1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
3S8FB 3FSAA 5B1JC 3QJQB 2DYSB 2AZAA 4KOBA 3OMIB 2IWEA 5TK4A 1BQ5A 3ASNB 5LDUA 4DP0X 5D4HA 1VLXA 1AS7A 3AZUA 3NJHA 3GYRA 3S8GB 3GXUB 1QLEB 2FJSA 4Q89A 5AZUA 1FWXA 1PZBA 2YAQA 2AANA 4KO7A 4AKQA 4BXVA 3FU7A 4DPCX 1A4CA 4AKOA 4YSCA 1A4BA 2QPEB 4UAHA 3BVDB 1ID2A 2I7SA 3NJGA 1AZRA 3S3BB 5B7MA 1NPJA 1FA4A 4E9SA 2HRGA 2BP8B 4Q8BA 1QHQA 1EHKB 1TU2A 3OD3A 3FSZA 5TK2A 1L9RA 1W8EA 1CC3A 3FPXA 4JHUA 3QJRB 3FQ2A 1GS6X 1I53A 2UX6A 1GY1A 4DP2X 3S3DB 3PAUA 2GSMB 1M9WA 4KO6A 3PLYA 4YSDA 1NICA 2BZ7A 3QJSB 1WA0X 1A65A 1OE3A 4G7SB 1KBWA 2BHFA 2QT6A 4CSPA 2GC7C 3NSYA 3NP4A 4AX3A 5B1BB 4YSRA 4PCYA 2OV0A 2PPAA 4A67A 2HRHA 2BWDA 4KNSA 3X1BA 1CYXA 2YAHA 2PP7A 3KW8A 4KNTA 1SJMA 4JHVA 2VW6A 3L45A 1ASOA 3FS9A 4E9XA 1AZUA 3ZBMA 1AZBA 1BYOA 2VW4A 4UF7C 3G5WA 6PAZA 2R7EB 3ERXA 3TBBA 1J9TA 3FQ1A 5F7BA 1HFUA 1KV7A 2AZUA 2BP0B 4P5SA 2XV2A 2BZCA 1TKWA 3OQRA 5B1KA 3HB3B 2VM3A 3FQYA 1JZIA 2YARA 3NT0A 2EIKB 1J5DA 3NJIA 2HZHA 1GR7A 2OCCB 4YSEA 3PAZA 1WS8A 3CVCA 3PCYA 3DKHA 2WO3B 3NJNA 3C75A 1FFTB 4N8UA 3ASOB 3NP3A 5EHFA 5I6LA 1JZGA 3PXLA 1ADWA 4HZ1A 2ZONA 4PAZA 3V9EA 1ZIBA 1JZJA 2QPDB 1PNDA 4DP5X 1ILSA 3FU7B 2ZWNA 1JXDA 2I85A 3QJVB 3T6VA 1MZZA 2BW4A 4HCIA 1MZYA 3ZIYA 3FU9A 5AFAA 1WA2X 1JERA 1PAZA 1IC0A 2X87A 2FQEA 4BWWA 1IBZA 1URIA 3FYIB 2HX8A 4M3HA 2BP0A 1V10A 2IDTA 2W8CA 4AKPA 2EIMB 1A4AA 4E9YA 1JZFA 1IKOP 2UXVA 1L9TA 2H5UA 3IN0A 3WKQA 3T6WA 1PY0A 1X9UA 1SF5A 2CCWA 4YSTA 3WNIA 1BQKA 1OV8A 2ZOOA 1ETJA 1DZ0A 1CYWA 1NTDA 1ZPUA 2J5WA 3QJUB 2CAKA 1E67A 3KW7A 1L9OA 3TU6A 2JXMA 3V9CA 3ZX1A 2PPFA 4KNUA 2AVFA 3CG8A 5I28A 5I6MA 4YSUA 1OOWA 2VSKB 1ZV2A 3EF4A 4NERA 3RYMA 2YAEA 1B3IA 2HLEB 2J56A 2IDUA 2IAAC 1SHWA 3IE9A 2GB2A 4QKTA 2H47C 2VSMB 2W88A 3ABMB 3NJJA 4YSOA 5I26A 4HCGA 2X88A 1BXUA 2VM4A 3N55A 2ZXWB 1QNIA 2DWTA 1OE1A 2XV3A 2GI0A 2MTAA 2PCFA 1M56B 4BK5C 1SF3A 1YLBB 3SBQA 1NPNA 1CUOA 1KCBA 4F2FA 1BQRA 4M4RB 2UX7A 2LLNA 4HHGA 1NDTA 4BDVA 2YAPA 2EILB 1XB3A 3DTUB 3SBRA 3EH5B 5I5IA 4W1TA 1UATA 1JXFA 1DYZA 3NYKA 1J9RA 1AANA 1NIDA 2IH8A 3UABA 3NJKA 1X9RA 5I6NA 3AG4B 1RKRA 3T71A 3T6XA 1SDDA 3SBPA 5A7EA 2HX7A 4KO9A 1ILUA 1AZCA 4TXVB 1SFHA 3IBOA 2YXVA 3AG1B 2QDWA 4GY4A 5PAZA 4A2FA 3CZUB 1AS8A 2XLLA 4ZK8A 1WAEA 4L0PB 4E9VA 3FT0A 9PCYA 2UXTA 4DP1X 2IWKA 3X1FA 1ET5A 1KCWA 4DP4X 5D4JA 3WIAA 1JOIA 2TSBA 1JZEA 1GW0A 3S3CB 2JKWA 4A2DA 3AY2A 1KYAA 2CBPA 1AOZA 1BYPA 1PZAA 4DP8X 1L9PA 1ASPA 4G7QB 1OCZB 3JT2A 4N4YB 7PAZA 3WNJA 4NAJA 3UACA 1BXAA 1NINA 4GP5B 2HXAA 3T6ZA 4BWTA 2P80A 4YVNA 5I6PA 1PZCA 2FT8A 1XB8A 2H3XC 1HAUA 4GYBA 4DPAX 1MG3C 4QLWA 4HCFA 3ABGA 3D12B 4BXSV 1BAWA 2PPEA 4EF3A 4AZUA 2IDSA 5FC9A 1V55B 3GDCA 1AG6A 1JZHA 3IEAA 4G71B 2GC4C 3MX0B 5I5MA 2XXFA 1GY2A 3TA4D 1N68A 4HALA 2Y1AA 1F56A 4G72B 2FT7A 4G70B 1M57B 1J9SA 1A8ZA 1GS7A 3PPSA 3OMAB 2XUWA 4KO5A 1SNRA 2BW5A 2YAFA 1MG2C 1PCSA 1JXGA 1JVLA 2NRDA 3OM3B 3TASA 5B3SB 2YQBA 4DP7X 4A2GA 1SHXA 2MRYA 3WKPA 1RZPA 1ZIAA 1N70A 1EZLA 1ET8A 2FQDA 4A2EA 4A2HA 4BDVB 3FSVA 1MDAA 7PCYA 1AACA 4KOCA 2EINB 3H4FA 3FU8A 4YSAA 2DV6A 3BQVA 4JKNA 3NJMA 1SDDB 4E9TA 4FAAB 4MFHA 1NIEA 2XVBA 3SQRA 1WS7A 2XXGA 3UAAA 1V54B 5IY5B 2YAMA 1XMEB 3CDZA 4YSSA 2XV0A 2VMJA 3NSDA 3QQXA 2PLTA 2E86A 3NJLA 4G7RB 1GYCA 2OJ1A 2GBAA 3WG7B 1HAWA 2VN3A 4YSPA 2B08A 2DY2A 4HAKA 1KBVA 3UGEA 2B3IA 2DWSA 2Y69B 2BO0A 2J55A 2XX1A 4DPBX 1JVOA 3UADA 5AKRA 1IUZA 1WA1X 2XYBA 2P80D 2XWZA 5F7AA 1NZRA 5B7EA 2IDFA 2IWFA 2EIJB 3WI9A 2XU9A 3PAVA 1AAJA 3H56A 1E5ZA 1PLCA 3ABLB 1CURA 1ZDSA 2PCYA 5I6OA 3ABKB 1AZNA 3EH4B 1AS6A 1L9QA 3H4HA 1NIBA 4NB7A 2FQGA 1ZDQA 6PCYA 1OF0A 4F7KA 1BXVA 5PCYA 3X1GA 2GIMA 1PF3A 4CSZA 4P5RA 1W6WA 1XB6A 2A3TA 2PP9A 1E65A 3FYEB 1KDIA 4K9JA 3FSWA 1PNCA 2QDVA 4YVUA 3AG3B 3EHBB 4YL4A 3AW5A 1KGYE 1R1CA 4HIPA 1ET7A 4AI7A 4ENZA 1GS8A 5D4IA 2CALA 3FPYA 1A3ZA 3MBWB 2VW7A 2TSAA 1IBYA 2Q9OA 1NIFA 2Q5BA 3N2JA 1SFDA 4UANA 1AQ8A 1OE2A 2FTAA 2UXGA 3AG2B 3CVBA 2FNWA 4WKXA 3IN2A 1OCRB 1L9SA 1ASQA 1J9QA 3HEIB 2CJ3A 1BEXA 2BP8A 4GXFA 2FWLB 5ANHA 3UAEA 1AR1B 2J57A 3T9WA 8PAZA 3CDZB 3NSCA 3NJFA 3QPKA 1T5KA 2FQFA 4X4KA 3TBCA 1KDJA 5E9NA 4A66A 1OCCB 1PMYA 4A68A 4WTQA 3QJTB 1GSKA 4DP6X 3ZDWA 1NIAA 2JFCA 3X2QB 4FA7B 2YXWA 2BWIA 2PPCA 3JTBA 1RCYA 1TEFA 1OCOB 2UXFA 1AG0A 4GP4B 2GHZA 3X1EA 5B1JA 2I7OA 3U25A 3X1NA 2FT6A 5B1AB 1PLBA 3DIVA 2HX9A 4W9ZA 1E30A 4E9WA 2WO2B 2DYRB 1NWOA 2IDQA 2PPDA 5I5JA 4E9RA 5I6KA 2RACA 2R7EA 4DP9X 1RZQA 4BWUA 1PLAA 4GP8B 2PP8A 2XX0A 3NSFA 3EH3B 2N0MA 1E5YA 1TEGA 4E9QA 1J5CA 1NWPA 2IH9A 2YAOA 3CVDA 1W6LA 2CUAA 3OMNB 4RH4A 5B7FA 4HHWA 4F2EA 2AFNA 4YSQA 1AIZA 2WSDA
chains in the Genus database with same CATH superfamily
