1AZBA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(copper)
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azbA00
2BP8A 2BHFA 2ZWNA 3H4HA 3UAAA 2ZOOA 2AFNA 2AZUA 3QJVB 1JVOA 4YSAA 4BDVB 2YAQA 1URIA 3QPKA 2VSKB 2CJ3A 3N55A 1OE1A 3JTBA 1JZFA 3HEIB 1ZDQA 2CCWA 1FA4A 2GIMA 4AX3A 4G70B 1J5CA 4DP4X 2VMJA 5PCYA 4HHWA 3S3DB 1OCRB 3AG1B 2UXTA 1OCZB 2DV6A 2EILB 2BO0A 3X1FA 1E67A 2YAOA 4F2EA 7PCYA 1PCSA 2QDWA 4K9JA 1KCWA 2IH8A 1UATA 1KDJA 1NIAA 3FQYA 1NPJA 3WIAA 2HX9A 3PAUA 4BXSV 2IDTA 1MG3C 2IWKA 1PNDA 2HRGA 1L9QA 3QJUB 5TK4A 2IDQA 3QJSB 1NIEA 3OQRA 1HAUA 1HAWA 1AG6A 3CDZA 3GDCA 2BP8B 3WNJA 1PY0A 2FTAA 3QJQB 5I26A 4DP7X 2CAKA 1ILUA 5B1JA 1AZBA 4E9YA 1M9WA 1AOZA 2X88A 2J56A 5I6NA 3T6WA 4F2FA 1PLCA 1GYCA 3KW8A 4QLWA 1JVLA 1VLXA 2WO3B 5F7AA 4GP4B 2FT7A 1SFHA 3NT0A 1R1CA 1GY2A 5A7EA 3RYMA 1AAJA 2HX7A 1AQ8A 2QPDB 4DP5X 1BAWA 2OCCB 2XXGA 3CZUB 2AANA 1ILSA 4X4KA 3PPSA 2VSMB 1AS7A 3NSYA 2FQEA 3OMAB 4ZK8A 2OJ1A 3QJRB 1PF3A 3FU8A 1FFTB 1ZV2A 3FU7A 1PAZA 4A2HA 2FJSA 4YSSA 2YXVA 2DY2A 2TSBA 2FQFA 3X1NA 1SF5A 6PCYA 1A4CA 3OM3B 2XX0A 4JHVA 2QDVA 4MFHA 1GR7A 1ZIBA 2IWEA 1J9SA 2XV0A 1NZRA 3H4FA 3ERXA 1AANA 1ET7A 1PZAA 3FSZA 2YXWA 3CDZB 3KW7A 1PZCA 3OD3A 4UAHA 4E9WA 4F7KA 2J55A 3NJGA 1EZLA 1KBVA 1OF0A 1AZNA 3QJTB 3WI9A 5D4HA 1ASQA 1BYPA 2YAFA 4P5RA 1PMYA 1BYOA 1M57B 3QQXA 6PAZA 3AZUA 3V9EA 1SFDA 3EH5B 4UF7C 4EF3A 1NICA 2DWTA 3ABGA 3AY2A 3EF4A 1SDDA 1W8EA 1BQRA 1IUZA 4NERA 2XVBA 1JZJA 5AKRA 4YSEA 3CG8A 4UANA 9PCYA 3OMIB 1JZGA 2PPAA 3FSVA 2DWSA 2IDSA 1PNCA 2IWFA 3UGEA 3EHBB 1NINA 2HX8A 3TU6A 1IBYA 1NIFA 3NJKA 2FNWA 2EINB 1L9SA 2H5UA 3BVDB 1WA1X 3PAZA 7PAZA 4YSUA 2FT8A 3FU7B 1V55B 2XU9A 4A67A 4G7RB 5B1AB 1OOWA 4NAJA 1AZRA 2GSMB 1OE3A 1A8ZA 1AS8A 2PP9A 2UX6A 3EH4B 3NSFA 2I7OA 3IBOA 2EIJB 3UACA 5I6PA 3UABA 2HRHA 1TEGA 4G71B 3WKQA 3ZBMA 2ZONA 2B08A 1KCBA 2JXMA 3EH3B 3NJFA 2BW4A 3TBBA 2HXAA 3SBRA 3H56A 4CSZA 3U25A 4KO7A 1XB8A 4G7QB 1XB3A 1WA0X 3T6XA 1J5DA 2IDFA 4GY4A 4DPBX 2UX7A 2VM3A 2Y1AA 1BEXA 1I53A 1SDDB 3SBQA 2CBPA 1QHQA 4KNTA 4AZUA 5AZUA 2BZ7A 3FPXA 2PCFA 2QT6A 3AG3B 2LLNA 5D4JA 5AFAA 3FU9A 2GHZA 2PPFA 4A66A 2OV0A 2YAPA 3NJHA 2E86A 2XXFA 2YAHA 4HHGA 4GP5B 4AKQA 1ETJA 2GI0A 1PLBA 4WKXA 5IY5B 2VM4A 2Q9OA 5I5MA 1CURA 1W6LA 3FPYA 3TBCA 1KDIA 3SQRA 1WS8A 3CVBA 3ZIYA 1PZBA 4W9ZA 1N70A 2PP8A 2HLEB 3ASOB 1ZPUA 3GXUB 3ASNB 4YVNA 1JXFA 4AKOA 2BP0A 4N8UA 1ASPA 1NIBA 3PLYA 2BWIA 2AZAA 3NSDA 3CVDA 3FSWA 2X87A 2EIKB 4N4YB 1KGYE 3GYRA 1KV7A 1A4BA 3X1BA 1A4AA 1IBZA 1L9OA 1AR1B 2R7EB 5I5JA 1GS6X 1AIZA 1J9RA 1E65A 4BXVA 1M56B 1TU2A 3OMNB 5I6LA 3FYEB 4YSRA 1JZEA 1RKRA 1SF3A 4WTQA 2W8CA 4HALA 1EHKB 3AG4B 2GB2A 2N0MA 4A2EA 4E9SA 4YSQA 3FQ1A 3S8FB 5I5IA 1T5KA 5LDUA 1QLEB 3FQ2A 1BQ5A 2XLLA 3UAEA 5D4IA 1GS8A 3N2JA 5B7EA 3T6VA 1RCYA 1AACA 3NJMA 2DYSB 4GYBA 1MZZA 1X9UA 1FWXA 3V9CA 4HCIA 1AZCA 4YSDA 1CYWA 1WS7A 2BP0B 4Q8BA 5B1JC 4RH4A 1OCOB 4BWWA 4DP8X 1SJMA 5B1KA 4BWTA 3MX0B 4E9TA 1MDAA 2JKWA 4KNUA 3S3CB 3IN2A 3NJIA 3FT0A 4M4RB 3TASA 1JERA 2ZXWB 4YSPA 3UADA 5B3SB 4A2FA 1JZHA 1RZPA 4DP0X 2PCYA 1ZDSA 2GC7C 1NWOA 4KOCA 5I28A 1AZUA 1J9TA 3JT2A 1IKOP 4Q89A 5EHFA 8PAZA 3HB3B 1GSKA 3ABKB 2FQGA 1ET8A 1WAEA 1F56A 2IDUA 3X1EA 4YSTA 4HCGA 3TA4D 1NWPA 3X2QB 2EIMB 3FS9A 1JXDA 4A2GA 1QNIA 3ABMB 2I7SA 1ET5A 4KNSA 4GXFA 1BXVA 3C75A 4L0PB 5F7BA 2FWLB 1L9TA 3WG7B 4HCFA 4PCYA 5I6MA 3WKPA 1A3ZA 1PLAA 3DIVA 3NP3A 1RZQA 3NP4A 2R7EA 4DP9X 2IAAC 4E9XA 1KBWA 3ABLB 1JZIA 4KOBA 1GY1A 2XV3A 1E30A 1CUOA 1V54B 4E9VA 4JHUA 3PXLA 2XYBA 4AKPA 2YQBA 1ZIAA 4DPAX 2PPEA 2JFCA 2MTAA 2WSDA 4DP2X 5ANHA 4FAAB 2FQDA 4KO5A 3AG2B 4QKTA 3G5WA 5FC9A 2AVFA 2Y69B 1OV8A 2WO2B 2YAMA 1BXAA 1V10A 2I85A 2XUWA 3T6ZA 4G7SB 4DP1X 2VN3A 4KO9A 2BWDA 3FSAA 1JXGA 1TKWA 2A3TA 3SBPA 2J5WA 3NJJA 4DPCX 1B3IA 2IH9A 1HFUA 2XWZA 1ID2A 1AG0A 2H47C 1W6WA 1NTDA 1L9RA 5B1BB 3DTUB 1KYAA 3CVCA 4KO6A 5PAZA 4JKNA 2H3XC 3NJLA 4HZ1A 3IE9A 4HIPA 2UXFA 4A68A 3MBWB 4YSCA 1GW0A 1YLBB 2CALA 4A2DA 4E9QA 3T9WA 1CYXA 3IEAA 4YVUA 2J57A 4AI7A 1SHXA 2UXGA 1ADWA 3PCYA 2RACA 5E9NA 1NIDA 3ZDWA 3DKHA 2VW6A 2W88A 2MRYA 4P5SA 2YARA 1A65A 2P80D 3T71A 2XX1A 3WNIA 2GC4C 2PP7A 5I6OA 4PAZA 5B7FA 5I6KA 2PPCA 2HZHA 1NPNA 2QPEB 2BW5A 1TEFA 1E5YA 2BZCA 4DP6X 4BDVA 1XB6A 3D12B 4BK5C 4ENZA 1BQKA 2UXVA 5TK2A 3AW5A 4FA7B 1SNRA 3X1GA 1BXUA 1ASOA 4YL4A 1E5ZA 1NDTA 2VW7A 3BQVA 4YSOA 2P80A 1SHWA 1X9RA 4G72B 3PAVA 1AS6A 1WA2X 3ZX1A 1L9PA 2NRDA 1OE2A 3NJNA 2GBAA 4BWUA 1N68A 2Q5BA 3S3BB 4M3HA 3S8GB 1IC0A 2TSAA 3NYKA 3IN0A 1MZYA 2XV2A 5B7MA 3FYIB 4TXVB 1OCCB 1DZ0A 2FT6A 1JOIA 1MG2C 4W1TA 3NSCA 2VW4A 4GP8B 4HAKA 2B3IA 2YAEA 2PPDA 1XMEB 4E9RA 2CUAA 2DYRB 1DYZA 2PLTA 1GS7A 1J9QA 4NB7A 4CSPA 1CC3A 3L45A
chains in the Genus database with same CATH superfamily
