4OD2B

Crystal structure of the fab fragment of an anti-dr5 antibody bound to dr5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
214
Chain Sequence
EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSGINWQGGSTGYADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDYWGKGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/immune system
molecule keywords Fab fragment of drozitumab, light chain
publication title Structural and functional analysis of the interaction between the agonistic monoclonal antibody Apomab and the proapoptotic receptor DR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 214
sequence length 222
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B01
2B8OT 3ZDYE 1PYWA 1TZHA 4GXVL 3U48A 2WUBL 1O0VA 5FCUH 1JN6B 4MXWH 5KVFH 1H5BB 1Q9OB 3ZHLA 4PJFF 4AG4L 1XGYH 2DQJH 4G6AC 4KPHH 1NEZA 3BUTA 1UZ8A 5DUBB 3QEQD 3GGWB 4U1LB 4U7KA 5AG9A 2ITDB 1R5VA 2NNAB 5JA8B 2C3HA 4PY7A 5FF6A 4PJGE 3CVIL 4PLJC 3BSZL 1V3LA 3MYJB 5E00B 5KSAB 3QPQC 1KEMH 1XR9A 4AQOA 5GSVB 1D6VH 1PG7L 3QUXB 4G8FA 3T65B 1YEFH 5CSGA 5D70H 5ELIA 1L6XA 5E5MB 3U0WL 5IESH 3EOBB 1S7QB 4PRIB 5D8JL 2Y5TB 5IB3A 5KSVB 1XIWA 1B9ZA 1QSED 4P48A 1WIPA 3PG2A 1QG3A 3BGFC 3EOAA 1AGBB 3VI4E 5JXAH 2VB5A 1FH5L 4P49A 4ZYKA 1ZLSH 5L88H 3HRZB 4S1SL 3L3DB 5EBMA 1YMMA 3WIFA 5GZND 4FFYL 4YK4B 1EGJH 3U36A 3BW9B 1UWXK 1HEZB 3VFSB 4H88L 4Y5XC 1ND0B 5F9OL 3MLVH 1I3GL 4XP5H 1P9MC 1KCRH 1AR2A 2PXYC 1II4E 3QDJA 5DS8B 1OB1A 2BOBB 3O2VL 4TUJA 2AK1L 1CG9A 2OJEB 5AEAA 3J8F7 2VN7A 3FFCD 5EU7C 4CMMB 2VZSA 1KCSL 1W0WA 3GSNL 5JQ6H 1ZT1B 4D9LH 2OLDA 2HG5A 1OT2A 3N50A 3EJYC 4P4RB 2UZYB 1WWBX 3ZLQC 4F33A 9CGTA 5ACMA 1C08A 4ORGB 4QNPE 5GJSH 2XTJD 1KYOJ 5DDHB 4RWHA 5FCSH 1K8IB 1E27B 1A9BA 4ODSH 4JJ5B 5DI8A 1AFVH 4JVWA 1MREL 2WW8A 4PP1D 4N9GA 4I3RH 4FFZH 1MPAL 3D39B 1LK2A 4JRYD 1X7QB 1MHPH 1I9EA 4DN4L 2H1PL 3DIFA 1NCWL 3TM6A 3A6BH 4KDTC 2EIEA 1F6FB 5KSBA 4MSWA 3GUTA 5SWZE 3ZT7A 3AREC 2V7NB 4I4WA 1YY9C 4HEPG 3V4UH 5IKCA 5DA0B 1BFOA 3UO1H 2GEEA 3ARBD 4OM1L 5BQ7A 5J56B 5E6IC 3VWJA 2C1OB 2ZJSL 5DFVC 3N1GC 3U0TA 5F97E 2B39A 4GW4B 4UV7H 3O6FB 4K7PY 1YN7B 4YE4L 1MCWM 1G9EA 1QFHA 1CGVA 3I6LE 5IMKB 5HI4C 3T2PA 3E2HB 3ALXA 1WBZB 3VWKB 4PJDF 1EIBA 1F6AA 3GSNA 5KVGH 3GMPB 2FLRT 5EZIL 2DLFH 4L3ED 4ZXBD 1EZVX 2Q3AA 1NGXB 4D94A 3ILPB 4W70A 5DVMA 2C9AA 4L8CA 3M17A 5DJ0B 3W5MA 3MFFB 1G0DA 4RFEA 1ULVA 2NY1C 4QYOB 5CINL 4B0MM 4GG8B 5AAMA 2Q1EA 4D0CB 2PCPB 4LCIH 5HYSA 4GAGH 1I8LC 2WM0A 2Z8RA 1BD2D 2OZ4L 3QB7C 3KPRA 3LEXB 2A38A 4CGTA 1CFSA 4TQEL 3P77B 3KPSD 3MLXL 3WBDA 4JG1L 4EI5A 1FZMA 3OKDA 1CR9H 5F89B 3RTQD 1KLUA 3UX9B 3DURB 3FJTA 3MV9A 2I60L 3AB0B 3K8KA 1W0YT 3LCYA 4QRPE 1VFAB 1ADQL 3LIZH 5I15L 3G08B 3BJLA 4JFOB 3ALPA 4Z77B 1ZXQA 5I9QB 3ULVD 1H5BA 1Q9OA 3O4LD 5MP6H 2YPVH 4MDIB 2P49B 4JFDD 1MCBA 1Q38A 1TTFA 5DUBA 3GGWA 4U1LA 3MLZH 4JN1H 2ITDA 5J12C 5HHMD 4OCXH 3M8OL 4Y88A 5ID0B 3JV5A 5CLTA 3RWCB 5IHUL 1MLCB 1A5FH 3MYJA 4HW6A 1W8NA 5E00A 5KSAA 4FZ8H 4RAHA 4KHTH 3FRUB 2JB6B 1TIUA 5GSVA 1AHWC 3QUXA 3T4YB 3T65A 3V6OC 4NQDD 4JM2B 4CU7A 1YEHL 4WRLA 3EYQD 4Q9CA 2D7PA 2Y25A 4LQFL 4KAQH 2D7NA 3TVMC 5IJKC 3QRGL 5E5MA 4YHNB 3EOBA 1OQOA 1KC5L 3JWDL 1S7QA 4GT7A 1SM3H 4PRIA 1JHTB 3MUJA 1NJ9B 3VDAA 5KSVA 3RDTD 4LU5L 4NGHL 2E7BA 4KK9D 4QF1B 3T04D 2OZ4A 4JR9L 4FMKA 2PN5A 1OLZA 1AGBA 1K4CB 3TZVB 3DMMA 4APQD 4HFUH 1F58L 4Z0XB 3MRNB 3PWLB 1B6UA 5IFAL 3BP5B 2FEEL 2X2YA 3HRZA 2ICEB 5C9JB 4Z95H 2JIXB 1BEYL 5FUOH 1RUPH 4FQCH 1ADQA 3DVIA 1KIUA 3DUUB 1I7RB 3Q1SL 3BW9A 1HEZA 4K7PH 3VFSA 1V3JA 2G2RB 4EQ3A 5IMOB 1QLEH 1S7TA 4FS0A 1ND0A 2DD8H 1MCHA 4NKMB 2NZ9D 5JMOC 1X5YA 2XQBH 1CE6B 5DS8A 2DQTH 2BOBA 1C5DB 2YOCA 4AEFA 1Q0YH 2XXMB 2OJEA 4YDVB 3RI5F 3T1WA 1X5XA 4O5LH 4DUVA 3BN9C 1TVHB 4CMMA 3G5YB 4Y19A 5IK3B 3RI5K 4ISVB 3EYOB 4PTTB 1ZT1A 1LEGB 5KOMC 5ENWB 4OUOA 1NCCH 4XNYL 4P4RA 5DD1L 4BK4A 2IJ0C 4YHML 4ORGA 1FGNL 1S9WB 3RWDB 4YXLL 1X9QA 2VDNL 3HR5B 5DDHA 4LLDB 1X44A 1UWGL 1KGCE 2B7DT 1K8IA 1E27A 3QIBC 4XZUB 3UAJD 4QEGA 3BD5A 4JJ5A 1GC1C 1RD6A 3FQUB 3TV3L 4PJ8D 3D39A 4KKBD 5BRZD 3WIHH 4OUUB 5IB2B 1X7QA 4YX2H 4JY5L 5IFJB 3MODL 1GOFA 3F7YB 1CYGA 4UQ3B 1IC7L 4OZ4B 3BZEB 3OG4B 4RGND 2V7NA 3HUJF 1HOCB 4WI9A 2KKQA 3QT2A 4CUCA 1T1YB 1TLKA 2DQUH 2EC8A 3IDXL 5EC2B 2C1OA 4XAWH 4JVUA 4Y1AB 4WTWA 2IH3B 4WCYL 5E6YA 3O6FA 1NBQA 1YN7A 3MBEC 1BOGB 3HB3D 5M7QA 2EH7H 2MKLC 4AEEA 4K8RL 3HI6H 5IMKA 5C71A 4OZGF 1WBZA 4UZGA 4S1RL 1MLBB 3CLFH 3GMPA 3HMXH 4P9HL 5CD3B 1NGXA 1FQ9C 3RQ3A 4L4TB 3K7UA 1R3IH 3ILPA 1LO5B 3CD4A 5DJ0A 4WWKC 3MFFA 3QSKB 3D3VD 4GG8A 4ZSOB 4D0CA 2PCPA 3GI9L 3TT3L 2QSCL 5EG6C 3SDDD 1DBMH 5DJ2B 4G6KL 3LEXA 1YEGH 4BH8B 3P77A 1J10A 5CJQL 4Q0XH 3BISA 3IFLL 3WLBB 5F89A 1HKLL 2AKRB 4ONOA 2HT2C 3KVQA 3DURA 1S7SB 2YD3A 5B3JF 5C0AD 3STZB 3NABL 3ILQD 1UM4L 1WBXA 1VFAA 4KGJA 4AMKH 3SQBA 2VDOH 3G08A 3U9UB 3N85L 3WNLA 4JFOA 5HHNB 4M03A 4XVTH 4V1DB 4M93B 2IF7A 1ZTXH 1Z9LA 1HE7A 5FYKD 3EUUA 3H2WA 4MDIA 4PJIB 2CUIA 3CFKB 3ZE1E 1QBMH 3CXDL 1Q1JL 2FCBA 1UEMA 4H5SB 2X89D 5ID0A 4LBEB 5E8EB 1P7KB 3RWCA 1MLCA 1RZ7H 2P8MB 1YY8B 5EH1A 2LU4A 3FRUA 5HY9B 2JB6A 3X11B 2AJSH 3T4YA 