2AK1H

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with benzoic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1H01
3VXRB 4GRMA 4PJEE 5HYJD 5JO5A 5SWQA 1K6QL 4KKAC 2FWOA 3KXFE 4NN7C 3FN0H 5I1HL 2Z4QA 3HA0A 1K8DB 4X6EB 5KZCB 1LVEA 3MZTA 1JGUL 1IC4L 4TULL 2DMBA 3SE4A 4MJIE 2EIDA 1IGMH 3R06B 4ZFGH 3MLYH 4F7PA 3HE6A 3GGWA 2F53D 4WO4B 2DD8L 3WO4C 1UM5L 1ZOXA 4PJGA 3Q48A 2GY7B 1INQB 2J8UF 1FL6B 3KS0H 5FUOH 2X9XA 2Y4SA 5MEPB 2V7HB 1WWWX 5T1DL 4ZD3L 3GRWL 3BKML 3RAJH 1LEIB 4HK3N 3VCLB 5C7XL 2IGFL 2F8OA 3UTSA 1YMHA 5FO7A 3O9WA 4LRIC 5HSFA 4YJZL 3BH8B 1FIEA 3NIFF 3WNPA 4JREB 2IMMA 4K3JL 2RGSA 4PJ5E 1X5LA 3CLFL 3OJDA 1VADB 4Z7VB 3WFBH 3BGFC 3BH9A 5IMLB 3ALWA 3SGKA 1OGTB 4LMQE 1MCKA 3E6HB 5GRVK 1F8TL 5KJRL 3VXUB 2JELH 3X13A 1CT8A 4IRZL 2AJUL 3QDGB 1DBMH 3L3HA 4KKBC 3ZSSA 2NY1D 1QRNE 4H0GA 5IW6A 1CL7I 4Q9CA 4Y4KA 1P4BH 5A2IH 1YEFH 2F54D 3QDME 5FK9B 4HH9B 3HC3H 1T2QL 4JY5H 3VJ6B 4P2RE 4F57L 1AGCA 4YHOH 1QLRA 3TNNB 2MCPH 2AK4B 1RV6X 2GT9B 4TUOA 4LCCB 5GJTL 4YHKL 1OVZA 3PWLA 2KQNA 4JDTL 1Q72L 1XH3B 4LSPH 2X7LA 5C0AD 3ZYJA 2FJFB 1Q9LB 2J8UE 1QLFA 3FB7A 5J6GB 5D6CB 4XXCA 3ARGB 3UBXG 2EKSB 4P4RA 1ZA6A 1QHPA 2J5LB 4JY6B 3RHWK 5IQ7L 1X4XA 2COQA 3S88L 3NIFE 5LVEA 2C7UA 5HHMB 3VGAB 5L9DL 2XA3A 3IKKA 2BY2A 4HQQL 1S9YB 3BP4A 4X7TB 1M7IB 1Y0LB 4LSVL 1IEAA 1T5XB 1OT2A 1DSFL 4LSTH 3NMEA 1Q1JH 2CLZB 3TIEB 3ULSA 5CSZA 5I16B 2R2HB 3RWDB 4BZ1H 4WHYG 2PKDA 1U3ZA 4IMKA 4MDJA 4NUGL 2FJGA 3X3GH 4XNXL 1BREA 4U2ZA 3DECA 5F88A 5DA0B 5C0DB 3ARFC 4DGVH 3SDYH 1OP5K 1T7VA 3IFPA 4MB3A 5HYJB 4FQIL 2AEPL 3PP3K 3TO4A 4OQTA 1FVCB 5FCUL 5C0JB 1MF2L 1SYVB 3ZKNC 3BPNB 3D0VA 3TBYA 1RZJH 5AYQA 4MNGA 5BCAA 3BJ91 4MNHA 3OX8B 5HBBA 5IVOA 2NY7L 1F4HA 4ERSH 2EDJA 1GZPB 1QSEB 1ETZA 2F53B 3NCYP 3DIFA 4UDTB 3BZEA 2HH0L 1BWMA 2AQ3A 4ONFL 3EOTL 1S3KH 1OAQH 3GJFK 1FNGA 1DQTA 1NFIA 1FYHB 2PETA 4RCAA 4UIMB 5L2KA 3GKZA 5DGRA 1FLTX 4AIOA 3AS0A 2FD6L 3IDMA 4OM1L 4NRXB 2R8SH 4Y5XC 4LLQB 5FYLL 4P46A 4TNVK 3O3UN 4UV7H 1VGEH 3STZA 2VLLA 2H26B 1OD7A 1QA9A 3LQMA 2NY1B 1J5OL 4KVCL 1CBVL 1PKOA 1CFSB 2B8OT 2F54B 3C8DA 3DURA 1SEQL 4JHBA 4Y16A 3OHXA 3AMLA 5JPMA 3T77B 2P24B 1JNHB 5I1JH 3WFCH 3C5SB 4QCIA 2X4PB 2J3SA 1VSCA 2QSCL 1HYRC 1OTSD 4PJHB 1CTOA 3FZUC 2BFVH 5C0AB 3WNLA 2KQMA 2VXSL 2YA0A 5E7BA 4L3EE 3BRFA 1FPTL 3T04D 5FCSH 1N64H 5EG6C 4NM4H 4MNQD 4XT1C 4EXKA 4UBDD 3EYOB 5T1KA 1BBJB 4XMKL 5FDWA 1ZTXH 4UT9L 3DROA 2PR4L 5E94B 4LRNH 3QNYB 1X5HA 3V95A 3VWKC 5J3HD 4JM2A 3O3EA 2A2QT 4PTTA 3LKNA 5D7JC 1I3RA 2ZUVA 2FX8H 4D0BA 2Q7YA 2LAGB 4PP1C 4HK3J 1R5VA 3BZFB 2MQ3A 4WW2A 4U7MA 1KXQE 3O4OC 3UROR 1XEDA 3B5HA 5D1XD 3NFNB 5EBWB 3T0EB 1BZ9A 1EVTC 5EBLB 3D2UA 3E8UH 4JFDB 1DUYA 3LV3B 2EDNA 4FQPA 5JW5B 4OGAC 2ARJA 3CK0H 2B4CL 4O2FA 3SKOA 5DJYA 1L0YA 1RZKH 2VAAA 2VZVA 4RGMC 3MJ9L 3SKMA 4JHZA 1BJ1J 4YFLI 4YHLL 5FFLA 1S5IL 3HN3A 5IJKA 5IVZB 3RWJB 5ENWB 5IHZA 4HXBL 4HLJA 3I85A 1NGXA 4LLYA 3I9GH 1EDQA 3TCXA 3UZQA 3C09C 1OAUL 3WXWL 3MOQA 1X44A 4ZFZB 5DYOA 1LEGA 4WV1B 2C3VB 5IESH 3NA9L 2OTWB 2XN9E 4D0DB 5KSUB 4YC2C 2QQQA 2SEBA 3O8XD 2D7NA 4Q9RL 5B21A 1E4XL 2NY6D 3C9NA 1SBBA 3LY6A 1QSFD 5C3TA 3MLWH 3WDJA 3PJSA 2P7TB 3SCMC 1XR8A 4N0UA 1DL7L 5C0FB 4QHUA 1KF9B 5IF0B 1N3NA 5D7IF 5IMOA 5TFSL 4ZFFB 1G0DA 3N1MC 5E8NA 5DEZA 5BZDB 3OKEA 2BSTA 3GSRB 4MCYA 4JJ5B 2CRZA 2GSGA 2ZSWB 2OJZH 4JPWH 4S11A 5DVLA 2P49B 3MLZH 5F1SA 2E8ZA 5J6HA 1D9KC 1F6FB 2EYSB 1PFCA 4YFEA 4G6AD 2XQYG 3PF2A 2CIIA 2J2ZA 4P5TB 5EZJA 1ADQA 3GB7B 1CFQB 1QVOB 1R3JB 2AQ2A 3CH1B 2NY0B 1YA5A 2LTQC 1KIQA 1T0MA 3OKYA 4HS6B 5D2NE 3LIZL 4GRWB 2EXWD 3RPIB 3QFDA 2XWBA 5C0CA 5IFJB 2WBWB 4MNQB 1BFVL 4DKEL 4IHOA 3S96A 4GT7A 2AJVH 43CAB 4WUUA 1UYWL 4AENB 2E27L 2EDFA 5CUSL 5I18L 3NABH 4DAGL 1NGYA 2YBRA 3MRKA 3PV6B 5D7IE 3VFMA 1XGUA 4RMSA 4UUJB 1NAML 1T83A 2EZ0D 3C6LD 3FRUB 2GJ6E 2CDEB 1TQCB 2X2YA 4PB9L 1P69B 4KDTC 1OAXH 4UIKL 1EBAA 3EGSA 1NDGA 2JJSC 3HHRB 4N0YL 3ILPB 5DDHA 4LKCB 3NAAL 1M7DB 4KKCD 1U3HD 1OTUD 4GUPB 1FVEA 2A38A 1U8JA 4QT5B 2XTJC 4X4ME 4DKFH 5F3BB 5SWSA 4KPHL 1MAMH 1YEJL 3T08A 1JYWA 4MMZC 4LU5H 4HC1L 5LAXB 4OLXL 5F8RC 5INDB 3C5ZB 3SE8H 1BX2A 5BZWA 4I2XB 2X4QA 1LE5B 2AI0L 4XB7A 5LXGL 1R3IL 5AUMB 3UJIH 1JZ8A 3VXSD 4JQXA 4PGDB 2NW2B 4XPHL 3NCBB 2FIKA 3HI5H 3W2DL 1XMWA 1FLRH 3U79A 1H5BA 3MR9B 4X5WB 4IJ3B 2BC4A 5GGUA 1KENH 4WFHD 5I8KH 3IU3A 4JKPH 4JAMB 4JFFB 4WFEE 4J6RH 3O8XB 4ZXBD 2NY6B 2DL9A 1IBGL 3L3GB 2XZZA 3ELAT 1QSFB 2XYCA 3IDYB 3CLEH 4NT6A 4OIBA 3FQWB 4KUZH 4YEEA 4Y19A 1P2CA 1Q9WB 1NSNH 1I3GH 3KVQA 3FQNA 3ISWA 4ODTL 1CN4A 4LQFL 3SDXF 3KNBA 3VD4A 1CDCA 3Q5YA 5CGTA 2O5YL 1YY9C 6CGTA 1P1ZB 4S1QH 5IMMA 3LSOA 2WLZA 1Z6JT 2DKUA 2X1XR 4C59B 1FH5L 1ZHLA 1R5IB 5E6IC 4U1JB 3NFSH 4BH7A 1IGJA 4LHUD 1CVRA 1EEYB 3IJSA 3CUPA 3HTLX 4NHUB 3FQTB 1MLBA 5DQJB 3QRFM 3U30C 1YEDA 3D25B 2XTJE 1FHGA 2WBJA 3QUZC 1CICD 4JPIB 3QO1B 1F3RB 5GGVL 4I9WE 2A1WL 3IFOB 1C08B 5MEOA 1JHTA 1FJ1A 5HI3C 5JW4Q 3H7BB 2HKHL 2A6IA 5HPOA 3WDHA 4PY7A 4FQ2L 2DF3A 3MO1A 4XXDA 1UB5B 4PV8A 2RHEA 3U4BH 3RZCB 5FIEA 3VFGL 3VW3L 3LRSA 2FGZA 2EYRB 1MQKL 