2DQGH

Crystal structure of hyhel-10 fv mutant (hy53f) complexed with hen egg lysozyme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSFSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqgH00
3RKDD 1K8DA 1TJGH 3IDNB 1N6QH 3H2WA 4GOSA 2COQA 5D1ZD 3LMJL 4C55A 3OTTA 1ZXQA 4C56E 5C2UB 3C2AL 1N5AB 4NZUL 1A1MB 4CN4A 3F5WB 1ND0A 4ZXBB 3CDFA 3C9NA 1QQDB 5D70L 4FXGA 4YBQC 4LSRH 4HFWA 5IHLB 1ZOXA 2R1YA 5C0BE 1QSFA 2XRAL 3CVHH 3MLYH 2I25N 3MFFA 4PJXE 3DURA 1T6WA 1ETZA 3MJ9H 4K71B 1SBSH 3O6MH 5C92A 2VZTA 5GGQL 4JRYD 1TQCC 4XNYH 4Q74A 4DZBB 1INQB 4QTHA 3GMPA 5I9QB 1T2XA 2VITB 3UO1H 5IIEB 5EU6B 3ZSTA 4NJAL 4M1CD 2D4DA 3U7WL 1EDQA 2CSPA 4XWGH 5F6HJ 3W9DA 3U7YH 3T2NL 4MGXA 2GJ6B 4I8DA 5DYOB 4HWNA 2OQJB 4KJWD 3VFSB 4LHJB 3VFOB 2AEPH 1S78D 4O9HL 1FV1A 2FECL 3MCKB 4L29A 4DVRL 4UILL 1DEDA 4RNRB 3X3FH 1JPGB 3D85A 3BUTA 2R2HA 2CLZA 3CCHA 2VL4A 4GS7B 4CN6A 5D7IE 1AQDB 3RVVC 2GY5A 1A1OA 3MJ6A 5HTSA 5SWZD 4TQEL 5HDQL 2A6KB 3FHQA 4O02L 3L5XL 4Y8AA 2PTUA 3LH2H 1P9MA 4G8GB 1AGDA 2DL9A 1BMGA 1VACB 1C12B 3MBEC 5D71L 3WXWL 4HZLB 1W0WA 5C0NC 3SBWA 2B0SL 2EDLA 3MRHB 5IB1B 2JF1A 3QIUC 3LMJH 4MD0B 5DUBB 4CW1B 3C2AH 3TP4A 2YD6A 1DN0B 4NZUH 2PUQT 3HI5L 1T0PB 3ILQC 4UQ2B 5DQJB 5D70H 1NSNL 1NDGB 4NQTA 4WO4D 4I3RL 1BFVL 1T7YA 5E2UL 4JN2B 3HMXA 1WF5A 3FFDB 2XRAH 4O2FA 4TOYH 1FFNA 4K55A 5ESVA 4JO3L 4LDOB 2X4PB 2R2BB 4KK6D 3GBNL 3NPSB 3NIDE 3ARBB 3TNMB 5L2KD 3TJEL 2PXYB 2H41A 1NH6A 4PJIB 1T0NB 1F8TL 3QRFM 1BF2A 3U7WH 5MI0B 2VLRE 3U9UB 1CE6A 3X13A 4JDZB 4X6BB 2FX8H 1BJ1H 1UXWB 4AEFA 3M07A 1D9KA 2X9WA 4LPWA 2CXKA 1RZ8B 3RTQB 4O9HH 5GRUL 5TJWK 4DVRH 1W72B 4UILH 1M05B 1JF6A 2EO1A 1H5BA 4ODHL 3VCLB 1KLFA 3IETA 1K6QL 4WNQA 3HKFA 5CLWA 4ONHA 1HCVA 2BVUA 5L8JB 1Z9LA 3O9WC 1U3HC 1CXKA 4TQEH 1R5VB 3HPJB 4QT5B 4GKZB 5HDQH 4O02H 3S6CA 3L5XH 3RX5A 2BNUA 4BKLA 1IZJA 3IAPA 2H3NA 1T04B 5KSBF 3VFUA 3T08A 4JRXA 1U8LA 3F7VB 3HZKA 5D71H 5F9JA 3WXWH 3MNWB 1T83C 3W9EB 3V95A 2B0SH 4Z95L 3QISA 4GRLB 3NIFE 1UADC 1NANI 4XCYA 3MRIA 3OZ9L 3M1BA 4L5FL 4HKBA 3HI5H 1JHLH 1NSNH 3G6AA 4L4TA 4MA3A 4I3RH 1BFVH 5E2UH 3P73B 2OZ4L 4NN5B 1DVFB 1DE4B 2DJUA 3VXMB 4YZFF 4POZC 5DK0A 1EXUB 3L6FA 3OKLB 2YN3A 2P42B 1I3UA 2L0DA 3MGOB 3MX0A 4C56D 4JO3H 4NQXB 4CBPA 1HDMA 3GBNH 1XGRB 4FS0A 3C5ZD 2YA0A 4U1LA 5C0BD 3AB0B 1U92B 5GISH 3A67L 4J1UA 3F62A 3WS6C 1RJZA 4QOKA 1F8TH 2CR3A 4K8RD 3PGFL 1TZHA 4K07A 4YFLF 3QO0A 2GJZB 1HKLL 5FGBA 4XVUD 2Y4SA 3ISWA 2MQ3A 1UB5B 3OR7A 1FQ9C 4M6NL 1A22B 1KELH 5CJ5A 3BPNC 4PJXF 5GRUH 2AXGA 5AAMA 4I18C 3RZCD 4XPBH 2RAMA 2WIMA 2VTFA 4Z7WB 4OCRL 4UIMA 4ODHH 1K6QH 3JTTB 1QNZL 5BVPL 2EE2A 4FQJL 5CD5D 1FN4A 3V9FA 1P6AB 4M7ZB 2P8PA 4I4WA 1UXSB 3X3GH 1CDUA 1CGSL 1R3IL 2YD1A 2HFEB 2OTUB 3KPOA 3QAZB 1UM5L 3DXAA 2YS4A 3LKQB 5BZWB 5J9PB 2R9HD 4NYLA 5JHLL 8FABA 1TNMA 3LS4L 1IFHL 4FTVB 2I9TB 1BZ7B 4Z95H 4MA1C 4PJEB 4L9LA 2E9IA 2GTWB 4OZFH 3OZ9H 4L5FH 5IJKA 5DZNA 3OJDB 3SJVB 4KK8C 1OAUL 1BZ9A 4HUVA 1RUMH 4WU5B 1T3FA 2FEEL 3QIWD 4X6CE 1UB6B 2OZ4H 5D7IF 2JJWA 5F97E 5CD3B 1MEXL 4Y16B 2V5MA 4M6MH 5E6IA 1ZGLM 1AP2A 1GGYA 5AG9A 2XT1B 4P5TD 2XTJE 3IDXL 2LTQC 5F3BB 1UWGL 4OM1L 1JZ4A 4ZUUB 4WI8A 4QHKI 1F3DH 3A67H 4RIRA 1U0QA 3QEQE 4PJ9D 1ZVSB 2XFXA 32C2B 1T1ZA 4JRWA 2D7MA 1CLZL 1CGYA 3PGFH 2J7LA 1OM3L 5LCVL 4OLWL 3MRJB 1HKLH 1T22B 4KJPC 3MRNA 4PD4J 2QR0A 2ICWB 5CSZB 1XF2B 3VG9C 3JV0A 4XP1L 4D8PB 1F11A 4M6NH 1KJ2B 1HYSC 1OGTA 2YD8A 3RWIA 2HFFA 3H0TB 2VLRD 4OCRH 1RJLA 2DWDB 3NIDF 1QNZH 4FQJH 2PKDA 4OIBA 5IFJA 2HT3D 5M94B 3RU8L 4LBEB 1CGSH 1R3IH 4HKJB 2MQCA 1UM5H 1DBBL 3NBNA 2G2RA 4KZDL 4U3XA 3CUPB 5T3XL 1ZHKB 4LCCA 1CVRA 4XNZC 5ESAA 4P5KB 4N68A 5EU5B 5JHLH 5D7LE 3K2UL 2KL6A 4I0PB 3OKNB 4H1LB 4MQSB 3LS4H 1IFHH 4JRXE 4U7MA 3QWRA 3G5XB 4YHOL 1LP9E 1RMFL 3FT3B 1RUPL 3FQXA 1URLA 2D7TL 5EWIL 4MD5B 3LKRA 1NFIA 4APQD 2PYED 1BLNB 3QNYA 4FQ1L 2XYCA 1NGXB 1OAUH 1QSZA 1XF4A 3SO3C 4X4XB 3ZTNL 4GAGL 2XY2A 1O7VA 4OD1L 3SN6N 3V52L 4KTYA 1WZMA 4OFVA 4L4TE 1AQKH 3BJLA 1MEXH 4P9HL 2IFFL 1BQHG 2F54A 1FAIL 3FMGL 1A4JB 4F7TB 3F7YA 1V3JA 1C16B 3IDXH 5BCAA 3P0GB 1U8IB 4OM1H 4JY4B 4L1DA 5B3NA 1TCRB 3KNBA 4G6JL 5EC1A 1IAIM 3DLQR 1CXFA 1JV5A 5CJQL 3FB6B 5IW1A 5F70A 3Q1SH 3KWWA 1BVLB 4XXCC 5CP3H 3EGSB 5BV7B 1CLZH 4QOKE 3NIFF 1OM3H 5LCVH 4OLWH 3ET9F 4PJGA 3FOLB 1I9EA 4R3SB 3S5LB 3OB0H 1LK2B 2NZ9D 4XP1H 1FVEB 4GKOA 1OTTC 2ADJB 3REVA 3O4LA 5FAAA 5C0GA 4GRWE 1QFWL 1I1AA 1MAJA 2APXA 3VFNB 3EBAA 1EFXA 1PKOA 3DX9A 4JQXC 5D6DA 3FQTB 4GKNB 4E9LA 4YBHA 3BEVA 3I6KA 2D31B 4EBQL 5H8DA 1UJ3C 1F2QA 1L9NA 3RU8H 2VXTH 3WJLC 3TNNA 1IT9L 2ED7A 3HB3D 5LGJB 2X1QA 2OJEA 1C7TA 4KZDH 5T3XH 5KS9A 1NEZG 3DXAE 4A2LA 2GEEA 3P11L 4K23L 3D85D 5BJTB 1ZANL 3WXVL 5IUSA 3K2UH 3WSQL 3QUZD 4ZFZA 3GSVB 2P49B 1AXSB 1YMHB 4YHOH 1RMFH 2XA8L 1NGZA 1RUPH 3ULSA 2FD6H 1KIPB 1TETL 2D7TH 5EWIH 3TPUB 3VW3L 3MLWL 1YMMB 3ARGA 4FQ1H 1YDPB 3GBML 3ZTNH 1R3KA 4GAGH 4OD1H 3RL1A 1CFNB 1FORL 5EH1A 1UJTA 2AJXL 5CBEB 2C9AA 4F7EB 1QLRB 1NPUA 4P9HH 5F1IB 1N5AA 2IFFH 1O5DT 3FMGH 2QV2A 4U7SA 3DX7B 1AY1L 2NY5C 3IKCB 3QBTB 2BC4B 5EU7E 4LSTL 1BEYL 4G6JH 