1A1NB 3FOMA 3ULVH 4HEME 2PXYC 2FRGP 1Z32X 5LXVA 5I1LA 5K39A 2NLJB 2AZUA 3U0TA 5J6HA 5L0QB 4S1DC 4RX4A 2XBZA 1XGYL 4AV0A 4EPSA 1TYRA 2N1TE 1ZDQA 1JPST 3OKDB 5D1QE 4QLRA 1MCOL 2W94A 1M9SA 3DVGB 5HDQH 4F7CA 2EUWA 2CBOA 5T3ZD 1CYGA 5CD3B 1TCRA 1FVEA 4POZD 2XKNB 4TMPA 5LCVA 4I4WB 4XP6H 1HCYA 5IJKA 4R4BB 3UTZA 1E67A 4U1MB 2QDWA 2DLGA 1UEMA 4M43H 1U8KB 4N2BA 4G43B 4KFZC 2JKSA 4NKDB 2E46A 4WFHE 3EADA 1UATA 5ANMA 4JHWL 1ZANL 2GK0A 1YJDC 4OIIH 1NBCA 4PJGF 2IDTA 4PJIA 1UB5B 1ADQH 5IREA 3Q1EA 4O2FA 3QJUB 4JAMB 1HSBB 3K2IA 3PWLB 1DEDA 4PGJA 1VACB 4FYRA 1GVIA 5HJ3B 4HJIA 2CKBB 3PDOB 1RD6A 5GSRA 1PG7W 5CXPA 5GRVK 2G3NA 4B60A 5J1SC 3VYNA 3O2DA 4PRDB 5ITBL 1AZBA 3VRJA 2WZPA 3VSUA 4NKMB 4BZ2H 3VD1A 5IUSA 2WYIA 2X88A 3ZDYB 2QKSA 4HYTB 5CCHE 1DCEA 4F2FA 3Q9PA 3CCHA 1RK0A 3QPQC 1T22A 1PW3A 1SQMA 2NNRA 3LN5B 5HP5A 1BSIA 3US0A 1GCYA 1UA7A 2Z8RA 2WO3B 3F83A 5F7AA 4XNYH 3RY5A 1AAJA 1RQ5A 3CLFH 1U95A 5HJGA 1N8ZA 3CXHJ 4S10A 1CGYA 1XGUB 3STZA 5GISL 4APQD 1KN2H 4BUHA 4MA3B 2P42B 3LXCA 3MRJB 4GUPB 4H0GA 1I8KA 4Q4EA 1Q0EA 4XPTH 4O02L 1GJIA 4PB0H 4XP5L 3QJRB 2NW3B 5JXED 4U05A 3QNYB 4L4JA 4OB5H 1PZ3A 2KLRA 2BVUA 2I26N 2RJMA 1PQZB 3MJ8B 4YSSA 4ONHA 3TH4T 1SBSL 3QFJD 1WWCA 2OTUB 2YUVA 2B1AH 3TWCL 5FWRA 4DK3A 1BVZA 1SY6H 2X12A 3K1DA 5EH1A 3PWPB 3VX1A 4XN5A 3E9UA 4X6BA 5E4IA 3K74B 1G7JB 2JB5L 1NZRA 3L2MA 4HFUL 1S7XA 3ATEA 3ZJAA 4PJEB 4R2GC 3STLB 3ZYZA 1ZCRA 5LNEA 3BZ4A 5E4EB 3MXWL 1E4WL 3UTSD 2H32H 2CR0A 1ASQA 1RL1A 1T21B 1BYPA 1SOSA 5FECB 4JREB 1M57B 1A7QH 2YMXL 5JW3H 3RL2B 4Y5VC 5EWIH 4J3OG 1KXQE 1HXYB 1F4YL 1IZKA 3HE7D 5CSZA 1I8IA 4JDVB 3BP4B 4O2EA 1G7PB 2XRAH 4AM0Q 4PFEA 1VCAA 2R83A 2WLKA 2ZXQA 5F44A 2VDML 4RRPG 2CKBH 1MCPH 2UUDK 4XTRC 4J28A 3ECBB 5I0YA 1JD9A 1ODAA 1F4AA 2OZNA 3TVMC 3KBEA 3ZHKA 2NY7H 3VXSE 1K3IA 3GMNA 5EIIG 2DQMA 1MJJB 5F0LB 3GBNL 4EN3D 2X2IA 1ZOXA 3JYBA 3TU6A 2JJUA 1NC4D 3UTOA 5BW7C 2L0DA 3APCA 2IQ9L 4PVNA 1T2QL 1PZ2A 3KWWA 5DJAA 1AGDA 2V7HA 2VR8A 4NZRH 2F74A 3LKSB 2I5YL 2L04A 3IFNH 2VLJB 3BXNB 4HT1L 4ZUWB 5B1AB 5LWYL 2EEBA 4FHBD 4B7LA 1XH1A 2EH8L 4LVNC 3QAQA 2X4RB 4NI6A 1E6JH 2I7OA 1O5DT 4AG4H 5MP6L 4X4ZA 2VDKB 1AGEA 4YPJA 5FV2A 3SJVD 5I6PA 3HBQA 4PJ8D 1F4XH 3BVUA 2V2TA 4ZTOH 3KDPB 3NEOA 1W80A 2FSDA 1C5BH 1DN0A 2EEDA 2J12B 2WD0A 5H94A 4JM2C 5EN2A 5AUMA 3CUPA 5MERB 2P1YA 2YGQA 2HT2C 3OAWA 1BQLL 4G6ML 4Y1AD 1QKZL 3ZO0A 2OYPA 2CO3A 1YC8A 1ZRUA 4PRIE 3IJYB 5E99H 2IDFA 3JTSB 5F1NA 1BEXA 2GBVA 1D9KC 4HKBA 5GRZA 3MRRA 2BOLA 5JUEL 3LKPA 2KC0A 4P57B 5AL0A 1JHTA 4CSTA 1G9MH 5E00A 4LSRH 4ZPTA 3BUYA 1ZLVH 3L13A 3G6DH 4HUCA 2Z8WC 3ZPDA 2WANA 3PABA 1DVXA 4R26H 1S7SA 3V95A 3WN6A 3IMBA 1ZVSA 4FMVA 2LLGA 2CNYA 4MZ3A 4Q56A 4B9KC 3BPLC 3G6AB 4S0TD 5IW1A 2BNQD 2IV8A 1EIBA 3H3BC 5FYKH 3EG9A 2B1HL 2OMVA 4U2YA 2G9HA 1U8IA 1A66A 3BEVA 1NGZB 3CXDH 2ZD0A 3V5HA 5EORH 1CGTA 3ARYA 3SDDA 1XV8A 1B0WA 4ODTH 4D8PB 1VESA 3CVBA 4HUNB 3K91A 3CMOH 3FCSB 1UURA 5TQ2H 3WJMA 1OGPA 2HKHL 1BPVA 4RGNB 5IT2H 3A23A 4EZJA 5D70L 4F24A 1NOFA 4X7FC 5HYJA 2K78A 5KSUB 4AOFA 2JLLA 4URKA 3GZQA 2EKSB 4WTWA 3UAJD 5ESAA 5CKAA 3H9ZA 3MRDA 1QSFE 1J48A 5CLXA 5CEZL 5FGBC 2HMID 1U58A 1I7TB 1EBAA 3HG1B 2BOCA 3BKYH 1AGBB 2Q7YA 4PJ9C 1G5AA 3ZE0E 5IESH 1Q9WB 5E5UB 3H2WA 4YSQA 1UC6A 5KTEH 4LEOB 1QWHA 1ZVYA 2LV4A 2OX5B 2WBJA 2NPLX 2XIDA 4NO0D 3SHSA 4QRUA 3ZYJA 1TITA 2BH0A 3QIUA 5CWSB 1EJOL 4K3JL 2E74C 2AITA 3UAEA 4JFOB 3ZLQC 5E6RB 5D4IA 2Z0BA 2OJZH 3CN3A 5ALBL 3EYQC 1IMHC 3CX5J 4ZODA 3U30B 1T6BX 2DOCA 3GIZH 3P0YL 3LNFA 3A4FA 3W1ZA 1HZKA 4AEHH 1J1PH 1MNUL 1TPXC 4M61B 4YSDA 4QT5A 1XXDC 5DRXB 3DRQA 3X11B 4MB4A 4QJ3B 2F19H 4F15C 3CLWA 1DEEB 4WF7A 1ACZA 3OKNA 4YEEA 1URZA 3FUKA 3G5VA 1RULL 1ND0B 4UYPA 5IFAH 3FT0A 4QO1A 3KGSA 3TASA 4YSPA 4AJYV 3L54A 1EHXA 1NFDE 3NRPA 1YNTF 2QFRA 3QVAA 2OI9C 2K4AA 4M3JA 1R3LB 4M1CC 2XVKA 5F7MC 1GGCL 1TO4A 3KGTA 4M1GL 1GYAA 4TVPL 4XZ4A 3KGRA 5D2NC 3O0RL 4ALAC 3UYRL 2A73A 2CIKA 4JRXB 2O6FA 4DSYA 1ZTXE 3VRIA 1I1FA 5AD0B 3ZT6A 2VR4A 3ULUD 5DMIH 4ZQKB 1DVFC 4H26B 4XMVA 4ZO9A 1FE8H 3D0VA 4XBEH 3TZVD 4MMYB 3OSVA 4ZFGH 4I2XE 2D31B 2CLRB 1H6UA 2YD9A 3AQYA 4BK5A 1R3HA 4NWTH 3B9KB 4GAYB 1JZIA 3B9VA 4V2CB 1G9NH 5I8EA 3TA3A 1ORSA 3RL1A 5FUOL 2BFVL 4NT6B 4XNXH 1PKQA 2IPUG 4I77H 5FYLE 2Q8BL 1BBDL 1QBLL 2GABA 2YQBA 5E94B 2ZYSA 2PPEA 3FQTB 4XOEA 3ARUA 2X4UA 3K6SA 4OVUA 3FHAA 4XNMB 1ZWIB 4EXPX 3HCVB 2BSSB 2XA8H 4ICXA 3SBWA 4F7EB 1CE6A 4G7SB 4XWGL 2P8LB 4PYHA 1UWXH 3BQUA 4KH2A 5FA4A 2YPLD 3MV8A 2FR4B 4NO2A 3EUUA 3VQ2C 1WISA 3BI9X 1RHHB 4HULB 4FNSA 5LJYH 4OZFH 4JFHE 3UIZA 1P5VA 3GBML 2IH9A 4G5AA 2QVTA 1W6WA 3CDFA 4PJEE 4XBGA 1FORH 2DLTA 1H0DB 1MAML 4UUJB 2O93L 5E8OB 3VM5A 1BW8A 5ICZB 3PWNA 1QFWM 4FQIL 4OCWH 2E8YA 5T1KD 3FQNB 1RUMH 1NLBH 2OTPA 3HA0A 1ZHLB 2R0WL 4PRHD 5J5EA 2P7TA 3ZSTA 1KIPA 1XDTT 4GRLA 1CYXA 5G4NA 4YXHL 2J7LA 4NLAA 3R0MA 2UXGA 3N41B 3NFSL 1E8XA 1HHIA 4HFWA 4HOZA 3MNWA 3H7BB 5CSGA 2YARA 4LVHC 3GQFA 4HVBA 4H8WH 4TQPA 5AW9B 5D9SB 4PS7A 2PPCA 2HZHA 1BZ9A 1C12B 4NO5B 4PV9A 3DSFL 4IIQC 3MREA 4L8BA 4ENZA 2YFOA 4AMKH 5JQ6H 1T04A 3WL9B 3AXLA 1DJWA 3KYMA 3MLTA 1MCCA 4DIXA 3GJFK 4DZ8B 5DTFA 5A2KH 2OR9H 1NEZB 1UB6A 3P4MA 1M1XB 4I7ZC 3CN2A 5MHSD 3FTZA 5D7JA 3QRFM 3D85B 3QIWC 3DJTA 3RWGB 3QCTL 3IF1B 1F6FB 2VB5A 2X1OA 4OD2B 4D0BA 4ZW5A 4H1LH 3FYIB 3GK8L 1CLOL 2FO4B 4XMWA 4L3FA 1JOIA 3GSNL 5EO0B 1R3JB 2R0ZL 5E7FA 3H3KA 1Z1WA 