4OD2B

Crystal structure of the fab fragment of an anti-dr5 antibody bound to dr5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
214
Chain Sequence
b'EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSGINWQGGSTGYADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDYWGKGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of drozitumab, light chain
publication title Structural and functional analysis of the interaction between the agonistic monoclonal antibody Apomab and the proapoptotic receptor DR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/immune system
total genus 39
structure length 214
sequence length 222
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B01
2YK1L 4PJFA 3MODH 1XGQA 1F3DH 3HNVH 3QI9C 4P0DA 4QRRD 4N90D 1MRCL 2GY5A 4LKXB 2CK2A 2VLRA 3MCG1 4HUXB 3L5XH 1XMWA 3F7YB 5L2JB 3F65A 1UVQB 4NQDA 2R1WB 1KJVB 2V2XA 3W5NA 4MHHI 2BMKB 3SDXA 1KTRL 4QRSB 4ZAKD 1IARB 2CKBH 1WJ3A 1KCUH 4U1IB 3SDDC 4GG6E 4ZFFB 5KAQF 1IC5H 5LQBL 3H3PL 3MLVL 1J0IA 4YHPA 5DJZB 4X7SL 2A77L 2VZUA 5FO9B 2XN9A 4GW4B 1BJ1H 1F6AB 4YFDB 5GS1A 1CTNA 1JPFA 1U8LA 3CFCH 5DC4B 5IFHL 1WAAA 3MUHL 4NO2A 4L29A 1Q0XH 4MD0A 1YNLL 3MBXH 5E5RB 2NY5H 4K9EH 1I1AA 4KROC 5F7YC 3BSZL 4OSUL 4XH2B 2J7LA 3LN4A 1TJHL 2YD6A 1KPVB 1H3GA 1NAKH 2BSSB 4AMKH 2ZUQC 4PB0L 4MQ7B 1EK3A 1JPGA 3QUXB 4JPVL 5IHBA 4TVPL 2W65A 4JFYA 4PJFE 2CDGB 4HKJA 2YUWA 3HNTL 4LPUA 4C58B 2Q1EA 1C5DB 4RFNC 4MAUH 1OP3H 2VLRE 2C4FT 5JNYB 4KKBD 2GW5A 3G08B 3GRWA 5CJBA 3TH2T 2JE8A 1VDGA 3QZWA 5C9JA 5EULV 5FO8A 3PWJB 5C0FB 3HUJA 2QHRL 1JF1A 1RULL 1JPSL 5DMKB 3GHBL 1DE4B 3SDXE 5CJQH 2AJ3A 3FO2A 5GRZA 3MLSL 4BFEA 1WZMA 2YEZA 2KL6A 4I3SL 1GGBH 3HZKB 4D9LL 3MZTA 1X4ZA 3VGAC 1W8OA 1FFOA 4UNUA 1RZJL 4Z78B 3RWEB 2FYYA 2B4CC 2E27L 1YQVL 3VGBA 5EU6D 4G8GA 4ZTPH 5F8QC 4MQXD 4PTUB 2HT4D 3GDBA 4U1LA 3K1DA 1D9KC 4N0FB 5KSBA 2XACC 5F3HB 4PBVC 3U30B 5CILL 3MREA 1S7TB 3GB7A 3G6AA 2DTMH 1D5BA 3VXUA 5C0GB 1KENH 2ADFH 4TUKH 2Q8AH 3AS2A 1WAAE 4PGZA 3BVNB 4CVWA 1UZ8B 3T2NL 1D5MA 2X4SB 1ETZA 3VI4F 3VXTA 1FLTX 1YEKH 2Q8BH 4HG4J 4YHYC 3P2TA 4GS7C 3RVXD 5HHPA 1G84A 2HT3D 1C5BH 2IBZY 3UMTA 3LKNB 1A9BA 1SYSA 1KB9J 4NM8L 1HDMA 3DV4B 3EOBA 3FT4B 1GAFL 1OAUH 4MXQC 1H3PH 4TSAL 5T5NF 5AYQA 3ZDYF 1RHHB 4NRXA 4P4RB 4HHAB 2WINB 3NIFE 3OKMB 2OR9H 1T2XA 3BE1H 2AEWA 2AXFA 1C16A 4RFOH 3REWA 3ZT7A 1PG7H 4Y5YA 5DXWA 1G7PB 4RZCA 3PWLA 3BMWA 5DVOA 3HUJE 4KMQA 3JV5A 3MV9B 5J11C 1QVOA 4QNPF 2VDNL 4YDLC 1KC5L 5GRWA 4Y1AE 4D9QE 5IT2H 3SDAD 1J0JA 1NC2B 3IFLH 2BJML 2FWOB 4KV5E 4L8DA 4NT6A 1LP9A 1KG0A 3IDGA 1B0GB 4XPHL 3VXRA 1WLHA 1ODAA 4GXVL 1AD0A 1MH5A 5IBUB 2R9HD 4W70A 4LEXL 4YGVB 1SJVA 3GIZH 5D6CA 3LRSA 1GIGL 4IRJD 1L7IL 1MI5B 2HFGL 2FO4B 2NY3D 2DQJL 4XP5H 2BVQB 5ID1A 1HSBB 3QFDA 2DB8A 4JCMA 3ECBA 1G6RA 2E7CA 2HP4A 4RMUA 5DK2B 5HYSG 5KSBE 4AEHL 2PKDA 2BC4B 4Y4KA 3VXUE 1BHGA 2ZJSH 1U8KB 2HLAA 3T08A 4JDVB 1JI1A 3TO4C 1DUZA 9CGTA 3ULUH 3RTQA 4HWEH 1DSFH 2BVOB 2VDMH 2ZCKH 1NBZA 5CSZA 4FNLH 1G9NL 4MNQA 4R9HA 3F5WB 1ZGLM 3EO1A 2BHYA 2F54D 1BQLH 2DLEA 3OR6B 2IH3B 1OP3K 5L8KB 3W5MA 2IAND 4OJFH 1EO8L 1UG9A 4LASH 1FYTB 4WV1C 1YPZA 3O9WC 4WHTB 3VFOB 4TULH 2R2EB 4WUUD 2JJUA 1T7YA 3T0BA 3D39D 3FFCD 4JRYD 3D5OF 2AABL 3O4LD 5FYLL 3OKKA 4ELKB 1HSAA 3K2UL 1RUML 2H1PH 1RZ8A 1URLA 1F4AA 4WW1B 1K8IB 3R06A 3NMEA 1A6AB 4P2RE 5CCKL 1KLUA 2I25N 3RDTC 1CLOH 2A6IB 3VFMA 1XAUA 5IR1B 4ODVL 2GTZA 1H0DA 4PJBF 1Q9LB 4G6KL 2WP3T 1DN0A 1NGQL 1OWWA 5JXAL 1UCBL 2IGFL 2GQHA 4YHZH 3S35H 5E5MA 1KB5B 4WTWA 1LP9E 3GNMH 3I84A 2Y36H 3S9DB 4MA8H 3FQRA 3VXRE 2DWEA 3OKOA 3WD5H 4GRLC 4CVXB 4EN3B 3BN9C 3BYYA 2NY0C 2VLKD 4NNPH 1W72L 3ES6B 5B3NA 4JZJB 2YRLA 1FC2D 2IAMD 1AR1D 2FB4L 1AP2B 4LCWB 4NQSB 4U6YB 1UM6H 5D7IF 3PE9A 5KJRH 3CDCA 1QHPA 5EN2B 3IETB 4NC2B 4Z7UB 1TENA 4JDTH 3MRMA 3B6SA 2MCPL 5EO0B 2I24N 3CNKA 4X80L 1E4KC 3P0VH 1FNSL 3KS0H 4XBGB 4KJWC 5JPNA 5C0DA 1G9ML 3VDBA 3MGTB 1A4KA 4MNQE 3U48A 5T5FL 1LDPL 1H5BB 3QO1B 3QH3B 1KELH 3RGVB 3UTQB 4F9LC 3HR6A 1YPZE 2LQRA 4S1QL 1EMTH 4G5ZL 1JIBA 1J1PL 5GGTA 3DUUA 1J8HD 5I17B 5DD5H 2N4IA 3MCLH 2ENYA 2B2XL 4EDXB 4JFOA 2DIAA 3HPJA 1AO7B 3I6GA 1DUYA 3BOVA 1CLZH 5GQBA 1NGZA 2EXYC 4ZNEA 5JHDD 1EO7A 4YUEH 5AZEL 3S6CA 5E70A 15C8H 4Y19D 4MJ2A 5FA3B 4RGMB 1TCRB 3MOBH 4L3EB 4JLRA 3DXAB 4UV7L 3DVNA 1AI1H 4KUCF 5I8KH 4LLWB 4U2ZA 1TTGA 5F7LB 4NZTL 2APFA 4F57L 3S4SG 1OGAB 4F33B 1I3GL 1YEGL 3FOMB 5FGCE 5I1IH 3BDYH 3FZUC 4GO6B 5ENWA 3REVA 4LKCA 3FOLA 4K07A 1P6AB 4IS6B 4DFIA 3TH4T 5DQJA 1KJ2B 1NCCH 1U91A 1A02N 4X5LA 1CS6A 3VXMB 3L3KA 5IB2A 3EYSH 3NAAL 1UWEL 3WNKA 4YLQT 3FN3A 5I76A 5JDSB 4Q9RH 4RISH 3BT2L 4NQVB 3EYUL 3WDIA 4JFQA 2EKSB 4PB9H 4CL7A 5DRZB 4AEIL 4YDJB 5C09A 1NAMA 3U2SA 1IGCH 5F7UA 2NR6D 4NN7C 2J6EA 4Z76B 1TLKA 1UXSB 5CLTA 1BD2E 2WIMA 5J06A 3TIDB 2VTFA 3QIWA 1JHTA 1EFXB 1RFDL 3QDJD 4Y5VA 5DRNA 3CFDA 3DSFH 3PIQB 4AY0A 5CAYB 4XPAL 2D31B 4HH8A 4J3SA 3ZHLA 4HFWA 1AQDB 1V7NH 3QFJA 4ZNEE 2AKRB 2FJHA 3KDMA 4JFDB 1AGEA 3MBED 1GC1L 3T0WA 2X05A 4GUPA 2QQNL 4C59B 4TUOA 5CJ5A 4Y4HD 5BCAA 3KLAA 4PY8J 1R3JB 2X4TA 3LS4H 3UBXA 1MCJA 1DCLA 4QHNA 5INDA 4QYOB 3C8KB 4HUVB 