5KANG

Crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21-1/1968 (h3n2) hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
231
Chain Sequence
QVQLAQSENELKKPGASVKVSCKTSGYTFTRFGMSWVRQAPGQGLEWMGWISGYTGDTKYARSFQGRLTLTTDTSTGTAYMELRSLRSDDTAIYYCVRNRVQMEVSPATQSTWYMDLWGRGTLVSVSSPSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin HA1
publication title Vaccine-Induced Antibodies that Neutralize Group 1 and Group 2 Influenza A Viruses.
pubmed doi rcsb
source organism Influenza a virus (strain a/hong kong/1/1968 h3n2)
total genus 41
structure length 231
sequence length 231
chains with identical sequence H, J
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kanG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kanG01
1PKQB 3JBG7 5FDWB 5E4EB 5ESAB 4KI5F 2BMKA 3QJHB 3X3FH 4BKLB 1H15A 4WWKB 4JHWH 3UTZB 4UQ2A 2HKFL 4LSTH 3KDMA 2C1PA 1R3HA 5HHQB 3B6SB 4JM2F 3DJ9A 3CAFA 4X6EB 3CVHH 1LP9E 2CIKA 1MCCA 3K4ZA 4QRPB 3MNWA 5HHXH 4WTXA 4PR5B 5F9OL 3O6KH 4NUGH 2YN5A 1I8MA 4HUVA 4ZO8A 5HYQA 1I3VA 2VLKD 1MUJB 5LCVH 1GHFL 4OKVB 2M26A 4L8CA 5JDSB 4MGXA 5KTEH 5CAYB 1LO5A 5E2WL 3JV5A 3LQAH 2EXYD 1JZ4A 5D96B 5FYLD 3JWOH 3NZHL 2PXYA 4OZIB 1X5GA 1EEZA 2FLBT 3SE3C 1QBLH 4LLYA 4XAWL 4G8IA 3P9MA 4MAYD 2MTPA 3QIWD 1AJ7H 3CFDA 4F7TB 1G6RA 4J4PA 1BZ7A 4W6WB 3QULB 4P23A 1MJJB 2VABB 5FHAL 3KR3L 4TYUA 2R2BB 3VXRD 1NC4A 4DGVL 3GJEA 5EUKB 4U6VL 3V2AR 2HH0H 4NKOB 2J8UE 1MY7A 2FJGB 1SY6L 2NY4B 3P73A 1JPTH 2X4RB 1OTUD 4EZMA 3O6LH 1RUKL 3TESA 1IKNA 4HKXA 1VACB 3V8CA 3MLVH 2A73B 1EMTL 2NX5B 4HBCH 1WAAF 4RDQG 3CFKB 5BXFB 2C7UA 1J0KA 2KKQA 3SGJA 2KBGA 5BRZE 3IDIB 1V7NL 4Y5XC 1FNHA 3PL6A 4KQ4H 1FNSL 1XGRA 3LRSB 1F4AA 4D9RE 4NWUL 5D4QA 3KLDA 4MA1B 4M7LH 1S7TB 1MQ8A 2JJTA 4QY8B 3LKSA 2X4SB 1BREA 3MRJB 5D2NE 3VGEA 4FTVD 3I6GB 5TFSL 3HR5A 3S36L 1ZA3A 1A4JB 2F5AH 3UTSB 4Z78B 1NKRA 3LOWA 4XNZB 1G7MA 4PJ9B 1C5CH 3L3IA 1XAUA 3HZMB 3QSKB 3MZGB 5ICZB 1OAQL 3LPGA 4OF6A 3TYGH 4P2OC 4FNLL 4HAFA 4TULL 5I1DA 4D9QE 2FL5A 3FO9A 3FRPA 2V9TA 2FSEB 5CJQH 4QOKB 5FUOL 3FQRB 4HZAA 1QLEH 3TT1H 2FBJL 1XF5A 1DBMH 3GSNA 3NCYP 3NAAL 3UEZA 3UJJH 5MEQB 2NTFB 3MC0A 4CN4A 3WFDL 3VXOA 1JGLH 4L4VA 1JPGB 4TSCL 4H20H 5KS9A 4J6RL 5CD3B 3L3KB 4LCCC 2FHFA 4RNRB 1NGXA 2KPNA 5EOTA 5CJ8A 4XP5H 5INCA 3BQUA 4N68A 4HIXL 4NOBA 1S7UB 2HVKB 4WWID 4Y19B 1A7PL 1OGTA 1PG7L 4JFOB 4U6HA 5GS0H 3FOMA 3UC0L 4W81A 1A6WH 4FXGA 1TETL 4ODXB 4JFDA 4XBGB 3RWCB 5HPMB 2HFEB 2YD9A 2BX5A 1T04A 3DMMA 4GT7A 2JK5B 4N1EA 4N1HB 2ERJC 5HDLA 3I9GL 1OGAA 1E4KC 4PTTB 4OFPA 4NYLA 1EBAA 5T1MA 4MNHA 2WBKA 3T0BA 4U1NB 4IOFC 1BQHB 4LVHB 4ODHL 4M8VA 1F4YL 4L3EA 2JCCE 3SN6N 4D0DB 4Z6AT 4UOJA 5J11C 3MMEA 1JPFB 3UP1A 1WCBB 4I1NB 2VO5A 4RWHA 1E27A 1JYXA 2NCMA 3GHEL 4XCFL 4K71C 1XGTA 3OHXA 2Z91A 4R90L 1MCRA 5IHZB 5JQHC 4O2EA 4WJ5B 2R4RL 3B9DA 4QXGH 1KN4H 5AZ2H 1VPOL 4BZ1L 1HCFX 1DBBL 1LO3H 1FVEB 3EGSA 4NFBA 4JDZA 4QF1B 2OR9H 1LD9A 1I7ZA 1BMGA 3BEVA 3IDJB 4KDVA 4LCIH 1DQML 3FT4A 4JKMA 4V2BA 3M45A 2GITB 1HWGB 35C8H 2VR9A 3VWKD 5HYJA 2CKBB 5HJ3B 2D0FA 4EVNA 4DUVA 3BWUC 4N0RA 4OQ1A 2OS7A 3DRTB 2HVJB 4L9LA 4OTXL 1QR1B 4R26H 4ZUTA 5ITFB 3HI1B 1KJ2L 2V7NB 3G6JE 3D9AH 3INUL 1GGBL 1FNEB 2XTLA 2I5YH 3GBLA 4JO1L 1HHGB 4XH2B 4FFWC 4I0PC 1QACA 1A7OL 4C83A 2VB5A 1Q1JH 4GKZA 2XTJB 1EZVX 4JRYD 2PO6C 3HNTL 3WN5B 3QUKA 4ETYA 4OZFG 4PRHA 1AR1D 5T3XD 2W0KA 4OI9A 4XP4H 5BO1H 3PWVA 3NIFF 4L29A 4JFQB 3L3GB 4P2YA 1A9EB 1UM6H 2P24A 1II4E 2VQTA 3NPZB 3QG7H 3BSZL 5TDOB 3T3PF 3SBWC 4BM7A 4U7SA 3V4UH 4OAWB 1SYVB 3SPVB 4PB0H 5CKAA 5D7IA 3RAJH 1JTTA 4KH2A 4XMKL 4F37F 5DMYA 3RWGB 3EDEA 2D2OA 4JM4L 3ECBB 2CR6A 2APWA 3VI3E 1UH2A 3D2UD 1KPRB 1WBZB 1UWEL 1D5IL 5IESH 4NDMB 2P8LA 4PLKD 2E9WA 3RWIA 4QRUB 5E0QA 1MCPL 3BDYH 4LNVA 4DTGL 5IQ9B 4O4YH 2PW1B 5C07E 2F54E 4JKWA 5DK0B 4WO4A 5DQ9B 3GSXA 1GGIH 1NCBL 4QRTA 3OAZH 5EIIB 1QSFA 4JFFD 4FMFA 3BN9D 4K7FA 4ZNEE 4PJXF 2IBBA 2UZIL 1BAFH 3V6BR 3E1F1 3MRPB 1LE5A 3SDAA 1OAUL 1OM3L 1P9MC 3B8SA 3QNXB 1OAYL 3NABH 4HIEB 2ICWB 3LN9A 4F7PB 4NKMB 2OZ4A 3SDCC 3RIFK 4D8PB 4OLXH 3ARGB 1ETZA 5CEZE 2BVYA 1TPXB 5EIQA 1EERB 3B5TA 4OUUA 5DJ0A 1PSKL 2CGRH 3B5HA 2WWMC 3IXAA 1UA6H 1BFVL 5LXGH 2VLRE 2C3XA 4WHTA 1DUZA 1DANU 2H26B 5DFVD 3PDGA 2Y7QB 3CUPB 2MCPL 2EE6A 3A67L 3RZCC 3U4AA 3VFWA 4BQ6A 4FZ8L 3HC3L 3VD5A 3PWNB 4LSUH 5I1CL 2F58L 3MFGB 3IS1X 5T5FL 5DJ2B 4K9EL 3WIFA 2JIXD 4LLVB 32C2B 5E8OB 3GHBH 4N0UA 4PRIE 2QADC 4H88H 4Z7WA 3QWRA 1CFNA 4YHOL 5J13C 4X7DC 1AKJD 2F19H 1D5ZB 3P30L 1AXSB 2BHZA 4CJ1A 3P2TA 1I9JL 2WZPD 1ZLWH 4RZCA 5IVXA 2YUXA 2QHLA 1CXFA 5CLTA 4M7JL 4OB5L 5D2LE 4JQVC 4LVEA 1TNMA 5KS9E 4JG1H 5GJTL 4HS3B 3D69A 4LKXA 5JLZA 1N8ZA 4P3CH 2PYEA 3WDJA 3RGVC 1S5IH 3DUUB 4HS8L 3KXFD 1G7JB 2WV3A 2OM5A 2VZ3A 4U6YB 1NBZB 2QL1A 5DRXB 1FNAA 3MRGA 4PB9H 2BNRD 1KCVL 3MRDB 4XNUL 1DLFH 2NY0B 1TJHL 1CLYL 4HFWA 5JXAH 5JW4N 3HE6B 4WY7L 2YMXH 3DGGB 1QRNB 4UT9H 2HT2D 2R0WH 4CRPA 4M4PA 4XVJL 2FLRT 4BELD 4IM8A 1JF5A 2KDGA 1SEBB 1FH5H 4RGOL 4Z18A 3EYUH 3LAFA 4HH9A 1JTOA 2NY7H 3BRFA 2W65B 4PRPD 5DVMA 5DRWB 1DBKL 3L5WA 4RWYL 2ENSA 3W11D 2YPLA 2ZUXA 5LBSH 2VXSL 2ED9A 4UNVA 4GOSA 3B3IB 3SDYH 