ4A 2AMUA 4GP4B 4NQED 3QQ9C 4X6CE 4YR6A 1IMHC 4YSAA 2F7QA 3T8XA 4B5EA 4WNQB 1NMBH 4WW1A 1ZEAH 2R56L 7PCYA 4U0QB 4XWGL 1CFNA 5E6ZA 2JCCF 4TL5A 5KSAC 4MA7L 2VWEE 1J9RA 3CU7A 4E41B 1HCYA 4EUPA 2YK1H 2X9WA 1LEGA 4FXKA 5FOBB 1W6WA 5D7IB 1QSZA 4NQEE 5KW9L 3CHSA 2R9HD 4LU5L 4XO9A 4Z7VE 1ED3A 3WUZA 4WF7A 3JWOC 3MLVH 1CN4A 1F13A 4LGPB 1XWVA 5HHXL 4OTXH 3QEHB 3MODH 1MOEA 1QRND 2X4NB 4WNQA 3NQKA 4MJIA 3HIZA 1E8WA 5C6PB 1H6EA 3D50A 4QRPD 3NCCB 3WY3A 4MNQD 3X1NA 4DETA 4E41A 1ZTXH 3IKCB 1YEGH 4HMCA 1QA9B 3OKYA 4AEHH 3BZEA 2O5YH 4JFOA 3T04D 2K6ZA 2A9DA 2NTSP 4G7QB 1R24B 5I5JA 2CPUA 1NLBH 1QRNE 1DBKL 1R19A 2UXGA 4CJ1A 2FGZA 2XWRA 3Q8CA 3S8WA 3EBHA 1TOXA 3CG8A 4QRPE 2UV3A 1YPZB 3OB0K 4G5ZL 4MNQE 3X1EA 4Y89A 5IY5B 1XMEB 4X8GA 5KN5B 4TTGA 4A7QA 1I1RA 3QEHA 4OJDH 4Y16D 3N1GC 5D9SB 3DK0A 2EDRA 4Z7UE 5EPMB 2EDNA 2IH8A 2J5WA 5C0CD 1M1XB 4Q2ZB 3VDCA 3CLWA 3ZTNL 4KKNA 4TSAL 2LW3A 4FI8A 1SN5A 4PGDA 2YJQA 5A3IC 4PEEA 4A2EA 4HLZG 2WN3A 5CF3A 3PQYD 4HXAL 3KG5A 3NIFB 3QEQD 3RDTD 2QVTA 1KGJA 5FUCE 5DJAB 3FQYA 5C0CE 3F00A 5JUEL 1FHGA 3F65A 4QYOA 4ZX3A 4TNEA 4WGKA 3NEXA 4OD2B 2Y7LA 2ZT9C 1EZUA 5KN5A 3JT2A 1ZK9A 1Y6NR 5MP6H 1ZLUK 5D9SA 4RIRB 3PQYE 1F4WH 1KCVL 3Q2LA 3QEQE 1ZLEA 3DC0A 5FCSH 1MJ8L 3KCWA 3K71B 5T1LB 4DVRL 1M1XA 2ZWYA 4Q2ZA 1NA8A 4L4VB 2KT6A 1NCCH 1WZAA 3ARZA 4X98A 4XNQB 2HUEA 2FSDA 3K2KA 3OTTA 1MUJB 1A47A 5EUOF 1IKNA 4LAJH 1XF2B 1FUNA 4JVPA 5KOMC 4DW2L 1MEXH 2CIKB 5KVEL 3A0OA 5JQHC 3F5WB 4EZJA 1BXVA 1IAIH 5JPNC 5T1DL 4E0RB 4Z76A 5DJAA 2DQTL 2NQDA 2XN9D 2FH6A 2F18A 3O45B 1KJVA 4G9FB 4PJCB 5L0QC 5C0GA 1UH2A 4O58L 3UTZB 3DSFL 4PJEE 4S2SB 3CSFA 3HUJE 4WVRA 4RIRA 3DUUA 4I5BA 4TLTA 1LEKB 2DBLH 3PXLA 2OZNA 4M8QB 2YEVB 3CPUA 1FG9C 1HT6A 2WLLB 3EJCA 1SY6L 4NZRL 3GB7B 4PI2A 3SY6A 4CC1A 4L4VA 2BW4A 2Y2TA 4GUOA 4ACTA 3S88H 1F1GA 1GZHC 1QHQA 1KUMA 4KTEL 4L1HA 4MDJB 4WW2F 4UWQB 4TSCH 4AIOA 1XF2A 4NQDB 5D4JA 3A24A 2BNRB 4QCIB 3W0WE 5FO8B 4LFHD 4DUXA 2EH7H 5E94A 1JGLH 1HWHB 3BKJL 4GXUM 4E0RA 2SODB 1CD9B 2NYYD 2B59B 4HF5L 3GTNA 3O45A 3OZKA 4M7KH 1WZMA 1QNIA 1F6FB 2BIMA 2PWGA 4PJCA 5T1KD 3AXHA 3E0GA 4AV0A 3HC0B 1OTTC 3FSOA 3NK3A 1BQHB 3QZBA 4O2CA 5DJ6B 5D93B 1KB5L 2RACA 2VXVL 3BT0A 4P3DB 3FUDA 3Q44A 2KYIA 4YDKH 4PW4A 1WWBX 1D5RA 2WVUA 4J3XA 1RH8A 1LEKA 3NPSC 2CGRH 3AY4A 3GB7A 5FHAH 1B2WL 3U82B 4Y88A 1X5ZA 4MDJA 5KTEL 4ODSL 4YE4H 4BHUA 2YEZB 1MAJA 4NQDA 3VTAA 2VLRD 5FO8A 2R0WH 5AZ2H 3IDXH 4HV8B 4YDJB 2EO7A 1LO5A 1ODUA 4TTDD 2F58L 1FVDB 1ZA3A 4IBUA 3N5AA 2QMJA 3GJFB 4JREB 3CN4A 3H9SA 4JUSA 4P3DA 4DOHE 5B22A 1ACCA 2QDVA 1JGVL 1Q38A 2VLRE 3QFJD 2QSVA 3RTLA 2QGCA 3SODB 3IJEA 4HAGA 5J8OA 3HE6C 3N44B 4RLDA 4F7CA 2MTPA 2XYBA 5CZVL 3HG5A 2HB0A 4AQOA 1WK0A 4Z9KB 2EIJB 1PG7H 1J0YA 1EEQA 2YEZA 1UD6A 3GJFH 4X6BB 1KTBA 2OJZL 2NW3B 4K3GA 3KE0A 5DZJA 1VF5C 4GRLB 1VGEH 4BQ6A 4LCYB 3QIWA 1FVDA 3L08A 1I82A 4UBDC 1KNOB 5EF2A 3GJFA 2Y0SA 4N2GA 1E2VA 1EWHA 3DX4A 5E5MB 4AY0A 3FYIB 2ZOKB 1GS6X 3JV6A 2WBJC 2YMOA 3M8OH 4GIOA 3IGAB 5I0YA 3ARFC 3EFOA 3K81A 1CS6A 3O3DB 5TFSH 2X2IA 4MA8L 5AG8A 3ZW3A 4NJ9H 2A0LD 2E6QA 4CADA 1OAZH 4X6BA 2VL5A 4HPHA 2K78A 2XZCL 4LDCA 1U2YA 5DO8A 1RIHH 4U3HA 3CSYB 1IGIL 3Q6FB 4GRLA 4YHOL 1XGYL 1ODAA 4LCYA 4PJ9A 4L3AA 4LLDB 1BX2B 1U8MB 3WEXA 1L0YA 3ZDZB 3PL6C 4QXTB 1R3HA 1NBVH 2EIKB 1DBBL 3DVFA 1SM3L 3HCVB 4NO2B 4WFGE 2VYRE 2EEXA 5AAWC 1SYVB 5TDPB 4R5XA 4AIZB 3EOAB 3KWXA 1E4XL 2HT3C 1GVIA 5DVMA 1ZHBB 2JK5B 1XX9C 2ZOKA 2F53D 4FP8L 1ID2A 3FB7B 3W2DL 3O3EA 3IGAA 4S11A 4TNWK 5FM5O 2ZNWA 1F3DH 4WI5A 4PJGF 3O3DA 3UYOD 3N1FC 4RGNE 3FHEA 1H3VA 1SHMA 3CPLB 3RL2B 1P6AB 1BOGB 1AGEA 4XN8A 4PIRF 3GLEA 3C6LB 1WTLA 3CSYA 4RBPK 2F53E 1LQBC 3DX9B 2PYFB 5KSAA 2N59A 4LLDA 5T3XD 3JWOH 1N8OE 4UQBA 4QXTA 4NO2A 1JZJA 3HCVA 5GISL 3RVTC 5E2VL 4LLQA 1SYVA 4AIZA 3ME0B 