4WKZB 1JUFA 1SVZA 5IHLB 3GT6A 4NZTL 1FRGL 3OMZA 4P2OD 1UWYA 3QUGA 3GXUB 1QLEB 1BQUA 1PZBA 4POZC 3VM7A 5IT2H 3GMRA 3LPGA 1CFVH 5J8OA 5E5MA 2QMKA 3ZE1B 3TS8A 1MCQA 1M4KA 5DD0H 5DJYA 2EVFA 1TQCC 2FATH 5K39A 4DGYL 4X9BA 1X7QA 1OAKL 4UTBL 3UXFA 2JI1A 4IKLA 2R83A 3S3BB 4PJHA 3UTPE 3UTOA 5B7MA 3MROB 4C59B 4N9GB 4ZXBC 4I9WE 2Y3NA 4FG4A 3QQDB 4K5MA 3V4PL 3EJQA 2OULB 1OT2A 1J05B 4XPGH 1RZ8A 1BAFH 5DS2A 1YMME 2X3CA 2ITCB 1UT1A 1CC3A 4RFOH 3MJ9A 3NZ8B 1HS6A 3LIZL 5IQ9B 3MNWA 2VGLM 1E6JH 2NLJA 4AH2A 3TA3C 3EW3B 4CSPA 4PRAB 3TN0D 5B1BB 3PAYA 1X5ZA 4QLRA 4RMVA 3ABZA 4OBRA 4P5TD 5H94A 3X11B 1JG9A 3D3VA 5TQ2H 5GSRB 1S7XB 1NCUA 1BW8A 4XBPB 3DMMD 4KNSA 5CBEB 1D9KA 2BNUA 2GJPA 3QA3A 1ASOA 1N0LA 3RBGA 4X0KB 1D5MB 2APVA 4K9EH 5F9OH 4MZRA 2AQQA 3ZL4L 1JF5A 1T6VN 3BDYL 5EWIH 4ZX3A 5C8JB 5GIRA 5B3JE 4YDLC 5FM5O 1A4KB 5IW3A 3A6BL 4ZAKD 2DKUA 2MNUA 2R7EB 2IFFL 1IKNA 3TFKD 3PDDA 2AZUA 3DVIA 5GJSH 5A43C 4N86A 4LT7A 1YQ2A 3MRPA 5IQ7L 3BZEB 1A7OL 4BFIA 2HFEA 4OCXL 3RGVA 1J5DA 2EIZB 4OQTH 3ZTEA 1UCBL 5I8CB 2Y36L 4BH7B 4CADA 3CE1A 2G75B 3L48A 3SE4A 5KSAA 5H35A 1MJJA 3BKJH 3WNOA 4FGMA 1HDMA 3CN2A 1QEWB 3OXSA 1ZVSA 4NT6A 4XMKL 3FN0L 1E27A 5J7CC 2VT0A 5AB0A 4BQ6A 1OAYH 4L4VA 2RTTA 4H40A 4OM1H 5AVYB 1U6AL 2FX7H 2G0LA 2DWYA 3UERA 2BIOA 3VXUE 1MZZA 2XQ0A 4HCIA 1LO5A 3GSOA 5E6RB 4JLRB 1WUNT 4Z7IA 3IE4A 3BPLB 3VXUB 3VDCA 5D6CA 4RMWA 4OKVB 4PV9B 1E2VA 4HULB 2QVMA 1NSNH 1MHHA 4W9DC 2BC4B 3GD1C 1TU2B 4BGLA 3OXRB 4YNYA 1P1ZB 1RSFA 2BVYA 1QFOA 4FZEL 5KN5B 2FSEA 3B9KD 4Z5RA 3O2DL 2OAAA 3IN0A 5JW5B 2K78A 4ZDHB 3W0WE 4MRBA 3R7RA 4PJ8C 3DJ9A 1J86A 1UVQA 4U3CA 1GMIA 1XD0A 1DZ0A 3W0WB 4AM0Q 4M1GL 3IRPX 1SJEA 1CL7H 1A6ZA 1T04A 2XI9A 1TO4A 3KJ6L 2YK1L 4FJZA 1CGSL 4MJ6A 3A67H 3CG8A 1IM3A 1M53A 5GGTL 3WKMH 5IGXH 1WV7T 5DZOA 4JN2B 4NC0B 1FE8H 5CF3A 2JJVA 3GMOB 3WO4B 3BGAA 4MDJA 3RL2A 3QUKA 2BNQB 2VXSL 1EZVY 3EBHA 4QJ3B 4R5XA 4YDJB 3QFDB 1R4XA 3CXFA 5I26A 4QRTB 3QI9D 4JPSA 4P23B 4C4KO 4W4OA 3G5ZB 2W9EH 4IRJC 4OF8A 1TXKA 2ORBL 3Q2WA 4FQQB 4JFEE 3ZHNA 5AAPA 1JPFA 4WFGD 1AJ7L 4FTVD 2QADB 3DX7B 4PJ9D 1WAPA 4NYLA 2EILB 5C0GB 4JFEB 2QSCH 1N3NA 3SE8H 5AZEL 3ARYA 3BHBB 3VWJC 3JBG7 3NJKA 1KJ2L 4HIXL 2CDFB 3T6XA 3AWFA 1Z9LA 3FQNA 3HS0C 3OPZH 1FBIH 4LL9A 3IBOA 3JXAA 3DETC 2CSPA 1G6VK 1MJ8L 2YXVA 5C0IA 4JJ5A 1JZ7A 5C0CE 3VG0H 4DN4H 5DEGA 5IIEA 1JF1A 1T80A 5C0CB 4PB0L 2IWKA 4HT1L 4KQ3H 4KK5C 1IQDA 5AW1B 4ODSH 4Z3TA 1VGKA 1AKJA 5FYKH 5EZIL 2OBGA 3VGHA 2EUVA 1L9PA 3MNZB 4EIUA 3QH3B 3KR3H 4Q0XL 2ATKA 5IVXA 1RZJL 4APQB 3L3GA 5F1IA 3QUZB 5DMGD 4GP5B 2JCWA 3OTTA 5ISZA 4JMNA 4N2EA 1FGVL 1NGWB 2ZIDA 3BZFB 1RJZB 1U93B 2KHAA 5DJDB 2JIXB 1K5WA 4WI2A 4L5FH 4RESB 5DUBA 3K0YA 1MG3C 1G9NC 4HKXB 5ACZA 3UTTA 2CUIA 4Z95H 1RLBA 2YUXA 1FDLH 2H7WA 1V8HA 2IDSA 3H7LA 2YD2A 5AOKA 5H2BA 3GDCA 4AL8H 5GISL 3P1VA 2HKFH 2GC4C 2WYHA 4S1SH 2AJXH 3VI4A 3QUYB 1ODAA 2D2OA 2EDRA 4PLNC 1N19A 1SUJA 4ILDA 2FHFA 4U6VH 4OM0L 1YUHB 1J10A 1A8ZA 3V5KB 3VGEA 1NCWH 3KS0H 4PY8I 4I0PA 5IB5B 3SO3B 1YQVH 2XUWA 2DW5A 2FR4A 3OGCA 3FU6A 1S78C 4P4KB 3FFCA 2YAFA 5JHAA 1PCSA 2NRDA 2N7AA 3GXNA 2BY1A 4WDIB 3WKNA 3TBSB 1K85A 3SOTA 4FEMA 1Z5LB 1SY6H 3X12B 1JNJA 2BSRB 4L9LC 5E1GA 1N70A 3QIBD 4JFWA 3WSQL 4PJBF 2YD8A 3FSVA 2H8PB 5SX5H 1A6WL 3BI9X 2CXGA 2O6PA 2OJEA 1T2JA 3HS9A 3N9GL 3TZVD 3AGWA 3ZKND 5HYEA 4X8JB 2OR8A 2UY7B 1IC4L 4D7PA 3BQVA 2WNXA 1RUAH 2VLKD 4U0RC 4E9TA 4M6NH 4P05A 4EVNA 3LH9A 3C5JB 2E4TA 5FECB 3FZUD 2DDQL 2N7BA 3VXRD 5HHPA 3K2UH 1A21A 3PHAA 4QHMB 5C6WH 2ADFH 4DUWA 4DK5A 5JHDE 3T4YA 2FIKB 4XHQA 4AXWA 1FVCB 3EJYC 4GI8A 4XZUA 1FRGH 2J73A 4UYQA 2EDTA 3HC3L 1PZUB 2HN7B 3ARFC 3AADB 4GAYB 4FJ6A 4JEGB 5B1CA 5AB2A 1OZUA 4LLMA 4R96A 2YKLH 5AKRA 4DGYH 5IB1A 1OAKH 5TE6H 4FEIA 1QSEA 5JLZA 3K5SA 3FTYA 5GGUA 3OC8A 3WTSA 3F6IA 1YN7A 1U3JA 3EH4B 4Y2OA 5E5UB 1EV2E 2D7NA 2EDOA 3QISA 2OR9L 1XGZA 1NIBA 3KPNB 2VERA 1ZDQA 2NY2B 2P49B 6PCYA 3P9WB 4G6FD 2QZ5A 3EAKA 2CZNA 3N1PC 3MUJA 3L08A 4BFKA 3LKQB 2GIMA 5I0XA 4D8PB 3LZLA 1P1VA 3E0GA 2OS7A 4KK9C 3LN5B 4GRLA 4WFED 1Z3RA 2WNWA 4ADIA 2PP9A 1G9NH 2YFNA 3E3QE 4ELMB 5B38B 3FSWA 2AK4B 2V37A 3MRCA 5J6HA 1JNHA 1FNSH 4UDTA 4KV5E 1RD6A 1KGYE 4FQHB 4JFHD 1NUDA 4NN7C 4XO5A 3ZO9A 4ZI8A 5KZCD 3O8XA 2EABA 1GGIL 3UROR 3I2CH 3CD4A 1MFCH 2XBZA 4Y19E 5JOPD 2Q9OA 1JYVA 1IEAA 1P7QA 2VAAB 3L7EA 4FHJA 1OAZH 2AF2A 2L7JA 4XRCA 5FA3A 3IU3A 2VR9A 3OX8B 4F92B 2F68X 4Y19B 4L4JA 1UH4A 1MWOA 2ISDA 5M94B 4G7VL 4QXWA 4L3FA 4YHOL 3HZKB 2E7DA 1S7QB 4XVUC 1UFUA 2P44B 3BDBA 1O5DT 3I9GH 1H0DB 4NO5A 4MQSB 2FJHA 5GJTL 4MD4A 4G43B 3ARGD 1A7OH 1WCBA 2ARJA 3KYNB 4LSVL 5HDWA 1KYFA 4OCXH 8PAZA 1A8JH 1N10A 5BOZG 3CDZB 4Q74A 1GXEA 1I9IL 4PJAF 4U7SA 2Y36H 2Y22A 4MCZA 5FHBL 3VXMA 1XBRA 3ARPA 4NKMA 3SGKA 3VAEA 2HFFA 1JZ2A 1BOGA 4FN0A 4QRPE 3RIAK 3CDGA 3S2CA 1OCCB 3C6SB 4LVNB 4MQXD 5DRZB 1FIEA 1Q9LB 1IGJB 2P47B 3IDUA 4NAQA 3STLB 2A99A 4QHUB 5CJOH 4QRPB 1HXMA 1UUSA 2BWIA 3FN0H 4BE6A 2I27N 4C4UA 2YD1A 2GIXA 1YEKH 4B9GA 4R4FH 1V3JA 5AYTA 3U0PA 3L4CA 1KFAL 3MODL 4JRWA 3VRLE 3VD2A 1Y1DA 2X6VA 1NDGA 3OZ9L 5F6HJ 3OAZH 5F0JB 4X7EC 3GZOA 3VFSB 3L7FA 4TLKA 5IKCA 1JBJA 1C08B 1PLAA 3D50A 4GP8B 3VYOA 2ATPA 4MKTA 4GW5A 4HKZB 5BRZA 1RK0A 3BWUF 3H2QA 5KVDE 3L5WA 3O2DH 3BZ4A 2AJ3A 3C5SA 4ZXBA 3OAWA 1UOVA 2R9HD 3WY1A 1CFNA 4ODVH 4ZFOA 3HI1B 2C3HA 2BVTA 1TTRA 3L4UA 4NP4L 4XPBH 4M1GH 1WE5A 5FYJE 5CCGE 4LPCA 3FUMA 4PS7A 1JGDA 3VFMA 4LKCA 4OY9A 3C5ZB 3RWDA 1CGSH 