5T3ZD 5D2NC 2XQBH 1YEHH 4ZUUB 5J12C 5FO8A 2G9HA 3BW9A 1NKOA 3KNBA 2DAVA 1S7VB 1G7IA 5SX5H 2XZQH 1N6QL 3R8QA 3GMMB 1XCQA 1CICB 2X1WL 3D18A 3LZFL 4YBLB 4JFXA 2ZCLL 5GRUH 4LP4A 2ZUWA 5A16A 4P46A 5IBTH 3O6FB 5E9DA 4PJAF 1W72B 5TQ0H 4IJ3C 1XR8A 3GMNA 4JQIH 5INDA 5DRZB 4NJ9L 3ZYIA 4I2XB 1D5MA 5C6TH 4Y8DC 2FIKB 4NN7C 1NCDL 1FBIH 4M03A 1J0HA 2BXYA 1TTGA 2IGFL 2VIRA 1WITA 1W8NA 3WEXA 2FBOJ 4MDJB 4LNRA 4DKAA 4K3DH 5LGHL 2EDDA 1UM4L 1EAPA 2DIJA 1F4XH 5HGHA 2BSTB 1SYSA 2DYPA 4I13B 1WC7B 3BMWA 1ZT1B 2YKLL 2XWJB 2NY5H 1WEJL 4JN2B 2D7MA 3RKPA 5F3HB 4CW1B 3SJVB 5I76A 1WWAX 4X99B 3BKCH 5I1GL 4DW2H 1RJZB 4QRQB 1GCFA 3MZTA 4PGBA 1IM9A 4HUWA 1NLBH 1FFRA 1F11A 3F12A 5JNYB 4MB3A 1IFHH 5MP6H 4Z95L 4PUBH 3QDGA 4BK5A 3HTLX 1WCQA 1P4BH 3MRKB 3NZ8A 2BY1A 1DP0A 3K1DA 2X7LB 3S35X 1DANT 4HK0A 1NSNH 4JPVH 4CVZA 4LASH 4HK3J 1T3FA 1T1YA 4OCLC 1GOGA 4AT6A 5D8JH 5D5ME 4KJPC 4P4RA 4PLOB 3QQNA 4L1HA 4XMPH 2OYPA 1KB5H 2WP3O 5C0GB 3MV8D 3K80A 3E2HC 4YDJA 2XPGB 3L1OL 4NPYB 2J5LB 3QIUD 4MJIB 3DX7A 4OZFA 2AQ2A 5LVEA 1T83A 4LCUB 4XP6H 1U3ZA 1FAKT 4QTHA 4KY1H 2DLGA 3OKEB 3ARBA 3T65A 1RK1B 1UB6B 4I18A 4FQ1H 3ARFB 5EZIH 2YWYA 3L3DB 3WXWL 5DQJA 5I1AB 2DLIA 3FN9A 1J0ZA 4MWFA 1YMMB 1F13A 4YHPA 1GGTA 3HI6L 3MODH 3C60B 4NO3A 3DVNA 3C8HA 3NPSB 1QBAA 1CF8H 2AJUH 2C3GA 3KPNB 1OARL 4L3AA 1UB5A 3EO9H 4X80L 3GMPB 5IR1B 1MREL 1CFQB 2WQ8A 5D1XC 4HV8A 1A5FL 1AE6L 4GQ9L 1KCUL 1A2YB 1NAKL 4OZHF 4PV8A 4DFIA 3OKNB 5A3IC 1XF3A 1F58H 1EJOL 1GAFH 1P5VA 4GRWB 2VE6B 1H3UA 1NCNA 4FQ2L 1A14L 4EN3B 5DURB 5JXEA 5DYOA 3B9KB 3W0WD 5CJXA 3CIQA 2VZTA 5IKCA 3QPQC 2BNQD 4GW1A 1FG9C 3VD3A 1MCJA 1QVOB 1QLFB 5DJYB 3SGEI 1PEZA 1KJ2A 3U30C 1R3KA 3JV4B 5A2JH 1AO7D 4KTDL 4DCQB 2FYYA 1WAAE 1KELH 1K2DA 3PABA 3QDJA 1QSVA 3VG9B 5KG9B 2MWCA 3IDMA 1WISA 2IANA 4L4TD 2CKBL 1EK3A 2E27H 1R5IB 5LAXA 2DQJL 5FOJA 5EUOE 3LKOA 3VXMB 2OLDA 4MHHG 1SJEB 2N56A 1A6PA 1ZHNA 3LQZA 2XY2A 1QPXA 3K0WA 3MJ7B 1LEKA 4P2RE 5AD0B 2P5WA 2AJSH 4IMLB 1GVIA 2MKLC 3FCTB 2DN7A 4L8SB 4C58B 3Q5YA 3F6LA 4QNPF 1QQDB 4LIQL 3CFCH 1IKNC 5EO0A 1UACL 1TZHA 1BQHG 2K1MA 4WFHD 1G7LA 3WD5L 3AGVA 3CPLB 5BVJB 3OR6B 3H3PL 3D3VD 4PLJD 4NNYA 1NFDB 3O2VH 3VFGH 5I8CA 2WWKO 4QXWA 3CXDL 3VFSB 2FX7H 3QIBA 2A0LC 1AGEB 1CG9B 4OCYL 4L4JA 3REWA 4ISVB 4CMHB 1L6ZA 3L5XH 5AWNH 4R7NA 5GS0D 1S9VA 2BSRB 2DI7A 4I5BB 4S1DC 3V4VH 3LQMA 3ZKND 4WI2A 1Z5LB 3AAZB 1T2QH 1RIHL 1L4IA 3DUHA 2OP4L 3GSRB 1HWHB 1RUML 1ZXQA 3QUXA 4YDLC 4LSVL 4GG6F 1KN2H 2YZ1A 2X89D 1FVCA 1RZFL 5ESQB 5FOBB 1Q8MA 5IFHL 3SDXF 3LKRB 1BVZA 1A1NB 1JGEA 4P2CG 1MCNA 5I30L 4PRBA 4CNIA 1L7IH 1BQLH 5DD3L 2BNUA 5DA4A 4IRJB 4GMTL 3VMPA 1I1AD 4C54A 4XPAL 3IVKB 1HI6B 1V7MH 3TBWA 1IGCH 5FAAA 5D1QC 5E6ZA 1IL1B 3EDKA 5C3LD 4RFEA 5MEOB 4MMZC 1J0YA 5E7FA 2WUCL 4K8RH 1EVUA 1XGUA 1DVFD 2AV7A 3BVNA 1YNKH 3VGBA 1B90A 4LEOB 4DFHA 4UBDC 4V1DA 2VDKH 5HYEA 5IF0A 1OW0A 1MI5D 5TE7H 2OJZH 2JELH 4NQEE 4M61B 4OM0H 3QAZC 1VGEL 5C0JB 5D7SH 2HFFB 5FDYA 2DICA 2DI9A 1KPVB 2DQGL 3ZO0A 4XX1G 3ZTNH 1PKQA 5M95B 4MD0B 1Q9LB 1IQDB 4AMKH 1U3JA 1I7UB 4K3JL 1L9MA 4Y5YC 3S36X 3PWUB 3QJHA 2FX9H 4M48L 4BKLA 4EI6B 4WWKA 4F8TA 1MJUH 3UTZA 3PJSA 3BKYL 5HHQA 3B6SA 3RVTC 2HJFB 3DMMC 1VCAA 3RP1A 3RVUD 3S34L 4X6EA 2HRPL 3DETC 1RURH 1KBGL 1FYTB 25C8H 4YQXH 4QRPA 4YAQB 3W5NA 4PR5A 3STLB 4R8WH 4I3SH 5ANME 3T8XB 3WJJC 2FX8L 2UY6A 4ZO6A 4WI4A 4MAUL 1MUJA 1WBYB 1Z9LA 1NUNB 4OKVA 4RBPH 3I02B 1YJDL 3ABZA 4HKZB 3MLTB 1NDMB 5JDSA 4K07A 5ID0B 3ALPA 1VEMA 4M6OL 4TTDC 4HWBL 12E8H 1L0YA 4OZIA 4NZUL 1CFVL 4PGZA 1IJ9A 4U1KB 2QQLH 3K2UL 3S5LB 3TBVB 2ESVB 4JZNA 3X11B 4PP2B 3JVGA 1NC2B 5GGVL 3UXFA 5EWIH 1T1WB 4F7TA 4R4FL 4P2QE 5E6IB 2IG2L 3QULA 4DUXA 3RVXC 1MJJA 2H32B 2VABA 4YXHL 3VJ6B 2R2BA 1J7VR 2XA8L 2D31B 5DHXB 5EUKA 1U9KA 3SOBH 3NIFE 5IWLC 1FQ9C 3K1KC 3RA7L 4NKOA 2GY5A 3BXNB 3NH7L 2FJGA 3BI9X 4PJIB 3HNVH 3C5ZD 1B0RB 1H3GA 3TN0D 2AABL 4X7SL 1JNNL 4BQ9A 1A7NH 3W9EB 1I9RL 2J8OA 3RJQB 3RHWF 2A73A 4APQC 3Q1SL 2NX5A 3SO3C 1YMHB 4M9PA 5F6IB 1YZZA 5JORB 1OSZB 4BK4A 3F8UB 1NEZB 4AY0A 2CK0L 1IBGL 2WSKA 3GNMH 5M94B 1LE9B 2AK4E 3GBNL 4XP9L 4RMUA 4WUUE 1S7TA 4QY8A 3VD7A 1QR4A 1UYWL 2X4SA 4RMRA 5IFJB 2AAVA 3P9WB 3MRJA 5EOCL 1RV6X 3I6GA 1A6UH 2CDEA 1W72L 4PJXE 3UTSA 3QXAB 3ZHDA 4Z78A 4DQOH 3S4SA 3SCMD 2XN9D 2X4UB 4LLQB 1DL7L 3WKNA 3HZMA 5ADPH 1QKZL 5ICZA 1G9NH 2FEDC 3T04D 3ZYZA 3FZUC 3MUGB 2P5ED 3LDBC 4NN6C 3RX8A 4AIZB 2EH8L 2IALB 4WVRA 1EX0A 4Y4HD 1IGMH 5ICXB 2J3SA 5GS1B 3CZJA 3OKDB 5C6WH 1S9KC 2FSEA 4LHUD 4QOKA 4A2LA 5E2TL 3FQRA 3P3YA 5E00A 1W8OA 4ZAKD 5DWUH 1VFAB 3BOVA 4B7IA 3AU1B 3O45B 1U2CA 2H1PH 4YZFF 5E8EB 3VXSD 1UWXK 5IG7B 1P7KA 5MEQA 2YN3A 1F42A 3RUGB 3C8DA 1MHPH 1OP3H 4NJAL 3C2AL 2O5ZL 2IAMB 5DHYB 1JPGA 4Q9CA 1HSAB 5CD3A 1A7QH 3L3KA 1X7QB 1W0YT 1KULA 4RNRA 3VFTA 3H0TA 2DIBA 5I8OL 2Z31D 4Q9RH 1INEL 1CR9H 4X83A 2Q20A 4K3EH 4J12A 2DBJA 1S7UA 2HVKA 4Y19A 2R4SL 5T1LB 4JFHD 3MXWL 5IBLD 2WMPA 4JFOA 2CJUL 5H8DA 1B6UA 1HK6A 4KRLB 2X70B 4Z0BH 1OY3B 2I60L 3RWHB 4ODXA 2QTEA 4XBGA 3RWCA 5HPMA 2HFEA 5J1TC 4M7ZB 2ARJQ 1T66D 2JK5A 4E41B 1TZGL 1RJLB 2E8ZA 4OD2B 3K2MC 2VAAB 3MV9D 4PV9B 4ZFFB 3WL9B 3VGGA 1F6FB 4NO0D 5ADOH 