2VQTA 4XB8A 5HHOE 4CDHA 1OGAB 2YHGA 2VDOH 5E4IA 3VXTB 4XNXL 4XAKE 5CJQH 1OF2B 4NQCA 3RKDC 2X4QA 1Z9OA 5DC4B 2XTJD 4L4VB 3ARQA 2W60A 2OMBA 5D1ZC 3U4AA 4P3CL 3FRUB 2NY1B 2H6PA 5HSFA 4PRDB 4HT1L 4I3GA 1FIEA 2A73B 4GMSL 1QFWH 2AQ3A 2GJ6A 4I5BA 4P2QB 4QHLB 3SY0A 3KXFA 5C8JA 1H9VA 5DJ2A 1T21B 4EBQH 3DV4B 4ONOA 1QHPA 1D9KD 4R97C 2J6EA 1MELA 4MD4A 2XQBL 4M7KL 1IT9H 2ZPKL 1OAXL 2BVPB 1JPGA 1ZKAA 2EIDA 3QFJB 4F9PC 2IH1B 3CMOL 3P11H 4K23H 1LHZA 1ZANH 4PPTA 3WXVH 3WSQH 4OLEA 4M1CC 4KROD 4NRXB 2F19L 2XA8H 3UPRB 5KJRL 3OHXB 3VW3H 3VMNA 3MLWH 1SYSA 3GBMH 1S78C 4JRXD 1FORH 4MNQE 1BVKB 4MD0A 3MJ8A 3P2TA 4CW1A 2WIIB 1DN0A 4PJAB 5JNYB 3TBVA 1P7KA 1AY1H 5T1MB 4UQ2A 5DQJA 3BKCL 3BIBX 4QHUA 3LKNB 4RFNC 1CIUA 4LSTH 1BEYH 4L4TD 5HYSA 1OSZB 2K3TA 1NANH 3HLAA 4XNXH 2HKFL 3DUSA 1BM3L 4LHQB 5FYJE 3QPQD 4YH6A 1LP9F 3NPZB 3I3BA 3ARBA 1A6ZA 5EOCL 1PZ5A 3MV9A 4KKCD 4YGVB 1HSAB 4PJIA 1T0NA 4X7CC 4PJGE 5J3HD 4P3CH 2QQLL 4UTAL 4A2MA 1IL1B 5GRVL 4HT1H 4WTZG 1GOHA 5ANMB 1L7IL 4QOKD 5CEZE 3VXOB 2DIJA 3U9UA 4GMSH 3O4LE 2W65B 4WO4C 5IM7B 4Z77A 5ITBL 5CCKL 3VA6A 2F8VA 4ODWB 4ELKB 2IAMA 2Z0BA 1YJDH 5E94B 1P5VA 1QRKA 4KK6C 4Y2DA 2A6IA 2CDFB 2NY3D 3S9DB 1T0MB 1PAMA 2NW2A 2XQBH 4M7KH 2ZPKH 4RRPG 2VJXA 4JFXA 4KZEL 5KANG 3CMOH 1FFPB 1FZJB 3Q6GL 3HPJA 4QT5A 3H3KA 2X5PA 5DC9B 5KJRH 2YUVA 5FUOL 1G7JA 1KTRL 4GRWF 3VMPA 3DXAD 1X5LA 5HPOA 5GRXG 3F7VA 1M4KA 3FFCB 2DWEA 2QKIB 3FCTA 5IEKB 3HZYA 3LKPA 5MEOA 3OKKA 3D39B 1YYML 3ZDXE 4D3CL 5AD0A 3AU1B 2FX7L 4KDWA 4B7LA 4N0RA 2FL5B 4ZPVA 2HFGL 1QEWB 3DV6B 4M62L 1NCDH 4P23B 2LE9A 3U7AA 2PW2B 1WT5C 4FQQB 1DE4A 3VXMA 1MH5B 3TA3A 1RQ5A 3HZVB 3MGOA 3KPMA 4TNVK 3MLSH 4FOMA 2HKFH 1BM3H 2HMID 4YAQB 2IBBA 2BRRH 2X4NB 5EOCH 1WBXB 3P4OB 1U92A 1Q9OB 4AEIH 5HHOD 3QPXL 3HR5A 2QQLH 1CFQA 4XAKD 4UTAH 3SKMB 3SDAA 3T4AA 4QXTA 3FQRB 4TVSa 4NQEA 3RDTA 2IADB 1M1SA 1U2HA 2XN9B 5CGYD 3VE0B 5ITBH 1RHFA 5CCKH 3PDGA 4LFHG 3O6FA 2GJ6E 4XBEL 5KAQG 4UT9L 3QEHA 4PUBL 3U9PL 3HN3A 3KXFE 4YX2L 5T1DH 2YPLB 5EZIL 3C5ZC 3ILPB 4Z7WA 2BHUA 2NXZD 3ZE0E 3JTTA 5I8EB 4RMVA 4EEEA 4KZEH 5L9DL 2LU7A 4OF7A 4MJIA 4YXHL 2Y6SD 2ESVB 1N26A 1R6VA 3R0MA 3Q6GH 4K8RC 3MUZ1 2OTUA 3CFDB 4ODXA 1F4AA 4KJQC 3S37L 1HSBB 4XVUC 3GSOA 3UDWC 3QH3A 4P9ML 4G8GE 1IM9A 4PBVC 1YEFL 4PJEA 2DQEL 4ZOBA 2GTWA 4D3CH 1YYMH 3QWRD 1IKFL 4YGAB 2FX7H 4BH8A 5DMYA 2HFGH 5CD5C 1E4XI 3QNZB 4M62H 1QLFB 4YE4L 5F21B 4MNQD 3WD5L 1JF1B 1MCBA 4L3CB 1F42A 2R9HC 5IVZB 5F3BA 3L3OB 1FC1A 2N4IA 2BOBA 4NPYA 3TYFB 4HX1A 2FHBA 2A0LC 3QPXH 4YDKL 3MV9E 3EYOB 4M4RA 5J4MA 1AH1A 4PJIE 4NUJA 4IOFD 3GIVB 2KZWA 3A0OA 3DOSA 1OARL 4MDIB 3QIWC 2APBA 4HIHA 3BN3B 2GIYA 1XF2A 3WFDL 3W0WA 1WIOA 3QZWG 5C9JB 4XBEH 1RU9L 3OKOB 4NKOB 4PUBH 3U9PH 4KHTL 4YX2H 4IRSB 5CEZD 4P5TC 3HUJA 5EZIH 3H0TA 3S8WA 4U1KB 3O4LD 4GW4B 3QCTL 5AUMB 1I1AD 4BZ1H 3GGWA 4PJ9C 3ZE1E 4MNHB 1CDHA 5L9DH 1T1YA 2APVA 4LLAA 5E1HB 4YXHH 2R0KL 1RK0B 5IWLC 3E2HB 1KCSL 2VR9A 4PJGF 3SQBA 1M7IB 4G3YL 4NKDB 4NSKB 3S37H 4UV7L 2QQKL 3TH3T 4OV5B 4XP5L 3VI4F 2ICES 1IKNC 3KJ6L 4D9RE 1GZPA 2WANA 4P9MH 1L9MA 3OKNA 4CVXA 1G7MA 3SDCA 4DJMA 5TE6H 3WHXA 1YEFH 3FT3A 2BRQA 3V6ZB 2DQEH 4E42A 2PW1B 3MRKB 2XA3A 4LLWA 2ARJA 3BKJL 4LVHC 3C60A 5JTWA 3SDXA 4X4XA 5I1CL 2EC8A 5F1SA 2HT3C 3ARGD 3OR6B 1S9YB 4YE4H 5A16B 4K7PH 3WD5H 4AYFA 3VXME 3B3IB 1FNAA 2ZG2A 2JJSC 1X9QA 1PDKA 4OB5L 4AT6B 1TCRA 3VGGA 1HINL 1WCBB 3H9YA 3RPIB 1BQHB 3JWDH 4YDKH 1MFCL 2MTPA 2WUBL 1C08A 1NMBL 1ORQB 1BVLA 2J5LB 4N9GB 4APQC 1Q9LB 1ULVA 2AABL 4P59L 4Q9BA 3ZDXF 4EDWL 3G6JB 1YEJL 1OARH 1E4KA 4R3SA 1WITA 3B9VA 4AIZB 5IQ9B 4NQEE 1TITA 3V7AG 4PY8I 4ZD3L 5H37H 3VGAC 4UINL 1FVEA 3X17A 1DBKL 2ADJA 5ADPL 4UZGA 1MHHB 1HXYB 3LKOB 2NY2C 5IFAH 4N5EC 4CMMA 4AG4H 5EG6C 5FV2A 1PKQB 1Q9KA 3QCTH 4PV8A 3ARYA 3HAEH 4U1JA 4Z7WE 5ITFB 2GJ6D 3GMLB 1FSKB 2D31A 3KXFD 1KPUA 3LQAC 5HHME 5B8CA 3RL2B 4WV1B 4KPHL 1KCSH 2X10A 1A02N 2ZSVA 4G3YH 2GK0A 4UV7H 2QQKH 3IRPX 4XNQB 1QD0A 3LS5L 5ID1A 1NGPL 3BAEL 4PRHB 2NZ9C 3KJ6H 2GUOA 3OPZL 5HVHC 3O4OC 2DKUA 1X5YA 4HBQA 4NC0B 5ID0A 4EN3B 1HOCA 4FTVE 4XPFL 1CT8A 5HGDB 1KEML 4G5ZL 1NEZB 3PQYB 4WJ5B 4PJEE 1MJ8L 2WK2A 3WO4B 3X12A 3LVEA 3DPBA 4LRIA 2CDEB 1I1YB 4RGOL 4G8GD 3ZE0F 5I1CH 3SJVE 5HYJA 1N8ZA 4NZDA 1N59A 3ARDB 3PABB 3HB3C 2PYFB 3BIKB 3RWHA 2E9BA 3D0VB 1HKFA 2KUTA 3VFPA 1A47A 1LO5A 4JFFB 1IC1A 4OB5H 3IFPB 2BC4A 5GS1A 1A6VH 1K4DA 3QUZC 3HRZA 1HINH 1CDIA 2CK2A 2IALB 4U6YA 4JFYB 5DJXB 4D0BA 1MFCH 2WUBH 3DETC 1XGUB 1FPTL 1NMBH 4Z7UB 1YEDA 4JFOA 2AABH 4P59H 2F8XC 3V8CA 5EZJB 1M71B 4EDWH 3P9LA 1YEJH 4CVWA 3ARBD 5I6XB 2FJGB 4Y19B 1EBAA 3D0LA 4KU1A 2AJYL 2PXYD 4ZD3H 3MV9D 1XH3B 2GK2A 3KLAB 4UINH 3SBWC 5C3TA 4QO1A 4X5WB 1DBKH 5ADPH 1NKOA 4HMDA 5DJ0A 3ZHLA 4EXKA 4OZIB 1RZIB 4PS4L 3QI9B 5F8QC 4P2QA 3HUJE 3S37X 4LMQE 1HH9A 5DMKA 4JGUA 5A2JH 1SM3L 3DV4A 4C54A 5JW3L 2BHZA 1CLCA 2B4CC 4OAWA 4AH2B 4KPHH 3N1PC 1ZHLB 2XTJC 4HMCA 3RTQD 4Y2DD 4PJIF 5KW9L 2BVPA 1ZAGA 5EN2B 3VA2C 5I73C 5JW5A 2V2XA 1QRNB 3LS5H 3ZYJA 1NGPH 1T1WA 3BAEH 3LEYL 1H3TA 3O3UN 2ZCKL 3FO1B 3UYRL 3OPZH 4PG2A 5JMOC 5IF0B 3ULVD 4XPFH 