2AK1H

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with benzoic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRYNPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSAKTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1H01
3RZCB 2VITB 4I48B 1MCBA 3MV9D 3OKLB 4UB0L 2QSCL 4KXZI 1KEML 3DIFB 4G43B 1CF8L 3H6JA 1TVBB 1PKQB 3L3DB 1NPUA 1SBSH 5F97E 1J0IA 4WI4A 35C8H 1UA6H 2G9HB 5HDQH 4KVCL 2WBWB 3AAZA 3HLAA 5H37G 1FL6B 1J0YA 3B2VL 2Q87A 3MRDB 4NQCB 3F6LA 1FV1B 4V1DE 3SGDI 5J12B 1FNAA 4WUUD 4PJ7F 2HH0L 2HFGL 3FB7B 4LSVL 2OL3L 2XIDA 4G6JH 3RGVA 3RGVB 1CXKA 3MRCB 3FB7A 4NWUH 5IBLC 2D7QA 3QULB 2O5YL 3D69B 2ZCKL 2J8HA 3ULVC 3C8KB 4OV5B 4XNQB 2VISB 3PQYB 2ZG1A 4WHYG 1NAKL 1UC6A 1X5GA 1LK2A 4JRXE 2AGJL 5HD8D 3PHOB 1BAFH 1U3HA 4PJ7B 1TVBA 4O9HH 3KJ6L 3KG5A 5EU6A 2AS5M 4X5XB 3OKLA 2X4TB 3BDXA 2VITA 1FL3B 1T0MB 4JRYE 2QADC 1RUAH 1CLZL 3L3HB 1PEZA 3PP4H 5A2LH 4L29B 4GXVH 5KVDL 4LLMA 2W9DL 5IVZA 2LABA 2WBJB 2IAMD 3S36L 3RI5K 3QPQC 4MXQC 1S7QA 4ELMB 4L3CB 2LU3A 5KAQG 3WJLA 3O3AA 3V6OA 5JXEA 1BQSA 2VZSA 3HG1E 3RWEA 3U7AA 4UV7L 3FQXB 4X6FB 1IGTB 4QXWA 2DTMH 1CDGA 4JPVH 4U1HA 1NCAL 1MCSA 1HSAA 4JFFD 1HHJA 2JK5A 1BGXL 3RJDA 4B5EA 3WFBH 1IC1A 1O7VA 4JHAH 4X6DA 1KSRA 3IRZA 4IRSD 1A14H 1LVEA 3S36H 4QOKB 4ZTPH 3I3EA 5B39G 1AGCB 3L3JB 4D8PB 2GJ6A 2JB5H 1BOGB 2YSSB 2BVPB 5GISL 1ADQH 5FUCE 2GSGB 1IC5H 2CRZA 4D94A 4UDTB 1WBXB 4ZPTA 5LGJB 5GIRA 5D2LB 3AREA 2P24A 1SMAA 3H9SE 5EBWB 4XH2A 1Q0YL 1DQMH 4PJEE 3DX6A 1B6UA 5I1IH 4CN1A 1F4YL 1YEFL 3WJJA 1F8TH 1DL7L 3MUJA 2OK0L 2IMMA 1QSFB 2C4FT 4IRSC 4P57A 3O9WB 4RMWA 3WL9A 3K81A 4ISVB 1GJIA 5FUCC 1G6RA 4EN3B 4NC1C 3U1SH 3C9NB 4TQEL 2XZQL 4AIZB 3T2PA 5D2LF 1U8LB 1A5FH 5E8NA 3O6MH 1WTGT 2XQYG 5B39B 1D5XA 3TT1L 3S37L 3MOBL 1HYSD 2DN7A 3RWCA 4XAKD 2ZCHL 3QQ9C 5C09D 3WO4B 4N5EC 3K0WA 1DQJA 1FVDA 1RSFA 5DRZB 1D9KA 5DHVB 1S9XB 3MLPA 1FORL 4HIJA 5F72S 2VDLH 2E6JA 1NFKA 2YS4A 2FIKA 3HNTH 1T3FB 3D39B 1NGQH 2QQLL 4H20H 3TJEH 3ZT5A 2BMKA 2BOCB 4MA3A 5SWSE 1KJ2L 4LDEB 3IDNB 5EO0A 4OZHA 1E4JA 2IBGA 3MJ7A 1BQUA 4QHLB 4MJIB 1YPZA 5DUBA 2IG2H 5HYSB 1N6VA 2AJ3A 1UYWL 1B4JH 3OKNB 3CFJA 3ROOB 4DQOL 4P49A 2HT2C 4PJXA 5E2UL 2WWKT 1A6UH 5ELIA 5D9SA 2FSEB 2CXKA 3UXFA 5SWZE 1AO7B 1U8PA 4DZ8B 3ARDD 4GRMB 1FZOB 5IB5A 3N9GH 5E8OA 2YPVH 3QJHB 4GW4B 1UG9A 5EOCL 1QPXA 3T0EA 2HWZL 3GMRA 2ICES 2M26A 1BJ1H 4LCWE 4D0CA 5ADPL 3JVGC 4YC2B 1JFQH 5CS7A 2D03H 4BFBD 3P11H 4PGBB 2O5ZL 2P5WE 5B4MC 4HUXB 1CE1L 5ETUB 1PAMA 3CNKA 5F7HA 2VDQH 5DMYA 5DA0B 4JRWA 4WWKD 4FTVB 1OL0A 2AJYH 5D1QC 2DQTH 3KPSA 3QEGL 3RHWK 1LE5A 1U92B 5SWZB 4U6YA 4MDIA 4HK3N 4K71C 4Z8FH 3O2WL 1X5XA 5HPOA 3OWEA 5F7MC 1E27A 3V0VA 4N0CC 1FN4A 1DSFL 3CFCL 3DTXA 3S9DB 4MXVF 5DC0A 4Z5RA 1HILB 4QY8B 1PYWB 2CUHA 4HKBA 1IEAA 5IOPA 1D6EB 2A73A 2F74A 4JFDB 3L3OA 4UIMA 3REVB 4KV5E 1A6ZA 1M71B 4A6YH 5JA9A 1K6QH 4O2EB 3AMLA 1F97A 3BOVA 3OPZL 3S5LA 5IHLB 3VXQA 3K1DA 2WIIB 3FQNB 3OHXB 2XA8L 4LARH 4UQ2B 4LEOA 3CDGA 1XGUA 3SDAC 3T8XB 3MO1B 4PUBH 4POYA 1HQRA 3TYFB 5T3ZE 3MV7E 4OBSA 5C0CE 3C5JB 4GMSH 3L5IA 3T2NH 5C0CD 5FM5O 5DD0H 2AXGB 2VLJA 5DJYA 3WFZA 5I16B 1RULL 3MC0A 1BFVH 4WY7L 5DVNA 2CMRH 2NXZB 5KN5A 1FPTL 3WUZA 1GZQB 5ADPH 3DYMA 3QNYA 2PUQT 1TZIB 1TNNA 4MWFB 3HHRB 1G1CA 3MLWL 4RMRA 4XVTH 5CP7B 1JHLH 1D5BB 4IRJD 4OUOA 3QG7L 4WI7A 3BSZH 3MA9H 1UJTA 5E6ZA 2BXYA 2DIJA 3LN9A 2IPUG 4GKNB 5FYKH 4HJGB 4YGVB 1CDIA 3LOWA 4EI5C 4L3EB 1BM3H 2EE3A 2NTFB 1U3JA 3DGCR 5IM7B 3JTSA 3DROB 4YXKH 2B4CH 4X4XA 3T77B 1OARH 3PWUA 3V7AG 4R26L 4N0UB 4RSVA 2NMSA 4J8RB 4MLIA 3F62A 3QPXL 5T3XD 2HRPL 1PG7X 1JPFB 5D71L 4M5YH 4QRTB 1YMMB 2LAGB 2A38A 2F54D 2CKNA 5DK2B 3U6RA 3WUWG 4JFYB 3T0BA 2OXGA 1IT9L 2BOBA 4JHWL 4UIKH 4JPIA 4WV1B 1FZMA 4PGDB 3MBXL 4KQ4H 4MJ4A 1YEGH 3QHFH 3RNQA 1S5HA 3HPLA 4ERSH 2GIYA 4DWHA 1LDPH 4YDKL 5D1XA 4DVRH 3CVIH 3HAEH 5E8PB 3N1MC 5HHME 3KJ4C 5I15H 5ID0A 1T22A 1OGAE 3ZHLA 1AI1H 2WUBL 4LOUD 1NC2A 1I3GH 3CLEL 5C9KA 3BUYA 1QBLH 5B3JE 4Z7OF 1NC4B 2GQHA 1GOFA 4DK3A 4UTAL 1G6VK 3EYQD 2DQJL 2P4AB 1VPOL 2BSRA 5F96L 5T1DH 4OD1H 1EO7A 1RV6X 3H9SA 2UZIH 3EUUA 3KYKL 4F15B 4P5TC 1LE9B 3FB6B 1UKSA 4NO0A 1IEBB 5DJCA 5F9AC 1GCFA 3W0WA 3D1MC 2J8UE 4GAJL 3ZKMC 4P23C 1ZEAH 4U3XA 2HT4C 4NO3A 5DI8A 2AK4E 3T08A 4X6CE 4NQEB 1B0WA 3QJFA 4NQDB 3DVGB 5IT2L 4P59L 5IHZB 3WUWA 4M7LL 1CFNB 3HC3L 2P8MA 4HS6B 1JNLH 3ZYIA 4OZIE 5DD5L 3X3FH 1S7SA 2UV3A 4HIXH 5I66A 1DDHA 3ARFB 4TVPD 4YR6B 3SOBH 5E00B 1CL7L 1JWMA 3O4LA 3RKPA 1P2CB 3T3ME 5LAXB 5H2BA 1B0GB 4I2XE 4K23H 4PJAF 3QUYD 4ZTPL 3WDJA 3QHFL 3VI4E 4ODVL 5EZOH 3PWNB 4EVNA 2XPGB 4OZ4B 5CWSA 2FLBT 4XC1L 4JGMA 4JFQA 4EBQH 1UM5H 1WIUA 2EDNA 3C09C 3HCVA 1AHWA 1YEKH 1KCLA 1I7TA 3TBVA 4FG6D 4CMMA 4FQXC 4ELKA 1K8DB 5DHXB 2R0WL 3QCTH 1JUFB 4LCCA 4HEPG 3RBSA 1XH3B 4LPUA 4QTIH 3SDCD 3ABZA 1ZA6A 2VXQL 3DMMD 3PV6B 2BNRE 4NHUB 1MHHB 5KVGL 5D7IB 1QSFE 4HKJB 3HI1A 4XC1H 1J8KA 3WDHA 4B7IA 3V4PH 2MHAA 3ARFD 3JWDH 1XF5A 3JV0A 3ZE1F 4BSJA 1IKNC 2PN5A 3KJ6H 3VFTA 3IJHB 4OZFA 4XXCA 4TVPH 1RJCA 3QIUB 5FYLH 1A22B 4LKXB 4WJ5B 2VZTA 1CDJA 4X7EC 1FO0L 2BVEA 