4OD2B

Crystal structure of the fab fragment of an anti-dr5 antibody bound to dr5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
214
Chain Sequence
b'EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSGINWQGGSTGYADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDYWGKGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of drozitumab, light chain
publication title Structural and functional analysis of the interaction between the agonistic monoclonal antibody Apomab and the proapoptotic receptor DR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/immune system
total genus 39
structure length 214
sequence length 222
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2B01
4I48A 5GRZA 5D2NC 1Z9LA 1EEYB 4JLRB 1G7QB 1TQCB 4C54A 1WIPA 4H8WL 1F6LL 1BZ9B 1M6OB 1Q9WB 4LLWB 5C0RH 5L2JB 1H3WM 4YHYC 1BBDH 1AD0B 5C0DA 2CLRA 3PWPE 5D2LB 1U8KA 3B3IA 3U2SA 5HHPA 3ZKMD 3QH3B 4JPKL 4OFPA 3RWFB 1D5BA 2B0SL 1NCWH 1Q1JL 3PP3H 4F80A 1EJ6A 5E4IA 3PF2A 5DMKA 3GEWB 1XF4B 4LAJH 4Y5YC 5HYQA 1JGDA 1LDSA 5DUMH 4YHOH 2VXSL 3QFJA 2FGZA 3KPQA 3X12B 3QB7C 5C0CB 3JWDC 4MJIA 5DHXB 1BAFL 1FYTA 4OGXH 3DO7A 5D1QA 1JZ6A 3C2SA 4I3SH 2ZOKB 4YBQD 3ESUF 2G2RA 4LSVH 3VFWB 2H3NA 4N9GB 3G6JB 4JHAL 4N8VG 4LL9A 1QBMH 2F54A 3V6OE 4EUPA 4Q6IA 2Z35A 2BSRA 1A14H 2XACC 5IG7A 2DLFL 2CUMA 3X14A 3ZYIA 3GMNA 4JR9L 3D39A 3AREA 3CLFH 5GS0L 4FQIH 1O7SA 4B53A 3QPQD 3VH8A 5BRZB 5KOVC 2YD2A 3Q1SH 4X83A 5LXGH 4JM2B 5DZNA 1X3DA 3W11D 4KUZH 1GPOH 3FCTA 2YXFA 4HUUA 5DMJB 1LO0L 3KDMB 5FFLA 2WUCH 1I7RB 4XB8A 4GXUM 4JY4A 3VFNA 4DN4L 2FIKB 2C3HA 3CFKA 4O2CB 5D5MB 2OJEB 3N85H 2MFNA 4WO4B 4ZFFB 1RZKC 5C08B 2Z31B 1W72H 2BSSB 1UXSA 2LTQC 3P4NA 2Q87A 4PRPD 1MFDL 3T0WA 4KFZC 3GMOA 1HZHL 4QRPE 1CDYA 2AXJA 3JUYA 3QRGL 4LK4A 2HRPL 4IDJH 3UEZA 3CDYA 1R3LB 5CBAB 1AHWC 1MCIA 5C9KA 1B88A 3HE6D 3L3KB 5I0DA 3MLRL 1ZA3B 4BZ1L 5E99H 3QEUB 2YUWA 1CZ8L 3QXVA 3RVUC 1N6QL 3AXLB 4P3CL 5FUZH 4GAFB 4JB9H 1SVCP 3WFZA 4F7MB 4OBSA 1A0QH 3WJLC 5T5NF 3L6FA 3VFVA 1Q9KA 4MXWH 3P9WB 1IARB 4LAQH 4CN6A 4YBHA 1OVZA 3BKYH 4NNXB 1F11A 1IL1A 1KLGA 4QKXB 2R2HA 1I1AC 3IDNB 4LDOB 4PJ9C 4BKLA 4JFPA 4HH9B 4LQFH 3DURB 5ID0B 2W1NA 3QIUD 5T1KB 5KS9B 2E7LC 1JTPA 5TQ0L 1I9RL 2RB8A 3CDCA 3GHBH 3CD4A 4L9LA 4LU5H 2ITCB 5D70L 4WEMB 3DMMB 3DSFL 4NRXB 1I85A 3GIZL 4ZSOB 4IMLB 1S7UB 3QIWD 3QJFA 3HI6L 4XP4H 3MLYH 3JWOC 1DEEB 2P7TA 2NQCA 2A0LC 4LHUG 4XP5L 1JV5B 4QXUH 1OAXH 1IFHH 4HMEA 3S5LB 5E8NB 3HI5L 3VGFA 4EQ3A 1LO5B 3OJVC 1YNTA 3OAZH 1SYSA 2NNAB 3LS5L 4MMZC 2QQQA 2YPKA 3BZDA 4AT6B 1HKFA 1HH9A 5A2JH 2AW2A 1JGLL 4R96A 4ELMF 4XAWH 2APFA 4KHTL 1J1OH 2CKBH 1KJMB 3MX0A 4UDTB 1KN4H 5E6YA 4NQDD 2R39A 1N0XH 4CVZB 1FRGH 2VXTH 2EC9T 1T5XB 3O2VH 4UU9B 1N7ML 1A6PA 5F3HA 2HRLA 3TLRA 4XP1H 4P2RE 3C6LA 3RVXD 3CSPA 4X80L 3QG6A 5I16A 1FH5H 2AXHA 4LSPL 3HNVL 5KZCB 1ZLUH 4KHXH 5I74B 3EYOA 1HKLL 1Y0LA 4XCCL 3GMLA 4G80B 3VXMA 4YNYB 2WP3T 4GMSH 5FGCB 2Y5TB 1YZZA 3UYPA 3D2UD 2ADJA 1NAMA 1OQOA 2NY2C 3MRFB 3DTXA 1MPAH 4FABH 1PKOA 3W5NA 4UV4H 3M1BA 4EUPG 3HNSH 4MB4A 3P9LA 3QUKB 3UTZB 1MUJA 4GXVL 1JWUA 4HBCL 3SDAA 2VDNL 5IR1A 4U6YB 5FYKL 4FMKA 3RVVD 1BQLL 2NY7L 4NCDA 1T66D 5I1AB 1G6VK 1WZ1H 3QDJB 4UUJA 4C59B 4G6JL 2R4SL 5FCUL 4OZFG 2FSEB 2BC4B 3VH8G 4UNVA 1JZ8A 3S37L 4OZ4B 3QEQE 2ID5A 2Q8AL 4DVBB 1LO4H 1Z9SA 2A1WH 4DVRH 3MRCB 5DEFA 3TT1H 2I24N 4G43A 3TPUB 3MV8E 3UDWA 5EIIA 3CFDB 4K8RC 5EOQH 4ZNEA 3T0DA 2YPLE 2GJ6E 2NCMA 5EUKB 5T3ZH 4M7LL 2H1PL 3B9DA 3DGGB 3VG0H 3QDGD 4A6YL 2W0LA 3CMOL 5GGRB 2XN9A 5FA4A 1LK3L 2J8UB 3RI5K 1CGTA 5E7FA 4N1CA 4Y88A 1CDHA 5H94B 4DUXA 5F72S 5EORH 4OD1H 1F42A 1XR8B 3IDGA 1IAKA 4K3GA 4ZAKA 1IAIH 4U1NA 4WW1A 4ZOCA 3FO9A 4YO0A 5IB1B 4XT1C 1QFWL 1XF1A 4XNYH 4X6BA 5D2NE 3VFOB 4FFYL 1XF5B 2FJFA 5GGVH 2PO6D 3Q6GL 4OSUL 4OZFH 4U0QB 1U3HD 3PDGA 3V4VL 4DUVA 1CFVL 3WHE1 2B2XL 5D9SB 5DR5L 1FPTL 4LPCA 3MRJB 1OTSD 1UB6A 1QSFA 3BD4A 2HFFB 1CFTA 3Q0HA 2XKNA 1U8IA 4WI2A 3P9MB 4QRRA 3N1MC 2HAZA 1HN1A 2J8HA 4JCLA 5BXFA 1Q0YL 3A6BL 5BZDB 3T0ED 4F9LA 1PG7H 2D7MA 4QRSA 3UYRH 5EN2A 1KLUB 4TNVF 3SOBL 3VGAB 4DN3H 4ZPVA 5GGQH 2NZIA 3VA2C 3TFKC 2B20A 4NKDB 4RWHA 3L3HA 3ARFC 2PTUA 2QQKH 4J23A 2VQ1A 4MAUL 1YQVH 1AC0A 5TDNA 5IBTL 1B0WA 2OBGA 4TYUA 3H2WA 3W0WE 1HQRB 2EYRA 4TPRH 1U8NA 4A2MA 3QP3A 5B8CB 4Y4FA 4X7TB 3BQUD 1QBAA 4U1IA 2V9RA 4PGDB 2ATKB 1TJIL 2FIRT 2XA8H 1G9NH 1I4FA 5GGRY 4RAVA 4M61B 3T1FA 3S88L 4NNYB 1MAKA 2AABL 5E6ZA 5DJYB 5HVGB 3HS0B 1HHGB 5GRVK 4JFDA 5CIPB 5J11B 4M7JL 3BEVB 2PYFA 1A64A 2NY6C 4W4OC 2ADFL 3PV6A 5DJ0A 1TVBB 4DGYL 3CVHH 3MPCA 1JN6A 3KPSD 4YZFE 4UINH 4RGNC 1HINL 4YDKL 2VDOH 2VLRA 2ICCA 3MBXL 4G5ZH 5C0AE 4L8SB 1YA5A 5A16B 1PW3A 5AAWA 5D8JL 1MREL 5TE6H 4O58H 4K3DH 4D3CL 1XGYH 4LLVA 1TTGA 1UJ3B 2YC1A 2ORBL 1QFWM 4LKXA 5KN5B 3QIBB 3O41A 3ZE2E 5CEZH 1FNEB 1NCDL 4JRYE 1G6RL 3QUXC 2NY3D 2DWEB 4DFIA 2XRAL 3AGVA 4FQ1H 4DAGL 3SGDH 2VAJA 4IM8A 4IRZH 4E5XA 5HGDB 3BKCL 2G9HA 4NJAL 3KJ6H 3FFDA 1DTUA 3O6FC 2Y4SA 4HS6A 1DVFA 3IF1A 5HVFB 3VXRE 1VACB 1BZQK 1HQ4B 3BGMB 4PY8I 1KIPA 4AL8H 2ZP0T 3TF7C 3MA7A 1ACZA 5IK3B 4L4VA 4RGOH 4Z7WB 3MJ7B 5ERWB 1OGAE 2VDQL 1FNFA 3O8XB 