4F3FB 2NY1D 3EOAA 4HJSA 4AUUA 1ZHBA 1TSRA 2APWA 5IKCB 3AWGA 1I1AB 3VGDA 1MPAL 4LLYB 3FB7A 2LTQC 4AYGA 2OL3L 4HS8H 1HOCB 5AWNH 3DTUB 4WK2B 1TZOA 5I73C 3HBQA 4JRFA 5G5DB 4NSKB 4PWIA 5F7MC 5CUSH 4K71B 3CPLA 4R5VA 3VGGA 3Q2CA 1BOGA 2C5DC 3BPOB 3GMRA 3UP6A 2CDGB 2W88A 4YSUA 2IQAB 4I0PC 3B5GA 2APSA 1FNHA 1EZVY 5IB4B 5FYLH 1XL4A 5CLWA 3WIHL 3GJEA 9PCYA 4MWFA 1MVYA 1QWNA 5HGBA 4JNXA 3OKLB 4PTUB 5IKCA 4APQD 1BLIA 1I1AA 4LL1A 3DRTB 4P59H 5JIMA 1Z9LA 2COQA 2I9TB 2CDEB 1HOCA 3ZMRA 4BWTA 4Z7AA 4L37B 5KVEE 1MXGA 5G5DA 3AGVA 4YX2L 5KBNC 2VH5L 4V33A 1X7TA 5EBGA 4MFHA 2YFOA 1F3JB 2EO1A 3UO8B 2WTRA 2CKNA 1YA5A 2IQAA 1JGUL 3T71A 3ZMNA 5EEZA 4N2NA 2XICA 3AS1A 3ATBA 1I9JL 3M1BB 1OLZA 2EINB 2W81C 3B9KD 2R29H 3GBDA 4H5SB 5IK3B 2HTKD 4AC4A 2ZXWB 3DHMA 4Y9BA 1IGJB 1XXDC 5D7LB 3JSSA 4FG6D 4NFBA 1T20A 1SXNA 3DRTA 1A7PL 5ANMA 2C3GA 4N8VB 3G5XB 5I82A 4F7KA 1ZIBA 1U2CA 1WDAA 4YHMH 3TZVD 1URIA 3KH4A 2WQWA 1ZVNA 2WANA 2H3NA 5IV2B 4JZOA 2P24B 1ZXKA 4WUKH 2FJHB 4PS4H 4FI6A 5ECJE 2VMDA 1IB5A 3MRJA 5CJQL 4AG4L 1JFQL 3RUGA 5A2IH 5D6CB 4FI7A 5IK3A 4H5SA 1N4XL 3NZSA 4AVJA 1DJYA 1OEZW 1LWHA 4MLIA 2F8OA 1IGJA 3QJOA 4F8OA 5JPNA 4PFEA 1WFNA 2J7LA 3U7YL 1R3JB 1ZRUA 3F7PC 5IVXE 4DO4A 3G5XA 5KVGL 3MLYL 2UXVA 4U0RC 4JFPB 2V33A 1RV6X 2XNAB 3MRNB 4P2YA 3ALXA 5K9KB 2AHIA 2BLFA 4BK8A 3ECQA 3FU9A 3HG2A 4E2OA 2LOEA 4M29A 4GB9A 2WLIB 3CFKB 5D6CA 4YZWA 3QEGH 3NSXA 1GZHA 5F7EL 4FQXD 3SBQA 4POYA 1OWWA 4Y1AD 5CLYA 3NJLA 1UWXK 3UEQA 5IVNA 4NDMB 1SUHA 4EQ2A 2PNDA 3FQTB 4AXWB 1AYRA 1BFOB 2ZNXA 4PJ7F 4Q6KA 1R3JA 3EGDB 3ULUF 3MX0B 3KNBB 5DLMH 3IJSB 2WP3O 3WIIL 4E9SA 3MRNA 1OALA 4I3RH 3WMQA 3WAJA 1KTLB 3NPZB 2A4ZA 2C1PB 4Y1AE 2YAEA 1MNUL 5DWUH 3MBED 4YQXL 5K9KA 2V17L 4OCRL 1BQLL 1G9NL 2QMKA 5C7ZA 1K3ZA 1T2XA 1ZVSB 3MJWA 3CFKA 4XP5H 4IRZL 5E99L 3B37A 5FYKL 4HWEH 4U7MA 2C4FT 1D5BB 1NQBA 1LO3L 2NY0C 3MV8B 4NDMA 1NANI 2XSKA 3FQTA 1J1XL 3DJ9A 2EXSA 3EGDA 1HZKA 4F20A 5D2NE 2EO9A 3MX0A 3IJSA 4L4TB 4QGYA 3UGUA 1RZPA 2WOYA 1FHNA 3N43B 1KTLA 2FBJL 4E5XA 1EEUA 5BRZB 5IESH 3IK2A 4FJ6A 4N0CC 2IDCA 3QHFL 4K8RL 2QLYA 2GBUA 4LHUG 3BAWA 3HE6A 3KHQA 1ZVSA 4XN9A 3GIVB 2JELL 3U9WA 3P69A 4FMFA 2FD6L 3H0TB 1HSAB 3BAYA 1TDQA 4X80H 1D5BA 3RIAF 1H8SA 4EO5A 2AABH 3MV8A 1FFRA 4CILA 1Z5LB 1JXFA 1U6AL 1HFUA 1OOWA 3QULB 1RPUA 1YCSA 4P2CG 4XNUH 2X7LB 4L4TA 5KVFL 1G7JA 1ET5A 1L9TA 4E42B 4LOFA 5I9QC 1MF2H 2WXLA 1N8ZB 5BRZA 2RR3A 3VFVB 2PPCA 5KSUB 4MXVE 1OLLA 3C5SB 1IEBB 3NDYE 2WBJA 4OCSH 5EIQA 4O4YH 2VRAA 2F1EA 1ES0A 3ARFA 1PZ2A 4N20A 4OLXL 3J07A 4Y5XB 1KIQB 3H0TA 2A7BA 3MPCA 4XTRC 4Q0XH 1JG9A 4N90E 3HAEB 3NK4A 2FO1A 2DQIL 3A23A 4WTQA 2F61A 4B50A 3FBQA 4L8DB 5HHNA 1WUZA 1Z5LA 2C26A 5F6IB 5DD6B 2OKMA 3FU6A 3QULA 2J8UF 1PZ5B 1O0VA 4KROB 2H26B 3NFPB 1PNDA 3PL6A 4YHLH 2VZ3A 4OGZA 2DN7A 3BHBB 1HYRC 3L4YA 4MQXC 4M7ZB 1N8ZA 2HJKB 2FEEI 2WY3B 2EDTA 3WFBH 4R5TA 5KSUA 1WWCA 2FGWH 2N4IA 2QADC 2VDRB 2HWZH 3HAEH 3C5SA 1UKSA 3NAAH 4GKSB 1GMEA 5GZND 2V9QA 2GY7B 3BAEL 3BZFA 4PD4J 3FL7A 2YAMA 1KIQA 4EI5B 4GO9A 3FZUD 3HAEA 3SD5A 4ZO6A 4RMQA 4C57C 3UO1H 1OB0A 5CCGE 4IKJA 1P1ZB 5DD6A 2NPLX 3DJRA 2WTPA 3CN0A 1PZ5A 3MACH 4HFUL 4AZ8B 3U9PL 2H26A 4X42A 4R4ND 1BWMA 1GGUA 1RAMA 5LQBL 1DBMH 3BHBA 4LSUL 4OCWH 2VDOH 4HFWB 2RFXB 1SEQL 2BW5A 1MCWW 4R97B 1WEJL 4GKSA 4KOCA 1BXUA 2XETA 5H4YA 5C70A 3WLBB 4JL2A 3IU3A 3HE7C 5T1MA 5J89A 4OFYA 4EI5A 2YQGA 4FLOA 2J73A 3UPAA 3S35L 5ISZB 5AOKA 4Q9QH 1JJUA 2NCMA 3Q3GB 4UT9H 1AKPA 4LVEA 4JM0A 1OTSD 5DC2A 5JW4N 1TXKA 1P1ZA 2ICEC 5ILTH 5C86A 5I71B 4AZ8A 1WICA 3MJ6A 2EAEA 2GSIA 4RGOH 4UT9A 2JJUA 1MIML 1XAKA 2NY6C 4HFWA 2RFXA 5B7EA 3O81A 3GXFA 4MQ7B 4EN3C 3KLAB 2E7HA 2V4LA 4HUWA 5EU7C 2OV0A 3LKPB 3T3MB 1ND0A 1YEEL 1BAFH 5CKGA 2DLGA 1MREL 2V37A 3MVSA 3P11L 5CKAA 5ISZA 3QQDB 3Q3GA 5JOFA 5KVGE 4NN5B 