5GRVK 3UPRA 1KEMH 4CAGA 4K7PX 2E7LC 4L3AA 1JNLL 1MJ8H 3WLWD 1XCTB 4D9RD 1V5JA 2FBOJ 4RGOH 4U05A 3QIBB 1CVSC 4IJ3B 1D9KC 3SDXE 3HE6B 5E4EC 2C7UB 3GMRB 1B4RA 3UZEA 3ZKXC 2VMFA 2ZG3A 4GRLD 4HHAA 5D72L 5EZOL 3SE9L 1S8DB 2FYYA 3ULVF 2OI9C 4NBXB 3LKNA 3GM0A 4LPTA 4ZS7H 1R3HA 3MROA 4KWUA 2GSGB 5GGSY 4PGJA 1QVOA 2N1KA 1F6FB 2VKWA 4KROC 3WIHA 1CLOL 1OSZA 5F7YC 1H0DA 4U1GC 3WNPA 1DVFD 3VXMD 1NUDA 2ERJB 4MJ6A 3TA3D 5I1LB 1OAYL 2UY7A 1FPTH 1QUNA 1IM3B 5EBWB 1JVKA 4TRPL 4R96A 2P8LB 1I9JL 1IVLA 4YHNB 4YGVA 4PY7B 5ESQB 1DEEB 2AXHA 2AJYH 4MMZC 2BNRB 1NFDA 5F9WB 4EXPX 5ANMA 1ZGLA 5GSVB 1MCQA 4YDVA 1I85A 2E6JA 3SOBL 5EUOB 5IM7A 4LGRB 3BT2L 3SDAD 4DN4L 4NKIH 3QQ3B 4NQED 4Q7DA 5EO1B 3RDTD 1BF8A 3HTLX 3TV3L 1SM3H 4DTGL 3ARFB 5JW3H 2MKLC 3QPQC 1D5ZB 2AAVA 4R4FH 2X9XA 3TT1L 1I3GL 4KKCC 3ZYOA 1MCWM 4OJFL 1SQ2N 5J3HC 4N0FB 2LAAA 4JKKA 1FFPA 1FZJA 2ZCKH 3UYRH 2KPNA 3O2DA 5HHMD 2FIRT 2YC1A 4FQXB 4PJ8B 5F7UA 5HVGB 1JE6A 4JDVB 3DSFL 2CDGA 2NNAA 4XT1C 1JNLH 4IIQC 4U0RC 5DHVB 5FGBC 1CGWA 4XC3L 5HXMA 3VRJB 3FQWB 1R5IA 3FFCA 1T7WA 1UM4H 2QKIA 4Z7OE 4Z7WF 1I8MB 4G8FB 2G75B 2NY3C 3SQOL 3MCLL 3NN8A 4FTVD 5HY9A 5HYJE 3D39A 4ELMA 4Y1AB 2R1WA 5I1AA 5D72H 3QULB 2Y23A 3SE9H 3M17B 1QEWA 2JCCB 1RK1B 3SJVD 1NJ9A 1MH5A 2NLJB 2VZUA 1I4FB 3AS2A 3VXUB 1KYOK 3EIFA 1CLOH 3HZVA 2X1XR 3MFGB 5IKCA 1OAYH 1OGAE 5HGBA 1FGNL 2LVCA 3N9GL 3V0VA 1A14L 3GSXB 4TRPH 4OKVA 4PJEF 3GJFB 4DFHA 4L4VE 5JPNA 1FBIL 2J8HA 4XVTH 4POYA 4KGLA 5EDXA 4ZOAA 3TVMB 4X7FC 5IROC 3SKMA 3GSNA 2A6DA 5FA4B 2ICWI 1UENA 3LAFA 3SOBH 5I0ZA 2XN9A 4K7FA 3BT2H 3QDMA 3VE0A 4DN4H 1X3DA 5EB9A 1BBJA 3ZL4H 4ZFOA 4LHUG 4PGCB 4MQ7B 4P2QE 1HHJB 3L5JA 3FQUB 3NCCB 3FT4B 5D5MB 4DTGH 2HMIC 1MAKA 3MQIA 3TT1H 4KKAC 3Q6FB 1YY8A 5EU7C 1I3GH 3IFLH 3CMGA 2W91A 3NCYS 2X70A 4OQTL 1OP5H 3T4YB 2NMSA 4HCRH 4LARL 5BXFB 4CGTA 1F58H 5E56A 1I8LA 2FATH 3CFDA 4ENED 2OR8A 1F4YH 5IW6B 2GTZA 3BGFC 4PLJD 5CGYC 1A3QA 4GMTL 3ZLQC 5KVFL 2ZJSL 4P5MB 1U41A 1FZMB 1ZS8A 1KB5B 4XC3H 3HUJF 4B41A 5E8NB 5INCA 3GSUA 1YNTB 4HF5L 4OGYL 5C70A 3SQOH 4I0PD 3MCLH 3U0TB 1AHWC 2FEDD 2DQDL 3SDCD 3P0VL 5HI3D 2NXZC 5CZXC 4RDQF 3CAFA 2X2YA 3VD7A 1GSMA 4PJAE 2GITB 1ACYH 3THMH 4FFWD 4YDLB 3VFRB 1BBDH 4XHJD 4RAUA 1UYWH 1LEGA 3PP4H 2BNQB 1I7UB 3FB8B 3S96B 1AGFB 2FJFB 1T7VA 5IJVA 1FGNH 5IT2L 5DEZA 5B39G 4R4BB 3N9GH 3K0WA 5J1AA 4LCCC 4NO5B 3CXHJ 3TYFA 5KSAA 2N56A 3EYOA 1U91A 2CLRA 3SDXF 2I07A 5A1AA 2YMXL 4Y4KB 4MMXC 1NFDE 5I30H 3AXLB 1XZ0B 5ANME 4MDIA 4EUPH 2D7PA 1EA9C 4W4NA 4HLZH 5C9JA 3GB7A 4LAJH 3EOAB 1G9MC 2P4AB 2QQNH 3GZKA 5DVLA 4U1KA 5DA0B 4QRTA 4RAVA 4NO2A 4TNWK 1QBML 2YEZA 3LD8C 4HG4K 4IRJA 3BGMA 2I27N 4MNHA 4OQTH 4X4ZA 1RUKL 3O3EA 5E70A 3UZQA 1RK0A 3UJTL 4LARH 4IOFC 4QGTA 4LLQA 5F7DA 2CIKA 3O11B 4Y88A 4NKDA 3MZTA 3C6LB 1TVBB 2O61B 1DLFL 2SEBA 4QEGA 4KC3B 4GMTH 4Z8FL 3CSYB 5KVDL 2ZJSH 4KY1L 3P40A 1MNUL 4L8SB 2W9LA 4G42A 5DD1H 4XCCL 3BDBA 4ZFGH 4HF5H 4N0UB 4OGYH 1FG2A 2DL2A 3FFCE 4NRYA 3ULUL 3A6BL 2HTLC 2DQDH 2VLLA 3P0VH 3D39E 5IP4A 5EFIB 3WLBB 5DDHA 3D48R 4QWWC 5BRZB 3STLB 5HYJD 4HZAA 4I9WE 4L8BA 4RGMC 2VAAA 3PWPB 3PHOA 3I85A 5IT2H 4V2CB 1ZEAL 1ZT4B 5KSUB 4JKMA 1X5JA 5I71C 2WSKA 3O3AA 3G04B 2ZOKB 1XF5B 1GC1C 2NY5L 4Z7OF 1ORQA 3G5VB 1Q9LA 3KPPB 1NCBL 1OGAD 1P69B 3UZVB 3GO1L 1S9XB 3NZ8B 1T89A 4L4VD 5IQ9A 3N1QC 5BS0B 3O2WL 2XN9E 3GI8H 3QDME 2ENSA 2VUOA 2OL3L 3EJJX 1S9WB 3MJGX 5MHSE 2NY1D 1IC5L 1HXYA 3LKOA 1G6RL 5ECJE 5E00B 1JWSA 3W39B 4ISVA 4ZXBC 1PKQA 3BXNB 3DBXB 3LN4B 2YPLE 1QBMH 3W82A 3MREB 3IJYB 5E8OB 5ITFA 1S9VB 3ZKMD 3D25A 2J12B 4P2QD 4CNIB 3E3QE 1PG7W 4HJ0C 3UJTH 3RL2A 2ESVE 2JB5L 2Q6WB 4K71C 3ABZA 4V1DB 3MUGB 3E8UL 4JO4L 1DLFH 2JB6A 3ROLA 4PRHA 5KVDH 4WI4A 4KY1H 1MNUH 4LSVH 3SDYL 4V2BA 3RRQA 4FQIH 1AD9B 4F9LA 4XCCH 5I9QC 4PJHB 2FGWL 1A7RL 4RMQA 3IYLW 4FQHB 4KKNA 3R8QA 1IE5A 4EN3A 1IAOA 3ULUH 4GG6A 3A6BH 4KRMB 1NEZA 3V5HB 3GBLA 2FWOB 2JIXB 2GHWB 1QR4A 2AV1B 5MEPA 2PCPA 2DQIL 3LQMA 4XP6L 1Q72L 5TF0A 1FLTX 4M6OL 1WBYA 2PYFA 3BIKA 1QSVA 5FO7B 3H3BC 3OKEB 3X14A 2RFXB 3DIFB 2QLVB 4GS7C 3TIEA 3DNKA 1QOKA 3QUKB 3IVKB 1XGUA 1A7OL 2M8XA 3GRWA 3FAWA 4Z7UA 5DWUL 4NQVA 3BQUA 1NCBH 3GO1H 4YHPA 2FJGA 4M4PA 5E7FA 4PJAF 3O2WH 3WN5B 3KLAA 4X0KB 4A6YL 1RAMA 4RZCB 1GGBL 5F89A 2OL3H 3TT3L 5LJYH 4TVPE 1EHLL 1G6RH 4OZIA 1JZ7A 2IH3A 3EJYD 3DYPA 1YN7A 1ED3A 4GO6B 1SY6H 3LDBB 4AK1A 1Z2KA 2Q76B 4XCNB 2R1XB 3OKMA 1X5GA 1FYTB 4AH2A 3DVGB 4AENB 3PWUB 2JB5H 5HGAB 5J12B 3NPSC 3E8UH 5EN2A 5GGRY 3T77B 3ARBC 4JO4H 4X99B 1ES0A 1NFDF 3SCMA 1QBBA 2PXYC 4X98B 4M02A 3SDYH 5CS7A 3P0YL 4ZS6D 4O51B 3IDUA 3QQ9D 1IGJB 2FGWH 1A7RH 5KVMC 2HWZH 4LVOB 5I1JL 4E0RA 4OCNC 3V6FA 5F7EL 1HHGB 1V05A 3IS0X 1OWRM 2XWTA 4PTTA 2C4XA 5MI0C 1FL3A 5H2BB 3I75B 4IMLA 1H15B 4GKSA 4BFEA 3F7PC 4QRPA 3E6FB 3N1MC 1S3KL 1DJSA 2OK0L 2DQIH 3LKSB 3VJ6A 1FL6B 1MY5A 4XP6H 1YPZA 3S97C 1SEQL 1Q72H 2Q3AA 1NKRA 5TQ2L 3LEXA 1X4YA 3FFCD 3RTQC 4Y2DC 4M6OH 4EDXB 5D9SB 4GUPB 4X80L 3CVHB 1SMAA 4YXLL 3D39D 2PR4L 2ED8A 2WINB 4K9EC 1OP5K 4LQ1A 1CFSA 3CFKB 4JHWL 4P23D 4TSAL 1ZLVH 1OB1B 5EU4A 5E9DA 3N1FC 3MSPA 4I9WD 