4FFVC 4PTTA 2OL3B 4MSWB 4U1NA 1BQHA 1XMWA 4Q6IB 4XWOD 3P4OB 5KVGH 1IM3B 1JPFA 3OJDB 1FFNB 4JJHA 3PWPE 2WK2A 2QSCL 2APFA 2R29H 1BWMA 4Z77B 5IHZA 3I3DA 1GPOL 2D7QA 4WJ5A 1BF8A 3AS1A 3PHQB 1TVHB 5FUZH 3ZSTA 3QDME 4O02L 1B0GB 2AW2A 1FVEA 1LVEA 4XBPB 1R24B 3BFOA 4QF1A 2V9RA 5L7XH 5F9AC 3VXUB 3IDJA 4XPFH 4LQFL 5EOCJ 3HMXH 3LS5H 4RGNB 2EYSB 3VFPB 4D0BA 1FLRH 2GITA 1ORQB 1KXVC 4X4ZA 3BE1H 2CKBA 1BM3L 3LMJH 4OF5A 5HJ3A 4Z7OF 5GZND 5C0RL 4PJCB 3O6MH 2V9QA 3DRTA 2HVJA 4X5XB 3RVVC 4JO4H 5ITFA 5CSZB 3HI1A 2C5DC 2V7NA 3GMRB 4HXBH 4NBZB 4ZD3H 3RWDB 1FNEA 1ND0A 5C0AB 4JANB 5D93C 2ZJSH 4DEPB 1FGNH 1U8HA 4POZD 4MA3B 2DMKA 2IFGA 3QI9B 3U4BH 3TNMB 2R56H 1I1YB 5FKAB 1IT9H 3ARDD 5D7JC 3WN5A 1PYWB 3CSBA 3PQYD 4N8CH 4HBQA 4FQXB 3T2QA 3GJFB 4BQBA 3A6CL 2Q8BL 2DLFL 1U93B 3GIZL 4JFQA 3L3GA 4NWTH 1A9EA 3QUYB 2XZAL 1MHCA 2NYYC 5E1HB 2NY3D 4NC0B 4ODTL 4W4NA 3CNKA 3EO1B 5TDOA 3O2WL 4QXTB 3GEWB 1U6AL 3EOBA 3SPVA 4PJ8A 3MCG1 2VC2H 4AYFA 2B0SH 2HKHH 4JZJC 3RWGA 2X1PA 4JY5H 4JFFA 2OQJB 4HIHB 4S0TD 1KPRA 1WBZA 4NDMA 4FQHB 4YO0B 1GH7A 4QRUA 3MCLL 3HNSH 5AUMB 5IQ9A 3NA9H 1T0PB 2W92A 5DK0A 5DQ9A 5CZVL 2WINB 5EIIA 1FFPB 1U3HC 3P40A 5B3JF 3WV0A 3TPKA 4FXKA 4NQDD 3MRPA 1I85A 2V5TA 4L8DA 4X8XA 3QNXA 3EFFB 4NC1E 4HIEA 2ICWA 5FGCB 1Z0MA 1N7ML 4PGJA 4F7PA 1T1ZB 4NKMA 4LSQL 4YWGL 1P7QD 1IQWL 4D8PA 3ARGA 3MFFB 1DQLH 1VFOA 5D70L 1FAIL 4XXCA 3UTOA 4XWGL 5AAMA 3UJIH 3S97C 1EFQA 2H26A 2CLVB 2Y7QA 3CLEH 1LK3L 3CUPA 5FGBA 4UV4H 1QNZH 1M71B 5I8KL 5ISZD 3VG0L 1NL0H 2XZCL 3EYQD 4Z7WF 2X4NB 3S96B 2NY6C 3PWNA 2YA1A 3KPMB 4QOKE 1FCGA 3DIFA 4LLVA 32C2A 3RL1A 3U79A 5E8OA 1CE1H 2DTMH 4OCRH 3ZLQC 3FKUS 4OFYD 4WI7A 4PP1D 1ZLSH 1OP9A 1AQKL 1P4LB 1AXSA 4PS4H 1RUQL 5GZOC 5LJYH 2P48B 3MTRA 3PP4L 1BZ9B 3MOAH 3SKJL 5IHUL 5GGTA 2XRAH 2DB8A 3CSPA 4MMXC 4HS3A 4LU5H 5DLMH 2QQQA 5L0QC 4J8RB 3ARBC 4OLZL 1IC4L 5HBBA 4TRPH 4M43H 4C56B 4WFFE 4LSPH 1A7BA 3HRPA 1G7JA 1OPGL 4X7FC 1MCWM 3LIZH 4U6YA 3REVB 1NBZA 2BFVH 5DRXA 5E2JA 3CMOL 3JSSA 3C6SB 3MRDA 3U7WL 1XCTB 1WZMA 3SGDI 3O2DH 3BDBA 4PJGF 1TQCC 3BJLA 4NHUB 3GFUA 4EXKA 1JZ2A 1EBPA 4YUEL 3DGGA 3Q6FB 1QRNA 1N5AB 1JHKH 2EH7L 4HFUH 4NN5B 3LS4L 4PFEA 2HMID 4KI5D 3KJ4C 5CIPH 1Z9OA 1GGCH 1SEBA 1MSPA 1MIEH 1S7RB 4JFEE 4U49A 4XVSL 3PNWB 3ZSSA 5K59F 3C08L 5I8EB 1OD9A 2FD6L 3O11B 3DV4B 5CUSH 5DRWA 2AI0L 2VZUA 5DXWA 4M93B 4I3GA 1C5BH 3TH4T 1MFBL 4TSAH 3B3IA 3UPAA 1HXYA 5C9JB 1RZKH 4HWEH 4ZUUA 2QQKH 3SKMB 1U8NB 1S78D 3ULUF 2Q6WB 1S7VA 2BOCA 5GSVB 4WCYH 3NCCB 3GMMA 4GRLB 4PJFA 2O26U 3QEGL 3MLZL 4N8PA 2NY1D 1DBJH 1QA9B 4Y4FC 5ENWA 3O6FA 3MRRB 3C87A 1W72A 4AM0B 5DZNA 4ODSL 4OCXH 4PPTA 2JB5H 5IBUB 2QHRH 1HINH 3B2VL 2DDQL 5I1KL 1UM5L 2EDBA 4I2XA 1QBMH 4OQTL 5F44A 2FIKA 4EI5B 3QEHB 1R3JB 2NPLX 1DQDH 4K8RD 2IBGA 1KYOK 3O4LA 2HT4C 4HWZB 2V5RA 4HUKB 4MDJA 5H37H 1U8KB 1JYVA 2A9MH 3D39D 2BSTA 1RUAL 2OR7A 4N5EC 3S5LG 1ZT1A 3BGMB 5HGAB 3G04B 4WV1C 3RI5F 2XWJA 3D6GA 4JN2A 1C12B 3QIBC 1JMXA 2DQIL 5TGBB 3IRZA 5F3HA 4CW1A 3SJVA 1KCRL 1S8DB 1D6EB 4X99A 4ZXBD 3E8UH 5IJKA 2SEBB 5IFAL 2VLMD 4GAYB 4XPGH 3FFCB 4QRQA 4PBVC 3GRWA 3HE7C 1JRHH 3CVIH 2MHAB 1CGXA 1H5BC 4YR6A 3W2DL 4MLSA 5L2JB 3C5JA 1OWRM 15C8L 4JLRB 1U8IB 5JNYA 1PD6A 5CLWA 2ZSVB 3PDOB 4RFOL 3MRKA 4XX1E 4IOSD 2X7LA 4G7VL 4DJMA 4TSBL 4ORGB 3H9HB 4IS6B 4LK4A 5BCAA 3IFNL 2DL2A 5FYKH 2VLLB 5IMKB 5EU7E 2X44D 4AK1A 5C0GA 2FNBA 5C0BE 2XPGA 3HMWL 2ZUTA 1EGJL 4NPYA 4UIKL 1V3MA 1OAXL 4S2SB 4MJIA 4HJ0C 1QSEB 4K9EC 3V5HB 2NXYC 4LCUA 1CLZL 4WUKL 4YDKH 3IAQA 2XQYG 1ZHLB 5MENE 3OKEA 1ZLUK 1RK1A 1UB6A 3ARFA 1OW0C 4YFLF 5J89A 3L3DA 1NMAL 4IOIB 1S9XB 3WSQH 1YMMA 3C60A 3X3GH 2OL3L 5E4EC 3KPNA 3QPXH 4Y0GA 5IR1A 3GMPA 3MRNB 3N1MC 3RZWA 4XTRC 1CFQA 1I1FB 1ZTXH 4WWKC 3OMZA 1MQKL 2HJLA 1X6NA 1A2YA 4BUHA 5J0BA 3QRGH 3OKNA 4OI7A 5C09D 4U1MB 4XC1L 3S88L 1UQSB 4G6FB 3B9KA 1IGFL 5JIKA 1ZA6B 4G6AC 5I1EL 3K8MA 1BVLB 3DLQR 4BFBD 3TBYB 4XPTH 1HEZB 1QVOA 1QLFA 5DJYA 3RIFF 4I48B 2BXZA 4O9HH 1X3DA 3JV4A 5HHOD 2N1KA 4DCQA 3EDJA 5KG9A 4S1RL 5GGRY 4ZMAT 3MRIB 1NLDL 1A6VH 3Q48A 4KWUA 3MA9L 3ZE1E 3TH3T 3JVGC 4S1SL 5BV7H 5I73C 3U1SL 4NRZB 1H3PH 1NPUA 3VXMA 2B2XH 4U7KA 2B1AH 1QOKA 1SJEA 4JREB 1A22B 4JPIB 5FECB 4MX7A 4Y5XB 3P0YH 4ZFOA 2FGWH 4KVCH 3MJ7A 4F9PC 4NHCL 1WGOA 5J1SC 4AL8H 3ISWA 5AD0A 3WBDA 4DGYH 4IMLA 1HCVA 1FL3B 3D3VA 2VL4A 5A2FA 1C1EH 5DMGC 4GAJH 4L8SA 4ZODA 2OSLB 1QQDA 5H2BA 4HS6A 2W59A 3GIVB 5F72S 3BX7C 4HZLB 3DX8B 3CPLA 4F9LA 4GSDL 2LABA 5BVJA 4QRRB 5SWQB 3OR6A 4OFVA 4P2OB 3MV7D 1NFDA 3VGAC 1D9KC 2V2WB 1R5VB 4I77H 1YN6B 2FECI 3D25B 4LAQL 4LHJB 3WNOA 4NC1C 5FYJH 3TO4C 1HXMB 5ILTH 4DN4L 1AGEA 1CK0L 3QQ3A 1CG9A 3N85H 4JN1L 4ISVA 3GUTB 4G9FD 1DFBH 2BSRA 4B50A 5CD5D 4I5BA 5FYLL 3RU8L 2J4WL 1ZT7B 3S8WA 1NGPL 4PJ9C 1Z5LA 3AAZA 4GXVH 5FM5M 1G6RH 3G08A 3PXJA 5KVEH 2W1NA 4R4NC 5C0NC 1JZ8A 1K5NB 1R5WB 2A9NL 5ESQA 5FOBA 1YEJH 3LKRA 4QHMB 3MBED 1A1NA 4M5YH 5J9PB 3GK8L 4FZEH 4WEBH 4KXZI 5KW9H 5L9DL 1XEDA 3DPBA 2IWGA 4IRJA 2JJUA 3QCVL 3IVKA 1N64H 1MI5A 1HI6A 3LN4B 5DMIL 3ZHLA 3DXAE 2RAMA 1N2RB 3GJFK 3X13B 4BSWB 1IL1A 5MEOA 4OLWH 2YR3A 4U33A 2YA2A 1FRGH 1XF1A 2LU4A 4LEOA 4RMTA 3JWDH 1JZ5A 4PJ5B 