1UVQA 4HJJL 3SDXE 4O4YL 3PNWB 4BSVA 5FYLD 4FZEH 3BT2H 1YN6B 2VDOL 3H3PL 2AXFA 2EC9T 3MACH 5C08E 1X5KA 2GCYB 3W9DB 1Q9KB 3HI1B 3OXRA 3JTTA 4GRLD 3C5JB 5HGDA 2BVOA 5DHYA 5F7EL 1I85C 3ECBA 5JOFA 3NZHL 4LDEB 1BFOB 1A7RH 4JRXA 4LAJH 1KCVH 3VXOB 3BHBB 3B9KD 4PRHD 3VRIA 4NZUH 1NBQA 3RGVD 1NC2D 2O5XL 1H8OA 25C8L 5D5MA 1D5ZB 2R0KH 2IJ0C 4KMTH 5TE7L 3MV01 3SN6N 2VLKB 4ZMAT 4E0RB 3RKDC 15C8H 1IAOB 1MHPH 3C08H 1KJVA 4PRIA 4H20H 4M5YL 3U7YH 1KN4H 3MJ7A 5TH2A 3T2PA 4I0PA 1UT9A 3VXSB 1TPXB 4P4KA 2DQGL 1FZJA 5BOPA 4DVBB 3O2DH 4D3CH 3X14B 3F7QA 1N8ZA 1XCTB 1SJEA 5ESQB 1RHFA 4UT7L 5JIKA 2PW2A 2IPTH 4ZXBB 2NY2D 1MAJA 2Z91B 1A3LL 3IAQA 4PJXF 5DMKA 3LKSA 5ITBL 3OAYK 1G7PA 1QPPA 4P23C 1KIPB 2NXZB 3LPWA 3L7FB 5MEQB 2OR8A 3PL6B 5GS1A 1B0WA 4P49A 1ZKAA 4UV4L 4LPYA 1DP0A 3S9DB 1S78C 1S9VB 2YHGA 3VXTB 1JZ2A 1EXUA 1A6VL 3IDJB 4ODWA 4PIRF 1A6WL 3PDDA 1HILA 5C2UB 3MREA 5T3XL 3W5MA 1B6UA 1HEZB 1BD2E 4X9IA 1OAYH 1V7NH 4FTVA 4LHUB 4FXGB 1A6AA 5EZLA 1D5XA 3WMSA 2ESVB 2ICEA 1LNUB 3ARBC 3VRJB 4PS4H 1CICB 5GISH 1AHWB 1NQBA 3SOBL 1AO7E 2NZIA 4YXLH 1JPTL 2AJXL 2V5TA 2VR5A 5GQBA 1YNKL 4F2MA 3MRNB 1KCRL 1JGEB 3VGDA 1IGIH 1JPFB 4D9RD 4OLVL 4MQ7A 4PJXE 3P4OB 3WJJA 1S5HB 3FMGL 3T65B 4U33A 2ERJC 1A7PL 3MBEA 5CMAA 4PJ8C 1EHLL 1CXHA 4OLWH 4JN1H 1HQRA 4NQDA 4M7LH 2I9TB 3GNMH 1I7RA 2XOTA 3BN9C 1CI5A 3RIFF 1AXSB 1I9JL 1O7SA 4GRLB 4HF5L 1VFOA 3P0VH 4LLDA 2CLVA 4JFYB 2DQCL 1F5WA 4OQTL 3U9PL 4LCWA 2Q7NA 4HBCL 4I4WB 4XHJD 3KDMB 5DUPL 3HZYA 4N68A 4Y8DC 3D9AL 4ONGL 2P5WD 3GKWL 3HKFA 4ODHL 1EHAA 1WZ1L 8FABB 2VZ3A 1FGNH 5I8CA 3B9KB 2VLRD 1LK2A 4PRHB 5LCVL 2EO9A 3GEWB 4LMQI 2VC2H 5IBLD 3DX8B 4TUKH 3EO1A 1HH6A 4YDJB 2UZIL 2MFNA 1AGEB 1A9EA 1NC2B 4HKXB 1SBSH 5JDSB 1A5FH 3B8YA 2OCFD 3H6JA 3VXQA 2H6PA 2F58L 1J0ZA 2XTLA 3G9VA 3KYNA 4U0RB 4AIXA 5I73C 4ONHB 2YA2A 5KVEH 1PG7H 3Q6FB 2G2RA 2IAND 5DS8B 5EFIB 3PABA 1DVFD 5F7NC 3LB6C 1UH4A 2UVEA 1VFMA 3VFVB 3RU8H 4HUKB 5C0IB 1MREH 1PZ5A 2IBZY 4XVUC 2NY2B 1F6AB 5EB9A 5AWNL 3VU2A 2ICWB 3UC0L 4OQ1A 3QUXA 3SGEH 3DSFL 3A6CH 4JFPA 4NN6B 3HR6A 1G9MH 2YSSB 3L7EA 1EO7A 5E5MA 3IDIA 4MZ2A 4LSUL 4NFDA 4K94C 4IMLB 4F8QA 3TA3A 4L1HA 4LEXL 1JRHI 3QXVA 2XT1B 1NGQH 4HPOH 3EYFB 4L1DA 3TVMB 1RZIA 1UXWA 3KPSD 4MJ4A 3LAFA 2AP2A 2HTLD 1YMMA 3U9UA 5I19H 3NPZB 2NYYD 5FM5M 3PXHA 2VDKL 4U1SA 5HYSB 3IFNH 5HHQA 4UILL 4ZFOA 4TVPL 5ANMB 2GFBA 2VLJB 3GMMB 3FO2B 3JV6B 1G7QA 1WWBX 4L8DA 2HFEB 4DWHA 5SX5H 2CRYA 2JCCA 2X05A 2YEZA 3OV6A 1R3HA 3ZE2F 4U6XA 4M43L 5J11C 4UB0H 4Y2DA 4L8SC 3O3DB 3MUGA 3HC0B 1MEXH 2XQBH 2Q3AA 3CVIL 4XH2B 2X42A 1B4RA 2IH1A 3MLXL 4PJ9A 3OJ2C 3QR2A 4HS8L 5HDBF 1RUQL 4JN2A 4FP8H 4OGYL 1IEHA 2ZZUT 4L9LA 4NKMA 5LBSL 5IW1A 3DGGB 2BVEA 5ACMA 3QA3B 2QR0A 1G7LA 2NMSA 1JPGA 4J8RA 5K9JL 4I18C 4PJ7A 4M93B 5CLWA 3C8KA 5DRWB 4UI2A 3O41A 1J0KA 2AJ3B 1UWXH 1ULVA 4YNYA 2HKFH 1C7SA 4DUWA 3F7VA 3X3FL 4K7PY 3GO1L 5I9QB 2FX7L 5CD5C 5ICZB 4JG1L 2OR9L 1MHCB 2JIXD 5C3LD 2G5BB 3MV9A 5F44A 5F9OL 2APTA 4GKOA 4JZJC 5IHBA 4RGOH 4Q6IC 1TVHA 3ZE2E 1VFBB 4J3UA 4PR5A 1GGBH 1NC4A 1UM6L 2Y36H 4NCDA 2MKWA 4TYUA 5EDXA 3W9EA 1I7ZB 4LLUB 1UWEH 2YPKB 3C60D 4R8WL 5DUMH 4BM7A 2IANB 3B43A 5HDBE 1WWAX 1DVFB 5IG7B 1K6QH 1LHZA 1WISA 1NAMB 5I1HH 4G8IA 2OXGA 5HHME 3QH3A 1JGUH 5JLZB 1IC4H 3O3AB 4TULH 2GK2A 1WV7T 3DVIA 3I6LE 3FB8B 2MHAA 4GKZB 3DUHA 1HNGA 4QF1B 4XCEA 3JUZA 2Z92B 2I9LB 1LO3H 4JZOA 3L3KB 1HSAA 1KTKE 2DD8H 2CIKA 1A4KB 1AE6L 1XCQB 1UM5H 4PRPA 3Q0HA 4YXHL 2P8PA 1CYGA 3BKJL 1MQ8A 1VERA 3HE6D 3MRRA 5C6WH 5T1DH 4ZD3H 3GRWH 4C56A 3GBLA 1OTTC 2VIRA 4MAYB 3MYJA 5B39A 5BRZE 5C7XH 2IGFH 5EIIA 4TUJB 4NC0B 1ADQL 5IK3B 5AAMA 3RTQC 3KPSB 1BQHB 4F7EA 2DIJA 3ZL4L 4K3JH 5DURD 1W2KT 3UTSD 3O9WD 3WXVL 1NUNB 2WM0A 1DBAL 5E8PB 1EZVY 3E6FA 5KJRH 1F8TH 1CE1L 5ICXA 2NY5C 1KT2B 4AT6B 4IRZH 2AJUH 5EOQL 3KJ4C 4LCYA 4P3DB 4NPYA 5FKPA 1OP9A 5GRXG 4ZPVB 4B50A 4R96B 1KLUA 4LPCA 2VISA 3KLAA 2X89A 4PG2A 5B4MC 1T2QH 1WEJL 3REVB 4F57H 1RU9L 1N26A 4Y4KD 1PKQE 5KSBA 2X5PA 1FYTE 3GUTB 1ZA3B 5GJTH 4YHKH 2ATKA 3HCVB 1TZHB 4JDTH 1IKFL 2UWEB 1Q72H 2NX5B 3U36A 3KPPB 4G7VL 5GRVL 4J4PA 4JQIL 1AP2B 4XBEL 5KN5A 2NY4D 1J1OL 2YN5A 5IQ7H 3O2WL 3KPLB 5T3XD 1P84J 5KSVA 3S88H 3DXAA 3N50A 5FM4A 3D69B 4X6DB 5L9DH 4HQQH 1PQZB 2YWYA 1SVCP 5T5FL 1EO5A 1IM3B 1FVDB 4OKVA 3RGHA 1HQ4B 4N0FB 1DSFH 3HB3C 3GMRA 1X5XA 5GSRA 1ZT7A 1H3WM 4N9OB 2HVKB 4GW1A 1A1MB 4PBWD 4NCC1 1XT5A 2WQ8A 1KIRB 1MIEL 3EFDL 4PJEA 4NUGH 4LP4A 5DJCA 2UUDK 4LHQB 43C9A 4XNXH 1AGFB 4HS3B 3U0PA 4OZHB 4R7DA 1HKFA 2GJJA 3WFEL 5KANG 5JA8B 4E5XB 3C60B 5HJ3B 1P4IL 1HWHB 1J86A 4A6YA 3HI6L 4MJIA 5F89A 3P4NA 4FQIH 2AEPH 5HGHB 2EXYC 2IC2A 1K3IA 1PD6A 3WNMA 1VEOA 4R2GC 2Y23A 1MF2H 4GRMB 4QHKI 5JO5B 4M4RA 5SWQB 1DE4A 1LP9A 4HT1L 2FWOB 1PBYA 3B2VL 4GKNA 3TO4D 2Z4QB 5DK0A 1YQVL 1VACA 1IQDA 1YYML 2NY7H 3DOSA 4BZ2L 3SE3C 2DQUL 4HKBA 1YNLL 1FP5A 4ZSOE 4N8CL 4PJ5A 5I30L 3JWDC 2HH0H 4ONFH 4F7PB 3HE6B 4KJPC 3GGWB 4WDIA 3EOTH 1OM3L 1B6DA 4PJGB 4G6JL 5DC9B 1VESA 3IS1X 3CDYA 4WRLA 1QRNA 4UAOB 5DURB 1G6RA 1F3DJ 3QCUL 4MJ6A 3UTSB 1YMHB 2FD6H 2MKLC 3O9WB 