2V2TB 4JM2A 5IVXE 3QUZB 5E95B 2DM2A 3QIWD 5TPWH 3UTSD 1J12A 3E8UL 2ICCA 4YHNA 2A2QT 3OZ9L 4XPGL 1E4KC 3WJLC 1P4IL 1JHTA 1NJ9A 3B9KD 4XPTL 1UCBH 3O6KL 5L7XL 2B1AH 3RL1B 3VGEA 2D7TH 4DQOH 4QF1A 2PTTA 1LILA 2CLZA 2NR6C 1M1SA 2JB5L 4AQ1B 1K4CA 3TZVA 1E4WH 4NBZB 1IGCL 3MRNA 3PWLA 3K2UL 2B20A 3BP5A 3MLRH 4AIXA 4RFNB 5C9JA 2ICEA 1IAOA 4MJIB 4OGAC 2JIXA 2F5AL 3QUYA 4ZG1A 4NJAL 3O3AB 1WITA 2VWEE 5TE6H 3DUUA 1BAFH 1I7RA 1O7VA 4UILH 5HDQL 2G2RA 5IMOA 3CZFB 1N8ZA 2KQNA 3BKMH 3ESVF 4OFKA 2W9LA 2X7LB 4PGJA 1EERB 4O2FB 3PWPB 1KNOB 4NKMA 2QV2A 2VLKE 5AD0B 4CJ0A 4L9LC 1CE6A 5L2KB 1PD6A 1C5DA 1UM5L 4M43H 2ZWLT 2GTZB 1JVKA 3PGFH 1FZOB 4YDVA 1A64A 5KVEL 1GJIA 3DX9A 1TVHA 3NH7H 5HHQB 3G5YA 4OTXL 5IK3A 4ISVA 3EYOA 2VDRL 2VH5H 4PTTA 1LEGA 4Q9QH 2CJUH 4BSJA 1IQWH 1OW0C 4XCFH 4XBGB 1LE9B 1S9WA 3RWDA 1B4JL 4JO2H 1KT2B 5IP4A 4LLDA 4KK6D 1REIA 2NCMA 4XZUA 2IFFH 2V9RA 2EDRA 4Y89A 2IAMB 4ZAKD 3FQUA 4P2QD 5F70A 4Q9BA 2BVTA 4XNZB 2OL3B 5E2VL 1F13A 4HD9A 5TE7H 4OUUA 5IB2A 1VSCA 2X4NB 5IFJA 2H32H 4IRSB 2A6JB 4PJAE 3F7YA 3TA3C 4UQ3A 3BZEA 4HWBH 4OZ4A 3TLRA 2ZCHH 3MSPA 4CU8A 1HOCA 3LS4L 4Y4HB 1KG0B 5ADPH 3HAEB 1T1YA 1EAJA 5EC2A 4WV1C 5EIIB 3QH3B 5L6YH 2ESVD 4XBPB 3TO4D 4Y1AA 2IH3A 4KI5D 3NPSB 2HRPH 3P30H 1YEIH 4TULL 5E99H 1S78D 1MCPL 4K9EC 5DUMH 3AVEA 1F8TH 2OP4L 1QBLH 1SMAA 3PP3H 1L7IH 1IGFL 5B4MC 1MLBA 4JM4H 5KZCB 3MGOB 4FQJL 4UMGA 2VWEC 4UT6L 5CD3A 4JPWH 2DQEH 4L4TA 2VLJA 3P4MB 3U30C 1LO5A 3I02B 3LEYH 3RAJL 1BP3B 4NKIL 2EIDA 1KJVB 1NUGA 4ZSOA 1AY1H 5CGYD 1FRGL 3BRDA 1E6OL 1RUQH 4IS6A 4YBLB 5HVHB 4M9OA 2XG5A 4ZNEE 1YPZB 3L5HA 3MZTA 3WLBA 3REWB 3WUWG 3WHE0 4XT1C 1GIGL 1S7SA 2JJTC 2FIKB 4NQCE 3MREB 3STZA 1I75A 1KIRB 5ADOH 3SY0B 2ILLA 4NNYB 5GIRB 4JFFE 4QOKA 5HHNA 3BPOC 2HKFL 4FABL 3D2UD 4Z7WF 4PYGA 1GGIH 2ZUXA 4V1DA 5ILTL 4EI6B 4I1NB 2OTWB 2N7BA 4PJIA 3B5TA 3ZHDA 4P2OB 4XMLH 1I3VA 1FCGA 5CZXC 4UOJA 1FGVH 2M8XA 1JFQL 5C0RH 5I76B 4H5SA 5BZWB 3FMGL 4LBEA 5E8EA 4R4NC 1P7KA 5D2NC 4O02H 4CDHA 2P8MA 4Z7VA 1YY8A 4OF0A 5HY9A 4MA7H 3X11A 3WDHA 2WQ8A 2YKLH 3QUZA 1G9ML 4QHKJ 3T08A 4YHZH 5DMGC 1XGQB 2F54E 2AK4D 1D7FA 1B2WL 3RL1A 1RZFH 4DFHA 4O4YH 5D7IE 3W11D 1VGKB 5T5FL 1DVFB 5CP3A 2OL3L 4JEGB 4OQ1A 5JOEA 1UWEL 2F15A 5I1GL 2A6KB 3BIKA 4X6CB 3FOMB 3A0OA 1UH4A 4MJIA 3VXUB 4QXTB 3CFIC 3ROOB 2AEQL 1FSKC 3SE8H 3ZL4H 3ARFC 3HZYB 5C0NC 3O3AA 1A7QH 2RCSL 2FH6A 3CZFA 5D7JC 4XBEL 2X7LA 5JW3L 2FEEI 3QG7H 2GTWA 4FXLA 4NWTL 2DQCH 4O2FA 3OGOE 3PWPA 1J5OH 2P43B 2C1PA 5AD0A 4ZUUA 2VDQL 5L2KA 2P4AB 1P5VA 5HYQB 3QHTC 1K85A 4RX4A 1O7SA 3ULUH 1FZOA 3H9SE 4FOMA 4ELKB 4JRXD 3WFCH 2F19L 2XN9E 5HHQA 2X5PA 3JXAA 2VZVA 5DHVH 4K7FA 4JFXA 5ANME 4PJ9D 5H37H 2OJZL 2YSSB 5GGQH 4LCWE 4KK5D 3S35X 4OFDA 5JMRA 5K9JH 1IT9L 3HI5L 4XBGA 1LE9A 1U6AH 1F5WA 1KT2A 1UB6B 4PJGF 2UWEE 5BVJB 5HHVH 4KQ3L 5JORA 1DSFL 1P7QD 1I1CA 3RNQB 3A67H 4F7PA 2OL3A 1NLDL 1DQDL 4LQ1A 2QQKH 2X4NA 1BVLB 5MERB 2DDQL 3L1OL 4IRSA 3D6GA 4HDIB 5FYJE 2CUMA 4IRJC 4MHHI 4GW5B 5SWQA 2CXGA 1TETH 4Y4HA 3WSQL 5IWLA 1KG0A 1W0VB 2BY0A 2XZQH 2ARWA 3HAEA 3KHQA 3KYKH 4F9PC 5BOZG 4G6ML 2A1WH 5EIIA 4UTAH 4XBPA 2VXVH 2OS7A 3ARRA 4LRNH 5D93C 2ZUYA 5DZNA 3RY6C 2D4FA 4HUUB 3NFPB 1BWMA 1PGRB 2W9DL 3B6SB 5DRWA 1R0AH 3CVHH 1OTUC 4GXVH 3SCMD 2WUBH 3X12A 4ELMA 1AC0A 3ARSA 3OJDB 3P4MA 1CBVL 3I02A 1A0QL 4AG4H 5GS3A 4S1DD 3HE7B 2EE2A 4LSPL 5TH2B 3VGGA 3CVIH 2ERJC 3BSZH 3MV7D 3ZKSD 1YPZA 4QNPF 3VRJB 5DUPH 3G6AB 4R2GD 1T1XB 1F2QA 5GS2D 3REWA 1CZ8H 2FIKA 3MREA 2E7HA 4G6FD 4WVRA 4YDKH 1R3LB 2N4IA 4PYHA 3F62A 3U0WH 3OJMB 3SY0A 4R0LB 5J3HC 4NNYA 5GIRA 2AJYL 3CX5J 1M7IB 5D8JH 3S36H 2Q86A 3IKCB 4EI6A 3DXAD 2KDGA 3RA7H 3BEWB 2Z92B 4HT1L 2OTUB 4DTGL 2QHRL 2X1WL 3IYLW 4FTVD 5D5MF 4P2OA 1ZGLM 1EO5A 2CXKA 1OGTB 5DD3H 3T4AA 2ZCLH 5I76A 3RWJB 1NCDL 5BZWA 4MXVE 1FP5A 4DVBB 2AJXL 5IOPB 5B3NA 1FL3B 1QHPA 2OR9L 4S1SH 1UC6A 3VMNA 5C92A 4FFYH 4WGVB 4NO0B 3V6ZB 3QP3A 1IC5H 5IV2B 4M7JL 4H88H 4U1MB 4FQXB 3K1DA 5C0CE 1I1AD 3KLHD 3Q5YA 1I3GH 4K3JH 5J9PB 5F6HJ 1XGQA 4I0PD 4J3VA 3O2VH 5DK3A 5D1ZC 2EDEA 1UT9A 1VGKA 1DVFA 4MMZC 4J23A 1AIFB 2PYEB 4GBXC 1OVZA 2IBZY 2A6KA 4X6CA 3FOMA 5KBNC 2DIBA 4CKVX 5FA3B 3VXUA 4QXTA 3ROOA 3HZYA 2HFGH 5MEOB 1FNEB 3ULUC 4KI5F 1MJJB 2EDYA 1NGYB 1PZUB 4OGYL 2YBRB 3LKPB 4GG6B 3MO1B 3TNNB 3I75B 5CEZE 3U4AA 4CADB 4NSKA 1MREH 2X4PB 4PTUB 1QRNB 4ESKA 1MPAH 4H8WC 4J12A 5TQ0H 4PJHA 5HYQA 1RUMH 4OAWB 4HGKC 4Z76B 1UJ3B 1VCAA 4ELKA 4DN4H 1KPUB 2H1PH 5KVDH 5DEZA 5F71A 3LPFA 2JCCE 5DT1L 4JO1L 4JQXA 3EYSL 5DEFB 3AAZB 3FHQA 2YSSA 1MFDL 5C0EB 3QQ4B 3VXSA 4OM1H 5HI5C 4DUXA 2CRMA 3CAFA 5BVJA 1YMHB 4PGDB 3ZDZF 3DTXB 1FFRA 1FYTB 3RNQA 1UG9A 2BMKB 4AL8L 4U1GB 4L3AA 5B39B 5HHOE 5FHBL 2CDGA 4Q2ZB 4YFEA 5EZIH 1XIWC 1XGUB 2FATL 3UJIL 4HDIA 5C09E 2EDKA 4DUWA 2W0LA 1UZ6E 4GW5A 4HJ0C 3O0RL 1UM6H 1QLFA 3J7HA 1RHFA 1W0VA 4LASH 4CVZB 2E7LA 3NCBB 5D7SL 1JNLH 1NMBH 3HG1D 4TQEH 4JG1H 1X4ZA 3SE3C 3MV8E 3QFJD 5I19L 4P0DA 1JGEB 5GRJL 4HUUA 3JWOC 3NFPA 1D5IL 5E4EC 2I60H 4PG2C 1X5IA 1ADQH 3B6SA 4P99A 1X5KA 2RJMA 1QACA 5HHXH 4WI5A 4PJXF 4AH2A 3KPRE 2UUDH 3O81A 2FDBP 3U4BL 4GKNB 4WUUD 1T5WB 2HJFB 4RNRB 4BFIA 2XTLA 4O51B 