2E3VA 1MVUA 2UVFA 3RWCB 3HPJB 4QHNA 4POUB 5F1KC 4Y2DC 4NKIL 4OT1H 2W0KA 2MPAH 5FYLD 5HHNB 5KVDH 5SWSE 5BV7L 1NCCL 3MRPB 3HE7A 3GHEL 3G5YA 1WAAA 5GPRA 4P4KB 1S9YB 1CL7L 2OP4L 4U2ZA 1YC8A 2ZG2A 3RHWK 4G9FE 1OAZH 4QF1A 5I1EH 1Q9LB 3GO1L 4TUKH 2ADGA 5C0EA 3OG6B 1DEDA 1ZK9A 1JJUA 1PGRB 4LGPB 4L3CB 5HY9B 4EDWL 4A6YB 1A5FL 5KANI 4P5TA 3ROOB 4YGVA 1X5AA 4NO0A 3WXWH 4K3EL 3QULA 4LVOC 5LGHH 4OCNC 3RRQA 4RA3A 1G7HA 3H6JA 4JVWA 3RTQB 1A7NH 2FX9L 3EYUL 2DJUA 4HJJL 1DE4B 4X6CB 4YX2L 1H3TA 2HKFH 3X17A 4OZHB 4XVSL 5J13C 5KVGL 3MOBL 3RL2A 5ACZA 4ORGA 5IQ7L 4GG6F 4LP4A 5IROC 1H8OA 5J6GA 5DK2A 1CGXA 1YY9D 3ZE1E 4WGWB 5KSUB 1MHHB 5DFVD 5HDBE 1PYWB 2GI7A 1XR9B 3L5JA 2X9XA 2B4CL 5GGSA 3MCKA 1YNLL 4OUOA 1BD2E 4JFFD 4Y1AA 2FWOA 5FO7A 2OLDA 1MQKH 4X4XA 1AJ7L 4MVBC 5HHQA 3U4AA 5C0JA 1ZXQA 1HEZA 3F12A 4JDTL 4KK5D 3MROB 5C07A 3SQBA 2QADD 2VLJE 3CSBA 1C16B 1IEAA 3AB0B 1EEYA 3EOTL 1J05B 1T7YA 4ERSH 3SE3A 2YEZA 1XZ0A 4HJGB 1MCEA 4X7EC 5BVPL 1M6OA 4LBEA 1UEYA 3V5HB 4KKBC 2FB4L 4U1HA 5CZVH 3EHBC 5JHDB 2VLKB 4K2UH 3C9NB 3IETB 3QH3A 2AK4E 4Y5VB 1CICB 3ILQC 4HT1L 4RNRB 1ZVYA 3UTPE 1IJ9A 2CPCA 1NCAH 2ZCLH 5F7DB 3V0VB 4XPTL 1JZ7A 2C1PB 3E6FB 1T1XB 2X09A 3QXAA 4UB0H 3RGVA 2DL9A 5A3IC 3JXAA 2AJUL 2BHZA 1HHIA 4AEIL 4V2BA 4TTGA 1C5DA 2MQ3A 4ONFH 4HIIB 3KG5A 1ZSDB 4D9LL 2ZOKA 1I9EA 4I8DA 4LIQE 4NN5C 2DBLH 4Z7OF 2BSTA 3OPZL 1BF8A 1ZANL 3MXWL 3HB3D 2EZ0D 3F7QA 5C09E 5DRWA 5F44A 3KPRD 3DETD 2XY2A 5EWIL 2VXUH 4Y16C 2WSKA 3LQZB 3PL6A 1MJUL 4N0UB 3SPVB 4M7KH 2PN5A 4AG4L 5I8OL 5KSAD 1I9JH 3OHXB 4PGZA 1G6RB 3DXAB 5CMAB 5JW4N 2NXYC 4PP1C 2LAAA 1CR9L 3BRGC 2EDKA 2JIXB 5KAQF 5L9DH 1I7RA 3KXFB 3SGKC 1D5XA 5D7IF 5TQ2H 3WIHA 5D5MA 2VOTA 1ODAA 2OJEA 4RMSA 4C57C 4F37K 3HZYB 1LO3H 5JW5B 3BAEL 2X41A 3LB6D 4ZFFA 1E4KA 3C8KB 4S10A 4G42A 4IRJC 1ADQA 1DBJL 4JPVL 5C08A 2DQUH 1JRHL 4KRPB 3F58L 3SO3C 5E2WH 2OK0H 1RV6X 2X1OA 5IFHH 1YYLL 1T2XA 3SY0B 5T3XD 3A6CL 1NQBA 4NN7B 1R3LA 4YDJB 5CBAA 1F8TH 2YUVA 4I0PA 4QTHA 5A1AA 4HPYH 3WS6C 5FO8B 4I3RL 3GSQA 3SCMD 1ZA3A 5I9QB 2F5AL 3QEUA 5D6DA 5BV7B 5T5FL 3B9KC 3LRSB 4PJCF 3AXLA 4YHPB 5C6TL 1WAAF 3N1GC 1IT9L 4QOKB 1PJ9A 4J3XA 2J8OA 5EC1B 3LN9A 4XP6L 1GHFH 4XMPL 5TF0A 2DQJH 4CDHA 3O6KH 2DTMH 2ICWB 3NFPB 4OZIA 1RI8A 1NGPH 3V4UH 3C8DA 4XVTH 1MCBA 2W91A 3EYFA 4WTZA 1WFOA 3P30H 4HH9A 4LASL 3DURA 2YD8A 3B2VL 1WBZB 3P11H 1G7IA 2FX8H 4OFYD 3LQAL 1INDL 3WHXB 4JZJB 5KS9A 2MQCA 2CD0A 1NPUA 2ITCA 4RGNE 5IOPA 3DMMA 5E0QA 1RZJH 4NRXA 4BZ2L 4JO3H 4NKOA 3VE0A 1DANT 2BY1A 4WUUD 3TN0D 3BKML 4B5EA 5M7QA 2VR4A 4ODTH 1KCUL 1YEGH 1X5LA 1Z3GL 4WW2B 3E2HC 5E7BA 1IGMH 3WMSA 1U42A 5GHWL 3S5LA 2BOCB 2NNAA 3GSRA 3NCJL 2C3XA 3B8SA 4PBWD 1OB1B 3PWPB 5MI0C 4JY6B 4AT6A 1EEZA 2HVKB 2VDKH 2APWA 4DEPC 1JFQL 2OR9H 4EN3B 1XIWD 12E8L 5MEOB 1LP9B 1OM3L 5FECB 5CINL 5CKAA 3OBAA 4PJ5A 3O3DA 3MOAH 4KJPD 4N0YH 4ONOA 2AJYL 1T4KB 4MD0A 5EBMB 4CVZA 2WW8A 1U95A 5IF0B 1AGFA 4UU9A 1ETZB 1RK1A 5TPWL 3WXVL 3VD9A 4EVNB 4PRIE 4HGWB 1CDCA 4DTGH 1N6VA 1FVEB 3CZFB 1F90L 1YUHB 3O3EB 4HKZB 3D85A 4QT5A 1SMOA 2XZQL 3L3IB 1RUKL 5I1KL 1QHPA 5I66A 4G80A 4NSKA 2WV3A 2QSTA 2UYLB 3RDTB 3RZCB 2Y5TA 3BGFB 2VSDA 4OM0L 5DWUL 4ESKA 3EOBB 3WUWB 4F9PA 4TNWK 2PNDA 3MRFA 4IHOA 4J3OC 1S9WB 1RAMA 1RSFA 3LMJH 4S1DD 3QUKA 4OCWL 4ZXBB 3GFUA 5GJTH 3UTZA 4Z8FL 2MNUA 1QLFB 4G8EB 4YQXH 1JNHB 4N8CL 4KJYB 1HDMB 2B1HH 4Y4HB 1VPOL 5D7LA 3HCVB 3CPLB 4WVRA 5F9WC 3NZHH 4KI1A 2BC4A 4BSJA 1YDPA 4QRPD 4KK8C 5F7EH 1WVZA 4OZ4A 4I3GA 2PUQT 4K23H 1KT2B 2JE8A 1H5BB 3LKRA 4HUWB 3RWDA 1GYAA 5JXAL 1AO7E 4DVBA 4KJQC 3EJZC 3MBEB 4MAYA 3TPUA 3ARUA 1AD9B 1SEQL 1WWBX 4YUEL 4NQCA 2CK0L 1AGDB 1B3JA 5EDXA 3THMH 1RURL 4U3CA 5EUKA 4M1DH 4OGAD 3LS4H 5DRZB 4YXLL 1OSPH 3DGGA 5HJ3B 2D3VA 3T2OA 3MV7B 1BPVA 1S8DB 5HI3D 3UBXB 5ANMA 3O9WC 2J8UA 1MCOL 1ACYH 2YOCA 5IFAH 3U0PA 3IFNH 2VE6A 2B5IC 3LZFH 4R26L 2DOCA 1RIVH 4L4JA 2PW2A 5KSVB 3N1QC 4LPYA 4MA3B 3BP4B 3T3MF 3IFLL 5DRXA 2V5SA 2FATH 1T0PB 2V7NB 4M93C 2VUOA 2QQLH 5H37H 5IB1A 3VFOA 1S7XA 3DI3B 1BIIB 4F58L 5CILH 1XF5A 2GFBB 3FOLB 2MKWA 2GK0B 3SGJC 3ARPA 2ZCHL 3BD5A 1NCNA 3TVMC 1G7PA 1TPXC 3G5XB 1FN4A 3AFLA 1W72A 4FTVA 4U1KB 5GSVB 2E9BA 5D9SA 5F21B 3FQXB 3MRJA 5C0BE 4WTZG 2X4OB 1INQA 4KUCD 4XWOC 3P9MA 5HYJA 1XCQB 4PJBF 4OLYH 4OZIF 3DVNA 2IPUK 3ARDC 4PJ8C 3C87A 1KLUA 3UTTB 3JV4B 3V8CA 1UZ6F 4J12A 4FQXD 3GJFK 4P9HL 3ZYOA 2AXFB 2CRYA 3G04B 5LQBL 1FNHA 3WE6A 5I1GL 5CJBA 1OHQA 3S5LG 1V05A 4P2RD 3ZZ1A 5E6IB 2CJUH 1JGVL 4PGDA 3X3GH 2ATKA 4UT9L 5HHME 1RZKL 4L8CA 1JHKL 1BEYH 4XH2B 5J1TC 4P2OD 5HVWA 3SE4C 4TRPL 1DP0A 5DJYA 4P2RB 3HS0A 4OQ1A 3QDHA 3MNWB 4R4ND 3BEVA 4OZGB 4ISVB 3O2WH 3VWKB 4JANA 4M1CC 4HKJB 3GBNL 3STBA 1AR1D 3OKEA 4YHKH 3HR6A 1UT9A 4U1GB 1XF3A 1S7VA 5HI4C 1EFXD 2KZ1B 1B0RB 3I3BA 4A2LA 5A16A 4EI5B 2R56H 4JRXA 2X40A 2FRGP 1L9MA 2DN7A 2DI9A 3RVTD 3M45A 3B83A 3S96A 5I75C 3QEQD 4DW2H 3ZE0E 1UGNA 5KN5A 2CKBA 4HF5H 4PLKD 4HUXB 4OFIA 2JJTA 1FNEA 4BUGA 3KYAA 2IH3A 1P7QD 2Z8VC 1WWCA 2DWEA 1A6TA 2BVPB 1S5HB 3MV8D 2AQ3A 4M1GH 4O51B 3TJHD 2GSGB 5L2KB 2YPLD 2GJ6D 3D6GA 5HGDA 4EI6A 4GKNA 1XF2A 1F6FB 3PHQB 3IDUA 2XQYG 4PJGE 4CDGC 3O0RH 2KQNA 2N7BA 1A47A 