3QULA 5CILL 5FO7B 3QDMA 5L2KD 4H8WC 5FYLH 3GHBL 1Z9LA 4P2RA 4NDMA 2G9HA 3OJDB 1SJHA 3G5ZA 2Z9TA 1Z0NA 3BH9B 1J5OH 4BSJA 4KVCH 5FA4A 4P46D 3X13B 4PGZA 2OMNA 1CT8B 3QBTB 4Y5VC 2J8UA 1NMCC 4RGNC 1SEQH 3L3HB 4R4NC 1EV2E 4P2CG 2EDLA 5IW6B 1PEWA 3LQAH 4Y4KB 2VYRE 5JUEL 3DVGA 4JCLA 1SM3H 4I13B 32C2A 4Y16D 3RWGA 4FQXD 2QSCH 3GIVA 1AGCB 2VDNL 1QLRB 2PTTA 3UTOA 3P30L 2VXSH 5E0QA 4TUOB 4AYFA 2HRLA 1CDHA 1FPTH 1K2DA 4UT6H 3PWLB 4LGSB 4MMXC 1KBGL 2NY4B 2X7LB 3UAJD 3B3IA 2BOBA 1QLFB 1TZGL 3FB7B 4XMKH 5ISZE 4UMGA 4UT9H 2CUIA 2PR4H 4P4RB 4HDIA 1ZA6B 4HBQA 1KYOK 3VH8A 5C0BE 1NUGA 2C7UB 2K7QA 5T1KD 2DQFA 2HA1A 3BP4B 3GMLA 1IEAB 2IEPA 3EDEA 1RJZA 4F8TA 1QOKA 4JM2D 3L3JA 5CSZB 3ULSB 1VFAA 4FQJL 1QRKA 3N1GC 4U2YA 4MDJB 2CXKA 4ZAKC 4AJ0A 2FJGB 5EN2A 2B4CH 3NCCB 3D2UD 3B2UD 3D87B 5MI0C 2IMNA 3MJ9H 1G9NC 1MI5E 4YHLH 2NW3A 1S5IH 3MV11 4GRWE 5F88B 4Z7QE 2WNGA 3H9HA 3FB6A 4HXBH 4GAFB 1GGTA 2P1YA 3IFPB 4WHTA 3S98A 4J3VA 2ZUXA 4ZQKA 5DTFA 4PREA 3KLHD 4D9QD 5F8QC 4Y4FA 3TO4B 4NCC2 4RGNE 1L4IA 1ZLVK 1OAUH 2WWMC 3D0VB 3TBYB 1JWUA 4MNGB 4BFIA 5ITFA 1YEHL 2ZJSL 4MNHB 1CD1A 3T2OA 5EU5A 3B5TA 3NA9H 3HG1D 2FEEI 1ETZB 4Z0BL 4Y4HC 4HIIA 5F21B 1Q8MA 3DIFB 4RMRA 4WUKL 1E4XH 3BZEB 4Q9RH 1EO8L 2VDML 1DL7H 3MA7A 4Z18A 3FTGA 1MY5A 3SDCA 1FNGB 3QEHA 1NFIB 3P9WB 5L2KB 2N7BA 3UTTD 1DZBA 4RX4A 5TFSH 3AS2A 2CMRL 3T1FA 3IDMB 2X4SA 1T66C 4LIQE 5JHLL 3ARFA 1C5CL 3P11L 4P46B 5J56B 3STZB 2VLLB 2NQCA 1QA9B 4L3EA 1NCBL 3BJLA 3QG7L 4MJ2A 2XA8L 1S7XA 2VXQL 2PYED 3KPTA 4JO1L 3DURB 4PJAF 4MHHG 1JUFA 4PGJA 4LPUA 4Y16B 3OHXB 5JW3L 5FGCB 4KVNL 3DTXA 5JPMB 2ZKHL 4BFGA 4FRWA 1IFHL 4QCIB 3T4YA 1A6TA 3S36L 2QQLL 3LIZH 3QUYA 2BJML 1KJ2A 1A3RL 4DKEH 4YHYB 3OR7A 2VTFA 4M6OL 4K07A 2ILLA 4M03A 4JE4B 1UYWH 2E27H 5CUSH 5I18H 4DAGH 3DROB 5IFHL 1NAMH 2WLYA 2R1YA 4QXGL 4WUUD 4Y1AB 3S34L 3UJTL 4PB9H 4JM2B 3O3EB 4X9HA 4PTTB 3LKNB 4RSVA 4Y5XA 3MNVA 1I3RB 4UIKH 4CJ0A 4D0BB 2Q7YB 1IJ9A 1R5VB 4N0YH 2W0LA 2BY0A 4WW2B 4K8RD 5EU6E 5HHPA 3TBVA 1U8QA 3NAAH 1UZ6F 2WZPD 2VSCA 5FECA 5ID0A 2IPUK 2LQRA 4G43A 1BZ9B 1YJDL 3D2UB 3KYMA 5D9SA 1CK0L 3TFKD 1DUYB 4KPHH 2CQVA 4X9BA 1YEJH 4UNVA 3EOYG 5DFVC 2ARJB 3VDBA 4CRPA 4O2FB 1V5JA 3SKOB 5DJYB 4HC1H 1NGPH 2VAAB 1MCNA 4OLXH 5SWSD 3SKMB 4A2LA 4EUPA 4L4VE 3S3JA 2DICA 1BQUA 4MJ5A 3ZYZA 4TSCL 2Q8AL 5IHZB 3IB4A 2AI0H 5LXGH 1HHHA 1NGXB 4LLYB 1R3IH 4XPHH 1IARB 4XCYA 5EO9A 4KI5C 5I1CL 1J12A 2R9HD 1D3CA 2YD5A 4U0QB 3CVHA 4PBVC 2OTPA 2ZPKL 5KS9F 2BHYA 5ETUA 5DYOB 1LEGB 4ZFOL 1UEMA 3V6OE 1IBGH 3OKOA 4X8XA 1P84K 4NO0A 2VDRL 2BNUA 1NLDL 2UVFA 1QR1A 2NXYC 2SEBB 1UWGL 3C9NB 3D0LA 5B3JF 1UZ6E 2CK2A 3PJSB 4ODTH 4LQFH 1N6QL 1MIML 1XR8B 4N0UB 1HZHL 2W38A 4QHUB 2O5YH 3OAZH 4Y19D 4MS8D 2FR4A 1N3NB 2D7OA 1MCSA 5IMOB 1FH5H 5KTEL 1KELL 5E8NB 2FH8A 1IC7L 1YPZE 3OKEB 1FFNA 2BSTB 3ZYIA 1AXIB 4U6VL 4MCYB 4M1GL 5GZOC 5D2NA 2GSGB 3F8UB 4DUVA 4K9EL 5I0ZA 1H3VA 3SQOL 4WFHE 5J6HB 3E2HC 5I0DA 3NGBB 5GGVH 3OB0H 3ALPA 5JNYA 3T0AA 5D7IA 3HNTL 1U8KA 2NR6C 4M3JA 4Z7WF 1N5YL 2CIIB 2HKHH 3QEGH 4WI4A 5EZJB 1UG9A 2GJ6A 4HXAL 4FQ2H 4U1KA 1KIQB 1T0MB 3FJTA 5D6DA 1T21A 1FG9C 1OPGL 3QFDB 3VFGH 3F5WA 2YPLB 2XWBB 5C0CB 5B3JE 3VW3H 2OK0L 1MQKH 4IHOB 3ARQA 4HJJH 3S96B 4O4YH 3VFRA 2E9JA 3H3PH 5C70A 4WUUB 3VXPA 3DI3B 2GK0A 1NGYB 2YBRB 3MRKB 5KAQG 3VFMB 1XGUB 3WIHA 5DR5H 5F7EH 1NANI 3NZHH 5IB2A 2FH6A 1A14L 3HS0A 4X7CC 4NQCE 3O6ML 1CGUA 3BQUC 3S37L 3CPLA 2ID5A 3EGSB 1NDGB 4KDVA 3GJEA 3V4VL 4JRXD 5F7YC 1EIBA 5DDHB 4G42A 3NN8A 2O5XH 5CAYB 4DQOL 25C8H 1FVEB 1U8JB 5SWSB 1T04A 2FX9L 4MD0A 2NNAB 4Z7WE 1GOFA 4NWTL 1UZ8A 4YDLB 5KG9A 2X4RA 1WTLA 4M5YH 1Z9MA 5T5NG 4OZ4A 5HDOA 1FL5A 4PRID 4WI3A 1BX2B 2AJSL 2VQ1A 4N0CD 5JXEC 5BZWB 1Q0YL 2X4QB 3OF6A 4F80A 4I8DA 2A0LC 2Z0BA 4I0PD 4YHNA 4P4KD 4UT7H 2FIKB 1REIA 3ZKMD 3ULVF 1H5BB 4ETYA 1A3LH 5GGUB 2BC4B 4URTB 3QAZC 2XACC 4X99A 1KLGA 1CIUA 1OB1A 1I1CA 3IU3B 1U3JA 5ITBH 4PD4K 1JMZA 4KDTA 4NT6B 3WIFA 2BVYA 2JJSA 1KXTB 4CUCA 3CX5K 1M7XA 4Y19B 1P2CB 3EDDA 4UV4H 3L5JA 3D39A 3FQNB 2E6QA 1A6VH 1A6WH 2QQNL 3KNBB 1J11A 3CMOL 3LPFA 3PHSA 5T3XH 4OCRL 5IMMB 3LSOB 5I74B 4RFNB 4M61A 4R97B 1ZHLB 3BFOA 2X09A 4ZO9A 4FTVD 4WWID 3FAXA 3VI4F 1IGJB 4BH7B 4KJWD 3IJSB 3CUPB 5GGSY 3SOBH 1QR4A 1MLBB 4JHAL 1YC8A 3WS6A 1MCCA 1JPTH 4I1NB 2AJXH 4Y0GA 1C5DA 1YEDB 3SDXA 1ES0A 1YNKH 3ULVE 1U92A 2BX5A 2WBJB 3NOIA 1JZ3A 1KCRH 3DETD 1U6AL 3L5IA 5C08A 4LF3A 1TTGA 1IAMA 1QFWM 3FMGH 5MEOB 3HE7C 1JHTB 3H9SE 4JRYE 4LAQL 1FJ1B 1A7PH 4CMHC 3T2QA 2A6IB 2GY5A 4QEGA 2R39A 1MFNA 1EHLH 1CD9B 5TE4L 4PY7B 2QADC 3MO1B 4XXDB 5AZEL 4PV8B 3D1MC 4L8CA 3MBED 4A6YL 1GCFA 3AAZA 3LRSB 1RZJC 4EI5C 1UVQB 1I9JH 4QTIL 4BSVB 5E03A 4NQDD 2DJUA 3ETBF 3N0PB 1K5NA 2AXFB 2DQCH 3MRMA 4RQQA 2GAZA 4TN9A 3U9PH 4CMMA 4HBCH 4BJLA 5DO2C 5DUPH 4WEBL 4RA3A 3OXRB 4XC1L 4X6CF 4ONGH 3GKWH 3JTTB 4FQCL 4ODHH 2BVOB 5HGDB 3TZVC 1WZ1H 5DHYB 4C4KO 5H8DA 4AG4L 3ECBB 5JOFB 4LCWD 5LCVH 4FMFA 4GXVL 3VI4E 4JRXB 1IE5A 4S0SD 2UZIH 3UBXI 3BP7A 5ICYA 5DMGC 5IEHA 3QI9D 5FOBA 3VRIB 4N5ED 3DX6A 2F58H 3QUZA 2CD0A 5D5MB 1JFQL 4RBPK 5H2BA 