4WFHD 3T0BA 5TH2A 1GGCL 4LGPB 3MJ6A 3M8OH 5E9DE 4X4YB 5IHUH 4P23D 4J1UB 4E41E 3VRJA 5FYLH 4TUOB 2HFFB 2Z93B 1CU4L 1T1XA 4LPWA 3JV4B 5LVEA 3N06B 4M5YL 4MHHG 4P46A 4LQFH 3MA7B 3G6JA 5FKPB 1ORQB 5J0BA 1R3LA 2LTQB 3MRBB 3QRGH 4R0LA 2NY3D 1D9KD 3V4VL 1KC5H 4PRBB 1M7IA 3T3PE 4MX7B 5LGHH 3IKCA 1S9KC 4KRMB 4QY8B 4NGHH 2XQYG 4OZHF 3BEWA 2Z92A 3LPGA 3VGHA 2OTUA 3NCJH 1CFVL 5CCKH 4LVEA 1OGTA 1F58H 3TH4T 2OBGA 3RWJA 5BXFB 5IFAH 2J8HA 4KU1A 1MF2L 4Y2DC 4N0CC 1M4KA 4DVBA 5C2BL 5IOPA 1FL3A 1U42A 3VWJC 4N1HB 4S11A 4NO0A 3GSRB 3V6ZA 2BDNL 2FJGB 4KTEL 5IV2A 1BZ7B 3BDXA 4GKOA 4NZUL 4OCWL 4U1MA 4YFLF 4FQXA 5I74C 1ZMYA 5FK9B 4B7LA 3BKYL 2BHZA 4XAKD 5J9PA 1L0XA 3JTSB 2BY1A 1QNZH 4LMQI 1WF5A 3RU8H 4N0UB 3EOYG 2DQFB 2GI7A 3O3UN 2P8PB 4IIQB 5ISZD 4D9RD 1BJ1J 4RWYH 3BUYB 2QQQA 4C59B 2QADD 2HWZL 1R6VA 1AIFA 4NQEE 2PYEA 1VPOL 4UDUB 3T1FB 4XNYH 3L5JA 1W72B 5DD1H 1DBBL 4ODWB 4LPYA 4EVNB 4YHMH 4YXLH 2VDNH 3Q6GL 1I1RA 4XWOD 5MEOA 5CFHA 1FNEA 1UWGH 1MJJA 3TJHD 4OCNC 4NNXB 1NGYA 2DKMA 3P3YA 5MI0B 2A83A 2YBRA 3LKPA 3MO1A 4Y19E 3I75A 3TNNA 3U82B 2X4PA 4PTUA 3PJSB 1QRNA 3TV3H 1GXEA 2IPTH 3DSFL 3L3OB 4OAWA 2DJ4A 2ICWJ 4Z76A 1UJ3A 4JY5H 3D9AL 4K7PX 1KPUA 3MODH 2N56A 1H5BC 1A1NB 1IC7H 5DEFA 3AAZA 4P5TC 4HUWB 3GBNL 4ZS7H 5C0EA 3QQ4A 1V8HA 1KENL 2ADGB 3RIAF 5HPOA 3EOTL 2O5ZL 3HE6B 3IDXH 2NY6B 3QXUA 3RIAK 1YC8A 5CIPB 3WXVL 1HQRB 3GMRA 2X42A 5KSAC 1YMHA 4PGDA 4WCYH 4PRHE 3DTXA 2FO1A 5C0BB 1FYTA 3PL6D 3QUXC 1J0KA 3SDYL 2VSCA 2BMKA 4K8RH 1G0YR 5B39A 2R4RL 3P2TA 4Q2ZA 4S1RH 5T1DH 5T3XD 3BKCL 4WHDA 4OF5A 1G6VK 1H3XA 5CILL 3DMMC 3HNVL 2QQNL 1OTSD 3O3DB 1RIVL 5IEKA 1FNGA 4CVZA 4KROB 4XX1E 3GI9H 2GFBB 3LMJL 2QSCH 1CXIA 1I3RB 2GJ6B 4G6KH 5J89A 3RBGA 5HPMB 1AO7D 5F7YC 5CJQH 4XHJD 3MCLH 3CC5B 3IFLH 1E28B 1HHJB 1HKLH 1JGEA 3DGCR 4PJDB 1T4KB 1IAIL 3WEXB 2W91A 3OTTA 4G43B 4DJMA 3GMMB 1UM4H 4UB0H 5DEGB 5T1LB 1S3KH 5C08D 3V0VB 3N85H 4PY8I 4ENEC 4ZNCD 1H3WM 2VLRE 2YD2A 1DEEB 5E1HB 4GKNA 1U95B 2NW2B 1T5WA 2HJFA 4RNRA 3L9RB 2D2OA 3SDAA 5B22A 4E5XA 2EXYC 3CXDH 1FBIL 3B5GA 5DHYA 3D0LB 1IGIL 5CEYB 4X4YA 4J1UA 3CFJB 1FE8L 4TUOA 3JWDC 2HFFA 3IVKB 2Z93A 5D1QA 2PYFB 2JJSA 5I0DA 3JV4A 2A9NL 1W72L 5I66B 3RVVC 4BQCA 3MA7A 4NHCL 1VACB 5FKPA 1WFNA 1ORQA 2DIJA 4JFQB 4KRNA 3MRBA 3OZ9H 4HGWB 1JF5A 1P4IH 4N5EC 4PRNB 3BYYA 4PRBA 3CX2A 4MX7A 4PJFA 3VA6A 4XPTH 4HKJB 2FWOB 5L7XH 4QY8A 4X99B 1MSPA 2JB5H 2YZ1A 5EORL 3P11L 25C8L 5D6CB 15C8L 1FN4B 1IGCH 4OLXL 3OKEB 1FC1A 3K2UH 5BXFA 5HXMA 3DRQB 1G7MB 3QDMB 3EYVB 5F1IB 3NMEA 1F90L 4NJAH 5DGRA 5HDQH 1BZ7A 3QI9B 3S37L 4XTRC 2H3NA 5FK9A 2R0KL 5FYKU 3JTSA 1JP5A 1XCTA 1J1OL 2DQFA 4IIQA 2P8PA 5FM5M 2UYLB 1U41A 3TN0B 5KVEH 4FXKB 1J0IA 5DMYA 1LWRA 2E6PA 4OFYA 2VDRH 2NY2B 4UDUA 3T1FA 1H8NA 5JIIA 2X9XA 4DCQB 1W72A 2Z31B 4ODWA 4UNVA 3DX6B 4EVNA 1EFXB 4KHXL 4Y16D 1P4BL 3BRFA 1B4JH 2NY7L 2MMXA 3OXSB 4JQIL 4RMVA 5DO2C 4NNXA 2P45B 1ODAA 4TNVK 3L5XH 4EOWH 3RGVC 3AB0C 3WIIL 3BT2L 3PJSA 4M7KH 5HI3C 5TDOB 5E2VH 5EB9A 3NZHL 3DBXB 3L3OA 4FQIH 4YXKL 1A4KB 5IFHL 3ZT6A 1QHOA 4M1CD 3FT2B 1LD9B 5I9QC 3IKKA 3FT3B 2J4WL 5EOQL 4WU7B 1A1NA 4FQ1L 3BE1H 5FAAA 4KTYA 4HUWA 2P24B 2L7JA 3LS4H 2VR5A 3NIGF 1UQSB 4BQBA 1D5ZB 4JKPH 3HE6A 5CIPA 1HQRA 4GAFB 4JFEE 2V2XB 3VI3E 5BO1H 4P9HC 5KN5B 5E8NB 5C0BA 2NZIA 3RVUD 4NN5C 4JM2C 4TULH 2W0PA 4AYFA 1MCPH 2R9HC 4JHAH 3KR3L 2OP4H 4RBPK 5I18L 1P69B 3PP4L 4P2CG 1IGFH 3E3QE 5E08L 3L6FB 5HDBE 4UT6H 2BJML 2C5DC 3OKOB 4HZLB 1GSMA 3RVWC 4YHKL 3HUJB 1X3DA 5D7IF 5HGHB 4O00A 3TZVC 5T1MB 3O3DA 3V7AE 2FR4B 3HMWL 1FG9C 4LPXA 3QPQD 3KJ4C 1FRGH 3QUYC 1I3RA 4Z7QE 4WO4C 4YH6A 1E6OH 5HPMA 2I9LA 3HAEG 2FX8L 3CC5A 4H26B 4I13B 1E28A 2CD0A 4OZGB 4U33A 2VLJE 1BQUA 1BM3L 1U8PB 3QDGB 4PJDA 1GIGH 1T4KA 3WEXA 4QRRB 2Z9TA 1S7WB 4G43A 3S98A 4NQVB 3GMMA 5DEGA 1ZS8B 5CAYB 3V0VA 1MFBH 4C54A 4KJQC 3R8QA 1HYRC 1T66D 2HKFH 4HBCL 5ILTH 1DEEA 1U95A 4LKXB 4DEPB 3ULVH 2D31B 2NW2A 2JJVA 5F1SA 3L9RA 4C4KO 3OBAA 3MJ8B 4NT6B 4GW1B 1JFQH 1A47A 3FMGH 5CEYA 5EZOL 1U8MB 3LN4B 3CFJA 3M07A 2FECL 4KUCF 1ORSB 4QOKE 2N1KA 2NY4C 3IVKA 4I3SL 2PXYD 3DHMA 2PYFA 2RBLA 4LLYB 4F3FB 2RIKA 4PJ7B 1UXWB 4DVRL 1VACA 1G9MH 1NGQH 1NL0L 3T0XA 2WLZA 2A6IB 1CIUA 2BK8A 4HGWA 4K94L 4HF5L 4PRNA 1OM3L 3ZO0A 2ICWB 3FTGB 3OWEA 2ZUTA 2DRUA 4RRPG 3U2SB 1LP9F 1NC2D 4X99A 3EJYD 3SE4C 5T5FH 3SQOL 4Z7VE 2ED9A 3U1SL 5D6CA 1FN4A 3ZDXF 2EZ0D 1UWEH 1KACB 3OKEA 5I1GH 4N8CL 3DRQA 3R4DA 4G8GD 3VGFA 1G7MA 2GK0B 3QDMA 3QG6B 4M1DH 3EYVA 4HH8A 5F1IA 5BS0E 3KPNB 1AH1A 4ZFOB 4C56E 2RCSH 4WY7L 1HWGB 1CICB 1RU9L 2ZUWA 3QI9A 3HAEH 4ZFFB 1KFAL 2O5YL 1A4JB 3VFTB 2VDQH 5EU3B 3C60B 2WNGA 4UNTA 3AMKA 5AZ2H 4NO2B 4M8QB 2Z91A 2LQRA 4KFZC 2UYLA 4PRPB 4P57B 5C7XL 3MNZB 3TN0A 4FXKA 5E8DL 3KLSA 1T0MB 1N0LA 1RZJL 2NPLX 2OJZH 2FL5A 3NGBB 4BSWB 1TZGL 3WNPA 2AJZA 4DCQA 3PWPE 2Z31A 3SKNB 1IT9H 3DX6A 1EFXA 2HA1A 1E4XI 3OXRB 3W39B 3OXSA 43C9B 1IVLA 1DSFH 2B1HL 1HH6B 4NRYB 4MQXC 4ZD3L 3TIEB 3OR6B 4GKSB 2Q8AL 1RJLB 3SO3C 2APTA 3WLWC 5TDOA 3I6GA 3DBXA 4S1QL 1NLDH 3TBWA 3Q2CA 1A4KA 1DQDH 4TPRL 1CVRA 2DDQH 3FT2A 1LD9A 3L1OH 4QO1A 4M93C 4XVSL 3HZVB 3FT3A 1U58B 1DUZA 2NY1D 3C5JB 4D3CH 3W0WD 4E0RB 