1FNFA 2JIXD 1ZA3B 5SX4I 2XKUA 4ENEC 1KV3A 2CXKA 4ONFL 2V6HA 3GRWH 3GGWB 4LLMA 3VFTB 4Z0BH 4Y4FD 2HKHL 3IJHA 2MSPA 2HVJB 3ULVE 3BKJH 3T3ME 1X7QA 2X70A 3NBNA 1FAIL 1I3VA 3WIIL 3FN0H 4OAWB 2EEBA 1OF2A 1F97A 1NFDB 5E0QA 2X4UA 4XP9L 1KNOB 2PYFB 2Z4QB 2BY0A 1MCHA 3VRJA 1KBGH 1YNKL 2EDWA 4MS8D 1DEEB 5I1KH 5IJVB 4UQ2B 2DL9A 5J11B 3BEVB 4MYWB 2EDLA 1JN6A 2JKXA 1AHWA 1VFBB 2MMXA 4UNTA 2UZXB 4YIQA 3MRBB 5ICYB 1A14H 1P7KA 3VFNA 1X44A 3BX7C 1KULA 1BZ9A 1IBGL 1UWGH 3T1FA 4DKEH 1T7ZA 4K7PY 1HCVA 4JFXA 3T4YA 4UI2A 3MROB 2ICEB 6CGTA 3NIGE 3T0ED 3NCJH 3DBXA 3BEWA 3QUKB 4HIIB 2BERA 5FK9B 4NWTL 2FATH 2X1PA 3CLFH 5D93C 5I1AA 3ARQA 3T0VA 1EEYB 1P84K 1IKFL 3QFJE 3RUGF 2FGZA 4G6AC 4EQ2A 2NMSA 3GSVB 3GMLB 1RIHL 4CMHB 4GAGH 1BGXH 4GW1B 5L8JB 4LKXA 3SE3C 1MFCL 4HUXA 1N64L 3HC4H 3F7YA 3JUYA 4YHIB 4FA8A 1UVQA 2R1WA 4XBEH 3C87A 4M4PA 1XT5A 2NY2D 4PJHF 5C0BD 3TWCL 1G7HB 2AQ2A 4HF5H 1KJVA 5TPWH 4BZ2H 3DYPA 2BMKA 3JVGA 3WSQL 3P30H 3F12B 4QRSA 5J57B 4WW2F 1OP5K 2UY6A 3WKML 2CUIA 1J0ZA 4WGVB 4U1IA 3FL7A 4AH2B 3O9WB 1P4LB 2JF1A 4ZFFA 2HFTA 4OFIA 1MF2H 1X3DA 3MR9A 2CSPA 3O8XC 5EU5B 3TPUB 2D0HA 4G43A 2Y25A 3CXHJ 5IGXH 5DJZA 5A40E 4E41E 5FO9A 4GW4A 1F6AA 3OWEA 4AENB 4OZHA 1CVRA 4MLSA 1YN6B 3RNQB 2B0SL 4KK8C 4RNRA 1X5YA 1N5AB 4FQJL 2WUCL 4KJPC 1QFWH 5JDJA 4ZSOA 3PJSB 1T03H 3VGEA 5EU7E 1U3ZA 3NACL 4ODTH 1JTOA 5SWSB 1NGYA 3CDGB 4H0GA 2EE2A 4EKXA 5HGHB 4R8WL 1GJIA 4XH2A 2VR4A 2YUVA 2YSSA 3HNSL 3Q5OA 4YC2C 3FRPA 3V6FB 1KPVA 2ADIB 4HJ0C 4GRLB 5FM4A 4HS6B 4PGCB 2NY0B 4MQ7A 1SJXA 3RI5F 4HEPG 3IAGC 2BK8A 1BMGA 4UILH 5HGBA 3NPSC 2CDGA 3DX7B 1B0WA 1WIOA 5DRWB 5GPRA 2B4CL 5HHOD 1C5DA 4J3VA 1OQOA 1JF6A 1J1XL 1MHPL 3SGDI 2N7AA 5JNYA 1YZZA 3G08A 2VWEC 4JM4H 5GGQH 3OKEA 3ZKMC 1WTLA 3MNWB 1S9KC 2FECL 5C0AD 3MJ9L 5C0FA 5GS0C 1QLEL 5ESAB 2CKNA 4CU7A 1YEHH 1DE4A 1A6UH 3O3EB 3IXAB 3HG1B 1UCTA 2AVGA 4ZPTB 2WNGA 3SE8L 1OD7A 3T77B 3LKQB 1KJ3H 5FYJL 4R4BB 5DK0B 2P5WB 2ZSVB 1E6OH 3HZKA 1MAKA 4Z5RB 4M8QB 4Z78A 4HUWB 3MRQB 4Q6YA 2ZCLH 2AK1H 4PTUA 1K3ZA 4I18B 3HI5H 1FJ1B 1T4KB 2X40A 4N0FA 3HC0B 4OZHE 5F3HA 1IEBB 3P9MB 1S7TA 5C0GA 4ZSOE 3BVNA 1UZ8A 3W2DH 1MFBH 3HI6H 1OP9A 2MKLC 3MLUL 3Q1SL 2QKIA 3HMXL 3JWDL 2PR4H 5J6GB 5EUOF 1WBYB 3OB0H 3ZHDA 2JJSA 3M45A 5GIRB 5C0RH 1LE9A 4N8VG 2AXJA 4P5TB 1S7XB 1VB9A 3LKNA 5GGVL 1GZPB 1SYVB 4L9LA 1AXIB 1NDGB 2YWYA 3DV4A 3FT4A 5F9OL 4WO4A 2GKIA 5TQ2L 3GIVB 1OL0A 1FHGA 4YE4H 1RHHA 4FG6C 4MJ6A 3WS6C 1INEL 4P4RA 4HHAA 2DQHH 3PHOA 1JRHI 2EDFA 3OKMA 3GSXB 2IPTH 4V2BA 5EIQA 2Y07L 2JB5L 4PTTB 3VFWB 5H2BA 3OJDB 5F93C 3ME0A 2DD8H 1G7PA 1YEEH 2ICES 2YS4A 2LTQB 3MV9A 1AKJB 3KR3L 4B5EA 4P9HC 5GGTH 3BKMH 3MOAH 2DIBA 1NC2A 3RWCB 3V0VB 2ZCHH 2FWOA 1ADQA 4QO1A 4IOFC 3W0WD 1B0GA 4JB9H 4WI3A 1EBPA 4LSVH 3ZMRA 1S5IL 3QSKB 4YGVA 4HXAH 5CEZE 4EBQH 2EYSB 4PLNC 4K3EH 1MI5A 4CDHA 2FO4A 3H7LA 4GAYB 2A1WL 4FQ1H 2BVQA 1HSBA 2OLDA 1JFQL 5DK2A 1TJGL 3TN0B 4YBQD 2BC4A 1U36A 3STBA 2BHUA 3O3BB 4HS3A 4JDVA 3FO9B 1BIIB 4NQXB 5DYOB 3E1F1 4JANB 3P0GB 4YDKL 2ZG1A 4KAQH 3CJJA 2BVOA 4OZ4A 1T6VN 3ZTJH 5E2TH 1J7VR 1T5XB 1YEJL 4LDLB 3ULVH 3OR6A 4J3OC 5JHLL 4CJ0A 1U3JA 1F11B 1NC4D 1FYTA 2VXSL 4L5FL 3VFOA 1NKOA 3EFDH 3B2VL 2R2EA 2P8MB 1AGDB 1T66D 2W9DL 3FHQA 4W81A 1FGNH 3GKZA 4S0TD 4ELKA 4PRPD 1F3DJ 1I3UA 2KH2B 1I8IB 3O2DL 1EO5A 4WW1A 1K8IA 2JELL 1FRGH 1RHFA 1A6AA 3G9VA 2D4DA 1NAMH 2A6IA 5GS2H 4LAQL 2J6EH 5DUBB 3IS0X 5IR1A 5TE7H 5I71C 1RZKC 3MV9E 3C5JB 5D7JA 1Q9LA 5FKAB 2VRAA 3DRQB 3V9FA 3SKUD 4NP4L 5E6IC 5I1CH 4YAQB 3W39A 1CLYH 3X11B 1LO0L 1KB5A 3UC0L 2YD1A 5KS9B 1F00I 3OJVC 3QG7L 4JRXD 3CU7A 5D8JL 4Z7QE 4MA3B 1XIWD 3ZTJG 4CVXA 1J88A 1C5CL 1NLBL 2RB8A 5GSVB 4EN3A 4XPGH 4LSSL 5DJXB 1QYGH 5DUMH 3ES6A 3MLXL 1MI5E 1V7MH 2BVPB 4JZJA 4PRID 4CGTA 2ZKHL 4NQSA 1AP2A 4LCWA 4U6YA 3F7VB 3HMWL 1MLCA 4D0DB 1BJ1J 3OB0K 4XNYH 2F9BT 5EN2A 3IETA 5SV4A 2R2BB 4IM8A 4OZFH 5BV7H 5EO0A 4UOJA 2AV1B 3SPVB 4RGNB 2BFVH 1ZHBA 3O6LL 4XBGA 1A4JB 3N85L 5FUZL 1KPRB 1DFBL 2I9LB 3MGTA 2JJVA 4ZO8A 2VC2H 4E42A 5FCSH 3VWKD 3ILQC 3C6LD 1H5BA 1MAML 3RGVA 5HYJD 1IKNA 5D7SH 1WVZA 3UTQA 4PJAB 3WNLA 5BXFB 1WBZB 1FYTE 4N5ED 4D2NA 4G7VH 2P48B 4H88H 3EDJA 2X1XR 1SY6H 1YJDC 3O81A 5I17A 1DQMH 2VR9A 3BAEH 3QQ9D 2J1KA 3WFDH 1HWHB 5L0QC 5DVNA 2ZOLB 2DBLL 1AO7A 4ZS6D 3TZVC 3O8XB 2GK0B 5TF1H 1P1ZB 1ITCA 2C3HA 1I7RB 4OLVH 3ZT6A 3I9GH 3V6ZB 2FX8L 2DS4A 1TCRA 4L3EA 2HMIC 4XHQA 1BM3L 2VH5H 2IFGA 1BF2A 2AJSH 5H37G 1MFAH 4LLWA 3WLWD 4ELMF 4LLVA 1ZE3C 1OGAA 4F33A 1DLFH 1T2QH 2EECA 2DYPD 1FPTH 1C7TA 1G0YR 4LPVA 4WEMB 3FHAA 3FOMA 3WUZA 1OSZB 4M1DH 1JWUB 4XNUH 4XC3L 2CPCA 5FFLA 3MJGX 2ZOKB 5C6TL 2BDNL 4JFFD 1U93B 4IS6A 2FH6A 4LCWE 2V5TA 4GXUM 4ZYKB 4C4KT 2VXTL 5ETUA 3BIBX 5J13C 5A3ID 1KCKA 1DLHB 3O0RL 5T33L 4FXLA 3HLAB 5A2KH 1KJ2A 2OP4H 4KUZL 2FX7H 3VXMA 1FFNA 4DN3H 2HKFL 4M00A 5IF0B 1YYML 4LFHG 4JO1H 4O2FB 5T1KB 2PW1B 4OGYL 4WFED 3CFBB 4H5SB 1UB5B 1CFBA 1P5UA 5ADOL 4NQVA 2NCMA 2EKSA 4LQ1A 5DRZA 2YD2A 3V52H 5HHMB 1IT9L 3RU8L 2HTLC 1JCKA 1QPXA 1V3MA 3FO1B 4DTGL 1NMCB 5C07B 2VLJD 4Z76A 1X5XA 3DVFA 2RCSH 2EDXA 1DJSA 3TIDA 5AWNL 1PGRB 5MI0C 1JE6A 5FYKL 5LGHH 2EDKA 5J1SC 3PIQA 4YGAB 4M6AA 