3OKKB 1A7OL 2BVYA 5BRZB 1KPRB 3NIGF 5F70A 3UYPA 1NBYB 3ULSA 3EYVB 4P46A 3SO5A 1MY7A 4MD0A 2JELH 3QQNA 3P4MA 1IC5L 4NQSA 3V95A 4XPBL 4YHML 4TVPL 4JO4L 4C57C 3JV4A 4DKEL 2A6IB 4NT6B 3RTQB 5HXMA 3QNXB 4K94L 4KVNL 3GMPA 1EEYB 1A7OH 4PV8A 4QGTA 1OCWH 2VZVA 4G7VL 3BPOB 1JTOA 5FGRA 5E70A 2G5BB 2VZOA 5B8CB 3VD9A 1TQBB 4QRQB 3OG6B 5L9DL 5JW3H 4PBXA 2PO6D 4NNXA 3V6FA 4M1DH 1MCHA 4EDXA 3QUZA 5KSUA 4OQTA 3MLTB 1T0NA 2EYSB 4DTGH 4HWEH 1MUJA 2FL5B 2OJZH 3LEYH 3GNML 3IFNH 3F5WB 3WFBL 2EDRA 2R4RL 4ZXBC 3IKCB 3V6ZA 2C3VA 2X4NB 2CDFA 4QGYA 1N2RA 1P1ZB 4IS6B 3VXOB 3THMH 4EOWL 5TQ0H 1UCBL 1EZVX 1QLRB 4LCCC 4XB8A 1UACH 1WBZB 1V7ML 3B9VA 1DBKH 4KK6C 1KLGA 2ORBL 3CFBB 2LTQC 2VDQL 3PGDA 3BGFB 4R9HA 3NFSL 3LIZL 1IAMA 1HWGB 2GT9B 2FH6A 1A6VH 4YWGH 5HYJA 3NBNA 3SCMA 5FDYA 3S35L 4IRJA 5D8JL 3S3JA 4FXLA 3G5VB 4JCMA 1M6OB 1YEFH 1A0QL 4NN5B 5E9DA 5IROA 1FLTX 1LMKA 5F1OB 4OJFH 1JGUH 3K80A 3CFKA 4WTWA 4JFPA 5LBSL 4L4VE 4KAQH 4PJHB 1Y6NR 1IFHL 4GQPH 5M94B 4LCYB 1NGYB 3FL7A 4WI6A 5C3TA 5CIPB 1NCCL 4U1GC 1G7QA 3T0ED 4DJMA 4FZEH 5JNYB 4NBXB 2MTPA 1KJ3L 4D0DB 3Q0HA 5EU3B 1F4XH 5JO5A 1LO3H 3EFDH 3S37H 5IFJA 4FQHB 5TH2A 4HEME 2H2PC 4JREC 4XWOD 3OV6A 4LLYA 1CTOA 4EKXA 3FQRB 4LARL 2OM5A 1JYNA 4UNUA 1MHEB 3O81A 5FHAH 1AGFA 1CFQB 3HAEA 3DI3B 3SDDB 1EAPB 1T04B 1R5WB 4XCCH 2PCPB 1PX4A 1EGJH 4ZOEA 2JTDA 5TPWH 3T2NL 3P3YA 3LRSB 5SWZD 4DTGL 2XQBL 2BP3A 4U1LA 3V4VL 5B38B 2R0LH 3ZTNH 4K07A 3LB6C 1HNFA 1INEL 1FNFA 4JR9H 4X6CF 4OUUB 3OKMA 1U95B 4WCYH 3NN8B 5D70L 4X8JA 1MRCH 1LWRA 3Q5OA 4PB9L 1DBKL 1CE1H 2ITDA 4H0IA 4CDHA 2Y5TA 1JIBA 4J3SA 3WNPA 3BP5A 1XR8A 5DYOB 4X9IA 1SJVA 2VLLB 1NGWA 1JWSA 4F7PA 1I4FA 1AE6L 4LNRA 4K9EC 3TBTB 5HI4D 4Z9KB 4IJ3B 3Q6FB 3RDTA 5C08E 5GJSH 3GB7B 1KB5A 2XTJC 1FNEA 1KGCE 5ICXA 4U31A 4NIKB 4NO5B 2V7HB 1E0OB 3WO3B 3CVHA 5E56A 1AQDA 1SVCP 1FDLH 3MNVB 1H3VA 4X4YA 4BYHA 1A7NH 5CEYB 4DOHE 3NZHH 5FO9B 1NAMA 3HC4L 2VXVH 3DGGA 4QHKI 4U7SA 3X12A 3BPLB 4LPCA 5DJ2B 4R4FH 3HI5L 1K8IA 1FFPA 2DL9A 5I1KL 2JJTA 3TZVD 4GRWB 3TYGL 4ZNEE 3V52H 3ZO0A 3JWNC 3ILPA 2WWMC 4ZFOA 2XWBB 2X10A 2WANA 4P23A 5T1LD 3ZT7A 2YRZA 3QEQE 4NOBA 4M6OH 3CVHH 3UTSA 1QO3B 2OP4H 1CD8A 1S7TA 1DQQB 5JORB 4MDJA 4Y89A 4Y4KB 4AIXA 3QNZA 4HUWA 3SGKA 2P5EE 1DUYB 5TDPA 4L4TD 1HHHA 4P2OC 1A3RH 3GHBH 3VXME 5C6TL 1OAKH 1FG2B 5CD3B 4PB9H 1BVKA 1ZHBA 2NY4C 3SDDD 4YAQA 4BK5A 2NNAB 4H88H 1F90H 3VXNB 3WEXB 5EZLB 1YNTB 2H2SC 3FT3B 3U30C 3WD5L 1I3VA 1NQBA 5E94B 5DMKB 4W68A 3T2QA 4F58H 5TE4L 5JTWA 3KLAA 4NQCE 1WZMA 1HQ4B 5F9JA 1D5MA 4JQXC 1OAYL 1PZ5A 1N4XH 3EJYD 2FEDD 5CGYD 3JUYA 5IHBA 4R26H 1GOHA 5BV7L 1OF2A 3MROB 5EUOA 3SOBL 3D3VE 1U8QB 3HZYB 3QDMD 3RNKB 1LDSA 3NPSB 1QR1B 3NA4A 4LKCA 5EIIB 2RB8A 3QI9D 4KDVA 3QYCA 5IBLD 5DS8B 3LQAL 2R9HD 5C0GA 4HXAH 3IDMB 1Q9KA 5TE4H 1NBVL 3HS0A 3ZKNC 1CQYA 1CGSH 3B2VH 1CFVH 1GGYA 4LCIH 2LQRA 3CDCA 3MNWB 2BVQA 3EDJA 2AXJA 2EYTB 4BH7B 1X7QB 4HCRA 4BJLA 4U1KA 4C55A 1QFUL 5DVLA 4ZD3H 3P0YL 4PJDB 3TBYB 3QRGL 4YDIL 1ZLWH 4LSVH 4EXPX 1DVFB 3DUUA 4ZDHB 4XGZA 1AD0B 4Z0BH 3LQAH 3H9SD 3W9EB 2F53A 5F89B 4ETYA 5JOFB 3MXWL 3QI9C 4LLUB 4DAGL 1X5KA 5J11B 3K8KA 4BQCA 2UZIL 1RK0B 3KXFB 5BZDA 1P7KB 1XGRA 2BY1A 4BFIB 1RHFA 3O4LD 5I17A 3H3PH 2YRPA 4KKNA 1LHZA 1ORQA 3RWHA 5DEGA 5DZLA 2DQEH 3GI8L 4MXWH 4RGNB 4O9HL 3DX9B 1C16A 1J8HD 4AQ1B 5KSAA 1S9VA 3IXAA 5I71B 4OF3A 2L7UA 4PJ8B 2X4PB 5D7LB 1RZIA 1H3XA 4XHJD 2MPAL 2CLRB 2Q3AA 2VXSH 4OLUH 1YMME 4NQXA 3AY4A 2HLFC 3QUML 1V3LA 2PETA 1K4DA 4KFZC 4HUNB 3PNWA 3QUXB 1AC0A 1KTLB 3LD8C 5DRXB 4GRLA 1N59B 4DCQA 3TVMC 3PHQB 2H26A 3C60B 1F42A 1NMBH 2HRPH 5T1LA 2HFGH 3B5GA 1T7VA 4J3VA 5ENWB 4Z7VA 1J11A 4H26B 3QFDA 5E8DH 2FEEL 2GK0B 2Y06H 4U2ZA 2ARJQ 2PTVA 2X1PA 1R3KB 3L5XL 4TUJB 5J6GB 1V7NL 2PXYD 4ZPVB 2DM3A 3VW3L 4XTRD 4RIRA 4R90L 3H42L 3VFSB 4FXKA 1NANH 1A1MB 5JA8B 1NDGB 2VLRA 3GHEH 4DVRL 1NAKH 3MRNB 1NCDH 3U9UA 4XP6L 3BZDA 5E95B 1FRGH 3IGAA 5FDWB 1Q9LB 4PRIE 2ED7A 1EPFA 5ANMA 2YBRB 3T0AA 5BOZG 3LMJH 4QXUH 1IGFH 1NLDH 1R3JB 1IAIM 3G08A 3H9HA 4RGMB 1EGJA 4XNYL 5LG1A 4MMZC 5C0EA 3MFFB 3LEYL 5SX4I 5BMFH 3DPBA 5FCUH 1BF8A 2EH8H 1SJEA 4YBLB 1NEZG 2MQ0A 1Q9WB 4G3YH 1CFTA 3SO3B 4WUUE 5F93C 1A7RL 3E6HB 2QKIB 3DVFA 4HJ0D 1CLYL 4N90E 3I6KA 2VLME 3U36B 4RFOH 2OZ4L 3RVUD 2E6PA 2X4UA 2DYPD 3S37X 3HA0A 3U0PA 1W0WB 32C2B 3B3IB 4MNHA 3KPMB 2D2OA 1RUKL 4LMQE 4PS4H 1N6QH 1EH9A 1J7VR 1FG9C 4NJ9L 5LCVL 5L2KA 4Q6YA 1WICA 2UWEB 4PJHE 3REWB 2QHRH 2MNUA 5L0QB 2W0PA 1YEJH 3P4OB 3MBEA 1ZHKA 3PXJA 1F3RB 1NCCH 5CD5C 1YMMD 4LSDA 3RX8A 2BZDA 3D2UB 4HC1L 4DOHB 3G6JA 5KVFH 2FD6L 3UTTE 5GS2H 2AJXL 5C08A 4YH6A 1CQKA 1X4XA 1DLHA 4DN4L 5C2UB 2W0FB 3GUTA 2IGFL 1FFNB 3FONA 4NFCA 5DDHA 4HHAB 2VLJE 3C5ZC 2A83B 5I1LA 5ESQB 4QYOA 1A7QH 3EJYC 5F88B 3V7MA 2X4RA 1ORSB 5F6HI 4PLOB 3PL6C 5HBBA 2ZG2A 5IKCB 3LEVL 1EMTH 3V8OA 5I1HL 1J88A 4G6JL 3NACL 4Q7DA 4DKEH 3MTRA 4MHHI 4ODSH 5C0BD 1U8IB 3O3BA 3QDJB 3N9GL 4FQCL 3RZCC 4LLVB 3QIWC 5ILTH 1R3HA 3IDJA 5LBSH 5C0RH 4OLVH 3SDXB 1G7IA 1FGNH 1WT5A 4BFEA 2H32B 2DKSA 1S7XA 1VFAB 3C60D 4P2QE 4Z7VF 5IEHA 4W81A 2O5ZH 4XB7A 2H45A 3BP7B 