2KH2B 2X4OB 1AGCB 4MCYB 2P24A 3VMOA 3L7FA 3WSQH 3F7QA 1D5ZA 2V9TA 4G6MH 4MXVF 2EDQA 2WK2A 1H3VA 2ATPB 1UFUA 2V2XA 5TF1L 5KN5A 1LDSA 5E8NA 4Y5YB 3GSWB 3QUZC 1Z9OA 1IMHC 1CGWA 1EHXA 4Z6AT 5F8RC 3BX7C 3C2AH 4MNQE 3BH9B 1CD9B 4ZO6A 2Z8VC 1BFTA 3L6FA 4OCLC 3OKOA 4HZLA 4HZAA 4I0KA 5SX5H 3HUJA 3MRIB 1CBVH 1F4XL 3BFOA 4PJ5E 5F7EH 5HGHA 4LNVA 2VL5B 1IKNA 5T1MA 4AZ8A 4M3JA 2FR4A 4RFNC 5T5NG 1U3HC 4LSPH 4X9GA 1RFDL 4XNMB 1EBAA 2VXSH 1YJDL 5HD8D 4GMSL 3TVMD 4EN3D 4H26A 2J1KA 4UINH 2YPLD 4V2BA 4HCRH 4OZIE 4OZGA 4ELME 1ACYL 1U8PA 3QDGA 1NGPH 4QRRA 5I1DA 3NCMA 5ID1B 2I26N 3GB7B 1S7WA 4NQVA 4P59L 4ZOBA 1ZS8A 2AJYH 5J1AB 2P5WB 1PSKL 1WWAX 2VNCA 1OD7A 5FB8B 3CSBA 3UBXB 2EH8H 2F53B 4LKXA 1IAII 3IF1B 2D31A 2JCCF 2PF6A 4HT1H 2E27H 4DTGH 2QHRH 3WO4B 2GAZB 3CSGA 3B83A 3MJ8A 3ULSB 3T3ME 2HLAA 1JTOA 1NCDH 1N4XL 1R3JB 1J18A 2CMRL 5CP7A 1G9MC 2OR9H 1U8MA 2DJSA 1G7JA 2X1QA 1ORSA 5E5UB 4F3FA 4LLYA 4M7JH 1EJOL 1UXWA 4PJ7A 4JJHA 2A6IA 4S0TD 3BN9D 4FQLH 4ZS6C 2ICWA 3FTGA 4X80H 1RQ5A 1CLZL 3U2SA 1O5DT 5F96L 2IADB 1MRCL 1PG7X 1KSRA 4HUVB 2QR0B 2Y06L 3WXWH 1UZ6F 4Y4HC 1MFAL 1ZAGA 3G5VA 5DMKA 4S0SD 3ARVA 5TE4H 4TVPL 2GK0A 3QG6A 3IXAB 5L0QC 2DKSA 5JHDD 3KPNA 4AJ0A 4L8SB 3NPSC 3KNBB 3BGFB 1CICA 2DTSA 1F45A 3WS3B 4ZFFA 3BMWA 4MAYD 2C3XA 1A7RL 1A4JA 1IZKA 3VFTA 4PD4K 5EU3A 3C60A 3CFCH 4NOBA 1NFKA 4NO2A 4M8QA 2FD6L 2XWBB 4LHQB 2MCG1 3WE6B 4PRPA 4P57A 3EKCA 3LQAL 3UPCA 1FIGH 1WZLA 3VGBA 1KCKA 1QFWL 3VG9C 3X17A 2HN7B 1T0MA 1QEWB 3SDXF 3EYSH 2HRLA 3MCKB 4BSWA 4MA1B 3OKKB 1EV2E 3O3EB 1QSFD 3SKNA 3MBED 4YBLC 4LLAA 5HVHC 3OXRA 4OLUH 2W65B 4PJHE 3W39A 43C9A 1U8KB 5TGBB 2I24N 3GNML 5FGCE 4NRYA 5IMMB 4EDWL 4OIIH 4S2SB 3OR6A 4NN6B 4ZO8A 3TIEA 4GKSA 1RJLA 5CSZB 4L3EA 5CJ8A 4FG6D 5FHBH 2D4DA 3CZJA 3VXSE 4WWKD 2FATH 3T3PF 1KJ2B 3UJIH 2Z4QA 3HZVA 4P3DB 1U58A 3C5JA 1V3KA 4E0RA 1J88A 2X4OA 1AGCA 4RSVA 4MCYA 3O0RH 4WIQA 4RAVB 1B0WA 4PJGB 4NHUB 3LN5B 5GJTL 2O5XL 2ATPA 2OYPA 1Q8MA 4Y4KB 1G6RB 1OGAE 5D7SH 4OCYL 5LG1A 3PDOB 5EWIL 4X5XB 4XXDB 3F7PC 4HLZG 3GSWA 5HBBA 5I19H 1OAQL 1Y6KR 1W8OA 3AREB 1D5IH 5F3BB 1EPFA 3OAYH 2Y4SA 3BH9A 5FUCE 5E6IB 5KS9E 3PHOB 5B39G 4JPIB 3O4LA 5IBUB 5GRVK 1X4YA 3ZE2E 2VIRA 3MRIA 1ACZA 4IRZL 2R0WL 3T0EE 2VL5A 4KI1A 5DK0B 5DURB 2FJHB 4OB5H 4YBHA 4OD2B 4X9BA 4KC3B 4RFOL 1GGYA 2LVCA 1GGCH 2BVUA 4XNMA 4JGMA 1PDKA 3G5XB 2VC2L 3WS6A 2YWZA 3ME0A 4NQDA 3H7LA 1CU4H 3MUZ1 3JVGA 4FQHB 1RJCA 3AMLA 4M5YH 1G1CA 1ZHKB 4YEFA 3GB7A 2VN4A 5CBEB 1QA9B 2A73B 2VJXA 2DWEB 2NR6D 5C07E 5DWUL 1UH2A 5GHWL 4W4NA 3V4VH 2PTUA 5J1AA 2P5WA 5FB8A 3ZTNL 3UBXA 2F53A 3QXTA 4APQA 3BQUC 2ZCKL 4LPVA 3EJJX 4JQXC 4DOHE 4N8VB 4OCRL 12E8L 3ULSA 4M7ZC 4RGMB 2YRLA 3OHXA 2W38A 5BOPA 5FA4B 1JCKA 3U46B 5DJCA 4CDGC 1R3JA 3G6JE 1DANT 1MF2H 2NX5E 2R0ZL 2EIZB 3M1BB 3EHBC 1ES0B 1U3YA 2HMIC 4MD5B 1LEIB 3GHBL 2BDNH 5T3ZE 3T77B 2XPGB 4KTEH 4P2RB 1FVEB 4NZUH 4OCWH 4OT1L 4MQSB 2EO1A 3AC0A 2BXZA 4HLZH 1IM9D 2Q7YB 2FECI 4M3KB 4OLYL 3IXTB 5KAQG 2IADA 5D5MB 1T03H 1E4XH 5FO7B 1LDPL 4HUVA 2QR0A 5SWZB 3HNTH 2HWZH 4BKLB 1JV5B 1TDQA 1VPOH 4MJ6B 4F57L 5FUCC 1KJ2L 2J88L 4Q9RL 2DQHL 1J0YA 2JTDA 3IXAA 5DVOA 2Z35B 2AXGA 4L8SA 5JZ7D 2AI0L 3Q6GH 3T0EC 3KNBA 3FL7A 2FEDD 3WS3A 4LEXL 5F3HA 2BZDA 4HS3B 1G6RL 2PYEE 5MEPB 2EECA 4NCC2 1C5BL 4NQSB 3F58L 5C0DB 2XWBA 2R1WB 3WE6A 5GGSB 1JBJA 3D9AH 1MNUL 3UCRA 3GIVA 3DETD 1YEDB 2R4SL 3PV7A 4PG9B 5C0IB 2HN7A 1QEWA 3FFDA 4WFGD 3MROB 1DLHB 1YZZA 4OF3A 3GBNH 1GGUA 4XCEA 3MCKA 5D72H 1KENH 3OKKA 1RZGB 3O3EA 3EOTH 1H3GA 1QRNE 1BQSA 5IW1A 3WHXB 2W65A 1TQBB 4I3GA 1U8KA 4M6NH 3FAXA 1IGJA 3UYRL 4XC1H 1JI1A 2X4UB 3IDNB 1JF1B 1MRDL 5IMMA 4OLWL 4P46C 3SDYH 4QRPB 4S2SA 4LHUB 3KYAA 5CSZA 3FRPG 5JLZA 1DBJL 2R4RH 1NFIA 1IGYB 4YDJB 1KJ2A 3BKCH 4JPKH 4P3DA 1TPXC 2WBJD 4X6DE 3CXHK 4L4VE 3QIBB 3D3VA 3KDMB 4RAVA 1IM3A 3BD3A 2QQNH 3HNVH 1SJEB 4RGOL 1J8HE 4PJGA 1FPTL 4PB0H 4NHUA 4TRPH 3BKJL 3LMJH 5JR1L 5SWSD 4Y4KA 1G6RA 5I1JH 3PDOA 4KDTA 4Z78B 1VESA 3H7BB 4XXDA 2FSEB 1GCFA 2ADFL 4FQXC 1RZIB 2YA1A 2CSPA 1BECA 2R29L 5B38B 5LGJB 5I6XB 1IAIH 3AXLB 5F3BA 1RIHH 3BEVB 4AEIL 1EEYB 1Z2KA 3GSUB 1LNUB 4HXBL 5E6IA 3PHOA 3HHRB 2DMCA 4JPIA 1K2DB 4MNGE 4R4ND 5DK0A 4JN2B 2FJHA 4PB9H 3NIDE 1SJXA 3GJEB 3RVXD 1H9VA 4OD2A 2D03L 5BW7C 1IBGL 3DLQR 1XF1A 1I9IL 1OAYL 1NMCC 4Y2OA 4GOSA 3LH2L 4TOYL 2NTFB 3G5XA 1HCVA 1AKJB 1FE8H 4BQ8A 2AABL 1I8MB 3CGTA 1KCLA 1DE4B 3U4EB 1KV3A 3QIWA 3QNXB 5DMGD 4M62L 3RL2B 2A9NH 4FQHA 1UWXH 2R39A 3TESA 1RZKC 4LLVB 4R4FH 4MLSA 3QIUC 3QXAB 2A73A 5CBEA 2DWEA 3MJGX 1XF2B 1PX3A 4TN9A 1I8LA 5IQ7L 4I2XA 5AWNL 5GGTL 3VFGH 3R06B 1UJ3C 4RISH 4I9WE 3JBG7 5BMFL 3RKDC 4G8IA 3PXJA 3ZZ1A 4K3DL 1D5BA 5D6DA 4N8VA 25C8H 3ARFD 15C8H 3KS0H 4G3YL 4WHYG 5FA4A 3U46A 4OLXH 3HPJB 5IROA 1RMFL 5EIVA 3OR7B 2EIZA 5DQDL 1H8SA 3M1BA 2BNRE 1TJGL 1ES0A 1F90H 5C8JB 2AQ1A 3DX8B 4MD5A 4PJFE 4YBQC 1DL7L 1LEIA 1NC4D 2XPGA 3KPPB 4P2RA 3VFMB 3VXOB 1FVEA 1YYLH 2ID5A 4LSVL 2DYPD 2KL6A 1ZHNB 2IANE 2Q7YA 5DJZB 4BZ2L 2QSQA 3VH8B 1MRFH 1GVIA 3WJJA 3WDIA 5LGKA 3E1F1 3R0MA 1J1OH 3W9DB 2KZ1B 3I84A 4LEOB 3IXTA 4OGXH 5D5MA 5FO7A 2W07A 4NC0B 2CK0L 5SWZA 2VRAA 4RAUB 1QFUL 4BKLA 