1TEYA 4XODA 4WFHE 5FGCB 3DUSB 4HSCX 4S0TD 4DP7X 1E42A 3II1A 4KHXL 3VRIA 5CN1A 3FUMA 4BZ2H 1F90H 2GFBB 5GZOC 4MA1C 1B9ZA 2LU7A 2AI0L 3F6IA 1AC0A 2EDBA 3JYBA 4IBZA 4MQTB 4J6RH 4LEXH 2OMUB 3MNVB 1A3RL 4NERA 4U6HB 5JHLH 5BS0D 1MFEH 2BJML 3G6DH 4MQ7A 4JQVA 2VDNL 3VGAB 4BZ2A 2KL6A 3BFWA 5D96C 3FCSB 3LKPA 4M6OL 5TDNB 3UCQA 3VI4B 4CSZA 4G2AA 4BZ1L 1UKQA 4YHIB 3DURB 4PQXA 5JHLA 1MVUA 3BH9B 3ROLB 2FECI 2UUDH 1XF4A 3JT0A 1IM3D 4QRBA 5BS0E 4BFFA 3SHSA 3F7VA 5B8CC 2WWKT 2J2ZB 4P06A 5DZAA 2GFBA 2OYMA 1TF4A 4YDIL 3VSQA 2Y7QB 1IAII 4XHJD 4NNPH 1CC3A 4HJJL 5I1GL 5I0VA 1KELH 3I3DA 1K4DB 1MCFA 2A9CA 2XIIA 4KJPD 2UY7A 4R7NB 5D72L 2EKSB 35C8H 4QTHB 5T5FL 4KJQD 5DYFA 1X9QA 5FYKE 5TDNA 2WC7A 3VI4A 2EDFA 3HJ0A 1IAOB 3Q6GH 1V55B 3DURA 4YHIA 3V6OA 4B41A 2J8HA 2Z8VC 1SF5A 3ROLA 2YQ2A 1YNKH 4BGLA 5CEXB 3NACL 1PPIA 3CN1A 4QT5B 4NT6B 3CZFB 2CCLA 4DJMA 4G6JL 4X7SH 2JIXB 3DMMD 5JO5B 3ARTA 1QW9A 3QG7H 4NWTL 5DLLA 4ERSH 1IC1A 3W81A 3MJ7B 4M43H 3DYPA 5I17B 3TIDB 4YXHH 2DH2A 1KWKA 3LRGA 2QQKH 1N64H 3HMWH 1K4DA 4L0PB 3ZOAA 3MXWL 2IMMA 4ABVA 3EF4A 4R7NA 5DRXB 3V6ZA 2EKSA 4O5LH 1AI1L 4QTHA 5AOLA 2E4TA 5AB1A 2IH1B 3CVDA 2OW6A 1H6FA 5T33H 2QSCL 1TTCA 2RALA 1EFXD 1HTYA 4ZX5A 4HT1H 2VQ1B 5HTSA 3FO2B 3NABL 4FE9A 3GSOB 1I8KB 5IR1B 1TQSA 3BW9B 3QS2A 4NT6A 3CZFA 2WQAA 3VWKC 1LO0L 5D1ZB 1DN2A 5DC0A 2JIXA 1QFWL 5KVFE 1MQ8A 4IU3B 5JO5A 2DQGH 4DP0X 1DUYA 3LZNA 4FMVA 3QXDA 5I17A 4HU8A 5MENB 4UMGA 5IQNA 3EF7A 4RWHA 1IGCH 3EGXB 1NC2D 3MKGA 3MV11 5DRXA 3F04A 3HC4H 2QEJA 1I8UA 4FLRA 5E5RB 3RVXD 1HN1A 2CPCA 2DD8L 4GSXA 1UURA 4G6MH 3CDGB 1AJ7L 3D3VB 1OM3H 5HJGA 3ZRCC 2B8OT 1K85A 4ZNEA 3FO2A 4PJAE 5IR1A 3GSOA 1I8KA 3QUML 3VVWA 4AYID 4JHUA 3KM2A 2ZICA 3AT9A 4ODHH 3FT9A 5DEZA 5TE4L 4OLWL 5D1ZA 3ZGIA 3GXIA 2IANE 2VDLB 2HPTA 1UADC 3EJZC 4OI8A 5EO1B 5MENA 5IFJB 2OR8A 4M5YH 3JYCA 3SDAD 3V0HA 5LXVA 1HC1A 3H56A 3KPQB 3V8CA 4ODTL 1GC1L 3TASA 3UJTL 3EGXA 2IPTH 1JFHA 1W72L 3BGFB 4BQCA 4JB9L 3C5ZC 3ECBA 4U1SB 1NCWH 3EYFB 3IRZA 2MCMA 1HQRB 4DO6A 4GBXD 4QXUL 3S34L 5B1AB 2VDLH 3P9LB 5CFHA 3CUPA 4DK3A 4KUCD 3BGMA 3O8XB 3IFNH 4I3SH 2AK4B 3ETBJ 4JRLA 2NY7H 1JTOA 3FW6A 3FK3A 1N12A 2FHCA 3L4WA 5BOPA 2OSYA 4MYPA 1YNTF 5IFJA 3AQYA 4Q6IB 3VGBA 3Q48A 2JQAA 3WYRA 3KPQA 1HQ4A 2YKLL 1EHKB 5EBWB 1BM3L 2CMRH 5E6RB 2GJRA 1QO3A 3A5VA 4XC3L 2WQ8A 3RQ3A 3UBXB 1F56A 1KCVH 1V54B 3EYFA 3F83A 3NZHL 3PP4L 4PR5B 4U1SA 1HQRA 4KITB 4TULL 1OTUD 3CQFA 3ZHDA 3P9LA 3WDJA 1MJUL 4AQEB 4AUJA 5CJXC 2Z93B 2XTJC 3BISA 3O8XA 4LCCB 2XJKA 5FKAA 3QDMA 2AK4A 3L9BA 5LBGA 2YQ3A 1OP4A 1CYWA 3INUH 4U1HB 1KEMH 3OR7A 3AADB 1RUML 1F4AA 2Q2LA 4RRPM 1YYLH 2JQMA 5F0MB 1RJYB 1NGYA 3U6RA 3VFPA 2E5EA 1UUNA 3GIZL 5CXPA 5T1DH 2DWTA 5EORL 2WZPD 1E9QA 4Z7NF 4I7ZC 5KS9A 3FHQA 2K7PA 2NX5A 1C5DB 1XCQB 4WU5B 1PX8A 4JQXC 5EBWA 3NSJA 1OGAA 2XFXA 5I28A 1AS7A 1QSEB 2E6JA 4R4FH 4RQQB 4WGVB 3VXRA 5AZEL 3D06A 4NZRH 3NP4A 4WTZG 2VM4A 2R0LL 1ACZA 1KCSH 1CGUA 1MCQA 2FIKB 2Z93A 2GTQA 4JFEB 2ZP0T 3IAPA 4HWUA 4IOFC 3RI5K 4XAWH 3SE4C 3VG9B 2OK0L 1DDHA 3TBYB 1A21A 2IWEA 1U3HC 4X4XA 4XBPB 3ZSSA 4EN3B 3LN4B 4OIAA 4X5PA 3U2SA 4J3OC 1QFOA 3C60C 4G11A 3BSZL 3RAJH 3O6LL 2NZIA 4YMPA 3HE7A 3MQIA 2CDFA 3T0VA 3GNML 1LJMA 3PCYA 2DL2A 4WU5A 1IFHL 1TYJA 3B9EA 4YDNA 1OSEA 4K7FB 1OF2A 1TNNA 3LYRA 1QSEA 4RQQA 2F9BT 1NSNL 5CU5A 4O51A 4DGVH 1CF8L 2ICEA 1AXIB 4HXBH 4XCCL 3FTXA 3VU2A 3O2WH 3X11B 1IGTB 3D25A 5KYYA 2OA9A 1UC6A 2CBTA 25C8L 4XBPA 4LXFA 4EN3A 5DJZB 1HHGA 1G9NC 1H3XA 1IU1A 3FQUB 1FAKT 3F85A 1SUJA 2ERJB 3G08B 1QI4A 2DIEA 2OMVB 1CB4A 2NW2B 4GIAA 1R5VB 3WFEH 4OI7A 2OMZB 3IJHA 1T80A 2NY2D 4Y9GA 3PNWB 1E28B 4N68A 3UDWC 1LO2H 4YDLB 1SYSB 2XWBB 5B8CB 1KV3A 2IO5A 1WA0X 1YY9D 4ZD3L 2X0WA 4A2HA 2BIIA 2A77H 1DP0A 1INEL 4H0GA 3AUVA 2WLKA 5D1QB 3GS7A 2XQYG 1FL5B 3VXTB 1CO1A 