3F00A 3CQPA 3OMIB 4IGBB 1NEZB 3B2VL 3BP7B 1VCBC 3WYRA 5GGTH 3T4AC 4RRPA 3AROA 5KW9L 4WI9A 2XQYK 4AITA 4AUUA 2Z8RA 4PP1D 3TA3A 4BXVA 2E7LC 5F7YC 3GBDA 3V8CA 4LQ1A 3KYMA 1A4CA 1I1YB 3D51A 2BHYA 3L95A 5A16B 4DW2L 5I5RA 1QWNA 5LGJB 5MENB 3AABA 3MRNA 4G8EB 2ALAA 2QVIA 3NA9L 1HQ4B 1QSVA 4KRNA 4Q2ZA 4XNYL 1F8TH 1RJLA 3HJ0A 4NZJA 1QHOA 4KGJA 4LVEA 1AXSB 4NBZB 3LQZB 3EJZD 2ORBH 4RA3A 2DQ6A 3AM8C 3RJOA 1FNFA 2RCSL 4FA8A 1IQWH 3HI5H 3MV11 1T1YA 3CSGA 4PTUB 5TK2A 3P30L 1I8IB 3H53A 2OMYA 4B9CA 1BLIA 2CIKB 1PTZA 3PWPD 2K4AA 2R1YB 4LAQL 4XX1E 4DP2X 2JQZA 3H3BC 3DJRA 5KEZA 4TVUA 3VFPB 4PWHA 1OHZA 5DHXB 3TT1L 3EF7A 3UYPA 4DN3L 5AQ0A 1J8HA 1GZHC 2QT6A 1FJ1B 3L2NA 1MHPH 4W9KC 4LCIH 2BINA 3SDXF 4L29B 1ZT4B 3QPXL 4O00A 1G0XA 1Q9OB 2Q2EB 5I1CL 4NFBA 2DEXX 4GAGL 1IGCL 3MRJB 4DK3A 3HPJB 1LWRA 2J2ZA 3UBFA 1J1XL 1FI8C 5AW5B 4KJYA 4LRIC 2G5RA 3EO9H 4U1IA 3D4YA 4JRFA 4MD5A 3Q1SH 3MV8D 1JZ6A 2VW4A 3CLEL 4RNRA 4KI5F 2YMXH 2XVGA 4ATTA 3U4AA 4Z6AT 5IHZB 2I5YH 4RGNE 3OB8A 1XZWA 3F83A 2BSBA 3CU1A 3HB3B 4RGNB 3X13B 4Q0XH 1WBZA 1CICB 5IP4A 1T7ZA 4F5CE 2MJWA 1A3QA 2EVJA 1UG9A 3H6AA 1G7HA 4M4RA 1TITA 3IRCA 4W9IC 1GMEA 4F7PB 4IRSC 4UIKH 3I85A 1FGVH 5CUSL 2DYPB 3WN5C 4KUZH 2GJJA 1TZIA 3QFJE 5T1KA 2VZUA 2QELA 1E43A 3OSKA 1KXVC 5ITFA 1JZGA 3MV7A 4PJ8A 3P4NA 1MCIA 3QFJB 3LV3A 5BZDA 1E4XI 4NRXA 1EEZA 2C8NA 1JZJA 2BVEA 4D7BA 4YHLL 4Z7OF 5L2JA 1PYWA 3ZQWA 1ILSA 4N2DA 4ZO6A 1OSPH 2W38A 1T4WA 2HTKD 4ZUSB 4HLZH 1BF2A 3C60A 2EVHA 1MZYA 4KZCA 4JHBA 4MYWB 1KTLA 2FEDC 2X87A 3BUTA 2FQEA 4PWGA 3BEWB 1BV8A 1S9VA 5E1IA 3B1TA 3UP1A 2OMXB 5E0FA 1QWHA 3TONA 2YEZB 1AZZC 4U3XA 2DD8H 1SY6A 2WO4A 3K3QA 4OI8A 3WXWL 5DMIL 4KXDA 2JLPA 1JHLL 1L9TA 4NUJB 1BZEA 4B96A 1S7RA 5FHAL 2FO4B 1A6WH 4X6FB 4IRJA 1DQQB 1HI6A 4Y5YB 3S3SA 3LH8A 1IAII 2X2JA 3QJUB 4M43L 2J21A 1MEXL 1MI5A 5JHLH 1A6PA 5FO9A 4M9OA 1N2RB 4OLUH 3APDA 4RDQF 3FRUB 3GS7A 2C9SA 3GMLA 4Z7UB 4Z3EA 3PHQA 4Y89A 4ETYA 2VC2B 3GMMA 2H6PB 2IH1B 4TNEA 2DDQH 3QJHB 1SXZA 2VSKB 3FQRA 1IAIH 3VWJA 2IAMC 3QZWG 3GB7B 3GJFB 4PTTB 3VQ2C 3QG6A 4X6EB 3WE6A 3MBEC 1OB0A 4E41A 3ZYIA 5C7XL 3HS0A 4JVPA 1AMXA 5EN3A 4KY2A 3QEHB 2VIRB 4I4WA 2VDMH 3GKZA 4CAGA 5E0QA 3PUCA 5J1AA 1NBZB 3HC3H 3BWUC 1OB1B 3SEPA 1YEFL 3U1SL 3BESR 1M56B 4NENB 4LSUH 3RWJA 3TO2A 5ICYB 4BK5C 1T0MB 4JGUA 1I8MA 3EYOB 1X4XA 2VOTA 2VDRB 5D1QB 1ORSB 2UX7A 4M5SA 1MAML 4WUKL 4R4ND 4KRMB 2KZBA 2GQHA 1JDDA 2W60B 3VRJA 2EECA 4JREC 2OR9H 3H55A 3EADA 3KL0A 1R3HA 3HOGA 3L3HB 4N3UA 2IG2H 1OY3B 2O4EA 1HWGB 2XZZA 3MRMB 3TBTB 3SGEI 3RTQC 2P46B 1NC4B 2Y2WA 4JO2L 1F1AA 3BP5B 5E8EA 3UDWC 3HPLB 3MNDA 3RFZB 1KPVB 3O9WC 5ICZB 1JHKL 4WK0B 1RVFL 4AVKA 1RUKL 3D87B 1JMXA 1R24A 4GIPD 4FQXB 4MS6A 2BRRL 2QTVA 4AENA 4FL4B 1I75A 4KROB 5D4JA 3S36L 2KQMA 2HMID 4HZAA 4I5BB 1A6TB 1GGIH 3PWUA 1NBQA 1KLUB 3PWVB 4IS6A 4DP8X 3BQUD 3VM5A 2RGSA 4A6YL 3PG2A 1JNNL 2PYED 3C8DA 5D1XD 2R2EB 2I69A 2ZYIA 2Q3AA 3QDGA 5DC0A 3LHAA 4YHOH 4M8RA 3UL4A 4AK2A 4L9LA 3B7YA 4TL5A 3ABGA 5DEJA 5DGQA 4R4BB 1QRKA 5I0YA 4R3SB 4LSVH 5IMKA 1ZHKB 1C12A 5L4FA 2HH0L 3ZE2F 2C4FU 1I9IH 2WVTA 3DSNB 4HJEA 2Y7QB 1B4LA 4IBQA 3HG2A 1GY2A 1UM4H 4JZJB 4X0NA 4L18A 5C9KA 1N68A 3CIAA 4RX4A 5GGQL 2MHAB 4FXKB 4JMXA 3A23A 4X6BB 2WLZA 4KI5C 4OJFL 4PRNA 1RP8A 2NNFA 4M5ZL 1TJHL 3KPLA 3T77B 4HEME 4LPXA 1SLVA 2X6MA 4BH8B 2EDHA 5DZNA 1PKQE 3PWNB 1IGIH 2YD0A 2XACC 4KO5A 4OLVH 4Z76A 5ENWA 3TASA 1FZMA 2PWHA 4HFWB 4NQVB 1LE9B 4UQ9A 1CE1H 1PKQB 2X5PA 4N2NA 1WLHA 3TTYA 1A1MB 3QC6X 2XIIA 2HLFD 1KFAH 2Y1VA 4H2AA 4JFUA 4XO3A 2LTQC 3C9NB 1CDIA 3ARFA 3KGTA 5DSCA 3BGMA 3DYMA 4PMEA 3NCYS 4WGWB 2DQJL 4G8AC 4F8QA 5LXGL 3UBGA 1J9CT 4MNQA 1U3YA 3CX2A 3G6AB 1JZ4A 3B2DC 1GPOH 3O2DA 1E4HA 3A6CL 4BZ2L 5GQBA 1P4LA 2NCMA 1DJYA 4C56E 1XMEB 2QLYA 3MZGB 4Y2LA 5EEYA 4GG6E 1BQHG 5IM7A 5C2BL 3O0LA 4W9GC 3DOHA 4XODA 1IM9D 4NAMA 1OP3K 4C56B 4GG6B 3V6OE 2VN3A 1I1AC 3U46B 3MLXL 5E2WL 4KDVA 3PU7A 3UGEA 5GGTA 3B2VH 3ULUF 1D6EA 2WBWB 2ZUTA 3QEQD 1DJIA 2A73A 3RHWF 3TESA 1CBVH 1G7QA 5DVPA 5KW9H 4F1SA 4WJKB 2UZPA 25C8L 3TVMD 2D31A 1XR9B 4J3XA 3W82A 2G60H 4LPUA 3GGWB 5DQDL 3QDJA 5TGBB 1INEL 1T6BX 1BGXL 1WA1X 3VXPB 3HUJA 4MXWL 3IVKA 2MKWA 2XTJC 3ARQA 1X5MA 2BIMA 4XNYH 2XWTB 3BIKA 5MHSD 4JDZB 2WVVA 5CJXC 4UOW1 3GRWH 4IKIA 4PG9B 1J5OL 1ACCA 3OLDA 3E9UA 1D7CA 1I31A 2N7SA 2Q76B 4U6XB 5DQ9A 5KBMA 5GS0L 2WZAA 3P30H 2ZKHL 4ZUWA 1MFNA 3FO9B 1LJMA 1QBAA 2VLJE 2BNRA 3RI5F 1B3JA 1V05A 5ICUA 4QIRA 4ZUTA 1GZQA 3QDMD 5I23A 2GY5A 4YX2L 1KDIA 1VFBB 2VLJB 5BOPA 2QDVA 4NC2B 4PJ7E 3IDJB 2KS0A 4OZ4A 2Q20A 4X8XA 3LEYL 4WENB 3FQXB 1SEQL 5D4IA 4DEWA 3ZE1F 1E0OB 1E8ZA 2ALWA 4PP2B 4TPRL 1L9MA 4PJ7B 1G7JA 3FT4A 4HWEL 5I1CH 5JW4Q 2R8SL 4JDVB 5HGAA 1Z5HA 4JCMA 1SJHA 2FO1A 2MIZA 5CHNB 4UANA 5EC2A 4EN3B 4BD4A 5AB1A 1AGBA 1CLCA 1J1XH 3UG4A 5LHDA 1DSFH 1LTXA 2P5WD 2YC1B 2CQVA 4K71C 3CLEH 2Q7YB 2IMNA 5JA9A 4FZ8L 1PX4A 2EE9A 4F91B 1ONQB 5HYSB 1UH2A 3MMEA 1QACA 1HOEA 2BSSA 5FGCE 2PW2A 2DIAA 4I2XE 4PGCB 1KIPA 4K2UL 4DOHE 3AU1B 3EGXB 3O6FC 5TDNB 3MR9A 3BUQA 5IVZB 1XR8A 1GA2A 4EQ2A 4G8GB 5FGCB 3TYFA 