4PJ9D 4JQIH 1AQDA 2AKRA 3TBWB 2R1XB 1D9KA 4JFDA 3EYOA 3LHPL 4HCRL 3GMQA 2YA1A 1TETL 3FO0H 1NGWB 4K8RH 1R3JA 4JVPA 1OGAE 3LSOB 3OGCA 4QYOA 3C8KA 5D96B 4PBXA 5I75C 2K9UA 4X9BA 1ZA3A 3PXJA 4W6WB 3HHRB 4JE4B 1FBIL 1C7SA 3GGWA 3BPNC 3VFTA 5DMIL 3TC9A 3F6LA 2LABA 2VR5A 5GJTL 2HVJA 3L5WB 5JIPA 3VXME 4OAWA 4LL9A 4LPTA 1NFDA 4ONHB 1KNOA 4EI5B 1XF5B 2PYFA 4OLZL 3O41B 1YYLL 2E9JA 2Z4QA 4OGAC 4RIRA 2X1WL 5CZXC 5DD3L 5CS7A 5KVDL 5GJSL 3U9PH 1ZHLB 1DEEA 5ACMA 5IJVA 4UQ2A 3BEVA 3O6KH 5CEZH 5I8EA 4A2LA 3KJ6L 1VFBA 3DMMD 2OMBA 3C5ZD 1NUNB 2V5YA 5ICYA 1J1OL 4QXUH 5DURD 3ZLQC 3CK0H 1JF5A 1ACYL 1VFAB 2Z31D 5FUOH 2DQIH 2ICEA 3MROA 2V9RA 4H1LH 2RIKA 3SOBH 5MHSE 4WCYH 5TH2B 1QQDB 2FSEB 3NFSL 3QUKA 5F6HI 4HIIA 5FK9A 5EOQH 1HH9B 5F96L 1HILB 5GHWH 3GMLA 4OFYD 1KT2B 4JFDE 1UENA 1UZ6F 4XC1L 4O9HH 4GW1A 4QNPE 5J1AB 2CLZA 5KSAB 3H2WA 4XVTL 4YHIA 4MDIB 3WO3B 5HI5C 3WXWH 1QFPA 3EYQC 2HT4C 3V79C 1EDQA 4IDLA 1G7HA 3QRGH 3P40A 2YC1A 3QQ3B 4OV5B 4RSVA 4ZOAA 4TSBH 3EYFB 4FABL 4ONOA 2VUYA 5I19H 4UB0H 1OVZA 3QEQE 1BBJB 4JN2A 3T2PA 3VG0H 5JTWA 4FTVD 4LGSB 4XX1G 3VU2A 3D85A 4AH2A 1MQKL 3I6KA 3O9WA 2DL2A 1P4LA 1S3KL 1RZFH 4M62L 3PWPD 3ARBD 1IRAY 3OX8B 3IDXH 4YDIH 3MOQA 3TPUA 3P11L 1NH6A 2HT3C 4HH9B 1NFDE 4H1LG 3WCYA 3QCTH 4HIHA 1ADQH 2I5YL 4DK6A 2CRMA 2E9BA 4Y5XB 4QHLB 1VFUA 1CGYA 4CVUA 3RDTA 4AENA 4IOIB 3KS0J 4AIZB 3UZEA 4PGDB 1YN6A 3RNQA 2VDRH 1N5AA 5SWQB 3FQUB 4M7JL 3RJDA 3PJSA 1ZT1B 4DGYH 3ZTNH 4YZFE 5F1KC 5SWSA 5CD3B 3MNVB 3CDGA 5HGHA 5E08L 2BCKB 1JZ3A 4X7TB 1FSKB 1NUGA 2X4RB 4GRLA 4PGCA 3M1BB 5HHNB 1OY3B 4NCC1 3LEVH 3UX9B 3VXOB 4KGLA 5E95B 3NABH 3DX7A 3MA9H 2YPLB 5CUSH 2IFFL 2OX5A 5DRWA 5EZIL 4B50A 5ABDE 1YDPA 4P23C 4IDJL 3MRJB 5BRZB 1I9JH 1NEZG 5ADPL 4JO3L 3TBTB 3QEGL 3MNWA 4WJ5A 4ALAH 5ACLA 5J3HC 2A9NH 5ESAA 1A1NB 2X89A 4D0CB 4IIQC 4NM4L 1QSEB 3O3EA 4WTXA 3GI9L 3IXAA 4V1DE 3HG1A 4ZPTA 2NXZC 3T77A 3TO2B 3LKQA 3RZCD 4F9LA 1S7VA 4R4BA 4S11A 2P5WA 5DK0A 2ZSVA 4Z5RA 1YC7A 4M8QA 4GSDH 1DBAH 5KSVA 1KGCD 4OLYH 4N5UA 1H3VA 5LXGL 4UT6L 4LSPH 5JO5B 4I18A 3WFCL 1IM9D 1FJ1A 2PO6B 1KB5H 1T4KA 1TVBB 1FLRL 3L5HA 5FO7B 1ZXQA 2NY4B 3ZKSD 3IS1X 4FQQA 1KCRH 1MIEH 1MNUH 4PJGB 1QP1A 3O11B 3A67H 3IF1B 5SWSE 5HVWA 1WC7B 2QTEA 1WICA 1CT8B 5DR5H 5HVHC 5JMOC 1B4JH 4RBPH 4QOKE 3TT1H 1RAMA 1WBYA 4LPWA 4WY7L 5DQ9B 5GIRA 1MHCB 1MWAB 2YN3A 4P5TA 4EQ3A 1QBAA 2AJUL 1S7XA 4WDIB 3IJSB 1GZPA 1UH4A 1SYVA 3OMZA 1NDGA 1FFRA 4KK9C 1DBJH 2VLLA 5KTEL 1JHLL 1FNHA 3GIVA 4M43L 1TDQA 1OAXH 4Y16C 1T1XB 3X14B 1NANI 3GSXA 3CXDL 3MRDB 2Z8RA 3L3JB 2XKNB 5C9KA 1A6VL 1OCWH 3CVIH 2XZAH 3OJDA 4B7LA 4W4OC 4HK0A 4KMTL 4KHTL 1MJ7L 5EIIB 1C12B 4DQOH 4ERSH 4Z77B 2XTJD 5L7XL 3DO7B 3L5JA 3RWCA 3HG1E 2BSTB 3VDAA 5AEAA 5KAQG 1QNZL 2P5WE 4QRRB 3RVUC 3VFRB 1M1SA 4HFUH 2OXHA 2YD3A 3C09C 5DMGC 1K3IA 2EYSA 3C60D 5ICZB 1X9QA 4XVSL 1FH5H 1RUKL 4R90L 5D6DA 1CE1L 4GAYA 2O5YL 5E1HB 1NSNH 4QRPD 4CADB 1OTUD 1FG9C 3TN0A 4PJ8C 4ZS7L 2NY6C 4ZAKB 5IHUH 1JTPA 3O3BA 1KJMB 2X09A 2XYCA 3HE6D 5CIPH 4DKFL 4HC1A 3FO9A 4TNVF 4DAGH 1BIIA 4NQXA 1LO4L 3DTXB 4K2UH 5DYOA 4JANA 2FR4B 1LO2H 5CINL 2J5LC 1QFWM 1VGEH 2BVYA 1IGML 5I15L 2VDKH 4DEPC 3V6BR 1T5XA 2F8OA 4RX4A 2CIIB 3MLZL 4M7KL 1F11A 5JOFB 3S36L 3UTZB 2P8MA 1AGDA 3FONB 5BO1L 3WDHA 3RUGA 4F9PA 3U0WH 1I8IA 1WZLA 1CD8A 1X5ZA 1MRFL 2D7TL 3GSOB 3QDMD 2VXUL 4G42B 2IJ0C 3V0WL 5GRYA 3GHEH 5DUBA 3MLTB 4EJ1C 4H20L 1MPAH 1TIUA 3C5JA 3VXPA 1WFUA 5FKAA 2C7UB 2UVFA 3BISA 4HBCL 3LZFH 4YAQA 4F80A 1KCSL 3DHJA 2DM7A 3OKNA 2Z93B 1OARL 3DLQR 2ED9A 1I9IH 4UT7L 2WM0A 4MA3A 3T1WA 3VA6A 2VIRB 4NN6C 5T1MB 1ZEAH 5DZOA 3VA2C 1AGFB 3NGBC 5GSVA 3D9AH 5DJXA 3RY6A 3X3GH 3W9DB 2BVPA 5IB5B 5E2UL 3SO3B 3AREC 3ABZA 2VNCA 5CMAB 3F7VA 2F15A 3BIKB 4TQEH 4D0DA 5IMLB 3S5LG 3TYFB 1ORQB 3G5XB 2NR6C 4K3GA 4PG9B 4MQSB 1RZIB 1SEBB 2R2BA 1CF8L 1GH7A 3LOWA 3QDAA 5GGSB 4LVOB 3SPVA 1PEWA 1FL3B 2ZWLT 1TVHB 4YXLH 1A4JA 5I1EH 5CHNB 5FHAH 1KPRA 1RU9L 2I9LA 5EU6B 3UDWA 3LQAC 4LCCB 4LHJB 1ZHKA 3QIUC 4QTHB 1UM4H 4O58H 5T5NG 3MBEC 3P3YA 1WBZA 5BXFA 1JZ6A 3VCLB 4Y4HC 3JBG7 3RUGE 2VXVH 5D1QC 1NCWH 2L4OA 3U4BH 4K23H 2HLFC 1S9VB 1KN2L 2DLFH 3O8XA 2D2OA 2GK0A 1P1ZA 5DVMA 1I7RA 2E9IA 4AQOA 4PJHE 3NA4A 2FBJH 1J05A 3J7HA 1LO5B 5DWUH 3S37L 1JPTL 2OZ4L 5I1GL 1DANT 4FFVC 5D9SB 2WBJC 5GISH 4J4PC 4U1SB 2IWGA 5BS0D 2IADB 1OSZA 3IFNL 4MAYC 1UXWB 4NKMB 1O7VA 2ZOKA 1HKLH 1JUFB 2WAHA 1U93A 1HINL 1DLHA 4UBDD 4FP8L 3HLAA 3SDAB 3RQ3A 3LEXB 3KPMB 4W68A 5F7MC 1FFQA 5F9WB 5IF0A 2M2DA 4RGNE 3VFUB 1U3HC 1BWWA 4PJXF 4KKAC 2PW1A 1F8TL 5T1KA 2GSGB 5SX4H 3CFBA 4H5SA 1UB5A 5EOCL 4IRJB 5DJ8B 3DO3A 1MREL 2QSCH 2NY3B 4X9GA 4YHKL 5FHBL 1PFCA 5TGBA 3N1QC 4KJQC 5C07A 3BP5B 1RJLB 2NYYD 4Q6IC 5T3ZL 4KDVA 3MYJB 4DJMA 1SJHB 1REIA 5D72L 4ZOCA 2BNQD 1S5HB 1UWXK 3QAZC 1Z0NA 3G04B 4TPRL 2F54B 3PGDB 4S1RL 3ZDZE 1I85A 3TBWA 2X4PB 1N0XL 5L9DL 2IANB 4RRPG 4PBWD 2DJ4A 4MNHB 4HX1B 2J4WH 4WUUB 1CDBA 4FQLH 3D39B 3FFCB 4JRYB 1NGWA 4XB8A 4PRAB 3O4LB 2D7NA 3H9YA 3AM8C 3LSOA 3OAYH 3BHBB 3IDNB 1QLFA 4OM0L 1LD9B 2DLGA 4KI5C 5EBWA 5DJDB 4D94A 1R24B 4J3XA 1X5JA 3SQOH 3SDYH 1IC4H 3M8OH 3HR5B 5CZVH 4Y2OA 4MCZA 2LVCA 5FB8B 3BI9X 3QUZD 