3IGLA 5K59E 4KXBA 1V05A 1Z3GH 3TYGL 4K8RC 3ZIYA 5DUMH 4Y5VB 4KK9D 2OJZH 2P5WB 2J21A 2HT4D 5DJZA 3AS0A 4LPVA 4HEPA 3FQUA 4P2OC 5L8LB 1K8IB 3CFIC 4IS6B 2NW2A 2ZCKL 3VFRB 5BMFL 2FX8H 4UM9D 4ZFFB 2F54D 2OMZA 1AFVH 4JN2B 1JNNH 3F2LA 1MCRA 2FE0A 3C2SA 3GTVA 4XCYB 1E28A 3LH2H 1KXTB 1T4KB 1T1ZA 4KQ4H 3H9YA 1TETH 4BFIB 1SYSA 2QGBA 2XWBA 4IJ3B 3ES6B 5IB5B 5B8CA 5HYFA 4RCAA 3TA3C 1UWEH 4JRXD 5K1VA 2XQYK 1P7QD 5DEGB 5D2LF 5E0FA 4GQRA 4S1DD 2F54E 3N42B 3VXTA 4JK0D 5IT2H 4BM7A 4RMTA 4PJDB 2VN6A 3IMVA 1OCWL 2E27L 4NKQB 4Y5VA 1I3GH 2P5WA 1FA4A 4DCQA 2NNRA 2XHNA 2GT9A 2AKRA 4NHCH 3IBOA 3RPBA 1IGIH 1K8IA 2E9GA 1XGYH 1GW6A 1IQWH 4IS6A 3DVIA 4JRXE 2EABA 5BUGA 1AR1C 1YZZA 1SM3H 1DQQA 3QJUB 4XCYA 3VWKB 1KXTA 1T4KA 1E4XH 1VFBB 2LR4A 4JCMA 4U7SA 5TF1L 2DWEB 1MFCL 3LEXB 4BFIA 1MXDA 3ES6A 3EO0B 1T2QH 5IVZA 1Q9KA 4W1TA 2X9YA 1C7TA 2WO2B 4M62H 2WUCH 3RY5A 2CH8A 1RL1A 5B38B 4H26B 2ZCHL 2C9XA 3BEWB 4Q58C 1KSRA 4ECNA 1AP2A 4KO9A 1RPQA 4PRBA 3MRKB 1T5WB 4LRNH 2J8OA 3GLDA 4F80A 2IWFA 4MCZB 1CFTA 4KKAD 1EHLH 5IBUG 4L1DA 2DMHA 2DM3A 3CX2A 2IDFA 5GISH 1G43A 5LO7A 2WUBH 3VWKA 5JA8B 1ZE3H 1Q9OB 4K5MA 3EO0A 1BVZA 1NGZB 3VI3E 3D4GA 2I24N 4IM8A 2DQUL 1J1PL 3JQOB 4TQEL 4H26A 3B2UD 4Q74A 2J1XA 4R2GB 3V52H 2ZWZA 3NCJH 1OP5H 1UYWL 2CHDA 4Y4FC 3P4LA 5DD0L 3BQUD 1XTLA 4ELMF 4A67A 3JBG7 2ZYHA 1I9IL 1EIBA 3TS8A 1SJEA 4MAUH 4MCZA 3D34A 4FQHB 4MMZB 3WOVA 4PH8A 2BOBB 5ACZA 1CVSC 5ICXB 3RU8L 1RP9A 4Y5YB 4Z3HA 2BVQA 2IDUA 3SQOH 3D09A 3PJLA 1QSVA 1A1OB 3BZ5A 2V3DA 3BE1L 3L4ZA 3IJ8A 4I2XB 5B1CA 4IBTA 2V5RA 3MCYA 4M5SA 5D7SL 1SXBA 3B8YA 4YX2H 2B3RA 3S48A 5D7JB 4L18A 1CLCA 1VRSA 3LB6C 3FQ4A 3HLKA 5IMOB 3C5ZA 2FQGA 2CLZB 5E8DH 5B39G 5LVEA 3BPNC 3CFCH 5DK2A 1YYMH 1NPNA 2P46B 3G5WA 1LYQA 2BZDA 5J13B 5EWIL 4ZXBC 1MCBA 4FQHA 3OKMA 1I9JH 1S7VB 3RNQB 1I3VA 3VXSD 2CJUH 3P0VH 4IOIA 2ETWA 1WZ1L 4IBSA 3MHZA 2YMTA 4Y5YA 1N19A 2F5AH 1JHLL 1MHCB 5I1HL 3KW7A 1A1OA 1LL1A 2APBA 2GTWB 3DK2A 3ZK0A 5FYJD 3EFDL 1K8DA 4I2XA 4FEIA 4HUXA 3FOLB 4OAWA 4A7GF 2BZCA 4J28A 3QXWA 4LNVA 2FO8A 4HZ1A 4M6MH 3VXSE 3WY4A 3EYSH 3FQRB 4GRWF 4R26L 1MHHA 4KKRA 5IMOA 4Z7WE 3SKUD 3ZDYF 1INQB 1UKTA 1FN4A 3I84A 2WSDA 1MCNA 2ZCZA 3VYNA 4G8GA 4I13B 1HHHA 1YC7A 1YEIH 1CXLA 2BFGA 2R4RL 3ASWA 3V2AR 4Y4KC 1S7VA 4OCYL 3RNQA 4DP1X 5IM7A 2ICCA 5E00B 3L2LA 1NMCB 3WJJC 2IOOA 3KGSA 1HHIB 4AM0A 5GGRB 2MPVA 2LE9A 4N0FA 3KR3H 3GBMH 2PWDA 4JQIL 1G4MA 1WFUA 4I4WA 3U2IA 4F7TB 2DICA 1KIRB 3RYMA 4ISVB 2D0FA 4AQ1C 1F5WA 3FOLA 2D0GA 3E1F1 3X1FA 3MJ9L 1OY3B 3FQRA 1N0LA 3VD7A 4M1DL 3QG6A 1INQA 1QW8A 2SEBB 3TCXA 5C08A 4JCWA 5DMIH 3V0DA 2E56A 2G5UA 4J3OH 5TH2B 3Q01A 3UMNA 1ONQA 1KYUA 2NLJB 4PRPE 1A7NH 1J0IA 3SE4A 4F8TA 1F6AB 5C6TH 3OLIA 1Z3RA 2APFA 1N68A 3QQNA 5MEPA 1HHIA 1XAUA 5GGRA 5E4EC 3G6JF 2HXAA 2EEDA 4HK3N 1TVBB 1U4EA 2QPDB 3CV5A 4H88H 3ESNA 3ZYOA 3APNA 4KVPA 1S5IH 1UHVA 5C92A 2O5NA 3QAZB 4L8SB 4MHHG 3DA0A 3P77B 4XVJL 1AGFA 4NHUB 1WD8A 3QZLA 1PY9A 3SKMA 4PY7B 2SEBA 4GG6E 3TO4C 1BQLH 1UOLA 1QWUA 2V7HB 1G9NH 2Y2YA 4UDTB 4JY6A 4OUUB 5LGHH 5F1KC 3E9UA 3KL3A 3WUWA 2NLJA 4MA3B 5E8PB 3D18B 1CLYH 2B0SH 1FNSH 1RFDL 4TUJA 1CFSA 5ERWB 1ZSDB 2M26A 3MV7B 1EGJL 1WUNT 2KBGA 5HSFA 1TVBA 1I8IB 5CSBA 1YN7A 5ESQB 2EVIA 2JLLA 3DXAD 5HDBE 3SDDB 3IDJB 3VSUA 5AW0B 3G3LA 1CU4L 3GSQA 3P77A 5ADPL 3UDWA 3CVCA 4HIEB 3CQQA 5DS8B 3C2AL 2O6FA 5E7FA 3MBXL 3QR0A 4DK6A 2V7HA 3LQMA 4LDLB 4R90H 3LN5A 4UDTA 5JLZB 2AJSL 4OUUA 2YA1A 3DXAE 4LKCB 4MA3A 5E8PA 3VJ6A 1JGDA 3WKNA 2ZP9A 3GKWL 4GKZB 1X44A 1KPUB 3DIFB 1MCOH 3L48A 3WXWL 1ZSDA 5IFAH 3MV7A 4MJ6B 2NDGA 3BVXA 1U6AH 4O2FB 4PN6A 4P2OA 4JCLA 3SGKC 3U6XS 1YNLL 3ZKQD 3ZE1F 1GC1C 4NQCB 1P7HL 3QNYA 3SDDA 1HINL 3IS0X 2ISDA 3K2MC 5IGXH 1IC5L 1N5YH 1QZNA 2W0KA 3S4SB 1NBCA 3BMWA 4WDIB 1Z5YD 4C59B 4HIEA 3L9EA 2XN2A 4TVUA 