1FIGH 4RMQA 3QXUA 1W0WB 4Z7UF 4KRPC 5C0JA 1ORSA 2HFFA 1KEGL 1KPVA 4NKIH 2RFXA 4MD0A 1Q9LA 1IQDA 1ZHKB 1JBJA 1I7UA 3SE4A 4OT1L 4EI6A 3PWUA 4NP4L 1AGCB 3IFPA 4ZTOH 4UILL 4LCWE 4MJ6B 2B1HH 4MDIB 2HJFA 4UTAH 6FABH 4Y8AA 2NXZD 1G0DA 1FYTA 4WIQA 3IKCB 2LTQC 3F5WB 4IOFD 4E9LA 1SM3H 3HAEG 4I4WB 3T8XA 2IBZX 2VDOH 2VDMH 1A6TB 5HYSB 1WBYA 4Z7OE 1M05B 2Q3AA 4LVHC 3GSNH 4YFDB 2A2QT 3I02A 1A0QH 4HJJH 3MLTA 3T2PA 1NDMA 4IDJH 3U9PL 1QFWH 5ID0A 2AQ3A 3V9FA 4W6YB 3BMVA 1C5DB 4U1KA 4MJIE 4KVNL 3S5LA 1BWWA 2ESVA 3X11A 4PP2A 1NC2A 5I19H 1T1WA 5DZOA 5ID1B 1AIFB 4QT5B 3TNNA 3MXVL 5E6IA 3V6OA 5IQ7H 3VJ6A 1YYLL 2D7TL 4Y5VC 2D31A 4NCC2 1UJTA 3BXNA 1J8HB 4PJIA 1UZ8B 2R0KL 1B0RA 5DS8B 4HLJA 3KPQB 4FHBD 2VUOA 4N0FB 4ODWB 3NMEA 1GZPB 3W9EA 5FCUL 4I0PD 3UTQB 4Z7VB 1YMHA 1JF1B 1QFWM 4GRWE 1CGYA 5JORA 2PO6D 5JHDD 4JO2H 1OSZA 1EHXA 1NEZA 2L4OA 3MUHL 1FL6B 3B9VA 2JKXA 2BVOB 4ZS7L 2VXUL 3MJ9L 4OZGB 3NIGF 1LE9A 1FO0B 3NCJH 1K6QH 2P46B 3I50L 1NCWH 1Q9KB 4RRPG 5DD0H 5IFJA 1T20B 3MCKA 4IMKA 1T03H 1XF2B 5MI0B 5B3JE 1MCSA 3QXAA 3P11L 4NGHL 4ZAKA 4NT6B 2X4UA 4FP8L 4PJHB 3FN3A 3MUGA 2FB4H 3P4LA 4AIZA 4LRNL 3VDAA 2IALA 2BNQB 4G8GE 5ICXA 3U0PB 5GS1A 3GDBA 1JNLL 3OKDA 4X7EC 5EU6E 4OLUL 2GJ6E 1OLLA 3IJHB 2ARJB 1VFAA 2RGSA 3O45A 2R15A 4KZEL 1KFAH 5EU7C 4PJ7B 5IG7A 5D7LD 3L95B 3U46B 4WI6A 1Q72H 5TH2B 2YK1H 1I85C 2YRZA 2IAMA 3CSGA 5DHYA 2H2SC 3ULVL 3RZCB 1HSAA 3QFJA 4OGAD 2WNGA 1X7QA 4UT7H 1P4IL 1YQVH 2QEJA 3QXDB 3VFUB 3WNLA 1LP9B 2WWMD 4S11A 1JPSL 3ARGC 3FB6B 3OAYH 3QJFB 1TPXC 4H1LG 1EGJA 2CD0A 4CU6A 4JRXD 5B8CC 3EDFA 4XXCC 4KC3B 2QLVB 4OD3L 1N0XL 1CXLA 3RQ3A 2X70A 4IRZL 4OSUH 4KPHL 5IBUG 3TBTA 2FATH 5HHMD 1KXTB 5IT2H 2YA0A 4G6KL 5AG8A 3QHZH 3UJTL 2KUTA 1DZBA 4E41A 1RJLA 2YD2A 4OD2A 2VAAA 4PV9A 1CE6B 1ZLVK 4JJ5B 3WL9A 4ZFFA 4UAOB 1EFXB 1WBXB 1AFVL 2E7CA 4Y2OA 1M1SA 3R8BB 4WW2B 5D1ZC 2ZCHH 1CVRA 1YPZE 2QADD 5C2UB 4MSWA 3L7EA 3MYZA 5HHVL 1CDJA 3CSYB 8FABB 5EBMB 1Z2KA 2O5YL 3AS2A 4XCCH 1FP5A 2DIAA 3QFDB 2J8UB 3OJDA 1IKFL 1FFNA 2YD7A 4O2FA 1KCLA 3ZMRA 1MCDA 4ODUA 3DSNA 3D0VB 3C6LD 1HZHH 5ALBL 4ERSH 2F53D 1A7RH 3HG1E 3VXTB 1TVHA 3LEVL 5K59E 4JCMA 2WBJD 1DUYB 3RBGA 1KXQE 3MOBH 3RGVD 2VWEE 4XBPA 1R24A 1YJDC 1FDLH 2OZ4H 3CJJA 3BUYB 3VXUA 1S9WB 1LILA 3S6CA 1E6OL 2I9TB 1DE4B 2I24N 4MXWH 3OB8A 2X1OA 4PD4K 4WFEE 2EYSA 1VSCA 3VFPA 2VLJD 4JO3H 4NO2B 1ZGLB 1ORQA 3DURB 4NQCD 5EORL 5SWZD 2Z93B 3QNZB 4PJCA 2NY0C 4X5XA 5LG1A 2Q7YB 3WIHA 3HE6C 5HDBF 5CSZA 1MAML 1BJMA 2AXGA 3RWDA 1B4JH 5BRZD 5C0AA 2VXQL 3FB8B 4JANA 4OLVL 3H6JA 4ZQKB 1GGYA 5TPWH 4MA3A 3QI9A 3TNMA 2E7BA 3I2CH 1T0NB 4XGZA 1I1YA 5FKAA 4GBXD 5EOQL 4MNQE 3H9SD 1IEBB 1PYWA 1CL7H 2AQ1A 2R1YB 3FL7A 4FQXA 4NNPH 1EVTC 3GJFA 4P5MB 5IB1A 5C08E 1NCCL 1CGUA 1CLOH 1H8OA 1QFUH 4RAVB 1U93A 3P9LA 3QUYA 3OZ9H 1OAZL 4ENEC 1X5YA 4H25B 5FUCC 4KZDL 5F9OH 3IETA 4J2XA 5DJZA 1ZHBB 3EO1A 4QXTA 3JTSB 4MVBC 5L6YL 3QDHA 2EYRB 3HLAB 5C0CD 5CP7A 4HC1L 4U1JB 2DWEB 2BY3A 1CICC 4X6DF 4X7CC 2GCYB 1CN4A 3G5VB 1T2XA 5E2WH 3THMH 4HUXB 4HAGA 2OQJA 4HIHA 4WFGE 3STZB 3O6FC 4YX2L 1WTLA 4FQHA 4AQ1B 4UV7H 4YO0A 5FYKD 3WHE0 2J6EL 1MFDL 5AUMA 3P0VL 2Z8VC 3QEUB 5DC9B 5FHAH 1KPUB 3O0RL 1ITBB 2IQ9L 3MO1B 2WINA 3H7LA 1FFPA 3KYOB 4L5FL 1MOEA 3RDTD 2VKWA 3ELAT 3S37X 5IROC 2IMMA 3BUTA 1J87A 1RUKH 1BJ1J 1KJMB 1DTUA 1UGNA 3EFFA 4UTBL 3KPLB 4YHLH 1TXKA 4LLDB 4YBQD 1T1ZA 1GIGL 5GGRB 2DJUA 3CCHB 3IAGC 5BS0D 4OGXH 3KLHC 3MFFA 5CZXD 5AYUL 2DQHL 4GQPH 3WO4C 4OJFH 3EFDH 3QCTH 4RA3A 5T3ZL 4B53A 4NCDA 2CLVA 2C9AA 4U1HB 3OKYA 1X6LA 3MLSH 2F8XC 3E2HB 3ZZ1A 1M71A 2E9BA 4OCWL 5HYFA 3PHOB 3G6DL 4JR9L 4H8WL 5C7XL 5TFSH 2X4NA 3S96A 3QUZD 4O5LH 2PYFA 5DTFB 1P53A 4FQCH 1CXEA 5KSAC 3RVWC 1X5KA 3MR9B 4KJPD 4XHJD 3WJLC 5F96L 2PNDA 4FNLH 1T5XB 2HLFC 4PY7A 2VR5A 4TULH 2FHBA 3V0WH 2HFGL 3RUGE 3RY5A 1GRWA 1TJIL 1ULVA 5I1IH 1IAIL 2D03L 2H9GB 4KFZC 5D1XB 1M7XA 1BZ9A 4F7MB 5C3TA 3S37H 3ZE2E 1J86A 1G7QB 4RRPA 3G6JB 3OF6A 3L3OB 3OB0H 2X1XR 4J8RA 2ZUSA 4HHAB 3MUZ1 2ADFL 4Y2DB 3C9NB 3NAAH 4C56A 3REVA 3SE9L 5CEXB 4KMTH 5L7XL 1RAMA 3WFEL 3NPSC 5FF6B 1S3KH 1JTPA 2NZIA 4G6JH 5DJXB 1MEXL 1XCTA 3U30B 5IVZB 4YIQB 3X3FL 4S1QH 3PDDA 4K55A 3Q6FA 4CADB 1N5AA 5A2KH 4ZYKB 1X5XA 1KOAA 2GIYA 4OD1H 4G7YH 3CFJB 5KJRL 5HHXL 4EN3C 4CKVX 3O6KL 4NUGL 1S7RA 5F7KC 2FR4B 3PNWA 3IKKA 2H8PB 4FG6C 1RHFA 1EAJA 3U7YH 5I8EA 5GRJH 5FYJD 3ZKXB 2B7DT 3O11A 3DV4A 4CBPA 2FH8A 2E5EA 5KTEL 2Y23A 5DT1L 2PXYD 3LQAL 5SV3A 4PJFF 3VG9C 3JWOL 1U8NA 2FO4B 1OAKH 5DI8B 4BSVB 4OZFH 4GLRH 4J4PD 1QBLL 2Q6WA 1FYHB 2F54B 4P23D 3KYAA 1F3RB 2KH2B 3V6ZB 1NC4D 3MJ9A 1AJ7L 2E6PA 3W9DB 1BD2E 4GRLA 3A0OA 1WIPA 3HUJF 4BZ2H 3OKMB 1QFPA 3GHEH 4XCFH 1QA9A 2HH0L 3VU2A 3GKZA 3MRRA 4R90H 2EEDA 2HP4A 5GS2H 4AM0A 3WE6A 4M6MH 1FZMB 3T2NL 3OBAA 5D7KE 3RX7A 3O6LL 1VPOH 2IC2A 2AEPL 4XT1C 2ATKB 3PF2A 1YEFL 3MLVL 3SGKA 3QEHA 3KJ6H 1Z9SA 4LPUA 4HBCL 3Q3GB 5TE4H 1DQMH 2BK8A 3FO1B 1VKXB 1INDL 2ZCKL 3DO3A 2VLRB 1TITA 1M7IB 1U8KA 4ZOAA 5DC4B 3FAWA 3PL6D 2DRUA 2F5BH 1CDCA 3L3HB 3WCYA 4JCLA 4YDLB 1MCKA 4P4KC 4KQ4L 1TFHA 3B8YA 3F58H 4P3DB 4LEXH 3BGMA 4OTXH 5C71A 5HGAA 3G04A 3RPIB 3CH1B 3E0GA 1KJ2H 4M7LL 1C12A 1TTUA 