4EDWH 4HIXL 1MJJB 3L5WA 4UV4L 3U7YL 1UM5H 4ZFGL 1NLDL 4ZOEA 3WS6A 3PL6C 1H9VA 3C2SA 4HWBA 4QWWD 2G60L 4ONHA 3RVTC 2EE9A 4EI5A 1XF5A 2PXYD 5CKGA 3O41A 1F58H 2BHZA 1GGIL 1TCMA 4XP4L 2VLKB 3PNWB 4Q74A 1GVIA 1SBSH 4YBLC 3VW3L 2IAMB 3AAZA 5DMYA 5HHME 2XWJB 2I07B 1UYWH 3QHFL 2UUDK 4S10A 5C07E 2NX5D 3IVKB 5L6YH 1MFEH 3QG6B 3GMOB 1JWSB 1VFAA 1TJIL 1NMAH 1JGLL 4M48L 2ED7A 1RD6A 4KI5F 4WNQA 1MCPL 5TH2A 1QQDA 2FSEA 2Y72A 4F15B 1DQLL 1WCQA 1HH9A 2YPKA 3B3IA 5I2IB 4K9EC 3UTOA 1KT2A 3JWOC 5MERB 3BH8B 3TV3L 2VLME 3MJ7A 5J1AA 5KSAA 5GRVL 5E7BA 1UADC 1J8HB 4I0PC 3HFMH 3Q6FB 3V4VL 3L1OH 4OGXH 1FC1A 4FQIH 1V3LA 4OV5A 2R0WL 2EH7L 2VYRE 2XWTB 3EYFA 2FH8A 5J7CC 3CDYA 4X6CB 1L4IA 4NWUL 5JHDB 1BBJA 4F7CA 2JK5B 2R0ZL 4KRPC 4Y19B 5HD8D 3AMLA 3AXLB 3SGDH 3VFSB 5T1DL 3OX8A 4OZGF 3U1SH 3K8KA 3QWRD 5C7XL 4HH9A 4G9FD 1CGSH 4M7LL 4QHLA 2CK0H 4XWOD 1RMFH 4IOIA 3W11C 5IFAH 4AIZA 1FFPB 2X6MA 4PGDA 1QO3B 4GJTB 3ARDC 1CGVA 5SWQA 3FQUA 3ZSSA 1OW0C 5DUPH 1ZT1A 2XY2A 1JK8B 5J4MA 5AZ2H 1II4E 3PGCB 3MGOB 3W82A 3DJ9A 2EZ0C 5CD3A 1WFOA 3MNVA 1MCNA 2ESVD 1OHQA 4Z7WF 5I8OL 2BCKA 5ESQB 1JNJA 1QKZH 4IHOB 1TZHB 3O6ML 2QJDA 1D6EB 4X7TA 4L8SB 4LIQL 5I1LB 3IDIA 2HRPH 2QR0A 4FQ2L 3V7MA 2X4RA 3HAEA 3M1BA 5HHNA 1BVZA 4G3YL 4K3DL 1XZ0B 3VXOA 4H26B 3VWJD 2YPLA 2Y4SA 1S7QA 4UAOB 1EA9C 2VE6B 4K71B 3MRJA 5LCVL 4PJ7F 4OBRA 1XFPA 2CMRH 1RIVL 1P4IH 3CFIC 5CP7B 4K7PL 3TBTA 4KGJA 2UWEB 5I16A 5TQ0L 4X7FC 3C2AL 3M17B 2H26B 1RJZB 1AFVH 3MRPB 1A1NA 3QUMA 3QDJB 5IIEB 3HE7C 1QSEA 3MACH 4LP4A 4BSVA 1OAKL 4L4TA 3O2VL 1I1FB 1Z9OA 1MCQA 4GRWB 3TO2A 3DV6B 2BRQA 2OQJB 4N0YL 4G6JH 3MBEB 3H0TB 4K3JL 1T22B 4Y4HB 1RJYB 5JZ7C 3DX8B 1T2JA 1XGYL 2ZUSA 1PSKH 1RIUL 2ADJA 2B20A 5JO5A 1HEZA 4DUVA 1N5YH 1IFHH 2DDQH 1JNNL 1TVBA 2JIXB 5KN5A 3MLWL 5FO7A 4L4VD 2W9EL 4KTEL 1T66C 5DO2C 4JFPB 3UJJH 4UINH 4PJGA 2EIZB 3O11A 5AG9A 4Y4FB 2OL3H 3IF1A 4I9WE 3BKYL 2R4SH 4NC0B 1WC7A 4IJ3B 4DVRL 1CT8A 3N1FC 2L7UA 1VFOA 5DQ9A 2R56H 3LMJH 1MHCA 1MWAA 2WWKT 3ZYIA 4ONGH 4WDIA 2FCBA 3TA3D 3IJSA 1R0AH 4LCIH 4I3RL 4L3CB 1P53A 3IDJB 4BZ1H 1VCAA 4YXKL 1KYOK 2MCG1 2PYED 1TQBC 3G6DH 3N1MC 5SWZB 5ITFB 1T1XA 1U8PB 3X14A 5FOBB 1P7HL 4N0CD 1XIWC 1JHKL 3MRDA 4JHWL 3ROOB 3L3JA 2XKNA 3EO0B 5J1TC 3AY4A 1E28B 1NGPL 1U3HB 2EKJA 1DVFC 3T0EB 5EIIA 1R3IL 2CDFA 3KPNA 1C12A 2ATPB 4X7CC 4Z77A 4Y2DC 5GRXG 1QSEE 3DO7A 2HT2D 3RFZC 1F6LL 2SEBB 2V17H 2BSTA 4L4TE 2J8UF 1B2WH 1WZKA 4R2GC 3QBTB 1KIQB 5CGYC 4QRRA 4ODWB 4OFVA 3OAUH 4OIAA 3VFRA 3I50H 1E6JH 3SGJC 4ZXBD 1GSMA 2KPNA 2NY2B 5C0BB 1N6QL 5DGRA 4XCFL 2VXQH 5C3TA 4CADA 4GMTH 4PP1C 3BPOB 4ZAKA 2J12B 1FV1A 1KJMA 1FDLH 3CFKB 4FFYH 4PJGE 3DTXA 5GZNC 1T83C 1KN4L 2YUXA 1OLLA 3O45B 1A64A 3TVMD 3GK8L 2CIIA 4BK4A 5D5MF 3BKCL 3G6JB 3TJHD 5JOFA 3F7QA 3UZQA 2LE9A 5F6IB 1PKOA 4MCYB 1PKQE 3ARGC 3UTSD 4WI5A 3RAJH 2R69H 2EE3A 3FB8A 5F1NB 5GS0H 2A9MH 5I8CB 2EDHA 3BXNB 4XNZB 4ZPVB 3VFPB 4G42A 4FQXD 5IQ7L 2YKLH 2F19L 5IOPB 3MLTA 5GZOD 3BGMB 4X99A 5B3JF 5EDXA 1G7QB 3SN6N 2C7UA 2FO1A 1JZ5A 1OWRM 4GOSA 1FIGL 2AGJL 3O2WH 3MX0A 3GO1H 3QNXA 3JWNC 5HHOB 4QRRE 4N90E 5IESH 1X5HA 2HJFB 2VIRA 5T1MA 4PJEB 2EH8L 1MRDL 3D2UD 1A7NL 4N1CA 1AGFA 5JUEL 4QTIH 1AQKH 4WFFE 3QCUH 5C0AB 3W9DA 3PQYD 4M6ML 2BXZA 1MCLA 5IB5A 3ULUD 3EDFA 4NNXB 4L1HA 5CMAA 4JFED 5D2LF 3PUCA 5IMLA 2W0FB 3TYFA 1ORQA 3LH2H 5DEGB 3CSYB 3KLHC 5LBSL 4PG9A 5F1OB 1RZIA 1SEBA 2VL4A 5GGSA 4X0KB 4KK5D 5E99H 1FL3A 4X9IA 2FGWL 5DD6A 4TVSa 5EU6A 4XAWL 3RL1B 2DQDL 1CR9H 4LCCA 3MLRH 1FGVH 4U6XB 1T3FB 3DETD 2ED8A 2QQQA 4QTHA 3MFGB 4HWBH 1JGVL 1EIBA 4PG2A 3VD7A 4QHKJ 5F7KC 1NUDA 1A7PL 3KPSB 2E27H 1QRND 3RI5K 4GLRI 4KY1H 2H32B 3VFVB 5F1IA 1JPST 4JGMA 5B38G 4KKCD 5E00B 3SDCD 4P9HH 1IL1B 1S9VA 1UZ6E 3QIBD 4X5WA 3ARVA 3WHE1 4JY4B 1S78D 4QRUA 3TH3T 2D3VA 1IM3B 1YMMA 2VO5A 2VDPL 4J6RH 3KPRD 4RA3A 4U6VH 3V7AE 3RY4A 4NZUL 4PJFF 3PGFL 4MJ4A 4PREB 3ZZ1A 1WBXB 1LO5A 3U82B 1JNLH 1S7WB 5E1AA 2NZ9D 1CDUA 1RURL 4XPFL 5D9SA 1I1AC 3MYZA 4TSCL 3GZKA 4U1SA 1Q0YH 3KYOB 4PLOB 2CR3A 2IADA 5I74B 3SY0A 1UXWA 4NKMA 2P46B 1JUFA 3L9RA 2LV4A 4WFGD 3SDXF 1KCVH 1JJUA 5C08B 3C5ZC 3B5TA 3SDAA 2EIBA 2WK2A 3BUTA 3QO0B 3LKRB 3ILPA 3LEXA 2YD9A 3KPMA 3IDYB 3KJ4B 2NW2A 4BZYA 2LAGB 3VFUA 2HA1A 4HIJB 4G7YL 2GSGA 5K9JH 3ZL4H 5EU6E 4Q2ZA 3U9UB 1P2CB 5DJ8A 5ILTH 1S7RB 3HB3D 3SE9L 3I2CL 5D71L 4FFZL 1JYWA 4GXVH 4WENB 5IW1B 1WAAF 2VZSA 1CCZA 2EC9U 3S7GA 2WUBH 1NCDH 3U7WH 4H8WC 3MYJA 1L7IH 3MODL 1QR4A 1NBVH 3HNVL 1RZKH 1T20B 5A16B 1JBJA 3DPBA 2YPVH 3V8OA 4KC3B 3L5XL 1S5HA 1BFVH 2R29H 3G04A 2F54A 5C0NC 2D0GA 2X4PA 4EVNB 1VEPA 4OIIH 1YMME 1NCTA 2IANA 3IFOB 1K4CB 1PYWB 1NC4B 5CEXB 1OT1A 4MNHA 3SKOB 4HX1A 4WUUA 3D39A 3FFCA 3HAEH 4JRYA 4PRAA 3O4LA 4PRPB 1IZJA 3N0PB 2CKBL 4R4FH 3IGAB 1KCUL 3BHBA 3IDNA 4GBXD 1LD9A 3CIQA 3SEPA 5KANG 2P4AB 5DJDA 3MJ9A 1R24A 5BZDB 1IC5L 3MGAA 1UQSB 5AD0B 1PEZA 3HR5A 2K3TA 4JHAH 3N9GH 3MXVH 5FB8A 4CMMB 1DQJB 1MCKA 1MJJA 3QUMH 4Q0XH 3MLYH 3HC3H 3CFCL 4YNYB 5DD1H 4JRXB 3SQBA 3OF6A 1Q0XL 1XIWB 4KKLD 3MBXL 1S7SB 2NY5L 5IW6A 4K9EL 2VLKA 5KSBF 2IAMA 1YJDH 3HN3A 1UB6B 3L7EB 2VDLH 1NAKL 2I07A 3HPLA 4QF1B 4AMKL 3PP4H 2ATKB 5FUCC 3IVKA 