1JV5A 4XNUL 5AYUL 4EUPB 4MJ6A 5DFWH 4LVNB 3NZ8B 5HJ3B 3CNKA 3MRPB 1TNMA 5CUSL 2VTFA 3UTTD 4KDVA 3FO0L 4KHXH 2Z35A 1KB9K 2P7TB 2W1NA 5GGTA 1R3HB 3VD5A 4D9QE 4H0HB 4ZAKA 4JKWA 4A6YB 1RSFA 2DMBA 3WIIH 3BT2H 4HS3A 1PZ5A 1U36A 4KVCL 2AJ3B 1ZA3B 2MPAH 5MEPA 1NEUA 5HHPA 3MV11 3VXRD 1DQTA 4YXKH 2PO6D 4NQSA 5GGRY 5C0DA 2R1WA 5GGSA 3VXNB 4OSUL 4TUKH 3VCLA 2F54D 5JIPA 4LSQL 2J4WH 5EU6D 2E5EA 1WIUA 5TF0A 1YEDA 3SDAC 4PG9A 5C0IA 1M7DB 2HT4C 3MROA 1FL5B 2E8ZA 2HLFD 3MUY1 3QHFL 2ZOLB 1RZGA 2R15A 2MCPL 4CVXB 3THML 1PG7W 4XNQB 3EYUL 4WHYH 3LPWA 4FNLL 2WUCL 1QFWI 5D1QC 2JJSC 4JHWL 2FB4L 3IDNA 1VGEH 2X4UA 2DIAA 1JF1A 5JQHC 1IAMA 4JFPB 4QRPA 4LHUA 1A6PA 2QEJA 3SJVB 4JO3H 3LB6C 5I18H 5D1XB 5IW6B 5I1EL 5SV4A 4WU5A 1IGYA 5E08H 2PR4H 5JOPE 2HTLD 3O8XD 4XPAL 1PY4A 1WFOA 4BFEA 4YHKH 3NAAL 4OKVB 3QIBA 3KDMA 4N1CA 5C0BE 1SJEA 2DWDA 3HMWH 1ZWIA 3RGHA 4MXQC 4ZODA 4DKFL 3TT1L 1YNKL 1KBGL 4DZ8B 4Z78A 3MRMA 3TA3B 5FHAL 1MAKA 3H7BA 2FSEA 5J3HD 3H9HB 1BM3H 5B38A 2FHFA 3BZFB 4X7EC 1CDIA 2XV6B 3AXLA 3O6ML 1F2XK 3UBXI 3BEVA 1UKTA 1EEYA 4EQ2A 3MRDB 3GJFB 3GSUA 1LNUA 3D2UA 3RBSA 4WV1B 5FYLE 7FABL 1PKQE 1OAKL 1EAPB 5DYOA 2XZCL 1K2DA 3DYOA 1TITA 1WIOA 3UJTL 1UB5B 1ITCA 4KMTL 4JN2A 1Q72L 4U6YB 3GJEA 4MJ2A 1GH7A 1R5WB 3K74B 5LWYL 1BOYA 2JELL 1FJ1B 1DFBH 3HZMB 3KXFE 3OAZH 2DTML 5BCAA 3QO1B 5EZOH 4KMLB 2NTFA 3D85D 3MLTB 1AKJA 4LPCA 5A2IH 4JO4L 1I8MA 2PW2B 1DE4A 3U4EA 3U30B 3QNXA 3RL2A 4LSTL 2LABA 2VLKB 2PTVA 4LLVA 4HIJB 3QXAA 1NL0H 3C5ZB 4PJXA 1XF2A 1JHLH 3INUL 1A7PL 1F42A 1OM3H 5ICZB 3R06A 5D7KD 1HNFA 4QHMB 2P5ED 4A6YL 3WMSA 2OQJB 5J57B 1SEQL 3UTPD 5DGQA 1CXFA 1ZVYA 3KG5A 4FFWC 4QT5B 3U1SH 4FXGB 3TEUA 3U9PL 1N6UA 1R5IA 3L5WB 3HPJA 1VEMA 4N8CH 4GLRI 3HE6C 3ULUD 3OR7A 3Q5OA 1P5UA 3S3PA 5C8JA 3DX8A 4P2YA 1JTTA 2F5BL 3UZQA 5DVKA 3VFMA 2FBJL 1RU9H 3VXOA 4JG0L 4I0CC 1KFAH 1ZHNA 3VH8A 2Y7QB 3O3BB 4XP1L 1HHIB 3W9DA 4JDZB 4LEOA 4YPGB 5DR5L 1CGSL 4EDXB 5C7XH 3F65A 4LIQE 4XCYB 3KYMB 5HI5D 4KK8D 4F8TA 2K9UA 3ZKXB 5EOCL 1RZJH 3NZ8A 2IBGA 4OLVH 4KROC 1TZGH 1A14L 3MRPA 5CJOL 1JYWA 3RJDA 5EO0B 2EKSB 1C12B 4M00A 1EBPA 4KJYB 2GQHA 1R3HA 3IU3B 3MXWL 2B1HH 4A6YA 4O58L 1XIWD 1JMZA 4ZD3H 1J9CT 1YC7A 3GSOB 1OD9A 2AJ3A 1ZA3A 4YPJA 2C3VB 4S1QH 2BNQE 5F7NC 4TPRH 2WP3T 4HJ0D 3VFUB 3MRHB 3ZTJG 1N7ML 1GPOL 2C4FU 5D7JB 2ZPKL 4WI8A 1ZGLP 1YMMD 1M7DA 2EE9A 5IIEB 4OM0H 1FL5A 2UZXB 3FB7B 2ZOLA 3T3MF 4KKAC 4ORZC 4CVXA 4XNQA 1JGUL 2VUOA 2V5RA 3HA0A 1XEDA 5TF1H 1AC6A 4D0DB 2VR4A 3QDJD 4NQCB 2VXQH 2MWCA 4X9IA 3RWEA 1BBDL 1HINL 4JFPA 3S97C 1TZIA 2YPKA 4DZBB 3SJVA 3JUZA 5A3IC 5D1XA 5IW6A 4JFFB 4NJ9H 1FORL 2NY5L 3GZKA 1MCIA 3SE9L 4OKVA 4UTBH 4I18C 2J6EL 1F4XH 4V2CB 3TGXA 1YQVL 4Z8FL 3SBWA 1F02I 3C8HA 1RFDH 1BQHB 3U79A 4DAGL 1YJDH 4DZ8A 4RA3A 1CL7L 3TA3A 4PD4J 4XWGL 4IRJB 1WSST 3QI9C 3H9HA 1ACYH 1G9NH 3BZFA 4YZFF 3VRIB 3QEQE 5F7DA 2GIYA 3BDBA 4P59H 2YN5A 3MRDA 3GJFA 4RCAA 4P3CL 1JYVA 5D7IB 4S10A 1EAPA 3QCVL 1P53A 2DQIL 3FQNB 1BGXL 3BH8B 4MS8D 3TN0C 5D93B 1UYWH 5IG7B 1UB5A 2ED8A 4N0CD 5DMIL 5KOVC 2NY2C 3VWJD 4U6YA 3NBNA 1IAIM 2FYYB 1R5WA 3E6HB 1U92B 3DNKA 3BDYL 1H3UA 1GHFL 2Z31C 1FJ1A 2BP3A 1IGTB 3ECBB 5JIHA 3KHOA 3QO1A 1HSBB 1QSEE 3MLTA 5GZOC 4K94C 1KLGB 4NQXB 3MACH 1QVOB 4WEUD 3IFPB 4WTZA 4QGYA 4GJTB 2VLKA 1C16B 5E8OB 4HIJA 4UT9H 3SDCC 3C5ZA 2J6EA 3ARGB 1J87A 3SGDI 2XICA 4JKMA 3H9SB 5D71L 2XN9B 1CLZH 2ERJB 4QHMA 2GY7B 5C6PB 5DJAB 3PQYD 1VKXB 5F96H 5FUZL 5EULV 1MRCH 2Y06H 5ANMB 4ZOAA 2NXYC 3FN3A 3KPRD 4LCWB 4H1LG 4QT5A 3DV6B 4FXGA 4EI5D 3L5WA 3UBXG 3L95B 1XR8B 2HKHH 4LGSB 4LVHC 2UWEB 3PP3K 3N0PB 1FO0B 4TVPH 3MV9D 4Y8DC 1RUAL 1JGDB 3FFCE 1ZKAA 4YUEH 5D4QA 3HFML 1MCOL 5EBWB 1IQDB 2BRRL 2Y7QA 4L1DA 1A7RH 4BYHA 1CK0L 3O3BA 2JKXA 1T04B 1A1OB 1EUUA 4JDZA 4YPGA 2FD6H 5KS9F 2XTJE 4EDXA 2HJLB 4Z18A 4BFGA 3MBXL 3KYMA 1IKNC 3LKOB 1QFWH 1CFBA 1QBAA 3RPIB 4BELD 5KSAD 4Z0BL 4MD4B 4MLIA 4RZCA 3QUXD 1AGEB 4JRYE 2IPUG 4TSCL 4YFDB 1HI6B 5EO0A 5D1ZB 5FGSA 2EKSA 2QQLL 1C12A 3H42L 4KJYA 4ODHL 3S7GA 4PRID 2PUQT 1MJ7L 4GBXB 2ZOKB 1DR9A 2XFXB 3GSOA 4JY4A 4XCCL 2C3VA 3LS5L 1OP9A 3V52L 1NDMB 3VFUA 3FB6B 3C8KB 3MRHA 1T83A 4GQ9L 2VAAA 3FB7A 5DLML 4ZUSA 3P0YH 1PYWB 5GZNC 4ZNEA 2HVKB 4L3EE 5L9DL 2B4CL 4U1HB 4N0YL 5GJTH 2O5XH 3MRFB 4WEMB 1A1MB 3QFJA 4OCYH 2YHGA 3IDIB 5EWIH 1HDMB 3KAAA 4ZTPH 4NQCA 1U8HB 2HH0L 1NEZB 5DC4B 4L8DB 3EDFA 1EMTH 4DZBA 1INQB 3I50L 4RMQA 4ENED 2P8LB 3DUSB 3I85A 4JFFA 3LD8B 2YC1B 4K55A 2D7MA 2X4TB 2VXUH 3KPSE 4OJFL 3VGAB 4OV6F 3JSSA 1JWUB 3FN0L 3MRJB 2ATKB 3SKJL 4LK4A 2R0WH 1UADC 5I30H 5DQ9B 3FONB 1TVDA 1E6JH 4JRWA 5GS1B 1HSAB 3QISA 2YEZB 3SOBL 1EVTC 1YNTA 2XTJC 3RUGF 1BQHA 4NCC1 3RVVD 3B4NA 2VC2H 3ULVE 2IFGA 2APBA 3D39D 1CICC 4IRJA 3O4LE 1WK0A 5C0CB 4N5ED 4PP1C 4JFDE 2EDJA 2IQ9L 2XA3A 3VRIA 1TJHL 1FO0L 1ERNA 1WZMA 3T0DA 3MA9L 2GJZB 3BPCB 3C60C 2K3TA 2EXWC 1AGDB 3T8XB 1CF8H 5D7IA 3S5LG 4GLRH 3IDUA 2V17H 3BH8A 5IG7A 3RHWF 3UC0L 2ZCKH 4NQDE 3RY6A 4OCRH 2FYYA 12E8H 3E6HA 5FYJL 1OAXL 5IBUG 3ARBC 5E4EB 3WFEL 1PEWA 4YHYB 3IDMB 1INDL 3O6FD 2JE8A 4R8WL 1IGTA 1BFVH 3ECBA 1C5CH 1VEPA 2R0ZH 1HSBA 1MFNA 2W0FB 4XTRD 2CR6A 4N5UA 1KLGA 4NQXA 1QVOA 2VUYA 