2DQTL 1A7OH 1Q9WB 3KAAA 5DWUH 3PXHA 3MODL 3WLWC 1S7SA 1J0JA 5C6TH 4JM2B 1ZGLP 3LCYA 3MCG1 5GGSB 1J87A 4JZNB 5BZDA 1J0KA 1WC7B 4GRLC 1GGBH 5L2JB 1TQBC 3TT3H 1PEWA 4UDUA 5GSVA 3V5KA 5BVJA 5JPMB 1JYVA 4ZG1A 3DYMA 4BSVA 5EC2B 1QPXA 5I74B 2VB5A 2XN9D 1PKQE 1XR9B 4WTZA 5DJDA 3QDMD 1A8JH 4NN5C 1DVFC 1A7QL 1DQJB 5MHSD 1KIQA 1KC5H 4QXUL 3HE7B 5E8PB 4KJYA 1XGTB 2HVJA 2YPLD 4IMKC 4X6DB 3WNNA 2R4RH 4N0FA 2A6JB 3AB0C 2VLKA 4P46B 4PRHE 3RIFF 4P4KA 4FMKA 2LU4A 2A9NL 1L7TL 3GMNB 4LP4A 5I1JH 4PP2B 4R90L 4RRPA 5F7EH 3SDAC 4BH7B 4JDVA 1WZKA 2A74A 2WP3O 4YHIA 2EYRB 3RDTC 1OP9A 3PQYE 2YSSA 1S3KH 1S7WA 2X4TB 2OK0H 1H3VA 4N5UA 3DGGB 5TQ2H 3BYYA 3Q3GA 3CFEB 4X80H 1F2XK 3MNZB 4YXLH 5IEHB 2EICA 5ETUB 2PR4H 3WIFB 2JCCA 2FJHB 1YZZA 4JFFE 4Z0BH 5LQBL 2ARJQ 3R8BB 1SJHB 3VXUA 2A9ML 1G1YA 1OTUD 4TSAH 4M7ZC 2H8PA 4I0KA 1OAKL 2M1KA 5DFWH 3U0WL 5EORH 2DQTH 3QAZC 4JFZH 4K2UL 1MFEL 2BVQB 4WUUA 3MODH 3RA7L 2EIZA 5BQ7A 4Z7UE 2ZSWA 4X4YA 1CDJA 3TN0B 4KKBD 1UZ8B 4Y19E 1CLYL 2DD8L 5FA4A 3SKOA 4X7EC 4BFIB 5I1DB 4OZIE 2EECA 3UP1A 4GH7B 4ZSOA 5FK9A 1HHJA 3B83A 1KPRA 3S3JA 4ZTOL 3EUUA 3FT4A 5CSBA 1A7QH 5D5MA 3JV6A 4QXUH 5MERA 1MCLA 3WUWG 4IRSD 1RSFA 3Q6FA 1EJOL 4X8JB 3DTXA 4KK9D 5ACZA 2O93L 5D96B 5TDPB 4PGDA 2YR3A 3T4YA 2Y36H 5CHNA 4AL8H 1QRNE 3MV01 1VSCA 2Z4QB 1G7IB 3U46B 2A9NH 1L7TH 5C0DB 5CZKA 1HHHB 4R90H 4ZUVA 1VB9A 3DX8B 2XZQL 3CU1A 4LNRB 5FYLL 1WV7T 4YC2B 1ZHBA 5K9JL 1KB5A 1U8QB 4WDIB 4KXZI 3U6RB 3MXVL 5E8NA 5DJAA 5D2LB 3VDAA 5J6HB 2FCBA 3L95B 3GHBL 3TBWA 1A9EB 1M7DA 1SJEA 5GS0D 2OCFD 2MHAB 2Z31B 2XPGB 3VFRA 4LSQL 5LQBH 3ARSA 4KI5E 1D6EB 2A9MH 3FB8A 4ENEC 4QRRB 3KG5A 1OAKH 3U0WH 4LU5H 5EO9B 4XI5D 3WS3B 3FZUD 3P9WB 5E9DE 3ARVA 3BESR 4K2UH 1MFEH 1TMCB 3VFVB 4WIQA 4R4BA 3RA7H 4X5XA 2AKRA 2HA1A 2DI9A 3LRHA 4I0PC 2H9GB 3PG2A 2FEDC 3SDCC 1CLYH 5B39B 1U95A 4Z0XB 1U8JA 4OCXL 2AJ3A 3H7LA 1JN6B 4Y4KA 1ZHNB 4Q9CA 4FFWC 4XHJC 1S5HA 2BSSA 4UIKH 4Z9KB 1K3ZA 3UJIL 4U6TA 5IHZA 2AJUL 3HFML 4WU7A 1EJOH 4HJJH 3QZWA 1WIUA 1KULA 2DM4A 3MRPA 5D7JA 5IMMB 3NCFB 4X6EA 3WFHB 2C3GA 4WUKH 4XHQA 2X9YA 5C0AB 4ODSL 4UNTA 1MCOL 2YD9A 3C6LA 1S7RA 2P43B 5BV7C 2O61A 4DZ8B 5IBUB 2XZQH 4PP1C 3I02B 5E8DH 3DROA 5FYLH 5IW3A 1Z6JT 1H3PL 1E4KC 3MRMA 4OZFB 1JZ6A 5K9JH 4NQDA 4PRHD 3MXVH 5KSVA 5KN5B 3FB5A 1SEBB 3BPCB 3NGBB 4ZUSB 4EN3D 4U6XB 3GHBH 4NO3B 4QF1B 5EFIA 3DVIA 5FDYA 3PQYD 4Y1AE 1GXEA 5DRWA 5BRZA 4LSQH 5FF6B 3STBA 3MGAA 3STLA 5BW7A 2JCCE 4ZOCA 2DTSA 4ODTL 3SKNA 5FO8B 1T1XA 3VXUE 1YEHL 3ARDD 3MUJA 1JL8A 4R4ND 5C08B 5FYKE 4I48A 5GGTL 3QDGB 5FKPA 2NY7H 4LF3A 4JFFD 1NMAL 4TSCH 1KCLA 1MVUB 3RVXD 3BD3A 3T65B 5DRZA 1TZIB 3CFJB 3KPPA 2R56L 5J56B 1B6DA 3WDHA 3K4ZA 2VLJA 4OCXH 1ZVHA 4XPGL 3S3SA 3BQUD 5FECB 43C9A 4LGSB 4DK6A 5FO9B 4LRIC 3TJHD 3BIAX 5DTFB 4OF0A 5TH2A 4Y19D 3UJIH 4XPAL 1PSKH 4J12A 2AJUH 5D5ME 5E00A 1T80A 5I1HL 3AAZA 3W39A 3HFMH 2AK4B 3BXNA 4MA8L 3TZVB 1R24B 3NH7L 4EIGB 4GG8B 4JB9L 3MREA 3IJYA 5IB4B 3D6GA 4Z7UF 1S9VA 2VN7A 1U8HB 3EFFB 1ZLVK 2DQGL 1CD0A 2OBGA 1FZOB 1IGIL 2VABA 5I18L 4OLYL 4WW2B 1XT5A 2QEJA 1MCOH 4F33A 1ZV5A 3HMXL 3U30C 4FXKB 2CRYA 1HNFA 3KPQB 3TLRA 1QRND 5F1NA 4OZIF 4P2YA 1UZ6E 3SCMD 2NY1C 3PF2A 3NACL 4FQHA 3EOTL 4MQXC 3RI5K 4J8RA 2OXGA 4WEMB 5HGGS 4HIJA 4MJ5B 1ZLWH 1PFCA 2V9TA 5DHYB 3ZKMC 2AV1A 2H32A 3TO4B 1UVQA 5T1KB 4N8PA 3SGJC 1U42A 1KLGA 1ZMYA 1GHFL 1DQLL 4QRPD 3GHEH 3HC0A 3QIBD 4ODTH 1YEHH 4HKXA 3FQNA 4HLJA 3NFNB 3EYVB 2NPLX 1T4KA 5GGTH 3DO7B 5KOVC 2ATPB 3CDGB 4X9BA 1NMAH 5EPMB 3UMTA 2HLFD 1DL7L 4HS8H 4KI5D 4LRNH 4CJ1A 5TGBB 3QUKA 1RUQL 3PGCB 5B38B 5E9DD 3HAEG 4OF5A 5J13B 1YPZF 4XPGH 3V6BR 3INUL 3OWEA 4XH2B 1BD2A 3EW3B 3FT2B 3WN5A 3LSOA 5DK2B 3RWDB 4RZCA 1I3RB 4XPAH 4LCUB 4KI5F 1CDGA 4K3GA 4NWUL 4TPRL 1EAJA 3MBEA 5I1HH 3IGAB 4MA8H 1B88A 3NH7H 1ZT1B 3UTOA 5DFTA 5EIVA 4JB9H 2ZOLB 3LZFL 3VXPB 3QIUA 3FL7A 4NNXA 2ZUTA 4XCNA 5JW4Q 3N06B 2PTTB 3P30L 2F53B 2Q87A 4AENA 4G6FB 1JNHB 1IGIH 4OLYH 1OAQL 3BJ91 3ARFD 1LO4L 1CE1L 1LEIA 4MCZB 3HMXH 1S7QA 1JTPA 2O5YL 1NC4A 3EDDA 1J0HA 3MJ7A 1EEYB 3U36B 3NACH 3F7QA 3EOTH 2IWGA 3BZFB 4I3SL 4F58H 3EJYC 3U1SH 1HHGA 2P24A 3WNLA 4N0UE 5H2BA 5GGRB 1OP3H 4LKXA 1Z5LB 2FH8A 4Q6YA 3D69B 3E6FA 1JPFB 3LKSA 1FL6A 4KQ3L 4KRLB 3QEUB 1GHFH 1Z0MA 4HK0A 5ERWB 1DQLH 1UCTA 3I2CL 5BRZE 2J1KA 1D5IL 4GUPA 3CVHA 1J05A 1IGML 3VFTA 3QWOA 4JFPB 3SDDB 4CVUA 4Y1AD 4NUGL 3I50L 4PRPB 3PWPE 4ZS6C 2Z93A 2HG5B 3FJTA 3DRTA 3KS0J 1OLLA 1DL7H 4WCYL 1OB1A 4EI6B 2A1WL 3QCVL 1KIUA 3VXUD 1GPOL 2LV4A 1KACB 1VPOH 3WKML 1JRHL 2AI0L 2AP2A 4XBPA 4OZGB 3BO8B 4Y5YA 1MHCA 2DQCL 2PO6B 3O9WA 1AR2A 1U3HA 3INUH 2VLJE 2IF7A 3I9GL 5GGSA 2DDQL 1BECA 4NP4L 1XR8A 3H9SB 2HKHL 4DFIA 1MCHA 2EDDA 1WC7A 5L2JA 1E28B 5BS0E 2VXVH 2JCCF 3T1FB 4NWUH 4TPRH 1Q94A 5JPMA 2UWEA 1HHIA 5CEXA 1OQOA 3DI3B 4P23C 1TVHA 3LZFH 3V7AE 3P4NB 2FHFA 4I2XA 3P30H 3QXWA 1XGPA 3U4EB 1LO4H 1CE1H 4LLVB 5AAWA 1J8HB 4X6DA 4LFHD 2O5YH 4MNGB 2A6JA 1BHGA 4WI6A 4P46A 3RHWK 1O0VA 1VFAB 1E0OB 3L3KB 1D3CA 4PJHE 4AMKL 4NWTL 2OTPA 4RFOH 4M3KB 1GRWA 3JTSA 3OG4B 1Z3GL 1V7ML 5D5MF 3WS6A 1XGYL 2R39A 3KPTA 4PGEB 