2EE3A 5CZKA 3W82A 4PRIB 1KJVB 4MDIA 4DN3L 2ZOKA 1G6RL 2FEDD 1BIHA 1MH5A 3MJ7B 5TH2B 1KSRA 3K46A 4I0PB 3RWFA 4P4KB 4HSQA 5D1QC 1FZJB 3QIUA 4GXUN 1S7SA 5ALBL 3T0DA 2P5WE 1N8ZB 1PYWA 1SJEB 1EVUA 1A21A 2JJUA 4L29A 5AWNH 5GRYA 2VLRE 3UC0H 4R0LC 3VGFA 3IDXH 3DSFH 3TN0C 2H41A 2PW2B 3FFCD 1Y18A 4HIHA 3BGAA 1BD2A 5DMKB 4LSUH 4OCSL 3QUXD 3LKSB 4KMQA 1LK3L 1NEZG 4LEXH 1G7PB 3DRQA 5EOCJ 3SDDC 4JKWA 5D71L 4EJ1C 3S35X 2YC1A 3TA3D 5GS1B 2WUBL 1AO7A 5HHOE 3P77A 1U93A 1TCRA 1EXUB 4AEIL 4ODWB 1HILB 1U3YA 2R1WA 4OIAA 3MREB 4BQ8A 5ALCL 4GS7C 1JRHL 3BO8A 3NPSC 4FTVB 4CKVX 2VDKH 4PJXA 4HCRH 1YMMD 4RZCA 4UILH 1A6AB 4TVPH 5EZLB 1D5XB 4S1RL 3W11D 4X7EC 3QEUA 2QHRH 2ICEB 4LLWB 2HFTA 4M43H 1IZKA 1P7KA 1I1RA 3MLXH 4F2MB 1RZKC 1FAIL 4M7LT 4HS8H 3ZHDA 3HMXA 2ZCKL 4Q97A 1RUQH 4OD3L 3ROOA 3LN4A 4MQ7B 5D96B 2J88L 2C1PA 4OGYH 4PJ9D 5CS7A 3MBEB 5CMAB 5LBSH 4OFYA 4OLZH 1HQRB 4P23A 4NQDB 5I1IL 1U58A 4H1LA 3J8F7 1RURL 3F7PC 1I7RB 4YIQA 4E42A 3AY4A 3RP1A 4K3GA 1MCHA 3HAEA 5IFAL 3E3QC 2AW2A 1AR1D 1UENA 2FSEA 4LLDB 2CLVB 2C5DC 4OZGF 4LCWB 4M7KL 2HAZA 1XIWC 3X3FH 3HZYB 3QXAA 3GO1H 2V2TA 3EHBD 2FX7H 5HPMA 4JG1H 4MYWB 2OR9H 1F45A 2EDXA 3P9LA 4ZNEE 5I8CB 1LK2B 1G0YR 3WYRA 5F9OH 3CFDA 1CS6A 3RVVD 3EUUA 3EO1B 1HH6B 2FIRT 2EDTA 1A9EB 1HHKA 1GVIA 1UM6H 3IAPA 3MV9D 1I9IL 5E70A 2UWEE 3O4LE 3VXQB 2H6PB 1SY6H 4R8WH 1NC4D 3JSSA 3KYNB 1T03L 1S7QA 2OL3A 4WENB 4GXUM 3V52L 4P5MA 5K9KA 2ED9A 4GQPH 2G2RB 2BSRA 1NAKL 3PABB 2X9YA 4QRRE 5F71A 5LGJA 5I1LA 5SX4I 2DM7A 3U1SL 4F7MA 3SKUD 5GJSL 4P2OC 4NOBA 4WY7L 3BEVA 4TVSa 1PZ5B 5I76A 2V6HA 3GM0A 4OZGE 1DR9A 2VNCA 1AE6H 3QUXB 4JFPB 4YXHH 3BKJH 3L7EB 3I84A 5E5MB 4FFWC 4XVJL 2HN7A 5DJAA 3IDIB 4MD5A 3CU1A 3AGVA 3QXTA 4PRPD 5DD3L 3TA3B 3MCG1 3ZT5A 1C16A 2PTUA 3KS0J 3QQ4A 5A2FA 3ZL4H 1BF2A 4P3WA 3TWCL 2CUMA 4C56D 5DC0A 3H9ZA 2PO6C 1KJ2L 3WXVH 1RZIB 1UXWB 4KMLB 2ARJQ 3V0WL 1CWVA 1DBAH 1HWGB 3FAWA 2XG5A 1SYSA 1YMMB 2DJSA 3BWUC 3VXME 3U9UB 4XBGA 2VLMD 5FF6A 2OZ4A 3SDAC 1ZWIA 2Y25A 5EOQH 2Y5TA 3BAEL 5IBTL 2XZQL 1ZLUH 4PLOB 4W70A 2ADGA 4U1SB 5HHQB 4B5EA 4ZFOB 2EECA 2GFBB 2AEQL 2BRQA 1G7QB 4L8DB 1WEJH 3TJHD 5DF0A 2JCCB 4HX1A 1RU9H 1LO2H 1KPUA 1T80A 1IVLA 2YEZB 1R3HB 4M3KB 4U6XB 1TENA 5D70L 4Y2DB 3MUGB 1OARL 5JIIA 5JQ6L 1IKFH 2XG4A 2BNRE 2IH1B 4PJ9B 3ROLA 5EU4A 2XZAL 1NBZA 4G7VH 4MCZA 4XP9H 4O5LL 3QP3A 2XQYK 4JQIH 5I1EL 3AREC 4GBXD 4JN2B 4XBEH 3IU4L 4KKLD 1WCBA 4C54A 3UTSE 4L9LB 4NKMB 5DWUL 3O2WH 1B2WL 1ACZA 3AU1A 2CR6A 5IW1B 5E00A 4J4PD 4IRJC 4KJYA 1CFBA 1I8IA 4ZUTA 2QR0B 1G7LB 3PDOA 1JPGB 5F72S 4J8RB 3DXAD 4PJ7B 3QISA 5J0BA 4FFZL 3QUMA 3C8KB 3CU7A 2M2DA 3O41B 4YNYB 4M7JL 3F7VB 1I8MA 1MIEH 3CXHK 3EFDH 2FO4A 3DVFA 3CVHL 5B39G 3MV9B 1RD6A 4LCCC 3G9AB 5E8OA 4MLIA 1TVHB 1A6UL 1P4IH 4PR5B 4PY8J 1NC4B 3HI6H 4L8SA 3BE1L 4ZOBA 3W9EB 1J0IA 3GSUA 3ARGC 4HWEL 1MCDA 2J5LC 1HHGA 4MJID 2HWZL 4HT1H 3VGAC 4G6ML 1UJ3C 3FONA 3B2VH 4G8IB 3BVNA 4J1UA 1YQVH 2A9NL 3SEPA 3QH3B 5CGYD 5BRZA 4BZ2H 2DQUH 4ESKA 1YNLH 2MHAB 4N8CH 5I30H 4KK6D 3G6AA 3U4EA 3LDBB 5CZXD 4XCEB 1OP5H 2D7TL 3ULUH 5IKCA 4JZOB 1HSAB 2CIKB 3PP3H 2VDPL 1JPSL 3LEVL 4PRPB 3QXDA 1Z3GL 2P8PB 1J1PL 4G6JH 3ALXA 1KB9K 2PXYA 3MRRB 1DQLL 4RMQA 4KC3B 3QCUH 4C56B 1JHKL 2VIRB 3MYJB 5B39B 2ZWLT 2E7BA 5EIIB 5CILH 2IF7A 5C0ND 5BOZG 4F7EB 1MCPH 4RFOH 1QRND 4JCMA 3GHBH 4RISL 3DX9A 5JW4N 3GSNA 3L3DA 1PKQA 4M8VA 1T0NA 2DQJL 3QDMD 1FYTA 1GOGA 4ZTOL 3VE0A 2BSSA 3S6CA 1CR9L 1Q9OA 3E6FB 5IMKA 5ICXB 4KHXL 4DJMA 2Y06L 3HPJA 3U83A 4U6TA 4LCYB 5FKPB 4NPYB 3W0WE 5HD8C 3GJFH 4R26H 5INCA 3WIHL 3MTRA 4LARL 4QY8A 4KKAD 1KLUB 5JUEH 1NJ9A 2VISB 3KLAB 3S35L 2XWJA 3HLAA 5ADOL 2VDNH 5ID1A 1XGTA 3ESVF 3QT2A 5KSBB 5E6ZA 3S5LG 2YPVL 2ATKB 2A83A 1KBGH 4OCWL 1Z5LA 3MGOA 2AABL 3U36B 3G08A 4NKQB 4FN0A 5L2KE 1TZGH 3MROA 1NPUA 3OZ9L 3RA7L 3MOBL 5KN5B 3VD5A 1JF1A 5KSVB 3DXAB 2W59A 3KPMA 4EBQL 1IGFL 3GMQA 3S4SG 4OKVB 4JHWL 4ZOCA 3GMRB 3RWEA 2IADA 5GSRB 1ZT7B 3QHTC 1DUZA 5D7LE 4FQJH 3UMTA 4GW1B 4FG6C 4ZPTA 4PJEB 2CK0L 1RI8A 5KVGL 5DJCB 43C9B 3U0PB 4KKBD 4R7DB 1RJLA 1LO5A 5C0EA 4A6YB 4MJIB 4ZSOA 4OZFA 5F89B 3P4NB 1Z9SA 3KPOA 2V2XA 3RUGF 3BP6A 4Z7OF 3GSWA 1DE4B 1LP9B 1UACL 4X5LA 4GKNB 1GPOL 4M6ML 1YEHH 5DK0B 2ZJSH 1DJSA 1VACB 3EO9L 4LEOA 1IQDB 5IBUG 1G7HA 2P46B 1KLFA 1GIGL 1LILA 4CVXA 4HKBB 2UY6A 4Q6YA 5DQ9A 3T0EC 4Z0BH 4PJ5B 2P42B 4WUKH 5LKNA 5CSGA 2O26U 1T20A 2VUOA 1EO8H 4WDIB 1JL8A 5JW4M 2ICES 2FEEL 2C9AA 1QRNB 3NCEB 1G6RB 1GL4B 1IT9L 2CMRH 2C26A 4MJ6B 3VH8G 1YEGH 4D9QE 3QULB 2Z8WC 3QDMB 3OKKA 5JHLH 1C5CH 3P11H 3EZ8A 5HYEA 4P2RB 1WFOA 4NDMB 2G9HB 1SJHB 2FECL 3G5ZB 2Q6WA 1Q38A 1NCBH 4GW4A 2HP4A 3IGAA 3ARFD 3QG7H 3RUGE 5FA4B 5D8JL 2XA8H 5CEZL 4Y8AA 2VXQH 2W60A 4Z7OE 4YUEL 1NDMA 4KGLA 4JO1H 2J8UB 2JK5A 4HPYL 4L3ED 4NN7B 2NPLX 3VI3F 3HG1E 1G1YA 5ISZA 3MRCA 5JW3H 4KHTL 4HKZA 2ZKHH 3ZKND 1O7VA 1IFHH 5IBUB 5F7DA 5C0BA 2ORBL 3DVGB 5HY9A 3S36H 2QQLH 32C2B 4LSDA 5KOMC 3RWGB 2BJMH 3GIVB 2PTTB 1UXSA 1A3RH 1VPOH 3UTTE 1DEEA 4M6OH 1K2DB 2F74A 2I60L 3QUYD 1TJHH 3L6FA 3B3IB 2BOBB 3MV7E 3OG6B 5M7QA 4RAUA 2YK1L 2IBZX 4HDIB 