3UJTL 1T1WB 1I3RA 1P4IL 5BZWA 5EWIH 4F33A 3QIBA 5IQ7L 5IR1B 3TIEB 1F4AA 4Z7WB 5MEOA 4ODWB 4KDTA 1OAXH 5EPMA 4J3WA 1RVFL 2A9NL 2R4RH 1OAZH 1EEUA 2P8PA 3C6LC 2R23A 5DJAB 2VUYA 1EFXA 1E28A 5FYLD 2AKRA 2FJFA 4EZMA 1XGQA 4EUPA 2A6JB 4I9WD 3BPLC 3TBSA 1O7SA 3GRWL 4OCXH 3HZKB 1A2YB 2BNRA 3NCJL 3TPUA 1OM3H 1ZGLB 3O45B 2J12B 3FTGA 2VQ1B 2VUOA 4IMLB 3BRGC 2VKXA 3V6BR 1JV5A 2BSSA 3KLHC 1RZ7L 1RIVL 1UB5A 3OXSA 1F4WH 3P73B 5CAYB 4RGOL 4XWGH 4G42A 4B7LA 2L0DA 4BZ1L 3OQ3B 4CMHB 3R06B 1MCWM 2VL5A 5IG7B 3QA3B 5JZ7C 4P2CG 5I1KH 2XXCB 4H0GA 2VDPH 1YY8A 5L8LB 4M5ZH 5LXGL 3OF6D 3L9RA 3MRKA 1Q38A 3U7WL 1AD9A 4FFVD 1QOKA 3EZ8A 4EUPH 1ZGLP 1NSNL 4XMKL 5EN2B 4M9PA 3P30H 1GZPB 5DJ0A 5IVXF 1K3IA 3VFVA 3V5KB 4J3XA 3UYRL 3KPLB 5K59F 3KPRA 4I3RH 3VDAA 2VN4A 3AU1A 1JZ6A 3GMQA 5BXFB 1NDMA 1Z3GL 2AV7A 5C08D 4N68A 3U7WH 1AP2A 2XN9B 4Y8DC 3MLYL 2XFXA 1WWWX 2FJGB 43C9B 1QFPA 3FRPA 2Y6SC 2PXYA 1KEGH 3J7HA 5DWUL 3PWPA 5DD6A 1R3IH 4L5FL 1MIML 2YPKA 5I6XC 3FQWB 3LSOB 4P2RB 4O5LL 1KELL 3G9VA 2YD9A 1JGEB 3KYNA 2IH3B 3AXLB 2FCBA 4CVXB 3BESR 4TUKL 2QQQA 5E6IB 3KNBA 2IQAB 4JANB 5JXED 1M05A 4HLZH 2CK0L 3MRRA 1YJDH 4JKPH 3OAUL 1OM3L 3TA3D 2C1OA 1JP5A 1BZ9B 4YBHA 1FYTA 3CUPA 1MQKL 1BZQK 1CZ8L 4CVUA 3HR5B 4HV8B 3QFJA 4MQXD 2JLLA 3MMEA 3R1GH 1I1AB 5BQ7B 5F21B 1FIGL 2J4WH 4PJ7E 2VLMD 1GGTA 5J06A 3ARBB 1LO4L 3QRGH 1U8OA 1QKZL 4JQIL 4HIEA 5HYQB 1HYSC 4K9EL 3WN5A 1IL1B 1GGIH 3BIKB 1BMGA 3PGCA 4G8FA 4QXTB 5FYJD 5FYKD 3VA6A 1FNGA 5DD0L 3GKZA 2VERN 1RZGA 5FA4A 4PLNC 1KOAA 2X40A 4YQXH 1JWUA 3STBA 5AAMA 4PRPA 5EIQA 3BEVA 3DURA 3HG1B 1GOGA 5BCAA 3TF7C 1IRAY 3IU3A 3MOAL 5F3HB 4YX2H 4ZO8A 5T3XH 1TJIL 3MBEC 1MCJA 3N85L 4MJ6A 4QRUA 3DARA 2Z8WC 1P9MC 1EUTA 2JIXB 1QNZL 4D9RD 1I8IA 4JRYB 2QQNH 4MCYA 1KG0A 1IE5A 3S98A 1FH5L 1GC1H 1T20A 1T20B 4IDLA 3GSRA 5DD3H 3KYAA 3MBXH 3NCMA 4ZFFA 3MJGX 1DVFC 4FXGB 1XIWB 4HIIB 4BQBA 2JIXA 5HGBA 4YFDB 3H0TB 3L6FA 2JB6A 3PIQB 3GMMA 4P0DA 1MCRA 2E7LC 1WGOA 2ATKA 2YKLL 1R5IA 3DURB 3OL2A 1I3GL 3EYQC 4YZFF 1YNLH 3UTOA 3IJSB 2ZZUT 2Y6SD 3O0RL 1S7WB 1RZGB 4KQ4L 5JPMB 3GSXA 3BWAA 1H3GA 3BH8B 4PJ5E 2BY2A 1T4KA 4LHUA 4FFZL 2MQ3A 2HKHH 2V2XA 2CIIB 1TETH 2OI9C 4MVBD 4QRRB 1ITCA 3D48R 3MCKB 5JW4M 1JGLL 3LQMA 3VGEA 4K2UL 3VXSE 1T2QH 4K3EH 1EUUA 1YYLL 4FABL 2E7CA 1EZVY 1MPAL 4PJEB 1K5NA 2QBWA 4U1MA 5A40E 2EH8L 5CHNA 4G3YL 3CUPB 4OV6F 4PJBA 2JKXA 5D96B 3LZFH 1CXFA 2BNQB 3QZWB 1OB1A 2C1OB 3NFPA 2CDEB 1TFHA 5DMJB 1RIHH 1XCQA 2R15A 3I02A 5HPMB 4OM1H 2AW2A 1MJJA 2DQCH 1M05B 3MRHA 5AYQA 4KKBC 4CVXA 2B5IC 5GSRB 1U0QA 5IMKA 3NIFF 5EBGA 3LSOA 4P2RA 4HD9A 1OGAB 2KZ1B 4R4NC 4YHKH 4E9LA 1CD0A 1FH5H 1GC1L 1X5AA 3H9ZA 1Z6JT 4PGJA 4ZFZB 1J1OH 2JF1A 2MJWA 2ADGA 3P9LB 4GG6A 3HMWH 4PJFA 3GM8A 3QIWB 2XFXB 4GUPB 5IWLC 2VLKD 2A0LD 2XN9A 1BOYA 4Q9QL 5DMIH 1YQ2A 4L8BB 3E6FA 5INDA 1IGJB 5JHDA 3QI9A 3AB0C 2DYPB 2FX8L 4Q2ZB 3AU1B 2PXYC 3NAAL 4CRPA 3KPRB 1Y6KR 5D7SL 5ESAA 3D0LA 3D0LB 3QIUD 3BD4A 3GI9L 5DJXA 4OQTH 5D1QB 4YO0B 1DQML 1MELA 2DYPA 1HHIA 4L8BA 2YMXH 4Z7VE 1A14L 2H6PB 3HKFA 2DMCA 3BMWA 4GUPA 4POZD 4Q9QH 1S7RA 3BDYH 3P9LA 2ADGB 1CN4A 1QSFD 3L9RB 4TNWF 4GG6B 3SKMB 1EX0A 1OGAA 4J23A 2VL5B 2AXHA 3ULVH 1WSST 2BX5A 4KROB 4AEHH 5GSRA 2BNQE 1QBMH 5M95B 3RTQD 4OIIH 5ADOH 4MJ5A 3PL6B 1C08A 1MJJB 1XIWD 4FQCH 2L7JA 1FFRA 3C09B 1XCQB 3I02B 4ZSOE 3PABB 1T6VN 4KI5D 3ZYJA 4J7RA 2VDNH 2CDEA 4I1NB 3NFPB 4QTHB 25C8L 1NANI 4YFEA 3BQUD 4JQVC 1YEJL 4POZC 4PJBB 4DUWA 1CDUA 2JJSC 4Z6AT 3VH8A 5CHNB 2BY3A 2NY5H 4XBEL 1ZT4A 4XNXL 1WFOA 3LMJL 5H94B 4Z76B 1XGQB 4C4KO 1E28B 1A5FL 1HXMB 1DBJH 5IJVA 4FA8A 5HVHC 5DJAA 5IMMA 2VL4A 3ZE2F 1CGYA 2BJML 5I8OL 5CUSH 2BK8A 3KJ4B 5HHQB 5ABDE 2CIIA 1HH6A 3SJVB 1I3RB 1VDGA 1T4KB 4QRRD 3BP7A 3D0VB 3BH8A 5IEHB 1T7ZA 1PLGH 2WZPD 4XBEH 1Y6MR 3IDJB 1IM3B 3P77A 3DNKA 4UV4H 5E6IC 3W0WD 5AD0A 1KEMH 3T0DA 5HI3C 4IHOB 4LF3B 4U7KA 1P7QB 3O3BB 3RI5F 5HSFA 3GMMB 3GNMH 1AXTH 2JB6B 3IFPA 3L6FB 2YMXL 4RA3A 4M00A 2Z8SA 4XCFH 3TNMA 3VGHA 1ZTXL 4PGCB 1AGDA 1XIWA 1JZ5A 1WISA 2M1KA 2X42A 3TNNB 1X5IA 3GSRB 1CICA 1HI6A 1A4KB 3WMSA 5ESQA 1I8IB 2E9WA 4K3HA 3KYOB 4GQ9H 2LU7A 3LKRB 3UJIL 5BS0E 2F54E 1FFNA 2DLGA 4QRUB 4MJ6B 3GUTB 3OAYK 4QNPF 3BGMB 1QLEL 1JRHI 4OFPA 1KIUA 4RBPH 4F7CA 2VXQH 4K55A 1W8NA 4G5ZL 1MCOH 3IDYB 2Q6WB 3C08L 2B4CC 3MLYH 1KXQE 3MRGA 5BJTB 5FA4B 1FNGB 2XZQH 2CGRH 3BIKA 1IL1A 1CR9H 1B88A 5TE7L 4XT1C 4BKLB 4HSQA 3TBWA 2QQKH 1VGEH 1NGPL 3SDYL 3VMNA 5F8RC 1R0AL 1U8OB 2W59A 2FX7L 1Z9LA 3B3IA 3ARBA 32C2A 1X6NA 3U0PB 2QLVB 5E4EB 4X9FA 2X4UB 1AFVH 2DD8H 1J5OH 3A6BL 3V5HB 3ARBC 3MMEB 3HR5A 4HV8A 3KR3L 5LXGH 1UB6A 1XIWC 2QKIA 5JW5A 2AABH 1QACA 1DUZB 3ISWA 4DQOH 3WJJC 1CFTB 1BZ9A 2A9ML 4LBEA 4KK8C 4X7SH 2DTML 5C0AA 5DGRA 1LGVA 4ZTOH 3DVNB 3L1OH 4NNPL 2Z31C 4RGOH 4XWGL 4PJFE 2AI0L 4M43H 5F7YC 3ESVF 5IWLA 4XX1G 3MRRB 5E8EB 4JANA 3FKUS 4U05A 3KNBB 4MQSB 5E6IA 4HWZB 4N0CD 1G0DA 3K1KC 1J05B 2XN9E 1JGEA 2IH3A 2DICA 3MV8B 5BW7A 4P5TD 3MRNA 3FQWA 1R6VA 5AZ2L 2YPKB 5DD6B 3RKDC 3H3BC 5FGBA 3IFLL 3UPCA 2FLRT 4RIRB 5E6YA 3VFSA 5D7JB 2B1AL 43C9A 2NLJB 3MUGA 3HMXH 2H9GB 4HX1A 