3HC0B 1CDBA 5TGBA 4JG0L 4NM4L 1S8DA 2CSPA 3RNQB 2NZ9D 3WUWA 4CMHC 3QBTB 2F5AL 2SEBA 4GAYA 3ZKQD 3FFCA 2NTSP 3UAJC 1S7XB 4PRIB 2MHAA 1C5CL 1MLBA 4M02A 1G0XA 5L2JA 5JIHA 2AJVH 1MCWW 2VLKE 3DBXB 2WM0A 1U8IA 4JLRA 5D1QB 4ELMF 3TYGL 3GSQB 3RJDA 4CMMA 2ZSVA 2GHWB 3PDOA 5ICYB 3BAEL 3OGCB 2IH1B 4Z7UE 5KSBE 2EDKA 5IP4A 1LK2B 3RKDC 5D2LB 1JGVL 1EV2E 3CU1A 3H9HA 4ORGA 2QSQA 4LPTA 5FYLE 4ZSOA 4IS6A 3ESVF 4P5TC 1OTSC 1QD0A 4EIZC 2VLLA 5IMKA 5J7CC 4IRJC 2EE3A 1DBML 4OF7A 4BSJA 5EH1A 4Y1AB 1P1ZB 4JM4H 5F7DB 1EEYA 3UJJL 3O8XB 1CQYA 3VXRE 1UWEH 4PRDB 2HTLC 3LSOB 4L4VD 3W5MA 2JF1A 1QSEA 1JGLL 4DTGH 4NQVB 3V5HA 1JF6A 1ZHLA 1K8DB 3ZDXE 2VWEC 3BQUD 3CLFH 4XP5L 2EO9A 3NACH 4IOIA 2YRPA 2AXHA 4H5SB 3OXSB 1S9XA 1IC1A 5KVFL 2UZIH 3BT2H 1OAUH 5FXCH 4JFDD 5EU4B 2DMCA 4JVWA 3TVMB 3MRNA 5LWYH 3DMMD 1I1FA 1LDPL 3TCLB 3QYCA 3Q0HA 1T7WA 3N1QC 1OGAD 3HC4H 4HIIB 2AGJH 3SE3A 3MGOB 4LKCB 2CH8A 4U1MA 2RB8A 1PSKH 1UQSA 1XIWB 4FTVE 5F88B 1BFVH 3MRMB 3U36B 4L3ED 3O4OB 3G5XB 4KGJA 2IFFH 1WFUA 1ZA6A 3TBYA 5FA4B 4Q97A 2ZUQC 1HEZA 4I48A 1PAMA 2NY2B 3JUZA 1CD0A 4HG4K 5I1CH 4U2ZA 3T4AB 3U2SB 2F58H 1WJ3A 5GPRA 3MRIA 5A1AA 3RVXD 1TENA 5ETUB 1BQUA 4QXGL 2YD5A 1KN4L 5AZ2L 3D85A 2HWZH 3AROA 5J6HB 5E6IC 1LO3L 3QO0B 2X42A 5FECA 4JPIA 4PREB 1YQ2A 4Y5XA 2WIMA 4C56E 5C8JB 2QQNH 5HDOA 5HYJD 1KIUA 1C7TA 3D48R 3FHQA 4H0GA 1FL3A 2VQ1B 2YZ8A 2Z92B 35C8L 4OB5H 4YXKH 5HI5C 1RI8A 3DOSA 2G75B 2OSLA 4I3RH 2IADB 1HKLH 4R26L 2Z8WC 1CLCA 5GRWA 3GIVA 4HXAH 2I5YL 2HT3C 1FCCA 3DX8A 2ZNWA 4QRRA 2Y6SC 4B7LA 4P2OA 3LDBB 4PRHD 4NN6B 1LGVA 1HHIB 2V2WA 4RIRB 1CLYH 3ME0A 1YN6A 3D25A 5BO1L 1HXMA 1OB1B 3VRJA 4IMKC 4U6XB 4GKSA 4WI5A 1IEAB 3V4PH 3RNKB 3QG7L 4ZTPH 3NN8B 1TCMA 3EO0B 5D5MB 3FZUD 1ZT7A 1G1CA 1JPST 1KG0B 1UC6A 4JM2B 1K5NA 4W6XB 1R5WA 2F9BT 4TQEH 4GAFB 2DKMA 2VDQH 3STBA 3LKPB 4QHMA 5CMAA 5J9PA 1MCLA 5C2BH 2O5XL 4UIMA 3BDYL 1G84A 4WO4D 4Q9BA 4O4YL 3LZFH 1GL4B 4RAUB 2ZKHH 1QSFD 1T2JA 3LN4A 2ZCLH 3BHBB 3KLSA 1MWAB 3S3SA 3SDAD 1N2RA 1MFEH 1HH9B 2VOTA 3X13A 4BSWA 4I9WD 1BAFL 1RQ5A 3ARWA 2NY1B 5DD5H 3U0TB 4YHNA 1IZJA 2VISA 1HNFA 2IAMC 4NJ9H 3VMNA 3GM8A 2GY7B 4Z9KB 5E24E 4QRSB 4PJ5A 2GAZB 3ALWA 2IGFH 4OLXL 4XAKD 2XWBA 2CGRL 3FFCE 1UA6L 5LXGL 1YYMH 4R0LC 1ZHKA 5JTWA 4XCNB 4JRYE 4LOUC 5DEGB 4F33B 4QKXB 1TCRB 4MJ6A 1RUPH 4M7ZC 2YC1B 4FFVD 1U8OB 4MDIA 2A6DB 1EEUA 5DDHB 4C4KO 1L0XA 4KK9C 4RGMB 4Z5RB 2UVEA 3A6OA 3OPZH 4LSUL 1MF2L 3IKCA 1ZANH 4YFEA 3F5WA 4I4WA 3NFSH 1KGCD 5ERWB 5EUOB 4C57C 1VEOA 1RHHB 1A6TA 1PZ5B 3QWRD 5HYSA 1M05A 1BJ8A 2LAGB 3OG6B 4Q6IC 4KROB 1MAKA 4O00A 4LGSB 5HDBE 4P2RB 1PGRB 5JHLL 1ZAGA 1ACZA 2EE9A 1JJUA 3EHBC 4LBEB 1C5DA 4KJQC 4G43B 5EO9B 2PYED 5ID1A 1DQJB 4JG1L 1AIFA 4QT5A 2GJJA 1AH1A 4I0PA 4P3CL 1HIMH 3RWFA 4JY4B 2RJMA 5KANG 2R2CA 2PO6A 4BJLA 5JHDA 3MLXL 5D7JB 3P77B 2D3VA 4RGNC 1J8HA 4CJ0A 4UUJB 5L2KB 1UZ8A 4G8EA 4YPJA 1XT5A 2OTPA 5DS8A 1QUNA 1O7SA 4MQXC 4PB9L 3KPQA 4N0FA 4G42B 1E4XI 4ODWA 1DLFL 1GZPA 1HSBB 4XP1L 3NCYS 3CC5B 4PRAB 1WICA 5JXAL 4X6DE 2YMXL 1Q9WB 1LEGB 2MCG1 3UTQA 2R0WL 4RMWA 4Z7VA 3SBWA 5L8JB 1LO4H 3DUSB 5F3BB 2W0FA 4MNGA 4DKEH 5KAQG 4DEPC 4QEGA 1FL6A 1IC5H 4LF3B 1A3LL 1A6AB 1Q0XH 3QI9C 4JZJB 1FH5L 2BVOA 1OARH 3X12B 5D6CB 4OZGA 1FO0A 2YPLD 4XPHH 3BESR 4X9IA 4LHUG 4FQXC 4AH2B 4XI5C 1Q9KA 1NAKH 1T20A 1XF2A 4PTUB 3QUYC 2XQBL 4FQ2H 1YEHL 3NFNB 1K4CB 4LCYA 5JO5B 5K9KB 4CGTA 4NT6A 5KVDL 3QEQA 4U0RC 3JV0A 2XZQL 4HCRA 1UCBL 4F80A 4U3CA 3VH8B 1A1MB 2R2EB 5E6YA 4P46D 4TNVF 3K8LA 5E9DD 5GRUL 4WU5B 1MAJA 3U0PA 1YECH 2Q1EA 1P9MA 5IBTL 1P2CB 5J6GB 1S7SB 5TQ0L 3UTPD 2EXYC 3IJHA 4DKDC 2CKBH 4JQIL 1RVFH 2ARJA 3SDCA 2E6JA 1NCAL 4J3TA 5I16B 3ARRA 4NQEB 5DF0A 2NQCA 4MAYC 3NA4A 2DBLL 4CU8A 3QIWC 2P8PB 4PJ7A 1BOGB 3L95A 3U46A 5CSBA 2D4DA 1CT8B 5GJSL 1ZOXA 4IDLA 5TH2A 2DYPD 3KXFE 4K3DL 1DN0B 4IHOB 1P84J 3FRUB 1F4XL 3RZCA 2DQFB 2EDOA 3DVFA 4LRIA 4LIQH 2BNRE 3EOAB 2NY6B 1EO7A 3VFUA 1LP9A 4O58L 1MVUB 1QHOA 2A6KB 3DHMA 3QJFA 4G6MH 4YHIB 1IZKA 3KPRB 3HR6A 1IM9D 4DW2L 3H3PH 2H3NA 5TDNB 4UB0H 5BMFH 4LLMA 3HPLA 2GYSA 3CXDH 1NLBL 3QDGD 4BFEA 4N8VG 5CGTA 1MFCH 5AZEL 1AD9B 1H0DB 2BOBA 5GISL 4PRPE 3DARA 1U95B 1F3JB 3ZE0E 4PG2C 1CE6A 4JJ5A 4JQVA 1EFXA 1WBXA 5C86A 3RTQB 4BQCA 2W0PA 5T3ZE 4LVOC 3DV6B 4WW2A 4GMSH 4JPVL 2IPUG 2IPUK 3BZ4B 4G9FB 4LASL 4P2QB 4XVUD 1YY9D 1MPAH 3RGVA 5D8JL 1JHLH 4GO6B 1BFOB 3QFDA 2J8UA 5IFHH 3D0VA 4X6CF 1EA9C 3NBNA 1G6VK 2IH3B 4M1DL 4WTZG 3VXTA 2V6HA 1CIDA 3ARBD 2LE9A 5TQ2H 2CIIB 4XP6L 4KY1L 1CXKA 4FQ1L 2VAJA 1KIQB 3BUYA 3KJ4B 5EZIL 3VFMB 5GS2D 2I9TA 2KZWA 1DE4A 3X14B 3PV6B 2BDNH 4NO2A 1YC7A 2CLZB 3MODL 1DLHB 2AK4B 3O9WB 1ZGLA 3DURA 3AREB 1CF8L 2AJUL 1FN4B 4WUUB 4EQ3A 3EO9L 3QNZA 3FQUB 2GW5A 5D2NA 2Q7YA 4M7KL 1VA9A 2BVQB 3L5JA 5EBGA 4PJXB 4K2UH 5MHSD 4QXUL 1AC6A 1F58L 2VQUA 1GAFL 5TF0A 5JXED 4H26A 3UYRL 4ZQKA 2DQGH 2CRYA 4F3FB 1T0NA 3S35L 5I6XC 4K3JH 4Z7NF 1KENH 3KAAA 1IEBA 2EIBA 2BVTA 2R1YA 2A77L 5DJ6B 5DD1H 2E7MA 3F7YB 4TN9A 4P5MA 3QDJD 5LGJB 4RAVA 3QG6A 1KELL 2IAND 4EOWL 4HWNA 3JTSA 3NCBB 5GGTH 2FX8H 4M7LT 2EYRA 5I17B 2E27L 3HLAA 1GZQB 3IDNB 1MJ8L 2ZWLT 2DWEA 1ZWIB 2GCYA 4X9BA 4DOHE 3G5VA 1YA5A 2B5IB 4PGEB 