3FT2B 3ZE0F 3H9ZA 3QG6A 3LS5H 5LG1A 3GMOA 1ZA6B 1JWSA 5F70A 2HN7A 5D7LD 4MAUL 3FAXA 3IRPX 3VWKB 2F54E 5I2IA 3C6LB 3UYPA 5HYJB 2IANE 3BH8A 3IKCB 3NTCH 1MWAH 4TOYH 4Y4KC 4U1GB 4OZIB 4UTBH 3KYNB 3FFCE 3D39E 4JRYE 5CJQL 3WFEH 1J8HA 3O4LE 3MRNB 5GSRB 4PR5B 4WI7A 3Q6FA 2A6DB 3CX5K 3RTQC 3WIHH 5I9QC 4N1HB 1GGBL 4Y0GA 4P5KB 1L0YA 2XWTA 4Y1AD 4G5ZH 4A2MA 1LEKA 3E6HB 4C57C 1EX0A 2FNBA 4GKNB 2Z8WC 4LLUB 4X6CA 4ZTPL 5JHDA 2JK5A 3FQXB 4BQ8A 3AXLA 5IHZB 4U7KA 3VFSA 4DZBB 4WHYH 4ZTOH 5EO1B 2DTML 5DFVC 1KENL 2ADFL 2RGSA 4TUKL 4PRHD 2Q8AL 2H41A 4N8CH 2DYPB 3WS3B 2CUMA 1FFPA 1YEKL 2Q8BL 4Z0XA 2VLKE 4JFHD 1IAII 2ZPKH 4JFFB 3VXUD 5BZWB 1EV2E 1JK8A 1C5BL 1Z6JT 3PGCA 3MGOA 1A3QA 1PQZB 3UROR 5ESQA 4IHOA 1IE5A 1TZHA 1D6EA 2OI9C 1H3PL 4L8SA 3LAFA 4V2CB 4U4BA 1BFSA 5I1LA 4LDOB 5C0JB 2OR9L 3BE1L 1P7QD 4I5BB 3HKFA 1N8ZB 4RFOL 4HPYH 1XZ0A 1PG7L 4H26A 1OGTB 1YPZF 4MB3A 1RSFA 4D8PB 1I8KB 1G7LA 1UWEH 4C55A 2Y6SC 1KACB 3W81A 3LN5B 2VLJB 4JPIB 5CP7A 1G0XA 5IT2L 4P2RD 2IPKB 1CD1B 1H8OA 2UWEA 3IFLL 1J8HE 3IAPA 3C60C 2VAAB 3O2DA 4LLDB 3M17A 1U42A 3MRPA 3ULSB 5IVXB 3QDJA 5IIEA 4NHUB 4OI8A 4GAJH 4PJ9B 4LHUG 4WHDA 1I1FA 5DDHB 3GIZL 3G9AB 3BP6B 3QIUA 4X6CE 4NKIH 3DV6A 5E4EC 5JHDE 4AL8H 4AJ0A 2OQJA 4P2OD 3MBEA 1NANH 4XP5L 3H0TA 5DLMH 5C0CD 1T22A 4PJIF 4Y4HA 1RJYA 3DX8A 4UTAH 1XR8B 2OJEA 2WSKA 2ZJSL 2I26N 1NGXB 4DOHE 3F8UB 5MEOB 3WUWG 2VKWA 3AC0A 2JIXA 4M03A 3BJLA 3RKDD 3ULUL 1P4BH 4HWEL 1DSFL 1I7TA 2VDML 2ZCKL 5I0ZA 1C08B 1WZ1H 1S9XB 3RWGB 1BQLL 1GHFH 1QSFA 4Y4FA 3CFJB 4YPJA 5EZOH 4OJFL 1RVFH 4LASL 2J3SA 3T0DA 5JA9A 4XMLH 4MNQD 3R0NA 4Z7NE 1JZ8A 5FV1L 2DMKA 2H1PL 5CSGA 4MAYA 4BELD 4U1MB 3IDJA 1CLOL 1BVKB 4PLKC 1ZLSH 2XZCH 2YBRB 4AM0B 5TDPB 5SWZA 5ITFA 3NCEB 1U8PA 3DMMB 1FE8H 3C5ZB 5B8CC 5FOBA 2B1AH 4Z6AT 2E8ZA 2EDDA 4RDQF 3R8QA 3EO0A 4YHZL 2UWEE 5HVGB 3S35L 4X6FB 5HXMA 1E28A 2AJYH 2Z31B 1U3HA 2Y36L 4IRSC 4OQTA 4MA8L 4YO0B 2EICA 2ATPA 5KVEL 1X4XA 3QDJE 1WEJH 3VH8G 1HQ4B 2SEBA 3WD5L 3VG9B 4OBSA 2DM3A 4QGYA 2DM2A 4NNPL 1KIQA 4GQ9H 5BW7A 2GCYA 2BOCB 4ODWA 1O7SA 1TTFA 1T89C 4P3CH 1UM6L 2BP3A 2C4FU 3S96B 5KJRL 3O6FD 1G7MB 1FNEB 4JDTL 2DKUA 1EVUA 4YH6A 5JPMB 2DRUA 3F58H 3FMGH 5DHVB 1FO0H 3P0VL 5L2KE 2Q7YB 2N1KA 4QXTB 4PRBB 3CFKA 4FTVB 1QSFE 2Z0BA 3T3MF 1KELL 3PWPB 3ARBB 4JR9H 3ARTA 4CBPA 3G5ZB 3AM8A 1EMTL 2W91A 1H3UA 1MSPA 3VI3E 4LQFH 5DD5L 2HVKB 3MCLL 3OB8A 4LNVA 1EHLH 3ARZA 2C9AA 3G6JA 5F9DC 4KQ4H 4LARH 4MCYA 1CLZL 4WWKC 3EO9H 5HDQH 5DJYB 1BD2D 4P4KD 4YUEL 5F1NA 5SWZE 3NFPB 5I8CA 4MLIA 15C8L 1J9CT 3BXNA 1FVCB 4ZPVA 3SCMD 3VFPA 2GK2A 3MOBL 4NO5B 4EUPG 2NY1C 4MDJA 3E3QC 4AYFA 4MJIA 1N7MH 4LPYA 4HXBH 1DZBA 3BQUC 5IOPA 4OFKA 1BEYH 1G7QA 4DGVH 1DTUA 4XVUC 3JZ7A 1KYOJ 4RMRA 4MGXA 5DGQA 1NL0H 4OD2B 4ZG1A 5I1IL 4LRNH 3BDYL 3ZKQD 3C08H 5EU7C 4XHJC 5HHOA 4HCRA 2C4XA 3NCMA 1ND0B 2HJFA 4PJEA 5JXEC 3S97C 5ESVA 1PZ5B 3T8XB 4RMWA 4KVCH 1NCCL 5C0AA 3AU1B 1HOCA 2OJZH 4N0UA 1BQHG 3MRFB 4BM7A 2BY2A 4NNXA 4FZ8H 5F7EH 2W0FA 5DEGA 2Z92B 3CSYA 3ULVD 1FG2B 4Q9RL 4RISL 3RZCB 3MJ9H 3QDGD 4X0KA 4PB9L 2F8XC 3L3HB 3EZ8A 5CZKA 5IMKB 1IGCL 5IV2B 1MFDH 3RL1A 2NLJB 4D0BA 1ZGLB 4X6DB 1T3FA 1CU4H 1E4XI 1AH1A 1IM9B 1M6OB 2A73B 4HUKB 1IMHC 1JMZA 2DMCA 4YK4B 3G6JE 4UMGA 5J12B 3KPSA 3S3PA 2IBGA 5GS2D 3DSFL 2H32A 3M07A 5BJTB 3ZKND 1QRKA 2ZUXA 2DMBA 2IBZX 1V7NL 4L8BB 2ITCB 4TVPD 2AW2A 3OKDA 2NTSP 1IL1A 1X5GA 3QIWD 4PJDF 4ZODA 3DGCR 1WWCA 2DLTA 3LB6D 4JY4A 4MJIE 1MFNA 2CRZA 2GSIB 3LS4L 5FXCH 3QPXH 3ARDA 5F7DA 3LV3B 3IT8D 1WBXA 4K55A 3B9EA 4NIKB 2C5DC 1S7WA 2BXYA 1ORSB 1CICD 5HHOE 3GRWL 1J11A 4NN5B 1A6TB 4FQPA 3QULB 4CN4A 3O3UN 4Z0BL 5E9DD 4PJEE 3BPCB 3VE0B 1BECA 3KYOA 2OI9B 3BKJL 4YX2L 3TLRA 1F2XK 5C0AE 4OZGE 4N0UE 3FN0L 4I2XA 2CH8A 3H42H 3X13B 2RQ8A 2XTJB 5FEBA 2E7MA 5C08A 1J86A 1K6QH 3QUXC 4JHZA 3QO0A 1T1YA 4G6FB 5E4IA 1EJ6A 3LKRA 4BQCA 1KBGL 3NVQA 2IC2A 2BY1A 5I1KL 3MV01 4G80B 4NGHH 3EW3B 4E41D 1RUQH 5EUKB 4Z7WE 3U9UA 1A14L 3C60B 3VXQA 1P2CA 4HS8H 4E5XA 1MVUA 3L6FB 1Q9OB 1S7RA 1VA9A 4DKEL 3CGTA 4QRPB 4G8FB 4EIZC 3NCJL 5IW1A 3KPSE 3B8SA 2FATL 3CLFL 3HE6B 5A16A 2X4QB 1T20A 2YUZA 4GAGL 1BGXL 4KWUA 2H2SC 5CJOH 3HC4L 3OG4B 4XBEL 3S37X 3D3VD 4ETQB 3IFOA 1K4CA 1PYWA 3LRGA 1NC4A 4Y89A 5JLZA 5CEXA 5E8NB 4HF5L 4BZ2L 3U30C 2Z91B 4QXGH 3SKOA 2FD6H 2CD0A 5EA0L 1OTTD 3P30L 1KEGH 1BX2B 3R8BB 3GJFB 4MSWB 4PRPA 2DQCH 3KPLB 4MA1B 1BZ7B 3IGAA 1VEOA 4ESKA 5IBLD 3QDMB 2G5RA 4JKWA 3QUYD 5BZDA 1MF2L 3R1GH 4HBQA 2JJSC 1UQSA 5FKPB 4N68A 5AD0A 4O2CB 5IGXL 4I2XE 1M7DB 2GITB 4JM2D 1LWRA 3O2DH 4CMMA 4KRLB 2ARJQ 1BWMA 5C08E 2XZQH 3QEUB 1I1YA 1E4WH 1CFNB 1QFWL 3LQAH 1INDH 2MQ3A 5B8CB 1T03L 2R4RH 1XIWA 3DOSA 4ODTL 4NO3B 1S7SA 1SJEB 4QXWA 5HHXH 3LDBB 2E6QA 2PETA 1DVFA 4POZC 5FCUH 2OTUB 2DKSA 4IRSB 4LVEA 3UC0H 2AEPH 1UB6A 1ZHNB 3L7EA 5B39G 3QNYB 4QF1A 1YN7A 1DQDH 2ATKA 3FT2A 1ZA6A 4UILL 2O61B 4TUJB 1MLBB 2H45A 4ZUSB 3SGJA 3P4NB 3H7BB 1MCIA 2NPLX 5FYLD 5GXBB 1T04B 1ZLWK 3TBVB 4K8RD 5GGQL 4JM4L 3VWKA 3AMKA 3C6LA 1CXHA 5HYJA 1NJ9B 3IKCA 4U05A 2XICA 1LEIA 1N6UA 3OPZH 3LN9A 3GEWB 1YEHL 4X4ZA 4OZIA 5C0EB 1A6UL 4G6MH 2H2PD 3MCKB 5GSRA 1T7VA 3MRNA 4XXDB 4PRPE 4PR5A 5JW5B 