3HB3B 1G9EA 3HRZB 2R69L 3QWOB 4C4UA 2DLHA 4MB4A 4PI0A 3PWNB 2JKSA 3K1KC 5JLZA 2IBZX 3ZKXB 3MC0A 4LKCA 3VB8A 4CW1B 4F8NA 3GHEH 5EN3A 2D7TH 2VMFA 3CDZB 1WGVA 1FZMB 4QXVA 4XCFL 4GKZA 1HI6A 1KPUA 1OQXA 3VXPB 2OM5A 3TBWA 4O2FA 2D9QB 3T0DA 1KENL 4X83A 1QKZH 4M1GH 1RXLA 2E0PA 2W5PA 3A6CH 3FT0A 4TN9A 43C9A 4U1NB 2H0JA 3RIFK 2FQDA 2TAAA 1CFBA 4YDMA 4OLVH 2N3JA 5T1JA 3S4SA 5IB3B 3RZCB 1VKXB 1X5HA 3BRGC 3QZNA 2HVBA 3LSOA 4K3HA 3QWOA 4OJAA 4GAFB 1MCIA 1XH1A 4WJ5A 1WF5A 3N1PC 1KTDB 1PCXA 2X38A 1ZD6A 5D71L 4D0DB 3MJ8B 1L9RA 2VZTA 2YC1B 3MUHL 1D5XB 2JKJA 3ESVF 4JFFD 5I74C 2FBRA 4CW1A 5I5RA 1KLFA 4P2RB 1YG9A 5E08H 3CDZA 3DX1A 1FZMA 3TWCH 4X9FA 2XIDA 3VXPA 4KK5D 2IADB 5C0DB 5DRWB 4FTVD 1XH2A 1MIEL 3BAJA 4EI6A 2JCCE 2V0AA 4A2LA 3TBTB 4JFFE 3QWNA 5AUMB 4U1NA 2MQ0A 3FFDB 4M5ZH 2WIIB 3IFOA 5KEZA 3EJSA 1W9XA 2XXGA 1CBVL 1EEZB 4L3CA 5FA3A 5B1KA 5IB3A 5ID0A 5I30L 4OZIB 1VKXA 3GBLA 4H8HA 2NR6D 4HH8A 4XMUA 5DJ0A 4KZCA 2UX6A 4CSPA 4H0IA 3TVMD 4FTVE 1NPJA 3H55A 4NNYB 4NKDA 5CINL 4DHLA 4D0DA 3MJ8A 2YC1A 1D5XA 4IOSD 4P2RA 2VC2B 3IGUA 3S35H 2YPLD 2XX0A 3HNSL 4RISH 2IADA 2Z4TA 5C0DA 2DQDH 2EE6A 3OKKB 1AZBA 5DHDA 3ZY7A 3KPOB 3ZL2A 2D2CC 3BPLC 3TBTA 3T2NL 2DS4A 2O5XL 3BN9D 4DEPB 2WIIA 1BXXA 1EEZA 4IIQB 1JPSL 2B2XL 4OZIA 3P3UA 4A04A 2AGJL 2YPLE 4OLYL 2ESVB 1XCTB 4Q6YA 5D1XC 3WNJA 5DSCB 4P5KB 1CE1L 5F7FA 5DD3L 3VE0B 5D5MA 1KT2A 3AU0A 3DO3A 1PS3A 2A74C 5C07D 3B2DC 2YUZA 3VM7A 3GTTA 4YO0A 3WY2A 4I0KA 1IKFL 5IHZB 4H8PA 1INDH 2MOVA 1WJ3A 2AJYL 3FC8A 3Q8BA 3BIAX 3REWA 5I8OH 4MDIA 5CEYA 4EZLA 5GSVB 4CGUB 2IDSA 4HC1H 4P23B 4RAUA 3UFIA 3VU1A 3U36B 2AJZA 2WV3A 4ZXBA 2CUHA 1I7ZA 1MQKL 2E75C 3KPOA 5C07E 4MNGE 4PY8J 2XCMC 1B88A 1AE6L 5IQLA 4OZFH 1OWRM 1M7IB 2XUWA 2ESVA 4HC1A 1NOLA 3GBNH 4ZSOE 5HGDA 1MH5B 1GOGA 4GMTL 1YRKA 1HH9B 4P5KA 3AQDA 5E8OB 4XPHH 4CRPA 2EZ0C 3A4AA 3T0WA 3MCLL 3EGSB 2I9LB 3CGTA 2V6HA 3P30L 4OBRA 4POZD 4TNFA 4U1IB 5JHDD 5EIIA 2AXFB 1E67A 5IHZA 3F6LA 4OZFA 4XNXH 2PO6D 4K4KA 1F6LL 5JW4R 4Y0GA 2Q8AH 1HH6B 1F00I 5EC2A 5GSVA 5FDWB 1UM6L 4P23A 5DQJA 3UBFA 4K3JH 3OHMB 1H0DB 4Y4KA 1ZXQA 2CIIB 2OJEA 5GRUL 5JHDE 3ZZQA 4J3SA 1KCLA 2OR9L 5EU3B 1OPGL 4WEMB 5EUOE 3F7QA 2K8MA 3PAZA 1MH5A 2B1AH 1A9EB 4UB0L 3GO1L 5E8OA 3RDJA 1VDGA 5DGRA 4GMSL 2I9LA 4FFZH 4U1IA 2AXFA 2EIZA 3I6KA 4NM8L 2ZUQC 1ILSA 5MERB 1HH6A 1NBYB 5H37G 2FQEA 1JZFA 4P5SA 5BZZA 3UYRH 3DX3A 3QDAA 5FDWA 5KAQF 1QLFA 3QO1B 2NZ1A 4ZMOA 3KJ6H 5IB2B 3ARGC 4PV8A 2Y7NA 1H0DA 2J5LC 3OV6A 4FFZA 4GOSA 4X5WB 4AM0Q 2WKOA 5I76B 3N50A 3ARDD 4FQJH 3DRQA 3RB5A 1G87A 2P5EB 2Q86B 3OZLA 4HGMA 1FLTX 4WV1C 1GZQB 2MTAA 4UM8B 2MPAH 2AS5M 2K70A 3WNPA 1AQKH 1UGKA 2VSCA 2CR6A 3UG3A 3OWRA 1WRFA 4XO3A 4RSYA 4XMLL 3HHMA 5L88L 4ZX6A 4GSUA 4YBHA 5T1LD 3U0WL 1IEHA 3EDEA 4MX7B 3QR1A 1DQML 2FSEB 5MERA 3QORB 1NBYA 4FG4A 3ERXA 2A73B 2R9HC 4LLWA 4FQPA 3TO4A 3QO1A 4AGPA 5C0FB 4HWBH 5IB2A 2JB5H 4X5WA 1PJ9A 3OLEA 5I76A 2ZKHL 2Q86A 1R3KA 3WO3B 4JY5L 4Z7OB 2AAVA 1X6LA 1HOEA 1JWUB 1G7QB 4HWBA 5SWSE 3HI1B 3ZT7A 5I6XB 4L5FL 1E6JL 2DL9A 4FQIL 4PS3A 4WWNA 3OZ9H 2HLFD 4GQPH 1KLUB 3L5XH 5J6GB 2YD3A 3V6BR 3KYOA 5CCJA 3CQPA 4MX7A 1TLMA 1RK0B 1OIOA 2UYLB 4N2FA 2A9ML 4X6EB 1HKFA 4OH2A 5C0FA 3RJOA 1LDPH 2GK0A 2WAQA 3PABB 2Z0BA 3WEAA 3RFZC 5I5MA 3AWEA 4OGXL 4LASH 3RJDA 2DQHL 3QUKB 4GH7B 2HG5A 2WXOA 2WBKA 2XQBL 4C56D 4EBQH 2H9GB 1BV8A 4BRVA 4EDXB 3W5MA 4O00A 2RTTA 3IFLL 4F33B 1JWUA 3QIBD 5ICYA 1G7QA 4OCXH 3F8UB 1A6WH 3HI1A 4O02L 1WCBB 3GMNB 4ZOBA 3RIAK 3S34H 1RCYA 3SGKA 3B2PA 4MMXB 3EHBC 5I75B 2AJXH 3BCDA 1V3MA 1GGIL 2FWSA 4OZGB 5J6GA 1IAIM 2WMPB 4P5TB 5TQ0H 2IG2L 3GM0A 3IGFA 4C56E 3B56A 3MR9B 4LCWD 2UYLA 2Z1PA 4XPFL 4X6EA 2ALWA 5KYNA 3CHXA 1XL6A 4MXWL 2IV9A 2AZAA 1CQKA 4NX0A 3VFSB 1CF1A 2LLLA 4UIKH 4ZTPH 1NEUA 2GB2A 3S37X 2VABA 3QUKA 2C9RA 