5GGVY 3VA2C 1JGDA 1DE4A 4XVUC 4X9HA 4WY7H 1PEWA 4KJPC 3FZUD 3AM8C 1E6OL 1A3QA 4R0LA 4OSUL 1MF2L 3GMQB 3HE6B 2J6EA 1FJ1A 4P4RB 3PHQA 4KY1H 4ZS6C 4YUEH 4EEEA 3VFVB 2IAMC 1AQKH 4UNTA 1ZHNB 2BNRD 3BP6A 4JCLA 1GZPA 1K4DB 5D2LE 3DSFH 5EN2A 1NEZB 3WD5H 3QEGH 4YXLL 2BRRH 2XZAL 4HWBL 5IBUG 1AD9B 5L2JA 1RVFH 2EDYA 3MRKB 2ERJC 1VGEL 2DRUA 2WBJD 5KZCD 3OJ2C 1FZJA 1WLHA 1JMXA 1MWAB 2OR7A 1Z3GH 4R7DB 3WXVH 2YR3A 4ELMF 1RU9H 4OZGF 5GGTA 3RWHB 4YHIA 4G42B 1JNNL 4QRSB 4PRPD 2PYEB 4PBVC 4LSUH 1YUHB 5FGCB 3KPSD 1TZGH 2XZCH 3KXFA 4NUGH 5ALBL 4IMLA 4LLUA 4GBXD 3O45A 1VPOH 5F96H 1SEQL 1QFWH 5KJRL 3IS1X 2AI0H 4M43L 3UC0L 1T6WA 3BXNA 5CINL 1B0RA 4ZDHA 3TBSB 4OF6A 3QBTB 2YD7A 1DVFA 4G6AC 1N5YH 1XZ0A 1EFXB 4JDVB 5I15L 1ACZA 4OGAD 1FPTH 2R23B 4W6WB 5E5MB 4NC0B 2VQTA 4FABH 3BZ4B 2BVQB 1B4JL 1T5XB 4JDTL 5JMOC 4M6NL 1P6FA 1IGMH 4F33B 4NC1E 5BZWB 4PG9B 3VFRB 4XPHL 3IDMA 5CEZH 3SY0A 1HOCA 2H32A 5JLZB 4WW1B 5EIIA 3BKJL 3HRZB 1IM9A 3SDXA 4YXHL 4ZS7L 3TPKA 1FNLA 3WKML 5J6HA 4D3CH 1JVKA 4C83B 1OF2B 3RY6A 1L6ZA 4M8QB 2FX9L 2L4OA 5F9JB 3NCYP 3V8CA 2F8XC 5IFHH 1U2CA 2CO6B 2P46B 4OGZA 5ITBH 1X5LA 5D7JD 4WW2C 1OWWA 1UA6L 3KLHD 3FT3A 4Y1AD 4LASL 3KXFD 4OLXH 5A2IH 5GS0L 1RJLA 4IBLT 2GJ6E 5I1LB 2OTUB 4YX2L 5DDHB 5TDPB 1RU9L 3QNZB 5FYJH 3BFOA 4OLYH 4Y4KA 3FONB 3DV6A 2ARJB 5C0FA 3X14A 1QNZH 1DQQA 5JORA 2UWEE 4JJ5A 4X98B 4QHMB 4X7DC 3UTSB 3G6JB 3GM0A 2Z92B 3D2UA 2VLKA 4GMTL 1WWBX 4BA8A 2KUTA 2OBGA 3MBEB 5C09B 5T3XE 3VU2A 5KVMC 3REWA 2YD6A 3QPQD 4XRCA 4NFDA 4GSDH 1KNOA 1SM3L 3B9EA 2IBZX 4O51B 1LO4H 2IJ0C 5HGHA 4FQLL 4WRLA 4RFNC 4HMEA 3OJDB 3W81A 5MHSE 3OR7A 4IOFD 5KOVC 4PGZA 2XNAB 1HINL 2EEBA 3KPMA 1RJZB 4OCRL 3O0RH 1BD2B 3WXWL 4FQJL 4HG4J 1K4CB 1IGML 5EC2B 5FO9A 3UJJL 2Z31B 4AIOA 5HVHB 2HT2D 2D7OA 4CAGA 5CEYA 3M07A 4K7PH 2IEPA 3NCEB 3IYLW 1A7BA 3SGEH 2NZ9C 4HS8H 2J7LA 2KBGA 2V7HA 4BZ2L 4LSRL 4MJID 3EO1A 5ISZE 1OT1A 4HPYH 2X6MA 1CTNA 3GB7A 3H3KA 4YBQC 3RDTB 3Q6FA 3ECBA 5J8OA 1Q72H 1R3JA 3G08B 1EAJA 1JPST 1JWSB 4AL8L 2VLLA 5ANMB 4LAQL 2BJMH 5SX5K 5DYOA 4Z7UE 4JO3L 4JPWH 4NJ9H 3U9UB 4HMDA 4V1DA 4YHLH 1NDGA 2VLRB 2IADA 3B5TA 5GS0H 3T1WA 4FXKB 4LPYA 3JWOH 4ZPVA 3KGRA 3HUJB 1ACYH 5J6GA 4GAYB 2GY5A 2IFFH 5E24E 2V17L 5I30L 4TUJA 3OKMB 4HKXA 2GK0A 1WZKA 3U9PL 3QFDB 3BH9B 4H26A 1AR1C 4S1QH 3UYOD 3KWWB 4GRLB 5AYUL 1Z5LB 3H7BB 5ERWB 3PWLB 3NABL 3SN6N 5JIHA 2YZ1A 1NCBH 2HTKD 1QFWI 3BQUB 1LDPL 4NPYB 3U83A 5EU7E 1UH3A 1X3DA 5GRWA 1QFUH 3QDAA 1JYXA 1AGFB 1AR2A 15C8H 4PJ8A 1SEBA 4PLKC 1N0LA 1Z9SA 4JLRA 4JM4L 5KSAB 1LO5A 3P0VH 4FQQB 1C16B 4ZUUA 1P69B 2AJVL 4FQHA 1GGUA 3KDMB 4EXKA 5JO5B 2EEAA 5T1DL 2AVGA 3TH2T 3BUTA 2YA1A 3C08H 1G7QB 4JG0H 4BFIA 4OCWL 2E7MA 1RK0A 5CIPA 5BZDB 2X9WA 3FOMB 4BZ2H 4RMQA 4D9QE 1OTUD 2J8OA 4LFHG 3LKQB 5C2BL 1RFDL 2F53B 5DGQA 3W9EA 1CXLA 4FS0A 1XF3A 1H9VA 5FYLL 4PYGA 1M6OA 1DBAH 4C59B 3RVWC 4IRJB 3RWFB 2MPAH 4U1KB 4G7VH 3PWPD 1X7QA 3MGOA 4KVCH 2GT9A 1SJHA 2CDGB 1MJUH 4PRNB 2AK4D 4ZFGL 1T5WA 4PR5B 2IPKB 4UI2A 3RPIB 4HCRL 5FF6A 5JIPA 1C5BH 4NZUL 3ARUA 3QIWD 1N0XL 4FHBD 2ERJB 3CAFA 1Q9KB 5T1MB 4IS6A 1XF2B 4XPBH 1M1SA 3K2UH 5C0GB 5SV3A 2C3VB 5DS8A 4R4ND 4LKCB 4X7SL 4GBXA 3RNKA 1DQDL 5EUOB 5I19H 1Q0YH 2FL5A 2LVCA 2JJVA 4HBQA 4P2RD 4RGNC 3MLTA 1PZ5B 2UVEA 5IV2A 2HAZA 4XC3H 5C86A 3B8SA 1HQ4A 2BHZA 4R90H 5KSUB 4PRPE 2R4SL 1DQLH 2BHUA 4P99A 1CDHA 4U3CA 4IM8A 5E94A 4G8GA 5IUSA 4Y2OA 3VXNA 3WEXA 2NNAA 5B21A 4YAQB 5J13B 3TN0D 5L7XL 1A6VL 1ZHBB 1MLBB 3UJIH 1BVKB 3G04A 4LMQI 4W70A 1ZLSH 4KZEH 1FG2A 5EUOF 3G6JE 4ZNEA 2GI7A 2ID5A 1JNHB 4HUWB 3QFJE 4NSKB 4KC3B 5EORL 1JF1B 2OK0H 4L4TB 4MDJB 4NQSB 1S7TB 3ZL4L 3ZLQC 4R96B 1KIRA 1BZ7A 5KSAD 1A21A 5IFAH 4X8XA 1NBYA 4JPKH 5L88H 4X0KB 4XNXH 1MNUL 4FQ2L 4J3OC 1KPRA 3QUXD 3LS4H 4HJJL 2ZUQC 2ZSVB 4NC2B 4KTEL 2QSTA 4LSQH 1MCPL 2OJEB 3HI6L 4JPVL 1QLEH 4C4KT 5EORH 5ECJE 4PJ5A 3O8XB 3RIFF 2XT1B 3X12B 2MHAB 4MXVE 1ADQA 5HHMD 3QXWA 2NY2D 4OFIA 1BQHA 1WCQA 2OR9H 4L8DB 1NAMB 3VXUD 3SHSA 1LO0L 1MNUH 3HI1B 5D7IA 1B2WH 4J12A 3TESA 3F12B 2CGRL 3EJJX 4P9HH 1KJ3H 5EUOE 2WNGA 3WO4C 4XXDB 3FFDB 2QEJA 1KC5H 4M93C 1AQDB 4MQ7A 1MCPH 3TH4T 1DQDH 4KPHH 3V4VH 2EDEA 2P44B 5TGBB 3CVHL 4M3JA 4RAVB 4RMTA 4OCMC 4CMMB 1FNEB 3GJEB 4PJ9A 1KB5B 1RK1A 1E6OH 3M1BA 1T1ZA 1I7TB 3TBVB 4BFGA 3TBTA 1AHWB 4LNRB 3HCVB 3DBXA 1I4FB 1KB5L 5KTEL 5F7KC 2VLKE 2X2YA 4HH8A 1NGWB 5C6TH 5EU4B 3EYUL 4L8CB 1O5DT 2D03L 4HAGA 5IVXE 1XR8B 4APQC 1EMTL 1A7PH 3Q5YA 4YE4L 2ICWI 1L7IH 2Y5TB 5LAXA 2ITDB 3GIZH 1OP5H 3O41A 4NQED 2OJZL 3O4LB 4WWKC 3BKYH 1DEEB 1A1OB 3HNSH 2ZUTA 2EC8A 3UDWC 5D6DC 4RWYL 5D7IF 4YR6A 1QYGH 1N7ML 5MHSD 5HHVL 1UJ3B 3ESUF 5T3ZL 1VERA 2X4QA 4PGEA 1UACL 3OKOA 1HE7A 1QA9A 1FFQA 1KTRL 1WT5C 2NZIA 2RGSA 4H88L 2ZUYA 1FLRL 2F5BL 2HN7B 3KAAA 5IP4A 4FTVD 3SDDA 5D8JH 2HA1A 3FO0L 5IHZA 4LHJB 1CFQA 4OCSL 2W60A 3W11D 4NO3B 1SQ2N 4H8WH 2XTJD 2BY0A 3FQRA 2YRLA 3LRHA 3QQ4B 3W0WB 3A6OA 4LIQE 1FORH 5TH2B 1IEBA 5IFJB 2YD2A 2D3VA 3V52L 4NO0B 4LSSH 4TYUA 1S78C 4U6HB 4Y2DA 2MCPL 1I8LA 1LE9A 3ARDB 4D0DA 3FFCD 1YEIL 2AEPL 2BRQA 1KIPB 3H9SB 4NHCH 5JNYA 2BSRB 1Q0XH 