1TVHB 1HH6B 3BH9B 3LQAL 1TF4A 5C1MB 2WWMC 5MEOB 3NSCA 1F13A 1S46A 2HVJB 4PYGA 3AQXA 3L6FA 3LZFL 4PLJC 1UXLA 4JFQB 2DEWX 2DWXA 1FPTH 3WL9A 3T3MB 4UNIA 4NIKB 2WZPA 3S3JA 2PPCA 4G80A 1IBFA 4R7VA 5T1MA 3F05A 2CMRL 1SOQA 3T0BA 1Y07A 2GI7A 2ZOKB 3SDDD 4NFCA 2Z31D 1DCLA 2NR6D 3NIGE 3GTVA 3LAFA 4PI2A 2XKSA 2BY0A 3TCTA 1O7SA 4L0ZA 3FTWA 2A9MH 4MAYB 3NIGB 3O4LE 1E30A 4KRPC 3EYVB 4YBLC 3T4AA 5FUZL 4R0LA 1I8KB 1I9RL 3FC8A 1NWOA 2F7OA 1FO0B 1XZ0A 2X70B 4ESKA 2E7LA 4XB3A 4PJBA 2EDNA 4JG0L 4Y7OC 2XG4B 3GIVA 4TNVF 3RY6C 4ZMVA 1TTFA 4K8RC 5DHVB 2A83B 1F5WA 3WAJA 5IESH 1YY8A 3REVA 3WXWH 5G2NA 4FCAA 3KPRE 3MGTA 1ZTXL 4FOMA 2F53B 4KH9A 3X14A 3WNLA 1FCCA 2G9HB 1NWPA 1QRNE 1FC1A 3IJEB 4PUBL 5D7HA 5D9SA 4UUJB 5FHAH 5LNEA 2WCGA 4JFFA 4RH4A 4GINA 4ZJ9A 5B7FA 3KPRB 4HHWA 4F2EA 4ZD3L 3QIUD 4LLQA 4LMQE 1QRNB 1W0WB 3AM8A 1WF5A 1QUNA 5JHLA 3NSJA 5DFAA 1Q72H 3ETBJ 2I32A 2X6CA 2QV2A 5JPNB 5ALBL 1PD0A 1ZT7A 4NEHB 1NCJA 4ZRGA 4HETA 3MFGB 4ORGB 3OJDB 5LO7A 1MCKA 2FJSA 4Q89A 3ZKQD 2X3BA 2B1AH 2WLLB 2ZUYA 4P2QD 4RAUA 1GZHA 1RIUL 2X0WA 1OWRM 3RU8H 4F3FB 1HL4A 1ZHLB 4OUUA 3H9SA 3BP6A 4XXDB 5AW0B 1IU1A 1A4BA 3HBPA 4UAHA 4YDVA 4RGMC 2Z65C 3MPCA 1XDTT 1ADQH 4P5MA 3MLRH 5FK9B 5FM8A 4JDEA 4EI0A 2GTZB 3TH3T 3LPOA 4LRIA 5HGHB 4K3GA 5L8JB 2KL6A 1AHWA 1VPOH 3HG0A 4JS7A 1RV6X 2CGRL 2YBRB 4GUPB 3W1ZA 4GKSB 3GK8H 5IVNA 1MAMH 1KJVA 3FMGL 5E6ID 4OZFB 1TQBB 3ZUCA 2BJML 1G5GA 2GJZA 1NKGA 4N8VG 35C8H 4LU5L 3K81A 3UBXI 1UUNA 2F0CA 1L0PA 3U2SB 2XWBA 4LP4A 5IV2B 3ULUC 2O61A 2IADB 2UUDK 2J6EL 3FW6A 4IRSA 2W59A 4YGVA 1D5BB 5FB8A 5EU3B 1JIBA 5I9QC 2RFXB 1EHAA 1B88A 2O6CA 3OG4B 3IDNB 4V11A 3X1BA 5JUEH 2FNBA 2CR0A 4ZTPL 3J07A 2OX5B 2BRRH 3IJSA 3KCPB 3RUGE 4D9RD 3S36H 4QWWC 1MCRA 1OGAD 3Q6FB 3ZT5A 1XGYL 1W8OA 4ZAKB 3RUGB 3OV6A 4NM4H 3R4RA 3QW9A 2X44D 1MDTA 1TO5A 3N5AA 1E28B 2P5EA 1OEZW 1JNNH 1ORQB 4Y9FA 5GS0C 5EPMB 2YXFA 4OVUA 4PV1C 5DURB 2VLLA 4LPWA 3E8VA 2NX5A 4EJ1C 1HH9B 1FSKB 4FLOA 3AU0A 4JW3A 4KKQA 4QUOA 1EK3A 4A39A 4QHLA 4PJAA 2YLKA 4OCRH 4HPOL 5I6LA 1UOWA 2H9GA 4UILL 1MPAH 2YD9A 4YO0A 2IPTL 5J56B 5CP3A 5EC1A 2HH0H 5AEAA 5DJ8A 3OKNB 4WI8A 3VE0B 3QP3A 3LNHA 1Q0XH 4NKQB 3Q3GB 5GGQH 3RILA 4NKIH 5ADPL 4OJFH 3B6SA 4P4RA 5K9OA 3MLUL 3MUZ1 3KMDA 1JERA 2X1XR 3WTWA 2I07A 1HHJB 3MSPA 3W11C 2OI9B 3QNYB 1OTSC 3OJMB 4TNWK 2IAMA 4DQOL 2XN9A 1FORL 3E6FB 3INOA 1F86A 4LNRA 7FABL 1WFOA 5KUKA 1KLFB 5D96B 3RX8A 3MBEA 5DDHB 1OF2A 5HY9A 1IBGL 4ERSL 4TSBH 1R3LA 1IKOP 3QCUH 2UXVA 3TBVA 2JLLA 2VLME 3F5WA 4X5WB 3NVQA 2DWEA 5JIIA 2YPLA 4YSTA 2XICA 1SF5A 3TNNA 1UXMA 4NKDB 1ETJA 5D7LA 3FB6B 1LXMA 2X4RA 1KENH 4AYDC 1DTUA 4BK5A 4JZNB 4WV1B 2E56A 3G5YB 3V0GA 3MJWA 1ZPLA 4KKCC 4CMMA 4JQVC 2C3XA 2L3BA 3A6CH 2IF7A 4WZ9A 2WZ5A 5DRNA 3U1PA 4HMDA 2VRQA 3MX0A 1U3HD 4YSUA 4M8VA 4FG2A 1B3IA 3ULUH 2HVKA 5DMKB 4KVNL 3BW9B 3I75B 4ZS6D 4O5LL 1W16A 3MLXH 4AYSA 3ATEA 4YUEH 3RTQA 2WIIB 2YN5A 3GXIA 4OGYL 4QJ5B 3UDWA 4KXAA 2VQ1A 1ZLUH 1R3IL 2WYTA 3O45B 1RURL 5FM5M 3D0VB 3KHQA 25C8H 1PJ9A 2XKNA 4GKZA 1Y0LA 4Q9RL 4NBYB 1IKFL 4FTVE 1FNAA 2J1KA 1INEH 4NWTL 4KMTL 4GG8B 1NDTA 1MCSA 2NYYD 3NCMA 4FTVB 4IHBA 1XB3A 4PJ9B 3EH5B 3DX9B 2N0KA 1G7LB 2PETA 3BAWA 4XN1A 1CD0A 3NESA 3GRWA 3IF1A 3MUGA 4B5EA 4XOCA 5J1SC 2QR0A 3JV6A 4ZPVA 1LK2A 4R84A 5GS0H 2JI2A 2F5AH 1RKRA 3SBPA 1BM3H 3BPLC 4X5RA 4KO9A 2ZKHH 3EBIA 4KK6D 3IXAB 1TNMA 2WINB 4HSQA 2EP6A 1P6FA 2P42B 4L8DA 3L3IA 1A7PL 4YX2H 1FNEB 3ARDD 3FT0A 5ANME 4BHUI 5ITBL 4FFYL 1MHCB 2E8ZA 1VB9A 2CLRB 3LKNB 3S4SA 1HEZA 3BWAB 5ANMB 5E1HB 1UWFA 4KTYA 4HWEH 1HKFA 4QRRE 5IF0B 1BYPA 3RP1A 3VCLA 2DIEA 5ETUB 2VDKL 3GSUB 4F9LC 4QRRB 5EU4A 2D7OA 1LEIA 4PJCE 5EBLA 2P80A 2WAQA 3QQ9C 5FKPB 2WD0A 2YQGA 4FZ8H 4NSKA 3X17A 2ESVD 5DA4A 2L8AA 4PJCB 5I16B 2YGNA 4P57A 3WS3B 5E51A 1UXWA 4J8QA 2AQ2A 4OV5A 4F57L 4OAWB 3EG9B 3GMQA 3FB5A 5GZOC 3UX9B 4ELMF 3C6LB 3B3BA 3CHSA 4KFMA 2CO2A 5D72L 3H9ZA 1SM3L 1F1GA 1AGEB 3ZIMA 4P23C 1NMBH 2J6WA 3B7SA 3MLSL 1IVTA 4LOUD 1J9SA 1GSMA 3EOAA 1CF1A 3HAEG 4B3VA 1X5JA 4IOIA 2CMRH 2CLZB 3W9DB 1P2CB 2DJUA 3SYOA 3EJSA 3TN0A 4LCYB 1CTOA 5KSBA 2BFVL 4D0BB 1I1AA 3FT2A 1BF5A 1ZOXA 1CFTA 1JGEA 3T65B 4XCCH 4BE5A 4NXSA 1KEGL 1RLWA 4R7XA 4JQXC 3U0TA 2WXQA 5FUZH 1XH3B 5DJ2A 5DT1L 4ZX5A 1M6OA 5DO2C 4MX7A 2K8QA 3AY4C 4JG0H 3L4WA 3RIFK 4GBXB 2VLKE 4KTDL 3O0RL 5HHOD 2VABA 4HCRL 1VFUA 1ZSHA 2VLKB 3VXRE 3UAAA 5HGDA 2Z4QA 1RL1A 4PB0H 4YSSA 1ZLEA 5I74C 5CJXA 3NJLA 2AGJL 4ZD3H 4AG4L 1UADC 2GBAA 4PWIA 5GRVL 4HWBL 3VXOA 1BEYL 1LWJA 4RZKA 1CXFA 1NGZB 1QLRB 4APQC 2OMUA 3CFIC 3QUZC 4JHAL 4L3AA 5TF0A 4H5SB 1DQLH 3FQTA 4A04A 4XNMB 2Y69B 2KLTA 2Z93B 3U36B 2V7NB 2XX1A 4BELD 3DGGB 5CU9A 2X3AA 1XTMA 1YYCA 5EU5A 1OLZA 4A1RA 2IVFC 3W2DL 1QI5A 2OYLA 2XZAH 2V9RA 3BUIA 1ZWIA 1ADQA 4J1UA 4OFYD 3U2IA 1CURA 2R15A 1AZNA 1NCBL 4K7PH 5HJGA 2QSQA 3QUYC 1OTTC 1TIUA 4QF1A 3CXHK 4NB7A 2D8KA 5L4JA 1U3ZA 2IALB 3GIZL 4D0DB 3R1GH 3X1GA 3SO3C 4WFEE 3B9KA 3DVNA 4KKLD 3QAZB 4UCFA 3D85B 3OAYH 4JKPL 3O6FA 3SO5A 3UC2A 1COBA 1W91A 3II3A 4EIZC 4U1NB 4JFHE 3TEUA 1LO0L 1R1CA 1KYDA 4G5ZH 2WXOA 1J48A 