2J5LC 1NBVL 3SQOL 1QQDB 1VACA 4Z78B 3R1GH 4LSUL 1EGJL 3O3UN 3JWOL 1FZKB 1RZ7L 3MV8B 4HV8B 3UTQB 5DYOB 5D7KE 3C5JB 4EZMA 2HH0H 5K9OA 2XG4A 1JF1B 4M6OH 1QRNE 3O81A 2XTJC 2BNQD 2IJ0C 1H3UA 2G75B 2DQDH 4X5XB 2MHAA 2Z8SA 1GL4B 3BGAA 3HPJA 4MQSB 1GGTA 1DLFH 4C56A 1S7RA 4H8WH 3MRQB 3QUZA 2CDFB 1U3ZA 1AGBB 2VTFA 3QWOB 5J1AB 2PXYA 3MRPA 3L5WA 3P0GB 3Q3GB 3ULVF 2G5BB 2A73A 4NQEA 2EIBA 1A7BA 3QO0B 5J0BA 2OM5A 5JMOC 3QQ9C 5DA0B 5FCSH 2HYMA 3C60A 4OJFH 2H41A 3V2AR 2GTWA 4L3CA 3ZHDA 4OCYL 4UT7H 2X6MA 4A6YA 4ZUVB 2VXSH 5JOFB 5F1OB 2PR4H 4U05A 1JI1A 4L5FH 3VGGA 1CIUA 3FT2B 3WDHA 3F7VA 4E41E 1NMBL 1WEJH 3BH8B 8CGTA 3O11B 4YPJA 3FQUB 2IG2H 2J2ZA 2WBJB 4OZHA 3LEXB 4XX1G 4U1SB 5ISZA 2KQMA 4M02A 5D1QC 2DLFH 4KPHL 1BMGA 4N5EC 4NP4H 4QXGL 3W0WD 4D9RE 1KB5L 1ZHKB 3GUTB 5I1HH 1MHHA 2VR9A 3NABH 4AENA 1PYWA 1IGYA 4P2QB 1T3FB 4MNGA 1PAMA 5F7LB 5JLZA 1FZJB 4WV1A 5HHOB 1U6AL 2FLBT 3W0WB 1WBYA 4ODVL 5I1JH 1PEZA 3VU2A 2P48B 1R5WB 2FBOJ 3AREC 1TJHH 1BOGB 1JYWA 2H2SC 2ILLA 5I71C 3NZ8B 4OLUL 3MROA 3H9YA 5EFIA 5K93A 3DRQB 5DXWA 2UV3A 2OTWB 2EECA 1C16A 1IQWH 4GRWE 4XCNB 4ZMAT 5KSBA 1FGVH 4K7FA 4MNQB 2IBGA 3KVQA 4GKSB 1CXHA 2VR5A 2QQNH 3VI4E 3U46B 3OAYH 4GFTB 1MHPH 5BZWA 3K1DA 3REWB 1NDMB 3EYQC 3IJSB 3MUGA 3PWJB 2PF6A 5JHDA 2JCCB 5LCVL 1EBPA 2BK8A 3CFCH 3C9NA 5C0AB 1KIRB 1CICA 4P46A 4Y5VA 2VDMH 4RNRA 2APTA 4JRYD 4L3EE 1LE5A 3V0VA 2C1PA 3HNTH 3FO0H 4JAMA 3D0LA 1XGRA 1FO0A 4XP9H 4ZG1A 2H9GB 5HYIA 1I1FB 1NUDA 1AHWB 2YD4A 2ZNWA 1ZSDA 4WUKH 5BW7A 2Y23A 4LSDA 5J1SC 5GGUB 1AQDB 4I0KA 4LCCC 1VGEH 2F58L 1J8HE 1JPTL 2RCSL 3LKNB 4FZ8L 3TZVC 1I1AD 4PJ9D 3K46A 1FL6B 1VGKA 1OGAD 4PP2B 1ZHLB 4LLQB 4GKOA 3RY6A 3KGRA 3WLBA 3VXRB 2X44D 2IBZX 3LQZA 3BP6B 5H2BB 4LGRB 4PV9A 5EZOL 2FR4B 4DK3A 2PCPA 4PJ9B 3HAEB 4U1MB 5D93C 2PKDA 4YHMH 4L9LC 3OHXA 1G6RA 3DXAA 5CMAA 4OLVH 1I85C 3F5WA 4G9FD 3MRLB 5CIPH 3LOWA 1CFSB 2A0LD 3C5ZA 4Z95L 5SWSB 2R69H 4XNQA 2BP3A 4KKAC 1DQTA 2JIXA 3P77A 3IU3B 3CH1A 3KXFA 4JPWH 3LS5H 1A8JH 1BFVL 4XVJH 4G3YL 1JGLH 4R0LC 5JW5A 2A6IA 4BA8A 1BFOB 3RPIA 3HRPA 4U1JB 4HGKC 4LF3B 1KPUB 3T4YA 5IVOA 5DJ8B 4IBLT 1YEJL 3SY0A 3TV3H 1VCAA 3Q5OA 1N7MH 1QLRB 3B6SB 1MAML 5ESAB 4YDJA 3IU4L 2IPKB 4GQPH 4H26B 3MYJB 4KROC 4X80H 3ZMRA 4OTXH 4TOYL 1V3KA 4GUPB 5F88B 4PG9A 2Y1VA 4GRLB 3LRSA 2B1AL 4FFZH 4YHPA 5I19H 1NAKH 4F7PA 3KLHC 1HKLH 5FKPA 1YEIL 1QKZL 2WQ8A 4QOKA 4R90L 4UDUA 4XC3H 5JIIA 4ZTOH 5E00A 3C6LC 2CGRL 5IEHB 4DCQA 1BD2D 1FDLL 2B7DT 3MTRA 3SDCA 4HCRL 4UQ2B 3FRPA 3LD8C 5FIEA 4L29B 3G5ZA 3FT3B 1BVZA 1N64L 4GW4A 2IQ9H 3WFCH 5EOCH 4MCYB 3WHXA 2NY2D 1BOYA 2VDNH 3FB6A 3TIEB 3H9SE 4Z7VA 2VLJD 1U8OB 2NY7H 1BWWA 1NBZA 4KKLC 4KZDL 4G6JH 1GAFL 4P3WA 5FDYA 2Y9RT 3L3JA 4PYGA 1LDPL 2L0DA 3P3YA 5IWLA 3OAUH 1A2YA 3ULUL 1KTLB 3T8XB 1A6WL 5F7YC 4OF5A 1KB5B 4KQ3L 2AK4D 4ETYA 4TVPE 3QDMA 1NFDF 1YYMH 2BOCA 2BXZA 2NLJB 2OSLB 5FYLH 4PY8J 4CMHC 4EOWH 7CGTA 3VG9B 3LEVH 4PJDB 1OB1A 5IGXH 2Y7QA 4JY6A 4KRLB 4HKBA 1E4XL 1AP2B 3FJTA 4OCXL 4CMMA 1EHLL 4K8RD 1TETL 1KF9B 4WFHE 2F15A 3CMOH 4EN3A 1PKQA 3ALXA 2VAAA 1LP9A 3MGTB 1LK3H 5JTWA 5FECA 4PRHE 3REVA 1RQ5A 3LHPH 5TE4L 1Q72L 3BPNB 5EBMA 4X6DF 4XNXH 1A9BA 1R3HB 4GW5B 5IF0A 1ETZA 2P5EB 4NZUL 5SWZE 2VLLB 1CLOL 1IM3B 1TZHB 5C09D 4NQXB 5FA3A 4HGWA 3STLB 2XTJE 4QO1A 5E8OA 2P4AB 1OAYL 3CZFA 3T77A 1YUHA 4G6AC 3ZKXC 4WI5A 3K7UA 1RU9L 2V2XB 1J86A 3L3IA 4AMKH 3V0WH 1KPVB 3V4VH 1AIFB 3U0WL 2EDFA 3EUUA 2E8ZA 1S5IH 4LVHC 4P59L 2UYLA 3ARXA 3RDTA 3RZCA 3QNZA 2NZ9C 4ZAKC 1R3IL 2Q7YA 5GSRB 5DI8B 1YMMD 2XKSA 3EYVB 1OW0A 3DWTA 5FDWB 2X1PA 4S1SL 2DAVA 2XXMB 2Z92B 5EOCJ 2A77L 5IVXB 4ODXB 3D3VD 3WFDH 3A6BH 4ZXBA 2UWEB 3BP5A 1N3NB 2K9UA 2R8SL 2UY7A 2E9JA 4RIRA 1J10A 1E6OL 4X7SH 2E5EA 4Y4HA 5ID1B 4HXBH 4ACPA 3B9VA 3BZ4B 3CPLA 3LDBC 3VXPB 1IKFH 1IBGL 1QSEB 4RISL 1CXFA 4KU1A 1SJEB 1JMZA 4GQ9L 2X4UA 4DQOH 5J12C 3TFKD 2FD6L 5IBTH 3BWAA 3QFJE 4HUWA 3MV9A 3ARFD 4MJIE 4G6FD 4C83B 1FYTE 5JOPE 5DO2C 1CLYL 1OLZA 3Q6FA 1TJIH 1X4XA 4FP8H 1NBQA 3S88H 4I9WE 3W82A 1VADB 5DJAB 2F54E 4NWTL 5GZNC 3ES6B 5HJ3A 3MLSL 1WBXB 3MV7A 4TNVK 1AY1H 1S8DA 3VJ6B 5TE7L 1LO2L 4J4PA 2Y07H 3EOAA 1WISA 3D9AL 1EXUB 1CGWA 3GM8A 3L3GA 5D6CA 1KBGL 1RIUH 5F7NC 1KPRA 2NY6D 1IGIL 5KSVA 1C5BH 3IFPA 4JKKA 4YJZL 4G8IB 1T1WB 3BP4A 1OSZA 4GLRI 5EA0H 4IRSC 5B22A 5AZEL 3OF6D 4RGND 1A4JB 1NEZA 2LU3A 3BESR 4NZRL 5KVEL 4L8BB 5D8JH 1TVDA 4HZLB 3BPCA 4D0DA 1BIIA 2C3VA 5GRUL 3FOLA 3V0AC 1UEMA 1P1ZA 1F4XL 4O02L 4E0RB 3HFML 3G5XA 2B8OT 1TVHB 3H7BA 1YECL 3OJMB 5I8KH 2GEEA 5GSVA 1VEPA 4TSBL 3MNVB 1NCDH 4P2YA 3FRPG 1J88A 3V5DA 3MO1A 3K4DA 5E5RB 1RUML 4L4TB 2D2OA 2P45B 3CFEA 2XRAH 1AXTH 3VXUA 4DAGH 5MENB 5JW4Q 4LVNC 1KG0A 3QUXD 4AZ8A 3P0YL 1XCQA 4NJAH 8FABB 3EO1B 1GVIA 3M17A 5MP6H 2NW3A 5IB5B 4X6FB 2FO4B 5JIPA 2KBGA 3RA7L 5JIHA 4NPYB 4APQA 1DQJB 5JXEC 1JTTA 1OT1A 3O6FD 4U2YA 5EBWA 2HFGL 3GI8H 3VGBA 2AXFA 3G04A 5D7JB 4Z7VF 2VDQH 3CFBA 3WKML 4WEBH 4M3JA 3GM0A 2HT4C 4B50A 4HG4K 1E0OB 1YJDC 3PQYA 3ARGC 4NZTL 4PRID 3QG7L 3IS0X 2AQ1A 5C3LD 3BZFB 1L7TL 3DSNA 1Q9OB 4WRLA 5T3XH 4Y2DD 3GHEH 1FORH 3ZKQD 5D1XB 3U7WH 1AR2A 3K2UL 1ZT7B 3T0VA 2JB5L 3F65A 5DRNA 3BO8A 2DICA 3GJFH 