1KJ3L 1T83A 1E6OL 2I60H 4JGUA 4R97B 1B0RB 3F6IA 4P5KA 2ZUTA 2OCFD 1B6DA 1T1ZB 3OBAA 3QPQC 1M71B 2ZCLL 3GMRA 3E6HA 4O4YH 2AK1L 4GKNA 4LLUA 1KOAA 5KOVC 3EJJX 5DRXB 2FEDC 3FQXA 1IZKA 2DBLH 5DHYB 5IHZA 5D2LA 4OQTH 1EPFA 3MFFB 4DZBA 3VGDA 2VOTA 5LWYH 4Z7QF 5EO1A 5IG7A 2A38A 3GBMH 3UTPD 5SV3A 3W2DL 3WS3A 2CUHA 4IEFB 4WEBH 1MFBL 4N9GB 3HI6L 1F4XH 3TA3C 3WN5B 5DJCA 5BS0B 2PR4L 3LCYA 3BQUB 1DL7L 2CRIA 4LRIC 4U1KB 4JFFA 1H8SA 5BZWA 4P57B 2IQAB 5C0RL 4KK6C 5D5ME 2P44B 2AERT 3FB5B 3JV4B 1P9MA 2VKXA 3JTTB 5ANMA 4MVBC 4YE4L 1U6AH 3UYRH 5C0JA 2DQHL 5T33H 5DZLA 4EN3C 1G7IB 1EHNA 2IPTL 1N8ZA 1NDMB 2M1KA 4NJ9H 5EZLA 4LP5A 1M7IB 5CWSA 4JZJC 1OGTA 4WO4D 1JTTA 2DD8L 1YEEL 3S3JA 3WFHB 5HYJE 5H8DA 3JSSA 5E8DH 4D8PA 1I8KA 5B3JE 3IU4H 1I7ZA 3BKML 4OCSL 3MOAL 4OZIE 5E24E 4M6NH 4M3KB 4R4NC 1DDHB 2IPKA 1CD1A 3GI8H 4CU8A 4MZ3A 2VAAA 4LLDA 1N2RB 3ULSA 4JB9L 5IVXA 5IEHB 4LSVL 4NHUA 2WV3A 4PJ9A 3CCHA 3WHXB 5DDHA 4HXAL 4TRPH 4EBQL 1H5BC 1L7TL 1VSCA 3LKSB 4K3EL 2DQGH 3RGVC 1IKNC 1X6NA 3BYTA 4FQ1L 4WEUD 3KYKH 5D2LE 3D69B 4XTRC 4J1UB 5I73B 3B43A 3CX5J 3VD9A 4JPKH 5CSBA 4MXWH 3GMMB 1XR8A 2XQBH 1NGXA 1LK2B 4YHMH 2D4FA 3HZMB 4KAQL 3BH9B 5T1LD 3GUTA 1C08A 2J2ZA 4NOBA 1S9XA 4JFFE 5E2TL 3RWGA 5KG9B 1GOGA 3ULVL 2QQKH 5BMFH 3TFKD 1IQWH 1YY9C 3THMH 3CFJA 4Z7UF 4RGMC 4WUKH 3RX5A 3OGOE 2EO1A 3QUZB 1CL7I 3HZVB 4WFHD 1T0PB 3EFDL 1CE6B 1AC6A 3LIZH 3SJVD 1FGNL 5ANME 3JWOH 3INUH 5D1ZD 2PXYB 1LGVA 1MCWW 4WFEE 3RVVC 1RUPH 1O0VA 1HYSD 1FRGL 4U1MA 1BF8A 1NAML 4YHOL 4DZ8B 1BVKA 5ICXB 4K7PX 1F2QA 3WNMA 2J6EL 2CJUH 2YBRA 2IEPA 4AM0A 5D1XD 5TE7L 5CD5D 2XT1B 3DMMA 3C5ZA 1P69B 5CJ8A 2MNUA 2NX5B 3RVWD 5I1CL 1CLYL 1RK0B 2Z31A 2H32H 4M93C 4YO0A 4OD1H 4NQDE 1DR9A 5IVXE 5D7JD 1HQ4A 1J12A 4NQCD 3HTLX 3G5YB 4XPGL 3ZE1E 4ZD3H 1UJTA 3EGSB 1QYGL 5DUML 1K85A 1U92A 1YEIH 2V5SA 2IALA 2OZ4A 4XNYL 1OTSD 4K3HA 4F58H 4HULB 1G7MA 4UZGA 2BVEA 1FNEA 2CGRH 5EU3B 2PN5A 5BV7L 4OLUH 1UH2A 2P24B 4AZ8A 5DHVA 2BFVL 3MRRB 4LBEB 4LSTH 5IB3A 2H8PB 2Q7YA 4QXTA 3S88H 3MRIB 4NJAH 1HYRC 2VC2L 2XN9E 1UJ3B 3QI9D 5FGRA 4Z8FH 4FTVA 2J8HA 3ORJA 5CJXA 3PWPA 3SDCC 4Z18A 5D7SL 3UEZA 3ARBA 3G5ZA 4G7VL 4H88L 4NUJB 1S78C 1SY6L 4G9FB 3B9KD 1DQML 2HVKA 4KTDL 3BAEL 3DNKA 4KHXH 3WFDL 4KQ3H 1S3KH 4F7PB 3GSWA 5I1JH 2JCCB 1CG9B 5A2IH 2WLZA 5KZCB 3ZYOA 5TF1L 5DJYA 4PGBB 4PS4H 2FX9H 4OCWH 4OLVL 3SDDD 5J6HB 3GKWH 4PJCB 3I9GL 1TPXB 2ESVB 1FVCA 2RFXB 4M7ZB 4NO5A 2VH5L 2AJSL 2DIJA 1MFAL 2P1YA 3QT2A 4R26H 4LCUB 2D7OA 3D1MC 3UTTA 1DLFL 1T2QL 1JVKA 2V2WB 4NDMB 1FPTL 3NH7H 2J88H 4ACPA 4GLRH 4A6YB 2M26A 3VWJB 4M1DL 4NO0D 4OCRH 3BJ91 4XNUL 1RZGB 4JG1H 1ND0A 1RZ7H 5F9JB 4KROD 1PZ5A 5DQDH 1FVEB 4U7MA 2CKBB 2OP4L 2FX7L 3AU1A 2O5ZH 1ZS8B 4DN3L 3B9DA 3MRFA 4G8GE 2MTPA 4JO1L 3PABB 2Z92A 1JL8A 1FG2A 4R0LC 1EGJH 3RZCA 2DI7A 4CMHC 1MOEA 1F4WH 2H6PB 3L3HA 4FQHB 4E0RB 3V52L 3PWPE 4OIBA 7CGTA 3PV6B 5IV2A 1NFDF 2NLJA 3ZE0E 4X6DA 2RCSL 1IM9A 1M6OA 1TNMA 2A73A 4IMLA 5E8OB 4Q9CA 3NIDE 5DA4A 1YEFH 5EOCJ 3HRZB 4L4VB 5LGHL 3NCBB 1Q72H 3KYMB 1VKXA 4YZFF 5BJTA 1WIPA 2BSRB 4JQIL 4L8BA 2ITCA 2YD4A 4R96B 1KTDA 4DCQB 3A0OA 3PDOA 3FB7B 4LLQB 5DJ6B 1LMKA 3WFBH 5H94B 3FO0L 4P46D 4K8RL 2GSIA 2AK4D 2PW2B 4XMKH 3CVHA 2V5RA 3UTTE 1AXSB 3TA3B 3WLBB 1D9KD 3LV3A 1UEMA 2HWZH 5E8PB 1NPUA 2FIRT 4BSJA 1ORSA 5TFSH 1LEGB 1INQB 2PYEB 3QULA 1Z3GH 1J10A 1PLGH 2H3NB 5FUCE 4KKLC 5FYJD 3BPCA 3VE0A 4PJIA 3C9NB 5FDYA 4ZDHB 3QEQD 1A7RH 3X13A 5E8EA 4X4XA 3IDUA 2DWDB 3U9PL 4MXQD 3HZYB 4LK4A 1D5XB 3O6KL 5CEZL 3QXDB 1XCQB 2DQUH 4X98B 3R0MA 4ZFOL 1GYAA 2P7TB 1KGCE 5EUKA 4ZXBB 1PW3A 4S1DC 4QXUL 2Q86B 3OKLB 3ZE2F 3C60A 4U1NB 3CK0L 2WWMC 4X6DE 2X5PA 3L6FA 1Q9OA 2JJWA 3CSBA 2VISB 5FUOL 2B8OT 2DQIL 4QRPA 1T1WB 4J2XA 4G8FA 3SOBL 5HJ3B 2AI0H 3BGFC 1D3CA 3EJZC 1XGTA 4PP2B 1N3NA 3HE6A 5EOQL 3B9VA 1I75A 3GSNH 5GHWL 2X4QA 1WITA 4HZLB 5HYSB 2W9LA 4O9HL 4NKOB 1MIMH 5IM7B 1KTKE 3U36A 1IVLA 2R0LH 3TVMB 4I18C 3FN9A 3WXWL 4ETQA 1ZTXH 2COQA 3QRGL 3U46B 2GUOB 2WW8A 2WBWB 5TDNB 2EIDA 3A6BH 3UTSB 5I15H 4TSBL 4LOUC 1BX2A 1M4KA 4GG8B 5I19L 5A2FA 4UB0L 4LF3B 3GJFA 4MSWA 3TO4D 3EHBC 3KPLA 1BZ7A 3VG0L 5K9QG 4K94C 5J0BA 1RZFL 2D9QB 4FQXB 1CYGA 3P0YH 4UIKH 2B1HH 4PJIE 3IDXL 4YDIL 4QY8A 4V1DD 4DW2L 3MV8B 5FKPA 1EAPB 4O2CA 2LFGA 4P5TC 1QPPA 3LEYL 2GITA 3QCTL 3D85D 2XTJE 1CK0H 5GGSY 3QEUA 2VDRL 3ZDXF 1CFNA 4S1SH 3CZFB 2NXYC 5B8CA 5ALCH 4DGYL 3ZTNL 2Y1VA 4NO3A 1S9YB 2R0KH 3D2UB 1DBMH 1SJEA 3RDTD 3NCYP 1OP5H 4M93B 5C6WH 2OTUA 1EAJA 2LTQC 3D0VB 4IRSA 4OD3H 1ZHNA 4QRPE 4JFEB 4YEEA 3QNYA 3WHE0 1FZOB 3IXTB 4QGTA 5DF0A 4HDIB 4JN1H 1I8MB 3LEVL 3A6OA 3U4EB 4EEEA 4KFZC 2BNRD 4LSQH 4GKSA 4QOKD 3NABL 4TUJA 1K5NB 1MLBA 3MA9L 5CUSL 3WIFB 4ZUSA 5JIIA 1T89A 3H7BA 1HNFA 4XP1H 2VDQH 3CUPB 3B2UD 1T04A 1I9JL 3TBVA 3BN9D 2A6JB 4LIQE 1IAIH 1CF8H 4YFLI 2HG5B 5D6DC 3RWHB 5F7WC 5BVPH 4OM1H 1CDIA 4HQQH 1NJ9A 3GJEB 2A9NL 3RL2B 3TN0C 1QRNB 5KW9H 5C0EA 4F7MB 3MCKA 4KUCD 4XXDA 1ZLUH 5JW5A 4Q9BA 3SDCB 2HFFB 1H8NA 3KVQA 4KJWD 1B0RA 5I30H 3QIBB 4ORGB 3OR7B 3QDHA 3P9LB 4GSDL 1IC7H 1DBAL 3TT3H 1T1ZA 5IQ9B 4OLYL 3UPRA 3RX7A 4LSPL 5DRXA 3KPRB 1KB5L 3NCCB 3WMSA 5C6PB 5DHYA 1WFNA 4OV6F 1Q9WB 