4DZ8A 2XI9A 2DQEL 2H9GA 4PRDB 1HXKA 4M7LL 4EDXA 4F33A 3SKJH 5IHUL 4LCWE 5ELIA 5PAZA 2BC4B 3JV5A 1E4XI 4R83A 4MZ3A 4BUGA 1WCBA 3I6SA 3U7AA 5FGSA 1CG9B 1FFOB 3CK0H 4OZGA 4ABQA 2XWCA 5CLXA 2R4SL 1E7VA 4HK0A 4X8JA 1FCCA 3P4OA 4N9OB 1RUPL 4H1LG 4P5TA 4XVTL 3PRZA 3QQ3B 4JM2C 3DHJA 4NZUH 5TDOB 4AITA 1C9SA 2FCBA 3MR9A 4ODXA 5E4IA 3WFDH 4X7TB 1IVLA 2OMBA 5A2JH 1NDTA 1PNCA 4ZFOL 4NKMB 3DECA 1T7WA 4QRTB 2FB4L 5FX3A 1JZEA 2G5BB 1KC5L 2JJSC 1Q0XH 4JPSA 4UOJA 4ZMZA 4PJGE 3QYMA 3TYFA 1E0OB 1UD2A 3UTOA 3ARBC 4HCRH 4HUKB 2FJGB 3IMRA 3GM8A 3LVTA 1R34A 5I1IL 3QI9C 2O6CA 2XY2A 3PGCB 4P2AA 4YSEA 4N2AA 1CG9A 4FNLH 4OLZH 1FFOA 4UNIA 3HZKB 4HD5A 1E5BA 1R5WB 2D03L 2BY0A 1OQOA 2VR4A 2YOCA 5TDOA 1DQLL 4HCRA 2V5TA 3QQ3A 1VADB 4J2QA 4UIMA 2KDYA 4X7TA 3V0WH 4BE5A 3E80A 1YMMD 2GYSA 5CCKH 1FYTB 4QRTA 2NXZC 2NYYC 1TZHB 2DV6A 2EE3A 3BFOA 1R0AH 4FG2A 2G5BA 5C8JB 3T1FB 2JH2A 3NVQA 5DVLA 2HFEA 4PREA 4AJWA 5JZ7D 5L2KD 5JW3H 1DZ0A 4QLRA 1IE5A 3H2WA 4YWGH 3QZWA 1YMME 3KS0J 2Z92A 3BP7B 2BSCA 3KGTA 4XH2B 3UZQA 3FMGH 1DLFH 5F71A 1H6TA 5AYQA 1GZPB 1FLRH 1Z5HA 2VL4A 4I85A 3WXVH 4UV7H 1Z9OA 4WK0B 4DKFL 3HZKA 4F9LC 3CBKB 1R5WA 4L9LC 4LESA 3SPJA 5E8EB 1VADA 4CVZB 5D1XA 3K7UA 2X6CA 5L2KE 1ZLWH 1FYTA 5LDSA 3RUGF 1TZHA 1EMTL 4X6DF 3VFUB 5KUKA 1TKWB 1GGTA 5AYUL 5C8JA 4PVBA 4ZK8A 5I1LB 1PJWA 4DO5A 5GGQL 3C6LD 1AO7B 1EERB 2WGXA 5JDSA 3NCYS 2ZWKA 5CSZA 4ZMAT 1ZV9A 5TE7L 1P4IL 1I1FB 3AROA 1RSYA 4XP1H 1Q0YH 3BT2H 5J5EA 4HBCL 4IRSB 5E1AB 2DQJH 4TUUA 4WJKB 4UQIM 2R1WB 1SVCP 1GZPA 1S9XB 3L45A 1C8QA 3EJUA 4QWWC 4PRHB 3B9VA 3QWRA 4TL4A 5E8EA 1HWGB 3II3A 2ODIA 4CVZA 1FIGL 4XPGL 1VFAB 3NFSL 4I1RA 3D52A 1FNGA 3CLFH 5JPMC 1AKJB 3HW7A 4RWYH 3BC9A 5AB9A 3VFUA 3FFCD 4UQ2A 5ENWB 1GTFA 1FJ1B 3S3SA 3DJSA 2BVOB 4N0UE 5F9OL 1MCJA 4G5AA 2NNAA 3MLXL 5F44A 5TF0A 1H9VA 1KYFA 4P4KD 1AO7A 1Y1DA 1NLDL 2JWYA 4X6CB 3ZTJG 3QDJA 2IXQA 4D9LL 4KKCD 2AXGA 2DI8A 2UY6B 4JPIA 4TKWA 3T4AB 2C7FA 4QRRD 4IRSA 3V0GA 4XPAH 1IKOP 3VFNB 4GSDH 4WY7L 2R1WA 1CK0H 3FFCE 3MLSH 2J12B 1T5XB 1S9XA 2CJ3A 4YHNA 2ZIDA 3L4XA 1S9VA 4PRHA 3TBCA 5KG9B 5DMGC 1HEZA 1J0HA 4NQEB 4Y4HC 1VFAA 1BEYL 2XG4A 2JJWA 2E27H 5J6HA 2E47A 4Z7VB 2GITB 4QRRE 2A6JB 4DNLA 1UCBL 5ENWA 3U7WL 1P6FA 2BVOA 2D7MA 2VXQL 1E9PB 4FFVC 3UABA 2R23B 5DMJB 2WXMA 3ASNB 3IMTA 5GS0H 4X6CA 1ZS2A 4WWKD 4JM4L 1THAA 5DTFB 1QLEB 3W9DA 3F58H 4XR8C 3T4AA 5KVDL 3IF1B 2XKNB 3OXRB 4FQ2H 3CXDL 2YBRA 2YA0A 4BSJA 1T5XA 3ULUD 4PJHF 2AVFA 3CHQA 4GAGL 1F4XL 4HOMA 3AB0B 3C5JB 4N2BA 5CJOH 5KG9A 4NQEA 1OF0A 2YWYA 3P2DA 4FA7B 1QRNB 2ED9A 2X4RA 2QL1A 5A7EA 3ZUNC 2OPCA 2GITA 1QLEH 1XGUA 2F5BH 1KJ2L 2A6JA 2OXHB 4QRPB 3LOWA 4MNQB 1E9PA 3ULUE 5T5NG 2R23A 5KYWB 2JJTC 4NIYE 3CFDB 4IDJL 2Q5BA 4Z7UB 1CDBA 1WQVT 4Y2DC 1KCWA 4Q8BA 1DSFH 1G7MB 2BWDA 2R0ZH 5DTFA 4QTFA 3ELAT 2BSTA 4ZRGA 5TK4A 1AY1L 1OP3H 3IF1A 3OXRA 4HLEA 3IE4A 4HHAB 2XVBA 3CFUA 1T1XB 2DQUH 4G8FB 5HHMD 4ICWA 1U95B 3MLPA 5J56B 5GRWA 1P4LB 3AG1B 3C5JA 3RGVC 4ZS7L 2FYYB 2VZVA 4Y16B 3QQ4B 1ETZB 1QRNA 3ZKND 2TRHA 2CAKA 2IQ9L 4IBQA 3B2VL 1Q9LB 5C0CB 3TX4A 1BPVA 3RHWF 1KDJA 15C8H 1WC7B 4MNQA 5F2FA 1G6RB 1YEWA 5HHME 3UTTA 2VIRB 1JHKH 2QTVA 3CFDA 4Z7UA 3PQYB 2NY4D 2RQEA 3QEQB 3QXVA 2ALAA 3C8HA 3RDTB 5CD3B 4XNDA 5A6LA 1M2VA 5CILH 4APQC 1JN6B 1KXHA 5LG6A 3L95B 4HHAA 5BQDA 3UH8A 1WGOA 5FF6A 5F7LB 4LMQE 1WFTA 2B9BA 1IQDA 3UTSD 3KZ8A 1G6RH 1HK6A 2FYYA 5HYEA 4LVHC 3QQ4A 3FF7A 2H2SD 1I7UA 3MRFA 2G75B 2HMID 3ZL4L 2DWSA 1EJOL 3CD4A 2FRGP 2HSIA 3W37A 4R8WL 1ZHLA 3QJHA 3B9KC 1NEZB 1G6RA 1WS8A 2BP0B 2NXYC 2ITDB 2VIRA 1SGKA 4PJEB 3UTSE 4P99A 3HUJB 3PQYA 5EFIB 2BRQA 3FBKA 3RDTA 4C58B 5CD3A 1U8CB 2RCSH 4GIPD 1AD9B 1XR9A 3F01A 4KZ0A 1JN6A 5HGGS 3NMEA 1A4AA 2P48B 4KX8A 4MTMA 1KEGH 1RSFA 2GBTA 4MASA 3BAKA 3GZKA 3L5JA 1JCKA 1XR8B 2APXA 5ACMA 4KXAA 