4K94C 1KIQB 2UZIL 3P2TA 4ISVA 4X4YB 5SX4I 4O9HH 3VWKA 3VD5A 2FGWL 3HE7C 1KNOB 1DQML 4EDWH 4PJ7B 2CIIB 4HDIA 1N5AA 4HQQL 4M62L 4QNPF 2BOBB 1FG9C 3UO1L 3RBGA 4XZUA 4F8QA 2EDTA 1JIBA 5C0GB 5F7WC 3BDBA 3MR9A 4JGJA 4CVXB 3EYUH 5SV3A 4R7DB 4H1LB 3CX2A 3HC3L 3MOBH 4P5TC 3MNZB 5F96L 4RMVA 4YC2B 3GI9H 4K9EL 4HUXA 4ZPTB 1UKSA 4U0RC 1BWMA 4MGXA 2EEDA 4XC1H 3QCVH 3KWWA 1DQLL 1QFUH 1HILA 5DD0H 1S5HA 1UYWL 4O51A 2GSGA 5L2KA 1ZGLM 3GRWL 2B4CH 2VMFA 1FCGA 5K59E 1YNLH 1DUYA 3RWIA 5JA9A 2H6PB 5J13B 1AO7B 1JPSH 2J88H 2YPVH 5C0IA 3ECBB 1QQDA 1H0DB 2DQIL 4GRMA 3GKZA 1CLZL 3LEYL 1CD8A 4CW1B 1Q0XL 1AJ7H 4HV8A 5E9DB 1D9KB 4B0MM 1Q94A 3GMRB 4MVBD 3VI3E 2HKHL 3QUYB 2G75A 5EU3B 2H26B 1FNGA 3VXME 5IW6B 4X5XA 1KLFA 5BMFL 3KLDA 3NFNA 2ZPKL 5DQJB 1EO8L 3MRQA 4JQVA 4XCFL 3V79C 4DGIL 1F02I 3WDIA 3QWOA 3MRMB 2FB4H 3MJ9L 1NGZB 5B3JF 2WK2A 1I1YB 2G5BA 1X5IA 1WC7B 4NN6B 1RY7B 3QCTL 2X4RB 1QO3B 4JN1L 2GW5A 3BHBB 4QY8A 4YAQB 4KKBD 4YFEA 3UBXG 1N26A 4HT1H 4C58B 4FNLL 1TQCC 5JUEL 3EHBD 1KYOJ 2QSCL 5C0BD 1U36A 1DSFL 3ILQD 5DUBB 4YPGB 4ZUVA 5JOFA 4M43H 4MCZB 1P4LB 1UWEH 1DFBL 1P6FA 1MIMH 2HVJB 5L0QB 3BP7A 5A3ID 2CDGB 1JGUL 3FT2A 4MNHA 4Z7UA 5IB3B 1H3PH 4LPUA 1MCLA 3BH8A 5LAXB 2GT9A 3O11A 3FQUA 2I25N 2WBJA 4ZNEE 3CNKA 5MERA 3WIFA 3MUZ1 1K4DA 3FZUC 5A40E 2P43B 1ZT1B 3KNBB 4HHAB 2YD5A 2XN9E 1TMCB 1UM6L 3FQTB 4WCYL 3MZTA 4Y16D 3LKQB 4P2QA 4Z5RB 5HHMD 3OR7B 1EMTH 2DWDA 4JM4L 4X7CC 3D69B 1FZJA 2VC2L 4FG6C 3GIVB 1ZGLB 2ZCKH 4N90D 1RFDL 1JZ4A 4HJ0C 4F7CB 1R5WA 1CR9H 4GMTH 3QNYB 3BYTA 3SDYH 3BZEB 4NDMA 5HHMB 3UTOA 1BOGA 4Z7NE 4MA7H 5FYJE 5KJRH 2NXYD 4PP1D 2EXYC 4U3XA 3DRQA 3M8OL 4ALAL 2JJWA 1UXWA 5DS8A 4JQIL 2GSIB 4Q9RH 4JM2C 2NPLX 3BAEH 1BVKA 1KXQE 4S0SD 1DN2A 4MNQA 2WQRA 5HGAA 5CD3B 1QSFE 1YYLH 4IRJD 1RZIB 1U3YA 3UJTL 5CSZA 1NDMA 3VD3A 3PWJA 4WO4C 2JCCA 1QZ1A 3LIZH 1A7QH 2Z31C 1KIRA 4I3RH 1PQZB 3F6IA 2IH1A 5DD3L 1I8MB 4BSWA 3BUYB 4JPIA 4LOUC 4PJIB 2YN3A 1F58H 2Z91B 2DDQL 4RGMB 3B9KD 3AS2A 3O2DL 2H9GA 2YBRA 3LN5B 1LEKB 3IXTA 4PRPA 4U33A 1FNSL 2UVEA 2LE9A 2BNUB 1NGXB 4NFBA 4LASH 3ZSSA 1QEWB 5HI5C 1FFOA 1ULVA 1ZHLA 1QRND 2BY0A 4HAFA 4LLQA 4PP2A 5LGJB 1LILA 2X05A 1ZEAH 2KH2B 3MRKA 4JFDE 3VGHA 4BZ2H 2E7MA 4WDIA 1VFAA 4Z0XB 2IBBA 4L1HA 4EBQL 4Q9CA 4XBGB 3WSQH 2QHRL 4LCYA 4UOW0 1KCSH 3BKMH 3HAEA 4WWID 4GBXB 1DZBA 4OFKA 5CD5C 1QRNB 5AUMB 1KCUH 5CEXB 4FQLH 1UH3A 1JL8A 3EDJA 2NYYC 1U91A 3H9HB 1CF8H 3C09B 4UOW1 5B39B 3DMMC 3GSUA 2A6KA 4XHJC 2I26N 3JTSB 3VFGH 2I5YL 5CP7A 3S4SA 2I60L 1P4IL 3DX6A 3NCJH 1CK0L 2X4QA 4JO2L 1M7IA 3IU3A 1CT8B 4AIZB 1T89A 2IADB 3QIUA 2OTPA 4KDTA 3V6ZA 1CN4A 3QQNA 5HGBB 2ZKHH 2XWJB 1D6EB 1BFOA 1T1YA 4NWUL 3TYFB 3RWHA 2WWKO 1A6UL 4LF3A 1NUNB 3WL9B 4K3JL 1FVCA 5I1CL 4RRPA 3U1SH 3CK0H 1GH7A 1REIA 1KC5L 4P5MB 2XV6B 4I5BB 4JKMA 3B6SA 1QLRA 5ESAA 2R0ZH 1NGWB 1S7TB 4XNMB 4JVPA 5MI0B 3NA9H 5FGSA 2GY5A 1CQKA 4E41B 4D9RD 4GRLA 4Z9KB 3MMEB 5GZOC 4JJ5B 4P4RB 1H9VA 4L4VE 1I1CA 2BVTA 5ADPL 2FJGB 1FG2B 4ZFZB 1BBJA 3G5VB 4PLOB 2EDJA 2V5MA 2I9LB 4LCWD 3HMXH 4NQDA 4UQ2A 1RHHA 5CBEB 5I74C 2YMXH 3CIQA 1RK0B 3WUZA 3NN8B 2EYTB 3TIDB 4OI7A 4AIXA 2HG5B 3BPLB 4Z8FH 4Z7UF 3CXDL 1WAAE 3VXNB 1U8OA 1TCRA 25C8H 2CIKB 4DZBA 3PABA 4F9PC 5F70A 1NLDL 3L9RA 5F9AC 5EU6E 4ZO9A 2A6JB 3WFEL 4HKXB 4GSDH 2PYED 3JUZA 2YKLH 2BCKA 3O4OB 2F19L 3D2UA 3UJIH 5DTFA 3IVKB 1FFNB 4AEEA 5L8JB 1CU4H 1H3XA 1IEHA 2NLJA 4TUJB 4L3ED 3SGEI 2EYSB 3E1F1 4KJQD 3EJZD 3SKJH 1AP2A 4NC1C 3ZTNH 1T7WA 4Z76B 5GS0C 5IQ9B 3V6FB 1MCOH 5IIEA 3RI5F 1N5YL 4UMGA 2P46B 2YA2A 3O9WD 1QBLH 1OAQH 1J8HD 5TDOB 3GNML 2P5EA 1NLBH 1CBVL 1CFQB 5FO9B 3EO9L 4KRNA 5CJOL 4NQXA 5I8CB 2IALB 5F8RC 3STLA 3LVEA 3GMMA 3D87B 5IEKB 4Y1AE 4BFEA 3LSOA 3JVGA 3JWDH 4OCRH 3HUJE 4F58H 2P8PA 2VDRL 1VENA 2V2XA 1LVEA 1YNKH 3NCEB 4NT6B 3QDGA 4G8FB 1AIFA 5E95B 5C07E 2EDLA 2P24B 4X9BA 1JHLH 4O2EB 5GSRA 1LD9B 3TVMD 1OAKH 2EICA 4K7PX 3EYVA 3G6DH 4ZS6C 4WFGD 4NO3B 2EH8H 5K9KB 4JJHA 3LH2L 4UIMA 1PD6A 4YE4L 5F6HI 3MODH 2YD9A 5JR1L 4I77L 4XWOD 5DLMH 2UWEA 4PS4L 5DD5H 3QRFM 1N3NA 4H5SB 5CJXA 4D0BA 2XIDA 1FZOB 4QRQB 3TJEL 1R5IA 3SKMA 3MC0A 2HTKC 3B43A 5ID1A 3ARDD 1KJVA 4PJ8D 3BZ4A 4MDJA 4KKCC 3HAEG 3IRZA 2PO6A 5DD6A 3VXPA 3N1FC 1TZGL 1NC2D 1PVHA 2P5WB 1M05B 4UV7L 3PWVB 4S2SA 5C0CE 4C83A 4LLMB 3FRUB 3S4SG 3VGAC 4ZODA 1JGVH 4XRCA 3FMGL 4G7YH 2OYPA 1WFNA 1RZKH 4NM8L 2FECI 4WY7L 4D2NA 1I8IA 1ZLVK 3G6JE 5DUPH 4TSAL 2R29L 5DJAA 3PGCB 3CXHK 3ES6A 4NKMB 3IYLW 1JYNA 5B8CC 1FC1A 3U83A 3VJ6A 1JHTB 1J0ZA 4RRPG 3OKMA 2VZSA 1EXUA 4PGCB 3QXUA 5I18L 2KDGA 2ARJA 1FAIL 4PJHA 4JDZB 3X3FH 4IJ3B 4KDVA 5DDHA 3IAGC 2WWMC 4PJAF 2COQA 5J11C 5BRZE 4X5LA 2DLEA 4M1CD 1T1WA 1I3UA 5IW3A 1FBIL 1A4JA 4HSQA 3PWUB 1MCSA 3NCCB 3OL2A 4WHYH 1LNUB 3T04D 1ZHNB 4HZLA 1K6QL 2X70A 5HI4D 2EIZB 4KMTL 2QEJA 2RJMA 4RCAA 3GSVB 4HUVB 4E0RA 3H9SB 5D5ME 2ZUYA 2VKXA 2R9HC 4XMLH 2NTFB 5EO0B 1J0HA 1J11A 3MLVL 3VXSB 3CC5A 1G7MB 5C08E 3KPSA 4TVPD 4HWBA 1MHEA 1NCTA 4M4PA 4PJXF 5EC2B 1A6ZB 1UJ3C 3RIAK 2HWZH 5CGTA 4JRWA 5I1LB 3QIBC 1N2RB 3SQOH 4HCRA 2BXYA 2JJTC 1ZS8B 1K8DA 4WFHD 3TH4T 4M7LT 1VFBB 4LSUH 3O6ML 3JWOH 4NPYA 1FVDB 1CDJA 3O4LD 1ORSB 4X5WA 