2QADB 5H35B 1J87A 4IRJC 3OBAA 5I8EB 4G7YL 2VXVL 4OF5A 4LCYA 3S34L 4YQXL 1MCEA 3GO1H 3D6GA 2GTWB 2FO4B 4N90D 3RA7H 3ZE0F 3CFKB 5HYIA 4OZIA 3R8BB 1NMAH 3QUZD 3MA7B 5E8PA 2XICA 5CJ8A 1VB9A 4R7NB 5EZJB 2MSPA 4ODBD 1TJIH 5SX5H 5ANME 3K4ZA 3HPLB 4M4RA 5IT2H 1JPSH 2OS7A 1BFOA 3CPLA 4HS3B 2NW2A 3PGDB 4PJ8D 4QWWC 1A6AA 1BVLB 1KLGB 4YPJA 1FZMB 2R29L 4PGDA 1VEOA 2F15A 4PD4K 4IMKC 1D6VH 4JQVA 1CXIA 3ARWA 5IIEB 4QRTA 3WYRA 2VDOH 1A9BA 1S7VA 1CD1A 5EA0L 2CDFB 1MAMH 5TFSL 1NMAL 2NY2B 2XY2A 3DX7B 1DBMH 4WI3A 2YXFA 1W72B 3P4LA 5HHVH 3OB0H 4K7FA 2O5XH 4JJHA 2KQNA 1DP0A 2HLAA 3MODL 4NZDA 1H5BB 4WEUD 2H2PD 3ZTJG 5IM7A 3S4SG 2NTFA 1CL7H 1T0NB 4H0HB 1G0XA 3VXPA 5HJ3A 2B8OT 4KU1A 3F58L 4L3EA 4M7ZC 3DRQB 2DQTL 2Q3ZA 5BOPA 4EDXB 1E4XL 1RUMH 1D6VL 3PWVA 4P2OD 4Z77B 1G9NH 1NUFA 7CGTA 3CSYB 4G9FE 3O2WH 3HB3D 1MEXL 4LLQB 1OAUH 5DQDH 4I77H 2NXZD 2V9QA 2YEZB 3QNXA 3PXHA 4GFTB 2I9LA 3HR6A 1GXEA 5CJXC 2GTZB 4PRIA 5DJYB 2AXGA 2E27H 2HFEB 4JFHD 4MD0B 3NTCL 4FP8H 3ULSB 2LE9A 1JHKH 3HAEG 6FABH 2BSED 2ZOKB 1F3JA 2EIZB 4UTBL 1JBJA 4MA1C 5I2IB 2XTLA 2VIRB 5F9OL 4R4FL 3T8XA 3EYSH 5E7BA 4JFOB 1T1XA 4WW2B 1URLA 2XRAH 1NJ9B 1HKLL 1YEDA 3T2OA 5K9KA 5J57B 3Q2CA 2KDGA 2O26U 5K9JL 3S5LB 2HMID 3LKNB 4KKBD 5HYSG 2R0ZH 5GRUH 5GGRA 4BQ9A 4HKJA 4C58B 5GHWL 2CR3A 2XTJB 4NHUA 3PV6A 3L3OB 1SM3H 5GGTL 1XH3A 1ZS8A 4NO0D 4LCCB 1B90A 4Z5RB 3FRUB 5KS9A 3EDFA 4YEFA 1H15B 3ULVD 1C12B 4ELKB 2V5TA 2PW1A 1UWGH 2DQHL 2DL2A 4G6MH 4OIAA 2NY3C 3RZWA 1OD9A 3MCLL 1CU4H 7FABH 5J1TC 1WZ1L 1OCWL 3BIAX 35C8L 4FTVA 5IBTL 1CE6A 1HHGA 1WFUA 3O2DL 4N8CL 4Y4FD 5DUPL 1EERB 3O3DB 4ZFGH 2QHRL 3WCYA 3BO8B 3RPKA 2X1XR 2B4CL 4U1NA 1AY1L 4FQPA 1EIBA 3AM8A 1ADQL 4K3JH 2EE9A 4XAWL 3E3QE 5EU6E 4XVSL 1P2CA 2H3NA 3HPJA 3ALPA 5AWNH 5FCSH 4YDLB 4V2BA 3ZTJH 1J1XL 4R4BB 4MYWB 4OZHE 5HGDB 2V5RA 3O4OC 1WZ1H 3CSGA 4GRMA 3D39D 4MNGA 1AO7A 3DX8B 1XR9B 2FSEA 5I66B 2IPUK 3KPNA 5E9DE 5DF0A 4QTIL 1F8TL 2G75B 2Z35A 3NTCH 2E5EA 3VGAC 3OKNA 1WEJH 3QAZC 1ETZB 4JO2H 3WNMA 2HKHL 2J8UB 1EV2E 2AJ3B 1EJOL 4P9MH 5HYSA 5FXCH 3GK8L 1CFNA 2XRAL 4JFED 2RFXA 1A47A 1T2QL 1NLDL 4XNYH 5D2NE 4GQ9L 4PBWD 4GKZB 4MCZB 1ZLSL 4KZEL 1OAXL 2OSLA 4M93B 5DI8B 2ZUQB 4P59H 5C0AE 4OZHB 1G6RH 5DEFA 3IJYA 4TSBL 2H1PH 3KPRE 5K9OA 4OT1H 4PTTB 1HXYB 1T3FA 4AH2A 5HHNB 2VDNL 2VC2L 1FGNL 1KFAH 2P8LB 4JO2L 5FFLA 1PFCA 9CGTA 5HHMB 5HDOA 1I1FA 2NY5L 4MXWL 4PJGA 4NN5C 1P4IH 1V05A 4DGVH 4FOMA 1DQJB 4K3DL 4HFUL 4JVPA 3Q5TA 1LP9F 3BUYB 3D39E 4ZQKA 1D5IH 3ARGA 2ZSWA 2E6QA 1T22B 4TSBH 4UILL 5L8JB 4KKCC 5GGSY 2GFBB 3A67H 3C60C 1CK0H 1U8LA 2DDQL 1WIPA 1BGXH 3FCTB 4M61A 4U1GB 5LCVH 2W9DH 1WAAA 2J88H 3K4AA 4JHAL 3C9NA 5D1XB 4L4JA 5IEKB 1G9NC 4OGXH 1C5BL 2X9YA 3ETBF 4G6AD 4OLWL 3O9WA 2HLFD 4HC1H 4UV7H 4WV1A 1ZLVH 2BOBB 5DA4A 1FAKT 5C07D 2ZNXA 1RIVH 1YMMA 1KLFA 5DXWA 1QEWA 3MNZB 4O4YH 4J8RA 5E5UB 5EBWA 1IKFL 2QL1A 5AG8A 2R8SL 3PWUB 4IIQA 2HT4D 5BRZD 1WWAX 3T77A 4TULH 4DGYL 1OP9A 1WBXA 3QWRD 5HY9A 1TDQA 1FGVL 2BVPA 1U93B 4NUJB 3MJ9L 4YGVA 4KTDL 3ARTA 4GKNA 3K74B 5C8JA 3C5ZD 1MQ8A 2I26N 5L7XH 1I9RH 3U2SB 3DO7A 1D5BA 4OCLC 5IQ7H 4YLQT 2DIBA 5CP7A 1CR9L 5TE7H 1OT2A 4AT6A 1MIMH 3OMZA 1ONQA 2AJSH 4S0SD 1KENL 5DR5H 4XPGH 2BNQD 1JPTL 3I3DA 3QXVA 4KV5F 4TUKH 1L7TH 4U4BA 1UM4H 3RAJL 4GG6E 4QEGA 1ZGLM 1UEMA 3ARZA 3O3AB 1MFDH 1CI5A 4PG2C 4L3CA 1KB9K 1FYTD 3LQZA 3C5JA 4WFGD 1GC1C 4M48L 3CMOH 4L29A 1QP1A 3KS0J 1KB9J 1HQRB 3AROA 1FL3A 2VLRD 2W1NA 5F8QC 4CNIA 4OCSH 2QSVA 5EU6B 1XGUB 2EC9T 3CDGB 1ITBB 3RVUC 3D5OF 1U3HB 2FEDC 5CGYC 5JHDD 2WIIA 2UUDH 1YC7A 2I60H 3RY6C 1NGXA 4RGND 1CG9B 4B0MM 2VISA 3PQYA 3ZDZF 4C56E 4KKLD 3SCMD 1F4HA 3LY6A 5CLTA 5A2KH 1M71A 4FQXD 4YHPB 3VFPA 3D69A 4AYFA 4KKAD 3VJ6B 2FGWH 1D6EA 1KYOK 3ZTNL 4KROD 1TVHA 1BFVL 4PB0H 3VFUB 3W82A 5L2KE 1PYWA 1AXTL 4HKBB 5CJBA 5EOTB 5TE6L 3UYRH 2QJDA 3DTXB 5JIKA 1P53A 3C6SB 3E2HB 2VDPL 4KJQD 4O58L 4OGYL 4ZO7A 2GK2A 4MDIB 4U6YB 4YDJA 4NGHL 5SWZA 1U92A 2DKUA 1EDQA 4P5MB 3MQIA 1HYRC 1NFDA 3RVWD 5I1HH 3U1SL 5ETUA 4KDWA 4HULB 1KEGL 3RUGF 1V8HA 4KJYB 2FDBP 3L3DA 5HYJD 2D4FA 4XCNB 4AEFA 1ZWIB 5DR5L 3QXDB 5J9PB 1KACB 3WLBB 4JRXA 3TZVC 4RA0C 2GAZB 4I13B 3TFKC 3CFCH 5I1CH 1U41A 3RZCA 4LU5H 3HNVL 1AQKL 2YPLA 4LFHD 4DZ8A 4NN6C 4XNMA 2Y07H 3T0XA 4JG1H 3CZFB 5DTFA 1L0QA 3GBNL 1MHPH 3LV3B 5EO9B 5EWIL 4PJXB 4KROC 1LEIA 4NO2B 1UT9A 5I71C 2AEPH 1QVOB 1T7YA 3FFCE 2MKWA 1QR4A 2ZUSA 3VXRB 4RISH 3LQAC 2K1MA 5DQJB 1YPZB 5DUBB 5JMRA 5KVEL 1H5BC 2Y36L 3VG9C 4QHLA 4XPFL 2ZCLL 4Y4FA 3IAGC 4UT7H 1MREL 1OHQA 4XX1E 4MX7A 2Q86A 3JTTB 5KSBE 5GGQL 4K9EH 2BOCA 4MA3B 2BMKB 4HW6A 1CGTA 3D39A 3MV9A 1K6QL 4PV9A 4TPRH 3ROLA 3PDGA 3F7VB 4K8RH 1I9EA 3DMMA 2FIKB 3CC5B 4Y4HD 5JHLH 1QG3A 5MEQA 2YZ8A 4CU6A 1E4XI 3RP1A 2R0LL 4UT6L 3R1GL 4KMQA 3JZ7A 4M6OL 5INCB 4ZUSB 2ZCLH 1I9IH 3MRLA 2KZWA 4PRHB 1IBGL 4FMFA 5CZVL 1YQVH 3RWCB 3CIQA 4NM4L 3RWIA 4YHYB 2OQJB 5EC1B 4TVSa 1JHTA 3MXVH 4G6KL 1WC7B 1D5XB 5B39A 4Z78A 1VGKA 1R3LB 5E8NB 4J3TA 4ORZC 1YEIH 4K8RC 4AIZA 4EN3A 2HT3D 1G6RB 1JK8B 3SE8L 3WIFB 2A2QT 4YPGB 4ISVA 5K9QG 2AK4A 2AK4B 3WIFA 5HTSA 3WL9B 