1ITCA 4QXGH 2I26N 5LG1A 3VH8B 3WKML 3S34H 3UJTH 3WE6A 3IS0X 1TDQA 3OAUL 2H9GB 2DQFB 1MI5A 3DYOA 2H2PD 2PYEE 3GMLB 3MA9L 1G9MC 1FV1A 2H32A 1RJZB 1WSST 3TNMA 3QQNA 5JTWA 3L3JB 4KTDL 1VFAB 1CXEA 4P5TC 3QCVL 4K71B 5F1NA 1CK0H 1CFTA 3FRPA 3UYRL 3VI3E 5T3ZE 2NY0C 4JFEE 5EN2B 4K2UL 12E8H 1SVZA 4AM0A 1I9RL 1XF1A 2NW3B 5D1XA 1WBZA 3H9HB 4AEFA 3FB6B 4TSCH 2Q8AH 3IYLW 3A67L 3V4UL 2LVEA 4WHTB 3CDCA 5DTFB 4ZQKB 4PREB 3TJEL 4BFBD 2RR3A 4Y4FB 3FZUD 2HLFC 1TQCC 3RPKA 5I1CH 2ZPKH 1JWUB 2KZWA 4BFIB 3PXJA 5ITFB 5IV2A 4LOUC 1CD1B 5GRJL 1HE7A 1N6VA 3CFCL 4TNWK 4HJ0C 5EU5B 1YNTA 2FB4L 1DDHA 1MCJA 1NLDH 5IHLB 1U8HA 4HIIB 4OF6A 4YE4L 1UWGH 2HFFA 3KWWA 4NO0D 1N6QH 1MIMH 1HZHH 3MA7B 2V5RA 3FTGB 3SDCB 3QEHB 2VERN 4X6BB 5AG8A 3C5ZC 1E4XI 3QHFL 3TYGL 4NQEE 3F58L 4FXLA 1MAKA 1BEYL 1KELH 5KTEH 4BK5A 4OIIL 3T1FB 1IC7H 2X4SB 5FO9A 4OGAD 4IRSC 4U6VH 3ARFB 1DN2A 2DTML 4K9EH 1ZGLA 5JXAL 4L3EB 4IJ3C 4XPBL 4DTGL 5E4EB 1QO3A 1JVKA 2P43B 1S7XB 4OBSA 1JGLL 2D2OA 4LPVA 4WGWB 4OFVA 1JUFB 3EYVA 3HNTH 3IDYC 4JKLA 3R0MA 3FN3A 1N5YH 3DTXB 1QP1A 5F7WC 3T4YB 1A6TB 2W9DL 5FYJE 5ABDE 4EUPG 1CTNA 4P99A 1R24A 3QUYB 1OPGH 4Y4HA 4MQXC 2OK0H 1KJ2B 3BEWA 2GJ6D 3OR7B 4X4ZA 3DV4A 1IGTA 5EU6A 5L2JA 3ZTNL 4PJAA 2OL3L 5I6XB 2IQAA 3Q5TA 4FS0A 1TFHA 4YH6A 1RIHL 5HDLA 2D0FA 1DQML 1E28A 2R1YB 5L6YL 4JPVH 5J8OA 4EDWL 1A14H 4XVSL 4NFCA 5D7SL 3O6MH 3QB7C 3MYZA 4Y5XB 3MNVB 2DIBA 4L4VA 3S37H 1EGJA 1WLHA 2XWTA 3K4DA 1ZT4A 3K4ZA 3WN5A 4Z7UF 1ZSDA 5HHPB 3TBVB 1FE8H 1U8QB 1F4YL 1NMAL 1TNMA 3C6LA 1ZLWK 2HYMA 2EXWC 5FECB 5ID0B 4G43B 4U1HA 3CJJA 4DQOH 5LGHL 5FB8A 1ZHKA 3KYMB 5D9SB 5BW7A 3PWJA 2FX9H 2YZ8A 2YUVA 3RY6C 1HSBA 1D9KD 4NWTH 3RZCC 2APFA 1ZT1A 5F7UA 2NY3B 4GQ9L 3V6OA 3OXSA 3I2CL 4EUPB 2O93L 5JOEA 4KXZI 1U3HA 2AJSH 4MJ5B 4EOWL 1Q0YH 3SKJL 4JO2L 4WFED 1HHHB 1FORL 1JN6A 1PJ9A 1VB9A 1T7XA 1BBDL 3EYQD 1NGWA 1JV5A 2ZUSA 3OF6D 1OP3K 4XCYB 5EO9B 2VWEE 2OZ4L 3P2TA 1RUPL 4KU1A 2FLBT 3CVHB 1II4E 4KKCC 5ETUB 1OTUC 1F4WL 1F13A 2FNBA 2HTKC 3DLQR 1YPZA 3OKOB 3O6FC 4NO0B 2BNUB 1UKQA 1CU4L 1QR1B 2VZ1A 4QRTA 3D0LB 3O4OB 2VXUL 1INEH 1ZLSL 3S97C 2RBLA 4IEFB 4IDJL 3CMOH 1OY3B 4POUB 4OCRH 4P9HH 2FR4B 1TXKA 4MD4A 3D39D 2LFGA 5KS9A 3ZTJH 2XTJD 1D5MA 4K94L 4RGMB 3B9EA 5CJ5A 1S9XA 5CKAA 4I9WD 1FFNB 4HUNB 3OAYH 5D2NB 4F37F 4JHAH 2DI8A 4ZXBC 2UZYB 1FL3A 4C58B 4BQBA 3QUML 1U6AH 5IHUL 2HT3D 3AM8C 1ORSA 3HMWH 5JNYB 5D7IB 1U8KB 5E2WL 4LVHC 1L7IL 2NXZC 3WO3B 4LAQH 3PGCA 4WTWA 5C08D 4XVTL 3PL6C 5DD5L 5TJWK 3SBWC 2GJ6B 3FKUS 5TE4H 1W8NA 4U1KB 4NQCA 3QO0A 5AZEH 3CSGA 1T21B 3AS1A 1LO0L 3F5WB 4A6YH 1C1EL 4QHNA 1BJ1H 1JTTA 1WF5A 4QTIH 1JK8A 3VFRB 1LD9A 3VXPB 1SEBA 3REWA 1BQSA 3VMNA 2GK0B 4WEBH 4YDKL 5GHWL 4XC1H 5LWYL 1PX4A 4FQCH 2QBWA 3RI5F 5CEZD 4LFHD 3UXFA 4Z7WA 5D1ZA 4AG4H 1CICC 5IB2B 1AHWC 1CF8H 1YY9D 2BHZA 4GXVH 5CJXC 3HS0B 3ILQC 4HUXA 1ZMYA 4WHCA 1T3FA 2R0LL 5FYJU 2F8VA 2ATPA 3LKRA 4HWBA 1J10A 5D7KE 3UO1L 4O9HL 3N9GL 3CPLB 3GJEB 4R90L 2C3WA 2GW5A 3IDGA 3BOVA 2JKXA 4G42B 3NN8B 4K23L 4WTXA 3HPLA 2I25N 1MRCL 3WD5L 1T04B 4MD0B 6FABL 1CFVL 3M8OL 1WWCA 3MRFA 3QUZD 4ZYKA 1UZ8B 5KG9B 2X4RB 4DN3H 1G6RH 1CGXA 1EFXA 4M1CC 2LTQB 3RGVA 4OZ4B 4DZ8A 2Q20A 1FL5B 4PGBA 5HI3D 2VQ1B 3DUUA 2OJEA 5C9JA 4IIQA 4M9OA 3BUYA 3GSNL 4EQ2A 4YHNB 3LQAC 5KANI 3K8LA 3VWJC 3QIUD 1WTGT 4BUHA 3MCKA 4PUBH 1FFRA 1EK3A 1OD9A 1DQJA 4X99B 1L9MA 2JJTC 1KLGB 1OB1B 1MCOL 5DHVA 2EC8A 5J12C 1JWSA 2CR3A 4G7YL 3C87A 4YPGA 1ZE3C 1BD2D 3CIQA 4GAYA 3WIFB 3CFKA 5D71H 2GSIA 2WUBH 4HMEA 5IWLC 3IFLL 3WS3A 3B9AA 3D39B 4DEPC 1RUML 4AEIH 3KAAA 2OS7A 1DTUA 3VA6A 4LFHG 5EU7E 4ODVL 2XTJB 3TGXA 4WWKA 4RMTA 5ACZA 4N5UA 1AO7D 1JRHH 1RMFH 3BW9A 4X7DC 4M61B 3H9SA 4JRYA 1BM3L 4P9ML 4TRPL 4S1RH 2NY2C 5JXEA 4XI5C 4NN6C 3FFCE 1C5DB 3SDXB 4BK4A 1ES0B 2R2EA 1FAIH 1SJXA 1UGNA 1QBML 5C08B 4NKIL 3JV0A 4UU9A 1R3LA 4OD3H 4LF3B 2J88H 4ODXA 5JOPE 3TVMC 3EO0A 2MPAL 4K7PL 1MHHA 5CP7A 5I71B 3TYFA 1IKNA 5I1IH 1CDUA 1RURH 2JF1A 1AJ7L 2DLHA 3LQZA 4L8CB 2A9MH 3MRLA 3AAZB 5IFAH 3MXWL 1YMME 4P23D 3FO0L 5TPWL 1K5NB 3MRMB 4RQQB 2GAZB 4CMMB 4M7KH 1JHLH 1S78D 1AIFA 1UEYA 3WNOA 4POYA 3MMEA 3K74B 5TGBA 3QZWA 4KRPC 3L95A 5EZIL 4WU7A 3QSKB 3CSBA 2EDEA 3BP7B 5ICYB 2AJYL 2DBJA 5IEHB 2WIIA 1I9IH 1CQYA 5MP6H 5FOBB 3DX6B 2EH7L 4KKNA 2P5WA 4MX7A 1U8IA 2BXYA 3QUZB 5CJOL 2VLRA 4AIZA 1T03H 5E56A 2DN7A 3V52H 5H2BB 1H3XA 3HE7A 3RL1B 1NAKH 4MDIB 2DLGA 3WFDL 2ZOKB 5JA9A 1MH5B 4M93C 4MQTB 4G9FE 1RZ8A 2CKBA 1M05A 3RWFB 3UCRA 2OYPA 1UH2A 3SGDI 5GJSH 3QIUB 1U8MA 1S7SB 4WY7H 4PJ8D 5J06A 2CKNA 5IBLC 2R4RL 5DVNA 1PYWB 5I9QC 5HDQL 5HHOA 4L29B 1PDKA 4OJFL 2CJUL 1X5GA 3V6FA 2DYPD 4ZS7L 5MHSD 3V6BR 1D6EA 1CLYL 4XVJH 2D7MA 1FG2A 1Y18B 4HIHB 1BD2B 1L6ZA 3RWIA 4F9LA 5DD3H 4MSWA 1J8HD 3NIDF 3DRQB 1RIUL 5I1GL 4H1LG 2YC1B 1KJ2H 3TBWA 1AO7B 3HAEG 3P77B 2AXHA 4IM8A 1U93B 5L8JB 3CGTA 1TCRB 4JR9L 1G0XA 1MWAH 4X7SL 2VKXA 2R1WB 1YDPA 3BAEH 3BO8B 2IAMC 5IBTH 2XZQH 5FGRA 1WIUA 4PJXB 5L0QC 4OZIF 3L1OL 4RZCB 4XP4L 1E6JL 2DDQL 2L7UA 4HLZH 4KROC 4RRPA 2AEQH 3QEUB 5D1QA 2GEEA 5C71A 3IETA 3LB6D 4DN4L 1VKXA 