1KCSH 2P5WD 5EZLB 4HUXA 3ILQD 2ICEB 4GAGL 3STZA 2EICA 3MV8E 1J1XL 4X98B 2AJSL 3ZKSD 2MPAL 4WV1B 3OXRB 1BVKB 4R4FH 3QEUA 1J88A 3T4YB 1I8LC 2QR0B 3VW3H 3CFEB 4ELME 3KPSB 4WU7A 3LV3A 1KPUA 2XA8H 3KWWB 4D3CL 3SGKC 4EI5C 3MO1A 3HE7B 3T08A 5DJDB 2E8YA 3KYOA 3B2UD 3I85A 4LFHG 2UWEF 4L8BA 2H41A 3CK0H 4XB7A 2Q3ZA 1PLGL 1XGPB 5EC1B 2RCSH 2YPVH 5DUBB 2UV3A 5GGVY 2QBWA 5I75B 1JNNH 1DJSA 1NGQL 3QIBD 1LEIB 1UWXH 1KJMA 3O2VL 3VFGL 4FQJH 1I9RH 1KUMA 3KPLA 3O81A 4LLUA 4Y88A 5DRNB 4PY8I 1R6VA 4XNMB 3EKCA 5GGRA 3OAUH 3Q1SH 3HPJB 5GQBA 1LO2L 4HGWB 3ILPA 1CGVA 1IILE 3R1GH 4IRSB 2WIIB 3ES6B 3L5XL 5AWNL 3D1MC 2J1KA 5HGGS 3BIBX 3SQOH 4JGUA 1IBGH 3GM0A 5B21A 3V4VL 1SJXA 3QUXD 3PGCA 3OKOB 4PJHE 2BY2A 4U1HA 2ICES 5E5MB 3ULVC 1T2QL 2EDLA 1EIBA 1RJCA 4HT1L 3PWPB 4XP9H 3W0WE 2Q87A 1XR9B 5HD8D 3PHOA 1UYWH 2BNQE 2CO6B 4X6FB 3WLWC 4PJBF 5D72L 3OAYK 5DTFA 1AO7E 1W72H 2NXYB 4ALAH 1LO0L 5IIEA 2HTKD 3QDMB 3MR9A 3UTTB 5IMMB 1A9BB 1L7IL 1BQLL 1QKZH 4L4TE 5GRVK 4A6YA 1I7TB 2CDGB 4RX4A 3FTGA 5ACLA 1T5XA 1RD6A 4PJ7E 1V7ML 2CUIA 1IGCL 5IB4B 3BGFC 1RZ8B 5JPMB 4QTIH 1TZIB 2H9GA 5D1XA 4F7MA 1BQSA 4V1DD 1G7QA 4PLKC 3G6JA 2GUOB 3L3OA 2C3WA 3KGRA 1AGDA 4HHAA 4Y2DA 4L9DA 3LEYH 3T2OA 5TE7L 2N7AA 3C9NA 1V5JA 2JELL 4PJAB 4OM0L 1REIA 1AHWB 3S3JA 5D7SL 1T7VA 2ZPKH 3T0AA 5CEXA 4WFHE 2X5PA 4BUGA 4XTRD 5JIPA 3GRWH 3C2AH 4WWKD 2O5ZH 5FF6A 1LNUB 3BN9C 5DJXA 1G9MH 5HPOA 2R1XB 1OHQA 1CDUA 2DS4A 5IVZA 4YIQA 4WW1B 2FX9L 4PJEF 2XA3A 1MJUL 2YXFA 1EO8H 2RIKA 5GS3A 2NMSA 1YN7B 4LSDA 4ZDHA 5I8OH 3KPPA 1INEH 1AC0A 4QRPD 5IGXH 2K3TA 1RURL 3SKUD 2L7JA 4KQ3L 25C8L 2AS5M 4YQXL 3CFJA 5F7LB 1JWMB 5I73B 5A2LH 4M1GH 3U83A 4R8WL 3PGDB 4I3SL 5HSFA 2CJUH 4OLYL 2FR4A 2H8PA 1YNLH 2XIDA 4F15C 3M1BB 4MA7H 5CS7A 1D5BA 4DVRH 1C08B 1T4KB 1X5FA 2Y4SA 12E8L 3KHOA 2FO4A 5DI8A 1MHEA 2QQLL 2ENYA 5C07A 1BFTA 2F54A 3V6ZA 5EWIL 2VXTH 4Q2ZA 3VGFA 1B9ZA 1ES0A 1BEYL 2Y06H 4JREC 4ZNEA 3LPWA 4YHML 1KT2B 1HQ4B 3OKMA 4U1GB 5I71B 1DEDA 2NY4D 1CDGA 1BX2B 3VGAB 1D9KB 1GPOH 3IRPX 3HNVL 4GFTB 4LDOB 2DQDH 2EC9U 3TO4B 1DBAL 1T22B 5IMLB 2X4PB 3IS0X 3IDXH 1A7NL 2ATKA 2NX5D 1INQB 4M9OA 4W4OA 1VADB 4LQFH 2Z0BA 3Q3GA 1VKXA 3FO1A 4GRWH 2VLRA 1RSFA 3V8OA 4KKLC 1M7IA 4O51B 3L3HA 5IM7B 2VLJB 1MVFA 1BM3H 3GNML 3TF7C 1IVLA 4P3DA 1B3JA 1ZT4B 3CH1A 3QP3A 2BRRL 5SWZB 3HC0A 4PRNB 1H8NA 4WTZA 2Q8AH 3UTSD 3RNQA 4PJ9D 1A6UL 5IHBA 3OKKB 3AS3A 4F7EB 3EYSH 3FO0H 4DQOL 1ZK9A 3KS0H 3HZVB 1S7XA 2AV1A 3P0GB 1E6JH 4NM8H 4OCNC 4PRIA 1UZ6E 5BZDB 3QNYB 5ADPL 1WLHA 1G9NL 3DBXA 5D1QA 3GSQA 4UDTB 3GBMH 3CX2A 4Q9QL 1CD9B 2DLFH 3O3AB 5ICYA 1Q9OB 4QOKD 3OGCA 3GIZH 2IH1A 2AXJA 3RL2A 1IGML 2XZAH 2WLYA 1LK2A 1ZKAA 5D2LA 5FEBA 4GW4B 2CK2A 2IF7A 3K4AA 2VDNH 4ZPVB 3VE0B 1KLFA 1U6AH 5DWUL 3GMOA 4M5ZH 4OFDA 1KIRB 4KRPB 4Y1AA 1U92B 1P1ZA 2IQAB 5F7DA 4H8WC 4MD5B 4UNUA 1SBSH 3O8XA 2X4QB 1RULH 4ORZC 4PRDA 3LSOA 4Y5YA 5JOEA 4M6NH 1X5JA 3VXQB 1K4DB 4PGCB 4Z7QE 1F4WH 4PG9B 1K8DA 1A7QL 3TYFB 3E6HB 3L7FA 2LTQB 5CZVH 3KYNB 3I6KB 2R0ZH 2Z35B 4Y19D 5FHBH 4Q9RL 1JWUB 3WJJA 1CR9L 4H5SA 5IEHB 3OXSA 4JFEB 4K3EL 3VH8G 1I1RA 2QSVA 1K3ZA 2VN4A 4ZFGH 4HIJB 5EU4A 3TVMA 5I18L 2OJEB 4Z0BL 4FQIL 3TCLA 3OB0K 3VGDA 1N7MH 1FZOB 1MHHB 4HIIA 7CGTA 4NCC1 3HRZB 3MGOA 4LKCA 3G5YB 3BZFB 5E8NA 5D70H 2IPKB 1XIWA 5ADOL 2FEEL 5F88A 4TNWK 4IBLT 4XWGH 3MRMA 3U36A 1CFBA 4Y5VB 3VWJB 5EB9A 3G5XA 1PDKA 3T3ME 3BZDA 2XN9E 5IWLA 2BZDA 3UMTA 5FA4A 5KVGL 4ZNCD 1Q0YH 2P5EE 5FM5O 5DUMH 1U8QB 2R29L 3U2SA 2B20A 3K3QA 4N9GB 4OFIA 5FUZL 4UI2A 4DKFL 5ETUA 4APQA 1E4WL 4GG6B 1AP2B 4AG4L 1RU9H 5J6HA 2KQMA 3G5ZB 3QO0A 4W70A 4PREA 5F8QC 3SDXB 3B9EA 4XPFL 1VGKB 5C8JA 1B2WL 1RZIB 3WDHA 3MYJB 4EBQH 3HMXL 5CINH 1VFMA 3VXSE 5C70A 1S5HB 1FLRL 3PP4H 3JWOC 5T5NF 2VQ1A 2Z92A 4NBYB 3UZEA 4OIIH 3QIUC 3EIFA 3N50A 1JZ6A 2G75A 3LEXB 2IADA 3O6ML 1MRFL 4JO4L 1IC4H 3CX5J 4HXBL 4X4ME 4KU1A 1OF2B 4Q0XL 2XTJD 3BPLC 2EIZB 1JE6A 4DVBB 2ZJSL 2EC9T 4GW5B 1B0WA 1GYAA 3O3DB 3BRGC 3U4BL 3CMOH 2R56L 4JFHE 2BERA 3TZVB 1WWWX 1HHIA 1H15B 4RIRA 4UQ2B 4F37K 2J7LA 5EC2B 1OP5K 3BN3B 3LS4H 4U6XA 3E3QE 4NWTL 1O5DT 5MI0C 1G7PB 1IEAA 1TQBB 2CDFB 1ACYL 3WNMA 3RNKA 4PJ8D 3NN8A 3MV9E 5SV4A 2DI8A 3VFVB 5D5MA 5HVHB 3VRLF 4N0YL 2FD6H 1NBQA 5DVNA 1KG0A 1IMHC 3Q5TA 5C0BB 4JM2A 2B0SL 1YDPB 1JGDB 1GC1H 1QEWB 1MFBH 4JY5L 5GXBB 4TPRL 3LKPA 1CQKA 1FG2B 3RGHA 4M00A 4KKBD 4YH6A 1QFOA 1WIUA 4MCZB 1MRDH 5MENB 3FMGH 3NGBC 3MLWH 3NA9L 3V52L 5J3HD 4RAUA 2RQ8A 2ZZUT 5HHPB 4P0DA 4X5WB 5B8CB 1IAKB 1MWAA 3MLZH 3UPRA 2H2PD 4FFYL 1HH9A 5EA0H 5J57B 5JA8B 1R0AL 2P49B 4EJ1C 4ODSH 2ID5A 2JTDA 2PW2B 3U0TA 5FO7B 5DK3A 3TA3B 4PJDF 1MCEA 3ARPA 4QYOB 2QJDA 4LRIC 5E2UH 3TV3H 3ARGD 2GAZA 2APVA 3MJ6A 5D1ZB 4X6CE 4NQUA 1NBVH 5CSGA 3LHPH 1ZLUH 2NR6D 4JHBA 1RUAH 4XCNA 3C09B 3CLEL 5DEGA 4F33A 4UV4L 1WAAA 4UOW1 1TCRA 3PQYE 2YC1A 1NL0L 1U8OA 2K9UA 5DDHA 4Z5RA 5KSUB 1ZA3B 2ZUUA 1WQVT 3JTTB 4UAOC 1NMBH 4JVUA 1QP1A 5ERWA 5BJTB 5EUOA 4WW2C 3BO8B 3W2DH 3L3JB 1PZ5A 4P49A 1X4XA 15C8H 1CE1L 2DTML 1UJ3C 7FABH 4Y1AE 4EDXB 4P2RA 1ZLSL 3PV7A 4RFOH 1O0VA 4G7VH 2Y9RT 4PS4L 2DQCH 4TSBH 2A6JB 4UDUB 3UZVB 3ZHKA 2FH6A 3V5KB 2P45B 4G43A 5JQ6H 2XRAL 3NIDF 