1ZLSH 1HYSC 4JRWA 1E90A 1CO1A 3LTVA 4KXDA 1F00I 1FFPB 2E6QA 2J21A 3DC0A 3FL7A 4K71B 2JKXA 1NCAL 1SGKA 4L5FE 2BHFA 4XN8A 3H4HA 2HFGH 4N90E 1JPSH 4DOHB 3AQZA 4XB7A 1I8LA 2VAAB 5DJYA 1J1XH 1N59A 4G11A 2FLRT 4HP5A 5C6PB 3S48A 4B96A 3GD1C 4MZRA 3TNMB 3VRLF 2V5TA 2Z64C 4NNYB 2GBTA 4JJ5A 1UD3A 4AY0A 4X4YB 1KACB 4LL4A 4WTZG 2HVKA 1BFSA 4WW2B 2W92A 1QUPA 2DQCH 3GGWB 1MFBL 2NTFB 1VPOH 1MKFA 2UXTA 4OFKA 5M94B 4KJYA 1PCSA 1DQTA 1Q0XH 1XQ4A 3AABA 4JFUA 3OKLA 4MDRA 1OP5K 2GIXA 3IJHB 2GTZB 4JZNA 4X9YA 1FIGL 5F8RC 1J05A 4OLUH 4Q9CA 2WZ0A 2OZ4H 4IHOB 4V11A 3V0IA 1KXTB 4D7BA 3KPOB 5HVFB 2WLIB 1MVUB 3SDYL 5CJQH 5I8CA 3QYNA 3BH8B 2AJSH 3JVGC 4DO5A 4BKTC 2J8UF 2C26A 1KBGH 4XWOD 5CZXC 1TQCB 5FLVA 4U6HA 5F7WC 2A4EA 3OQRA 4UTAH 1X6NA 4Y19D 5ICXB 1AZZC 4HUUA 3QDGE 3Q9QA 4X4XB 4E42A 3I6GB 4M5YH 1MCBA 3W0WD 2JKIS 4U1HA 2D8KA 4FG6D 4C8XA 4WHDA 5HYIA 5KVFL 4L1HA 1LO0H 2G0KA 1ILUA 5BO0D 1B2WH 2OLDA 4B27A 2Y2WA 2E7HA 1U6AL 1M9WA 3EJZC 3VUAA 2BS8A 4H0HB 1EANA 3LNHA 2ZOTA 1XSKA 3IU3B 3T6WA 2R69A 3KW8A 1NGQL 1II4E 1T3FB 2CQVA 5CJOH 2NXYB 4H1LG 3BWAB 2GQHA 3MNMA 3NT0A 4XHJC 3SPVB 3ULAB 2PW2B 1G6RH 3KYNA 1DVUA 3IU4L 4HW6A 3RKDC 2H6PA 1BAWA 4OF3A 4P07A 3B1UA 5A3IC 2C7UA 3OAUL 3EDJA 3SDAA 5I1IH 5AOKA 2A38A 1NBYB 1YY9C 1Z66A 3AQDA 3KS0J 1JFHA 5ESQA 1DBJH 3ARXA 4JFDB 2DL9A 1T7YA 4OGQC 2MPAH 1CLVA 3QDJA 2LFEA 3DMMB 1A4CA 3TBYB 3V7MA 1XX9C 2AJYL 3MJWA 1GR7A 2RQEA 1YJDL 3L2LA 4LVEA 3C8KB 3O3EB 4A2LA 3DHPA 3QH3A 1AKJB 3APMA 1ZS2A 3MFFA 3LZNA 1ZJAA 3NUKA 3CDZB 3VQMA 4APQA 1OB1B 2R59A 4JRXE 3MODL 1T7ZA 4P2AA 4MDJA 1IC4H 2AQ3A 1RZ7H 5I76A 4FTVA 5I2IB 4W4NA 2X9XA 5FO2A 2FSEB 2K45A 3ZZQA 3CJJA 2DMBA 3L7FA 5IK3B 5JXEA 1WT5A 3HBGA 4TUJB 3DECA 4RCAA 4YPGA 5DVNA 2YKLL 2V37A 1T1YB 3QFJA 1AIFB 2PYED 5I0DA 3I02B 4V1DD 3WLBA 3AY2A 1KB5L 3G9VA 4KAQL 1U8PA 5D1QD 1QOKA 4OZHB 3RPIA 3RY6C 2FJHB 4NERA 1KYOJ 4UINL 1JZJA 3IAPA 5E6UB 4LEXH 1E5AA 2ZCHH 4Y5XA 4APXB 3UTSA 1NEZG 3OXSB 4WFHD 5EBLB 4JO2H 1DJIA 2BSRA 4KKBC 1E9QA 4BH7B 4MNGA 1OGAD 1FL6B 5DD0H 1P7KA 1YNLH 1X6LA 1IT9L 3HE7A 4NGHL 5B38A 2GJ6B 4FXGA 1TYJA 4MA7H 3QIBB 2VE6B 1I1YA 3BKML 2R1YB 3NSFA 2R0KL 3KPTA 1YEJH 5C0AD 5I19L 5DR5L 5FHAL 2ZICA 1WZ1H 5EDSA 2VIRB 2BVPA 2PW1B 4CL7A 4IMKA 4HIXL 5I1AB 3HHSB 3NCEB 4EN3A 4OT1H 4ZTPL 2VITA 3LH2L 1NC4A 5HHQA 3QRGL 1A1MA 3P2BA 4RFEA 2HXAA 2MCPH 4DERA 3SBRA 2R29H 2RIKA 3BP5B 1MQKL 4CSZA 3TXAA 3U25A 3QS3A 4K7PH 2X6UA 5E8EA 2YN5A 3QCUH 4XZUA 3U4EB 1KIQB 4N0UB 4PLNC 3C5ZB 3ARDB 3BSGA 3B4NA 2VNCA 2BZ7A 1JZ2A 4MMXB 2WLLA 4ONFL 3SJVA 4DKEH 4PJ8A 4JDEB 3QI9D 1WCQA 1YQ2A 3S36L 2APFA 2OL3B 5C86A 5EO1A 5DU7A 3LD8C 4KKQA 5DS8A 2X3AA 4R7DB 5DSCA 1K85A 2AC0A 4WI0B 2CRIA 4ZNCD 1WSST 4YHLH 5KYWA 1WCBB 4UTCA 4EOWH 4X9IA 1ECYA 4Y1AA 3BIKB 1HU8A 4QGYA 3JWDH 4DN4H 2R2HA 1XCWA 1RP8A 3HC3H 4R3SA 4HXBH 1NCWL 1QG3A 3KPNB 5CN1A 3ROLA 4P2YA 3WIHH 3A67H 4ZD3H 2AQNA 2OSWA 3AREC 1S9WB 1UM6L 4HC1H 4WUUD 4UI2A 2C4FU 3PGDA 3VFMA 4K23L 2JXMB 3OHXB 1NIBA 3MLPA 4PJFF 4F92B 1TZOA 3QEQD 3L9RB 4GXVH 5DDHB 3T1FB 3VWKC 3GYRA 3EJCA 5ECGA 2AK1L 1ED3A 5D7EA 2JJSC 1TZIA 2BNQA 1QPKA 4JM0A 3BVNB 4R8WL 1N8OE 3U9PL 1FI8C 3WN5C 4GW1B 5DS1A 2R7EB 3BZEB 3QRBA 2I24N 1OARH 2D03L 5JW4N 4N2CA 1K2DA 3D4GA 3MC0A 4OZ4B 1IM3D 1NM4A 1FRGH 4ANWA 5ESVB 4C57C 3BZFB 3MCYA 3BP6B 4YDKL 1D7BA 2YMTA 5DHMC 1KJMB 3V5DA 1ZXKA 3AITA 3CPUA 3MLVL 4DOHE 5HPMA 3S9DB 4KZ0A 5I6XB 4O51A 4UAOC 3UJTL 1S7RA 3W9EB 4ABQA 4HH9B 4ECNA 4MRCA 2V2XA 3UAJA 3BSZL 2ENJA 3VI4F 3M17B 4BHUA 2DI7A 1R33A 2CGYA 4F5CE 1R6VA 1MHEB 4YDVB 4DFHA 2VQ1B 3QUYD 4R90L 4R7XA 1X9UA 1FWXA 5I1JH 2HTKD 3ULVD 2OL3H 2JWYA 1BXXA 3VCLA 1BF2A 1Y18B 4NO0A 4BWTA 4YDJB 1AYOA 4MX7A 1L7IL 2ZXAA 1OQXA 3IN2A 2QQQA 2NY4C 4G1MA 5KVEE 3KL3A 4DZBA 1AXTH 5E70A 1RK7A 4PRID 1YEHL 2EUXA 1N6QL 4XE0A 4DP0X 2CH8A 3HVNA 3MGOA 3S5LA 4KQ3H 2WVUA 5DC4B 3JT2A 4TF4A 8PAZA 3VSTA 4ODWB 2EO1A 3L08A 1NOAA 1IGML 2ED9A 2C3HA 4LIQE 3FK3A 4O02B 3S3JA 3X1EA 4YSTA 2GFBA 4M29A 3MRIB 3T8VA 3QISA 1PBYA 1JZ7A 4UQIM 1PFCA 3RTQC 5ES4B 3CFKB 2O26U 3VXRB 2Y6SC 4JBSA 2ZPKH 3WNKA 3IJEA 4GKLA 5B21A 2JK5A 4RAHA 3BP7A 1MRFL 3DXAD 3DYPA 3QEUA 3JXAA 2X1XR 4HWEL 2V7NB 3MRFA 4HS8H 4P5MB 3RPBA 3WGUB 2DWDA 2CDFA 4PJAB 2D4DA 2R4SH 3KPSB 4BJLA 1WGVA 4OV5B 1ZANH 1M7DB 2XTJB 3PWVA 4KO5A 3T77A 4B53A 5JIIA 5FC9A 3VNYA 4NPYA 4P23B 4E41B 3RILA 1S46A 3TZVA 5HHNA 2W65B 2Y7LA 3T6ZA 1W72L 5H35B 4RMBA 2VC2H 3UC0L 2R23A 2VDMB 1OAXH 2CPUA 4OV6F 3CFEA 2VSCA 1IC5H 3U6RB 2PETA 3V7AG 3T09A 1A7RL 4HK3J 3S2AA 1XZ0A 4NQED 2X2YA 1EBPA 1C1EH 5DO8A 3DTUB 4HX1B 3WIIH 5E1HB 1HWWA 4RFNC 3UO8B 3KL0A 4ALAL 1E3XA 5F96L 3FCTA 1F97A 4NP4H 3O2VH 1ANUA 5KVDE 3EOBA 4A68A 4U0RC 4X8JB 4XMZA 4RA0C 5TDPB 4E9QA 1HHHB 2YPLA 3TFKC 5J7CC 4B9GA 3O4OB 3II2A 2UZXA 3WHXA 3OR6A 1E9OB 2XG5A 2EE0A 3PCYA 4OZHE 1N0XH 1YMHA 4YQXL 4U6XA 1CPUA 4JGJA 4EQ2A 1LEIB 2BLFA 2HG5A 1BJ1J 2XX1A 4XP5H 2X7LA 3T71A 1JHKL 2MNJB 3EYOB 4PGEB 2TAAA 1TFPA 4XNUL 1U4EA 5DHVA 1S9YA 5DK0B 3KVPA 1JVKA 5GJTL 2FIKB 2WNGA 1NPNA 5T1KA 4PRNA 4PRHA 3IVKA 2V9UA 4J6RH 1FC2D 1FZKB 5AVSB 4BK5C 4M7KL 