1OARH 1IAII 1P7KB 5F70A 2VL4A 5JQ6H 4UDUA 1AGDA 3EAKA 4MAYC 4OCLC 3TN0A 1NCAL 4XVUD 1LWRA 2XZAH 5GRWA 3ROOB 3LN4B 4ODUA 2CRMA 5I1EH 2HTLC 3NA4A 3M07A 1AD9A 3IU4H 1ED3A 2OQJA 2C1PB 3GDBA 4ZNEA 1B2WH 1OQOA 4RIRA 3I50L 4FQHA 4Q58C 5JHDA 1BJ8A 4MHHI 4P23B 4EUPH 1U58B 4H1LB 5IEKA 4PLJD 4YIQB 4E42B 3HAEB 4FFZH 4OLUL 2FSEB 3KR3L 1U8OA 4MA1C 4L8BA 3O4LA 1JYVA 4M7JH 2KH2B 5F3HA 4GLRH 1SJVA 2I5YL 3MRGA 3QXAB 4OZIE 2V2TB 2Z8SA 5HPMB 3CVHH 5KSAA 3P9LB 5L7XL 3CFDB 4QRRA 2QV2A 3MV8A 2ZG1A 1HHKB 4LIQL 3BE1H 2I07A 3STBA 3LH2L 4HWEH 4OZGA 4PRDA 2JIXA 4QYOA 1OW0C 1S7QB 2OL3B 4UQ2A 2HWZH 2OMBA 1XGQA 3H2WA 2WV3A 4G6MH 5TDPA 4P5MB 5K9KB 4GOSA 3U0WL 2BSRB 3B9VA 3C6SA 4JM4L 4PLNC 2HT2D 2UUDH 2A9NH 3TP4A 5J7CC 1QFOA 5LGJB 3FT3A 5I1LB 4F7MB 2FO1A 1N7ML 3BEVB 5BRZD 4PJCF 5I76B 4NUJA 1FCCA 2D7TH 3IRPX 5HVFB 4XX1G 1GOHA 2F5BL 3T3PE 4HZLA 3ZT7A 2VDPH 1JPSH 1XIWA 3VXMA 3LEVH 1Z3GH 5DGQA 1J1PH 4X6DF 1YEIL 3L5XL 2XPGA 2GUOA 3K2MC 1DQLH 1I7TA 3STLA 1KACB 2HN7B 5DJAB 1JHKH 3PWUA 4MD5B 1EUTA 4GG8A 4PJIF 5CD5D 1C16B 4YK4C 3QQ4B 2PXYD 3K7UA 3MFFA 4RISH 2EEDA 3O81A 1P53A 1L7TL 3VFOA 2DQJH 4ZTOH 4EIZC 1CR9H 1SYSB 1S7WA 2BNRA 5E2UL 4XBGB 5FF6B 4KHXH 1LP9E 2Y06H 1ZLUK 4RMWA 1ZWIB 3V4PL 1FYTD 1I3VA 4NP4L 2GHWB 1D5BA 2J7LA 3SE4C 3H0TA 2ADGB 4HGMA 4LARH 3WIHH 1NL0H 1PAMA 1VA9A 1M71A 5BXFA 3S35H 1T2XA 1X5ZA 4QHLA 3HE6C 4HX1B 5ADOH 1KPUB 3L5HA 4PJCE 1EGJL 3MLTA 3CD4A 3BMWA 4M5ZL 2YPVH 5J1AA 1TVBA 4UAOC 3UPAA 4OCWH 5C9KA 1DBBL 2AABH 3ROLB 5EU4B 5T1MA 1NBZB 3O9WC 4MCZB 3AFLA 2W91A 3OZ9H 3RA7H 4MB5A 3MOBH 1WCBB 1QBBA 4XCCL 3MRHA 5H37G 3AU1B 3FQUA 1P7HL 2I27N 5E00B 1ND0A 1RULL 4KJYB 1J9CT 1I9EA 2X4OA 4RAVA 1HHIA 4EBQH 1IGFH 1I8IB 1EHXA 2PO6A 4ZUTB 3ARYA 1A64A 3PDOB 3RTQD 4JHWH 3GMPA 4M9PA 5DZNA 3IKCA 4PJFF 3O3BA 1JTPA 2OXHA 4HUMB 3QUMB 2FATL 2HFGL 3DWTA 4NM8L 3EOAA 5DD1L 1BZ7A 3SDAA 1I8MB 4Y89A 3MOAL 5HGAA 2C4FU 2FO4B 4P48A 5KVGH 4FFYL 2GTZA 3MRIA 2JB5L 3R06A 3FT2A 3VDCA 5F9WC 1NGZA 5E8OB 1AXTL 4GG6F 5J11B 2ZNXA 4L8SB 1NBVL 3I3DA 5B4MD 2XI9A 1U8NA 1ACYH 5FV1L 3GSUB 3A6OA 3VFNA 5EOCL 1X6NA 1HHGB 2D3VA 3AREA 4JB9L 4GW5B 1UACH 3FONB 4HG4J 1GPOH 4H25A 4M6MH 3BVNB 3MLSL 4J1UB 1A9BA 3EO9H 1NUFA 5BRZB 1MJ8L 4IRJA 3DNKA 1GIGH 4N8VA 4PJFE 5LQBL 3G6AB 4IMKC 3U4EB 2FYYA 5AD0A 4PRBB 5IKCB 1MCFA 4MWFA 4C83A 3HB3D 2A6JA 3MLRL 3QXDB 5F6IB 3UBXB 1ZLVH 2PXYB 4EI6A 3W0WA 2QQKL 1IT9H 4LCCA 2HJFA 1P6AB 5IVXF 4GG6E 5DC4B 1WICA 2R29L 4DUXA 3TO4C 5GGQH 4XP5H 3T2NL 4JO3L 3DX9B 3GSNB 3L3DB 1PKQB 1T0NB 1FYTB 7FABL 3VE0B 3BKCL 1N4XL 2BSSB 1EH9A 1Q9OB 5D8JH 1GGUA 5IMKB 4YUEH 2DQEL 3HPJB 1IRAY 4AK1A 2KUTA 4HPYH 1UJ3A 2D0GA 1KCKA 5INCB 1WBYA 4KHTH 4QY8B 4NQVA 5GZNC 2IH3A 1NJ9B 2ORBH 5ELIA 5ISZD 2XWJB 3HLAB 4HWBL 1XGTB 5ID1B 3ARSA 2YD4A 4OZFG 5C0BD 4UTBH 3B8SA 2I60H 2A83B 4LVNB 4JANA 1Z5LB 1J7VR 1QSVA 3MGOB 5D7LA 3G08B 5DJ6A 2N4IA 3MROB 2AK1L 2YK1H 3A6BL 4FQXA 5IVXE 1DQQA 1JF1B 3WKMH 1C12A 3KPMB 3RVXD 1ZVSA 3MA9H 1FDLL 3GMQB 3H7LA 1CZ8L 1UQSA 1RHHA 3RWEB 2IADB 4WFFE 1MI5D 1DUZB 4KTDH 3RNQA 2V7NA 2GTWA 3QCVH 3R8QA 3V0AC 4I3SL 1F4AA 3IDUA 4ZPTB 3UYRH 3GMOA 1T89C 4HKJA 4K2UH 1IGML 3EYSL 3ARDA 1J8KA 4ZFGL 4RGND 3V6ZA 4YHYC 1I9RH 4EQ3A 4R4ND 3VG0L 4NO5A 1RJLB 4M7ZC 2QSVA 3V79C 1LO5B 1FNFA 5C0EB 2EDWA 5FGBA 3V4UH 3A67H 4ZSOB 1T2JA 4OZFB 4ZUWA 1E4WL 3TJEH 2X4UA 1N0LA 4IOFD 3KPOB 2V2XB 3BP6B 4HULB 3ULVL 4JM2C 3GSWB 4O2EA 1DANT 2DMCA 1CE6A 3TO2A 4LEOB 3VXNA 1AH1A 3WFBL 5GRJH 4WW2C 3CFCH 1G7HB 4GMSL 3I02A 4CVXB 1NUDA 2C3GA 4QGYA 5DQ9B 2OX5A 3B2UC 1KTLA 4OV6F 1CQKA 3MC0A 3NBNA 1Z0MA 1T20B 4JZNA 3RUGA 4P2QE 3NCYS 3QPXL 3QHFH 3S3PA 3TYGH 3F58H 3HG1A 3ARTA 3BESR 1BEYH 4QRSA 1R5WA 5EBGA 4ZAKD 5F7MC 3P4MA 3EJZC 3OKKB 1QBLL 5JMOC 1MCIA 2DTMH 2BOCA 2XKNA 4YGVA 4KJQD 4Y5YA 2Q6WB 4DTGH 4GW4B 3UTTA 1TQBB 3IGAB 4NZRH 2W60B 1TLKA 3LZFL 1NDMB 1JGLH 1B4JL 3RI5K 2JK5B 4HAGA 3FRPG 5EUOF 3FQRA 3MV7A 4YO0A 5DMYA 2J6EA 5ISZB 1A2YA 3MRCB 4RDQG 2WIMA 3CSPA 4HKZB 2ITCA 2XNAA 5F7DB 5C0BB 1JNLH 5HY9B 2W9DH 1KN2L 2VKWA 1M6OA 2CSPA 4BZ1L 3BISA 3ES6A 1UXSB 2PYEA 1QD0A 1J18A 1MUJA 1DEEB 3X3GL 2F74B 3FOMA 5LJYH 1CLZL 3DYMA 3L6FB 4Y4HD 4J3SA 1VEPA 3I75A 1IM9A 2OL3H 2ZSVA 4JQVA 4RAUB 1RIHH 3ZKXC 1KB5A 4JFEA 5EU6D 1DQMH 5ENWA 4NZDA 3K81A 4L5FL 3CXDL 5L6YH 4EDWH 4XVSH 3WE6B 2A77L 3MGTA 5D7SH 1S7VA 2CKBL 1MI5B 3LKOA 3DVNA 3RNKA 3MLPA 1FFQA 1YEKL 3NGBC 1FV1B 2H32B 1RZJL 1W0VA 2APWA 4Q74A 2YRLA 1XF4A 2AGJL 4TPRL 2GKIA 1NANH 3TNMB 4LVEA 1F4YH 1NMAH 3QWRA 4G5ZL 4L4VD 5LGHH 1KFAL 5EUOE 4B7IA 2NLJA 4RGNB 5F1NB 1CFTB 2ADJA 2YA1A 3H42L 4KY1L 4FNLL 4LGRB 2DWEA 1H3PL 2NZ9C 4AM0B 1L6XA 1PVHA 4GQ9H 1GC1L 2DOCA 3I2CH 3LD8C 4NNXA 5D1XB 1F11A 1WBZB 4W81A 4EOWH 1S3KL 3SKJH 3OJVC 4U05A 4JO2H 3VD9A 4ZOEA 3G6DL 1FORH 2FL5A 2NTFA 1T83C 3VD3A 1BZQK 4PLKC 2OZ4H 1RUPH 1KNOA 4OI8A 2FZ3A 4XNZC 1OL0A 35C8L 5IV2B 4NQEA 5E2TL 1F4WH 2DS4A 3GSXA 3U6RA 3RVUC 5A2KH 3QDJA 2PTVA 1YNTB 1DDHB 1BGXL 4APQC 2B5IB 4OTXL 4JFHE 1CU4H 4BFEA 1U8HB 3BD3A 1KJMA 2HFFB 2VXUH 3KWWB 4V1DD 1ZLSH 2K3TA 5BS0E 4IDJH 5I1JL 2XIDA 1AQDA 3PWNA 2LVCA 