3GSOB 2H45A 3NCEB 1XF5B 4Z8FH 4HJGB 4Z7NE 1CXIA 4LU5L 2YEZA 4KK5D 5DD6B 2BCKB 4NO5B 4ZPTB 3WFCH 4KHTH 1E4JA 4JY4A 4TRPL 1I1AC 2Q86B 1GXEA 1SY6A 4M43L 5JZ7D 4DZ8B 4LSPL 1J9CT 1EGJH 5D7JA 3KLAB 3P77A 3LIZL 4XC3L 4UUJA 5L2KA 2BFVL 1MCBA 3GB7B 4NQDE 3BPCB 1DVFC 1QRND 1HSBA 3O2DL 2ZNXA 3CC5A 4PRAA 5BQ7B 1LEGA 5EOTB 1JHKL 1OL0A 4HFUL 2F8VA 2QSTA 3DUSA 4TOYH 1V3JA 1OGTB 4LF3A 1GGCL 2AXFB 1A6AA 1MIEL 3TT3H 3AM8C 4JZJA 3VCLB 5BVPH 5E08L 3X12A 4R2GD 5D6CA 4K94H 5CUSL 2ADIA 1MQKH 4AH2A 1HYRC 1F2XK 3ZL4H 1KIPB 1Y6MR 2X05A 4YEFA 4PTUA 4TSAL 4XC1H 5ISZE 4MVBD 4QGTA 3MRHB 4QWWC 1RZKL 5DQDL 2QQKL 3NFNA 3RVUC 3TEUA 1K4CA 5JO5A 3LN5B 5K9KA 3TJEL 2XNAA 3IT8D 4XNQB 3HCVB 4WCYL 4HQQH 1U3HA 1KTLB 2J12B 4NKQB 2XY1A 3DXAB 4OV5B 1NANI 3VH8A 4KMLB 1A1MA 2R2EA 3O6FD 1X5AA 1EXUB 4WU5A 1LMKA 2WLZA 4S1RH 3U48A 1DBJL 3BP7B 1P2CA 5J6GA 1NLDH 1S7SA 2JB5L 3MA9H 1E0OB 4S1SH 3U1SH 3IXTB 1QBML 1JMZA 1CDIA 5I16A 4NQEA 2R69H 3WIHH 3PP3K 1PY4A 4JDZB 2PR4H 5CZKA 1E4XL 3O4LD 3WO4B 2P8PA 1DSFL 5HVFB 4LARH 3OR7B 1BOGA 1ZVYA 5IOPA 4X9GA 1CT8A 4DZBA 4PJBE 2WW8A 1O7VA 2KZ1B 1YUHB 2X9WA 1DN0A 4IHOA 4LCWB 3FRUA 5HI3D 3WNNA 5FV2A 1KV3A 2DQFA 2R2HB 1JZ3A 3C5ZC 3LKNB 3EOAA 4OM1H 3SJVD 3TN0C 5AYQA 3KLHD 3GJFH 3SE8H 4YK4B 1IGTB 3VXNB 5KSAB 1EHLH 2DLEA 4L3CB 1MVUA 2A6KA 1MFNA 5ANMA 2UVFA 4YHIA 4C59B 3P4NB 3KPRA 3BIKB 3TIDB 3FAXA 4KI5E 5DUPH 4NOFA 5TDNA 3TJHC 4OF3A 1RZJL 2P1YA 1BOYA 3HI5L 1AD9A 1H0DA 2EZ0C 4YLQT 3OL2A 1CK0H 4UU9A 1U95A 5ITBH 1RZGB 1F3JA 3CDYA 1PY9A 4PBWD 2PTUA 2Y5TB 3SGEH 2ZG1A 4XPBH 3DV6A 3RU8H 5IJVB 3BZ4A 1NGPH 3CFBB 4P2QA 2HLFD 5FYKL 3SCMC 4PJEE 1ZEAH 1BFOA 4GG8A 3NTCL 4MJID 1M6OA 2IH3A 3GK8H 1P7HL 1NJ9B 4Y4HC 3T0EB 1FC1A 3U0WH 3QUMB 4KK8D 2CIIA 5H94B 3ARFD 3S7GA 4OF8A 2ZUVA 4UQ3A 3QCVH 3SKOB 4WO4B 3VFMA 1YMMD 4Y2DC 1HHJB 4QRTB 3BEWB 3C60D 4C4KT 5DJAA 3DECA 3X14A 3WSQL 3PV6A 4P59H 5HDQH 2CLZA 3S98A 1DLHA 2AK4A 3QWOB 3X3GL 3AREA 2CPCA 1FN4A 4JKKA 4LSRH 3QHFL 4WUUA 3QPXL 4WRLA 2DM7A 4IIQB 3D39E 2DOCA 1ZTXL 3FQUA 4N5UA 2BVQA 3WNKA 4LMQE 3MBXH 4PJXA 2AJ3B 5DURD 1Z0NA 1X4YA 3B9KD 3HZKB 2GK0A 4FG6D 1PVHA 2Z31C 4F3FA 4JQXA 4WTWA 2VLME 2E7LC 4UILH 3ZKXC 1U8MA 5IBLC 3RIAK 2EKSB 5DJ6A 5E8DH 1WZ1H 4Y4FA 3F7YA 4G8GB 3SDDB 4O9HL 5LGJA 3LH2H 5EU6B 1H3XA 3LPFA 3T77B 2GJ6B 3NFPB 4KK6D 1T7XA 1YEEH 2AVGA 3JXAA 3H42H 5BW7C 4KKCD 3VXMD 1I9IH 4P48A 5BV7L 3IDNA 1H3PL 1ZWIA 3B43A 2B1AL 4YHKH 4XWOC 1BIHA 2ICEA 4AL8L 4P4KB 5L2KE 4DGYL 4K7PX 4RZCB 4TVPH 4X98A 4KVNH 5BOPA 1RZ7L 4WV1A 3OXRA 3SQBA 1HNGA 2V5YA 1V8HA 1FJ1B 5JPNB 2VTFA 4QHKJ 2QR0A 5JLZB 3KPSA 1F02I 3KWWA 3R0MA 4W4OC 4P3WA 2E6QA 1JNHB 5IK3A 1KLGB 3HE7A 5DJDA 3QZWG 5AAWA 1H5BA 4F57L 4KKNA 1XGPA 5EC1A 1GOFA 5DUBA 1HN1A 5F1NB 4N90D 5HVWA 1LEIA 2OK0H 2JCCF 5DRNA 5FCUH 2C3VB 5FYJL 4XNMA 3GMLB 3HPJA 5ILTL 5GZNC 4HGWA 3LCYA 4MZ3A 2YS4A 3M07A 3N85L 1JI2A 4P5TB 1W0VB 3UAJD 4IRSA 1YPZB 3ES6A 1FNFA 5C09E 2RHEA 1DFBL 5FGSA 5DR5H 4ZS7H 4PJGB 2VXUH 4ZUWB 1BIIB 3OKOA 5F7EH 3MJ9H 4POZC 5E5MA 4GXVL 4XNXL 1G6RL 4HUUB 4XXDB 3PWPA 4TUOB 5KVEL 1XR9A 4QO1A 3ARDC 2QV2A 3LD8B 1CGWA 3WUZA 4JEGB 4TUKH 4X6FA 3Q6GH 3HG1B 4N1CA 5HI4D 2EC8A 1OTSD 1YEJL 4NFDA 1HILB 5ESVB 5HHOE 4M5YL 3V7MA 3P11H 3QDMA 4FZEL 4R3SB 4IRJD 4GS7B 2AP2A 3WNPA 4K7PH 4WEBL 3UTTA 1A9BA 3T0DA 5KVMC 3DHJA 3F6IA 1I7TA 2HRLA 2CDGA 1ZLVH 4YE4H 4JFXB 1N64L 3IGAA 3WHXB 2LU7A 1RZ8A 5FDWA 3O8XC 5A16B 2OTWB 5JPMA 4ELKB 1UEYA 4OLUH 5ESAA 5B38B 3N9GH 4M3KB 1XR8B 1X44A 4KDWA 4K7PY 1MFAL 4F8QA 5CGMA 4DGIL 1FV1B 2UYLB 1D5MB 2APXA 3JWDL 2R9HC 4W68A 2UZXB 3T09A 1U58B 4YDIL 1FIGL 1A47A 1MCOL 4PJAA 3VMOA 5E99H 1AHWA 3KPRE 3QCUH 4MNQB 5HTSA 4NKIL 4HH8A 2ZUQB 4ONFH 1LNUA 3ULVH 2R1XA 2DYPB 4MLIA 5C08B 2XZZA 1FPTL 3TVMC 1N4XH 1P4IH 1YN7A 4ZUVB 5F7FA 1FYTD 4XNYL 5JOPD 4UTAL 6FABL 3VI3F 1JPSH 5I76B 1J05B 2Y72A 1NAMB 1JWMA 1XIWC 5F93C 5TF1H 3PGDA 5TDPB 4G9FE 5E2VL 4OD3H 5BOZG 4JKPH 1N0XH 2VDOL 3O4OC 1U8JB 2A38A 2YD8A 3GSNL 4F9PA 3M1BA 1FE8H 1A0QL 3HB3C 1B4RA 1QFWL 3NZ8B 2NY2C 3I6LD 1C08A 1T4KA 3T3PE 2X4RA 2ESVD 1NC2D 3EYQC 4HK0B 5BZWB 4Y4KB 1N3NB 1VACA 5E6ID 3EJZD 3U9UB 2BVPB 4RA0C 1PBYA 3CFKA 5BXFA 3F7VB 1IKFH 3RHWK 2BC4B 3IDIA 1KT2A 2WUBH 1HQ4A 3L5IA 4R97B 1BX2A 4Z0XB 5CBAB 1IARB 1D9KA 3CMGA 3LRSA 3MJ8B 4XZUB 1JK8B 4HKBB 5JR1L 3TO4A 1T22A 5IMLA 2X4PA 3VRLE 2W38A 3WYRA 1N5YH 3FQWB 1INQA 4I18B 1G1YA 1A4JA 4RISL 3VFNB 1VADA 5T1KB 3ARSA 1EPFA 2YD3A 2K7PA 3TO2B 4MWFB 4PJ9A 5F1IB 3MNZB 4JO2L 3EAKA 4NO3B 1D5XB 4O51A 5IM7A 3FRPG 5EORH 5KZCB 2APBA 3NCJL 1K6QL 1ZT4A 1F3DH 1MAMH 1NCWL 4PRNA 3GKWH 2MJWA 5DD0L 5SX4I 4JDVB 2V2TB 4QHNB 1T03L 2YUZA 5DGRA 3OKKA 4F7EA 5DEZA 3MRBB 1H3VA 3CU7A 3HZVA 4KI5C 5BZDA 3RY4A 5KS9F 1NFIB 3QNYA 2VITB 4M3JA 4PJDE 3QQ4B 2A6IB 4JM2C 1KB9K 2NTFA 4UDTA 3O3AA 5F7YC 4X4YB 1Q9OA 4CVUA 1AY1H 4LPWA 4GW4A 1U41A 5CJ5A 4ZPVA 3VE0A 3CXHK 5FYKU 4ZFZB 4P99A 1U42A 1LWRA 4HC1H 1NEUA 1KIRA 3MRLB 3KPSE 1T5WB 4HUMB 1FGVH 1U92A 2IQAA 1BGXH 1QYGH 4MD5A 3M8OH 3VFRB 4AEHL 2X4QA 4R0LB 1LEKB 2IAMD 4B41A 4UZGA 2VSDA 5F9DC 3CDCA 5ACMA 5LQBH 1Q72L 2E7HA 3QFJD 2YK1L 2NY1C 1QZ1A 3VXQA 1MFDH 1K4DA 4D9LH 3P0VH 4PG9A 3F7RA 3E6HA 3GI8H 3ZT6A 