1CFNB 1WQVT 1RUAH 2IAMB 4HX1B 5D7JA 5IT2L 1NCBL 5C8JB 3D25B 2VIRB 4PRHB 2LABA 3ZDXE 2R23B 2XTJD 4LHUD 5J56B 3FOMB 1FNAA 2D7TH 4XNUH 2EDHA 4U6HB 4MSWA 3QWQB 1I9IL 3BZFA 5DT1L 2VQTA 4IMKC 2Z93B 2CRMA 2GKIA 4Q2ZA 5SWZB 1DUZA 5D1XA 4G7VL 1I3RB 3O8XC 5ICXB 1ZT7A 3OKOB 4JFQB 3K1KC 4LHQB 4OGYH 1MI5D 4FQ2H 5L6YH 5KS9E 1UVQB 1D6VL 2NY4C 2NY5L 5EULV 1BREA 3W2DH 4HLZH 4DUWA 4PB0L 4ELMB 5JZ7C 4ELKB 4X4YA 1QG3A 2O26U 4I18A 4ZSOE 3QQ9D 4PJ7A 4NHUB 4J8RB 5CLWA 3PP3K 5ALBL 4P4KC 1A3RL 1WSST 3T4AA 3DV4B 1CGSH 1J7VR 5IHZA 3PHSA 1XCTB 5L8KB 5LJYH 1EVUA 5C0GA 1WIUA 4MQTB 1NMBH 2A9MH 4OB5L 4CVXA 2X4SB 4YHLH 5FUOL 4Z0BH 2BNRA 1AXSA 2ICES 1RUQH 3FL7A 4H1LA 3PDOA 1IC7L 3TH3T 1U8KB 1Y18A 2CK2A 3B3IB 5HHPB 3U2SB 5HHVL 1B2WL 2O5YL 3RTQC 3IGAA 4MJID 1FYTD 5JOPD 3MLWL 4HIEA 5D1QD 5DMKB 1O7VA 3DARA 4PJ5E 4N5ED 5HYQB 4UTAL 1FSKB 4NM4H 1NAML 4YXHH 4JHWH 4JG1L 3QFJB 4I9WD 4C4KO 2F54D 4ODVH 4M03A 1H0DA 2IPTH 3DO7B 1TCMA 5E9DA 3VFMA 1GGYA 2G2RB 1X5JA 1CXIA 2H3NB 4D0CA 3ARED 2WUBH 3GMRA 4M6NL 1FE8H 3DOSA 3CLEL 1AFVH 2C3WA 1RJYB 2H2SD 4NO5A 4K8RH 5BJTA 4HEME 4Q6IB 5IW6A 2BSRB 2VXQL 1L9NA 1IGJA 5IG7B 1IC5H 3OGCB 3ARSA 4KVNH 3X14B 1Z0NA 1C7SA 1SJXA 3D39B 2FJHA 2PW1A 4LIQH 3TO4B 1R0AL 4CJ1A 3QZWA 3QEGH 5D4QA 3VXTA 2O5XH 3TNNB 4M5ZH 3U7YH 1DJSA 3KAAA 4JFFA 1RZGB 2YWYA 3AB0C 1RULL 4LEOB 1QO3A 2QBWA 1IGCL 3EYQD 4PUBH 4QGYA 3RKPA 1JWSB 1MRDL 3BT2H 3FCTB 3QDJE 4HUUB 5D7LE 4HG4J 4JY4B 5DGQA 5IFJB 15C8H 43C9A 4XPHL 2AEQL 4MCZA 3S35X 4K7PL 3HMWL 4GAJH 4Y5VC 1CICC 2HVJA 3CCHB 4PJEA 4ZTPL 5IVNA 2ESVB 1MAJA 2CDGA 3ULVE 3MRNB 4EQ2A 4PJHF 1DQQB 4GLRH 5IMKA 3GMOB 1MCWM 4MQXC 2RCSH 1YPZA 1S9XB 5FYJL 4NQCE 4J3TA 1U92B 4KGLA 1KXVC 1IAII 2AXGA 1ZT1A 3KNBA 3TZVD 5BW7C 2APVA 4H0IA 4KY1L 4M6ML 3N9GH 4G6KH 5DJ2B 5ANME 4AIOA 2J8UE 1EUUA 4X8JA 3S34H 3GSXB 2GAZB 1L0XA 4Z5RA 3OR7A 1UADC 3EOYG 4M8QB 5HHXH 4F3FB 3RY6C 4ZQKA 3DHMA 2BRRH 1UC6A 4OGZA 1ZGLA 5BO1L 3SE9H 43CAA 2Y6SC 1Q9KB 3K8MA 1BQUA 4JZNA 1F11B 1IL1B 1KLGB 3BZEA 3R8QA 4JFPB 2ZUQB 2EDYA 2APBA 4R8WL 5DVNA 4KZEL 4KKAD 4XTRC 4BK5A 1YEFL 2D7NA 4XX1E 4JO4H 4FTVE 2W60B 1KN2L 4LRIA 4QLRA 3SDDA 3OTTA 2FH6A 3I3EA 5CD3A 3NCBB 5KSAA 5C92A 3CUPA 1X5FA 4CVWA 4NFCA 3QJFB 4M7ZB 4XPFL 1RZIA 4KH2A 2WIMA 3F8UB 2YR3A 4R4FH 3CDGA 5DEGA 4G8GD 4IEFB 5HYJE 2P7TB 4UILH 4O2FA 6FABH 3LN4A 4KRPC 3UPCA 3P0VL 1I8MA 1MEXH 1F4WH 1YNTB 3Q5TA 3BUYA 1SYSB 2HMIC 4KROD 3C08H 9CGTA 4NN7C 1QKZH 2D7PA 5SX4H 2OMBA 4PJIA 2Z91A 2YPKB 3O45A 5DJ6B 3EO0A 4LNRB 3MRGA 1B6DA 2BVQA 1LK2A 1HH9B 1LEKA 3KLHD 1SJHB 4R96B 1ZLUK 4JKPL 4AK1A 1FDLH 4LFHG 5I9QC 2WIIB 1T6WA 3BSZH 5GQBA 1A1NA 3MLZL 5BV7C 2BY2A 3C6LD 5E08L 5IHBA 2BNUA 2XNAA 1NGXA 3MREB 3RBSA 2ERJB 1QEWA 1KJ2H 4XPGL 1WCBA 4H1LG 3RUGA 4MYWB 4LSQH 4ZFGH 3GJFA 3HPLB 4UT6L 1ZWIB 3SCMA 4KZDH 2QTEA 1EZVY 1GAFH 4RWYH 3MRDA 4XBGA 1UWGL 4KKLD 3KPTA 5I16B 4NQSB 1CE1L 5B38A 4OF7A 3EYOB 5KW9H 1Y0LB 5CEXA 4JZJC 3GMLB 5FHAH 3VXMB 1NGQL 5B39A 3H9HA 3S8WA 1J8KA 1RVFL 4PRDA 4KQ3H 3V9FA 3TESA 5HBBA 1ND0A 2EKJA 1VERA 3JTSA 5A2KH 3I75A 1C5CL 5GJSH 2W59A 5GGTA 1INEL 5F7UA 5F89A 4Q7DA 1CS6A 2ADJB 3GRWA 1NAMB 3U9UA 1QA9B 3DVIA 2IADA 3DTXB 3QUMH 4JRXE 2O93L 2C4FT 3M1BB 1E4XH 4WW2C 4OCXH 3HLAA 1W0YT 3P9LB 3RQ3A 1MUJB 3SDAB 1JWUB 4U1LB 5FGBA 2XWJA 5EZIH 3ZDYF 4JFZL 3UTSB 1MNUH 4G6ML 4UUJB 4WUUA 3TN0A 2B4CC 4ODSL 2AJXH 5F9OH 3OJ2C 4MXVE 2O61B 4YHIA 3NAAH 4HIXL 3T3PF 4UIKL 1S7TA 4XNMA 5ACMA 1F3JB 3BVNA 4EN3C 3TEUA 2F5BH 2HN7B 1VFUA 2Q76B 2D03L 4NGHL 5TJWK 4L1DA 4XBEH 3RVWC 2XN9D 3MMEA 2FBJH 4G43B 5EIIB 3TWCL 4JJ5A 1FLRL 3SDXA 3GSNA 3KJ4C 4Z7WE 5FM5M 4NOBA 2JTDA 4P59H 5FYKE 3G5VA 5ALCL 2I9LA 5GISL 2NZ9D 4ZAKD 4C56E 3NIGE 4FFVC 3V6OA 3WDJA 1F3DJ 3TIDA 3U4BH 2J6EA 4PJEF 4OUUA 1E4WL 3RDTC 3RZCC 5HDQL 5BVJB 3BGFC 1FIGH 3VXNA 1IAMA 2CIKA 2R8SH 4NQEE 4QTIL 1IAKB 2GITB 1KOAA 4GXUN 3V52L 1T2QH 1YPZF 4KV5F 4GG6B 2VDPH 1PSKL 3U4EB 2GIYA 4X6BB 3Q5YA 1GIGH 1QSFD 2A6JA 4KMQA 4CU7A 2IFFH 4ZXBC 1C1EL 4XBPA 4GQ9H 4YHZH 1IZJA 3RAJH 5I30L 5E2UL 3C2AL 3ZL4L 2YUZA 4EDXA 2HJKA 5AWNL 1A7OH 1FFNA 4Y4HC 3BI9X 5AG8A 1CLYH 1KUMA 1GXEA 4RX4A 3NIFF 1T5WB 2W0FB 4TUJA 1QNZL 1U8IB 3TCXA 2EYSA 3IDMA 1IMHC 5DO2D 1GGCL 1KEGH 4QRRB 5K9QG 3LDBB 4YDLB 5I1IL 4QYOA 1YN6B 1H5BC 1JI2A 4NWTH 3VFTA 2NY1D 5BXFB 4OZHE 2MCPL 5E56A 5F9JB 4Z76A 5ISZE 3T2NL 5EN2B 3I2CH 5D7SL 3MBEC 4TSCL 5TH2A 1LO2H 5IQ9A 4PY7A 4QRPA 5GZND 2R0LL 1N8ZA 2BX5A 1KBGH 3S35L 3I9GL 4KK9C 4W68A 1MWAH 4MNGE 4KTYA 2VQ1B 5DMIH 5TDNB 4L9DA 1PEWA 5AZEH 4MJ6B 3WCYA 4EXPX 1DBBL 4JFDD 5IEKA 3DUSA 4Y4FB 1I3GH 2GUOB 1YEHH 3KYKH 1L0QA 4ETQA 4IRSD 4ORZC 1GOFA 1NL0H 2Q1EA 1I4FB 4G8FA 4O02H 3T1FB 4X99A 3UPRB 2KPNA 4ONHA 2DB8A 2HT2C 4OV5B 1RZ8B 1SEBB 1S9KC 2P24A 3OXRA 4O2EA 5KSBE 2PYFB 4K7PY 3CVIH 1YEKH 1RUMH 1S7SB 1QUNA 1MJ7L 1KGCE 1MY7A 1JN6B 3ARWA 3P0YH 4KXZI 5IJKA 1IEBB 5JHDE 5I0ZA 3VGDA 2VLRB 5FOJA 4H5SA 2VLKE 3RA7H 1K4CA 2Y72A 3RUGF 4HWEL 3MLTA 5CJ5A 1G9ML 3IFOA 5IB4B 5JXED 1YEEL 1ZGLP 2W9DL 1UM4H 2P5WA 2YC1B 5B39G 4LMQE 2NXZB 4LKXB 5F6IB 1EUTA 3QG7H 1BJ8A 1J18A 3O41B 4LLMA 1KCLA 4N1HB 1LMKA 1A3LH 2HT4D 4OIIH 2BJML 3LQAC 3ARGD 3MZGB 1OP5H 3WJJC 2OQJA 4E5XB 