4P57B 2NY0D 1KXVC 1S7UB 2WWKO 5MI0C 5CSZA 1HH9A 4Z78B 1PG7L 3IDYC 5I8CB 1WC7A 1KJVB 2OQJA 5EC1A 1UM6H 5GRVK 3KHOA 3EDDA 1JI2A 4A6YB 4XH2B 1JF6A 2WV3A 4PRHA 3AREB 3JWOC 3QEQD 2IAND 1CDYA 2A1WH 2E9JA 3MRLB 4ZUSA 5GIRB 1BP3B 2R29H 4ZPTB 1IAIL 1CYGA 5C0BE 1A7NL 4IEFB 3GBMH 3LD8B 2GJJA 3CC5A 4JY4A 3HMWL 3F7RA 4GMTH 1BOGA 1UZ8A 5IW3A 4D8PA 1AGCA 3L3JA 4M1GL 4XMPL 4QOKA 4CL7A 4LVNC 3TFKD 4X6DB 1NCDL 5L0QC 4MX7B 2DWDA 2JK5B 4HIHA 5HVGB 4U1HB 5E99H 2Q1EA 5I8KL 4LQFH 3F7QA 5EZIL 1IGTA 4X6FA 1CXEA 2O5YH 3HE7A 3ULUC 2X70A 3ZE1E 1QFWL 3ZSSA 3NABH 3UO1H 3UMTA 4ESKA 1DN0B 1LEIB 4O2FB 1RULH 4OB5H 5DJ8B 4HXBL 3GO1L 4KRPB 2WBJA 2MFNA 5E4EC 3CZFA 4LLMB 3AY4C 2R56L 4LVEA 4XNMB 4P2QA 3UROR 2KQMA 4FZ8H 2YPLB 2ZKHL 3BPOC 3U4BH 1T0MA 4X80L 3G5ZB 2X4TA 3WLBA 5J9PA 1ZWIA 3VRIB 2GSIA 1G7HB 5TDNA 5E08H 3QO0B 2HKFL 4PJIA 4F9LC 2PO6C 1IGCH 1NFDB 3QUMH 1I85A 4OCWH 2NXYC 1N64L 3C8KA 3B2UC 3E2HC 4OV5A 3ULUL 1A9EB 4Z7UA 1CIDA 3TVMA 4YDJB 2X89A 1X9QA 5J4MA 3QULA 4WUKH 2NYYC 4WIQA 4BUHA 2V5MA 1T66C 3VFUA 1I7ZB 1OY3B 5LKNA 1FV1A 4PY7B 4YHPA 3BYTA 3MRDA 1CGSL 4NQCA 3B9DA 4HFWA 2PF6A 1CG9A 3HLAB 1ACYL 4ONGL 2CQVA 3TA3A 2ZPKL 2CD0A 3ZKND 4LVHB 15C8L 5EBLA 1YY9D 5ID1B 3V9FA 2QADD 2WP3T 3V6OE 4AEHL 5HGGS 2R9HC 3K7UA 5M7QA 3TH3T 3RIAF 1FZKA 1RHHA 2DQJH 4R2GC 3GSNA 1U42A 2EZ0D 1MRFL 1I7UA 2XN9D 2N4IA 4OLVL 5HD8C 3FJTA 3ARGD 1B3JA 1A7RH 4I0PD 5KSBA 1RJYB 1U3HC 2JJTC 2NY7L 3NH7H 2QV2A 2EDKA 1W72H 1PGRB 1PJ9A 3ME0A 3QO1B 2FB4L 5IB3A 2APWA 3HFML 3QDJE 4Y5VC 4KZDH 4HFUH 2RR3A 4XWOC 3P0VL 3S35H 1R24B 4U7MA 1LD9A 1ONQB 1UADC 1OP3K 4QF1B 5E2TL 5JDSA 3HC3H 4PP2A 2ADIB 3ARPA 2XG5A 1CK0L 2DDQH 3DYPA 5MENE 4I18B 4PJ9C 3T0EC 3MLZH 4JY6B 4HS8L 5A2FA 4PJDE 1CIUA 1G7JB 2W38A 3LHPH 1U93A 3JVGA 1SBBA 1JNJA 4G9DA 4YDVA 1W0VB 2VLRE 2VH5H 2YPLD 3D18A 3S8WA 4XVUD 5KZCB 1NC4D 2WUCH 1BIHA 1U8HB 1I8KB 2PO6A 4XNUL 4JB9L 4IIQB 4PS4L 5C1MB 1QEWB 3MNZA 4X6BB 4B53A 1MJUL 1TPXC 2I5YL 3MUHL 3D3VB 4P5KB 2O61A 3H42H 2FHFA 4G8EB 4PJ5D 4OLWH 2XACC 1FVEA 2Q8AL 1HIMH 5DMIL 3GSOB 5FKAA 3O6FA 3UAJD 3VXMA 1I1CA 2ZPKH 5IEKA 4CVZA 1KJ2B 3QR2A 5FYJE 5CSBA 5IJKC 3MRMA 1RZKH 4HDIA 5DC9B 5DJ6A 3RY5A 3FCTA 4OF8A 1FL5B 3CMGA 1NKRA 4PLJC 2GFBA 3GDBA 2G60L 5BMFL 2ZSWB 4HH9B 2CKBH 4ZQKB 5D5MF 4XP4L 4PRAA 1JN6B 3RFZC 3GMOA 4G5ZH 3SGDH 5TDOA 2WIMA 2GCYB 4NFBA 3VE0B 5HHPA 4F37F 4HAFA 1H3PH 4WWKA 3X11B 3V4PL 1T21B 2E8YA 4R2GD 4F2MB 2P8LA 2B1AH 1I9RL 5HHNA 3T0WA 4DKDC 4Q9RL 4HK3J 5BS0D 4PJEF 1WAAF 4PTTA 4M62H 4XPTH 3IFOB 3O11A 1FYTE 3IJYB 5DEFB 1WTLA 2AJVH 4Y16C 5D6CB 1FSKC 3O6KL 2AERT 1TLKA 4GRLD 4MCZA 5D5MB 1INQA 2ZUXA 4ODUA 1U6AL 2DM7A 3THML 5DK0A 2WSKA 1J12A 4EOWH 1A1NA 1MVFA 1Z9MA 1MI5D 1VKXB 2BXZA 2EDXA 1MWAL 4KTDH 1H8OA 1S8DB 1V7MH 4JREB 4NDMB 1VA9A 2J8UA 4JPKL 5L88L 1XGTB 3DXAB 5I1AA 3SGKC 4NQVB 1S9KC 5AG9A 1TZHA 4Y1AB 4B41A 1I9JH 1U91A 2D9CA 4MHHG 5GGRY 1T66D 3O6FD 5IMOB 2AJSL 1CLOH 2CLVA 5IF0B 1PQZA 1XR9A 4ZTOL 5BVJB 4MNGB 1FNSL 1UVQB 4LLWA 2NYYD 2C1PA 3BHBB 1QHOA 2HG5B 5HGDA 3VRLE 1WFTA 1UM4L 3S3SA 4F3FA 1OGAD 4CW1B 2XKNA 4JGJA 1HCFX 2WAHA 1C5DA 5C0IA 3MYJA 3SDCA 2H3NB 3EOYG 3MJ9A 4BH8A 3CX5K 1B2WL 2P48B 4U1NB 3UBXG 2D31B 2YWZA 4PD4J 5FO7B 2IH1A 3WE6B 1CE6B 1HHGB 1L7IL 3KPPB 3VD4A 4JR9L 5FHBL 1C12A 5T5NF 1HSBA 1H15A 1X4YA 4D3CL 5KS9B 3FRUA 3IETB 4KI5E 4S2SA 1CGUA 1J18A 4YUEL 3WJLC 2P5EA 1ZS8B 3X13B 4MZ2A 4EUPG 3IFLH 5FV1L 1XF4B 5FECB 3LEVH 5CEZE 1F90L 5SWSD 4G8IB 3INUH 5EUKB 5FYKU 4XVJL 3ZE2E 4ODSL 2VDKH 3B9KA 3TCXA 4BM7A 4YHYC 3LEXB 3RKDD 3QIBD 1IGYB 2Q76A 1JRHH 2NR6D 2R0KH 4XPAH 4RISL 5CJQH 3SDXF 3HUJE 5C0CA 4S0TD 2OZ4A 2BFVL 1MVUA 3PP3H 3RL1A 4WHTA 2OMNA 1BQLL 5KS9F 4HGWB 4XNZC 4Q9CA 1IFHH 3KPRD 4J1UA 2FX9H 4JFOA 4HUVB 5IFAL 4TUOA 5FM8A 3GSVB 5I2IA 4X7TB 5I18H 2X1QA 2EIZA 3NCCB 1ZANL 2OR8A 4NKMB 4XHJC 1J86A 3WIHH 2CKBA 1FDLL 1NGQL 4H20L 4HK0B 3VDBA 1E4XH 2HFEA 5BS0B 3OGCA 3LKSB 1NBZA 2GTZA 1FNSH 4PRIB 3RVVC 4UT6H 3SCMC 1KJMB 2FX7H 3BW9B 4Y88A 3EFFA 1BLNB 1S5IL 3QWOB 4KRNA 1G7PA 2YK1H 5GRJL 1YJDC 1NFDE 2I9LB 4LU5L 5T33H 2ZG3A 2GHWB 4JKPL 5T1KD 2YEZA 3U46A 3QWQB 5GGQH 4JG1L 5GJTH 4LLQA 4L4VB 4OCYH 3AGVA 3MX0A 4N8PA 5I1JH 3CSYA 5GRYA 4XMKH 2IWGA 3BAEL 5E03A 1TTFA 1OTSC 4Z77A 2EH7H 3PWVB 4MD4A 3WHXA 1IQDA 5CGMA 1JTPA 2NY4B 2YD5A 5D72H 5E2WH 3TJHD 5AAWA 4LAJH 2DLTA 2HLAB 1ZHLB 4OM0H 1DBML 4L9LC 5F1IA 3S97C 1TVDA 1TMCB 3ARED 3QEQB 4GT7A 1MFBL 1ZXQA 3DX7A 3T3PE 4OZIF 3W39B 1A9BB 1S7VB 1NSNH 3MRJA 3VG9B 1GHFH 3UTSD 5IIEA 1OW0C 3MA9L 1FAIL 1J0JA 1OGTB 4UUJB 3RGHA 1L0XA 4J6RL 1A6TA 4NRXB 3TO4C 1A6AB 1BVLA 4OD3H 5F7FA 3QCUL 2A74A 2NW2B 4HS3A 1BM3L 1BFOB 1PVHA 1JZ2A 3GMLB 4GW5A 2M8XA 1MJ8H 3HNSL 4PP1D 3AVEA 3EO0A 2CMRL 1G0YR 2E7BA 3V0AC 3MRPA 2Y1VA 3CJJA 4J4PD 1ZK9A 3SE3A 3IB4A 1LEKA 4CUCA 5FOBB 3ALXA 1JHLL 4PIRF 4UB0H 4OZIB 1EBAA 3AMKA 3RWJB 2GTWA 5CFHA 3S5LG 1WV7T 4EI5D 3CLEH 1YNLL 5BO1H 2R1YA 2FBJL 4UU9B 4Y16B 5H35A 3QG6A 3ZZ1A 5B3NA 1KIPA 2B7DT 1Q94B 5ACZA 3UO1L 3ARDA 2XKSA 4ODHL 1BQHG 1QRNB 4MVBC 4WU7B 5F7DA 4KWUA 4YK4B 1A8JH 2Y23A 4YC2C 4H8WL 3TJHC 4POUB 1OAQH 2WQRA 4HBCH 1MREH 