2YQGA 3Q6FA 5IR1A 3II3A 1KCSL 2Y23A 2JB5H 1D5ZB 2UY7B 3BAYA 4PJDF 4HFUH 1AGFA 2GJ6E 3AW5A 1JI1A 3OLGA 4NO3A 1JP5A 4Y16D 1G5GA 1ZT7B 3VFOA 1KENL 1TXKA 1OP3H 1EHLL 4JO3H 4TQHA 1IBBA 3QDAA 3ZO9A 1AHMA 1JAEA 3FZUD 1MXGA 3BHBA 4YDLB 5KJRL 3WIFB 1RZFL 4D9RD 1JNHA 4JB9L 5BUAA 5LGJA 1F4YH 4LDOB 3T4AA 1IILE 2NTSP 2BMKA 4FXTA 1EZSA 1OCCB 4JO1H 4K9EC 4RZCA 1IC7L 4WV1C 2X4PB 4MVBC 1HINL 3CDYA 3NSCA 4NAMA 2O5ZH 4HAKA 4OBRA 4N0UE 2D7OA 4M5TA 1DYZA 4G1EA 1U8HA 2ZX7A 4NB7A 3US9A 4CSPA 5JHLA 1KULA 1RVFH 1HJCA 1T1ZA 1WC7B 1D5MB 5KYUA 5EF3A 4X5WA 2DPKA 4G6KH 3NA4A 1QW8A 5D7LB 3GB7A 4ZAKC 3HRZC 3VI3B 3UBXB 4HT1H 4JE0A 5GGRA 1AOHA 5B4MC 5LWYH 4ZI8A 3REVA 3ARFB 3MRLA 2YAQA 4Z76B 3ASWA 1OE1A 1UYWL 3LIZH 4N24A 1IAKB 5FYJU 5J11C 4G5ZL 2GSIB 3DHMA 3PWPD 3CQQA 3GZPA 2ED6A 2G2RA 4R9HA 4CNIB 2WSKA 4P4KB 4FMKA 1OCRB 1RV6X 4EDWH 1OB0A 4MRBA 5SWZB 4XRCA 2E7BA 4XH2A 5ADPH 4D0CB 3L4CA 3V9FA 3GJFB 5IHHA 3N1FC 5GGUB 2CDGB 2Q86A 2ZAHA 3SQOL 3T2LA 2WWKO 3MCLL 3BLBA 3PHQB 5FYKD 2PCPB 2NY1B 3KLQA 4DH2A 4QEGA 1KPUA 2K6YA 5IBLD 5BZWB 2XNAB 1S7VB 2YUZA 2FVNA 1I7ZB 5IB4A 3GDCA 1J8RA 5DMGC 1IQDA 4LCUA 3WTUA 1HZLA 1SHSA 2WXJA 5AKTA 5BZZA 5G5DB 4KROC 5B1JA 2OMBA 2FJFB 3Q3GA 3OQ3B 3I74A 3NQKA 2B1HH 3ME0A 2EC8A 5D1XC 5DUPH 4JMXA 4I1PA 2CMRL 2LVEA 2VLJD 3FUMA 4HUXA 4XE5B 5HD8D 1RJLB 3ZMEA 5IF0B 5KS9E 4MZIA 1CDCA 3LV3B 3CXHK 3SE8L 3VGAB 5FW6A 4FQ1H 2K8MA 1S5HB 3NFNA 1KJVB 3NZSA 4X99B 1A6ZB 3DNKA 2MWCA 4N0CD 1DE4B 3OMAB 4J7RA 3GNML 3UBXI 5I0XA 1X7QB 3GRWL 1AD9B 1LO5B 3MACL 3DO7A 5C8JB 4FQCH 4ZYKB 3X1NA 3II1A 3OM3B 1LO2L 2BS71 4AZ8A 4F2MA 3IDJB 2Z92B 3RU8H 4N1EA 4K3EL 3RWIB 4LSVH 4F8PA 1BMWA 5KW9L 3TM6A 4LZKA 2J1WA 3I50H 5HHXH 2YXWA 3RE0A 4I9WD 1IAIM 2HLAA 5I74C 4FJYA 3HOGA 4U6YA 1K6QH 4Y9CA 3GJFH 4K3JH 1BGXL 5CM1A 2V5YA 4OCLC 3VXRE 2EDWA 3CZEA 4LLWA 2ZSWB 2P5WD 3UFIA 3D9AH 3SDCC 3D8MA 3UZVA 1C5CL 2DWTA 4Y7OC 3G08A 5SWSB 2EXTA 2J6EL 3EF4A 4Q9RH 3P0YH 7FABH 1CBVL 1W8EA 4XP1L 1D7CA 3HHRB 1JK9A 2Z0UA 2ZXDA 1G1KA 1MNUH 3F5WB 2G9KA 1UUSA 4GRWB 2RBLA 3IFPA 4PLJD 4HEMA 3BGFB 5F8QC 3O81A 4Q9BA 4ZUSA 5JO5A 4RGND 1A7NH 1JGEA 4CN4A 2XTJE 4MWFB 5AZ2L 3KD4A 4QY8B 3T0EB 4E41E 5FCSH 3FFDB 1KBBA 1BVKA 4BFIA 5CNHA 4X8XA 2PYEA 1CICC 4JG0L 4M9OA 1TVBA 2RCSH 5BVJA 4M1GH 4TVPH 3HMXH 4GO6B 4AE1A 5D1QA 2GSMB 1BMGA 5C0DB 1A8ZA 2C9XA 5SV3A 3HG1D 3HNTL 2YR3A 4NQXB 5DK2B 3V52L 5D5MB 2Z8SA 2YD3A 1LP9F 2FUQA 3HMWH 1P5UC 1QR4A 4QCIA 3PGCA 4PYGA 2EXWD 4LKCA 1LNUB 5JW5A 2NOYA 3TCLA 1A02N 4BSVA 4WCYL 2EVHA 4PW4A 5G4OA 5E5MB 3EYFA 1S7WB 5GS2D 4OZIF 1BECA 5CCKH 2G3ZA 2HA1A 4ZXBC 3LPFA 1OP5H 3UBXG 1QO3A 4AIZB 1J8SA 2YEZB 4I5BA 3T0WA 3SD2A 1KPRA 2LU5A 4AZUA 1XBDA 5C0GB 2MJWA 5HHPA 5C0AA 3GMRB 1KJ2L 3FOLA 2PMZA 2XWEA 5DQJA 3TV3H 5AFAA 1N6UA 1T80A 4JZJA 4NUGH 3BESR 3N9GL 3FQ4A 5GS3A 3O11A 5TE4H 3L5HA 4I18B 3TONA 4XCEA 2ZOLA 2E6PA 3GSNB 3CFMA 1O75A 2YAHA 5TE6L 4W9GC 4GQRA 3LQAC 1TZGL 1MOEA 1QR1B 2PN5A 5EOTA 4XAWL 4LLYB 5AG8A 3H9HA 4WKZB 1F3DH 1HJBC 3V4PA 1D6EA 4OQTH 2C9AA 5L7XL 3PUUA 3DX8B 1MAMH 4OCMC 1FFNA 4Y5XC 1S5IH 1HHJA 3EJRA 4W9ZA 4YHNA 5FUZL 5TE7L 2FDBP 4JRXD 5GRUH 3NIFF 4G80B 4QTHB 2BP0A 4AKOA 2EDNA 3HUJF 3Q05A 2GIYA 4Q6KA 4C54A 2O5YH 3G6JB 1KLGB 4PBXA 1TTAA 4HBCL 4FFVC 3BCDA 4QRTA 4GSXA 5DUMH 4YXHH 2ZKXA 1G4MA 1FJ1B 4ACPA 4PJ7A 2O61B 1ZMYA 4G42B 5E8PB 1T5WA 1T66D 4GKOA 1SUJA 3CDGB 1U92A 4JFPB 1DVQA 2JCCF 4RRPM 1TEYA 3B9KD 5HGDB 4KRLB 4EIUA 2F58H 3TN0C 1RIVH 4PU2A 2ZYHA 2NUPA 3V5KA 4XC3H 1XHHA 4N9GA 3PQYB 4EN3C 1KEGH 4OKVB 4K3HA 4QHPA 3CMGA 5TDNA 1KGJA 2EIDA 2GB2A 1Q1JL 4HOXA 3K7UA 4BFOA 1F3JB 3OKMA 2FK9A 2QQNL 3QEQA 3MRGB 1SLVA 2F18A 3B2VL 3VI3E 4GIAA 5IMLB 3DK0A 4PVLA 5CEZE 3WEXB 4ZMTA 1KXQA 2XLLA 1LVEA 3IM1A 2IXQA 3HI1B 4MJJA 4PWJA 4W9FC 1GS8A 1BJMA 5EUOF 4AQEB 4YHPB 3JV0A 2VN5A 2ED7A 3CX5K 4UMSA 1H5BC 4GW5B 4GYBA 3TNNB 1IM3A 3ULSB 3GRBA 1ZLUK 1FL3B 1QNZL 3MLYL 4MD5B 1CGXA 2NR6D 1XZWA 3DUSA 1MJ8L 3BEWA 5SWZE 3FONA 3BGMA 2PXYB 5CINL 1XCTB 3RKPA 3VFSB 4DP8X 4X6EA 4OGYH 1CDYA 3OGOE 1G9EA 1AFVH 2WAQA 3GSNH 5JTWA 4XI5C 2VLKD 3S3CB 4HMEA 4K7FB 4HJGA 2G75B 3WS6A 2VN4A 5GZOD 1MWAB 3OB0K 4U4IA 3UJIH 5FIEA 4XMLL 1NCAH 2GC7C 2WYZA 4NXSA 3V0GA 4HIIB 4N5UA 4RBPK 4B9JA 3GUTA 1JMZA 1J8HD 4EI6A 4N25A 2ENPA 2OMUB 4LNRB 3ILQC 1BLNA 1MFAH 1EO5A 4I85A 5EOCH 3TA4D 2XDHA 2CCLA 5JPMA 2XIBA 4HAGA 1CF8L 4BYHA 3O3BB 4G8FA 4XN9A 4GSUA 1BIHA 4TSBH 1IEAB 1XSIA 4HK0B 4QHNB 4YGAB 4JLRB 1MI5B 4PRIA 5F7BA 3WENA 4BRJA 3ZK0A 1L6ZA 1DJSA 4TVPE 3U1PA 1KBWA 5GS1A 1M42A 4Q0XL 2W0LA 3EO9L 1JI2A 2NT1A 4LBEB 4TNVF 3WGVB 4DPAX 4MB5A 3TPUA 1XF3B 5AYUH 4D0DA 4FAAB 1HEZB 3D85D 2WZ5A 5D4QA 3IAGC 3K72A 3VD2A 2I9LA 3LSOA 3BT0A 4S1QH 1PZUB 2KI6A 1BOGB 4UZUA 1KB5B 1CVSC 1QTPA 3DXAA 1EXUA 1HOEA 4QRBA 1ADQA 4FHKA 2QLYA 3JTTA 4W6XB 3QR1A 4WW1A 2CGRL 4RRPA 4U1LB 3RUGF 3RWEA 35C8L 2P24A 5F21B 3PJSB 4PP1C 5ABAA 1EJ6A 5C7XL 5IEHA 4L29B 4MD0A 4TSAL 3UYPA 2C34A 3MNZB 1U6AH 2EYTB 3X17A 5D7IF 2QR0B 1MJ7L 4JX0A 1H3PH 4BZ2A 1FLTX 4ATWA 3N44F 4RMQA 3P11L 1NGQH 5AAMA 5JYMA 2FEEL 3HRPA 3MJ9L 4ZBJA 3RX8A 4DVBA 5JLZB 1MWAH 2DWXA 