1OSZB 3LXBA 5JPMB 5JOPE 4RIRA 1T2QL 3FQUA 4JCLA 3V52L 2F18A 1ZRUA 5KZCB 2LQRA 5I1EL 3BISA 4NQXA 1ODUA 4JPIB 2A6KA 5E08H 1YJDC 1BCIA 3WY4A 3WOVA 4XBGA 3U6RA 3HMWL 2V7HA 3VXQB 4EAEA 2WBJB 5CKAA 3HCVB 1Z2KA 3RWFB 4CBZA 2VN4A 1ID5I 3EFOA 1ZLUK 5I18L 1ASQA 3D4CA 1XGYH 3C6EA 4PS4L 4WEEA 2V5TA 5DHYB 1BEXA 1O7VA 2VN7A 4I3GA 4GXFA 2JJSC 5A2KH 3QI9A 4JPKL 5GRXG 4WJ5B 5L4MA 1TMCB 3DTDA 1G7IB 2BSEA 3R18A 2AXGB 3O41A 2NXYD 3RAJL 3KWVA 3SGJC 3NJFA 1BBJB 3C09C 2CKNA 3RY6A 1QUPA 1KLGA 2XFGB 1MVUA 4FQCH 4Z7WE 4A68A 4AOFA 1BHGA 2ZUQC 1NIAA 5BOJA 3KWXA 1NGYA 3S35L 1RERA 4UILH 3WIHL 1TEFA 2IPTH 2ZXCA 3SPJA 1ZK9A 3IJ9A 1AG0A 1CBJA 5JYLA 2GHZA 1RK1A 1NMAL 5L6YL 5FO7A 3RVWC 2G4EA 2I7OA 3MC0A 4NQED 5B1AB 5EEWA 4ZFZB 1S7SB 2W5PA 4KU1A 2WO2B 1A7RH 4N1HB 4R97B 3HG1A 1KN2L 1NOAA 2E76C 3CXHJ 4HKJA 4J7RA 5F7LB 4UM9D 4DQOH 5DUPL 2P8PA 1FORH 1XF4B 3QJFB 1BZ7B 4GMSL 4RMQA 1RK7A 2CJSA 2ZKWA 3SDCB 5CN1A 4ERSH 1QFWL 2YD4A 4R2GD 1XHHA 2ZWKA 3SZKC 3D48R 2Y7OA 1QASA 4ABQA 4HD9A 2YZ8A 2QJDA 3BEVA 5DJZA 2OP4L 1DJHA 1BZQK 3U0WL 2E46A 4XOEA 1VGEL 3O2WL 4UT7L 2R1XB 3I02B 4FLQA 4MAUH 1K2DB 3ALWA 5IJVA 4XI5C 4XBEL 3L4YA 1D5ZB 3IDYB 5B39G 3UJJH 5DVKA 3HG4A 3MRGA 4OGAC 4DP0X 1AS7A 5EO0A 3RVVC 3EJUA 3SDYH 4A55A 1YEEL 3I84A 4KKBC 4LSQL 3PQYD 1KWKA 4JVWA 2AJYL 4HK3J 3WLWC 3SPVA 5EU6B 4KVNH 2FSDA 4UM8A 4OIAA 3TXAA 1WC7B 4O5LH 1AR1C 4ZW7A 1M1XB 3NJGA 1AZRA 4OGYH 2F19H 5E56A 1W15A 1NPJA 4TUOB 5CN3A 5LNDA 4LZKA 1FAIH 1JTPA 4HIJA 1R3IH 4ODTL 5E2VL 5JQ6L 1JWSB 2HKHL 1QHQA 1YJDH 2APXA 1JYNA 1IX2A 1M7IB 1NA8A 2MMXA 1FG2B 2VDPL 2UVEA 1UEYA 3T09A 3P3UA 1IKFH 3WBDA 2UYLB 1M7XA 4LVNC 2D9CA 3T3PE 5H8DA 5IROC 1BFTA 2AEQL 3QJRB 4EIGB 4NC1E 3VMNA 3QIBA 3K1DA 4XB8A 1M9WA 2P52A 3PLYA 4Z7UF 2DMHA 5E8OA 4WKZA 1GHFH 3CZSA 4WO0A 2M83A 5H4YA 4LSTH 4BGDA 1S7UA 1B2YA 1EAOA 1EUUA 1IVLA 5IEKB 2VZVA 4FI7A 4ZMZA 5F96H 2BWDA 5IEHB 1S9WA 1KELL 1A7PH 2J5LB 1LEKA 2ZAGA 1ACZA 5CJBA 2J88L 3RNQB 5ITBH 4UF7C 2X0UA 4Z3JA 4N9GA 1Z6JT 3DIDA 3QQDA 2XVLA 4M9PA 5BXFA 3LCYA 1IGTB 3M8OH 4XC1L 5F9DC 1KXQA 2A9DA 3B2UD 3EYSL 4ZMPA 1A6VL 1F4HA 1ZEAH 1Q9KB 2VM3A 4BHUA 2MOVA 1Z1WA 3BP4B 4PCKA 1N18A 3C5ZC 2DM2A 1DUYB 2YQ3A 4AE0A 4IGBC 3UIYA 1S3KL 1WH0A 3NZ8A 4WLCA 4D0CA 1T66D 3MGOB 3JWOL 5AOZA 1MJ7H 1CDGA 3P69A 1GGUA 1CPUA 3C8HA 1FFTB 4JPQA 2OW7A 4E0RA 4V33A 1E5CA 5EHFA 1TJGL 4N2FA 4L48A 1BD2D 4OGXH 4PRAA 2Y72A 4AGLA 4F57H 4J5VA 4J3OF 5I73C 1CT8A 5B4MD 4HIHB 1S7XA 5D72H 1PNDA 1SM3H 4XBPA 4F7CB 3D0AA 4KUCD 4FXLA 3EDJA 1F4XH 5I66B 4GW1B 4F7EB 4NCDA 4JQVA 1CF8L 4M5YL 2DPKA 4X0KA 5BW7C 5C97A 4U1JB 1XCXA 3FL7A 3FU9A 2XSKA 4YC2B 2KZKA 4FERA 4FQIH 4EKXA 1A0QH 1JYXA 1A4KA 4ONHB 1X5HA 1YVLA 2QMJA 4BSJA 4BWWA 1EHNA 2ZSVA 3QCTL 5D93C 2BFVH 3SYAA 4HUNB 1JZFA 4KVPA 1AQKH 1CG9B 3HHSB 4GKOA 3QNZB 2EIZA 2ZCHH 2Z7WA 1KEGH 3L3OB 3QIWC 4WU5A 3WNIA 3VGAC 2Y1ZA 4BH7A 2G75A 2XG5B 3QZMA 5DT1H 3R7QA 1B4JH 1PFCA 2W1NA 4JRXB 2R56H 1CJYA 3O0RH 3QEGL 4KTDH 2CGYA 3RWIB 2JXMA 3V9CA 2V2WA 4XCFL 4AGPA 5C09D 1XF2B 4TSCH 2AI0L 3LIUA 4P99A 5FFOA 3OKOB 2FH8A 4OZGB 1DVZA 2AKRA 2AGJH 2VSCA 1CVRA 4QXTA 4AG4H 2YAEA 4DUVA 5MEPA 2IGTA 3BXNA 4JLRA 4OLYL 4RGNC 4JFDA 2Y5EA 2DLIA 2K9UA 4G6KL 4QKTA 5H37G 4JHAH 5D1ZD 1KIUB 4OKVA 1PZ3A 4PV9A 1N6QL 3UZVA 3AXLA 1X4YA 3UPCA 1XAKA 4I3SL 1P1ZA 1D7FA 2XA8L 5KN5A 3G6JE 5F9JB 3W2DH 5JW5A 5LGKA 3G6JB 3OR7B 4NNPL 2JI3A 5KAQG 3D2UB 4X5QA 1NCBH 4PJIA 1JXFA 4F9LA 1CZ8L 1EFXD 2EH8H 2IGFH 5HHMD 3RPKA 3TX4A 3CBRA 4CC0A 2YHGA 4YBHA 1UD2A 4TKWA 3PDOB 4GG6F 4P9HL 4DGWC 4Z8FH 4PBXA 4LSPL 1PIFA 3EDEA 2BNQA 4N6RB 5TQ0L 4E9VA 5EZLB 2P45B 4MQTB 4YDJA 5GZOA 4J39A 4FI8A 5GS2H 1YNTA 4N0YL 4QKXB 1JNLL 3SDDC 3U7WL 3D0LB 4WVRA 5FPIA 1E4KC 1XVSA 1Q94B 4P23A 1T2QH 4A2DA 1U8MB 2ZUVA 3MOAL 4IIZA 2B5IB 4Y5YC 3VA6A 5I1EH 1AOZA 3RDJA 4ZFFB 3WV0A 2AC0A 4RDQG 2HT4C 3LN4A 3HBZA 4FQQA 5E94A 4ETQB 2VDLL 1QTSA 3RDTB 1P53A 4LEBA 5HI3C 5IJKC 4IU3B 3LPFA 2O5ZH 2H3XC 5EOTA 5I18H 1SPDA 4G8IB 4PS4H 1UCTA 3BHBA 5EV7A 3V0VA 1ECYA 4K5LA 3FUHA 1TPXB 4G5AA 5FF6B 4JQXA 2YBGA 4WWKD 1ZA6B 2KERA 1JZHA 1I8LA 1ZY9A 4HSAC 3AY4A 4WI3A 1H3UA 3HS8A 3K7UA 5I0VA 3BUBA 4OF5A 2ROYA 1CU4H 4PJ7F 2FT7A 2EKSB 4WHTB 4NO0D 2YWYA 3GSNB 4CN1A 2BY2A 2QQNH 5D1QC 3WIHH 5J06A 5HVFB 3HZMB 4LHUB 4XMVA 2R69L 1C8QA 4YXHL 3T0XA 5HJ3A 4U1MA 5GRYA 4IBTA 1NMAH 2YUZA 4CKVX 2RMNA 4DP7X 5L6YH 2VQ4A 3HBQA 3NCJL 1RZPA 3QUZA 2E6QA 3LOWA 3PNWA 1ACXA 1NCDL 4A2EA 3WHXB 1DE4B 4EI5C 1Z9SA 3RVUD 1ZJAA 4CW1B 1KN2H 4M7JH 4PN6A 2DKSA 3BZFA 1RJZA 1U93A 5DJDA 2VDQL 3MV8A 3Q9QA 1ZT1A 2PYFA 3IPFA 2HFGL 3JWOC 4OIFA 5I15L 2GJ6A 4AMKH 4JKNA 3UBXG 3DYPA 1QFWH 2Z4TA 4OFVA 1KY7A 1DQTA 3BMVA 3DX8B 4P2RD 3Q06A 4FL4C 2XN1A 4KROC 3SYCA 4AQOA 4LXFA 3T3MF 3QUYA 4KX9A 5C08B 3KLAB 1VGEH 4UQIM 4UT7H 1NFDB 4A7QA 3IDXH 4XMUA 5HI4D 4OF6A 2GIYA 1IM9B 3WAKA 1AY1L 4FNUA 4XBEH 4BSWB 3DARA 3HI6H 3P9LA 1MAKA 3QEQE 4GQ9H 4YDIL 1U92B 3L5JA 3ZRFC 4DWHA 2OMNA 1S4IA 3NIGF 3QEQB 4WDIA 1MHEA 4LSQH 3TBSA 4ENEC 4YEEA 5D5MB 1Z5LA 3X12A 5BO1H 1B2WH 2AJYH 1UKSA 1QPXA 3KWWB 2XYBA 3IDIB 2D0FA 2H8PA 2XU9A 