3QQ4A 4N5ED 5CBAB 3OGOE 5GJTL 5I8KH 1UWXK 4O00A 3KPOB 3WFDH 5JDJA 2W60B 4LLDA 2WM0A 3T09A 1F11A 3U48A 3SPVB 2F54B 3BAEH 1DBBH 2E27L 3GIVA 2ZCKH 1BBJA 2YHGA 2HN7A 3E0GA 1WCBA 5I1DB 2XI9A 4UTBH 2PW2B 4U1SB 1QA9B 5DFTA 4M02A 1PBYA 4LPXA 3GSNL 5CCKH 5L2KD 4ONFH 2CLZB 4NRYA 1UJ3A 4EN3D 4Y5XC 2X4SA 5JIIA 1RUPH 1VFMA 3P9MB 2ENYA 5DJDB 1A1OA 1P4BL 4W4OA 3OX8A 3MV9E 5E2VL 1W2KT 3O41B 5CGTA 4WVRA 4OT1L 5I1GL 5DD3L 1UEYA 3DETD 1LEGA 3P4NB 4JFXB 3KYKH 3L3IB 3V4UH 1F2XK 3ZKMD 3MLZL 5JHDE 4F80A 3EYFA 3Q1SL 1VACB 1ND0A 4PRBA 5EU4A 1NGZB 3RVXC 4X80H 5FA3A 5GGSB 3VI3F 1M7DA 3L3GB 2Q8BH 4HG4K 2ZP0T 3D25B 1RK1B 5D71H 4DEPB 2OL3H 4PJ9B 1HEZB 4N9GB 4P2OA 3LCYA 1RD6A 4AEIL 4CN6A 1AKJB 2IGFH 3TO2B 3T1FB 2FBJH 1MCLA 4X4ZA 3T3PF 2DQUH 1MCNA 4Z95L 2LU4A 4KI1A 5IK3A 3FFDA 4XXDA 5KSAC 4OGAC 3VFNA 5TF1H 5JPNB 5FOJA 1C1EL 3F12A 4MSWB 4PJBE 5HI5D 1N0XH 4MGXA 4OZGB 3T0EE 2DLIA 2X1OA 1VEMA 4L8DA 1BQHB 5D7IE 4WUKL 4NKIH 1YYML 4L4VD 3U4AA 3FT4A 3FT4B 5FO8B 5FO8A 2VYRE 3ARDC 4RNRA 2ARWA 3CSBA 4RMVA 2ZWLT 4EI5B 3L95B 1RIUH 5CJOL 5HHOE 2ZSVA 2FYYB 2C4XA 4RQQA 3ZDXE 1I7RA 4X0KA 1NCUA 1GH7A 1ZAGA 3ZHKA 1BZ7B 2YA2A 5ICZA 1G7MB 1KIRB 1AKJA 4R96A 2EZ0C 1IAKB 1HEZA 2VH5L 4N9GA 1IGFL 4L9DA 3V0WH 1RFDH 2R0WH 1FYHB 4OIIL 4JHZA 5FGBC 4MNQA 1F02I 4NSKA 4WV1C 4GS7C 1OSPL 1A0QH 1T89C 1IJ9A 1LP9A 1UH4A 4GRWE 4C56A 4E5XA 1GSMA 3G04B 2R0ZL 1AXSB 3F7YB 2UYLB 5C92A 1L7TL 5C9JA 1SY6A 2EDBA 2PYED 2DLHA 5B38G 2FO1A 4G8GB 5KS9E 4E0RB 3GRWH 4JFXA 3P4NA 1LEGB 3Q1SH 4NQCD 4ZOAA 4RFOL 1UCTA 1WF5A 3CDFA 2JB5L 5IW6A 4YFLF 1A64A 3LKOB 3JWDL 1FVCB 3OX8B 3C5ZB 3FZUC 1MRDH 4KKCD 4KK5D 4UV4L 4CU7A 2ESVA 4JZOA 5IV2B 4NKOB 5F9WC 3CD4A 3QEHB 2X4SB 4X4MA 1EHXA 5LWYH 1XAUA 5SX4H 3FB5A 4BZ1H 3EBAA 3FO1B 1VADB 2DQUL 2V9TA 5IBTH 4GBXB 4UNVA 2HJFB 2F5AH 5T1KA 1K2DA 1CBVL 2J2ZA 5T1MA 1XF2A 1I1YB 2CUIA 2NXZC 3B43A 1BBJB 4I4WB 2NW3B 4XCCL 3DETC 2IPKA 3RPIA 2P42B 1T5WB 4PRNA 2CDGA 3KPOA 3MGOB 3G6JF 4QT5A 4BQ6A 3RWFA 3MLRH 4Y1AE 4K7PY 3U7YL 4JM2F 5C7XL 2IAMA 5DVMA 1XF3B 5I1EL 5F7DB 1I1RA 1Q94A 5KVGH 1N8ZA 1TJGH 1EHNA 3QG6B 2DLEA 4XNZB 5ALCL 4MJIE 1F6AB 3CFEB 3QHZH 3O8XC 5DUML 2DQGH 3ULVL 4IOIB 1I75A 3RWJA 2E9IA 3I2CH 4D9LL 2BVOB 1T83A 3KDMA 1AR1D 3HI6H 2Z9TA 1MIEL 5GGUA 5I74B 5SWSB 1VESA 4ZUUB 1N6QL 4PRID 5C70A 4JLRB 3WSQH 4PJBF 1SEBB 3ZL4H 3GMLA 4GW5B 3VXRD 4N1EA 4Z18A 4ZYKB 3UEZA 5EFIB 3UJTH 4KQ3L 4UUJA 4Y4FC 5DURB 4NPYA 3RZCD 2IPTL 3VXSA 3M17B 3MRJB 1YPZE 4WFED 3RHWF 2YC1B 4IOSD 2A9MH 1BREA 5ERWA 3QEQA 1YZZA 3H7BA 4H1LA 3TA3C 4TVPE 3KWWA 5FGSA 1OLZA 5F1IB 4XCYB 4CVWA 3BH9A 1J5OL 4NP4H 2RHEA 1DFBH 4RWHA 4HKXB 4Q6IA 1JYVA 1IQDB 4GAYA 4LCWD 4ODTH 2R2BB 4PP1C 3RX7A 3WHXB 3HUJA 4MD4B 5AZ2H 4R3SA 2IQ9L 1HDMB 3SDCC 4JDTH 3QRFM 1I9JL 3B8YA 2IADB 4LCWA 2HMIC 2D7TL 1KPUA 4L4VA 1GIGL 2HT3C 2R2EA 4RGMC 4JAMA 3VDCA 2F9BT 3U46B 1M7IB 3N50A 2V2WA 1DANT 2CJUL 4FG6C 1G7PB 5CD5D 3QWOA 1BLNA 3BRDA 3ECBB 3VGAB 1TJHL 5IESL 2H8PA 3LKSA 3G5XB 3MLXL 4FN0A 5BS0A 3FOLB 1DZBA 4PTUB 4M7LT 4XBGB 2R2HA 5HDLA 3BSZL 4WI2A 5MP6H 2WMPA 4WO4A 3CH1A 4X7TA 3GSVA 3WIHL 4U6VL 3G5YB 4OD3L 3MOQA 4ZAKD 1XMWA 1EEZB 1K4CA 5AZEH 2VE6A 4KK6D 4I3RL 5EBMB 2VDRL 5B8CC 4FNLH 2SEBB 3M45A 3RL1B 1AIFA 1X6LA 3EOBB 2NXYD 2XNAA 3VH8G 2RIKA 2YK1L 5FK9B 3OR7B 4I0PB 5DHYB 1UM6L 1IGYA 1PSKH 2Q76B 2ZJSL 3VWKD 4EQ2A 4LCUA 4AG4L 5HGHB 1UGNA 2J3SA 1SYSB 4O51A 1KNOB 2PR4L 3DOSA 3SJVD 2DI7A 4XRCB 4ZXBD 4QXGL 5HHXL 1D9KD 3BZEB 1XF4A 1QD0A 2DWEA 4MAYA 4ZUVA 4KK8D 1YMHB 4OAWB 4L3ED 3MUZ1 2Z92A 3B6SB 2EIBA 4JO1H 4N0UE 4KI5F 1CGVA 2XTJE 1OLLA 4JJ5B 3BKCH 5GRVL 3X14B 3V79C 1QSVA 4AENA 3DV6B 1BJ1J 3HI5H 4PJCF 2AXFB 3GGWB 4Q74A 2FATL 5C0ND 5E99L 2OTUA 1LO0H 2XZCL 3NIFE 1RJLB 2ESVE 1NLBH 1YC8A 2BCKA 2ATPB 3QG7H 3MXWH 3C2AH 4LIQL 4NZTL 3S7GA 1NCWH 1OQXA 3LH2H 2IALB 5J7CC 4BH8B 4J6RH 3B9AA 1JHKL 4MS8D 1ES0B 3KLDA 1C5DB 5DO2C 3BPCB 4CW1A 4PJCE 2HG5A 4MXQD 3NIGE 1S3KH 4LLWB 1FNHA 1UVQA 4M8QA 4LEXH 4S1RH 5BVJA 1PQZB 1MRCL 3IDIB 3N1PC 1F13A 4C83A 4XI5D 1U91B 1XEDA 2DI9A 4WW1A 5JLZA 5CILH 4WGVB 3W5NA 4HQQL 1HOCB 2ICEB 4DZBA 3D3VD 5EDXA 3CFDA 1RMFL 2AK1L 3VFRA 4PG9A 1RQ5A 3V4UL 2F53E 1JNLL 3PL6D 1QQDA 1MAML 5IVXA 5D5MA 1SY6H 1WZLA 4TNWK 1GGBL 3HNVH 3DMMC 4CADB 5I30H 4RBPK 1OAKL 4BSWA 4JDVA 1SVZA 3IFOA 4WUUB 1E4KC 3JSSA 3FRPG 3U0WH 2C3GA 3UTPD 2K3TA 3MREA 4DN3L 2Q7NA 1T21A 3BXNB 4RDQF 3VD5A 1J0KA 4F2MA 4NUGL 5E6ID 1RUML 1ZKAA 1K3ZA 5GGVH 4DFHA 4F58L 1KN4L 2XKUA 2GCYA 2R69H 1GGCH 4MNQD 3NZ8B 1JN6A 5H37H 4FP8L 5D1ZA 2I25N 2C9AA 4L8SC 5IHUH 1V3KA 3DHJA 4FRWA 4QRSA 3QDGA 2AEQL 4OTXL 2I07B 2X05A 3NPZB 4RMSA 3MRMB 4OCRH 2J5LB 2P5WD 1EHLL 2AJUL 1KT2A 2LVEA 3O6FB 5FKAB 1MFAH 2EO1A 3WDIA 5L2JB 4KJWC 1FVEB 5E08L 2H1PL 3GFUA 4OB5L 3S34H 2O61B 1WEJL 1WK0A 2B5IB 2EDFA 3Q3GB 5FEBA 1LNUB 1IGCL 1JPGB 1IBGH 4WTZG 3BP6B 4X6BA 4F7TA 1ZHNA 2AEQH 4OTXH 3ULUH 3EO9L 1AI1L 1FC1A 2VWEE 3S36X 4QRPA 1FJ1B 4P4RA 1MFBH 3HE6A 2EXWC 5DSCA 1AO7E 1G9EA 4LPWA 4PJAA 4M6NH 2CSPA 1FFOB 5IFHL 5B22A 2KL6A 4Y5XA 4G9DB 4S1DD 4HUUA 1DE4B 1JGDB 4HX1B 4EN3C 2NX5E 4JDZB 2DBJA 5D7JA 4RGNE 1MCIA 