5LQBL 3PE9A 3GHBH 3VWKD 1AJ7L 3RJQB 1PAMA 2Q7NA 3V5HB 1C16A 5E8OA 5AG8A 1DTUA 4OT1H 4R96B 3BPNC 3D18B 5A2JH 4R97C 1ED3B 3ARGA 3CIQA 1NCBL 3CCHB 4YHOH 4LAQL 3H9SA 1M7XA 4MB4A 1WAAE 3QQNA 2JCCB 3SGKC 1MCRA 1CS6A 1UENA 4UUJB 5DJAA 3CH1B 4FHBD 1VKXA 1LDPH 3QCUL 4HMCA 5ANMA 2HFEA 4X6DF 2DM4A 3DV6A 3L95A 4F57H 4HJGB 1LK2B 4Q9RH 2UWEA 3O45B 3VXMB 1FO0A 5I8OL 4Z7WE 4PLKD 3RTQC 1JGDA 3P9MA 1PEZA 2AI0H 1WZ1L 5HI3D 1I9RL 1BIHA 4YHLL 1JNHB 1JIBA 4PV8B 4MQ7B 3LQAC 1MUJB 5EBWA 5HHOB 2C26A 1IQDA 4TTGA 1MAML 1D3CA 1B3JA 1G6RH 1QQDB 1T04A 1A1OA 1LP9A 4Y2DB 3UEZA 1T1WB 5C09B 4HBQA 3MJ9H 1CDGA 2HJLA 3TP4A 1MNUH 5FDYA 3BRGC 3LV3B 4K8RD 1MQKH 3SEPA 3RPIA 1B0GB 2R4SH 1FZKB 4MD4A 2VKXA 5GGSY 4PR5A 1S7VA 2C4FT 1AGEA 1NFDF 4JM2D 1OPGL 1HI6A 3MV8B 5D1ZA 1U8QB 2APFA 3WS6C 1VFUA 3F5WB 4CN1A 1T3FB 3BESR 3UYRH 1CLOL 4H20L 2E9JA 1MRDH 1BF8A 4RGNE 4OLWH 1KPVB 4GBXA 2ZOKA 2XFXA 3MPCA 4J3XA 3RVWD 2XXCB 5I71B 1DBJH 3ARTA 1ZLVH 1NDMA 3FB6A 3TZVD 1IFHL 3C8KA 5E2TL 5KSBF 4J3OC 1FZMB 4WHTB 1OLLA 4ZOEA 5FKAB 4APQC 5H2BB 2JIXD 3H6JA 4F2MB 4PLNC 4RGOH 2WIIB 5E9DB 4E41B 2HVKA 4U1HA 3B8YA 3BKJH 5JR1H 4DN3L 3BXNB 3MMEB 3MRFA 1A1MA 3JWOL 1N5AA 3IDIA 1HDMA 1U8HA 2CUHA 4ALAL 5BV7B 4HWEL 2J8OA 4L8DA 1Z5LA 3OX8A 5K9QG 1Y18B 1IL1B 1INQA 4KJQD 4P5TB 5JHLL 2P8LA 3D3VE 4ZFZB 4QRUB 4DKDC 1MJ8L 3DUSA 4AEIH 5DZLA 2YC1A 1RULL 1UA6L 4HXBH 2X4TA 5CEZL 4KJPD 5F9DC 1T7VA 1JWUA 3MRJA 1OP5K 2ATKA 1WQVT 3K4AA 3I3EA 2AGJH 3EIFA 5DJ6B 5DQ9A 3FONA 5C0AE 2ZNWA 1KB9J 3TWCH 4ZTOL 5GS1A 1HSAA 2YEZA 4QTIH 2D03H 1IBGH 3PWVA 1I9IH 1OAYH 1F11B 3IAPA 4Z7OF 2GITB 3LH2H 3NFSL 2AEPL 4TOYH 3SGDH 2FZ3B 3DVGB 4HXAL 2OM5A 4L8SC 5FM4A 3UAJC 4C57C 4MMXC 5FYKE 5C0CA 3DMMB 1CTOA 1A6WH 1LHZA 2GSIB 2GJZA 3BPCA 5MHSD 3JTTB 5F6IC 5IQ7H 1AGDA 3V0AC 5AWNH 3T8XA 1CL7I 5GGTH 1NC2B 4O2CB 3GKWL 5BMFH 4DWHA 3SE3A 4NQEB 2W59A 1Z0NA 4RGNC 3MTRA 3RRQA 1S7TB 3QXDB 1A7OL 4K3DH 3H9ZA 3K46A 4IDJL 1BX2B 3UTSE 4PG2A 4OIAA 4Y1AD 3IDMA 4MA1C 3N1FC 3OQ3B 1IILE 4Q6YA 1UJTA 1RMFH 3QXVA 4KV5E 5DQDH 2G9HB 4K3HA 2W0FA 4I2XE 4OBRA 3HB3C 1DQQB 1DL7H 1Z3GL 2X4RA 4Y19B 3ARDB 3MLWH 5B21A 3V5HA 1N0XL 4H25B 4LSVH 1NMAL 4NN6C 4R96A 3D18A 3BJ91 4L4TD 4BZ2H 4KWUA 1ED3A 5BZDB 5JO5B 5A2LH 3CCHA 4Y5VA 4RMTA 2JCCA 4M1GH 5ITFB 4UUJA 2J8UE 3CH1A 3VA2C 1BZ9B 4K07A 1I8KB 2CK0H 4ZO9A 4NN7C 3REVB 2VYRE 5C9KA 4P2RE 4XNUH 5AYUH 3NACL 1T20B 2EC9T 3O6LL 5DJYB 3MR9B 3SDDC 1A22B 3AY4A 4HJGA 4ONFL 3O45A 3VXMA 3TBTB 4MQXD 4Y4KC 5ESQA 3FO0H 4PRHB 1FLRL 3WLWD 1OSZB 4NM4L 1GC1H 4WHCA 5D5ME 3CX5K 4YGVB 3ILQC 1JNHA 4TVSa 5I16B 4PV8A 4MQ7A 1MUJA 5HHOA 4IM8A 3QQ9D 4V1DD 2C3GA 3QNZB 4KVCH 4LFHD 1QQDA 4Y2DA 1T1WA 5C09A 5BV7L 1KIPB 4WUKL 3LSOB 3NN8B 4LSQH 3S37X 4IOSD 3LV3A 1GAFL 4N9OB 2NQCA 1B0GA 1WEJL 4JCMA 3I9GL 4P2QE 1FZKA 1DN2A 3QHFH 2MTPA 3EFFB 4MYWB 2MCPH 2R2HA 2P48B 4Y7MA 3EYUH 3QUZD 4EUPG 3MV8A 4XPHL 1U8QA 4FNLH 2XKNB 1CFQB 3JUYA 4G7YL 3F5WA 1H15B 2WUCH 1T3FA 3QIWC 3WYRA 1HQ4A 3LKQB 4DKEH 4OLEA 2FB4H 1IC1A 1ZHBB 4YNYB 1QFWM 1KPVA 2BNUA 3H3PL 1GZQA 3B9KC 5I1EH 2VLRB 2YD7A 1JNJA 3CDCA 2ESVE 2UVFA 1ZHLB 2BY2A 4KI5E 4WHTA 3GBML 4XPAH 5FKAA 5GRVL 3SDXA 4A2MA 4MJID 5D6DC 5H2BA 4RGMC 3RGVB 1JE6A 3WFDH 4F2MA 1WBXB 1WBYB 4FQ2H 2WIIA 4HWZB 5E9DA 5IROC 4E41A 1ZEAL 3MZGB 4G7VL 3BXNA 1RIUL 4J6RH 4DKFH 3MMEA 3TBVB 3TT1H 5J6GB 3PWPD 1KBGH 1FL6A 3TFKD 1BHGA 2D0HA 5FHAH 5L2KD 3IJSB 4XNXL 5DSCB 4NUJB 1Z6JT 1I7UB 4RX4D 1Y18A 2WBWB 1IL1A 1JZ7A 4P5TA 5CKGA 4LDEB 4ZFZA 4QRUA 3VD9A 3P0VH 3DI2B 3WJJC 5A1AA 2DQGL 3ZDZE 1OWRM 1OAKH 4O9HL 4LLMA 2XZCH 5M94B 2DI8A 4NN5B 3UJTH 3BN3B 3LQMA 5DJ6A 1FNFA 4NZTH 1Q72H 1IKFL 1DQMH 1KLFA 5F7MC 5LWYH 4MZ3A 2JELH 3GEWB 4G42B 1F11A 2GITA 5KSUB 2YXMA 2DTMH 2VAJA 2VZUA 1T6WA 2FZ3A 3DVGA 1KTKE 2IAMD 2PTTB 2CLZB 1N6QL 4PBWD 4JO4H 4EUPH 3X14B 4OZFG 4ZS6D 4WTXA 4LSTH 4ZAKC 5DK2B 4F80A 1Q9KB 4IRSD 3CMOL 1QP1A 3RWFB 2GSIA 2V6HA 2XQYK 2AXHA 3IDGB 3JTTA 3P9WB 3INUH 5H35A 1IAOB 4QXUL 2EE3A 3KJ4B 1A7PH 3QUYB 1LE5B 4WO4B 1MCFA 1NC2A 1J7VR 4O2CA 4Y4HD 4A6YH 4K2UL 4NQEA 1M05B 1SEQH 3QXDA 1N8ZB 3LKRB 2VZOA 5ESVB 3SO5A 4YC2B 3MNVA 1BX2A 3FOLB 3OB0K 1S5IL 5LBSL 4ONGL 3U9PH 4XPFL 1NUFA 5L8JB 2AK4E 2ZUQC 3TO4C 4PJXE 4NM8L 4KI5C 2G9HA 1TQBC 2UVEA 5GGVL 1DQQA 3DX9B 3V6BR 2F5BH 5HYJB 3ARDA 3F6LA 5KZCD 4JG0H 5KVFL 4H25A 5D96C 5CGMA 1QD0A 1XGTB 1X6NA 3O2DH 5BZDA 5JO5A 4WTZG 1KCVL 1KELH 5ITFA 5IT2H 5TQ2L 2NY4B 1BZ9A 2G60L 2OMBA 3I2CH 3QZWG 1I8KA 1JZ4A 1EXUB 3REVA 1FNLA 1T20A 5DJYA 1SBSL 3MR9A 1ZLWH 5EOCH 1KN4L 1QBBA 1YEFL 1YYML 4QCIA 4JFEB 5CJOH 2XYCA 3BVNB 3TBTA 4PRHA 3V79C 2FX7L 5CBAB 4JRXE 3P4NB 4OZHE 4Z7NE 1OSZA 1CT8B 4F8QA 4NKOB 3S9DB 4YGVA 3ZKND 2IALB 5I16A 4IMKA 1JI2A 4M7LT 2EDBA 1A6VL 4O58H 5I6XC 4OZFH 3VXTB 2AJVL 3MUGB 3O9WB 3QNZA 1UGNA 1VFBB 3O41B 4GAJL 1ZLSL 1DQJB 4P2OD 3W0WA 1KIPA 3AS1A 3LSOA 3NN8A 5T33L 1N7MH 5K93A 1GPOH 3BOVA 2ZPKH 1EGJL 3GJFH 1JF6A 3PWUB 3ZE0F 1F3DH 2EDHA 5JW4R 4XVUD 3EFFA 1SYVB 2HJKB 5J11C 1HK6A 2CKBH 1JGUH 5EO9A 2XRAL 2XKNA 1CFQA 1MVFA 4J8RB 4FFVD 3WFBH 3G6DH 2VLJB 4K9EH 4HUNB 1H15A 3LKQA 2FX9H 4YNYA 1ZHBA 3DHJA 1B6DA 2NMSA 4GRWE 1BBDH 1ZV5A 5F72S 3BHBB 2F74B 5I1KL 4YIQB 