4YZFF 3W0WB 5TE6H 1HCZA 3L1EA 3HS9A 4HOZA 3EG9B 3QUYD 1OGPA 1P5UB 1PLGL 2OZ4H 5CHNB 5JIHA 2J8UE 2LHAA 1NEZA 2BP0A 2BVTA 4J4PD 2ITDA 4C55A 1USQA 3O9WD 4PJEA 3EDDA 4JM2A 4S1RL 4JDTL 3BWSA 5J11B 4JFTA 4DPBX 2YPKB 1U8PA 2WQVA 1X7QB 4QO1A 1OAQH 1ETB1 2OZ4A 2M8XA 2XN9A 2NCEA 3NGBC 3SE6A 5T1KB 1SF3A 4XMTA 2VSDA 3OB8A 3CC5B 3N85L 3S3PA 2JJSA 1D9KC 3LMJH 4M1DH 3ARBA 5FM5M 5IMLB 1KCKA 1TZGL 2VMCA 3P54A 3NBNA 1I9RH 3FQWB 1R1CA 1BSIA 4UINH 4KUZL 4JO2L 3U4AA 4C4KT 1JZIA 1P5UA 3CWGA 3E3QE 1P7BA 5CHNA 5BZWA 1RZ7L 5J1AB 5HXMA 3CFEB 1MFBL 4Z3GA 1EANA 3QCVL 4DOHB 4U1KB 3VQ2C 3KYKH 2AEPH 2X4UA 2VLRB 2YPKA 2O93L 2EE2A 4G71B 1X7QA 3L1GA 3SDXF 3U0PB 4GAAA 3MUY1 1XF3A 1U3NA 1TITA 1QI3A 1U92A 4HIIB 1PX4A 4RSVA 2XA8L 1JF1A 1KZYA 4PPTA 3K4ZA 2XX1A 3QDGD 3V7AE 4X99A 1E27B 1M56B 4AYDC 5D6DA 4P9MH 1KCRL 5IMLA 1KB3A 1TQWA 5E9NA 3FQWA 1DVYA 5EOTB 2DQFA 3VFMA 5JXEC 3WMPA 4OF8A 1I85C 4F9LA 1GOFA 5J1AA 3KS0H 3CFEA 43CAA 4U1KA 4BELD 4PJXA 3QDGE 2Z8RA 4PGZA 5LCVL 2VLRA 1MAML 1TPXB 5I1KL 3S3JA 5GRVK 3S36L 3U0PA 4OGAD 1MFVA 1L9PA 5IQ7H 4WHDA 1S7XB 5FWQA 4S1QH 1IBBA 2EUXA 2ITCB 4FNTA 4HIIA 4X5XA 5IQOA 3CZNA 3DHUA 3WTVA 2LU4A 4QR7A 2OS7A 1E27A 3H3PH 4L1BA 1AQMA 2IGFL 3QFJA 4NOBA 4URKA 5EOTA 2ZSWB 3IDNB 4W4NA 1CICC 3BKCH 1JZ6A 2QLVB 1LNUB 2D4FA 2CBMA 3I9GL 3LXBA 4U49A 5FHBL 3KMDA 1NOFA 2PR4L 4UQ9A 5HJ3A 3PIQB 5F7DB 2Q7AA 5JIPA 3O2DL 4HUUA 3WTSA 3VCLB 2J3SA 2QSQA 2EE9A 3KLQA 1S7XA 4BH7B 4TOYH 5KUMA 4H8WH 2COVD 2ADGB 2ROYA 3BDYL 5D55A 2YRZA 4N0RA 2YR3A 1RQ5A 3BAIA 4R84A 4BWUA 4RGNB 1DEEB 1F8TH 5AVQB 2XJLA 3L3HB 1OK8A 4UQ3B 2F53B 1KBGL 2FH8A 4AWJC 4MAYD 1S9YB 1RI8A 3E6FA 2YBGA 5GRVL 1Z6JT 5C0IA 3BYTA 3PG2A 2EDHA 2OCJA 4G59C 3SYPA 2AJUH 4ZO8A 5F7DA 5IQ9A 3GHBL 1EAPA 2J1YA 5DFTA 1KF9B 3BLKA 4GINA 4ONOA 2ORBH 2RAMA 1A66A 2F08A 3AW5A 3K2UH 3VCLA 3VFOA 2WJ5A 3OKOB 1J5IA 2AK1L 1GGBH 1WCQA 3TFBA 1SBSL 2N7BA 2X44D 5DXWA 4YJZL 1BVOA 1DEEA 4EDWH 2NY1B 1VACB 1PL3A 2CBOA 2PW2A 2K6WA 4QHUB 3OSKA 1K5NA 3K3QA 3M86A 3FCTA 5HHOD 3L3HA 4XMXA 4UQ3A 2F53A 2FT8A 3GSWB 3LXCA 4OM1H 4KI5C 3I75A 3WS3B 5E9DD 5T3XH 5IW3A 3EH5B 4KO5A 4N26A 4ZMNA 3U1SL 3R7RA 2Z6FA 4P46C 1NAMH 4XNZB 2LFEA 2VXSL 3VACA 2AQTA 3MAWA 5HHOE 4TVPL 4FL4C 3OKOA 2EICA 4OGQC 3BEVB 4R4NC 4O9HH 1S46A 3AUWB 5E9DE 2A9AA 2X2HA 4MKTA 1NAMA 3LZQA 4HMDA 3RX5A 2JJTA 2PETA 2NQCA 4Y2DA 3O41A 3UACA 4RGMC 4L1LA 2KDGA 2R2HB 3GSWA 1DZBA 1WLHA 5JW5B 2ZUSA 1S9WB 2ZOTA 4BXSV 3RGVA 3HMXL 5AKVA 3RP1A 2FO4B 5GS2H 5FUOH 4JGUA 4ZUVB 5CJ8A 3IYLW 4A6YL 4PJ6A 2DIAA 4XI5C 3FN0L 1FSKC 2CM6A 2IFFL 4FLQA 4XVSH 4ODVL 3BEVA 4B5ZA 2CO6A 4CSSA 2CO4A 4KRPC 3D69A 3EUUA 3IFPA 2XBTA 4ETQB 1DVUA 3RVWC 4WI8A 4ZUTB 3UC0H 4APXA 2EVGA 1I9EA 4G80A 2PR9A 4ZODA 3EJYC 4IKNA 4AL8H 4APQA 1KB5B 5EOQL 5HGHB 4R4BB 4Y2OA 1EHXA 4W4OC 5IBLC 5C0AD 4J1UB 2VDMB 2BSRA 3MRMA 2L7QA 5JW5A 3LPOA 1TZIA 1UATA 1MHPH 1IGFH 2ZX7A 5F7BA 3TZVB 3LZFL 3H6AA 3SPVA 2L7JA 4F15C 5B7FA 2YPVL 4QJ5B 2WXNA 2YO3A 3H42L 2YUWA 1M05B 1OXYA 4LLVB 4RFEB 4ZUVA 4D8PB 5EEXA 5KS9F 1MI5D 5IVXB 1J5DA 5C0AE 4DQOL 2VDMH 3B9KA 3KCPB 2I7SA 3MLTA 4ZUTA 2G9HB 3NTCL 3IN0A 1AS6A 4IJTA 3LHAA 4R4BA 3WI9A 4F7MB 2ROXA 1BLNA 4J1UA 1MI5E 3ARED 2AEQL 2N1TE 1UA6H 3PGFL 1EX0A 1ESOA 2C3XA 5AKTA 1QHOA 4XMPH 4JMNA 3QPKA 5HYJE 3QXUA 1ZANL 2XOTA 4L05A 1CTMA 4RFEA 2H6UA 1J7VR 1M05A 3C8KB 3DGDA 3P0GB 1L0XA 2FWUA 2X3AA 3BUYB 1T21A 4L23A 3HC3L 1DFBH 5AB2A 3LHPL 1SZNA 1R46A 3O2VH 4FQXB 5EOCL 3KCPA 4KJPC 4EKJA 4Y1AB 3HPLB 4MMYB 1EXUA 1OPGH 2G9HA 2LGNA 2NY5L 3I74A 4HIHB 1OAKL 4KJQC 3RTQD 4K23L 4NWUH 3GMOB 3KYMB 4JPKL 1SLUA 2HVKB 4FFWD 3KVQA 1C16A 1Q1JL 4JPVL 3CDYA 4Z7NE 3V0FA 4ANKA 5IJVA 1EVTC 2J1ZA 1SLWA 2CNZA 4ZG1A 2VLKD 1DVFD 2Y36L 3MBEB 5DVKA 2QQLL 4HJGB 4N5UA 1T83C 3BUYA 1WFIA 2CBPA 4G7SB 5D2NB 1E4HA 3T09A 4YUEL 4FQXA 