3AXIA 4OJDH 1QSFA 2DKUA 5G2NA 4YVUA 3H9SE 3VG9C 5JHMA 2WCPA 3I6LD 1YRKA 4C83B 5I15L 1CI3M 4PWIA 5D2LA 3H1ZA 4BUQA 2X3BA 4PJCF 4GRWE 3FO1A 4P5SA 3LPOA 4RNRB 2VDPL 4I1NB 4R2GB 3BPCB 1TJHH 4YFEA 1B9ZA 4AITA 1MSPA 5E6ZA 2NLJA 4MCNA 1XCQB 2QPEB 2Y3AA 3LNGA 3ARPA 5DZ9A 4Z8FL 2AJYH 1XR8A 2YIHA 4FQQB 4AGQA 1ZHBB 2IOOA 2VWEE 4Y5VB 2JIXB 1G7LA 1EHNA 2R27A 3GS7A 1SY6A 2BFGA 1AQHA 3AACA 3OKDA 3M86A 2OK0L 3D2TA 2W38A 1RZJC 3FAXA 4U1GC 5E2VL 3DVGA 4UIMB 4ZOCA 4BCXA 5CD3A 2H0PA 2CUHA 2VW7A 1KJ3L 3Q1SH 5D5ME 1DVSA 4PRAB 1VAHA 2JKNA 4I4WA 3QJOA 4YSOA 4R4BA 4N2FA 3ULUC 4Z0BL 3TL5A 1J0IA 3NJNA 3TVMB 3WEBA 1N68A 1U8KA 2H32A 4G43A 4NKDA 3W56A 4GUOA 1X5MA 3HI6L 2E5EA 4LBAA 3I3DA 4CVWA 1DBML 2KZ1B 3FQRB 1GXEA 2VH5L 3J2PA 1FCCA 1HH9B 1IGTB 2DQHH 1PVHA 1H8SA 2QQKL 3PWLA 5J1AB 4UV7L 2IGFL 2CUAA 1VACA 2E9WA 5F1KC 3MBEC 1AJ7L 4LVNB 1LHZA 5HJ3A 1ECZA 2CKBA 3HI5H 4X7TB 5C0IB 2LFGA 2DQIL 1GOGA 3UZEA 1I8AA 4H4NA 4QNPE 2MMXA 1CD0A 2P5ED 3MV7B 4PRDA 5IB3B 4FFYH 3KPMB 1WTGT 1K4DB 3OXRB 3QJVB 4HGKC 3UCQA 2YUXA 4JM2B 2WN3A 1IT9H 3F7KA 4JFDD 1MVFA 2FHBA 1IIKA 4F3FA 1W16A 3U0WH 3BLPX 2DEXX 3LN5A 3QPKA 4LSDA 3OZKA 4XN2A 1BBJA 5EU3B 1NMBH 1X5HA 1YY8A 4I13B 4GT7A 5I19H 2JKJA 4HIEB 3MRBB 3F7VB 1D9KB 1LTXA 5GS0C 3JWNC 4OJAA 2D7NA 2ROYA 3V4VH 5M95B 1AKJD 4HS3B 2F68X 2WIIA 4ZTPH 3M7OA 1XGUA 2P8PB 4H25B 5I16B 3QRGH 4MA3A 3MRJA 1EEZB 4EEEA 4F7PB 2RAMA 3CHXA 2X41A 3V4UH 4JANB 3WTWA 5BZDB 3G6JE 4KH9A 1G7QB 1BQSA 4JHAL 5F6HJ 2NW3A 1NPJA 3WIAA 1OAYL 3QNYA 2AK4D 3TT3H 4JKKA 1PQZA 3MJ8A 5EOQH 4NZJA 3BPLB 2ZSVB 3SE3A 4QHKI 3VAEA 2J6WA 2VZTA 4ONFH 3PWPA 1NKRA 1FG2A 3GXNA 4HH8A 2WM0A 4K9EL 4KFMA 1BAFH 1BA9A 1NAKH 4PJEA 3STLA 3PQYE 1PY0A 1VHPA 3CHRA 5I26A 1HWHB 1DBBL 4KRPD 2C3GA 3BDBA 3BCFA 2WQVA 5FECA 1T21A 4IOSA 2P26A 4LCYB 3OAYH 1T2XA 3BGAA 2QMKA 1AOZA 2WY3B 1L6XA 4ZZKA 2WNKA 1FAIL 3RL2A 1YEEL 4XAKE 3AGWA 2IMMA 4XMPH 1PLGL 1HXYA 2XN9D 4GAGH 4I9XA 4ERSL 1WGOA 3Q06A 3BP4A 1G7PA 3H3PH 2IVFC 3SGJC 3VACA 3QIBD 3RGVC 4ZX4A 2X6AA 3L9BA 4TNGA 5KVFE 3FO0L 4K23H 5LG1A 6FABL 3Q6GH 2YQ2A 1QP1A 2J44A 4WHYH 5F93C 5GGTL 4PJ9B 1W8NA 1MJJA 1BPLB 2GVYA 2OJ1A 3HAEH 2CDEB 3U9PH 5IGXL 4OD1L 1MFDH 5BNXD 2XWBB 3IBEA 4QI3A 1KTDA 2D03H 2VLJA 3EF7A 4LASH 4MASA 3WJJC 1QYGH 3POHA 5F1SA 3FN0L 1OWWA 3C5ZD 5DJCB 3ARDD 2X4RA 5A2FA 4LCVA 3D2UB 4PWKA 4YIQB 1CDHA 2P4AB 2BVOB 4D2NA 2DQJL 1E4XL 4YAQB 5BUGA 3MLVH 1R9FA 1X5KA 4GSDL 2I9TB 3FT9A 1B0RB 2AXFB 4M1DH 1TPXB 4J4PD 1I9RL 1NGWB 1QFHA 4M7ZC 5C9KA 3V79C 1W72B 1PMYA 3EYSL 3V6OE 5MERA 1HL5A 2CIIB 4LAJH 5CEYB 1YYLH 2R4RL 1JYWA 4F15B 3FU5A 3TTYA 4N2KA 5EV7A 3CU1A 3WMPA 1IGFH 5DEGA 4YHML 1MI5E 3IJYA 3TESA 4H2AA 3NCWA 3JTSA 3BW9A 5A6IA 4JKPL 1CFVL 3TIEB 5KVGL 1P4IL 2OI9B 4HUKB 1KYOK 3QDME 5INDB 2ZUYA 5IJVB 4P57A 1IJNA 5D2NB 4FP8H 3CFIC 3GIVB 4RETB 4JGNA 2IMNA 2QKIA 4FFTA 3ESOA 4KV5F 3AT8A 3FTSA 2FNWA 3U4AA 1N6QH 3G6AA 2P5WA 4XWOC 1DBKH 1Y6MR 1V55B 1NCDH 2X89D 4J1UB 4Z7VE 5EC1B 5L2KE 1W9XA 1IGMH 1NGZA 4NAJA 2YK1L 3K5SA 3B6SA 3L4YA 3QFDB 4A7UA 4GXUM 4XCNB 3WTTA 4JR9L 4FG6C 2VLRB 2CHWA 2X4SB 5CBEB 4U1IB 4AYID 3FCSA 3ALXA 4OUUA 1TEGA 4RAUB 4ZX6A 2ZONA 5T3XL 4KI5F 3BZ5A 1ZV9A 5I1KL 3QWQB 2F53D 1NCBL 3NSXA 5CGMA 5E4OA 4JFED 1WWAX 2JELH 3H56A 4L8SC 5KSUA 5I0VA 4FQXD 5L4MA 1QFWL 3MO1B 2EKSA 4CU6A 4FN0A 4XX1E 4H7VA 2ZUQC 4KMQA 4HPHA 3GSXA 5F3BA 4DKFL 4JW3A 3ETSA 2NY0D 1MIMH 1I7TA 2R39A 2OYLA 4BQBA 3NIFE 3HG1A 4C47A 3HUJE 1AGBA 3ZHDA 4P5TB 5D72L 5T3ZL 2FEDC 4LQ1A 5IVZB 1Q9WA 3VXNB 4M7JL 1DBAL 4LEOA 1W72H 2JI3A 2OX5A 4XC1L 3MSPA 3UC0H 4FQ2H 5CWSA 2XBDA 2YA1A 2RD0A 4JFOA 2AKRB 4KU1A 3C2SA 3IS0X 3UL4A 4BK4A 5T1LD 3IDGB 4UM9D 3H42L 1S3KH 4Y2NA 1EMTL 2C9UA 1V8HA 2D73A 4ISVA 3UCRA 1C8PA 4PIBA 4ALAH 4N8UA 1Z0MA 3NSDA 3CFBB 4LVHB 1N3NB 4AUUA 3CFQA 4LGPB 3P3UA 3OC5A 1DEEA 4N4YB 3VXRD 5EUOE 1G7HA 4I3RH 3NBNA 3WY1A 1ND0A 4KKZA 5E23A 3SY6A 4P2OD 1OL0A 4IIQB 1IBZA 1L9OA 5AEAA 4ZMOA 4WTZA 5KUKA 1R3LA 4PJIF 1GS6X 4XMKL 3OJDB 1ONQB 3PPEA 2F5AL 5J8OA 1EZVX 3MNDA 2Q6WB 5KSAC 5I0ZA 1I1AD 1YAIA 4XGZB 4XHQA 2FJUB 4JRXA 2A9CA 4NRXB 4CVXB 1IBHA 2O1AA 1OAUL 1Z0NA 1WFMA 3KPSD 4E9SA 3MV7E 3GHPA 2XTJD 4ZQKA 3FQWB 1OD7A 3APDA 3QIWB 4H26A 1L9NA 3WUWB 3QEHB 4YHOL 5C6TL 1N19A 1FYTD 2Q10A 1CN4A 4MMYA 3WYRA 3MOAL 1EAQA 2FLMA 4AV5A 2D31A 4E5XB 1KMGA 2IANB 1KENH 2HJFB 3N2JA 4FYSA 1T1XB 5ISZB 3B9KA 2OMTB 4WJG3 2XPZA 4M6NH 1MHPL 2EDMA 2SEBA 2XHNA 3B43A 5I75C 2AQ2A 4BKLB 4J27A 5E94A 3RJQB 3RTLA 4RISH 5HYQA 3QNXB 2FZ3B 3FQTA 4GEJA 3CHSA 2DQGH 3LN4B 4FQHB 1ETZB 5GGSY 5C2UB 4FFZH 4MJIE 1DFBH 4UNUA 2O5NA 4XNMA 5CUSH 3OGCB 1NUDA 3HCVA 1HS6A 1JZDC 1R5WB 4F7EA 1Z7JA 4PS4H 4H1LA 3TLRA 4KVPA 5GHWH 1TTBA 5DT1L 2P8LA 1TDQA 3F8UB 1U8NB 1KSRA 2FR4A 3NK4A 1QVOB 3MFGB 1V27A 2IADB 2MQCA 5I28A 2H6OA 3PFQA 1P4UA 3QI9C 3QUMH 2FQGA 3ALPA 3T3MF 2NR6A 2QVKA 1AGCB 3L3JB 1M53A 1DSWA 4UUJA 1PD1A 5E8OA 1JXDA 1AHWA 5ICZA 1SJHB 2K6ZA 1YMME 3FQNA 1UYWH 4MA8L 1HOCB 1ZHLA 4LB8A 5JHDB 5GZOA 4KZCA 4KXCA 3KMDA 4NZTL 3GUFA 3GFUA 4ELMB 1RHFA 1UT1A 4PGCB 4N68A 4IBZA 3LQZB 2XJLA 1GY1A 4R4NC 5E2JA 1E30A 