4WWKA 3SGEI 4DWHA 2NW3A 3KPQB 3MFFA 2IPUK 1I4FB 2D7QA 4F9PC 1KCRL 5C2BH 1MIEL 5IROA 1MNUL 3A67L 2A0LC 1L9MA 3IFPB 2FEEI 2X9YA 3AUVA 5BS0A 5EBMB 3BQUA 4EOWH 1D5IH 5DR5L 4H8WH 2A6KB 3K2MC 1B4JL 2EXYD 4C56D 3TT1L 1B3JA 3S4SB 3O3AB 2OTPA 4P57A 4M1CC 2IQAA 3U0TB 4M02A 2Y23A 4GG6B 3DURB 1FZKB 5DHVH 3FB5A 3X3FH 1X5IA 3JV4A 4CNIA 1U2HA 3MA7B 5C09E 1DBJL 1Y0LA 3JTTA 3OXSB 4XZUB 3V8CA 4NCDA 5JXEA 1OAXL 4CVZB 2GIYA 2AJVH 5JMRA 1G7IA 3FZUD 2B5IC 4PJDA 3RY6C 1OCWL 3WO4B 3K7UA 3CVIL 1FZJB 2XZAL 5E2VH 3WFHA 1QHOA 3ET9F 5DFWH 4EXKA 3VXSD 5HJ3A 3WNPA 4DQOL 4ERSL 4M5ZH 4O51B 2X42A 4OLWH 3QZWG 5MEPB 4R0LB 1BZQK 1D6VH 2BY3A 5FM5O 1F45A 4RGNC 2QBWA 4NBXB 5L2JA 1I1RA 1IQDB 5E03A 3UDWC 1K9TA 4HFUL 4Q7DA 5DC0A 3WHXA 3LKOB 3LKSA 1MY7A 3K81A 1NCBH 1FH5L 3T0XA 3BD5A 4M1GH 1MCRA 1MHHB 1VESA 4F8QA 1NSNL 4QRTB 3D69A 5KS9F 1BFOB 4J1UA 1TNNA 1GCFA 5D2NC 1YA5A 5IHUL 3QHZH 3GMMA 1U95B 2XRAL 1MJ8H 1LK2A 1C1EH 1XF4B 4GBXB 4DAGL 3H8NA 4K2UL 4PRNB 1LO2L 3E3QE 5F7HA 5BS0E 1VGEL 2VDKL 5KG9A 4GAFB 1FQ9C 3QUZA 3DECA 1QUNA 2V2TB 2Q3ZA 5ECJE 2OTWB 3SCMC 5KBNC 1CE6A 3Q6GH 1PG7X 4KRNA 3TM6A 4JPWH 3U0WL 2PXYA 4XNXH 1ED3B 5HI3C 1G6RH 1GL4B 4RQQB 4ENED 1ZLUK 5FYKD 4PJDE 4DZ8A 1CGTA 5ICXA 4PJAF 4FOMA 2BSSA 3TF7C 1KB9K 4NO2B 1MPAL 3QHTC 3QUXA 3T4AB 2BNUB 3DVIA 2NX5A 1I7UB 3LZFL 3QJHB 5FECB 5IB1B 2Z8SA 1FN4B 1LO3H 5D7LB 3JUZA 4JQVA 5C70A 1I9IL 3E8UH 4LAJH 1CIUA 3OG6B 3ZDZF 1ZEAL 3PWJA 5F97E 1V8HA 3LPGA 5LGJB 3G5YA 3V4UH 1CFVH 2XA3A 2E7HA 1Z0MA 3D9AL 3EGSA 4HKJB 2OBGA 3X3GL 2GY7B 5DMKA 4HEME 5HYFA 1TZGH 3BGFB 4WTZG 1NMCC 5D7KD 4TQEL 3CVHH 2Y7QB 3EDDA 3SKJH 4PJ5B 1E27B 3RA7H 3ZYZA 1QFUH 3RWEA 2P24A 3HUJB 1ZANH 3ARFD 3MRRA 4LBEA 3AFLA 4YXLL 4Y1AB 3DUHA 5I1EL 4PFEA 5DMJB 3MRIA 4NNYB 5FHAL 1GGCH 1I85C 3FO2B 4G6AD 3T2OA 1DBBH 1K2DB 2GJ6D 3H9HB 1FFOB 1UM4L 4O58L 1GXEA 2HRLA 3ZO0A 4M5YH 1ACZA 3EKCA 2X4SA 4M61B 4CUCA 1Y6NR 4PRHB 4NUJA 3RHWF 4G9FA 4U1LB 5D96C 3BWUC 3BP4B 2VXVL 4OLXH 1NCWL 3U4BL 2EE6A 4F7PA 1ZVHA 4K23L 3KXFB 2DOCA 4LSRH 5IFJB 4JQXA 2DLFL 2WWKO 3GB7B 5K33A 3TP4A 5E2WL 3S35X 1CICC 3LKPB 3QNZB 5J6HA 4PJCA 5B4MD 2FBJL 3T3PE 4KDWA 1V5JA 1G6VK 1AY1H 4HUMB 2NXYB 5FDWB 3O8XD 5DWUL 1Q9KB 2WINA 1E4XH 1RZJC 4YQXH 5K93A 4LCUA 1IAOB 4EI5C 1K8DB 5FGSA 2V2WA 4NDMA 1P7QB 4O5LH 4A6YA 4M7LT 1HDMB 4KJPD 3U6RB 1LVEA 1RZGA 1HKLL 1A21A 1AE6H 1PDKA 5F9JA 2R8SH 3H3BC 5KVFH 4P2RB 1NFIB 1FVEA 3REWB 2CKBA 1EEQA 1VFMA 3QISA 4OTXH 4P59H 4Y5YB 3GBLA 2RHEA 1ZS8A 1ERNA 4HJ0D 2YWZA 3QEHB 4JFZH 4WU5B 4RMSA 4GH7B 2YD7A 2IMNA 4P2OB 1F3JB 1LP9B 2H6PA 3PG2A 2QSCL 4HMDA 4XNMB 4E0RA 5KSAC 3I3EA 1I3RB 3PV6A 5C0CB 1UKQA 1U8KA 3ZKMD 3S34H 4NZRH 1B4RA 3LRSB 3VD5A 4G9FE 5GS0D 5E8OA 5HHMD 3F5WA 4LCYB 3HRZA 4L4VA 1FCGA 2AV7B 2IH3A 3H3KA 1XR9B 4U0RB 4RDQG 1OPGL 2BSRA 1J18A 1WF5A 2HH0H 4WHTA 1JNNH 2KQMA 4PJCE 4DCQA 1PG7W 4Q9QH 1R3HB 3FB7A 2B39A 4YWGH 4D9RD 5DJ6A 2J4WL 5H94A 2DQEH 1WISA 4FQLL 5CSZB 4MNQB 2PW2A 4Y5XC 3WLBA 1AXSA 3P9WB 3TA3A 5JOPD 4XI5C 4LRIA 4OGZA 1JGUH 4X5XB 2YRPA 3SQOL 1INQA 3SDYL 2PYEA 4N8VB 4B53A 1IC4L 3M8OL 4Z95H 1E0OB 5CZVL 1VACB 2H3NA 3TIEB 4I3RH 4LSUH 1UM5L 4QRQB 4XPBH 1FSKC 3C9NA 5A43C 4ZDHA 5ALBH 4UDTB 4LVNC 3TNNB 2GT9B 2B5IB 1F58L 4TTDD 4FFWD 4CDGC 2DWDA 3Q5TA 5ID0B 1A6WH 1AXTH 4F37K 4PLJC 3HZYA 1SBSL 2VN7A 4FG6D 1X5FA 1D5XA 3QXDA 4MWFB 1WWAX 1B9ZA 1XGUB 1XCQA 5JR1H 4X98A 4Z7UA 1U8NB 4ZXBA 5FGBC 1UYWL 3NA9H 2Q86A 3O6FB 3OKLA 4N1EA 1TQCC 4U1NA 4LU5H 5L6YL 1MFEL 3CSPA 2MHAB 1NMAL 2VISA 1UA6H 1T1WA 4DUWA 1IGJB 1S8DB 4I77H 3S8WA 1HN1A 1HE7A 2EC9T 3NN8B 1F90H 3QO1A 3QH3A 5HI4C 4IOFD 4PP2A 2MJWA 5AG8A 3CMGA 5J9PB 2HTKD 2CR6A 3LQZB 4HZLA 1WT5A 1JYVA 1B90A 5HYSA 2R15A 5D2NB 4NKOA 5IM7A 1BIHA 1LNUB 4EDXA 4JJ5B 2PO6C 4PYGA 3HFML 4HJJH 2EEAA 2F53D 3L1OL 4OGXL 2XTLA 3U46A 4FQIL 12E8H 2GUOA 5TDNA 2NY4C 3E0GA 3UBXG 4GG8A 5ITBH 1SEQH 3C5SB 4P2QD 4LF3A 1BD2B 4P4KB 5FA3A 3DXAA 2HJLB 4OZFG 3SCMB 1W2KT 1A3LH 2DJSA 4FQXA 3UYOD 5I1DB 4XAKE 1PY9A 3MV8A 1EAPA 25C8H 3U1SL 4PGJA 2YMXH 1G9MC 5J8OA 3MQIA 3BZEB 1CGSL 4ODHH 1L6ZA 2CK0L 1VPOH 2F58L 1RMFL 5IFAL 1Y18B 2ZG3A 3DVNB 2VDOH 3K4AA 2EEDA 3LQMA 1EHAA 5DUPL 3CU1A 1ZVSB 3MSPA 5AZ2L 4OCNC 4Z7UE 1S9YA 3BZDA 3D2UA 1AGBB 1FL5B 3MXWH 3AY4C 1QKZL 3D0VA 5IKCB 2ZNXA 3BN3B 4JFEA 2HRPL 5JDSA 4I9WD 5E6ID 1TZIB 1FZOA 3MV11 4PJGF 3IXTA 5IVNA 1LK3H 5DQJB 4HDIA 4YDJA 3EFFB 1GOFA 3QDGB 4XCCH 1K5NA 3RWJB 4XWGH 3WIFA 1KFAH 4OI7A 3CUPA 2NQCA 1UXSA 1L0QA 2CMRL 1P4IL 4CN1A 4MA7H 1GZQB 2A6JA 5GGRB 4RWYH 2HG5A 1OAQH 1EFXA 3RWHA 1AO7E 4NQED 1LILA 5T3XE 3GJEA 1AFVL 2D31A 3RL2A 2EYTB 1CGWA 1QRNA 4ZAKC 4WHCA 3TCXA 3V5KB 3MACL 2AEQH 1QBML 5HPMB 1EJOH 4W6XB 3E2HC 2YD8A 4L3EE 3SDCA 3DXAE 1U58B 4G6JL 3QIWB 3A6CH 4ORGA 5LKNA 5IQ9A 1XCTB 3HCVB 2P47B 4EIGB 4L4TD 3ILQD 3MV8E 3EOTH 4HIEB 1PSKL 5JQHC 4HUVA 4HFWB 3KPRA 1N5YL 1IFHL 4BFIB 2DDQL 1PY4A 1Q9WA 3KPQA 4JVUA 4PGEB 5C1MB 5DD0H 1I4FA 1WWWX 2EXWD 3GBNH 3WXVH 1CICB 5HVFB 3UJJL 4UINL 4NCC2 2VDPH 3VRIB 5E9DB 2OL3L 3IFPA 4HT1H 2IG2H 4UT9H 4J3UA 2R4SL 3CXHK 3MV7D 3TZVD 2XQYK 2MOVA 4OZFB 5EBMA 2A6KA 4XT1C 1MEXH 4X7EC 3S4SA 4R6UA 3ULUE 2R56L 2O5XH 5LGKA 3LMJL 4JFEE 8CGTA 