4K3EL 2CRYA 1MI5B 4NKDA 4D9LL 3OG6B 1DVFD 2I07B 2VLRA 3QAZC 1YQ2A 4IS6B 2DAVA 2NY5H 1JGVH 3W11C 1ZHLA 2VDLL 3UMTA 5E8PB 3VXUD 2J3SA 2J6EH 3RGVA 4Z8FH 1JWSB 3SO3B 1WBYA 4HWZA 3SJVE 3P0GB 1CD1A 3HC0B 2CRZA 1FFQA 4QOKB 5HGDB 3TBVA 5J6GA 4DAGH 2EDWA 3ZT5A 1CL7H 3IJSA 4XWGH 5DSCA 4NUJA 1I7UA 4F7MB 5JXED 1Z9MA 3MLUH 4WI4A 1YECH 1ZSDA 1WWCA 1EGJA 4P3CH 4UBDC 4YR6B 4RMRA 3UO1L 3MV7E 5JA9A 4Z7VB 4JDTL 4HPOL 3QCVH 4WFFE 2DQIH 4FMFA 2VDKL 5DMIH 1UXSB 4KK5C 4UV7L 1MCCA 3EHBD 1ZVHA 4LVNC 3BDYH 1MWAB 1S7XA 2HMID 4WW2F 3I3DA 2PETA 1CXKA 1GHFH 4G42A 5BS0B 5KSUA 4C56B 5KVGL 1CE1H 2DLFL 1F4AA 3H0TB 3DXAE 3X14A 2D0FA 4AIZA 1IEAA 2DJUA 5DK2A 2ZZUT 4FTVE 1Q9KA 2VDPL 3NCEB 3VG0L 3RWFA 3BIKB 4CRPA 5A43C 3IDGA 1U3HB 2KPNA 1LE5A 3FT4A 4WO4A 5D71H 3SGJC 4GAGL 4OD1L 2X4SB 1EO8H 5FUZH 1M05A 3LKRA 1EDQA 2NYYD 3BMVA 1CR9L 4M9PA 1NGWB 2GTWB 5ESVA 3FOLA 1WV7T 4CN4A 3CLEH 2C1PB 4ZUUB 3O2WL 4JKLA 1WISA 3NCCB 5JHDA 3CPLA 4LSSL 3QA3B 3MGTA 1RUAH 3BI9X 4N90E 1Y6MR 5HYJA 4MAYA 5EBGA 4K7FB 4JFXB 3HFMH 1MCOH 1MJUL 1XGTA 4U49A 5D1XC 2BRRH 4WEBL 1CK0H 4G6JL 1J0HA 3SCMC 2MQCA 4LSUL 1WT5A 4JN1L 3HE7D 5JORB 1L9MA 4PGCA 4S1DC 1EXUA 3U7WL 3MBXH 4KHTL 4F7PB 3SBWC 4W6WB 1QSFA 4Z0BH 2VLMD 4EXPX 2VABB 4JFEA 5IEHB 3BVNA 4TSCH 3T0WA 1MCLA 4JREC 5CBAA 3H42H 3P4NA 3A6OA 1CT8A 3SE4A 3ULVF 4HIEB 4NKOA 4ODHH 4X4ME 2IALA 5EO1B 3W9EB 5SWQB 2EEAA 4UV4L 4MNQB 3EO9L 3VXTA 3MUGA 3O9WA 1WC7A 4XCCH 4KJWC 1VFBA 3O41A 3LS5H 1EHAA 3BP6B 3V52H 5L0QB 1DQJA 4NRXB 4Z95L 4PJ5B 4Z9KB 1RUPL 4GQ9H 4FQCL 3EO0B 3PWUA 5ICXB 4NO0D 3TNMB 5DLMH 1SYVA 2HJKA 2DD8L 1JK8B 5DRWB 4FQXD 4N0YH 1SY6L 2XQBL 4OZIB 4J8RA 3TPUB 3X12B 4ELMB 2NY5C 1MWAL 2HH0H 1I1AC 4Q6IC 3VG9B 4O5LL 3BHBA 1N6VA 2F74A 4YGAB 3I50H 4YIQA 3C6LB 3C5ZC 4I0PC 1MI5A 5F7UA 1B88A 2I07A 2PYED 1WAAF 3HG1E 4M7LL 4OQTL 2D9QB 3SKJH 3GI8L 3QFJE 5E8PA 3DSNA 1P1ZB 2Q20A 4CMHB 1T7WA 4OD3H 3B9VA 1JWSA 5T1KB 5J13C 3SOBH 3HC0A 5I8KH 1T22B 1DBAL 5HGDA 2K1MA 2Q86B 2LV4A 1IJ9A 2AEIT 4U4BA 3QXWA 1QRND 4WI3A 4WUUE 5H37G 3KPTA 1XF3B 4R7DB 2XKUA 4F7MA 4XMPH 3NIGE 2IQ9H 1MFEL 4WFHE 3WL9B 3T4AB 1XFPA 5F9WC 5I1LA 3MA9H 4XH2B 1NEZG 4H0IA 3RKDD 4YR6A 1FVCA 1K5NB 4KVNL 3TJEL 4UI2A 1E4JA 3B9DA 3R1GH 4P5KA 2YUVA 1SY6A 4PJBE 1UXSA 3I6KB 3DYPA 3QQ3A 3ZKXC 1NPUA 5FYJH 1MWAA 3GHEL 3WFEH 4YBQD 1YPZF 2GT9B 2ENYA 4R8WH 1FYTD 4GQPH 5BS0A 5C2UB 1EA9C 3MRLB 4C56A 2QJDA 3H0TA 3T09A 5A16B 1AJ7H 1LO3L 5EFIB 2J2ZA 2EYRB 4OQTA 1FDLH 4HG4K 5GRUH 3ET9F 5KANI 2F8OA 1U3HA 1NUDA 4LCYB 1NCBH 4P4KB 5FECB 4LAQH 4DGVL 3V6FB 1LMKA 3W2DL 1DBML 1T83C 2X4SA 3RX7A 1YEGL 2QHLA 5E70A 4I8DA 4RMUA 3QCUH 3GK8L 1NGWA 5JPNB 4NSKB 4XAKE 4HS8L 1KPRB 3BIBX 1FG2B 4PJHB 3QA3A 1B0RB 5ISZE 4D9RE 5FGCB 1G0XA 2A0LD 2BOCB 4D8PB 2NXZB 1Q0XL 3SN6N 3HRPA 3BQUB 4W4OC 1I9RH 4OCMC 4XVTL 4H8WH 4M7ZB 3EO1B 5C0JB 2AW2A 3MQIA 1MAMH 4YHIB 1HHHB 3VXSB 2X1XR 4R90L 4CU6A 4ERSH 1EFQA 4HKXB 1RZ7L 3PWNB 3SKMB 1OOAA 2AJSL 4ZUWA 4R7NB 2ENSA 5E4IA 2CDGB 2VABA 5IEHA 3ESUF 1OGAB 1LP9E 1OPGH 4PP2B 4G80B 1VENA 3C87A 3MOBL 4LLWB 1CDCA 3LB6D 4HIEA 2B1AL 5EO1A 3W9EA 1CLOH 2D7TL 4H20H 4G9DB 3ZDXE 4DQOL 1FNHA 1MY7A 1QLFB 1JPST 4CW1B 4MNQA 2NY3C 1V05A 2H2SC 2WSKA 5KS9B 3BP6A 1INEH 3NCYP 3MLRL 5AZEL 5FO9B 1T89A 3QO0B 2WBJA 5E2TH 3LEVL 4NRXA 2X70B 4PJ5A 3IJHA 2B4CC 3L3GB 5EUKB 3T0EB 3X3GL 3EO0A 2H2PD 2O26U 4MXQD 4OLZL 2X9WA 1QPXA 1T7YA 5ICXA 3TNMA 3BIAX 1JK8A 4U1IB 4KV5F 4DN3H 5T3XE 3V8OA 4AH2B 4OZIA 3TPUA 4NDMB 4J4PA 3JWOH 3NOIA 4TTDD 1GGBL 4PJCE 3PGFL 1A8JH 1CGYA 4BFIB 4HWEH 2O93L 4U1SB 3NH7L 4OGZA 5C07B 3L3IB 5JHLH 3C6LA 4RMWA 3OKLB 3ARGC 3WNNA 4KRPB 4HS6B 2R69L 5EZJB 1RULH 5T5NF 1IQWL 4OFYD 5CEZH 1FNAA 1HNGA 1AO7E 4XCFL 5HYSG 1GGTA 2J8UF 4DOHB 4GS7B 4KZEL 1YEKL 4JO2L 1PG7H 1S9XB 1P1ZA 2VLLB 4CJ1A 4P46B 2GHWB 3G6JB 1RJZB 3QJFB 5T1KA 2NX5B 3OF6A 2GSGB 4ZTOH 5TDPB 2X6MA 2IFFL 5C08E 1T22A 5E94B 3S88L 4XWOC 2WANA 3NFSH 2AEPH 5TE7L 3TJHC 3VFPA 4HXAH 1TPXB 5CZVL 4EBQL 1CDJA 1FYHB 2YK1L 1XF3A 1NGZB 1BVKB 1I7TB 1F00I 4R7DA 3KYNB 3GRWL 1FH5H 3WL9A 4HWBL 2JK5B 2E9WA 5I73B 4ODVL 2YD6A 2ZCHL 4MDJA 4XH2A 4XVJL 3F7RA 4MB5A 2GY5A 1MELA 1K5NA 2OI9C 5ADPL 1LEKB 2BFVL 1A7BA 2DI7A 2OR7A 4XI5D 3R0NA 3HE6D 2NY6D 1A7OH 3I6KA 5F9OH 3P30L 1YEIL 3D25B 4IDJH 1I7ZA 3ZHKA 2GT9A 4NWUL 5C0BD 4POZC 4UT7L 3MRLA 1L7IL 1AXTL 2AK1H 4KZDL 3PV6B 2AV1B 1ZT4B 5A16A 1KCSH 4JPWL 5EFIA 3GSNH 1YEEL 4LGRB 2X09A 2CH8A 2EYRA 4C58B 1NMAH 4E42B 3GMNB 3V8CA 4U1KB 3L3KB 1GZPB 4B5EA 5F1KC 4LCYA 4P4KA 5FECA 1NMCB 3QFDB 4QWWC 3V6FA 2FH8A 2H8PB 3RWGA 3P73B 1KIQB 2XOTA 4F9LA 4KROD 1OTSC 2GJ6D 2A83B 3BP7A 5HDOA 2CDEB 3MFGB 3NACH 5JPNA 2NW3B 3QIUB 4NUGL 4UOW0 1KPRA 4ONFH 1FG2A 4YXHL 3GRWA 3OAYK 1B0RA 4HWBA 4EIGB 4JGJA 5EU4B 1C7SA 1NCWH 2BOCA 3SHSA 4D8PA 4L1HA 5T1LD 3BQUA 3FQXB 4NM4H 2IEPA 1CXLA 3EO1A 5C0JA 3DOSA 3GM0A 4U0RB 2XZAL 4NC2B 3LD8C 4YHIA 1HHHA 1I4FA 4K71B 1UH3A 2ZSVB 5C0GB 3ARUA 2ZJSH 1L6ZA 5BV7H 3VGAC 3C08L 3VXME 3GMRB 2RB8A 4NO3B 4X6DB 4L4VB 2C7UB 4HKXA 2BVPB 3PWNA 4WUKH 4O02L 3SKMA 2FNBA 1QUNA 2ZG3A 4YE4H 1GAFH 1J8HB 4MA7L 1WEJH 3CVHB 3I9GH 4R7NA 5GS1C 3T2OA 4IMLB 4ODXB 3TIDA 5KANG 1OGAA 5J7CC 3V4PL 4PP2A 