2EKSB 1TCMA 5GGUB 2X4TA 3C09B 4KQ3H 1JMZA 1E6JL 4XP4L 2V2TB 5KAQF 2GT9A 3HRPA 1D5IH 4F7CB 2Z91B 2X4UA 1IGMH 3RWGB 4G6KL 3WNKA 1MLBB 1JK8B 4NUGH 3I50H 2BVOB 3E3QC 3H6JA 4L3EB 3WIFA 1OAZL 4KVCL 4EVNA 4I18A 4WCYH 5IOPB 3RWCB 4F15B 1GPOH 3I6GA 1VERA 4YFEA 3WKMH 2AI0H 1YUHA 4X9FA 4NRZB 5HGHB 2DQCH 1VGEL 1I1FA 1CDYA 3QWQB 4ODUB 3I9GH 1HQ4B 2DDQH 4NP4H 1UZ8A 2HKHH 1KB9J 2XXMB 4PD4K 3L5WB 3VXNB 3JV4B 3A6CH 2YXFA 5CFHA 3MRBA 3DRQA 4BQBA 4XPTL 3PWJA 4Y4KD 2DB8A 2C1OA 1OTUC 1G7QB 5FGCB 1T5WA 1YECL 1JGDB 4ZPTB 4HXAL 1RZJH 2LFGA 2MCG1 4Y4FB 2C3XA 4QXWA 3SGEI 4LHUA 2VDPL 4HS6B 1GVIA 4P57B 4YR6B 5I16A 3BP4A 5EBMA 4KKBC 5D7JD 3SKJL 3T0AA 3LRSB 5DA4A 5I66B 5C0DA 4JO1L 4AMKH 3L3GA 4NWTH 3DX8A 5EZLB 4WW1B 4POUB 1Z3GH 4NHCL 3C6LD 1EO5A 1XGYH 3RWJB 3JVGC 3U6RA 5KTEL 5INDA 4PJBB 4W6XB 5D2LA 5JQHC 1E6JH 4YHKL 4OM0H 4XP4H 4IRSC 4KK9C 4H5SA 1AO7B 4HAFA 4IHOB 2WV3A 4HV8B 1A9EA 4G6KH 3BSZL 2Z31A 1U93A 3KHQA 1MIEL 2LABA 4F8TA 4ZUWB 4NGHL 3GUTA 1AE6L 1OAZH 4LK4A 1U8PA 4LCYA 1D6EA 2Y5EA 3Q2CA 1HIML 4H8WC 1WWWX 3L7EA 4KVCH 3E2HC 5BRZD 5DF0A 5EO9A 2XWBB 4HKZB 2P46B 3VFVA 3C5JB 5DJ6B 3PWPD 2EH8L 1ERNA 4UDTB 5CP7A 1VGEH 1FCCA 1XGQA 1WBZA 3PHQB 1AGBA 5EULV 1T20A 4W4OC 2E7HA 3OL2A 5B39A 4JPIB 2X44D 1JN6A 2J4WL 3RWEA 5GS0C 1ZHNA 1ZLWK 1SYVA 3TCLB 2EDOA 4XPTH 2FSEB 2VLJD 3LB6D 3OJMB 4RMSA 2YZ1A 1UG9A 1QBAA 4PR5A 4XI5C 3P9MB 4XX1G 1YECH 1CL7I 3FZUC 3IDJB 4HXAH 3T2PA 4L8CB 2BXZA 1BFOB 4I2XE 5TFSL 1MHEB 2IFGA 3BX7C 2VDPH 5I2IA 1Y0LB 1G9NL 1AFVH 4LSDA 5IB3A 4X6DE 5C0AA 1FL5A 1LE5A 5C6WH 4WHTB 2J5LC 4JO1H 1A7NL 3OJVC 1T7XA 4ORZC 2DI7A 2YOCA 3I02A 4ZUTB 4NHCH 3FO0L 4KUCD 5E6YA 1LEKB 2IBZY 1MCFA 1A6TB 1T89C 4XXDA 5KTEH 4XXCA 1DUYB 5L8KB 5KN5A 1P7QB 3OX8B 5HI5D 1J7VR 5HDBE 4NDMB 4YHKH 2F74B 5C0JB 4K3DL 5I1GL 1QR1A 1MY7A 2IANB 4LEOB 4QF1A 5KZCB 1BFSA 1KENL 2JIXD 2X4OB 3BSZH 2B2XL 3QDAA 4MB5A 3O6KL 1MIEH 3HG1B 1FSKC 4KUCF 4NGHH 5DD6A 1AE6H 5L7XH 1HIMH 1CFVL 4WV1C 4BZYA 5LBSL 4HJGB 2CLVA 5HJ3A 1FJ1A 1RZGA 3ZDYE 1FAKT 4KAQH 4DKAA 3MO1B 4PJHF 3QDGA 3WEXA 1WFNA 2ITDB 4HXBL 3PIQA 1MCWW 3B2UD 1UJ3A 1MREH 2WBJB 3BRGC 1MVUA 2BY0A 4F9LC 1IMHC 2J6EL 3CX5J 3WJLA 2VL5A 2B1AL 3VWKB 2K1MA 5JDSB 4EN3C 5HHNA 4GJTB 4NZTL 4O2CB 35C8L 5C1MB 5GIRB 2J4WH 1MI5B 4TUJA 3WO4C 1T03H 5CIPA 1OP3K 3WE6B 5KVGH 1R3JA 3RY6C 4GBXB 5FO9A 4K94C 5JOPE 2FNBA 4JFEA 1A6PA 3MRFB 5D8JL 1FO0A 2DLTA 3MLTA 4TTDD 3ARDC 4R4NC 3TC9A 3GSRB 1LO2L 1NAKL 1Q0YH 2VXQH 1R24A 1A6AB 4HWZA 4KRPB 5IB4A 4QYOA 4GW5A 2X4RA 1FFOB 1G9NH 2EIBA 3RVXC 1EMTL 4Y5VA 1NUFA 5C0ND 2XWJB 4J3SA 3EFFA 1UH3A 1X5ZA 1XIWB 3WMSA 1ZTXL 1A7NH 2BCKB 3ILQD 3FTGB 1NFKA 2HRPL 2P7TA 3TJHC 3FO0H 5I6XC 2RGSA 2YWYA 3OKDA 4PV9B 2Q86B 1IEBA 1V7NL 2Z8VC 4HQQL 4URTB 2N7AA 4R7NA 4K3DH 5D2LE 2HTKD 2DM3A 4JAMB 5D1ZA 4YDJB 1KENH 3G5ZA 5EUKB 3MUY1 5T1KA 2B2XH 1F97A 3IDMB 3O6KH 1UH4A 5HBBA 3GMMB 3HC4L 4CADB 4U1HA 4ORGA 2YUZA 4NBZB 2VXSL 5EU3B 5LBSH 3B6SA 3E6HB 3EYVA 3OXSA 2EXWC 1NLDL 2VDLL 3V2AR 3VXRB 4HXBH 3MRRA 3SCMC 3AY4C 4XBGB 2J6EH 2UZYB 5FM8A 3O0RH 5EIIB 3PGCA 2B1AH 4F9PA 4NZTH 5ALCL 35C8H 1G9EA 5I17B 4U1MA 4YHZL 3BH8B 3ULVL 3OAYK 4NCC2 2EO9A 3QIBC 5A43C 3RWDA 2VC2L 4JM2D 3HE6C 1WGOA 5D8JH 1I3RA 3CPLA 2NX5B 1C8PA 4LCUA 5BOPA 4FRWA 5JOFB 1WFUA 1YNKL 1E27B 1LO2H 3PXJA 5JXAL 4U1NB 1RZKC 5DI8B 3L1OL 1ZT1A 4NM8L 3FHAA 2HLFC 2ZOLA 4KI5C 4U1IB 4J3XA 1EMTH 2AW2A 2QSTA 3OXRB 3CGTA 4WEUD 5C0CB 2NY0B 3ES6B 4HS3B 1YY9D 2ERJC 1S7XA 4JM2F 5C0AE 1ZTXH 5SWZA 1QSEB 4MCZA 3HE7D 2VDKL 4JFDB 3TO2B 4DKFL 5ADOL 5IVXA 2HRPH 1A6WL 4NN6B 3LHPL 4NFDA 2LVEA 1MCSA 1EFQA 3U36A 2XNAA 3ZYIA 5FOBB 4P46D 5F9WC 1V7NH 4HQQH 2W0FB 4PJFB 5GGRA 1QPPA 2BVEA 2R8SL 1CICB 1Z5LA 5GS2H 3D69A 1JPFA 1EJ6A 1CF8L 1LE9B 1IZKA 4UQ3B 3HC4H 3T3PE 3ARFC 4WO4A 4X6DF 2VXSH 3RIAF 4JFPA 3MLVH 3ZT5A 4U6HB 3ZKSD 5C08E 3PV6B 3QDGE 4JM4L 3BZ4B 2ZCLL 4F7MB 2BSTA 2EKJA 4FQXC 4F80A 5IB2A 4PJ8C 3V5DA 1X5KA 1F02I 4OGXL 5HDBF 1IAKB 1RULL 1N3NB 2VZSA 4EKXA 3MA7B 4YHZH 4U4BA 3MRGA 3ULVH 1VADB 3VRIA 3G5YB 2VC2H 3NA4A 1E28A 3R06B 2FECI 5J6GB 3PL6B 1EGJL 4M7LL 3QDJB 4QRQA 4UTBL 5CINL 5JXAH 2P47B 4L8DA 3ZDYF 3IDYB 3L1OH 1OWWA 5DS8A 1N64H 1V3KA 4NM8H 5JOPD 1N7ML 3OSKA 5E2TL 5CSGA 4AQ1B 1JPSH 5C0EA 3P4NA 1OHQA 3SO5A 1SHMA 4IOIA 3QXDB 3L3DB 4PREB 1WT5A 4KK8D 1CGUA 4DKFH 1J8HA 2VDKH 3HS0A 5ADOH 3LHPH 4C58B 2R2EA 1VFAA 3C8DA 4DKEL 2VISA 1TXKA 2V9RA 4NNYB 2R8SH 4NHUB 1D5XB 4PGEA 4P4RA 2EKSA 5GGUA 1CF8H 3BRDA 3S7GA 1D5BB 1ZT7A 3NOIA 4E41A 1J1XL 2JJTA 3B9AA 2I26N 3RWGA 2G60H 1K85A 1YN6B 1DCLA 3BWUC 3S98A 4Z78B 1KXQE 5CZVL 5DGRA 4ONGL 1LGVA 2FIKB 3FO2A 1IGTB 2Z31D 4JM4H 2ZCLH 5IOPA 3RWCA 3MUHL 3MMEB 4JCMA 2K7PA 5C0BA 1NAMA 4OGXH 5IBTL 5CJ8A 1RULH 3BISA 5D2LF 5L88L 4HGWB 5C07B 2HLAA 4Z7VB 2DQFB 3L5WA 3VXNA 3DJ9A 1CYGA 3BKYL 5DJZB 1EGJH 4UTBH 3UDWA 1VGKA 4XVSL 1S7UA 2YK1L 4LDEB 4FZEH 4Y2OA 5DVKA 3AS1A 4NQSB 4OQ1A 4YDLC 5E2TH 2ID5A 3IXAB 3VFWB 3TBYB 1NCTA 5T3XE 2F53E 1JZ8A 5DEFA 3RNQB 4EI5B 4B50A 4P57A 3B9KB 1HYRC 1EEQA 1HHKB 3WUWA 4H1LG 4QGYA 5HHQA 1T5XB 4PRIA 4DKEH 1ZSDB 1P7HL 5D93B 1MUJA 5C0AD 4JY5L 