3KYNA 3I6KA 2Z35A 1IC7H 4U2YA 5IEHA 4JFEA 2APTA 3O3UN 3UROR 1Z3GH 4KMQA 3HZYB 1EHNA 1SMAA 5D6DA 4D0DA 4HIJA 4CL7A 1WCBA 4N9OB 4PIRF 3WHE1 2OJEA 1I9EA 4E41D 4KK9D 4YPGB 3WFBL 2FATL 3QHZL 1FZOA 1WVZA 1MHHA 3U6RB 3ROOB 3HRZA 3G5YA 1T0MB 1F8TH 4RGMC 5F97E 2EE2A 3V95A 3VD4A 2IPKA 3UDWC 4QHLB 4CUCA 3UO1L 1BBDH 3UTTE 2ZCHL 1BD2B 4ZXBC 3QUML 1YEIH 4Y5VA 3VWJA 1YEKH 3F7PC 3NCFB 5HVGB 5EBWB 5IB3B 1Y0LB 2CQVA 3QUXB 4OCWH 1SEQH 4OGYL 2F15A 4KROC 4XCCL 4H8WH 2AJYH 2EIDA 2WAHA 1U8QA 1HZHL 5C0DB 4XVTL 4Y16B 1K3IA 3PIQB 1QR1A 4U7MA 3MOBL 3VXUD 3NOIA 4GG6A 2VDRL 1HHGA 4HPOL 4XH2A 3G5ZA 1M4KA 1MNUH 1FDLL 4X9FA 2MFNA 1KF9B 4RGND 1NUDA 3SDXA 3ZKMC 5SWSB 1VGKA 4PJAE 1RZIA 5CHNB 3MYJA 4MXWL 1TJIH 5D7LE 4OCSL 5D7KD 4JO3L 4OUOA 1JNJA 1BLNB 3WIIH 5ALCH 3IDGB 5JW4R 5D7IF 1AI1L 1ODAA 3MRQB 2Y07H 3OJVC 2IJ0C 1J0JA 2BP3A 5C0AD 2CKNA 2FJHB 4KTYA 1B4JL 2KL6A 1OF2A 3QI9D 4WENB 3FJTA 2HFTA 4U0RB 4DVBA 4OAWA 1SYVA 4R6UA 4GW5A 4JPKH 5TPWL 4YHYB 3O3DA 4XHQA 3WFEH 2VLKB 3I2CL 1L7TH 2UZYB 2GSGB 4FQXD 1MEXH 3TZVA 1YEGH 4K23L 4XI5D 4JRXE 5D5MF 3ECBA 1CL7L 5FYJU 3LRGA 2DLHA 2GTWB 4NQSB 2DM2A 3PJSB 4NNPL 1DQTA 3IU3B 3QUYD 4Z7UB 5EG6C 5KSBB 2OBGA 5EC2A 4Y7MA 4LLAA 5HHME 1CLOL 1QFUL 3UZQA 1JGUH 5E4IA 1RJYB 2X9XA 3OZ9L 1G7PA 4PLNC 5KJRH 2CDFA 4YHZH 5CP3A 2PW1A 4UT6H 3VFVA 1IAIM 4MAYB 2A74B 1OTTD 3QIWB 1IAII 1FIEA 3HAEB 5EZJB 5C0BA 1YDPA 3VXRB 5IEKB 1JGDA 2CXKA 5DT1H 1QEWA 1D6VH 1IGYB 4FMKA 3THML 4U05A 1FG2A 1X4ZA 2VR4A 4MCZA 4UV7L 2W60B 2QKIB 4JZNB 5I15H 1GOHA 2F53E 5MENA 2R1WB 4BA8A 2VDPH 2W0LA 1G9NC 2X09A 2LVEA 5HHPA 2OI9B 2WANA 5KN5B 1TNNA 2Y5EA 4X5WA 5B8CA 1IAKA 2PUQT 4X0KB 1CBVL 3T1FB 3HS0B 5E8PB 3AVEA 5FO9B 4DAGL 2PW2A 3T2NH 5F89B 2VLJE 5FO7A 3SHSA 1FO0H 3TA3A 4RDQF 2AEPH 4NQCE 4QYOA 1AGBB 1LHZA 5T1DL 4YHLL 2JJSC 1ZMYA 1YEFH 4JHAL 5SWZE 3R4DA 1NGYB 2CLRB 3SGDH 4AQOA 2DQEH 4LVOB 3KYMB 1XGYH 4FTVB 5D1ZA 1INDH 5DJ2A 2ZCKH 4OGXL 2P47B 5KBNC 1IGJB 5IVXF 3IYLW 5EU3B 4OJFL 3EFDL 3QCTL 2DQTL 5CWSB 1C8PA 5EUOF 4OZHE 3MLSL 4HCRH 3BP5B 3S3PA 1D5ZA 3H9SE 4JG0H 4NM4H 4DK6A 5KSUA 3ULUL 4O5LL 2CDEB 2EDWA 3JTTA 4FQCL 2UY7A 2CMRL 4ZS6D 5DO2D 2O61B 3RTQC 3S4SB 5BJTA 3BO8A 4NZTH 2E9IA 4XBEH 3L3JA 1HQRB 5DJ8B 1MIMH 5CD5C 1VENA 3QH3B 4HWBA 3DUUA 5C0CE 5TJWK 4X8JB 4EDXA 1UT9A 3BAEH 4AZ8A 3X17A 5D9SB 3V0WL 3EJYD 1ERNA 2A6JA 4UDUA 1JGVH 5I1IL 5E00B 3V5KA 3OF6D 1DEEB 3HE6A 3S37L 4OIAA 3MBEC 5GRXG 4F2MB 2A1WL 3GSOA 5FYKE 4HJGA 2EDQA 5DD6A 4C56D 2BCKA 1JFQL 4NO5A 4ONOA 4ZPTA 1P7KB 2Q86A 4TVPD 5I6XB 4DZ8A 5C0FB 3KLAA 1NAML 2DD8H 2H6PB 2OXGA 4KMTL 3BYTA 3G6AB 4JKLA 5JW3H 2W65A 3O9WC 3GB7A 4QNPE 3AREC 1S3KL 4HX1B 2AEIT 4G6JL 2AEQH 3BPCA 3VXPB 4WHYH 5BQ7A 4YXLL 3VFTB 4S1QL 3H0TB 1T7YA 2ADGB 2XYCA 5KVFH 4OD1L 4X7TB 4G7YL 5BS0E 5HY9B 2AXFA 1CICA 3BP6B 3VCLA 4JQXC 5IB5B 4H1LB 3U7YL 5GRJL 5B38G 1J5OH 1LDPH 1TVBB 4G9DB 3VRIB 1KIPA 4KKAC 1UXSB 1BBJB 1RFDL 3MRHA 2HYMA 5DRZA 1OAKL 4UOW0 2NXZC 2EDHA 3LN5A 4HEPG 4GRLD 4XNQA 5A40E 4GG6E 1AXTL 3HCVA 4BQ8A 1KTLA 3K81A 5ELIA 3DXAA 4P5KB 4WDIB 4OV5A 2BHUA 2B5IC 3SDXE 5IROA 3IDYB 4KDTC 3MLYH 3WLBB 1EXUA 4BZ2L 3BP7A 4LDLB 4TNWF 1WC7A 4M6ML 3VWKB 5FA3B 4EI5D 3IXTA 4KUCD 2C4XA 1UKTA 3RI5K 1L9NA 3KJ6L 3HFML 3OR7A 1RJZA 1AXIB 4NIKB 5TE4L 1WV7T 4P9HL 4X4XB 4D0BB 1YUHA 3C5SB 2F5BL 4JRYB 4OCMC 5EZOL 4LCWA 4KUZH 1A1OB 5I75C 2R2HA 1MRCH 3MGTB 3F58L 3LKNA 4LEXL 4GKNB 4JFZH 1IGTA 1UENA 3VXNA 2ILLA 5KSAA 1ND0B 4L3CA 5CCKH 3FFCD 3WJLA 5F6HJ 3IFOB 3P4NA 4IRSC 1HYSD 3V79C 1U8HB 3BIKA 3TIDA 1PX3A 2E3VA 3ULVD 5FV1L 4ONHB 3ALXA 2CUMA 1ZGLM 4QHUB 2AJVL 3BGFB 3WLWD 5FYJE 5TE6L 5B4MC 3IFLH 2YUWA 3LVEA 1CIUA 1HH6B 1RZGA 4KJWD 3KHQA 3D2UB 1MHCB 2Y5TA 4XMLL 5C0EB 1RK0B 2XQYK 4LL9A 1A8JH 5IJVA 3TBSB 3CFBA 2VMFA 2NLJB 3V5DB 1G7HB 3EOBB 4PJ8B 2EXWC 1U91B 5I1AA 1BF2A 5LGKA 4BZYA 1CZ8H 3KYKL 3WXVH 4BH7B 4FFZH 3TWCL 1ZVSB 1OCWH 4JFFB 3MLUH 3IAPA 4N0CC 1QSED 1FFOB 1Y18B 1NJ9A 4KAQH 4HEME 2O5XH 3T0EA 1IGIH 5CJOH 3QUMA 1NGWB 4X6DB 1RPQA 5H94A 5CEYB 4JZOB 2UUDK 3SKOA 1KACB 2VE6A 5KSVB 3CLFL 3AS0A 4U6TA 4EN3A 1HHJA 3NACL 1CD8A 3BEWA 3DSFH 1AHWC 3EOTH 4F15B 4FXKB 4ONGH 3BT2L 2JE8A 3BKJH 3FN0H 3QWOA 2JJWA 5GRZA 4L8DB 1VFUA 2VZ1A 1ZE3C 1N0LA 4IIQA 5LWYL 4NNXB 5EO1B 2EDEA 5D71H 2XG5A 3KVQA 4ODBD 3HC4L 2AGJL 1YC8A 4OGAC 4G6FD 2AJ3A 2HLAB 3HA0A 4ZO9A 3HZKA 1U2HA 1R5IA 4MA8H 1FSKB 4DN3H 4DUWA 2ED8A 2FHCA 3GSWB 3I3BA 2JIXB 2XFXB 3IF1B 1EZVY 4A6YH 4RMSA 2IFFL 2YWZA 2R0LH 2EKSA 5JUEH 3OX8B 2PKDA 2V5SA 4G8GA 3SDDA 5F9JB 4NQXB 5EU6A 1AKJB 4R9HA 3U7AA 3T77A 2GJ6A 1A6ZB 3NFPA 1NMCB 1GSMA 1MF2H 3FCTA 1CU4H 3H3KA 4D2NA 1T21B 5ABDE 2A83B 3D85D 3DIFB 3RL1B 3WO3B 3GSUB 5DHVB 2HWZL 1D7FA 2YD4A 2I26N 5DK2B 4KXZH 4HULB 4S10A 4MQ7B 1XF4B 5JHLH 5KANI 3KXFB 2QQNL 4U1GC 5I71C 4P4KA 1RZKC 2MMXA 2VH5L 2V17H 2BNRB 3C6LC 4L4VE 5GGSB 3UX9B 4Q7DA 1DR9A 4YZFE 3VFSA 4EDWH 4YXKL 4AEIH 3CH8A 1FJ1A 5JPNA 4I3RL 1RIVH 1HKLL 1FNLA 2WBJC 3V6FB 4KKLD 5GHWH 1JNHA 4QRRD 1KLGA 4HXAL 2ZUYA 3MLXH 4P2OD 3WKMH 4MJ2A 3GSRA 1KC5H 4MXQC 5F1NA 4P9MH 4XP1H 4PRPB 4JFDE 2R8SH 4FQLL 2GK2A 2C3VA 3L5HA 4GRMB 3GMLA 3TCXA 1K9TA 3H9ZA 4HPYL 5JDJA 4P5TA 2CXGA 1OGAE 1W0VA 1YPZA