3GTNA 3BIAX 3WJLC 2ZCLH 1E5ZA 4XPHL 1XH1A 2K3TA 5TDPA 4TOYH 2B15A 1Q0EA 5DF0A 1KY6A 4FADA 5JQ6H 1QFUH 3APFA 5E9DE 4J2QA 4JZJC 5CINH 3ZUNC 5ID0B 2VDPH 2WLMA 3L5XL 4FXKC 4PRIB 3AMKA 5E9DB 4BFEA 3ZTNL 3KWUA 3N50A 4CN4A 3MAWA 2VC2H 2Y5TB 1AD0A 3ZJAA 1YECL 5J89A 3QXWA 1CD1B 1XXDC 5ES4B 1Q9WB 5F1SA 1FVCA 3EHBB 3SGJA 1XQ4A 4QTIL 2E7MA 2Z34A 2B14A 1G6RL 2Y0SA 4LCWB 4XP9L 4YDKH 3J7HA 3TCLB 1EEQA 2HN7A 2KH2B 5L2KD 2W95A 1BVLB 2R4SL 4QO1B 2ZKXA 3LZQA 1LE5B 2P5WE 5GRVK 4HUVB 4RMRA 5F88A 1R34A 1KELH 1VACB 3UYRL 2IBBA 5DRXB 2XZCH 1R33A 2P5WB 3AQZA 4U1HB 3BUPA 1IT9H 4GQQA 5D6DC 4L3EB 2EIBA 4ORZC 4WWPA 5B22A 3GMNA 4HWUA 3IMRA 4L8BB 3DJSA 1J12A 2OK0L 4XC1H 3WJJA 3H7BA 3KPNA 1A6VH 4K94C 3IBEA 4JE4B 4BZ1L 1I7UA 1CXKA 1I7RA 2H2PC 3US9A 5D70L 3SJVB 4D8PA 5KBNC 2QQQA 1T22B 2AMUA 2AP2A 1DDHA 3A4DA 3V6OC 3LN5A 4DPRA 4M7LL 1INQB 3JWOH 3NN8B 4ELMA 4NOFA 2AK4A 2EYTA 5C6PB 3H0TB 3MRQA 5TJWK 4JRYD 1TJGH 3JUZA 4DP6X 4Q58C 4U1KB 2AQ1A 2F74A 2CKBL 1U8KA 4JL1A 1HZLA 3QEUA 2UZIL 4R90L 3H54A 5T5NF 1C1EH 4FRWA 2H41A 3DHMA 5ID1A 4NPJA 1GCFA 4ODXB 3X1NA 3SD5A 4JGNA 3W39B 4M5YH 1WK0A 2CPUA 1T7YA 2WNKA 3CFEB 4W9ZA 4ZYKB 2HPTA 3RUGF 3NH7H 4JB9L 5BZZA 5I5JA 3HZKA 1JGLL 3U9PL 1S7QA 3FBKA 2EXWD 2VKWA 3QCTH 3QDAA 1LK3L 1UXSB 1G87A 3RZCB 1H0DA 3KPPB 4ZNEE 4PY7B 5FEBA 2VQUA 2IOMA 2PN5A 3EH3B 3KYNA 4G43A 1G1CA 2A77L 4OB5L 2N1TE 3BQUA 4N2KA 1IBHA 2X4SA 1MW0A 4HMCA 1UT9A 4OR1A 5D1XA 3L8QA 4XTRC 2FUQA 3C6SA 3QEGH 1U8OB 5E2UL 5GZND 4EN3C 1X7SA 2A38A 1Q9LA 4KK6C 5IROA 3STLA 4XCFH 2VLRD 3ASNB 4QHUA 1LQBC 5SWSE 3MYJB 4YDZA 1T21B 1WG3A 2AI0H 4FQJH 1MFBL 1OAUH 1AP2B 3Q6GL 5EOCH 5SWSB 4KO7A 3KZ8A 1EERB 3WIIL 3LEVL 1AHKA 4XP1L 3RZWA 3VJ6A 3QNXB 2BDNH 4JHWH 4OLYH 4XNAA 1SDAB 1TQTA 1J0ZA 1R5IB 4G6KH 4IHOB 5IFJB 1T7WA 1KGCD 3OVUB 1YEIL 4ALAL 2CA3A 2ITEA 4H88L 4I3SH 1C08A 3ALPA 3OD3A 3Q2VA 5EEXA 4HKZA 3V10A 4MB3A 2FJFB 3D09A 3QRBA 4G6ML 4HOWA 2K0RA 5CEZD 3GI8L 3FSZA 3QQNA 5F7WC 4DVBB 2BHZA 1L9RA 3LHPH 1WBXB 2LABA 4NNPH 5BJTB 1HZHL 3C2AL 4GO9A 4P06A 3QZWB 2BK8A 2HCZX 3ARZA 3BKYH 4K94H 1CZ8H 1LDPL 1OE3A 3C5ZA 4OLEA 1F4YL 3ROLA 3T0EE 4IGBA 1JGUL 2BHFA 4NM8L 1UOKA 1RHFA 1NEZA 2O5YL 3BP7A 3QSKB 4DGIL 3PGDB 4MAYC 1I1RA 2IIJA 2X41A 2B0SL 3T0EB 5HPMB 1KF9B 4YGAB 4P9HH 3ALXA 5FYKU 1XV8A 2AQSA 4H1LA 1LD9B 4LOUC 3BFQG 2EEAA 4MMXB 2YAHA 2E74C 5CJQL 1I1YA 3V4VL 5CLWA 1ERNA 4D9RE 4MD0B 5TQ0H 5A16A 5LGJA 5MENA 3BJLA 4G8EA 3LEXB 1U8CB 4EZKA 3IB4A 1HQ4A 1W72L 1T2XA 1JNLH 3UJIH 1RULL 5C0BD 2PR4H 4PV8A 4Q4EA 4OBSA 3OHXA 2LV4A 3MOAH 2HLAB 1GOHA 4PVNA 1MRCH 1T1WB 4Y7MA 5BW7A 5B1KA 1XAUA 2DMGA 4ZFGL 4JZOB 4PREB 3T1FB 2QLVB 4PTUA 4N0CD 1I8IA 5JPNC 4KPHH 2CIKA 3M46A 3VTTA 4P3WA 1NBCA 2R1YA 2G0KA 3R0MA 3QUHA 1SGKA 5F0LB 4HUXA 4H0IA 2HT2D 5IG7B 2IPKB 1H8NA 1S5IH 4M48L 4WI4A 3QIWA 5EA0H 5FUCE 3VQ1C 4L29A 5BS0B 4O02L 5EN2A 3GHEL 4RFNB 2I60L 1M6UA 1FCGA 3HPJA 2Q3ZA 3ZL2A 3TBYA 2X9YA 4LEEA 5G55A 1FQ9C 3B3IB 3LXCA 5K9KB 2CCVA 1N5AB 4X5PA 1M7DA 1ZLDA 4AQZA 1WZMA 3WIHA 4FE9A 3HR5B 4JANB 2IANB 5IZ7A 1I1FB 1ETZA 5IHZA 3TBWA 5M7QA 2FX9L 4HGWA 4NQCE 4MDIB 1TQBC 4YXHH 3EGSB 2WUCL 2WQRA 2DF3A 3RPIA 1SXCA 1DFXA 3BOVA 3X13A 5GS1C 4NQCB 4LL1A 1F6AB 3K6DA 3QPQD 3FONB 3Q5OA 1OAQH 3TO4B 1NCDH 4PJCF 4EMZA 2J8HA 2B39A 2HFTA 3D4ZA 4N22A 2RA1A 2YSSA 1IBDA 4LPTA 3DXAB 4HU2A 1E67A 2ICEC 2JKNA 3BAIA 2HFGH 3JWNE 2DQUL 3FRPG 1LL1A 1RZGA 2PPFA 3L4XA 5KYYA 1LLAA 1BVKA 3D3VD 5C07B 1HJBC 1ES0B 3MU3A 4G1MB 3WELA 1SQMA 1E3XA 1D9KD 1WVZA 3JQOB 4ZUSA 1ZVHA 2B2XL 1RFDL 2E3VA 4JKKA 2IDUA 4RBPH 4TVPH 1KGUA 3GBLA 4FA6A 1KN4L 5HP5A 1JZ8A 2ADGB 4YDIH 3BGFB 4NKOB 4HIIA 1JK9B 1VHPA 2PTTA 4AJYV 1EQWA 2ZXWB 4B0MB 4EQ3A 1NBVL 4WI6A 1FZOB 1QD0A 5E1QA 1G0YR 1QZNA 5EULV 4YHYB 1HINH 3SDDA 4N68A 4NUJA 3P4OB 1TG8A 1KEML 2NR6A 1CQKA 1E4KA 1WFNA 1XGQA 1FFNB 2Y07H 3IJYB 3ILEA 3QXUA 4N8CL 1YNKL 3K1KC 4PLKD 5KSAD 1QG3A 5I75B 4WNSA 1C8PA 1OO2A 1A25A 1ZLSL 4Z7VB 3GSRB 1N4XH 1CXHA 3NYKA 4XPAL 4B7LA 1OARL 1N2RA 1NLBL 1AC6A 3G5VA 4ANUA 1NFAA 3KPSA 3L5XH 2PXYB 3Q8CA 4MS8D 4B6ZA 5JIDA 5IJKA 4HIEA 4Z7UA 1I4FB 1GGTA 4OZIE 1ILUA 2H6PA 5L0QB 2JKLA 3QJHA 3WLBA 1GC1L 5FYJU 3GSVB 4N90E 2OI9C 3CZUB 3OZKA 1AS8A 4K7PX 4OZIB 2DLFH 3GB7A 4PTTA 4TTDD 5D96C 4W9EC 1MNNA 2X4NB 5CILL 4DP1X 1UGNA 4YHNB 1XIWB 2XZQL 1KCWA 3BT2H 4IKNA 2FUTA 3G9AB 4W70A 5KVEL 3QEHA 1G6RH 2NY1D 5LUMA 3K6IA 5DVNA 2VAJA 3OLGA 3AY2A 3KCWA 5AW4B 3VFNB 3JZYA 1PPIA 4NENA 3ZMRA 5ICYA 2GABA 1A02N 3I3DA 3EYOA 4UU9B 1C5DB 4WV1C 5D1QA 1ORSA 1ZA3B 4P2QA 4QT5A 2HXAA 2M26A 3K46A 3D7PA 4OZFH 2ESVE 3AGVA 4X7TB 5JMOC 5KJ4A 2R4RL 4N1CA 1VERA 4JK0D 2Y24A 2DH3A 2ESVB 1T03H 4N2IA 2K9FB 3MA7B 2FLMA 4EI5A 2EC9U 3AREB 5CSGA 4BZ1H 3MRMA 2WCPA 1V55B 3TBTA 3OAUL 4Z18A 3RURA 4HV8A 1MFAL 3V7AE 3BP5A 4NCC2 1RZ7L 5CMAA 2R29H 4HALA 5IUSA 4L37A 3LY6A 3O6KH 2A6IA 4LLUB 1GS7A 1SBBA 3RB5A 3SDAC 2FZ3B 2K6WA 1SNRA 3WXVH 4R90H 3PWVA 1TCRA 1UC6A 4GSQA 5ACLA 3MN8A 4AEFA 2QVFB 3SB3A 2Q8BL 5TE7L 4XT1C 3WFHB 1UJTA 2R2EA 3AC0A 1ZCRA 4HJIA 1JV5A 5KS9B 1X5IA 4JDTH 4NPYB 4KXCA 3AQDA 5DJXA 2C4XA 1B9KA 1AD9A 