4G80A 4XPHH 4GG6F 5GGVY 4LLWA 4G7YH 5A3ID 4NO5B 1N64L 4G9DA 1G84A 4O4YL 1HYSD 4CW1A 4AT6B 2EYSB 5IEKB 3H3PH 5CINH 5T3ZL 1FNGB 3ARZA 5HVFB 5KS9A 3F6IA 1G7IB 2OZ4H 1C7TA 4Y4FB 5FO9A 1VB9A 3QO0A 5DRNB 3MLXH 4PLOB 2X70A 4MNGB 5EUKA 3L3GA 3T0EA 2FBOJ 1XT5A 3SE8L 3ZL4L 4I5BB 3W5NA 1A7QL 1H3PL 3QDMD 1NFDB 4YHYC 4WGWB 5FOBB 5GRZA 2PKDA 4AIOA 3QYCA 5I15H 3QG7L 3VFRB 2DQCL 3QI9D 4U1IA 4G7VH 1RIUH 4WNQB 2XWJB 1RUKL 4NDMA 1QOKA 1JJUA 1WTLA 1WCBB 4X6BA 3CJJA 4EKXA 4XNXH 2R23B 3SDXE 3WFCL 1NQBA 4U1SA 3SDAB 4E5XB 5C07A 3L3IA 4R4BB 1V5JA 1MY5A 3OKLA 3TN0D 3AGVA 5DHYB 4HS6A 1KB5B 4Y5VC 5EZJA 3UDWA 4JY6B 2NY2D 2DQGH 5K9JL 1JPSL 2XZZA 4OF7A 4O9HH 2BVYA 5D1QB 5CEXB 2Z31D 1S9XA 2VLLA 1EFXD 1IGML 1MCEA 4L4JA 1YEHH 1IKFH 1RJZA 3QJFA 2NX5A 5TDPA 2GSGA 4DK3A 3A67L 3AY4C 2UY6A 2R2BB 2BNRB 3JWDH 5E94A 1U8LB 4PJFB 4XCNB 3U83A 4LU5H 2QQKL 3MLYL 4JR9H 1RZKL 4Z7NF 1NGZA 1T21B 1BVKA 1I7TA 4HWUA 2IANB 3KYNA 4BUHA 2JK5A 2CO7B 3CMOH 3PABB 4KXZI 2BXYA 1TETL 4F7CB 4M1CC 1BEYH 1LEKA 3LVEA 3CFEB 2A1WL 4K2UH 3Q1SH 1D5XB 1S8DB 5L2JA 4MVBC 1XZ0A 4PUBL 2H3NB 3D25A 1JZ3A 1S5IH 5LBSH 3RUGA 4ONGH 4XPFH 4NZRL 1X5AA 1SVZA 1XCTB 1GRWA 2AS5M 3DO7B 3RVUC 3PV6A 1R0AL 2AV1A 3CVHL 5GGVH 1ZT4A 2G75B 4KQ4L 5KAQF 5F9JB 4BA8A 1I85A 2APVA 2OXGA 3BWAB 4JDVB 4GRWF 4E42A 3GMNA 1CDUA 4U1KA 5F7LB 3L3KA 1GZPA 4GXUN 5BW7A 5I71C 1KF9B 4G9FB 1ROWA 4G8GE 3CK0L 3QFDA 1FGNH 1KCVH 1TMCB 2H8PA 3PIQB 3P73A 1GOGA 2AP2A 5TQ2H 1KIQA 3SPVB 1P84J 2G60H 1HH9B 4X9HA 3LHPL 5EIQA 1FFPB 1L0YA 5DD0L 5DUPL 5HYEA 2CDEA 1FFNB 1SBSH 2NW3A 1CZ8L 1A3RL 3QIUA 1KN4H 1YYMH 4D2NA 5J6HB 2YD9A 4YDKL 3QDGD 4QRRD 5EU4A 2YWYA 2FX7H 1XGPB 3S36L 5BV7C 3FQXA 1MIML 3S96B 1A6VH 3U7AA 2BSED 3RA7L 5CJ5A 3DX7B 1UVQB 2AJVH 3WD5L 4XMKL 2BRQA 2ZSVA 1T66C 5C0GA 5DD3L 2ZCLL 4GAJH 3WCYA 4NO3A 4X6DA 5LCVL 2WINB 4L4VA 5IHBA 2C7UA 2BVPA 5T33H 5IGXL 4ODTL 1KB5L 1J8HA 1IC5L 1CLCA 1A21A 3CVHA 3HS0B 1FVDB 1QTYT 4IMLA 1U8JA 4ODXA 4RQQB 2Q76B 4P9HH 4K3JL 4LRIA 2CIKB 1ZE3C 2DLHA 2XRAH 2Z8SA 2HT3D 2H26B 2VO5A 4NO5A 3W0WE 1HN1A 2CLVB 2V2WB 2HVJA 4WJ5B 4AT6A 2EYSA 5I1KH 4K3EH 3TT3H 1JRHL 1G7IA 1PKQB 1VADB 4Y4FA 4XP4L 2I9LB 5DRNA 3N1PC 5IMLB 1J0ZA 1G1YA 2VDLH 4MNGA 4U0QB 5F7HA 4I5BA 2EZ0C 3FN9A 2HFGL 4WI6A 3WUZA 4CVUA 1NFDA 3CDFA 3NABH 5FOBA 4NC1E 3KXFB 4RDQF 2MQ0A 4JFHD 3VFRA 1CICD 3V7AG 1U91B 2Q8BL 4EIZC 3BGAA 3LDBC 2KQMA 4WNQA 2P1YA 2VITB 2XWJA 4Q58C 1OAZL 5TQ0L 1RUML 1WCBA 4BSVB 3ARDC 3RZCB 5MEND 3C60D 2B0SL 2EXWD 2R23A 5KVDL 5D7LB 1BZQK 4XGZB 3PGCB 2LU7A 1JUFB 2AXFB 4XB7A 4R4BA 4PRPD 1Q1JH 4JKKA 3CSYB 3D87B 1KB5A 5ABDE 3V6OE 1A6AB 1OTTC 5EN2A 4JY6A 3UPAA 4LSRL 1A6TB 4JDTH 4HPOH 2YPLE 5CEXA 3HC4L 5JIKA 2CKNA 4GSDL 3HCVB 2VDKH 4LARL 2G5RA 2Y72A 3MXVL 3E8UH 5H94B 4XPGH 2R2BA 2BNRA 3QHZL 2DM7A 1U8LA 5HGGS 2D3VA 4XCNA 2GW5A 3DVFA 3O6KH 1T21A 4I18B 4IMKC 2IANA 3KLAA 1FNSL 2WLYA 1RURL 4LFHG 2VDPH 3PABA 4OCSL 3VG0H 4F7CA 1S9VB 1UM6L 4TVPD 1L0QA 2YMXL 4PREB 2F5AH 3ES6B 3GIZL 3PQYA 4KUZL 3CFEA 5CD5D 3HZKB 4LASL 5HGBB 4OD1H 4QLRA 3Q3GB 1MCNA 2VOTA 1D5XA 1JNLL 1NMBL 1S8DA 4LSDA 4HMEA 1T2XA 2ICES 3O2WH 1UM5H 1OF2B 4LSSH 3DO7A 2Z91B 4NIKB 3BAEL 5EA0L 5HHXL 2G75A 5F9JA 4OTXH 3BWAA 5D2LF 1JN6A 4JDVA 4NC1C 2E9IA 1KTLB 3B2UD 1MJUH 2DOCA 2FL5B 2BNQB 2AJZB 4G9FA 4GH7B 4WEBH 3C9NB 4G6JH 4GRLB 4LSUH 5JHDE 1U93B 4TNVF 2NNAA 1SMOA 3PIQA 3SPVA 3V0WL 2KZWA 3VFWB 3IDYC 3IJYB 1HH9A 5FYLL 1FFPA 3U7WH 4UQ2B 5HYJE 1FFNA 2H9GB 3SDCB 5EC1B 3I6GB 5J6HA 3TBWB 5HD8C 1JPFB 3MNWB 4EN3C 1EO7A 3C6SB 4URTB 1XGPA 1DUZB 2Y5TA 5I8EB 4KY1L 5IBTL 3S96A 5LGHL 2NXYB 2P5WD 4UV4H 4MZ2A 3L7FB 3DX7A 3EO9H 4ONHB 1UVQA 3DV4B 3QWRD 3NCJL 1QLRB 4LVHB 2F53D 1QSFE 3STBA 5CCKL 2D7QA 2EDFA 2ZG2A 4C55A 2WINA 3FKUS 3OAZK 1CWVA 4N68A 3L3DA 2FRGP 4LVOB 2NY0B 4PJBF 2EYTB 4M5ZL 3HS0A 1FVDA 3IFOB 3OKMB 8CGTA 4RQQA 2Q76A 4G6AD 4F7TB 1SJVA 4FQJH 4QHUB 2CIKA 1SY6H 4HG4J 2H26A 1QNZL 3RU8L 4M6ML 2CLVA 3BO8B 1MWAH 2V2WA 3NIFF 3QEQB 3FQRB 5JUEL 4NKIH 3RAJH 4WJ5A 4PLJD 4RWYL 1YEJL 4CBPA 1WTGT 1PKQA 1VADA 4P5MB 4PY8J 4HKBB 5CP3H 5IMLA 4M7LH 4EXKA 4OQTH 3V5KB 3GI8H 4JVPA 5DF0A 4YC2C 1CCZA 5I1DB 5DJDB 3KYOB 2HYMA 5KW9L 3KXFA 4LIQL 1QSEB 2XIDA 1MI5E 1U91A 3FQWB 2DLTA 1DBAH 4KXZH 2VITA 2IPTL 4FABH 5K59F 2RHEA 3ISWA 2XA8L 4BSVA 4MAYC 3RZCA 1VHPA 5D7LA 4XGZA 3PGCA 1JUFA 2AXFA 1MFEH 2HLAB 4PS4L 1C1EL 3CSYA 3LRHA 4Z7UF 1EH9A 4P3WA 5CP7B 4ZS7L 1A6AA 4PJEE 5GRXG 5JTWA 1WT5C 2CK2A 1G7JB 1BQLL 4KVNH 5LJYH 3TJEH 1A6TA 1WJ3A 1HILB 4KGLA 1T2QL 4GW4A 3HCVA 1WCQA 5H94A 3GHEH 2BC4B 2GUOB 1I9JL 3Q48A 3KLDA 2IQAB 3FFCB 4HAFA 5GS0L 3VWKA 1B2WH 5T1DL 1PJ9A 2YZ8A 4U3XA 3DPBA 1KEGL 2OL3H 4I18A 1CGTA 1X5GA 1LO3H 1ZOXA 1JZ5A 4FG6C 4KTDL 3E3QC 3O9WC 3G5VB 5E7BA 5DMKB 3QDAA 3KWWB 1S9VA 4PREA 1AE6L 2BSRB 2XTJB 3ES6A 2AEQH 4DGVH 4QYOA 2I9TB 3HZKA 5HGBA 2VZ3A 3Q3GA 3W2DH 3EJZC 2Y9RT 2NTSP 3GK8H 4WW2B 4XBEH 3MCLL 5JW3H 4NWTH 4Y4KD 4QTHB 2MQ3A 4L3CB 1N2RB 4JRYB 3ZYOA 3GDBA 1OCWL 4HS8H 5I75C 2AQ3A 1LO4L 1OF2A 4UB0L 4PJ7F 2WIMA 1S3KL 2ARJQ 3ARED 1YY9D 5J1TC 2F19H 1IAKB 1Q0XH 1M71B 2D7OA 3QDHA 4PJCF 4Z77A 5E6ID 5DFVD 3MCG1 1KTLA 3W82A 3ARBB 2BNQA 3EDDA 1VFOA 1JZ8A 3C9NA 5M95B