4OI9A 4LLYA 4Y4KC 4ZO9A 5MENB 3HCVA 2ILLA 4Z7QE 5FYJU 1HQRB 4Q2ZB 5IGXL 3GMQB 5E5MB 4ODVH 3KLSA 1J1XH 3GI9L 4D9LL 1AKJA 4BM7A 3QIWA 2P5WB 4KTDL 4OFIA 4BK4A 1WZLA 1W8OA 5CZVH 3IFOB 4FFZL 5D7JC 3BP7B 4ONGH 4ZUWA 4CU8A 4PRPE 3OB8A 4LIQH 4JDTL 1V8HA 4P5TA 4Y4HB 4HPYL 4OCLC 1JPST 1MIML 3V4UL 3QG6B 4C4KT 3NTCH 3ELAT 1LWRA 2XWBA 4MYWB 3C6LC 5DJ6A 5IBTH 3T0XA 4P48A 2AQ1A 4PJ9A 1U8MB 4IS6B 2DLGA 4UDTA 4PJDA 3C6SB 5C08D 3IKKA 4PRBA 1U8OB 4HUWB 3K74B 4L8SC 4OZGE 1RD6A 3QDGD 5L88H 5IWLA 1HH6B 1S9KC 3S5LG 1CG9B 2KH2B 4ONFL 2UVFA 3H9SE 1BREA 2ADIB 1NCCL 3BKYH 3UTSA 4AIXA 4QRUB 1DDHA 1G7HB 1X5FA 3DVNA 4XVSH 4LKCA 2YK1H 2DMCA 3O3BA 4LP5A 1K2DA 3N85L 4G6AD 1JHKL 5AYUL 4G9DA 5B3JE 5MEQA 5BW7C 5D1QB 2I5YH 3IDJA 3U83A 5C71A 1DTUA 4L8CA 1BFOA 1FZKA 2E9WA 3A6OA 2IMMA 3EDEA 1Y0LA 2BOCB 1HXMA 2EDBA 2CKBH 2VQ1B 3MOAL 3NFPA 3TZVD 3WJJC 4G8EA 4HIEA 4FMFA 1J8HE 2BXYA 4MNGE 2Q7YA 3MLRL 4JY5H 1G7PA 3NMEA 1F3JA 5HDOA 3ETBF 3LY6A 3SGDH 2VDNH 5F9OL 3FOMB 3Q5TA 2FEEI 4FQ2L 1A3RL 3F58L 5EBLA 5SWSB 4Y89A 4TNVF 3KPLB 3QHTC 1F6AA 1I8KB 3GI9H 1RV6X 3S35X 4D9LH 4E41E 2F8OA 4UBDC 1XFPA 4BSWB 2PNDA 4KTDH 4NC2B 4NNPL 1PG7L 4O58L 5JQ6L 4U2ZA 4FFZH 4G9FB 3T8XB 4XGZB 5I1EL 3TO4D 5T1KD 1NGWB 4L3EE 4JDTH 5IK3B 4HPYH 2F9BT 1I7ZB 4XRCA 1K8IB 1MIMH 4HJGA 5E1AB 1CFTA 3V4UH 2NTFB 3LIZH 2VQUA 5DJYB 2ITDA 4AEEA 1K5NB 5FIEA 3UXFA 3B43A 4IDJH 5HI5C 2VXUH 5I1IL 1MFDH 4J3TA 4EUPB 2FHCA 2OR9L 2WWKT 2HJLB 1C5DB 5GIRA 1NCCH 1MLCB 3WFEL 4ZODA 2RB8A 4TSBL 2IBGA 4ETQB 4PRAB 4RQQA 4X7TB 1F13A 2BY2A 5TE4L 1BIIB 2ICEB 3MRFA 1D7FA 4ZDHA 1JHKH 5AYUH 3ZDZE 3BHBB 1YC7A 1JJUA 5FGCE 1J12A 4JEGB 3B2UC 1A6AA 3QRGL 5FKAB 3MOAH 2VR4A 1TNNA 3J7HA 5EOTA 1UM6L 1FVCA 3CFCL 1XIWA 1CXLA 5T3XD 2F53D 3MLRH 2BCKA 5TDOB 5DJCB 4G6FD 2EDKA 1AIFA 3FTGA 3JWOL 3K81A 4PRIE 4P2RB 3QUZA 1TTFA 1J1PH 2XOTA 3WIHL 1P2CB 5F9OH 4H88L 4FQ2H 1A3RH 3QUYB 4Q0XL 3F58H 4PV9A 4TTDC 3STZA 3BP6B 2GFBB 3QA3A 3WN5C 4BJLA 3PNWB 1K4CA 1Y18B 4PJBE 1N5YL 1NBZB 2X40A 3NCEB 4HIIB 1RIUL 4MZ2A 1W8NA 4HEME 1SJXA 4YIQB 1L0QA 2Y7QB 4YDJA 1A1NB 3ESUF 2V7HA 2BVTA 1AO7E 4NNPH 1PG7H 3LDBC 4O58H 5JQ6H 3IDMA 1FNEA 5E99L 4J2XA 1KV3A 4I1NB 5I1EH 2ADGB 3IT8D 5IVXF 1VKXB 4X6FB 2X7LA 4ZTPL 3QXAB 3C5SB 4X6CA 1FDLL 2QSVA 5J12C 4D0CB 4LLMA 4QY8B 3BD5A 3U0PA 3SDDD 4DVBB 2W0PA 4PRPD 5SV4A 1JWMB 4PJDE 5I1IH 3UYOD 5EIIA 4LVOC 2HTKC 2JK5B 2B5IB 3RX7A 5GGQH 2NY6B 1QFWI 3QEQA 3UTTB 3WFEH 5I17A 4NCDA 4TSBH 4OUUB 3UTSE 4F2MB 1NGYB 1HZHL 1U58B 3O2DL 2Z92B 3O3DA 1EV2E 5TE4H 3MA9L 2HJKA 5IMOB 3BD4A 2JLLA 4NJAH 3HAEA 2E7LA 5JOFA 3T2NH 4XCEA 1MCPL 1UFUA 1QHOA 3T0EB 2EDWA 5IV2B 5FGSA 3QRGH 1BWWA 1JYXA 4U1IA 5L6YL 3OXRA 5C0CA 4OZGF 2DRUA 1UM6H 2FZ3B 3CFCH 1RJCA 2BY1A 2IPKB 5J1SC 2XKNB 4J4PC 4JFQB 5FUCC 43CAA 5F3HB 3JWOH 3CK0L 3LEVL 2BSED 4P3WA 4Y5YC 4MCYB 2NW3A 2V2WA 3WIHH 4H88H 4JM2C 1J8HD 1G0DA 4Q0XH 1XCQB 1TIUA 3PWLB 4C83B 1U36A 1MCKA 2J8UB 5B3JF 1N5YH 5D7LA 4N1CA 2W0FA 3EDJA 1XF3B 1RIUH 5TF1L 2EYTA 3TEUA 1LP9A 2ATKB 5I74C 3RKPA 3MRCB 2IANE 3QP3A 3D18A 1UKSA 1FVDA 3GSNL 1YY9C 1JZ5A 3V0AC 3HG1E 3FONB 5DUPL 4ZTPH 3HE7C 4E41D 4R7DB 1FDLH 3VXQB 1IQDA 1AD0B 2X4SA 5CBAB 4ZFOL 1ZA3B 1LQSR 3B5TA 4PJCB 1IAIL 3PV6A 3VWJA 4GAYB 4G8IB 1B9ZA 2BMKA 4L3ED 4P46C 1N0XL 1R3LB 9CGTA 4WHYH 1X5IA 1JF5A 5KG9A 1N3NA 2YA1A 3TJEH 2OL3B 1MI5E 1G6RB 1HZHH 1VADA 3TBTB 3O2DH 1BWMA 3G5YA 5H35B 3MA9H 5F1KC 5HYQA 4HUXB 2OM5A 3R06A 4IIQA 3KYOA 5J6GA 4KJQD 2OSLA 1ZK9A 2A83B 3O45A 3VGEA 1KNOA 1MCPH 1Q38A 3R0NA 3DI2B 5DD5L 3KLHD 1I8IB 3HPLA 4F7PA 1V3LA 3ECBB 4O00A 1UA6L 4OZ4B 5SX4H 5L6YH 4RMRA 1JUFB 3KPSB 1A6UL 4PREA 3KVQA 2AQ2A 4JRYB 3W5NA 2YRLA 5F7NC 4Y5XB 4LSUL 3CK0H 1ZA6A 2BY3A 1BX2A 2Q3ZA 3NCYP 3P4MB 4PB0L 4JZJB 2NYYD 3UEZA 1PY9A 2OR7A 5SWQA 1SVCP 4H26A 4NNYA 3ZDZF 4PRID 4M8QA 2G5BA 1D5XA 4XZUA 5TPWL 2BFVL 3CH1A 3AREB 1D5BA 5IROA 2A0LD 1R5WB 5C0IB 3BZEB 3GSNH 2E9JA 3QUML 5E8EB 1MRCL 1U8NB 1AKJD 1YN6A 2ZUSA 1AO7D 5D96C 1S7VB 3QJHA 3L9RB 1IAIH 2FIKA 3VXRE 4YBLB 1N0XH 3NABL 4XVJL 5JUEL 3IU3B 3CXHK 3MMEA 4Y0GA 4G80A 2H26A 3KYNA 4OD3L 5HHOA 4PJBF 1CD1B 1NL0L 4MLSA 3MYJB 4QHNA 3RGVB 4A6YB 4M61B 4WWID 1I7RB 4OV6F 3U82B 4YC2C 4ZNCD 2X09A 4Z5RA 2W1NA 4PG9B 4HFUL 1GIGL 5ALBL 2VZ3A 4UNUA 3U4BL 4MAYB 1EEZB 2NX5E 5J7CC 2D0FA 1WK0A 4QHKJ 4Z76B 3UTSD 4Q6IB 2Z35B 4GRMA 1HWGB 1UA6H 2Z31C 4NQSA 5J06A 1E4JA 1VDGA 4KMTL 4UOJA 1AHWA 4FFVD 2AVGA 1QACA 5F7KC 1VCAA 1A6UH 3BUYB 1N2RA 3VFWA 2WLZA 4PJDF 5C0CE 1MJJB 3TBYA 5C2BL 2IC2A 5CWSA 3GDBA 1DQQB 4YPJA 4EI5A 1GOGA 1JWUB 1L4IA 5BVPH 4LSUH 1QSEE 3BGAA 4JFDE 2BSRA 5JO5B 2CMRL 4PB0H 2DF3A 3G6DL 3IJSB 1KTDB 2QQQA 5GZOC 2Y06L 2AJSL 2WBKA 5F96L 4MDJB 3GSQB 4CVZA 3B4NA 1G7LB 3KPRA 2R29L 4PJFE 1W0VA 3NCMA 2BFVH 1UQSB 4OCMC 4Q2ZA 5IR1A 5HHPA 3LN5A 1FRGL 5KSBB 2C3VB 2Q7NA 3QUMH 1UH2A 1P7QD 1ODAA 4NT6A 4OI8A 1K3IA 2CUHA 2OJZL 2BDNL 3LPFA 1TFHA 2IG2L 1MRCH 4MNQA 4XNMA 4Q97A 3BN9D 1ZWIB 5E2WL 5KZCD 5F93C 2VOTA 4EOWL 4Y4HA 5T5FL 3NAAL 3HG1D 4YO0B 4XVJH 3CD4A 5JUEH 4TUOB 1D5MA 5JW4M 2NY2D 4OD3H 4N5ED 5F7WC 1UWGH 1NL0H 4QRSB 4S10A 1KLUB 3C6SA 4GW1B 4O2EB 