1V54B 1P69B 4KHTL 4QRRB 5DZOA 3ZT7A 5DJXB 1DJYA 3H7BA 4Z7UB 5E8DL 4IYKA 5ETUA 4ZJ9A 4BFRA 1MCSA 5D9SA 4LCIL 3RIKA 3G5WA 1C12A 2VMEA 2OZ4A 4NO5A 3C5SB 2WO2B 3MCLH 4PJXA 4XXDB 3F7LA 3VE0B 5EPMB 2H0EA 2FUTA 1JNNL 4XCYB 1XWVA 3V0VB 3TT1H 4YE0A 3WL9A 2MQ0A 4OIFA 3IFLH 4LHUB 4XCCH 4UTAA 2ZX5A 4DZ8A 1N5AB 1A7PL 3H8NA 1B3JA 1HFUA 2XWZA 1CJYA 1BFVH 2EO7A 3C6EA 1M1XA 2FX8L 1EO7A 1UENA 3C12A 3GMQB 3D85A 1DANT 4YHYC 2DEWX 5D7LD 5DHEA 3RWGA 1L0XA 3QS2A 4ZS6D 3IF1A 3SPGA 4JKNA 1SM3H 1ZY9A 2F8IA 4OD2A 2IOMA 3DX0A 3J8F7 3SPIA 2FO4A 4K8RH 4BM7A 3M07A 5EO0A 1R3JA 4FOMA 3T9WA 3IEAA 4UOQA 3SPJA 3QUYC 2R2EB 1AXSB 1P7QB 2R0LH 4F7CB 2BIIA 3ZDWA 2K6WA 1TCRB 3ULVC 1ZVNA 4DO6A 4P4KD 1NC2D 4WI6A 4BFKA 5LGHL 2C9SA 5D2NE 6TAAA 5SWZD 4EO5A 5I1GH 4HPOL 2AXJA 4PAZA 1TMQA 4K0OA 3SO3C 4BQ6A 2VAAA 5DQDL 3QQ3B 2JJTA 1TEFA 4PS3A 5JQHC 1TENA 1QFUL 1U30A 2QADC 4PWFA 1XAKA 4OGAD 2V33A 3QZPA 3TNMA 4R97C 1NCIA 4CU7A 3RY4A 4NNYA 5KW9H 2NY1D 2KH2B 1COBA 1KJ2B 4X4YA 4DK5A 4OY9A 4MS6A 2EC9U 5SX5H 4ONOA 4WW2A 3L9EA 4P2RE 3GGWA 2NTFA 4YXLL 3DDGA 1NFIB 5DZAA 3BPNC 1BGXH 1WA2X 1GKOA 4YE4H 1LM8V 4HCRA 5ICUA 3IJHA 2GTZA 5DFWH 1RPKA 1ZT4B 4DQOH 1ZLUH 4IHOA 1KXTA 1WLHA 3KPOA 4YMPA 2WLIA 1MVUA 5A2JH 2J6EH 3BH8A 3QBTB 3WFCL 3WUWG 4XNBA 2ZE0A 1CZ8L 3A21A 4TVPD 5DGQA 4A7VA 1CGSL 3OZ9L 4E5XG 1GHFL 3VMPA 5ICXA 1L5GB 3ISYA 4X4XA 3L45A 3I6GA 4XNZC 4OZGB 3WEMA 4YUEH 1I8KB 5IQ7L 1P6WA 5LDSA 3K2UL 4OM0L 3F7YA 3H0TB 3FF8A 1XGTA 1GH7A 5BS0E 3IU3A 2YD1A 4QRAA 1IB5A 1KCRL 3RFZA 5E9AA 5HHOB 1FSKC 2X2HA 3EFOB 4NWUL 1T3FA 1JWMB 3BWAA 1H6EA 2HKFH 2X0VA 3O0LA 4F93B 3SPVA 1GGIL 1CDGA 2PW2A 3RLSA 2GIMA 1F42A 2OMXA 2CHNA 4IBQA 5EZOH 3CZSA 1TQWA 4FQJL 2W1NA 2OTWB 3M46A 4F8LA 3BZ4B 1INQB 4HSQA 3N43B 2XY1A 2P5EA 3QQ9D 1O6TA 1RZJL 2HTLC 1NBYA 4WCYH 5HI5D 1UUNA 2IH8A 4PUBL 3UAFA 3POCA 1KDJA 3LD8B 3FQYA 2R29A 4GO8A 3ULUL 1MW2A 2G4EA 4JFDA 1G43A 5HI3C 3B8SA 2F08A 2ADGB 2PWDA 4PWEA 5HVHC 2IWKA 4ABUA 3TBYA 1L9QA 4YK4C 5SWSD 1R3IL 4TV3A 4KJQD 3LXBA 2WXOA 3L16A 1NIEA 1I8UA 1F58L 3C8KA 3O3EA 4C4KT 1AKJA 4OCXL 2JQAA 3LS5L 1QACA 3CDZA 1OB1A 3L1FA 4BV1A 3AREB 4IJTA 3IWVA 3QJQB 4IKJA 4DGYH 3E3QC 5I2IA 5EU4B 2FSEA 1YVLA 2C4XA 5IK3A 1I1CA 4A2MA 1MPAL 3MRMA 2AK4A 3GXFA 5TF1L 3T0ED 1XSJA 3KWWB 3DIFB 3VWKB 2F74B 1T1YA 4Y16C 1AIFA 1UQSB 4HQQH 4NEHB 4ES9A 4TVUA 1T89A 3WN5B 4F58L 5ISZE 4OZHA 2F8VA 3RYMA 1W0YT 3ATDA 2FJHA 4XXCA 1B4RA 3UZEC 2NY3D 2B16A 2KMWA 2OCCB 2XXGA 3CZUB 3FTUA 4HC1A 4LHUG 4MXWL 5BZXA 3VTAA 1LWJA 1YQVL 4HBCH 3EKCA 4APXA 1QZNA 4KJPD 5E5LA 2YRZA 3OXSA 3WUZA 2H1XA 1KTLA 3BT2L 3P40A 5DJ6B 5GS0L 4A7GA 5EBLA 2D2CC 2FECL 4JPSA 1JFQH 4BH7A 4UAOB 3KEDA 3U82B 1FL6A 2KDGA 5F1NB 3RGHA 4JHVA 2QDVA 5C07B 5JOPE 2GJ6A 4HKBB 4X6FB 3NCXA 3QIBA 2IWEA 2VE6A 3ARSA 2R1YA 3U1SH 3UBFA 4DEUA 1RJYB 3GLAA 1ET7A 2H1PL 3KW7A 2WOYA 1JHTB 5K69A 1Q1JH 2VIRA 2PW1A 5E00B 4TS6A 5I1AA 3HHSA 2ZWSA 4I8DA 2AABH 3IKCB 1KUMA 3GJEA 3WE1A 4RSYA 4L18A 2V9TA 3BP5A 3F7PC 5I73C 5JHDE 2BSTB 2NY4B 3U4EA 2FLBT 1A9BB 1KIQA 4N0UA 3D87B 3C5ZA 3K8KA 3ARDA 4JPIB 1LMKA 1HZHH 3MLYH 4LSPL 3F84A 4MMXA 1MJ8H 2Y5TB 2OYKA 4YSEA 9CGTA 1G9MC 5EU6B 4QRRE 4ZS7H 3ZTJH 2GAZB 4JDEA 5CINH 4YZFE 4YN3A 3DVFA 5JHLL 3BKCL 2IWFA 2CK0H 2OL3A 4J4PA 3RWCA 1T1WB 2DS4A 4RDQF 3R19A 3E8UL 1WZMA 5F9JB 4KK5D 2DBLH 4BGLA 8FABB 1DO5A 1XF5B 1XIWD 4WI0A 2F54B 5CILH 2EINB 1WCBA 2WSPA 3RTQB 3DBSA 4IOFC 5FA3B 5ESAB 4Z7WB 4FMFA 1U58B 3KPNA 1LWRA 1OE3A 4NN7C 2VDPB 3IBOA 5F9WC 4ZPVB 4F8QA 4EQ3A 1S9WA 3UACA 3EOTL 1RIHH 3ZBMA 1HCVA 1UM5H 2JXMA 3EJTA 3OHXA 1UJ3A 4MJ6B 1J87A 4OJEH 3TBBA 3HZMB 1A3RH 1P4LB 5DDHA 3L9RA 4ODVL 4QMEA 3T1FA 3ML8A 3GI8L 3L7EB 4XAKD 3PS6A 5L4JA 1RMFL 3RG1C 4MD4B 1XB3A 3BVNA 5KBPA 3W5NA 2X89A 1N67A 1BZOA 1RFDL 2N4IA 4GW1A 3SEPA 4M7LL 3BZEA 1QHQA 4X9GA 3MMEB 2FBJL 2I07B 4N0CC 1RUQL 2UVFA 3P73B 5ESVA 3BZFA 4QT5B 4A6YL 3BP6A 2VR3A 1OT2A 1KJMA 5ABZA 4PI2A 4R4FL 3B5HA 1T0PB 1HILB 2PXYD 1ZEAL 2J73A 2APVA 3FO2B 3SY0B 4X9BA 3Q2LA 5ANME 3SE9H 4BSWA 4RFNB 3D07A 2MIZA 2DQUL 4PJ5B 1RUAH 1KFAL 4GP5B 2OKMA 1ETJA 3T3PF 4HH9A 4L4VD 2OSXA 5CJ5A 1SVZA 1N7ML 3BD5A 35C8H 3EDKA 4U0RB 3L4VA 3M17A 1PSKL 3KLAB 4MJ4A 3WXWH 2EE2A 1MHEA 3AM8A 1DDHB 4YDVA 1S4IA 4DKTA 3O9WC 1KPVA 3RWDB 3HE6D 2VQ1A 2WBKA 3LDBC 5D8JL 1MJ7H 1ZPUA 3NABH 2FEEI 4KTDL 4GS7C 1IGJB 3ILEA 4FNRA 3B2UD 4NQSB 1GZPB 3A6OA 1Y18A 2VL4A 1CB4A 1QI3A 3RJDA 4YDJA 1P9MC 3D1MC 3ARBC 3L1OH 2ENYA 3C2AL 3K81A 4WEUD 3ZYOA 3GXMA 5I15H 1RLBA 1MI5D 1A0QL 1R3HB 3IDUA 4IK6A 4UM9A 4X80L 1CL7L 1ORSB 5LBSH 5HGAA 4YZWA 4ODWA 5C70A 1QHPA 1CVRA 4EE2A 4JKWA 1JZEA 4O02A 1F1GA 4OZGE 1SF3A 4HALA 3MRIA 2X4UB 2NQDA 1UOWA 4H8HA 4RWYL 4OCYL 4Z0XA 5HY9B 5I5IA 3CFKA 3VXRA 5FGSA 4X8GA 3VI4B 5HHOE 2BVEA 4G8AC 2EVGA 1UOVA 3ZE2B 2CO6B 5FA4B 3MV8B 1D7FA 1DQKA 4WV1B 3Q44A 1G9NC 4YFLI 2Y2YA 3N42F 4B9CA 1UH3A 3T6VA 1KJ3H 4G6JH 4P5MA 1I1AA 1MZZA 1GMEA 4PJAA 4HJ1A 2EXWC 3KVQA 4JO4H 1MQ8A 3HR5A 3V9CA 3HI6H 2GW5A 5I1EL 2PABA 3KPSA 2A77L 5F1OB 2DLEA 1M7DA 2VR7A 4Q4IA 4WI3A 4JQXA 2VQTA 5GGVH 3S37X 4E41A 4JPKH 4NX0A 1FYTA 3RVUD 2W65A 