1WBYB 2BVPA 3CXDL 4H8VA 3TH4T 3U9PH 1A14H 4WWID 5TDOB 3WFCL 4MQ7B 1LK3H 1LMIA 5E5RB 2HJKA 2HUHA 2LU7A 2AV1A 2ZXBA 1QR4A 3ARTA 3Q01A 1RP9A 3FNKA 3NJMA 3QE5A 4R3SA 1PG7X 2R2HA 4AV5A 4HUWB 4U1LB 4YN3A 3WJLA 4G9DA 1ZANH 2A77H 4OB5H 3VU1A 1BM7A 1L3WA 2VMJA 4NRYB 4PRPE 5AYUL 1ITCA 3QQXA 4JZJA 4RFEB 4OFPA 4OCSL 4KKNA 3OQ3B 4QY8B 4P5KA 4X6BA 4KKZA 1YYML 2NY0B 4MLSA 2BOBA 4PRPB 1J7VR 2DY2A 2WC7A 3IFOA 1AKJD 2EE2A 4JFPB 5GGRY 2ICWB 2HRPL 5F9WB 1MFBH 2C3WA 2XQYG 4HFWA 4Q4IA 3TEZA 3LB6C 4B9ZA 3II1A 3V0EA 4KBPA 4PJXE 3DUSA 4L1HA 4MCNA 3UC0H 3WIIH 5BV7B 4WUUD 2AABH 3OWRA 5CR8A 5EIIG 3DK0A 1JP5A 1A1MA 3B37A 4CDHA 5B38G 1FAKT 5ISZD 4FABL 4N85A 4U1GB 2IH3A 4N26A 1H15A 3CH1B 3C6LC 3ABLB 4IKKA 1QEXA 3UTTD 2OPCA 4ALAH 2AXJA 1ITBB 1AS6A 5I6XB 3G6AA 3SKJL 3K2MC 5I1KH 3N85H 4G6MH 2O30A 3GI8H 2L04A 5D6DA 4Y4KB 1D5IL 1IGFL 3OKMB 4K3HA 2JSFA 4JO1L 1HZHH 1CFSA 2OYKA 1W6WA 3U4BH 3DRTA 2H3NA 3WJMA 1JAEA 3WY3A 4K9JA 3I6GA 4YZFF 4GG6A 4I0PD 3X3GH 2ENYA 1LDPH 1QPKA 1D6VL 3QARA 1F4YH 4LCUA 2WTRA 1JGUH 4NM8H 1XXFC 2GEEA 5DMJB 2O5YH 2NTFB 3FFCD 4H0LC 4DGIH 5EF3A 4HPYL 2B0SH 4CVXA 3BN3B 1XR9A 1QW9A 1MQKH 3MQIA 1SOSA 2FRGP 1BVZA 4GBXC 3GGWA 4RBPK 4GLRH 5TD4A 3T2OA 1U3HA 2EYSB 3QS2A 2FTAA 3TLRA 2CK0H 1HEHC 1W72H 1B0RB 2IDCA 2FNWA 3FUKA 4K5OA 2XWTA 3V0AC 4N8VB 4Y9EA 1ECZA 2X4PB 4JDZA 3GSQB 4PW4A 5CO1A 4H8QA 2QFPA 3VSUA 1S7WB 2YUVA 1T20B 3GINA 4U6XA 3BYTA 4ATWA 4ZFGH 4MSWA 4YS4A 4ZG1A 2NDGA 2ICES 2P1YA 3FO9A 4QTFA 2B3RA 3CFMA 1DBJL 3UO8B 1ICTA 3ARXA 4HJJH 4TNFA 1MUJB 1QMUA 2GTQA 1T5KA 3F04A 5DWUL 4X4KA 2W91A 4MA7L 2RBLA 1VFBA 2VLJA 3AB0B 4FULA 3IDJA 4JKMA 1KTRL 1RZFL 4YMPA 1F11A 1OW0C 4XGZA 3FQXA 3NEXA 3KXFA 4J3WA 3BAEH 4JBSA 1TETL 2B1HL 1TNNA 3IFNL 2LU5A 2IJ0C 4JDVA 3SIKA 4O02H 2PR9A 2I60H 2VRAA 4PJEE 5CHNA 4EN3A 5I1AB 3IMVA 1QSED 2DH2A 4TV3A 4PJEB 4FJYA 5K33A 1N0XH 1K8IA 1WZKA 3BVXA 3LRSA 1JXKA 2Q7YA 4FFWC 4FMVA 3K6OA 4KQ4L 1ONQA 3U79A 4KWUA 2DQCH 1EXGA 2Z7ZA 5D55A 1G94A 3QAZC 4UMSA 1JMZA 2VNCA 1FL5B 3UPAA 3AU1A 3EGXA 4H8WL 3UYOD 2YZ1A 2FBJL 2VKXA 3N44F 3PYCA 4G8GA 5F3FA 3BH9A 4NHUB 1MFDL 1E5YA 5MEOA 1TEGA 5D7IE 2X9WA 4GRLD 3F7PC 1AC0A 3CVDA 2G2PA 5JPMC 2ATAA 3TOPA 4UNTA 2E9WA 5D7IB 3ZZQA 1DBAL 2EIDA 4JFQA 5T1JA 1CE6B 1I3RA 2FIRT 2AZAA 2PKDA 5DLMH 2B9AA 5TK4A 4OLZH 2GPZA 2VZOA 2OXHB 3VW3L 3ARSA 3O3AB 1VLXA 2WBJC 1I7ZB 2W0FA 2ZOKA 4WSGA 4MA1B 2CJTA 4J8RB 4XMPL 3DX6B 3PHSA 1UQSB 5D2NB 3EJJX 1PGRB 2B2XH 5IQMA 4MAYA 2EKJA 3NIFB 4AKOA 3NJXA 3EYVA 1BREA 3CX5J 3K6FA 4NFDA 4XX1G 4F7MA 4JFZH 2A9CA 1I8KA 4MHHI 1KB3A 3BRGC 2X70A 4QYAA 4UB0L 2I9LA 1IFHL 1NOLA 5DD1H 2SODB 4P8QA 1BIIB 1DVFB 1JRHI 1NBVH 2XG4A 2X38A 3RVXC 4N2AA 2UZXB 5AOJA 4KXZH 4K7PY 2F53A 2G9HA 5AVRB 4N8CH 1YNKH 4M7ZB 2Q86B 4AZ8B 1GY1A 1MCOL 1OPGL 2YSTA 3DX2A 3PAUA 3DGCR 5DA0B 4I88A 1QRNA 1W0WA 3L9YA 1JRHH 4TN9A 3W9EB 3WFZA 1OARH 2YN3A 4YLCA 3K72B 5GHWH 1A65A 5L88L 5JPNA 1PX3A 1LILA 4OZGF 3U30B 3APCA 2VE6A 2Y6TE 3CBJB 3HC0A 3FK3A 5HHOA 1NAKL 3O6LL 4MMZC 3JV4B 1CFMA 4ORGA 4OLXL 4DCQB 4FCHA 1Z9MA 4JG5A 2HRHA 2DAVA 4HQQL 3WTXA 3KPTA 4CL7A 3FS9A 2X09A 3MRHB 4XXDA 3SDCC 2BH0A 5MEQB 4MDRA 2ICWJ 4POZD 1CK0L 4J27A 2MEJB 1G6RA 4ZW8A 2DMCA 4LVOB 2X4TB 2JF1A 4TS6A 2E9IA 6PAZA 3T8MA 3OB0H 4P3DA 5FK9A 4MA8L 2WY3B 3BUYB 4K3EL 5BRZD 4DKAA 3EFDL 4GPVA 5HGHA 3G6JF 3UTSD 1DLHB 4EXPX 2HAZA 3CSPA 3MNVA 2F2HA 4Z3FA 3QQ3B 4ZXBD 4GUPA 5KVGL 2BIIA 3IDYC 2P8MB 5KTEL 3JYBA 2ZT9C 4OZFA 1SQ2N 1IFRA 5CEZL 3WTVA 4XPFL 1E9PB 3I6KA 3HE7B 5GS1A 4JG9A 5FOJA 2R4RH 5TH2A 3ASOB 5EIVA 4DO6A 1PCXA 3HLAA 4OSUL 3VXSA 2IADA 4BZ1A 5IK3A 1HILA 2K6YA 2OMVB 1ZLVH 4N2OA 4HOMA 2MWCA 5EU3A 3TA3D 3G7TA 1MFAH 1BZ9B 2ICEA 3UIZA 2R29A 5BO0D 3IDNA 4I3RL 3ET9F 3QO0A 4N0UE 3F6JA 1UB5B 4AWJC 2OX5A 3KCPA 5JXEC 3M45A 3D69A 2E9GA 4XNQB 2J4WL 4N0UB 3T0VA 5K1NA 1KB5L 5MI0C 3BC9A 5H4ZA 1WDAA 5HXMA 3G04B 2CBTA 3RUGA 3CVHL 4MYPA 4XAWL 3ROOB 2Y25A 5IB3A 4EBQH 4JM2B 3SKMB 1A4AA 1E28A 4TQEH 2Q8BH 1OAXL 1HN1A 1ZVYA 4H8HA 5TE7H 3IGFA 5EPMA 2Q1EA 4H26A 2Y2YA 2A6JB 1OV8A 3GLEA 1HH9A 5LCVL 3ZLQC 4IOSA 1ZPUA 4XVTL 2H0FA 2CO7B 3WFCH 1UOLA 4PGEA 5DGRA 3HR6A 4DTGL 4O2CA 3ZX1A 1HIML 2J5LC 4EZLA 5D7JB 1PSKL 3TF7C 3HAEB 4Q52A 1CIDA 3DBXB 3NEEA 4HXAL 3RL1B 1MCPH 4Z78B 2FAUA 4BV1A 3D6GA 1F90L 4X98B 5KVEE 3O6MH 3UPRB 4XNZB 1S6NA 4D9QE 4HS3B 4MMYA 3QHFL 1UWXK 2XY2A 3CN0A 3HMXH 3LQMA 4FYSA 4PHZA 4WTZG 4ZMOA 2C7UB 5TF1L 2YO3A 1TYRA 2OZ4H 4JFXA 4LSRL 3ABMB 4ONGL 3QNYA 3KLDA 1AGCB 1SVBA 2HRPH 1O7DC 1PEWA 1U8QB 1KLFA 2DWTA 2WLKA 1B0WA 3CFDA 5DDHA 1TKWB 1KBBA 1U8LB 2NY6B 1NPUA 3VFGL 4EOWL 3CIQA 4J3OG 4JQIH 4X5WA 3BKML 4UOJA 2B59A 4AQ1B 4HUUB 1BQRA 4FABH 5JW3L 2JJTC 4FXGB 4NKDA 1TEYA 3ZVVA 4NQEA 2XWJB 5FA4B 3FB6A 2C3VB 5T1KD 1VADB 1MWAB 3AS2A 4OF7A 5HHME 2X7LA 4PJ8D 1E42A 1AANA 4RLDA 1U8NA 3SKJH 4MJIB 1U95A 1X9RA 4OIIH 5FKAB 3L1GA 3VRIA 3RRQA 5AW2B 1NUFA 3G08B 3DYOA 4YC2C 2A9BA 1NFDF 1Y18B 2M1KA 2ICCA 5AL8A 5AW6B 3EZ8A 5EORL 3TIDB 2QDWA 4LB8A 4GY4A 5HYJB 3TV8A 4J3UA 4AGMA 3LRKA 1MKFA 3B5HA 2JCCE 1YEDB 3THMH 5DMKA 3H3PH 5KSVB 3AS1A 4UI2A 3BW9A 