3CCHA 5FO8A 1U8PA 5F97E 3QXUA 4K94H 5MI0B 4NIKB 2YMXL 1LGVA 1FNLA 3FOLA 5FO9B 1X5YA 4JQXC 5HTSA 4FQQA 2YXMA 3QIWA 1HINL 4XWGL 1BMGA 3PWPD 1WJ3A 1ZGLB 4PRNA 1NCCL 4QKXB 4NO3A 1QO3B 3QUMH 4G80A 4WTZA 4AMKL 4W68A 1KULA 5IB3A 2EE6A 2ZG3A 1U95A 5IHUH 3WUZA 2APVA 1UKSA 2VDLL 3EYVB 5E2WH 4N1EA 1L7IH 4D8PA 4KI5D 4XVTH 5DD5H 4HG4K 5DT1L 4HIEA 4MS8C 5FOJA 1JGDB 1R24B 5EUKA 3UZEA 4Y4HB 5BV7L 4RFEA 1LO0H 2OSLA 1C1EH 3LRGA 3BEWB 4Q9QL 3D39E 4DVRL 3DV4B 5I74C 1IGTB 4NQCD 4RFNC 5EU6B 5L2JB 4R97C 1TIUA 2NXYD 2Q87A 1FC1A 4V2CB 3RHWF 5GHWH 4PJAB 4YDKH 3U46A 2IQAB 3MNWA 1NKOA 1UJTA 2VUYA 4HIXL 1E28B 3KYAA 5H37H 3ULUC 4IRSA 2R0LH 1HXMA 4L4VB 5D1ZD 2WBJC 4O9HH 3UO1H 3N9GH 1CFNA 1KXVC 4ZUVA 2XXMB 2XWTB 5SWZA 5CP3A 1ZT4B 1MNUL 3WN5B 1AFVL 3LMJL 4R90H 1ZSDB 5A16A 5GZOD 4K23H 3C6LB 1FNEA 3WLBA 1FZMA 4U1HB 5FB8B 1ZHKB 2B0SH 3WD5H 1TTFA 3PWJB 3PQYA 6FABH 3WNNA 1CFVH 3M8OH 4QRPE 2F19L 5ILTL 1HSBB 3K8MA 1ZK9A 1ZT1B 3ULUF 4LPXA 3F6IA 1WZKA 2NR6D 3OXSB 5HGBA 1U3HB 4TOYL 5DJDA 4H5SA 3PG2A 2DLIA 1EFXD 2B2XL 3GSNH 4H26A 1JN6B 1RFDL 4Z7UA 3I6KA 5CEZE 2C4XA 3V0VA 1NGWB 1JV5B 4WHYH 2R0ZL 2DQIH 1HK6A 4PTUA 3EYUL 3BWAA 1V3JA 5D93B 1CGSL 1JZ4A 4RBPH 1GAFL 3AUVA 1MCOH 1BVLA 4BQ6A 4G7YH 1YPZB 1EFQA 2OP4L 3S8WA 4XTRD 3QEQE 4H0HB 3TPKA 4LPTA 4QRTB 2HT4C 4QRUA 3IFLH 4PV9A 2BY1A 2Y6SC 4ODVH 4WI6A 4IS6A 5F1OB 3OB8A 1HIML 1N59A 3V5KA 3EDFA 5A3IC 4MD4B 3MCLL 5KS9B 4F7TA 1BOGA 5TQ0L 3RZCA 5E9DE 3G6JF 1Q0XL 1NBYA 1D5MB 3ULVD 4P9MH 1BM3H 4TRPH 4TNVF 1FSKB 4WWKD 4CW1A 1S9XB 2B1AL 2BNQA 1SQ2N 3VGEA 3DRTA 3H9SD 3TH3T 4JRYD 3WUWA 4F58L 1A7QL 4ZO8A 2PN5A 4HIJA 4LLMA 1FL3B 5E24E 4LP5A 5JXED 2IFFL 1QBMH 4NKIH 2R4SL 2A0LD 1BHGA 1I4FA 2EIEA 1ORSB 1OAXL 4IBLT 4FXKA 1RPQA 3PGCB 4YX2L 2YKLL 4HUVA 2MPAH 4K7PH 5GS1C 2WP3O 4CAGA 3O6FA 4NQCB 3QO0B 5JZ7C 4JDZA 2NXYB 1AJ7H 4QHNB 5TDOA 3MXWH 3IXAA 2GITA 1JK8B 3FO0H 1G6VK 5TPWH 4LQ1A 1LD9B 5CWSA 1SEBB 4RA0C 3REWB 3FCTA 3VFWA 4XP6L 3G6JE 5E99H 1FZOA 3G5VA 2C1OA 5D1ZB 4Z7WB 1XCTA 4U7SA 1NEZA 3ARUA 4HUXB 3UJIL 3GSOA 1T3FB 2ATPB 3LKRB 4OI7A 2AJYH 4OGZA 4YFLF 4CU8A 3NTCL 4J3WA 2EH7H 5GRZA 4OLYL 3ZDXF 1QZ1A 3WJJC 5EU3A 3IDGB 5CJOH 2O61A 4FFVC 1QQDA 3HPLB 4PBXA 5F1KC 3AM8A 4W4OC 1KPVA 2D31A 3MRFB 4ZYKB 2DWDA 2PYFA 4BSWA 3WFDH 2BSED 3L5WA 3QI9A 1EFXB 1S9VA 4U1GC 3RGVB 3HE7D 3WCYA 4DZ8B 1AGBA 4PGBB 3DUUB 2OJEB 4IIQB 3BUYB 3JWOC 1EAJA 5M94B 1F42A 2R4RH 2QADD 1JGVL 5FUZL 5HDQH 3LEYL 4OJFH 3OKMA 2CJUH 1D7FA 1T1ZA 4ZS7H 1F3JA 3MCKB 4N5EC 5CJ8A 5FYKE 5SX4H 2QKIA 3LN5A 5F1IA 3OPZH 1YEEL 1CLYH 5HHOD 1DQJB 5DO2D 3SPVA 5DHVB 1JWSB 4OV5A 4YPGB 4GAYB 1RIUH 5I1GH 3CFKB 1H15A 2BZDA 2GSIB 3ZDXE 2CPCA 1QKZL 3FFCA 2VJXA 4KH2A 3WS3B 4JR9H 1X5IA 4NNYA 4OBRA 5DMGD 3WJLC 3TT1L 3BYTA 4WWKB 2QSTA 1N0XH 4JVWA 5ACZB 3QNZA 3L1OH 5DQDL 3BW9B 4KK5D 4XP4H 1E6JH 2H45A 2YOCA 2DDQH 3H9SB 4JRYB 3QWOA 3QZWG 2ZUQB 1LEKA 5EORL 4F7CA 1E6OL 2DMKA 4KUCF 2JTDA 4GRWH 2EKJA 4DN4H 5MHSE 5DK3A 1U41A 2H32H 5D1QD 3VWJA 2R2EB 4LSQL 3TA3C 5FV2A 3O6KL 4UU9B 4U1MA 2N7AA 2HJKA 1R3LB 1J8HE 4R7NA 3QAZB 4NJAL 4ODXB 2FGWL 2JJTA 5FHAL 4XP1L 1FNAA 4WFGD 3TN0D 4YHPA 1MCQA 3RKPA 1IAIL 3EO0B 1MY7A 5CCKL 1MHHB 5CP7B 3RVTC 3ET9F 3TYFB 4NBXB 5BQ7A 1YUHA 4G8EA 1RK1A 2R0KL 3LQZB 4Y88A 3MRLB 3UJJL 1KCLA 4LPWA 5JHDD 4OLUH 3DHJA 3KR3H 4J7RA 3WEXA 4PPTA 4EXPX 3TCLA 3QDHA 4OCYL 2I5YH 4XRCA 1AIFB 2W0KA 3O4LD 5B8CC 5KVDL 3MMEB 2AKRA 5DA4A 5TGBB 1QG3A 3QZWB 1PLGH 4Y2DC 2DIAA 5HVHC 5CJQL 3L95B 1JZ6A 4G9FA 4WU7B 5KSAD 1U2CA 1GGCL 4LIQH 4ELMF 2WIIB 3LH2H 4XX1E 2GI7A 4QRRD 3MV8D 2P5WB 1AY1L 3MRQA 4MX7B 1U8IB 2YD3A 2D9CA 1Q94A 2P8MA 2VLRB 1OGAE 4AIZB 1FCGA 1NCWL 3BIBX 1FN4A 1ODAA 3HZVA 4YHML 3HE7B 3U0WH 2RB8A 4JM4H 4ODBD 2Y1VA 3H9YA 3M45A 4RRPG 1CD8A 1RZ8B 2CKBB 5B22A 3MUY1 1M05B 4CVZA 3TV3L 3QRGL 3MODL 2A6DA 4OF7A 3QIBA 1U8MB 1N7MH 1O0VA 1QYGL 5L88L 5E2VL 3O6LL 3UTZA 1G7JA 5FM8A 5HHOB 2F5BH 5HYSA 1IAKA 1RSFA 3V6FB 4I3GA 4NRZA 3SGJA 1YEIH 3L5XH 3OMZA 3RFZC 1D6EB 2D4DA 4Q7DA 1FG2B 3RWIB 2J6EL 2N56A 2XXCB 2VL5A 1XIWD 3VXMD 1N2RA 3BIKA 4YXLL 4MSWB 4ALAL 4NN5B 4GMTL 1F90L 2K7PA 4JDVA 4K3EL 1A7BA 1MFBL 4ELME 2FRGP 1L7TH 3ME0A 3TBWB 3OKDA 4OB5L 4OGXL 1FBIL 2Q86A 5E2UH 2D7PA 5FYKU 1YDPB 3V4PH 2ZUYA 3U48A 4NP4H 1UB6A 5T3ZL 3DMMA 5D2LF 1KB5L 3BKMH 2BNRD 4PP2A 2F5AL 2CDGA 2AV7A 1EERB 1WGOA 5D1QB 3KHOA 3IETB 4N0RA 1HNFA 3CLFH 1EGJH 1WUNT 1VKXB 1RJYA 4M5ZH 3BN3B 4UDUB 1MCLA 1GRWA 5DVOA 1AGDB 3UDWA 5B38A 2VZSA 5GGSB 4P2OD 1DBBH 3TN0B 2NCMA 2VC2L 4QHMA 1P5UA 2FBJL 3MRJA 4HUUA 4ODUB 1U8LA 4Q0XL 4N1HB 4W6WB 4OZIA 1XZ0A 1AD9B 3HNVL 1ED3B 1A4JA 2OQJB 2XKUA 1S9KC 4XCCH 4RIRB 4FQHB 1Y6KR 1RULH 4FFWD 5JHDB 4K8RL 4IOIA 4P5KA 4OI9A 2X9WA 5IEKB 1BWWA 4GBXA 1U8OB 2FATH 2HFGH 3O4LB 4L8BB 3RRQA 2PO6D 5DD1H 5F3HB 3O0RL 5T33L 4PG2C 2IAMA 3MOAH 3MRGB 1MFAL 4OSUL 5D2LE 4FFYH 2XY1A 2IBBA 2JB5H 5KSAB 1PSKL 1MREL 3SDAD 5KW9L 3HR5A 5EZOL 4GLRI 4QRRB 3MV8B 4XMLL 2H3NA 5BV7B 3EDJA 1DLFL 4LSVH 1NBVH 2I07B 4P9HC 5T1LA 2YUZA 3BP5A 4J4PC 5EOCH 4UINL 4OZGB 4PRDB 2JIXB 1KV3A 1K4CA 4QYOB 1E4KC 2QJDA 2BVPA 3SY0A 4UQ2B 3FO9A 