3D9AH 4I18A 3BZFB 2XA3A 2E7HA 3JWOL 4TNVF 3TT3H 3VWKC 3EHBD 4RX4A 2DQCL 4P2RE 5FYJL 4TOYL 1J05A 1R24A 3QPXH 2QSCH 2CRYA 4NBYB 1GAFL 4KJWD 3WIHA 4XNUH 2GY7B 2NR6C 1JZ7A 5E8EA 1JCKA 5IB3B 4ZSOA 2D7PA 4NWUL 2Y06L 4JE4B 5CMAA 3QP3A 1G9MH 5AUMA 4QOKD 1UWEH 4PREA 3TC9A 5KSBB 1P4LA 3SGEI 2Z93B 1QBAA 3RDTC 5A43C 1I7UB 3BIBX 4M1GH 5JW5B 4KTYA 1SYVA 4LGRB 1RHHB 1UB6B 4IRSB 1QRND 4E41E 4MA8H 4DUVA 2BERA 3MRIB 5JXAL 1M4KA 1BEYL 3QSKB 4JQXA 5EBLB 3ZDYE 4XBPA 5I9QB 2VJXA 3MJ6A 4FQJH 3MRFA 5C07A 1BIIA 3TA3B 4YGAB 2ADFL 3TBWB 5E2TH 3N0PB 4BKLA 5KSBF 3RWGA 4AMKH 1U8JB 4XP4H 1YEEL 3RBGA 2AJZA 2EXYC 5TQ0L 4PY7A 5LQBL 3MRGB 4ACPA 3MLUH 3QHZL 5IB2A 2Q6WA 4NYLB 4NN7B 3LS4L 5E9DD 5D93C 2AJXH 4NCC2 4FTVE 3K8MA 3DUSB 4N0YH 1OAZL 2WP3O 3M8OH 5ESVB 1CLZH 1RUKH 4OJFL 3TVMB 3E8UH 1A9EA 1ZVHA 1CT8A 1QFOA 3KYOA 3O3UN 2K7PA 5E1AA 2FIRT 1A4JB 4XCEB 4JN2B 1HI6B 4JKLA 4OGXL 1ROWA 1ZVSA 3LRGA 2ILLA 2OR9L 3TNNA 3QO0A 1LO2H 3OR6B 4JFEA 1HIML 4DGVL 3VRIA 2B1HH 5HVWA 2FD6H 4I18C 3G5ZA 4Y16D 4K3GA 4OKDA 1OSPH 3VMOA 4Q97A 1WITA 1IC7H 3E8UL 4X5WB 4P2QB 4JKWA 4NNYB 1Y18B 4IHOA 4LF3A 1OW0A 5DC4B 5JR1H 1KLUB 3Q48A 5DJ8A 1IM3A 3P77B 4JVWA 1EFXD 4ZUTA 3B2UD 3PUCA 2V2TA 2MKLC 1HK6A 4M6MH 4LPTA 4RMUA 4DUXA 4XP6H 2ZUVA 3HE7B 2HFFB 5DURD 5FM5M 5J56B 3NIDF 1IGIL 2HTLD 5IMLA 1C7SA 1HH6B 2XXMB 4QXUL 4YWGL 5LWYL 1UQSB 4HIHB 4PRHD 5ADOL 4NCC1 5LGHH 3UCRA 2BNUB 4F7MB 5IMMB 2YPVL 5FGCE 3BT2L 5IJVB 3O6KH 1HXMA 1CBVH 3UAJC 5H94A 4Z76A 3L5WA 3T4YA 4L9LB 3MRBA 5L9DH 1ZT4B 4H25B 4JY4B 3K8LA 4M1DL 3VH8B 3QDGE 3C2SA 4LHUG 4BSVB 4OF7A 3U79A 3CCHB 1N3NB 3MR9B 5F1NB 5DRWB 3GK8H 4GKSB 1L6XA 3C6LD 3PABA 3GMNB 4M48H 2DJ4A 3O6ML 1VENA 2HJLA 4A6YA 4KGLA 3PL6A 2QQKL 1KELH 4MJ5B 5I73B 1KJVA 3CK0H 1ZSDA 1FO0H 1AE6H 1HH9B 5CJXA 4OI8A 4BUGA 4I3GA 3RAJH 2P5ED 2CK0H 2VB5A 3DXAE 1S7UA 4RAUB 4I5BA 1I8MA 5F44A 3SKMA 3A0OA 4YPGA 4U1IB 4K71B 1S7RB 3ILQD 5GS3A 3MGAA 3CMOL 5D5ME 2N1KA 3STZB 5KG9B 3OB0K 3MPCA 2AV1B 4FQIL 1R0AH 1HHIB 1L9NA 2A6DB 5D1QA 4WO4C 5GS0D 4KAQL 5FKPB 3S96B 5ESAB 5T33L 1BBDH 1IZKA 3PG2A 4Q2ZA 5INCA 4ZAKA 3DYOA 3VWKB 1U3HD 3E3QC 5JHDB 4OD2A 2WINB 3MFGB 3F7VA 4YBLC 2I9TB 4PV9B 3MV9B 4N9OB 5GSVB 1H3WM 4YE4H 4PJFB 1KTKE 1H0DA 4PJ8C 3ZMRA 4ZFZA 4OBRA 3JTTA 2Q86B 3DO3A 3MLRL 2EDHA 3NCFB 4LSPL 1H3UA 3BYYA 4Y4FB 4N1HB 2GKIA 2LAAA 3MYZA 3WFCH 2D7MA 4AM0A 1EJ6A 5F7EL 5IESH 5DQJA 2J8UF 4ORGA 3VXRA 1E6JL 5HPMA 4X99A 4P3WA 3LB6D 3E1F1 4G9FD 3VGFA 3R4DA 3SDAA 4NO2A 3GJFB 3INUL 1OB1B 4M9OA 1H8SA 5DTFB 4A6YL 2XQBH 4UOJA 5FYKL 1F00I 3O8XD 4X5LA 5ITFA 3G6DH 3RJQB 1YA5A 4EDWL 4U1MB 1K5NB 2QTEA 3BD3A 5DRNA 4PJEA 3C5SB 2GAZA 5CEXB 3WFCL 1JPTH 4JRXB 1Q9OA 4FFVC 3QXDA 1LQSR 4F7EB 2X4OA 1QRNE 4Y5YB 1EBPA 4XCNA 1JFQL 3MCKA 2APBA 3W11C 4KJYA 1NAML 2FWOA 5IW1B 2V2XB 4LSUL 4JVUA 3IDGA 4HPOL 4Y0GA 4LHUB 1RZFH 4P5MA 3FQUA 3BWAB 3GSXB 4WHDA 4U6XB 3U0TB 5JPMA 1F4XL 2FEEI 3GEWB 1KIQA 2C4FU 3PQYD 4GMSL 1UXWA 4O5LH 4OZFG 1DTUA 5DMGC 1C8PA 4Z7WF 1S7WA 2UVFA 5KJRH 3I6LD 5HVFB 1AGBA 1QLFA 3C6SA 3WXVL 1TTGA 1TPXB 1KGCD 1R5IB 5EOTA 4G8GD 2ATKB 4IRZL 1TVHB 3FAWA 4BELD 3BP4B 3GJFH 4ONOA 3RDTD 3VJ6A 5I6XB 5FUOL 3IF1B 1J8HB 3VFPB 2GUOB 5MERB 2P43B 4QNPE 5K59E 1NLBL 5HGBB 1YNKL 3NCBB 4LRNH 1NUDA 3PDOA 4FXGA 3WKNA 4ZFFB 4D2NA 2XY1A 2XWJB 5L8KB 1NGXB 1B4RA 4LGPB 4N0RA 2KPNA 4GH7B 4M03A 2Z8VC 1KG0B 3QWRA 2DTSA 5F7LB 5IB4B 4JRYA 4D9QD 3SBWA 5EOCH 4U1JA 3RU8H 4CNIB 3DJ9A 3ZHDA 4G6KH 1MHCA 3IU3B 4OF0A 2X7LB 3LPGA 2VRAA 3FFCA 4JFFE 1KCSL 3UTTA 3BEVB 4KKAC 1HZHH 4GG8B 1P7HL 3LQZB 4NZRL 5I76B 3LH2L 3EAKA 1IAII 3MJ8A 1KN2H 3QCUH 4M1CC 2VXSL 4OLUL 2EKSA 4OZGE 3UPRB 3BKYL 4G8FB 3PGCB 4QXTA 3H8NA 2ZUWA 3OXRA 4TNVK 1MLCA 4YDKH 4HGKC 5JXEC 2DQIL 3WN5B 2VWEC 2YOCA 5T3ZH 5HYQA 4HIEB 2FGZA 4XVSH 5D96C 1QUNA 3TCLA 4AT6B 3OAZK 3DXAD 3U2SA 3DO7B 3EYOA 3U4EA 3I9GL 3GBNH 2VLJD 1L0YA 3TWCH 4G80B 1SBSL 1MPAH 5C8JB 1IAIH 4YNYA 1C7TA 1MH5A 2AQ3A 4NUJA 5J89A 2GJZB 1YEGL 1JTTA 1IARB 5DVOA 5HY9B 3FT2A 4WU5A 4XMPH 4BQ8A 3V2AR 5J1AA 4K7PX 3TP4A 2VN7A 4MA7H 3OTTA 1EJOH 1QZ1A 5CCKL 1CFSB 1KBGH 3UTZB 3RQ3A 2IQAA 2I27N 1YYLH 3QFJD 3VFWB 1P84J 3KYNB 4LDLB 4C56D 8FABB 4NHCL 2OL3B 2JE8A 4DW2H 4OZFH 2ITCA 3HG1D 3HE7C 5BW7C 1NCWL 2EIEA 3PWPB 3P2TA 2PXYB 3CLFH 3TZVB 4TSAH 5DD1H 3MRQA 5CKAA 3RA7L 4KRPD 4M61B 3RU8L 2FZ3A 3HE6C 3WKMH 2CRMA 1UZ6F 5GGTH 2K9UA 1F5WA 2ZOLA 4DVBA 2EDOA 4UQ3A 3ARGB 5T3XL 3UBXI 1NDMB 2AV7B 5BXFA 3BD5A 2DQDH 1P9MA 1QSEB 3MLVH 3KPLA 3V5KA 4AL8H 4PJGB 5IGXL 3QB7C 4AEIH 3GI9H 4YIQB 4JN1L 1I1FB 1T1YB 1KN2L 2B39A 5DD1L 5GHWH 4CMHC 5K33A 1HXYA 4AH2B 3GSUA 3PWJB 1SY6L 5K9OB 1PG7H 2Q8AH 1Z9OA 2OSLB 2VZUA 5C6PB 1U8NB 4GKZA 1YYMH 2I24N 3R06A 3WS3A 2K7QA 2RFXB 2PTUA 4TRPL 4Y2DC 5IGXH 3WLWC 1PW3A 3JV6A 4HF5H 4PJGF 4UIKL 2R8SH 4ONHB 1ETZA 5JR1L 3MZTA 1YPZF 2BSSB 2LFGA 2F5AL 4Y4KD 2Z35B 1JV5B 2G75A 1E4KA 2VQ1A 4M7KL 3SDAD 3KPNB 5GISH 3VRJA 4I77L 2IFFL 3TPUB 1KPVB 1ZGLA 3DX8A 4M6AA 1A2YA 2BNRB 2JCCB 5C0BA 4YDIH 2J6EL 4R4BA 1RZ8B 2GEEA 3QH3A 4EUPB 4OFKA 2XV6B 2AKRB 2FJFB 4QRPD 3STLA 4F8QA 4LHQB 3HPJB 5E2JA 1RZJL 1DBBL 2P8PB 1KENH