3U0TA 4ONGL 4GG6A 2VZ3A 4U1JB 1R0AL 1FZKA 4LCIL 3ZHKA 1Q1JH 5EWIH 4M3JA 3RVWC 2P42B 3MA7A 4BZ1L 6FABH 1GC1C 3OXSA 2R2CA 3MRBA 1HHIB 3G6DL 4E41B 1SMOA 4KKBC 4CVZA 1JYNA 2WQRA 2Z35B 1J5OH 1SVCP 3GFUA 1FZJA 3SO3C 5EBLB 4JO4H 3BZ4B 1OD9A 1CL7H 35C8H 4JY5L 5CBEB 5K9OB 4O51A 1EEYA 1QRNE 5MEPA 1V05A 1P7KB 3GSVA 2AJXH 1YQ2A 4R0LA 3VFNB 5CLWA 2V17L 3FFDB 4LVOC 1B2WL 2P8PB 4HK3N 4P5MB 3UO1H 2W0PA 3OAUL 2MPAH 3I50L 1OOAA 1IQDA 3BUYB 3JV6B 2DM4A 4MQXC 4LCCC 3D3VB 3LKOA 4MHHG 3OAZH 4KRMB 4WWID 3KPRE 4PG2C 2HTLD 1MHHA 2VXQL 3F12A 4QRTA 8FABB 1BFOA 4GMTL 4BA8A 4LHUD 2VSDA 1PX4A 3CAFA 2D9CA 4A6YH 1IJ9A 4G8EB 1U3YA 1U95A 2FLRT 1FDLL 2ICCA 4WFFD 4X7DC 4FFYL 1QEWB 1XF4A 2LVEA 3B9KC 4GBXA 4AT6B 1FNLA 3ARPA 1CGUA 4PRNA 5EU5A 4NRYB 4MQTB 2GFBB 3QUYB 3RVXC 4WI4A 2I9TB 4WFGE 4JM2B 3ZKXB 5TE4H 2P8LB 4UDUB 2V2TA 1NMBH 1O5DT 1VENA 3Q2CA 2OTWA 4I4WB 5AYUH 3MR9B 3I6LD 3RAJL 2R69L 4G43B 4DN4H 5T3ZD 5MENB 4XMPH 1ED3A 5GS0L 4OF6A 3SGKA 2A9ML 3IU3B 3V6FA 7FABH 4OZHB 4RQQA 4GMSH 1Z5LB 2XOTA 4RNRB 2V7HB 1A5FH 2ADIA 4NZJA 2YKLL 4ZSOB 1CDJA 4HS6A 4LVNB 4ZO9A 3AS3A 3T4AA 2BNUA 4R7NB 3SDAC 1NGYB 3AS0A 4Z7VB 1IAIM 1I7UA 3QJHA 3O2WL 5IB1A 5FECA 1FN4A 5F9WC 2YSSB 3GO1L 4J3WA 3RPIB 4X4YB 1NFKA 4BFGA 5D7LA 3G5VB 2R9HC 4ZO6A 5IESL 1QBLH 2FIKB 1A7QH 4OGAD 4OB5H 5CP3A 5CZXD 1TQCB 4IRJC 4QTIL 5LGJA 5HGBB 1AQKL 3QCUL 2NY3C 4JG0H 4JGJA 1P84J 1SMAA 5IBUG 1Y6MR 1GGUA 2Y7QA 4OKVB 4Y7MA 3LH2L 4AIOA 4XPTL 3OKEB 4PJ5A 1E27A 1XEDA 3Q48A 4HUWA 3MRQA 5E99L 5HYQB 5IVZB 4P9ML 5I0DA 4Y1AA 2CLVB 3AB0B 3VRLF 4NNYA 3ZE2E 3T2QA 1CR9L 2X4NB 3MLRL 1FGVL 3P77B 2UV3A 1K2DA 3HC0A 1IEBA 1W72B 2F5BH 3P9MA 3H9HA 5EZJB 2D7MA 4HWBL 4M6OH 4G8IB 5HGAB 4KY1L 5HI5D 4NUGH 4M61A 3EYQD 4PRHA 4P46C 4ZFOB 5HDBF 3BP4A 5BVJB 1NBYB 4MD4B 4P9HL 3KXFA 4QHKI 5J6GA 4NHCH 5IFJA 1B6UA 4J3TA 5TE6L 3WBDA 1HZHH 4H1LB 1FORH 4KVNH 2UVEA 3LKPA 1OLZA 3QNZA 4U6VL 4J6RL 1SQ2N 4LVHB 2QKIB 1YECH 3OAZK 1JNLL 5FDWA 1ZOXA 1Q9KA 3CLEH 5D7LE 43CAB 1IAOA 2R1YB 1K8DA 2YRZA 1KXTB 1LE9B 3EBAA 1YMMD 4PTTA 3VFWA 1P7QA 3MRKB 2ZUVA 4L9LB 1T21B 1Q0YL 1AKJA 2IAMC 3EAKA 4WO4B 1AR1C 3U6RA 4JKKA 1MCOH 5JW3H 1EXUB 4MJ6B 2ZP0T 3V0VA 1KCVL 3PHOB 3SBWC 5T3XH 2ADGB 4P2RA 1MCWM 1NFIA 5GRJH 4JKPH 4PJ5E 2L0DA 4ZFZB 5H2BB 3ZDXE 1F4YH 3QXAB 3JWDC 1ZT7B 2KZ1B 3QEHA 1NEZB 5DC9B 4ZNCD 3ARXA 4WU5A 5HGDB 4F15C 5K9JL 3ZL4L 2ERJB 3L3DB 3K8LA 4CKVX 5ILTL 2OM5A 4P23D 4P2OA 1F3JA 3H9SD 4XNMA 2OMNA 4YFEA 2X9WA 1P5VA 1I3RA 4OF8A 5C0CA 2Y06H 5MP6H 4WTZA 3E2HB 4CJ1A 2WUBL 1NCDL 3U7WL 4PRHE 2A2QT 1RUAH 3TBSB 5J3HD 4IRZH 1NBVL 1RZKL 1OAZH 3KXFE 4LCYA 2IQ9H 5T1LB 1KJ2H 2YPVL 2AV7A 4JFHE 2NXZD 1CXIA 1XR9A 1BFVL 2R29L 4HS3B 2ID5A 4OIIL 2K7QA 4GFTB 1R3HA 5DT1H 4Z7OE 4CRPA 4OZ4B 3SJVB 2NY7H 3CSGA 1TFHA 3LPFA 4Q58C 3T09A 5D1ZB 4R4FL 2YD5A 3V2AR 2FBOJ 4ODUB 2APWA 3DROB 3O4OB 4D3CH 3RP1A 5JW4R 5F88B 3QCVH 3DX9B 4X5XA 3DRQA 4N8VA 5D1XB 3TJEL 4LGRB 1J8KA 1QSVA 5BOPA 4HWNA 4JHAL 3N9GL 3MXVL 1VACA 3X11A 3TIEA 2BRRH 3CH1B 2X1QA 5KS9A 3QUML 1UWXH 4Q0XL 4QRQA 3MLYL 2P5ED 4I0CC 4WU7B 3HC3L 3KPTA 4L8SC 4X4MA 4RAHA 5DD1L 4UDTA 3MRLB 5JQ6H 5D7JB 4POYA 4TYUA 3VFGH 3TNNA 1FIEA 2GT9A 4OI9A 4X6CF 4NQCB 5EC1B 3V6OC 2WZPD 4RMVA 4KK9D 5ID0A 4PUBH 3W39B 1FYHB 4UAOC 4S0SD 4K71C 2Z8VC 3FCTB 1YJDL 4Y16D 4MWFA 1GOHA 1XGUA 5KVEH 1D5ZB 2VDLL 1OB1B 3OF6D 1U8NA 5C0CE 2E7LC 1A3RH 3PP4L 3B2UC 3O6FA 2R23B 2Q7NA 3CMOL 2AV1A 3E6FB 3LS5L 2C1PB 2MHAA 1IGJA 1S8DA 1MLCB 1H3WM 3NN8A 5KVGH 2ORBH 2X7LB 3QI9B 4PJAA 5J9PA 4LGPB 3RVUD 5IWLA 3LQZA 1PD6A 3NTCL 1ZHBB 5D2NA 2Q6WB 1KLGB 1MWAL 4TOYL 2YHGA 2LU3A 4Z7NF 5DEZA 3VXNB 3I3DA 5DMGD 1LNUA 4UTBL 3FQNB 4E42B 4JJ5A 3UPCA 2ZOLA 4OCXH 2CLRB 4Y8AA 3B9KB 3WFEL 4KZDH 3V95A 3GSQB 2XI9A 3WIHL 3KHQA 1I9EA 4NRZB 1IGIH 2UUDH 4PJ8D 4HPOH 2NY6D 2PNDA 3V6ZA 3C5SA 1BD2A 4P4KA 4Y4FC 3SDDB 1U8JB 1KEMH 3RWDB 2UWEF 3S3SA 2HJLA 4IJ3C 1TXKA 3SCMA 1HNGA 5EU4B 5KS9E 2FECI 3QYCA 5I1DA 4X4ME 4ZTOL 3CX2A 1AJ7H 3FT3B 3EOAB 4N8CL 4HD9A 3BZEA 5C8JB 1JWUA 4GRWF 4HLJA 5D70H 1OAYH 2OR7A 1A2YB 2XV6B 5I18H 4MS8C 1Y18A 4PY7B 4JO2H 4NO0B 4LLVB 2B7DT 4ZYKA 4KU1A 2ZPKL 3U4AA 2AJZB 1ZVSA 4IMKC 2BVTA 4KROB 1AGBA 1GPOH 1B88A 1FL5A 5CIPB 1HIMH 3CFEB 4O2FA 5IKCA 4YJZL 3T0EC 4YXHH 2D7PA 2ZUQB 1RK1B 1CBVH 5ETUB 3SGEH 3FQWB 1TZIA 2ZUYA 5I1HH 3BDBA 4HPYL 3EFFA 3QDGA 4PJAE 3FO1A 4GKZB 1FFNB 5BW7C 2DI8A 3RWJA 4RFNB 4W4NA 3BO8B 3S5LB 5D2NE 1UGNA 3VI3F 3PF2A 1EZVY 1L0XA 2XY1A 2NY2C 1GZQA 5GGRA 4AEEA 1NCAH 3ARED 3K8MA 4O02H 1U41A 4OF3A 1HQRB 3QXTA 4DGIH 1CXLA 4OCLC 1JGDB 4OT1H 2EYTA 4Q97A 1S9WB 3BPOC 3V5KA 4JY6B 2R1XA 2ZSWB 4GAJL 4XP6H 4XXCA 5HPMA 1OM3H 1KLFA 4J23A 4NKIL 4AL8L 2EDTA 3VGAB 5HSFA 1R3KB 1U58A 5DLML 1PBYA 2QQLH 3KNBB 1XCTA 3HCVA 2XXMB 4P46B 1G1YA 2VSCA 4J7RA 4HIEA 4UTAL 2MWCA 1HHKB 2AK4B 3QIUD 2OK0H 4JHBA 1D9KB 4BFIA 3EYOB 2WLYA 5F6IC 3GMQB 1P4BL 2XA8H 3BZFB 1SHMA 3ISWA 4PGEA 5CP3H 1CICA 3X17A 1WZ1L 3UJTH 5D1QD 5IK3B 4JRWA 3OGCB 1GHFL 2HLFD 1CZ8H 3I3BA 1SM3L 4XNZC 5E9DA 3VRIA 2FRGP 4NOFA 5EZOL 1RVFL 5L2KD 4OZFA 4P2CG 4YHYB 4GS7B 3WJLA 5HPOA 1OSPH 2EDQA 1A7OH 4XMLL 1DBKH 3QEQB 1I9RH 4XCNB 4L9DA 5DJ2B 1QSFD 1ZHLA 4U1JA 2G75B 1BAFH