4L4VD 1P53A 2JB5H 2FEDC 2G9HB 3MCLH 3VFUA 3WIHL 5D7IB 3FFDB 1IM9B 4OM1H 4XXCA 1DVFB 5B21A 5E6IC 2WLYA 1JHTA 1KIPB 5K33A 3MA7B 4NYLA 3UAJC 5IHUL 4BYHA 4JDZA 1FAKT 2F8OA 4JVUA 1P5UA 3HE7D 1MVUB 4XWGL 5EZLB 1WZKA 1T2JA 3KPLB 3RX5A 1XGPA 3DXAE 5GS2D 3VWKC 4PB9H 4LRNL 2UZYB 1TLKA 1LNUA 1ZHNA 1OP3H 1L7IL 1LQSR 2CR6A 5EU6D 4TULL 1RMFL 1KFAL 4RFNB 3GSVA 3KXFE 4NC0B 4U1GC 3G5YB 4PJCB 1JP5A 1ROWA 3MUJA 3KS0J 3A0OA 1RUPH 2NTFA 1AKJB 4QF1B 1KENL 1KELL 4RZCA 4EI5C 4P5TD 3ZSTA 1EIBA 2ADGB 4NO0D 3VXSA 5C0EB 3SDXF 1MIEL 3BEWA 5KBNC 2GTZB 1A6ZA 1QPPA 2UY6A 2Q3ZA 4RMUA 1BQHA 1MVFA 1H8SA 1UCBH 1GRWA 5J4MA 4YGVB 4ZYKA 1HHJB 4IOFC 1G7HB 4YBLB 1UB5B 1CVRA 1LE9B 4UI2A 1CFNA 1UACL 1J0YA 2IAMA 4S1RH 3QEQA 2FCBA 2FYYA 1D5IL 1GGBL 4HX1A 4QOKE 1MHCB 3RL2B 2EH7L 3HMXA 3H3PH 5ACZB 4HMDA 1P7QA 3HC4L 2VIRA 2VDLH 2ZPKH 4YLQT 3QHZL 1QVOB 5J6GB 3FOMA 5FGRA 4Y1AD 4WI4A 1D5ZA 4U6HA 4WGVB 4NQVA 2YPLA 2ZUXA 3ZKNC 4DGIH 5IVZB 3GK8H 3H42L 1I3RA 3BFOA 3SGEH 3R06B 2QSVA 5GGSB 3KPMA 3MCKB 3OKOA 4JFQA 4KWUA 5ESVA 5C07D 4JN1H 2DJ4A 1EAPA 3ARZA 1UM5L 1UVQA 5JUEH 2FWOB 1DL7H 2MKLC 3TA3B 2GCYA 4PG2A 2W9EH 4JQVC 4ELMA 1JYXA 2RAMA 3I6KB 5JQHC 1A3QA 1HI6B 5C0JB 3VDAA 5HYSA 1HEZB 3F12B 3OKLA 2DQEL 2BNQA 4NHUA 4J8RA 5CCKH 5JDSA 2FEEI 5L8LB 2C4XA 2P1YA 4YK4B 4P23B 4MXQC 4O5LH 2RGSA 2H32B 3QBTB 1IEAB 5TGBA 5EO1A 1OLLA 1U93B 3EDFA 5D2NA 1PX4A 1QR4A 4IDLA 2OJZL 1MFBH 2BVEA 2X4SA 1XZ0B 1EFQA 2YEZB 3CXHJ 4LBEB 3F62A 2AJSH 4MS8C 1GC1L 1Q38A 2JF1A 3KR3H 4OLZL 1C12A 4U1HB 1AH1A 3V7AG 4ZS7L 5C0CD 4GRWH 1P7KA 1PKQE 3FZUD 1LEIB 1UM6H 1LP9E 1VHPA 4XMKL 4QNPE 4LSRH 2W92A 2WBJC 4X0KB 5C0RL 3QXAB 4GW1A 3RGVB 4MJ2A 1QPXA 4J6RH 4AQ1B 1TQBB 1HHIB 3NGBB 1C5DB 2XPGB 1QYGH 1NCWL 4FG6D 4ODUB 3ZTJH 3FTGB 4M9OA 4HJ0D 4Q74A 4LLUA 4XPAH 2BSTB 4ALAH 3TT3H 4YHOL 5DHVB 3CU7A 1RJYA 2X89D 5DRWB 5BRZD 2EXYD 1DR9A 2R2EB 1P69B 3OGCA 4OGXL 3PL6B 4JM2D 1O0VA 1ERNA 2ZSVA 4I3SL 5I15H 3ULVL 4GAGL 4NO2A 4LSVL 3TO4A 5GGSY 4AEHH 3OSKA 1QBML 2FH8A 3TNNA 1T21A 3ZDZE 1RZGA 4KUCF 3LKSA 4QCIA 4LEOA 5HGGS 1A14L 4P9HC 4Q97A 4WO4D 2EXWC 1JWSA 4S0TD 5FAAA 5BOPA 3CLFL 3GGWB 5C08D 2Z31D 3NBNA 5IFJA 4FQIL 1D5XB 4U6TA 3ELAT 5EBGA 1F4HA 3O2DH 3Q1SL 1ZHBB 4LOUD 5LXGL 4MMXC 4RFEA 3L5HA 3CCHA 1FNSH 2ESVA 1A02N 1TTUA 3MV9E 4U6VH 4G42B 3MRNA 4KUZL 2F8XC 1DQQA 2XQBH 1PG7X 2QR0A 1GPOL 2R4RH 3ZHLA 1T0NA 3KHQA 2WUCL 2X1XR 1CYGA 1S9XA 1IC4H 4MB5A 5ESQA 4RFOL 1U92A 4I0PB 4QTHB 4XXDA 5EIQA 2R1YA 2XI9A 5HI5D 5T5NG 1JK8A 3GSQB 3MV7E 1W72L 1Z5LB 5DJ2A 3GSXA 2GAZA 5E2JA 2DYPB 4IDJL 2LVEA 2UUDH 4M8QA 1DBKH 4UTBH 4HFWA 1T22A 5F7FA 2DLHA 4F3FA 2EC9U 3CSGA 1VEOA 5F6HJ 5CD5D 4YHNB 5T1KD 4OZIB 4QXWA 3BIKB 2NYYD 3AROA 3RWJA 3EYFB 3PHOB 3DMMD 4XHJD 2DI8A 3MRIA 2LAGB 5FUZL 4H20H 4O4YH 1G7IB 3PDDA 5IP4A 1MFNA 1A0QL 2VQUA 4LAQL 5IOPB 3BKYL 2W60A 3QSKB 3ALWA 1IQDA 2VSCA 3I50H 4NKOB 2NR6C 1T89C 4FXGA 4KDTC 3VE0B 5DFWH 4LQFL 1TNMA 3VXUE 2Z8WC 4U6XB 1M1SA 1A6AA 1IE5A 4LU5L 2AGJH 5E2VH 3WNNA 1RIHH 1OY3B 3UTTE 4OKVA 3GSRB 1PY9A 1YN7A 4DOHE 2P42B 2X7LA 4ZUUB 4XP4L 5DJ6A 3WIIL 4LNRA 3MLYL 5GZOD 2MSPA 1EEZB 4ZUTA 4YIQA 1SJHA 4QXUL 1OAXL 3DRTB 1IFHL 1T83C 2WIIA 4Q9QH 4GRLC 2RQ8A 5TF1H 4F15B 3T65A 4TVPH 4PJ5B 3O3DB 3MREA 2BDNH 4HS8H 4MD0B 3T08A 4GAYB 1U95B 1AGFB 4OQTA 5F3BA 5KZCD 1RK1B 4WHDA 3HPLA 5C6WH 1ZWIA 3S3SA 4XAWL 4BJLA 1J1OL 1XFPA 2XWBB 2CKBL 3KYOA 4NRYA 3S36H 1KN4L 4OZGE 3D85B 1PFCA 1N0XL 1QOKA 4KMLB 4NQSA 1FRGL 1NMAH 4QT5B 2AJZA 2VXTL 2BHUA 3O2VL 3O3BB 5I66B 4NSKB 4Y5XB 3G9AB 4XP1L 3UMTA 1OF2A 2OTUB 3QDJD 1FH5L 1QA9A 1V5JA 4IHOB 4O00A 4KHXL 2VZUA 2BMKA 3FO1A 4AYFA 4GMSL 3LKPA 4U1LA 2EE2A 4DK6A 3R4DA 3UTSA 2VH5H 3TYGH 2CLVA 5D7LB 5DJXB 3VG9C 2N4IA 5CGYC 3TBSA 1VKXA 3QHFH 5I73B 2YRLA 5GS0D 4WEUD 4QRUB 3WLWC 4HPOH 1YDPB 3UCRA 4KAQH 1MPAL 4FABL 2O61A 1NGYB 4UV4L 2MQ0A 4R3SA 5L2KE 1MJ8H 3HG1B 3HNSL 1CBVH 1F3JA 4W6WB 5JIKA 2OR7A 2AK4A 3QO1A 3IT8D 3FQWB 3LKRB 2ENYA 3RWDB 2HN7A 4BSVA 1OCWH 1P2CA 2Q76A 1WZ1L 3S98A 3BPNC 1LGVA 5ITBH 2IMNA 2VDRH 4MAYB 2EIDA 4NQCB 1TTFA 3FB8B 3WKNA 2DQCL 3QYCA 4LHJB 5L7XH 2IQAB 4HFUH 1TFHA 3JVGC 3QQ3B 1LO4L 4R2GB 2A1WL 5ANMB 3RL1A 4DVRL 3RGHA 4I2XB 3U0PB 1NJ9B 4YWGH 4C4KT 1OTUC 2VE6B 2BERA 2OXHA 1QRKA 4KTEL 4M5YH 3LH2H 5EOQL 2PW2B 4BFIB 5T3ZL 3N50A 4HZAA 4ZS6D 5BVJA 1OP9A 2X4NA 2DL2A 4EUPH 4CNIA 4Q6YA 3U7AA 5DRXB 2GITA 4GG6A 4PV8A 2OI9B 1PY4A 1PZUB 1S7XB 3U4EA 1BM3L 3P40A 2HTKD 4CAGA 3ZE2F 5EORL 4KKCD 4OD1L 5CJXC 1G7PB 1FN4B 5HYJD 1YMMA 1W72B 3H9ZA 4FTVB 5CAYB 2CKNA 1T6VN 4DKFH 1TZIA 1T5WA 2GHWB 1INQB 2W0FA 4KI5C 2WM0A 4NM8H 4FQJL 3ORJA 2JK5A 3HRZA 3D3VA 1MFEH 2GJJA 1X4ZA 5GGVL 5HYJB 4OIAA 4AH2B 1YN6A 2MJWA 3DVNB 5F9JA 3PWLB 5F97E 2AEPH 3D18A 4LPTA 5E2TL 3ARQA 3VW3H 2E6PA 2Y06H 3MLPA 5DEZA 1YEDA 2QV2A 3QJHB 1UQSA 4P2QE 5ECJE 3TP4A 3WE6B 3ARFA 2NX5A 5HHOE 1R6VA 1PG7L 1NMCB 1NDGB 3UYRL 1EDQA 4P0DA 2WWMD 4MJ6A 1FBIH 3M07A 3TBWB 4JFXA 2GUOA 4NNPL 4DN3L 4PBVC 2DM2A 5GGQL 4TVSa 4KMTH 5BQ7B 4L8CB 1MRCH 5FHBL 2CO6B 2QQKL 4OF0A 3UPRA 1YQVL 4OV5A 1RZ8A 1FO0L 1SEBA 3K3QA 4LSTH 4TPRL 3BW9A 5TFSL 2R9HD 4MNQE 1S7SA 4JANB 2ENSA 2XA8L 1G9NL 4ZOAA 1A1OA 1L0YA 4JRXD 1NBYA 3MLUH 