1L6PA 4ZAKB 3WFZA 1FNAA 1M7IA 3BVVA 3HRZB 3LEYL 1KIPB 1E2VA 5GGSB 4NYLA 5CU5A 5AQ0A 2LU3A 4UWQB 4RFOL 1AJ7H 2YBGA 4IBSA 3M1CA 5AB2A 1N4XL 4NFBA 5J11B 1OAZH 3U6RA 1TT6A 2B1OA 5L88H 1WAEA 1NGPL 3MLWL 4L23A 2OMZB 3S34L 1J7VR 3TJHC 4R2GD 4HX1A 3MRHB 2AJVL 4JFXB 1O5PA 1EZUA 4F33B 4JKLA 3ZZ1A 3PIQB 1ICTA 2PO6D 4NQCB 4NM4H 3IRCA 4L8BB 3GI9L 4JUTA 4KQ4H 4X8JA 1L9TA 4Z7QF 1N9PA 2X28A 2D7PA 1ZS8B 5TDPA 5F1IB 1GSMA 5IB1B 1E9OA 2DLHA 2CK2A 4UDTA 4DQAA 4GB9A 5I1HH 3BUQA 3TH3T 1U36A 1HK6A 4QRSB 1UB6B 2B7DT 2DEYX 4H8WC 2MTAA 2WSDA 4XTRD 4YHIA 3EYOA 4RGOL 5HHME 4PGEA 1KNOB 3TVMD 3MLSL 4LSUL 1T83C 3HG4A 4K5OA 4MNQD 4L4TD 5DK0A 2FIKA 4KROB 4WUKH 4G8GB 4W9CC 1ACYL 1TSRA 2VJ8A 2H0FA 1WF5A 1JGUH 4HKZB 3RNKB 5D1XB 1D5ZA 2UY7A 3EXJA 1IM9B 4P4RB 2A3TA 2XZCH 4HIQA 3BDXA 3RBSA 1JPEA 2A9MH 1SDYA 4WK0B 1ZT7A 3QO1B 4DPCX 4TQEH 2NQ3A 4KVCH 3K1KC 5E2UH 5GGRY 3WO4C 1NPUA 2O6DA 3SDXB 4FKKA 1L9RA 3UMNA 1FAIH 3MV7D 4B6ZA 1YEEH 3CVCA 4G7VH 2UYLB 3WIFA 1EX0A 4PQXA 1PLGH 4W9EC 1WZAA 3L1GA 5EEVA 4JM2D 3EGXA 4UILH 1EJFA 1Y6NR 4O5LL 2Z8VC 2YS4A 2BRRH 2X4PA 2HT2D 2DI9A 3DK2A 2J57A 5E6YA 4AMWA 3FO0H 5H4YA 3ECVA 4OD3H 6FABH 2VXQL 2HVKB 2ZOWA 1UHVA 1D9KD 4G7YL 4JS7A 4AQAB 1GZHA 4NFCA 1WC7A 1D5MA 1AHWC 3WNIA 1MREL 5IGXH 4OD1H 4FJ6A 3WY2A 4JZNB 4PG2A 5D7LA 4LMQI 5I74B 5HYJE 3SE4C 1O6VA 2NMSA 3N50A 3VI3A 2F54E 3UBXA 4HISA 1ZK5A 4C4UA 2YO3A 3ARFA 2XXMB 4PJDB 4Z76A 4ZMLA 1E4XI 2VO5A 3P9MB 4Z7WE 1U9KA 3WJLA 3HS8A 4G83A 1IAKA 3SDCB 1C7TA 4U6HB 3VGDA 2GSIA 1KBKA 2M26A 4HGWB 1IKNA 1A14L 2DB8A 1NLDH 3K6DA 3X1GA 3UPAA 3HW7A 4BQ8A 4CNIA 4ZO7A 4ODSH 4P4KA 1G1CA 4NQQA 1F6LL 4WI8A 5SWZA 3WSQL 4NHCH 2BXYA 1J5OL 4D0CA 1SQ2N 2JB6B 1HI6B 3PUCA 3GJFA 1PG7L 4GKSB 4RAVB 3IK2A 4K7PX 4YHMH 2CJSA 1FGVL 5GGUA 5D7KD 3THMH 2CDGA 2DN7A 2WLHA 1DZ0A 2H8PB 3NJVA 2WB1A 3PHQA 4IHBA 4OJFH 4AQ8C 2PCPA 2RTTA 1M6UA 1CICB 4YOKA 2MSPA 3COOA 4F7TA 3KLDA 2WJ5A 4LL9A 5BZWA 2XNAA 1S7VA 2C7FA 2H6PB 1NCGA 2JNZA 5IVXA 2K70A 3QUZC 1JF6A 2C7UB 3KM2A 4PJ6A 5F6IC 1OY3B 1HIMH 1P5UB 3BH9B 3GS4A 4NKIL 4PJ9D 3FDWA 3ZHLA 3ULVL 2FJFA 1IIIA 1DO6A 2ZX6A 3OF6D 4UDUB 5ESQB 4CA4A 3WKNA 3O4LB 3CZNA 4PJ5E 1XCXA 4K07A 1MW1A 4D9QD 4BDVB 3W11D 1URIA 4HPYL 4Q9QL 5MI0C 1OXYA 3AWGA 4AL8H 4ZXBB 4AUYA 2QBWA 3HMXA 3DX7B 4LRIC 2DTSA 3LKQB 5JXAL 3BD3A 5IF0A 1M05B 1R3KB 3FN3A 2V5SA 3D2UD 1JK8B 5T3XH 3QFGA 2VLME 3LV3A 3IGAB 5D6CB 5HDQL 5I1KH 1KOAA 1YEDB 4MAUH 2AEPH 2DV6A 1S5HA 2WXHA 1KJVA 1CURA 4X99A 1TF4A 1A6ZA 5FFOA 2QV4A 5C09D 1MNNA 1DE4A 5IMMB 3F64A 2QGDA 1X5JA 3ZKSD 4M43L 4DKFH 4HHAA 1X7QA 4OLZH 5EIVA 2R2BA 1DJXA 5B8CC 1AD9A 1LO5A 3QFJB 5C8JA 2X40A 4KKNA 4ZYKA 1MG3C 1BZEA 4QWWC 3WLBB 5CCGE 4I48B 1XD1A 4P3CH 5T5NG 1UASA 3I2CH 3IDJA 3FCUB 4L48A 4GFTB 1EGJH 2VUKA 3RWIA 4M1CD 1PKQE 1MHCB 3IAQA 3MGAA 2ZOKB 2BP8B 1TVDA 4Y5XB 1DBAH 4HUVB 4YC2C 3WTVA 1NCCH 2X2JA 2Q76B 4TTDC 4XC1H 5LKNA 5AENA 1LLAA 1C08A 4AEEA 4KGJA 1UXMA 4BZ2L 3VWJC 1DVFD 5ID1B 2ZSWA 1J0YA 4IS6A 5DMKB 2UZYB 3NIGF 4Y4KC 3ZE2E 3HE7B 2IG2H 3MV8E 4ORZC 5SWSA 3BFWA 3EFDH 2VXSH 2FT7A 5J6GA 1MHHB 2IIJA 4GIOA 1D6VH 3C08H 2WN2A 3A6BL 3F5WA 4K2UL 1UACH 2LAGB 2VLRD 2A5UA 4XNYL 3MOQA 3CLFL 3TN0B 2B9BA 2ZZUT 4X4KA 2ZCZA 3PPSA 1CGUA 4MXVE 4EN3B 3E9TA 5DRZA 2RB8A 1CR9H 5DFAA 3MLZH 3OAZK 4QY8A 3T0EA 1H6FA 1K5NB 1PY9A 4PB0L 4YLBA 2XTSA 2DICA 3VXMD 2FWUA 3QSKB 4XMKH 2Y9RT 2AERT 2F5AH 4J8RA 4OB5L 1WBXB 2EDBA 1ZV5A 3EJUA 5C0DA 1YEIH 2B1AL 2MQGA 2VUYA 1SY6L 1E6OH 1OAUH 4NQXA 5DK2A 2WO4A 2W59A 1H5BB 5D5MA 4AV4A 1AANA 4GH7B 4YHKH 4UAHA 3BISA 1E5BA 3NZHH 4RMSA 3N1MC 2XWDA 1LNUA 3WI9A 4F80A 1JYNA 4L1SA 1XF4B 5DSCB 5I0WA 4KUCD 3LZRA 1I1RA 4FXLA 2CHDA 4NQCE 4Y1AB 5E5MA 1S7WA 3QXVA 1A7QL 1BCIA 1HCFX 5JW3L 1PIGA 2MEJB 4WSKA 3LQAH 5EWIL 4AIZA 4R3SB 2YEZA 1DQDL 3QQ4B 3FFCB 5C0GA 2OMWB 1JGLH 1SMOA 2XRAL 4UANA 3B2XA 2R9HC 4BBWA 5A7BA 1MCPL 1JCKA 1RJCA 3OKOB 3UTPD 2JF1A 3ZE1F 4I18A 1IBYA 4LXFA 1A5FH 1CMOA 4Z7IA 3GSNA 4NBZB 2DI8A 3CLEH 3D5OF 1R4XA 3DHJA 4JZOB 4U49A 1YECL 4CN6A 5KVGE 1QR1A 4GOSA 3VXTB 4Y5YC 4LLYA 5D1XE 3JV6B 1CFBA 4WKZA 5I17B 1EUUA 3VXPB 4NZRL 4XXCC 3V55A 3IFNL 1LP9B 5C0FB 4P9HC 1BEYL 4BUGA 2BNRB 1CXEA 3DX8A 2ZP0T 2WB7A 4HWBH 5IUCA 4KRPC 3LPGA 1GGYA 3LHPH 4K15A 4FADA 2OSLB 1JTTA 4G80A 4QTHA 4XX5A 3WU1A 3QXWA 3SDXE 2B5IC 1F4XL 5D96B 3T3PE 4AVJA 1SN5A 4ZTOL 2FJGB 3G6JA 1KLGA 4OZIB 4NZTH 1C5BL 3WFEH 3CZLA 5HYFA 12E8L 2LABA 1IE5A 3U7AA 3GZOA 3D05A 1FJ1A 3TYGH 4G7QB 4FDWA 2O61A 3MXVH 4G42A 5E8PA 2Z35B 3CDGA 2IAND 4JFPA 3DO7B 1JV2B 4UZSA 5ISZD 3JV4B 5E99L 5HGDA 4QJ5B 1HYSD 1NMCC 3FT4B 3L8QA 3N0PB 5IQ9B 5BQ7B 2O30A 2B77A 1UA6H 2EE6A 3VD0A 1ZD6A 4WFFE 5B22A 5A1AA 5CJ8A 2VUOA 2YA0A 1G9ML 4NO0B 3UBHA 1F3JA 1DSFH 3M8OH 2E86A 1JNNH 1U0QA 3G6DL 4LAQH 1LEKB 3RHWF 3RX7A 4BCYA 1CXIA 4I87A 5IMLA 4R26L 3WEXA 4Q74A 5KBMA 1OZUA 3FT2A 4M6OH 4DK6A 1EZVY 3BJ91 3HI1A 4TUKH 4AQEA 4XNDA 1JZ5A 1CLYL 4YHPA 3VG9B 2P47B 2UZPA 5JDSA 3L5JA 5FYKL 1A9VA 3TBCA 3SQRA 4GW5A 5T8IA 1WS8A 4WNQB 5T3ZE 1G7IA 4JPQA 4Q6IC 2P28B 3TNNA 5EORL 2ARWA 3T2NH 2PP8A 1FL3A 2WINB 2JKTM 4MD5A 4ODTL 4S1RH 4X50A 