3K1KC 1O7SA 1Z0NA 4HUWA 1B0GB 1OTSC 4QCIB 4YNYB 4HUUA 4MVBD 3IJHA 1G84A 3AMKA 5LWYL 1ORSB 2ZUWA 2WBJD 5C0FB 1GAFL 5DC0A 3U2SA 4KV5E 3VWKD 1NC2A 3NGBC 1B90A 2WMPA 4OCWL 3QDJE 4W6WB 1A4KA 2IQAB 3BEWB 1QA9B 4GBXD 5DJ8B 4OZHB 5DVNA 4KMTH 3VXSB 1QLEL 4C56B 1P4IL 5F6IB 4FABL 4HCRA 5C2BH 3TIDB 4FQLL 4L4JA 1S5IL 5L0QB 1FCGA 2OP4L 4JCLA 3TH4T 4D0DA 3KPNB 3F12B 3KYMA 4PJXB 4XTRD 4G7YL 4KRPD 3ARWA 5JW4N 1MPAL 5F9DC 4G6ML 2CMRH 5IMLB 2AGJL 3G6DH 1DBBH 5CMAA 1XIWD 2Y06H 2AJSH 5F96H 2FLRT 3EKCA 1T66D 3MRLB 3ZZ1A 4G6AC 1WISA 2R29H 3GRWL 2P8MA 1NBYB 3ROOB 1KTLB 3KPLA 1FRGH 1JHTA 3DETD 5D7KE 5EO0B 1E6OL 3RZCB 3W2DL 3IDNA 1KJVB 4F3FB 3TZVC 2IG2H 4JJ5B 2GSIB 3V52H 1U8KB 2JJUA 1OW0C 3PDOB 3BPOC 5JLZB 4YDIL 1P1ZB 5E2WH 3OAUL 4X9IA 3IXTB 4Y5VC 2AXFB 4EOWH 1A1MA 1FAIH 3NAAH 5IK3A 1I7ZA 3F5WA 3WL9B 4ZXBA 5DFVC 5E1AA 1QQDA 4WW2C 2VE6B 5DR5L 2EYSB 3IAQA 5T5NG 3CZFB 3WFCL 4TTGA 3DARA 1KXVC 1SJVA 1PYWB 5HYIA 3VXRD 4HK3J 1YEIL 3VH8B 5C7XL 5C07E 4Z7VE 1BQUA 2XQYK 2HJLA 1C5DA 1GAFH 4GFTB 4Y7MA 2WWMD 4DZBA 1INQA 3REWB 4KI1A 4OCWH 3MRQB 4ETQA 3QEQD 2VITA 4H0IA 4HWBA 1QFPA 3TO4C 5IIEA 4X6CF 2ICEA 5EU6A 5E24E 3ZKQD 4Q9QL 1P4IH 1EUTA 4ZO6A 4FABH 1RUAL 2NX5D 5DYOA 2NXYB 2OQJA 3CFBB 3LN9A 4FQLH 1UT9A 4HWEL 3VFSA 4QHMB 5KBNC 3VFOA 1BJ8A 2YD4A 5FKAA 2OP4H 1JNNL 3RUGB 2FH6A 4G7YH 3FB7B 1MPAH 4G6MH 3MCKA 5C0CD 3OMZA 1U3ZA 1WICA 2AGJH 4RNRA 1RZKL 2NY0D 5A3ID 1NCWL 4LCWB 1KJMB 1DUZB 1AQDA 1TENA 1QSED 2VDQL 2AV7B 4JFDD 2A6KA 3QUYA 2M2DA 2GFBA 3KPRE 3GRWH 3PNWA 1RHHB 3G08B 1CBVL 1TETH 4G43B 1E6OH 4G8GA 3W2DH 3KYKL 1VACA 1C12A 2Q20A 1BGXL 1A1NA 5D7LD 2R23B 4HZLA 2WNGA 4QKXB 2P5WE 5IHBA 1OL0A 3MRHA 4RMWA 5IB1A 2AJXH 1CICD 4YDIH 3OAUH 1IARB 3HI1B 5DUBA 3PGDB 1VFBB 3QXAA 4R0LB 1V3MA 1NDGA 3R4DA 2Z8RA 1OSPL 4JN2A 1HEZB 4RBPK 4QY8A 3FFDA 2X4PA 3OF6A 1BJMA 1T2QL 2R2BA 1YEIH 4MXVE 4PJFF 3Q0HA 4YXKL 3VWJD 5C7XH 3ALXA 2C1PB 2JK5A 1KG0B 4JLRB 3TNMA 4OUOA 4TNWF 2PYEB 5DRXB 2PXYA 4NKMB 1IGFL 1C5CL 3CLEL 4OUUA 4P9HC 4UUJB 1K8DB 3RX8A 3M8OL 1VA9A 3EJZD 5BO1L 4J7RA 3V8OA 2AEWA 4Q9QH 4MXWL 1ZE3C 3RIFK 4JDZA 4X6BA 5I8KL 1UXWA 3PL6D 3SDDC 3QDJD 4D9QE 5DSCB 1RZ8A 3RTQA 4HFWB 4OFYD 1JNNH 4J23A 5GRZA 1QSFB 4HBCL 1CFBA 5JIIA 2AK1L 4XX1E 3L3HB 1W72A 1M05A 3DURB 2NZIA 1ETZB 1NCWH 1OAXH 3VCLA 4KV5F 1KN4L 4MCYA 2VDQH 1R5VA 2VR5A 4GKZA 3HNVL 3B9EA 4BQCA 4ZOEA 5JA8B 5ICYB 1VENA 4QTHB 3DMMB 3GMPB 2F19H 2NR6D 3QNXB 5SWSE 1T04A 5IFHL 3KYKH 3NZHL 3KDMB 3EAKA 1BGXH 3W9DB 2ATKA 3MNWA 3W9EA 3I3DA 4GRLA 3GNML 3QO1B 1FNGB 4TUKL 5D7KD 4G9FE 5FCUL 1MQKL 3CDCA 3B9DA 2A77L 2W38A 4R7DA 3BKCH 1FV1B 5GSRB 3P73A 4PJCA 1DVFA 3D85B 2R2HB 1EXUA 1N4XL 2CLZB 3CCHB 3OKLA 4G8IA 2ED9A 4NQXA 1T2QH 1XGRA 1R3LA 4IMKA 2EDFA 4KKAD 4N0CD 1IGFH 1C5CH 3CLEH 2FO4B 2NQCA 3M8OH 2I9LB 4M00A 3BDXA 3C09C 5C07D 1W0WB 1SY6A 5BO1H 1L7IH 4HUXA 3T0WA 2GJZA 5EU6E 2JJTC 4N8VG 2VSCA 1MFNA 3AM8C 1UB5A 1KB5L 1I8IA 3R1GL 4PGZA 1PLGL 1PEZA 1WWBX 5C3LD 1OVZA 4O2FB 2AK1H 3PE9A 5ESVB 4F15C 5CZXD 4Z7VF 2XTJB 4XNUL 4Y5XA 3S3PA 4EI5D 4P2RE 2VKXA 4DKDC 1UXSA 3B9KD 3HNVH 2HFEA 3SE4C 2DJSA 2F5AL 3F65A 2RJMA 4P2OB 3LKQA 4X7SL 5FUOH 5BZWA 2YRPA 3KLHC 4YEEA 1YJDC 5J9PA 2CPCA 1CD9B 2XACC 5IFHH 3NZHH 4HPOL 4J6RL 1DZBA 4FTVA 1CE6B 3X13B 3QHZL 2I9TA 3MLUL 1BZ7A 3AREA 4Y8DC 3GNMH 3KPRD 3BZEA 1D9KB 2YD2A 4TUKH 5FCUH 1MQKH 5E8EA 3OJDA 2A77H 2DBLL 3SJVA 1FLRL 4XC1L 3ZKXB 2XICA 2P1YA 4KH2A 4WU5A 2P5WD 1UB6A 5LXGL 1H5BB 1IGYB 1G0XA 5CD3A 3IETB 1N4XH 4FP8L 4Y16A 2C3WA 4ONHB 2NYYC 1QTYT 4JY6B 1U3JA 3ARTA 4R8WL 4Y4HD 1TJHL 4ZUUA 3MYJA 4KQ4L 1NCAL 3GM8A 5I15L 2BNUB 4BKLB 2H3NB 1ZVSA 3UTTE 32C2A 3VFUB 4JRXB 4OCYL 5AEAA 1U8LB 3UTQB 3HZKB 5F9JB 4AQOA 5FYJD 3D5OF 3QUXB 4WI2A 3HZMB 3MRJA 4MAYA 5C86A 1MCJA 1T22A 4DN3L 1Q8MA 3MRIB 3M1BB 2ICWA 3R1GH 5CSZA 4HKBB 1NC2D 2ZKHL 4D8PA 1ZVYA 4UT9H 3T0EE 1KJ2A 3G6AB 4MA3B 1CU4L 3BUYA 4H0HB 3UC0L 5DK0B 1MJJA 4MXVF 2HTLD 5D1QD 2DWDA 1DQQA 1JWUA 1HDMB 1KTKE 4D9QD 2DKMA 4QWWD 4U1LB 3ULUE 4LBEA 4HKJA 1DBJL 2F5AH 3IJSA 4QOKB 1J5OL 2WQRA 3CUPA 1ZHKA 4X7SH 2G9HB 4MDJA 3TM6A 1TZHB 4P5KA 3BDYL 2J8UE 4HPOH 5EU5A 4J3UA 3QO0B 3VFMB 4I0PA 3TCXA 4H1LA 4J6RH 3T3ME 4FFVC 3QHZH 3G5XA 5ENWB 3V0WL 3MLUH 3UYPA 1TVDA 4MD5A 1IKFH 5SWSD 5HD8C 1BLNA 2DBLH 4XB7A 1FLRH 1NGXA 4XC1H 2AXGB 2J2ZA 4RA3A 4JQVA 5H94B 5F7LB 4UIMB 5LXGH 5D4QA 4FP8H 2CXGA 4PJCE 1A4JA 1FN4B 4G9FD 4XCFL 4F7TA 4QTIL 5K93A 3TFKD 4I4WB 1C16A 4R8WH 5I75B 1TJHH 1U8IA 3U48A 4JY4A 2ZNXA 3KPOB 4ZXBD 4QRSA 4W70A 5GZND 4KQ4H 1KLUA 5I15H 2OTWB 3OG6B 1B0GA 4QCIA 3GFUA 4NYLB 2P48B 3FB6A 1BQLL 1CCZA 4OCYH 8FABB 2GKIA 4HJ0D 2GY7B 3EGSA 5C0FA 4CDGC 4FN0A 1XEDA 3FOLA 4DN3H 4L9LB 1YA5A 1I75A 3S5LA 1LK2A 3BN9C 2DS4A 4X5LA 3WFDH 4NO0B 2ZKHH 1RU9H 1BZ9B 3BEWA 4HUVB 4KHTH 3BP5B 5DMGD 3UC0H 4EQ2A 5EU6D 1Y6NR 3KPSE 3VFNA 4WGWB 3TIDA 5E6IB 1AP2B 3FQTA 4GKNA 2ZUQB 2V5TA 4MVBC 4PY8J 3KPNA 1D6VL 2YUXA 2R0KH 2WBJC 3V4PL 4I0CC 5HVFB 1DBJH 4HSQA 2XFXB 3VWKC 5LGJA 1T1ZB 5DEGB 1KCRL 1A7PL 4XP5H 5BJTA 5GS3A 4GBXC 4P2RD 3GSVA 1Z9MA 3TPKA 1AXSA 1YMHA 3MRNB 3V0WH 4JFHE 2QR0B 4YPGB 5ILTL 1EO8L 