2OMZA 3HBGA 4UOQA 5E8NB 1D6VH 3ULVE 3AQYA 1SRDA 5D5MF 3L3OC 1GTNA 1TZAA 4F7TB 2NY4C 4U6YA 4EDWL 3D0VA 3ECBA 5F21B 3K80A 1Y6NR 3AT9A 4G7QB 3BZ5A 1CO1A 1OCZB 3JT2A 2OL3L 2Y7LA 3PQYA 4PRDA 4XMLL 3SDAA 4BFJA 1DL7L 4IRJD 1W72A 1CXLA 3L81A 3PGCB 3O3DB 3DX9A 1AQDB 1G7LA 1KIRB 2BMKB 1DANU 1OP4A 3MXVL 1FN4A 2EQDA 3FTZA 4DPAX 3K6NA 4HCFA 4QLWA 5I0DA 2PO6C 1OCWH 1RUQH 4ZZFA 1RHHA 4G71B 3IXAA 4WWKB 3WGVB 3VWJD 3QQ4B 4UQ3B 4WSJA 5DWUH 4MA7H 4E41D 4JY6B 4LLYB 2VL4A 3DETD 3DO7B 4DAGL 4DGVL 3ILQC 2A74C 3DPBB 4PJDE 3PPSA 3OMAB 3VH8B 2CLRA 3LKNA 3WTTA 1G9EA 3P4MB 1DZBA 3O11A 4O02A 1WZ1L 1ZXQA 3IFNH 3N91A 4IU2A 5FLUA 4PJDB 4IBSA 5IF0A 1FNLA 3M17A 5B3SB 4KK5D 3ZY7A 2MRYA 5ETUA 5LBSH 3WKPA 5I71B 5LAPA 1KCSH 3B2XA 4J3BA 5F72S 1BX2B 1II4E 3ZHDA 4W6YB 3ZQXA 4KZEL 1NC2B 3Q44A 5FKPA 2VXUL 1M2VB 4KQ4H 4LPVA 1HHKB 2GITB 4PJCA 3F58L 2Z6FA 3MFFA 3TPKA 1XO8A 5I16A 1S5HB 2UWEE 2F6AA 5CIPB 2APBA 4KX8A 4P2RE 1V27A 1H3GA 5JOEA 3EG9A 4FAAB 3HTLX 2NW2B 1T83C 1MFDH 2UWEB 5J5EA 3ZKSD 1OL0A 2YAMA 1WD8A 1J0KA 5L7XL 4NQDB 3NSDA 1A5FL 1MIML 2E86A 4PD4K 3P54A 4MJ2A 3KL5A 1GGCL 2B5IC 2MNJB 15C8H 2B08A 3MCYA 2Z9TA 3K8KA 1YO4A 2DWSA 3RDTC 2HWZL 3E8UL 4ZZKA 3WU1A 3LVEA 3C12A 3IMTA 1BD2A 5EOQL 3P0VL 2DQFB 4MJJA 4LCYA 4LIQL 3CHRA 2GFBB 4XMPH 1V3MA 2LOEA 4KQ0A 3T65A 1S78D 2GUOB 3L3KB 1TPXC 3QDGD 4UQDA 1D5XB 5F7AA 4TQPA 4GRMB 1XH3A 1PLCA 1IFHH 1ZDSA 1USZA 1QX1A 1EO5A 4GBXA 5MP6H 4WGKA 4N2CA 3IETB 3MRIA 2FQGA 5B39B 5IMOB 2R1WA 1THCA 3VI3A 3K8MA 5ELIA 2C9QA 3GQFA 3DHJA 3UO1L 3PFQA 5EUKB 4XN8A 3OSVA 4DFIA 3VFRB 2BCMA 4ZSOA 2LLLA 2UV3A 4NJ9L 1CTMA 1OPGH 2NMSA 1XB6A 3MRLA 1OT4A 2JTYA 5C9JB 3BFWA 1WISA 3GSXB 3FYEB 4E42B 5HYSG 5I30H 4U05A 5FYLH 2N59A 5L88H 1EO7A 4OJAA 3IU4L 4H5SA 3S7GA 2NUPB 3QZBA 3L2MA 4FC3E 3H6JA 4JR9H 5L2KE 1HL5A 2AMGA 5DJCB 1UM5L 4AM0B 2Z93A 3HZVA 1KJ3L 3GBNH 4NQUA 4O2EB 5EEZA 4OLXH 5INCB 3U36A 2V7NA 4PIBA 3DGGA 3UTZB 3EJYD 4KDTC 4E5XB 5L2KB 3IGAB 2XBDA 1OW0A 3QBTB 4I48B 2AJZA 4OFIA 3ARFD 3ARWA 2Z35A 1MIEH 4Y5VA 4HS6B 3TGXA 3OKKB 2LVCA 3K4DA 4BM7A 4MA8H 5D1ZA 3ZXAC 2CJUH 4L1BA 2YRLA 4U6HB 4Y4FB 4GRWB 2CDEB 2IALA 2X89A 4NZRL 5AYQA 4D0DA 1XCTB 1ZS8A 5ANHA 3VU2A 4F80A 2FEEL 5KVGH 1ZK5A 2CO3A 3LKSB 4QGTA 3OKEB 4HPHA 2I9TA 5KVFE 4L8CA 3CFCL 4ZS7H 5C71A 4PRHB 2TAAA 4PU2A 4W68A 4LARL 4JRYE 3UTQB 3BPCA 3FOLB 2C1PB 4ZMYA 1IEBA 3QJTB 4KK9D 1GSKA 3DX0A 4OSUH 3DUHA 1E5BA 1OSZA 4JRYB 5JPMA 2C9AA 5E6UB 1S7TB 1CLYH 5FO8B 2AQNA 4YAQA 1N6UA 1JD7A 4KJWC 5IBTL 4BFOA 3OLIA 1S3RA 4JPIA 3X1EA 2QVTA 3QDJD 5CR1A 4JO3H 1FGNH 1MJUL 2Z92A 3CCHB 1Q1JL 2WBJA 2IO5A 3HCVA 4QGYA 3OKDB 4TULL 1LO3L 2FGWH 2J4WH 5C0AA 3RWFA 1NCIA 5DHYA 4G8FB 2BIHA 2F7IA 4DP9X 3CVHH 2XCMC 2HT3C 4B9IA 4F15C 3VFTB 3QUMB 1E4WL 3KH4A 4N2HA 4HZLB 2P26A 4GIAA 1G7IA 4S2SA 3RWGA 3TFBA 5I8KH 3VFVB 2AXGA 1JGIA 3EHBC 3LTVA 3QR0A 4XVUD 3H2WA 3H42L 1ZMYA 3SBWC 3NCBB 4X99B 1JI2A 1W0YT 1YEWA 4G7YL 1NGPL 3DX1A 5DI8B 2YIHA 1E9OB 1PJWA 5EG6C 3CWGA 1IC5L 1W2KT 5G5DB 5J9PB 3IMSA 2VLRE 3NIDE 2ZP0T 5FIEA 3M7OA 3A0OA 1FYTE 3GSNH 4DTGH 1HIMH 3SPGA 4CGTA 1PSKH 4HXAH 2VLRB 5D4HA 3NIDB 2NYZA 2LW3A 2P3YA 1FYTB 1NLDL 2H0EA 4U0QB 5AZUA 1N64L 2K6ZA 3S48A 5AB9A 4M8QA 2OQJB 5IT2L 3VFOB 1BMZA 1DLFH 3P9MB 1KC5L 3HMXA 5DD0L 1CDYA 3VD0A 4IIQB 4ZFZA 4NIYE 5SX4I 3SODB 2FH6A 1ZGLB 3C08L 4MMZA 2OZ4A 2KPNA 1ZHBA 3BVDB 4FMKA 1EO8H 4LSRH 1BFOA 4NO0A 4ANVA 1N26A 4K3JH 2CNZA 2BP8B 1XF4A 3QJFA 1EHKB 1BZ7A 4XAKE 3AITA 3SDCA 3QXDA 4XPGL 4JQIA 2AEPH 5DU7A 1S9KC 4EOWH 4F8OA 4XNUL 1BAFL 3BKMH 5F93C 3VX0A 5JW3H 5T5NG 2Q10A 1FZJB 1GS6X 4NHCH 2ITDB 4RFOL 4R83A 2VITB 5F1NB 5LGHL 2R1XA 3SKOB 1K2DA 5JXAL 1R3KA 1E6JL 1EAQA 1D5ZA 2XPZA 5A2LH 1IAMA 2NY7L 4K55A 5EU7E 3VTMA 4QAWA 2EVGA 1NAML 4GW4B 3GJEA 2AQTA 2XQBH 4K5PA 3RZCC 3HFML 5EU6A 2O5XH 6FABH 4WWNA 4E9XA 2F8OA 1A6AB 1AZUA 4JFYB 3PY9A 3MDJA 5F9OL 5EWIL 4TUOA 1KWGA 2CU9A 3I6LD 1F3DH 4P5SA 1H3TA 1N5YL 5JXEA 3BUDA 1TVBB 2YARA 4ZNCD 2O6EA 4Z7VF 3U82B 1Q0YL 3VNZA 2OL3H 4HJSA 4JFFD 2HJLA 4AW4A 4C4BA 4OQTL 1RZIB 2EEXA 3ILPB 4JO5A 5E1AA 3WDHA 1TCMA 1U58A 1KCLA 5IR1B 3LD8C 1UJ3B 3BKJL 4XB7A 5C3LD 3PXLA 4MZ3A 2FGZA 1U0QA 1ADWA 3A24A 3N06B 3SGDI 4OZIF 3V7MA 2JELL 3Q8AA 4MXVE 3VFUB 1TFPA 3ISRA 1IAOB 4JFOB 5IEHA 4OM1L 1NGQH 3T6VA 3H9SD 5BVJA 4PJHE 1DQDH 4D2NA 2CO6B 4GT7A 4DAGH 3RNQA 2F7RA 5GXBB 5D4QA 3SGDH 3DDGA 4PJHB 4B50A 4WCYH 4F8NA 4FYQA 1XGPA 3MLVH 3QO1A 2R0LH 3QJOA 1HCVA 1IGTA 1AXTL 1NSNL 2AXFA 4FFZH 4AKPA 1RZ8B 3QUXB 4N0FB 1Q9KA 2XNAB 1TZ8A 4GXVL 4LQFH 1ED3B 1DUYA 2ENQA 4N25A 4KZEH 1HEJC 1L5GB 1R5WB 2VXUH 3T0EC 3MUY1 3MNWB 2CAKA 2WBKA 3QS3A 2NLJB 1DDTA 4PR5B 4AH2B 3CHXA 2NY3B 3N41B 4IM8A 4MMXC 4CJ1A 3TU6A 1OQOA 3D3VE 4I18C 4IRSD 2JJTA 3W81A 2MQCA 4PJ5B 5IQLA 3WKML 5IGXL 3D3VB 5L9DH 3VFWB 4F7CA 1A5FH 4LBAA 5C6TH 3QA3B 5LQBL 4F7EA 4YBQC 1GGCH 4P3CH 1N0LB 5GSVB 3KPQA 4M1DL 3GBEA 1I8AA 1KSRA 3PP3K 4WI5A 3P4LA 2X9XA 4ONHA 5GIRB 1KT2B 4YSOA 1BSIA 2BVQB 3E8UH 4LLDA 4WF7A 2VM4A 3DBSA 3U83A 2YRBA 3P0VH 3HW7A 5EOQH 3ZDYE 1QNIA 5FFLA 4LIQH 1EPFA 1OE1A 5KS9F 2P5ED 2FEDD 3WEAA 1DCEA