3WO4C 5B4MD 1B4TA 1UVQB 3FO1B 3L7EB 4UT7H 4Y1AA 3HPLA 1C1EH 3L54A 4MMYA 2VLKE 2I7OA 4KRLB 3ABKB 3LRKA 4Z18A 1DCLA 2ARWA 3GMOA 4HKXB 2EDQA 4I18C 3A6OA 2HVKA 4W9EC 5JORB 1ETA1 1AC6A 3GMPB 3UAJC 3KDMB 4FEMA 3OJDB 1C12B 3SOTA 3A3YB 3BCFA 3R06B 3SCMD 4AGLA 5IHLB 3TBVB 4N6RB 2YAFA 2XKUA 3MBEA 3M45A 4RNRB 3V7MA 4HJGA 2Q20A 1PQZB 1LE5A 1Y1UA 2VERA 5JXEA 2G30A 5D2NA 1AD0A 3CFTA 4XVUC 4BQ9A 1P4BL 3FO1A 4WHCA 1QUNB 5JXAL 1JD7A 3VQMA 3RWFB 3TT1H 4MCNA 3V0IA 1JYXA 3NJHA 1LM8V 1UXWB 1VFUA 4AW4A 3FB8B 3B4NA 3K1DA 4HKXA 1XB8A 3NDZE 4WHTB 3QYNA 5JORA 3OGCB 3M17B 1C12A 3PLYA 2OL3B 1KGIA 2PPEA 3R06A 1FCGA 2GSMB 4M93B 4C8XA 4HKBB 4UZGA 3TBVA 1FP5A 2W60A 4K7PL 3ZXAC 3GXDA 2ILLA 3VVVA 1CICA 3DYMA 4PY8I 3DO7B 3DOSB 1OW0C 1QHPA 3MTRA 1J8KA 1TQBB 2FEJA 4OD1H 1BEXA 4HJ1A 2Y5EA 3APMA 5JQ6L 1K4CA 5F96H 1DJIA 3AQZA 4EUPG 1NFDA 2UXTA 3V5DB 1UXWA 1XGRB 4MXQD 1HIML 3FB8A 1NGWA 4H44C 2YD5A 4I77H 3O3BB 4UILH 3WKPA 3D39D 4HOWA 1QVOB 4LAQH 4PTTB 2X53A 3M17A 4IU2A 1X5MA 1G1KA 2BHYA 1DQDH 3FQ2A 2ZKWA 4HKBA 3VRJA 4JRWA 3HG1A 3UOAB 1TQTA 3LIZL 1KB9K 4H40A 3DO7A 3UMTA 3DOSA 3QR2A 3CFBA 3GZPA 4YLBA 1A9BA 3OXSB 3VXUD 2V2TB 3D39E 2I5YH 3A4FA 3WV0A 5D2LE 2J43A 5I15L 2DQEH 3EFFA 2Y3AA 4KHTL 5F1IB 5DI8A 1RZ8B 4O2EB 4ETYA 4NZTL 4UTBL 3V5DA 5HHQA 3MLWH 5KSVB 4OZHA 2YEQA 4UV4L 1R4XA 1ADWA 4FABL 3QIUD 3DGGB 3Q2NA 1SPDA 4AE0A 1OD7A 5C0RH 2HFGL 1QVOA 3IDMA 1YQVL 2FVNA 3VXUE 2X89D 4PTTA 3MCKB 5AVWB 1QBMH 3TNNA 5IIEA 2NMSA 3LPGA 4G7RB 3BJLA 3FRUB 1A5FL 2YOAA 3K6DA 2NQ3A 1TVDA 5HI4C 4K15A 4U6XB 2GI7A 3CMOL 3K6NA 2DLFH 4JO1H 4JFVA 4TSBH 1IJNA 2FB4H 4B9KC 1UCTA 2R2EA 2UVFA 3OXSA 4N24A 4JG1L 5C7XL 2J88L 5DQ9B 3GXMA 1U8JB 3W9EB 2W38A 1NL0H 3B34A 4IGBC 4M56A 4P46A 4DVBB 4O2EA 4OJFL 3AU1A 1CUOA 2WO4A 2F8VA 5I1IH 4BKTC 1XV8A 1ADQL 4ZMQA 2WWMD 3DGGA 4KWUA 3MCKA 1YEKL 3X14B 2DPKA 3KEDA 4IRJD 1T1YA 3FRUA 2VDQB 5CAYB 2FEEL 3E7JA 2NZ9D 2Z9TA 2CO2A 4JR9H 3QNZB 4KBPA 2JNZA 1NMBL 2BY1A 5F9JB 1ZEAL 3FUIA 3W9EA 4F57H 5E6ID 4LBEB 4NUPA 4UTAH 1N5AB 2IJ0C 1LK3H 2Y1YA 2YFNA 1NFKA 3K0WA 4ELME 4YPGB 3KDPB 3MV9D 5E1HB 2VDQH 1KYAA 2YK1L 3J7HA 2VR5A 3CFJB 4FZ8H 1HXYA 1PX3A 4IKIA 5EF3A 2DI9A 4HS3A 3FPYA 1QG3A 5DRNB 3G6AA 2WP3T 5FO7B 3P3SA 4U6YB 3ULSB 4HULB 2X41A 4UTAA 1SOKA 2XPZA 5BS0B 3MLVL 4WHYH 3ETBF 3T3PF 5AOZA 2EQDA 1F18A 4PP2B 4NYLB 3MV9E 4NC1C 1E5ZA 3HA0A 3IM1A 1NC4A 2FEDC 2BFVH 4OTXL 3MODL 3FULA 1BGXH 3RA7L 2LAGB 1X9LA 3BH8A 2PXYD 5AYUH 3SKOA 3Q06A 4A2GA 1IM3B 4ODUA 1N5AA 5KVMC 4XNYH 4YGVA 5TGBA 4QRUA 1ZTXL 4XN2A 1SJVA 1YEGL 4YPGA 4XNAA 4LDEB 2E7BA 4AEHL 5JYMA 4A2MA 2O5YL 3F3HA 3N3EA 2MNJB 1TG8A 2UZYB 3H8NA 5DRNA 1NLBL 1HDMB 4LHQB 4TNGA 5FO7A 2GAZB 3MYZA 2IWKA 3ULSA 4NN6B 2X4QB 2GJ6D 4UTCA 3WJLA 3GLAA 4XPGH 1Z1WA 2F7IA 4HBQA 1CFQB 1AGDA 1PW3A 5JMOC 4KPHH 5GGUB 3CH1B 3K46A 2EADA 3NEOA 1W0WB 4LIQE 4QTIH 4ZOEA 3TN0D 5EZLA 2Q3ZA 4NQSA 4DWHA 1IM3A 2GJ6E 1FAIH 2XPYA 5HI5D 4D9LH 4GRWE 3DMMB 4J3OF 1ZT1B 2OXGB 3ZDYE 3IDYC 3EBAA 5CP7A 3B6SA 2JE8A 5EZOH 2X4OA 3LKOB 2UZYA 3VWJD 2JQZA 1IBGH 2GAZA 4PRNA 1OANA 2UZXB 4GW1B 2X4QA 1HE7A 5JR1H 1N0XH 2HKAA 1KBPA 5IEHA 3SDCD 1CGSH 4KJWD 3VYOA 2G60H 3V4VB 1YEHH 3R0NA 1PKQA 3BWUC 5FCUH 5D7JD 4UNTA 3C87A 5MP6L 2Q8BH 1EFXB 1KXQA 1F4WL 5GGUA 3CH1A 4BKSC 1UM4H 1W0WA 2BHFA 1IC4H 4YBQC 1D6VH 2FECL 3X1GA 3BZ4B 2BWIA 1BMGA 1JOIA 1NCCL 3OAYH 3NCWA 3DMMA 4YK4B 1YEJH 5ACLA 5T8IA 1T83A 1M7UA 2K0RA 4HP5A 1JWMB 5DK3A 4NP4H 3RWIB 3V4VH 1MEXL 2OCFD 3WD5L 3GXNA 4PJAB 5DYOA 5DD5H 4MB1A 4ANXA 2ZONA 3X3GL 1IAIL 2UZXA 4GW1A 5DT1H 1NC2B 3LEVH 5EV7A 2WXIA 5IHBA 2BNQA 2P49B 2MIZA 3GMLB 1KFGA 2IANB 2H6OA 4NUQA 4XRCB 4NUJB 4ENZA 2XBDA 1F4YH 3V4VA 2BP8A 1D5IH 3G6JE 2V5YA 5BVPL 1A7OH 2H3XC 1F45A 2GUOB 3UAJA 3TBSB 2BY2A 2DBLL 2Y3NA 3WKML 1QBAA 2X5PA 1LEIA 4BA0A 3BZ4A 2ZXDA 4DGYH