3QUYD 3TYGL 1FH5L 1KIPA 3TPUA 1OGTB 3BKJH 1YMMA 4R9HA 3DUHA 4OBSA 3HI6L 5D2NB 1YDPA 3AS3A 2GSIA 4XTRC 4KRPC 1CFNA 1RJLB 5CBEA 4F7EA 1QLRA 3IXTA 2A38A 2DOCA 5F1IA 4WFFE 5CJXA 4WGVB 4KK5D 1XIWC 3DX7A 4QTIH 5IFJB 3IKCA 1T66C 1MJ7L 3CZFA 1T6VN 3MNVB 1W2KT 3CIQA 2G2RB 4W6YB 4AEHL 1OGAA 2UVEA 4LCCB 5ESAB 3VXTA 2GJJA 1WJ3A 1BQLH 1OF2A 2QSCL 3OF6D 4L4VA 3EO9L 4U3HA 3LKRB 1NFIB 2NY6D 1EHAA 3FRUA 3UTTD 2CD0A 3QNYB 4PRDA 1XF4B 2VRAA 5DHXB 1N6QL 4FZ8L 2A73A 2F54B 2KZ1B 3CFBA 4QHLA 2H32H 3JWDC 3SGJA 3F7YB 1AGEB 1T21A 4DWHA 1D6VH 1MOEA 3V4PH 1IC7L 2XY1A 1II4E 5EC1B 2XKUA 1JV5B 2W92A 3QFJA 2WWMC 1DUZA 2DYPB 1A7PH 2IH1A 4CKVX 3HNTL 2AV7A 4XNYL 1MWAL 2CO6B 3QXTA 3ULUD 4NRXA 3QJFB 1OPGL 5ILTH 3OHXA 1JI1A 1FH5H 4G5ZH 3REVB 4M9OA 4MX7B 3HI6H 2XIDA 4XWGL 4IRZL 1I1AB 1EFXB 1A0QL 3ZE1F 1BVKA 5A3IC 2NY0C 2WIIA 3BEVB 3I6KB 4PJAA 1VFBA 3ULUF 5JNYA 5DD3L 3WKNA 1IGCL 3LPWA 5T1MA 3B8YA 4HDIB 6CGTA 4M9PA 1GZQB 3TNNB 2OJEB 4OGAD 4NN6C 4AEHH 1MAML 2J8UF 5KS9B 1S7TB 4BUGA 3T3MF 2DLIA 1PZUB 2C1PA 1KG0A 2QSCH 3EO9H 1DQDL 1NGZB 4OSUL 3ULSB 1HSAA 1CICC 4UUJA 5JW4R 1MFBL 2WAHA 3ARGB 3C87A 2CIIB 1IL1A 4PLNC 1R3KB 4FZ8H 3RL1B 3MBXL 3VXOA 1SMOA 1M7XA 1U9KA 4PJCF 4OZHE 3VXSE 2DQUL 2W65A 1LVEA 4JVPA 4PS4H 5IG7B 4WTWA 4ODWA 4ELKA 2OX5A 1HK6A 2HRLA 4TN9A 5DSCA 2J8OA 5E94A 3VWJC 3GJEB 2CDFA 1QBLL 1IC7H 4TOYL 1T0MA 3L3HA 3BOVA 3KPSD 5KW9H 1MCRA 1N0LA 1UEYA 2N7BA 3CU7A 3LRGA 4NQCB 4GAJL 4S1DD 2X4QB 5F6HI 3LEYH 3HNTH 5FYKU 3EJZC 2W60B 1MWAH 5FDWB 5ICYA 3DMMA 4U6VL 1OPGH 2H6PB 3QNXA 3PL6C 1P5UA 3QDHA 1RURL 2IJ0C 3KDMA 2D3VA 3AFLA 4LSPL 4IRZH 1YMME 1DLHB 2FX8L 3EYFB 3IDYC 4I5BB 1A0QH 5IEKA 3SY0B 4JFHD 3QO1A 3KXFB 1FNGA 5GGTA 5C8JB 3AU1A 1QFUL 3EYQC 5DJ2B 3ARED 5DD3H 5EZOH 1IGCH 2FL5A 1SBBA 4DEPC 4M6AA 3DV6A 4P23A 4MD4B 5GSRA 2PW2A 4FQQA 4NN7B 1DP0A 1KBGL 2CR6A 1MAMH 3DX6B 3WBDA 3VMOA 3ZHDA 4WFFD 2NR6C 3CFIC 4YAQA 4Y16D 5IBLD 2X4NA 1KB9K 3D3VB 1DQDH 1WBXA 3P4OA 1I9JH 4OSUH 1Q9OA 2FO4A 4ZYKB 3UROR 3RGVD 3WNOA 1MFBH 4LSSL 4JZOB 1SYSB 4N0YL 2I9LA 3VD3A 2VLME 4BELD 3MBXH 4WENB 3TH2T 4CU6A 2I60L 3FQRA 2IADA 2DQUH 3MJ8B 2UYLB 4MAYD 3N0PB 1KF9B 3TBVB 1JHLL 1P7KB 2VUYA 4CN1A 3TV3H 5B21A 4KFZC 5DRNB 2XQYG 4QHUB 2CJUL 3RI5F 1QBLH 2YPLA 4N8VB 5HYEA 3ILPA 3RUGE 2ICWJ 5HYSB 4N0CC 3HLAB 1WIPA 2YD7A 5FYLE 5I8EA 3DUSB 4OJFH 4E5XB 4GAJH 4LCWE 3QFJE 2ESVA 1A6ZB 1PW3A 3H7BB 1PZ5B 3B2VL 3MV9B 5GISL 4PJ5B 1JNJA 1HSBA 4P2OA 3RY5A 4U6VH 3HMWL 4LPXA 3DSFH 1RURH 3K46A 4LSPH 3BW9B 4Z77B 4WHYG 1EO7A 4LGPB 2IAMB 3QSKB 1TDQA 1KELL 1QFUH 4Y2DB 2A6IB 4IOSD 4XPBL 3QNZA 4EI5C 2NW2B 1QLFA 1IGYA 3B9KC 1JGVL 5T3ZL 1KBGH 3QXVA 1JF1A 5D1XB 4JFXB 4JY6A 1LNUB 3AMLA 5JZ7D 4L3CA 2EDTA 3X3GL 5D93C 5IVZA 1PJ9A 1FNLA 3L3OA 6FABL 1A14H 1OT1A 1ADQA 5JDJA 2PYEE 3FN9A 4YEFA 1G7JB 1FBIH 2R15A 4LSSH 4N0YH 3UTQA 4DGIL 2DWEB 3QUXA 3VD9A 3FCTB 3HZMA 3GIVA 1P4LB 2I60H 1TQBB 3HZYB 3LKPB 5MEOB 3OKKB 5AD0B 1QG3A 2HT4D 3JVGA 3SE8L 4PP1D 4YFLI 4YHLL 4GLRH 4P3DB 4ZPVB 3MV11 1RUML 3OKOA 4NKOA 3DSNA 5K9KB 2CJUH 4IRSA 2NY4B 3TBSB 4Y4HC 2E5EA 3TA3B 1J10A 3VXSD 4GW4A 1QKZL 1GJIA 1QSFE 3KPMB 4CMHB 5AUMA 4M6ML 2DAVA 3GSWB 2XZZA 5IBUG 4AY0A 2R69L 4U2YA 4OZFG 3B2VH 1M7IA 5LGKA 4NSKA 4RX4D 3HR5B 3HMWH 1CFQB 1UEMA 4OV5A 2MWCA 1A2YB 2G9HA 5KVFH 3JBG7 4OZHF 3IU4L 3SDAB 3T4AB 3VFMA 4QXTB 4NQEB 3RDTB 4W4OA 5ENWA 3RVWD 4P49A 3V6ZA 3O6FB 2PW1A 5D1QC 3QEHB 3MRKA 5J57B 3QQNA 4MB4A 3RJQB 4LQFL 2AEQL 5H94A 1YMMD 5FXCH 3OR6A 1S9YA 5A16A 3GMOB 1JGVH 5T3ZH 1FO0L 1UC6A 3B3IA 5HHMB 4MQTB 4MJIB 3LQZB 3CX5K 3D87B 4AT6A 1NCUA 1CZ8L 4WWKB 4ODXB 6FABH 2OTWA 1WCBA 4KGJA 1BQHA 3RPIA 2F15A 3GSOB 1L0YA 5DO2D 2PETA 4J3WA 3KJ4B 3QH3B 4N9GA 4DGIH 1J86A 1IM9B 2YMXH 3NCBB 3G6JA 1WCQA 3DHJA 3BZDA 3SE8H 4AIZA 4YHLH 1AR1D 4X7DC 4BH8B 4NO0A 3RHWF 1TJIL 3JXAA 1MHHA 2VLMD 3BP5A 3V6OA 4MQXD 3TFKC 1AQKL 1FP5A 2X41A 4LVNB 3TESA 2KBGA 1QKZH 3MXWL 1MCEA 5GZNC 2WQ8A 3RZWA 3M45A 3GMLA 2NXYD 2R69H 1RUKH 3QYCA 3P4LA 5F8RC 4WV1A 2EDRA 2QADB 2BOBB 4NPYB 4HX1B 5JHDB 5DEGA 5JIKA 3Q1SL 4XNQA 5FYLD 4Z8FH 4NUJB 7FABL 4R26L 4LCWD 4NJ9L 3IU4H 2BJML 3QFJD 1JBJA 4JKPL 1KJ3L 4MXQD 5DT1L 1OOAA 5C6PB 5DMGC 4HIHB 5J8OA 4YPGA 3DVFA 5HGDA 3W0WB 2W07A 4BFBD 3PQYA 4WJ5A 1WQVT 2OS7A 4PLOB 1SVZA 4NCC1 5CIPH 3RUGF 2IBZX 3RY6A 5D2NA 5K59E 4LQFH 2DBJA 2WUCL 2CDEA 2AEQH 1I1YA 2P44B 2XXCB 3HUJB 4RMTA 3UBXI 3WFBL 4S11A 5JIPA 3ARDA 4HH8A 1FO0H 3PABA 2EDQA 5CEYB 3GGWB 4YK4B 3ARUA 2MNUA 1T1YB 4WFHE 3D0VA 4JFFA 2VXTL 5B38G 1CZ8H 4RWYL 1ZEAH 3IFPA 3MNVA 1B0RB 1OD7A 2E3VA 2IALA 4JFYA 5DJXA 3QUYC 2NY5H 4ZO8A 1GZPB 3DECA 2GI7A 3AS0A 4CVXB 2CUIA 1G7MB 5ICXB 3SDCB 3WHXB 2ZWLT 5EZJA 1M71A 4MHHI 2FD6L 4E42B 4Y19A 4LLWB 2ARJB 1XH3A 4BUHA 4DCQB 4YJZL 3C60B 4X5WA 3SDXB 4KK5C 1L6ZA 1TJIH 4P2CG 1IC5H 1YC8A 2CKBB 1RZIA 1C1EL 3QI9A 3MXWH 3O6LL 4IEFB 3RVTD 5AWNL 1AGEA 1VFMA 1ZHLA 5DZLA 4DUVA 3C08L 2VDOL 1QSFD 2B5IC 1C08B 1QRNA 2DYPA 2NY6C 1XAUA 4KUZL 7FABH 3IRZA 4R26H 3AY4A 4B53A 4NJ9H 2FR4B 2BJMH 3RP1A 3RIAK 3FO1A 1WSST 4JKPH 1KJ3H 3U79A 4XWOD 3QJFA 3KYAA 5DT1H 5IF0A 3UPAA 4PRNB 3DMMD 2CRIA 4KDTC