3OKEB 3OF6A 1IEBA 4OD2B 1OQXA 1SY6H 2JCCE 4DWHA 2X4PA 1XF3B 1S7VB 3NTCH 1G1CA 2VLMD 4N0FA 3SJVB 3QIBD 3OB8A 1HYRC 3NOIA 3HKFA 2FHCA 3SE8H 4JRXB 4LGSB 32C2B 1FL5B 3CVHL 3V4PH 5IB4A 3X13B 2P8MA 4UINL 3S96B 4BQBA 3K8LA 5IMLA 3EAKA 5FF6A 1MCFA 1A7RH 2VDOL 2CKBB 4WTWA 5HDBF 3PGDB 5JHLL 4G5ZL 3D48R 3A67H 3FFCA 4R7NA 1RD6A 2IH3B 1KJ2A 4IS6B 3QUXA 1A6TB 4RAUA 5D7JC 5TE6L 4O58L 1IAIM 1XGYL 4EI6B 4XGZB 4GKNB 1XF2B 4NBYB 5D7IA 1JNNL 5FYKD 1IM9A 1RPQA 3O8XD 1IC1A 5CEZL 1U3JA 3DROB 4PB0H 3PGFH 2DM4A 4HIJA 4MB3A 3WS3B 5ICYA 2EDWA 1ORQA 2NY4D 3ULUC 5K9OB 5IESH 4DGVL 4C56D 4UNUA 4FQ1L 5D1XC 3FB7B 5ALBH 5JZ7D 4IRZL 4X7DC 1UKTA 2OL3H 3KJ6L 4Y4KB 5C6PB 1A9EA 1ZV5A 5EZLA 3SKUD 2MHAB 4P4KD 3KPLA 1F45A 2NY4B 4AL8L 4U49A 3RIFK 4C56B 1S7RB 4PJFA 3QUZB 4BQCA 4OD3H 4LCIH 1B4RA 4RGOL 2XQYK 2PXYB 3L5WB 5F1SA 4PJCA 2A73B 4NQEB 3WYRA 5EH1A 1AKJA 2O5YH 3CSYB 1HYSC 4JO1H 1MLCB 3RJDA 4OT1L 3H7LA 2MPAL 3C60B 5KVDL 1GOHA 1IKNC 2GTWB 1LEGB 2GTZA 3RTQD 4C55A 1MJJB 1I7TA 1N4XH 1NAMH 3F7RA 3OKKA 2ZUUA 2DD8H 4YC2C 2DQFA 1HHJA 4BFGA 4UNTA 5I1EL 2AV7B 5E8EA 5FV1L 4LCUB 3GBML 4QHLB 4TUKL 5IMOA 1UB5A 3F7VB 5GRYA 1LE9A 4J1UA 3L3OA 1B4JH 1EAJA 3ARBB 2Q6WA 1MHCA 3BX7C 4ODWA 5ISZB 1HXYA 4HULB 3WXWL 2AS5M 5LGHL 3NCYP 3U6RB 1QVOA 5IROA 1D9KC 5E24E 2JELH 4Y0GA 1A7NL 4NQDE 4FHBD 4X9IA 4N9OB 4MLSA 4AENB 1IGYB 1WUNT 5AD0B 5IM7A 5IVZA 4MNGB 1NFDB 3QUYC 2HKFL 4RDQF 5BS0A 5JLZB 3R06A 4WV1B 1P6AB 5FM5O 3OAYK 1WBYB 4HGMA 4HIHB 5JORB 1WCQA 1H15A 3TA3A 3IDXH 1MRDH 3RFZC 3I6KA 1HI6A 4UZGA 4R97B 3LPGA 1KGCD 5EFIB 5JPMA 4B7IA 4NN6C 3NPSB 4GOSA 4X6DB 4P23A 3HMWH 1MCPL 3MJ8B 5AYUH 2R0KH 2H32A 5JHDD 2EDRA 2W0PA 4PGJA 2V7HB 2VLKD 3FKUS 4JFEB 5KSBB 1U93A 4K7FB 1MQKL 1CICD 4RBPH 4LLDB 5EB9A 3C6SB 5FYJH 2GQHA 5BZWB 4PJDE 3L7EA 3MUGB 3T0XA 5L0QC 4MQXD 4GO6B 5T1DH 1CXEA 2IF7A 5GRJH 1QFWI 1TXKA 3MACH 2VISA 2H8PA 4P46B 3HI1A 1LEIA 4ERSL 3PXHA 1LE5B 3GB7A 1ED3B 4X0KA 4XI5C 3OZ9L 4JAMB 3D0LB 1XGRB 2IANB 1FO0B 5CZVL 5DJDB 3VRJA 2P5EE 1OT2A 3D5OF 4K2UL 4KXZH 1NANH 2XPGA 1SJVA 5JQ6H 5INCA 5JNYA 4ODUA 4BZYA 5J9PA 3FTGA 2Y6SD 1NCAL 2ZCLL 1EPFA 4R8WH 4KZEH 4YR6B 5A2FA 1WWWX 1VGKB 5DHVA 3QDGE 3ISWA 2GK2A 3TPKA 5F7HA 4ONFL 3WLBB 2R2EA 4WHCA 5CJQL 4XTRD 4Y16A 3J8F7 3DXAD 3CVHB 4WU7B 4HD9A 4DKAA 1T0MA 4JY5H 4PV9B 1KTDA 2E6QA 2PCPB 3HN3A 2DBLL 1E6JH 2JIXD 4BH7B 5KAQG 1URLA 5HXMA 2EEAA 3KXFD 2W9LA 4W6YB 5IVXE 1ZTXL 3E8UH 1TJGH 2F53A 4FZEL 3PNWA 4NHCH 1NSNL 1SMAA 4LRIC 2UWEE 2VXUL 5GGVY 3SDDC 3F5WB 1EH9A 4LPXA 2I07B 3C5ZB 4XNQB 3GGWA 4M7KL 3P77B 1FC2D 4EKXA 2B39A 4KRPD 3CH1B 4HH8A 1DANU 4KI5E 4LMQI 2N7AA 1QSEE 4JKLA 4KTDH 2QKIA 2VZOA 3QR2A 2HMID 1I9JL 2J4WH 1ZHBA 2R1WA 2YSSB 3AU1A 4JKPH 5JPNB 2A6IB 3RPIB 4MQ7A 1NC4B 3T4YB 3T2QA 4IRJA 4U4BA 2VITB 2VZVA 5EZJB 5L9DL 5EBLA 3VWJB 1F2QA 3BIAX 1SM3H 4RGMC 5TQ2L 4PRBB 2YRZA 4S1QH 2IGFH 4QOKD 1BGXH 1LO3L 5ILTL 3S3JA 5D72H 2OZ4H 2AJVH 4PJFF 2C26A 2DLGA 2YXMA 1Z5LA 1UWGH 4PG9B 1X44A 5E2WL 5CKGA 2OK0L 2M26A 3B9KA 4F7PB 1MF2H 1K3IA 5IFHL 5FKPB 2DYPA 2DQGL 2RIKA 1CXKA 3ARRA 4UDUB 4JN2B 1F8TL 4FS0A 5E00B 1WF5A 3FONA 1ZE3C 4WENB 1RVFH 4M4RA 4HPYL 4DCQB 4YHNA 2VUYA 4PJBA 2ED8A 4BK4A 3SDCB 3BIKA 4WJ5A 1JNLL 1CWVA 3PHOA 1CFBA 1X5YA 1YJDH 4GBXC 3G5ZB 4K9EC 4GW4B 1EBAA 3C09C 3U36A 4QRTA 3RNKA 2QJDA 3FB6B 3DX7A 2VYRE 2YK1H 2DQJL 4Z7VB 5SV4A 3O6KL 5CEYB 1NBZB 4XPBL 2DTML 1JPFB 1NGPL 3V4UL 3QI9A 3L3JB 5MEPA 4K94H 4CADA 3KPSE 3P30L 4L4TE 4Y2OA 2Y36H 1WT5A 3P11L 2FX8L 5MENE 3V7MA 4N1EA 5FGBC 2NY0B 1A2YB 1X6NA 4U6XA 3S97C 3UC0H 3PWPD 1OAUH 2WBWB 1RZJL 5GS2H 5KVFH 4PREB 4EN3D 3IDJA 4CU6A 3QDMB 1HIMH 2YRPA 1DBMH 3DX9B 4JO3L 4Y8DC 1HWGB 1ZLWK 2K7PA 4N0RA 4ZUUA 3EW3B 1CL7I 2Y7QB 3IXAB 3RVWD 1NFKA 4HKBB 5I2IA 1YEGL 4CMMB 1IGML 3DRTA 2ICWI 3TBVB 1PKQB 2VAAB 1C08B 3REVB 3DVGB 1OTTC 2XFXA 3RWGA 1N59A 4X6EB 4AM0A 1A9BB 3INUH 4GAYA 3QFDA 2EKSB 1E4WH 3ULUE 3TO2A 3KJ4B 2VDKL 1HXMA 4FFVD 5C9JA 3MRBA 2OR9L 5FA3B 4HWNA 4GT7A 5E8OB 3RDTD 3RZCD 2XWBA 1HSAA 1PSKH 4HS3A 3T77B 3V8OA 2VRAA 4DKEL 4N0YL 3MOAL 7FABH 1WICA 3OXSA 5ELIA 5E8PA 3BPLC 3ME0A 4KQ4L 3KYMA 4PJ7E 3O3BA 2YUXA 5ITFB 1QR1A 1KJ3H 4LCWA 2XICA 5AWNH 4Y5XA 4HC1H 3QNZB 3B9AA 4ZXBD 2Q7YB 2XZAH 5D1ZB 4DTGL 4KVCH 3TCLA 1I7ZA 1BIHA 5ENWA 3IB4A 3LV3A 4OLWH 5KTEH 2OTUA 1U41A 4K55A 4Y4HD 5KVMC 5AEAA 4DJMA 3O4OC 2BNRE 2HLAA 4OLEA 3O6LH 2EDEA 3BP5B 3KYNA 3NPZB 4RIRB 4Q0XL 3FB5A 2R0LH 5DJXA 1WTLA 2PYEA 4QRUA 3MBED 3QCUH 1NGYA 4JFYA 2HFEA 3AMKA 3HG1A 1FFPA 2X4UB 5GJTL 1J87A 3FQWA 3BWAB 4KK9D 4YQXL 3MV9B 4YDIH 3MLXH 1AXIB 1DBBH 1S3KH 4L3EA 1H8NA 2B1HL 3MV7D 3Q6FB 2VN4A 3KLAA 4LSSH 5E9DE 1CE6B 3NZHL 4ZOEA 5F7EL 3FB8A 4K23L 5F8QC 3BXNA 4PRNA 1KCVH 2IQAA 2O5ZH 3FN0L 1OARH 4M3KB 3QQ3A 3EOAB 3HR5A 4I2XA 3O9WA 2HT2D 3HC0B 1NJ9A 1J8HA 2HA1A 3QQ4A 4Y19A 3AAZB 5C7XH 3L3GB 5D6CB 3THML 2V2TA 2YA1A 4BFIA 1KPRB 5HGHA 3IFPB 1R5VB 3LS4L 3OJDB 4JFFE 1OSPL 1OSZB 4ZDHB 5DVKA 3EYSH 1NEZB 2AK1H 3IFNL 3BPCB 4FQCH 2C3VB 1CGYA 3ZE0F 1NUFA 3RKDC 4D0DB 1RIVL 5IJKC 1JVKA 1QLEH 3VXUD 2E9IA 3VD7A 3SGJA 2YD7A 1P1ZB 1R3KA 3H7BB 3TM6A 4H25B 3RX7A 4EJ1C 4PJEE 2AI0H 1MFCH 3V5DB 3MO1B 3UTTD 2QQLL 3CFEB 4PJGF 