1XGQB 4JB9H 1T7ZA 4J3OC 1V7ML 5TDPB 3MLSH 3LVEA 3C6SB 1ZV5A 1HCVA 4Z78A 1P4LA 1MJ8H 3ARED 3D3VE 1JPST 3VFTA 3FT3B 5GS2D 4MA3A 4OUUA 5FYJL 1KTDA 4K7FA 4DW2L 5LQBH 1QSZA 1BVKA 3S5LA 4IRJD 4ELKA 4NUJB 4ACPA 3PWVA 5FCUH 4HZLB 4UOJA 4S1DC 4DGYL 1WQVT 1XIWB 3MLRH 4P59L 3VXMB 1FFOA 2Z93A 4JKMA 2DJ4A 3BPCA 2XPGB 2GUOB 3STLB 1I7TB 4X5XA 2QQKH 3TH4T 4DCQA 3PWUB 2VDQL 4DK3A 3FQXA 4GG8B 3QQ9D 1CDJA 1T1YA 3W0WD 3MFFB 3T2NH 1H3GA 3S4SA 4JO3H 4PJCA 3VFOB 1YY8A 1CGWA 3HRPA 1E27A 7FABH 1VCAA 3BKCH 1N4XH 3MRDA 4DOHB 1OW0A 1S7WB 2HLAA 2BNRB 5K33A 2DQEH 5J9PA 3ORJA 2EDBA 1D5BB 3UZVB 3H0TB 4PJIA 1KTRL 1WFTA 4OM1H 4YR6A 1M71B 5BXFB 4QHLB 3V2AR 1V05A 3GI9L 4HWBH 4LCUA 1BP3B 1BOYA 3MLTB 3WLWC 1WT5C 3RWCA 2V5MA 5J1AB 2Y5EA 1WBXA 1NFDF 1TVBB 2X6MA 1CBVH 4L4TE 4KQ3L 1EUUA 4KDWA 5T1MB 4ENED 2AK1H 3Q2CA 1XFPA 2GYSA 3TEUA 5E95B 5C07E 5D7LD 3MRHB 1W72A 3RL2A 3FQUB 1UWEL 5A2JH 1ND0B 5CLTA 3O45A 2X4OB 4RAVB 3F7RA 4Q2ZA 1HHIB 2PO6B 3X17A 4N8VG 1FDLH 3BDBA 4I3RL 1OQXA 1CZ8H 3GMPB 5E6YA 3IKCB 3O3BB 5K93A 3OTTA 3LKQA 2K1MA 4QTHA 2CLRA 3EOAB 1BZ7B 3SDAB 4I3SH 2IQ9L 4OAWA 5HGAB 2GTZB 5IB1A 4RDQF 3MRIB 2ADFL 5CBEA 3EYSH 5FHBL 3FT2B 1I1AC 1QTYT 4LRIA 1NGZB 2ADIA 3VG0H 5DHVH 5HD8D 3T0WA 3MJGX 1LO3L 2J12B 1QSED 4MZ3A 4ODSL 1D6VL 3ARDD 4PJFA 1E4WH 1U8NB 1NFDE 3QDAA 3RWHA 3VFNB 4M02A 1TZIA 2X44D 3ULVH 2YZ1A 4NFBA 5EC1A 3AREB 2MQCA 1NCDL 4H25B 2QTEA 1A9BB 5BVPL 5KVFL 2J8OA 4IRJB 4GMSH 4GG6A 4YBQD 4N8VB 3PV7A 5FM5O 4K71C 4QXUL 1T6VN 3WBDA 4AZ8A 5DJXA 2FYYB 1EJOL 5AD0B 4YBLB 3CC5A 4MWFB 4RNRA 4KK9D 4C83B 3EIFA 5FAAA 4F33A 3WXWH 2A6JB 2ENSA 4PYGA 3V7MA 5DEFA 3QPXH 3V7AG 1DCLA 4EI6B 3W0WB 4FG6D 2HJFB 4O51A 1DQDL 4AL8L 1QBLH 4Y4FC 1YC7A 3VFPA 2WANA 1WITA 3JV5A 2AV1A 3ARVA 3CFEA 2O5ZL 2EC9U 3LZFH 3PIQA 2X4NA 3N1QC 1B4JH 3AB0C 2FECI 1UJ3B 1WBYB 4NQVB 1AD0A 1QBAA 2IH3B 3HUJF 3KLDA 1RZGA 2VB5A 5IVXA 4MVBD 4WI8A 3MV7D 3ZHKA 3IRZA 5ADPL 1KN2H 3I6GA 4M48L 4XGZA 2EDDA 4IOSD 4LK4A 3JZ7A 3SDCC 3U7WL 3QNXA 2ZNWA 1CXFA 4U3HA 3CFBA 3T0ED 1CLZH 4JANB 1FRGL 4JFDD 5D7LB 5FA3A 5DJ6B 4TTDC 5BVJA 4FQXB 5IVNA 4L5FH 1DQQB 3CXDH 1IM9D 1C12B 2A77H 5T3ZD 5E4EC 2CKBH 1GZQA 4JFED 2VZOA 1ZVSB 3ZYOA 1YEKH 1QFUL 1BFVH 1FZKA 1RZ7L 1UQSB 1RHHB 4TPRH 2AGJH 3U0TA 4G5ZH 5JMRA 2F8XC 3RNQB 1KFAH 2V7NB 2GTWB 2FCBA 3KPRE 3H42H 2ZCHL 5T1KB 5FDWB 1JMXA 4KY1H 5DJ2A 3GMOB 4FNLH 3QUYC 4HKJB 2R0WL 3HUJE 3QWRD 4XWOC 3ZT6A 3ARDB 1H3PH 3V6ZB 4NO5B 1GC1H 1A1NA 4JFQA 5J13C 1W0WA 3MBXL 4E41E 1OLZA 3G6DH 4JFOA 4ZUWB 5I6XC 3JUYA 4Y2OA 1MCWM 2X4UB 2H2PC 4GAGL 1UA6L 4PJAE 2WBKA 1ZLWH 3QQ3A 5E7FA 4WCYL 4P2QA 4O2EB 1CE6B 4KXZH 1KC5L 3BZ4A 3TO2B 35C8H 5E2TH 4JGUA 2EH8L 3VXNB 4WW1A 4XNUL 4GKSA 5E5RB 3EJYC 3I02B 1BGXH 4LSSL 2IBGA 2IFGA 4U6YA 4NQED 2X1PA 4OTXH 1CVSC 1KTLB 3QDJD 3FO1A 3LQAL 4WI5A 4JZNB 3RUGB 3W2DH 5F96L 4NO2A 4MGXA 1SM3L 2NY3C 2YXFA 1GSMA 1OP3H 1T89A 2YD1A 2W0FA 4NZTL 1VHPA 5ESVA 3HG1B 4P5TD 4Z5RA 3VWKA 4MXQC 4QRSB 1MJUL 1R5WB 1PX3A 2NY0D 2YMXH 5DRNA 3P4MB 4JEGB 4UT6L 1MFEL 4YGAB 5D7JA 3UEZA 1BFTA 5BO1L 5I1KL 3CZFA 1HINH 4XWGH 2XKNB 2BOCB 4YGVB 4Y5YB 2DM2A 4HCRA 1NCCH 4BH8A 1EA9C 3UTTB 4YQXL 4Y1AA 5FYJD 4AMKH 3QIWD 3D5OF 4KI5F 5MERA 4LGPB 1GHFL 5D4QA 1JNNL 1A22B 3FQRB 3MV7B 4YO0B 2VDLH 1DBKL 1A2YB 5GS0C 2HLFD 2ITCB 2XNAB 2EYTA 5DT1H 1JTOA 4V1DE 1B3JA 1M6OB 4LOUD 5BV7H 3RIFK 5F7HA 3T1WA 3ES6B 2PYEB 1I1FA 4HJ0D 4Q9QH 4N90E 4DVRH 1MUJB 4I5BA 3UTPE 1WK0A 3FOMB 3ZE1F 2EE2A 1A0QL 4FMKA 1YECL 4U6HA 3I75B 1IC1A 1IM9B 5EUOA 5KS9E 2ZSVB 2A1WH 3FB5A 1KB5B 4OFIA 3LKPA 4JFEB 4HIXH 5HI5C 3PWPE 5D2NC 5D2LB 4XZUA 3J7HA 3C5ZD 3MGTB 2EEBA 4YPJA 1HOCA 1S7VB 3BD4A 3LKOB 5I75B 1BF8A 3DVNB 4HWZA 3RNKB 1BVZA 3GI8L 4X4XA 3U2SA 1IGCL 1MNUH 3QXWA 1W0VB 1AFVH 3LMJH 4IRSD 1XF4B 3SCMA 2VDOH 3M17A 3BPOB 4KI5E 2WAHA 5F7FA 3R4DA 5SWZD 3QUKA 2NLJB 4O02L 2AEIT 2ADJB 4OF0A 5D6DC 2F19H 5ILTH 2R1XA 1XF5A 4JFFD 3D18A 4UNUA 2DWEB 3GHEL 1SY6A 2Z31C 3PQYD 5F6HJ 5AG9A 3VGHA 4NNXB 1F11B 4TOYH 1N5AA 5GRUL 2LU4A 1VENA 1ZEAL 3GM8A 4J12A 3CH8A 1MSPA 2B2XH 3ZE1E 1RFDH 2FL5B 5ESAA 1UM4L 2NTFB 1D9KA 4MQXD 4WTZG 1IEBA 2HVJA 2R0ZH 5BS0A 3EYUH 5TE7H 5IOPA 1KNOB 2BMKA 2FZ3B 1CGSH 1RZFL 2FBOJ 1GAFH 4NQEB 3GSXB 2DBLL 3VG9B 5CEYA 4JFZL 4OCMC 1I75A 1ZHNA 3QDJB 3U6RB 4Z95L 2OP4H 2DQGH 2YRZA 3AS3A 3K2UL 4KTEL 1W0YT 1KJMB 1BPVA 2LAAA 2CGRL 4HFWA 1HIMH 1AQDB 3PWNB 1J05A 3DJ9A 4X8JA 1Y6MR 3CCHB 3MCLH 4TSBL 1U8PB 5FO8B 5TQ0H 4HJGA 2ENYA 3EYQC 2YPLA 1Q0XH 3OJMB 5C6PB 2DKSA 2B1AH 3G04A 3FOLB 4U1LA 1EX0A 5EWIL 4FQQB 3RZCD 1UH3A 3QIWB 5MENA 4F58H 1A7QH 2BNQD 2BK8A 4PRNB 4OT1L 2VE6A 4NO3B 3V8OA 4G80B 2IFFH 3GK8L 1T1XA 1KOAA 1UCBL 2R4SH 3EDKA 5IB3B 1U95B 1KCSL 1A6PA 3IXTA 2LU7A 4D8PB 4YX2H 2YKLH 3PDGA 4HIEB 2LU3A 4OUOA 4NSKA 4APQA 3NZ8A 2P44B 1FAKT 5EUKB 1XGRA 2HTKD 4RFEB 5HI4D 2OSLB 2NNAA 2E6PA 4U3CA 3CDGA 2JJVA 3O6FD 3NCJL 4JVUA 1Y6NR 1NGPL 5D7KD 5DEGA 5JORA 2E7MA 4MQSB 2VLKD 2D0HA 2APXA 4OLVH 4LNRA 3MNWB 3U46B 5IM7A 4XP6H 2ZCLL 1X4ZA 5C86A 2YD9A 5GS2H 4QRPA 2BVUA 4O58L 4X80L 4H0IA 4M8QA 5H94A 2P8LA 3WS6C 2HT3C 3QPQC 4IRSB 4N9GA