4YVNA 3K6NA 3CMOL 4LVOC 3PLYA 1IARB 5TQ2L 2PXYA 5KZCB 1XCTA 1JDAA 3VFSA 3C09B 5IT2L 1EDYA 2X87A 4UQ2A 5GZNC 1IFHL 2V8MA 2D0HA 1S9KC 4Z6AT 4A39A 4K7FA 1WBZB 4JRYD 5JHDD 4QIRA 3QUXD 1MWAA 3QEGH 3CVIL 5D1ZD 3LVEA 5I5JA 3GKWL 2CA4A 1MDTA 3MRFB 4LSTH 1RJZB 1LD9B 4HIIA 2BCKB 3NCJL 4MAYC 1PZDA 4Z9KB 2XTLA 3IGLA 4MMZC 1A22B 4QRRD 1U2YA 1UJ3C 2BVYA 2AF2A 2OMUA 4L1TA 4LNRA 5FLUA 2YHGA 3QG6B 5IESL 2B9AA 2BDNH 5F0MB 1T4WA 5HHNB 3O4LE 3EJZD 3O3BA 5KTEL 3ZKMC 2OM5A 1B4LA 3E0GA 4HK0A 4QHNA 4BHUI 1U8MB 1MI5A 3JWOC 4JGUA 1E8WA 3V0FA 1DJZA 1YHPA 4XOAA 2R23B 3PXJA 3RWHB 1AACA 1AE6H 2QGEA 4LESA 3NJMA 4YXLH 3NRFA 4IOIA 2OJZL 5TFSL 4XHJD 4IBVA 4LHUD 4LBEA 3MBEB 2MKLC 3VFTB 5IIEA 2ITCB 4RVBA 1XF3A 4AGPA 5A3ID 5A43C 1NM9A 4YBLC 1HEZA 4RH4A 4FQXC 1OCOB 1J1PL 1YYMH 4AEHL 4CBZA 3MN8A 5IKCB 3WFCH 4Z7QE 1YY9D 4OCRL 4ELDA 5D7HA 4GG8A 1O9VA 2P8MA 2F19L 3C5JB 5DGRA 2NY0C 3OZ9H 1WFOA 3QFJE 2YPLB 2C9RA 3D39B 1RZPA 4WJ5B 2LGNA 5IFAL 3GBEA 1MFVA 2XG5B 4FYTA 1FDLL 4J39A 1ZDSA 3DOIA 4U1LA 2DMKA 4LU5H 5FO7A 1YMHB 3BAKA 3MR9B 1P7QD 4PREB 2M8XA 4WO4C 3PJSA 1TU2B 1A1OA 1GSKA 3FT1A 4OTXH 3NTCH 4L29A 2G5UA 3MNZA 3P3SA 5L2JB 2ORBH 2ADYA 2EYTA 5CLYA 4G6FD 1LL1A 4UT9H 2QR0A 1KCRH 2NUTB 1JF5A 3MU3A 2Y7SA 1MN4A 4NWUH 4MGXA 3L9YA 5DMIL 1T0NB 4MNGE 1BXVA 5JLZA 1FE8L 3VGEA 4PV8B 3WG7B 1D2PA 1I9JH 3GF8A 3VH8B 3WKPA 3KYOB 1F11A 3ZU8A 4ZFGL 4C83A 4FX5A 5BO1H 5IJBC 5C0CD 3A4EA 4NWTL 3EW3B 1G9NL 1FVCB 4RNRA 4XNXL 1FH5H 3BPCA 5JDJA 3BHBB 4Z3TA 4MA1C 3FHQA 3HG0A 4IGBD 1XCQA 2AVFA 4P2OC 2PO6A 2YAMA 2AS5M 2BMKB 4FQQA 4RZCB 1ZHBA 2JKRM 2XA8L 3FSOA 4KKBD 2BWDA 4KO9A 4Y5VA 4CMHC 3HVDA 4DPRA 1JZ8A 4OCXH 5FV1L 1MEXH 1I1AC 2COQA 1U8HB 2PYFA 4UIMA 3RGVB 2VDLH 3SJVE 1B3IA 4NQDD 1T1ZB 1NAMH 4PRAA 4OR1A 5JMOC 4R5TA 4TL4A 4AH2B 4H44C 3U1QA 2VXVH 1Q9OB 4TNFA 3TVMA 4MNQA 1MPAH 1SYSB 2WAHA 4D7PA 1AI1H 1Z9MA 5L8LB 4P3DB 1A3QA 4AXWB 5DRWB 4PBDA 3FQRA 3REVB 1SJVA 4OCWL 4Y1AE 3VGFA 4EMZA 2Y7NA 5EFIA 3HZKB 1JJUA 1NLBL 32C2B 1HH9A 3GTVA 3U7WH 4R5VA 5J1AA 3WFDH 1A6VL 1J8KA 2RACA 5F3HB 2XPGA 3O6KH 5C3IA 5I66B 1Q9KB 5CD5C 2BCMA 1YQVH 2VW6A 1RZ8A 3MZTA 2IC2A 2MRYA 4X7TA 1VEPA 3BUIA 2Z7UA 5C0IA 2FECI 5KBKA 1MFEH 4XH2B 1ORQB 3MV7A 4OQ1A 5I6OA 5JOFB 5IB3A 4DNLA 3KPMA 3KPRD 1K4DA 1EAPA 3OXRA 4H8WL 4Z5RB 2AXHA 3U2JA 4M7ZB 4JM2A 4K3DL 1E5YA 4NLHA 1JN6A 1DL7L 2BNQE 1DQLH 2V3FA 2WXGA 3KPPA 4LQFH 1TZAA 5EU3A 2EADA 2UWEB 1KPUB 4HIEA 3MRBA 3EBIA 3F7VA 4AMKL 2W81C 1D9KA 4GINA 4A6YB 2BNRE 1A6PA 5C0RH 1MCRA 1ASOA 4YL4A 5IB4B 1PDKB 4HS3A 4PCKA 2A83B 2P8PA 5I16A 3RVXD 3ARED 3ZX1A 3EBGA 1EEZA 1FVDB 5B1CA 1FAKT 4F7PA 3ZR6A 4P05A 3ZRCC 5BZDA 1PX4A 1G7QA 3BSZA 4X5RA 2BIHA 4RMVA 4HUWB 1J88A 3KG5A 5HDOA 3VWKD 4W1TA 1FLRL 4GQZA 2WWOA 2PPDA 1NEPA 4E9RA 3ZRFC 4PJ7F 4AC4A 1U8OB 4Y19B 3BWUC 1BREA 3T0AA 4BRVA 1O7VA 1TO5A 1JNLL 3W0WB 3E8UH 2IEPA 3NIDB 4JCLA 1MCQA 3UAAA 4LSSH 4DTGL 2HFGL 4QTIH 1WFNA 1JPSL 3R4DA 4AQZA 4N86A 4QXTB 1L3WA 4L8SB 1WQVT 1J1XL 3D0LB 3K4ZA 4QOKB 1QASA 3HN5A 4KXZH 2HG0A 3NACH 2Y2TA 1SEQL 4CVZB 2ETWA 5C07D 1KLFB 5B3NA 2DQ6A 1Q72H 3HB3C 1CD1A 5FGBA 4TNWF 5MEOB 5EOCJ 1C8QA 2Q3AA 2OULB 5BQDA 2AMGA 2ZWZA 1X5YA 1ZLDA 1R5IB 4PJ9A 3JWNG 1VPOL 2IJ0C 1F02I 1KTKE 3OF6A 1Q0XL 1RMFH 1IBFA 2CDEA 3NIGE 2K9FB 2UY6B 4Z3IA 3SPHA 1RFDH 3PV7A 4OLUL 3AAZA 4PB9H 2R1WB 3FC8A 3UZVB 5DLLA 2NY4D 5INCB 2PTVA 2AJSL 4LOEA 1URLA 5DJCA 1P7HL 3QJSB 2ZCKH 3VH8G 1F6AA 1JK9B 3T65A 3D2UA 1KBGL 4YIQA 4AIEA 4FD0A 2BVOA 4NPJA 4YAQA 2IF7A 5EU6D 5AKVA 1F90H 1LJMA 4ZUSB 1B0RA 2AXFA 5JO5B 5BRZD 4NKQB 3UEQA 2DQUH 4M5YL 3ULUE 2NNFA 5GSVA 1W72A 3HBZA 1LO0L 4S1SH 2CIIA 1NJ9A 5CEYA 1JL8A 1N7MH 3HJEA 1B2WL 1Z9OA 3PYCA 3TBTB 1PSKH 2CO4A 3LKRB 3SYCA 3D3VB 4U7MA 1S3RA 4V1DB 4R0LC 4UQCA 1GGUA 3TIEA 4DFIA 5IBTL 2MCAA 4KTDH 4E0RB 4JRFA 5INDA 2QPDB 4W4OC 5IJVA 1G6RL 4AENB 4QCIB 5SWQB 3L5WB 5KSAB 1CK0H 5FB8B 1JS4A 1TZ8A 5D2NA 3NSYA 2HLFC 3GIVA 5LN8A 3U4BL 5I1IL 3C2AH 2MOQA 4PTUB 1WFIA 1GZQB 1A0QH 1GGTA 1DVFA 1CL7I 1OGAB 3LPPA 1I8MB 4E36A 4X80H 4DUVA 1CL7H 1FPTL 4J3OF 2YPLE 4J1UA 1XSOA 2MPAL 4KK8C 5EC1A 5GRYA 1UM4L 3QFDA 4ZOAA 1E3FA 3KCPB 5D6DC 4XCNA 2VLRA 2NYKA 4U1IA 2VT0A 2DQFB 3JWNE 5I75B 4RAUA 5AVXB 4JJOA 1OF0A 3QJTB 2NY2D 3LVTA 3B56A 5D4HA 1RK1B 5DHYB 1UH2A 1XTMA 4PRHE 4XNQB 3VXMA 2EXSA 2YZ1A 2OA9A 3VMNA 1UXSB 2X0WA 5FGRA 3TFKD 5I18H 5I1EH 9PCYA 2QGCA 2A77H 1TVHB 3QI9B 4KGLA 1E7UA 2HAZA 2NSQA 3HPJB 5FOBB 4TPRL 5IVZA 1UVQA 4LCWB 3VXNA 4RZKA 4KXAA 4D94A 1RZIA 2ZCHL 4PVMA 1JGVL 1JRHL 3ZE0F 3LEYH 1ID5I 1EEUA 1U93A 5IFHH 1AZVA 3F00A 2ZJSH 3F6IA 4JO2L 3FU7B 4KJQC 5IVNA 2AKRA 1T5WB 1N4XH 2Y1ZA 3HPLB 1U92B 5K9JH 4OM1L 5DD0L 4G8EA 3IDGA 1I85C 2UX6A 3K5RA 3S34H 4IIZA 3V5KB 4MA7L 4WNSA 4WUUB 4Z7AA 2ATKB 3WY3A 2YD5A 1YEJL 5MHSE 3LZFL 3SGKC 1KCBA 1DR9A 5DWUH 1WZ1L 3CFBA 3LKOA 1N3NA 1WD9A 1R0AL 2KERA 3SE6A 4L8CB 3GI9H 3UEZA 4OT1L 4ZFFA 4LLDB 2MCPL 1UD8A 5F6HI 2R29L 1IU1A 4XPFH 2NZ1A 4IIQA 2Y1AA 2VM3A 3IDXH 4K7PL 4XODA 4P0DA 2J2ZB 4MVBD 2NY3C 1SDDB 3NGBC 3QCUL 3SBQA 3OJDA 5DVMA 1ONQA 2Q6WA 1IM3B 2RFXB 1T0OA 4XGZA 2APWA 4AVHA 3MLSH