3VXUB 1J1XH 1GGIL 1KG0B 1XGUB 4AH2A 3M17B 3PWLA 2BVOA 2NW3B 5T1LB 1K5NA 1WJ3A 1F4YH 4U7MA 4BQ9A 4QHKI 3UBXI 1FL3A 4P9MH 2FEDD 4APQB 4DOHB 1ADQH 4HEPG 5EBWB 5IHUH 5E6ID 3N06B 3OGOE 3QJHA 5A43C 3ZO0A 1KYOK 3NIFE 3CFBB 3CFJB 1P4BH 3UAJD 4XXCC 1CVSC 1JRHI 5LBSH 2DQTH 1NDGA 4PD4J 3PQYB 5C2BL 3TBWA 5DURB 4PGEB 2AJ3B 1JMXA 2BY3A 1L7IH 1DDHA 4IJ3C 5BQ7A 1FIEA 3BKJH 3VWKD 3BRFA 5DRNB 3BO8B 5LWYH 3QXWA 1S7WB 1I8LA 3J7HA 1MIEH 1J9CT 2CJUL 5T1MA 4EI5D 5INDB 3MXVL 5MHSE 1BEYL 4HDIB 3RIAF 1N5AB 4V1DB 3IJHA 4OD2A 1F13A 1JUFA 2C3GA 4HUNB 4XZUB 5DD1H 2R2BB 3BN9C 4ZO6A 3SJVA 1KCRH 3MR9B 3O2WL 4P48A 5C70A 5DC0A 3QDAA 1UACH 32C2A 4IOFD 1FL5A 2IC2A 2A2QT 2ZOLA 3E6HA 4RQQB 3X13A 1MCRA 4MZ3A 5HVHB 4JREB 4PJIE 5H8DA 4YHKL 5L2KD 1J5OH 3PGDA 1DN0B 4JG0H 1AE6H 2R56L 4IS6A 3KWWB 2IAMC 1HILB 5GRVL 1PLGL 3H42H 3RUGE 1XMWA 4XGZA 3ZKND 1DQDH 1DUYB 2EDQA 3RWIB 3H3BC 2V6HA 4HF5L 5C0IB 3O4LA 4GRMB 1SVZA 2JJSA 3AS1A 3S7GA 3DROA 5FEBA 2Z4QA 3WS3A 3W9DA 3ESVF 4M1GL 4HK0B 3FB7A 4GRWF 4RMRA 1Q94B 4Y4KA 2ZUWA 4LHUA 1FNGB 4OF6A 3VI4F 3O0RL 4PG2C 5DFTA 2X10A 3F7YA 3R1GL 3NFNB 4HMCA 2OJZH 4MXQD 4MJ5B 5CUSL 2HH0L 5DK0A 4M6OL 1MI5A 1BECA 4Q9BA 1PZ5A 2IEPA 4JPKH 2DQDL 4MS8D 4QY8B 3CSYA 3OB0H 2B0SH 3GDBA 1Q1JH 1MLCA 1DLFL 2Y25A 4XMKH 4WUUE 1LEGA 1PG7W 5ICZB 1MJJA 5HPMA 1EO5A 2WBJD 1BAFH 3WN5B 5SWQA 4KK6C 3BP7B 1U8QA 2AV7A 3ET9F 4LCUA 4MNHB 4Z7UB 1D5MA 4GS7B 1R3JA 4QHLA 4KJWC 4OJFL 3GSWB 4JHAH 3V5KB 1FSKC 2GT9B 1B0GB 5IUSA 3WNMA 4UT7L 3ARBA 5IBLC 3SDXE 4P2QD 2PR4L 5MERB 3WIFB 1K4DB 4L5FL 2WAHA 5GS1A 3SKNB 1U8LB 1RJLB 5HHOD 4YFLI 1BVLA 4R4BB 5J3HC 3PP4L 3U6RA 2HTLC 5EG6C 3L7FA 4JR9H 4GAGH 3ULVH 1WEJL 5GS0H 3GSOA 3SN6N 1BLNB 5AD0A 4MDIA 3EGSA 1NFDA 2IG2L 2DWDB 4MA8L 4Q6IC 1J1PL 2X9WA 1N6UA 4HIHA 4BFBD 5JORA 5IBUB 4UQ3A 4OFVA 4NP4L 3MA9L 2GJZB 3TO4C 1LO0H 4NDMB 4MNQD 5I1HL 2Q86B 3VMOA 3NABL 4OZFA 2EXWD 4DN4H 2CO7B 1QFHA 1UXWB 5DS8B 4X6DA 1HCVA 3AS3A 3MJ8A 1BVKB 5CSBA 5E8DL 2V7HA 4JFEA 5I1JL 5C0AD 5FK9B 1HNFA 1MFDH 1TJHL 5HGAB 1HZHH 1NEUA 3OKDA 4LLDA 3MQIA 3QRGH 5E1HB 3C6SA 2HRPH 2ZUSA 1HHHB 5CSZB 4RFOH 4P49A 1QD0A 1IQWL 3MLRH 4MHHG 1FGVL 4BZ1H 2IH1B 5F9DC 1QFOA 4XAKE 4BSWB 1CZ8H 1V8HA 3RZWA 2DMCA 4JPIB 1N6QH 2QQNL 4P3CH 3EKCA 1ED3A 4NOFA 4LEXL 1HHKA 1MHPL 2IANA 5DJDA 3RVUD 4XNZB 2YBRB 3CFCL 5IW1A 3IXTB 4PRPB 2XT1B 2VDML 4FQQB 4FMFA 3VXRD 4ZUSA 5IB2B 4ENEC 3FHAA 1K3ZA 3HNTL 4LCCA 3FO0L 4E42A 4YR6A 1WZLA 3HE6B 3GMQB 1FFOB 1MY5A 3TZVA 4XP9L 5TQ0H 1I9RH 4DKDC 5D70H 3DSFH 3MRKB 3SHSA 3V7AE 4WDIB 2DJSA 3GIZH 1VFAB 4WUKL 3CVHA 4WU7A 2ZUQC 4LCYB 1VGEL 5SWSD 3HI6H 4BH7A 1SY6A 2NR6D 2WANA 4ODHL 4XP5H 1U91B 2EDNA 2ATPB 2APXA 3G08B 1FJ1A 3GSUB 4JZOA 2A6KB 3HI5H 2I07A 5CP7B 5DJZB 3S4SB 3BH9A 3DX6B 4FN0A 1A1MB 2X4QB 4M7ZC 1M7IB 4DZ8A 3QIUB 3V6ZB 3WIIH 4Q58C 4YHML 5DJCA 2XY1A 2YSSA 2P5WE 4I4WA 5JPNA 1IVLA 4KHTH 4R0LA 4PJAB 5FYJU 1T1YB 1A6VL 2Q20A 3IAQA 4OLVL 2V5RA 5DZLA 3RWHB 1NC4A 3QIWB 1FVCB 2R69L 2VITA 3DO3A 2V2WB 5EZJA 4PTUA 1CGUA 3VWJA 4G8GA 3I3DA 1KIUA 1QP1A 4GRLD 4JPWL 4EEEA 2NY5C 4PRBA 4XVJL 3QEHA 2LVCA 3FAXA 1T7XA 4F57L 2EE9A 2W65A 2E7HA 3SKOA 5EO9B 2ERJC 3W81A 4LSPH 3HNVH 2OL3A 3TV3L 4XCCH 5H35B 4HWBL 3CX5K 2M2DA 4JN2A 4PJXB 1BBJB 4HWUA 5EOTA 4JKWA 4Z7QF 4OTXL 4NQDB 1RHHB 4MJ4A 2L4OA 4FFZL 5I19L 2XKUA 1NAKL 1FV1A 1UFUA 4WFFE 1UWXH 4XC3L 4GXVH 4HBCH 4ZTOL 5SX5H 5C71A 5ABDE 5FYKH 1X5KA 1TCRB 1BQLH 1ZVHA 5CEYA 4DZBB 3PABB 1P7HL 1JPFA 5TDPB 3JZ7A 2R4SH 3L9RB 5FCUH 3VXSE 3CFIC 1F2XK 3S37H 2IQ9L 3WFCL 4WIQA 5CGYD 3SDAC 5EOCL 2BCKB 3WLWD 3D2UB 3DYPA 3FQRB 4POYA 5DTFB 2Q8AH 3NACL 3OKNA 3FQNA 2CDEA 5FB8B 2ZSWA 4PREA 3VFSB 3DX9A 3UTPD 5DSCB 4Z18A 3HZKB 1KACB 4EIZC 5B4MC 4KRMB 1FP5A 2AKRA 2DQCH 3IXAA 1OD9A 3OAUL 4M7LH 2H1PH 3DIFB 1PBYA 1BJ1H 3G6AB 4A6YH 2P5ED 3TBVA 2R2CA 4JGUA 5IIEB 3JTTA 1C08A 3UDWC 1YYML 5FYLL 4KTEH 1PDKA 4EOWL 3DVGA 3I6LE 1X9QA 3LEVL 1BZ7A 4X6EA 4FQHB 5F7MC 2EKSA 5IGXL 1OTUD 4HK3J 3MV01 1ZLWH 4JEGB 3GMMB 5HDLA 3LSOB 1QFWH 3LHPL 4ELME 4H88L 2I9TB 2P8PB 4FFYH 4WHTA 1MRFL 1BM3H 4XNXL 2AAVA 4OSUH 3Q6GH 4NUJA 3QDGB 2BNQE 3C5SB 5ITFA 2A83B 1CFVH 2B2XH 5EUOA 4PTTA 5DVOA 5DR5H 1FPTH 5D1ZA 3FO2A 3PE9A 4FQJH 3IDYB 3WHE0 4AMKL 4UIMB 3V0WL 4KI5D 1QSED 1Q0YH 1S5IL 1G7LA 5E2TH 4D0BB 1R5IB 3SOBH 3SKMB 3GKWL 1KJVB 5E5MB 4MDJB 2PO6B 2WLZA 3QT2A 5DD6B 4YDLC 1U3HB 1QACA 4WWKA 4MAUH 3WFDL 4F9LC 3WNLA 3TBTA 4S2SB 1HH6A 5E94A 1UJTA 4PRAA 5M95B 1WGOA 4X7SL 4NNPH 1G7JB 4HXBL 4XRCB 1CE6A 2VWEC 4U7SA 1IKFL 1I8IB 5FHBH 3T0EB 2AABH 4DQOL 1BJ1J 1LWRA 2P8LA 3D0VA 2MOVA 4M7JH 1FO0H 3B8YA 5C0FA 4Y4FC 3U9PL 2E7CA 5TFSH 1EO7A 3OKMB 3HC0A 1JGEA 2ADFH 5KOMC 4NRZB 2JKXA 4DGYH 3AAZA 3D39E 2ARJB 1TDQA 4PJHB 1N0LA 4FP8L 5DDHB 3IDIA 1HINH 4YDKH 1R5VA 4FXLA 1UA6L 4WTXA 2J1KA 3OJDA 3MBXH 3K81A 3BQUB 4ZDHA 3GBLA 4P57A 1U58B 1AY1L 2A6DA 4IRSA 2Y07L 5BS0B 1MREH 3K4ZA 4M9PA 2X70B 2M8XA 3DUUA 4D3CH 2NW2A 4L4TD 1RIUL 5C3TA 3VDCA 3VXOB 1C5BL 2ORBH 3LRGA 4YGAB 5MEND 2ZUVA 4CL7A 1I8KB 4H25A 5JHLH 5EA0L 3TH2T 2ESVE 3H8NA 1G6RH 2AEIT 3CC5B 5K59F 3KPSB 1MHEB 5D96B 2X1WL 3MFFA 3IKCB 1XGUA 4KGJA 5K9JL 2NXZC 3BKCH 2OZ4A 2VB5A 5F6IC 3GZKA 1JNNH 5D7JD