5KANG

Crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21-1/1968 (h3n2) hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
231
Chain Sequence
QVQLAQSENELKKPGASVKVSCKTSGYTFTRFGMSWVRQAPGQGLEWMGWISGYTGDTKYARSFQGRLTLTTDTSTGTAYMELRSLRSDDTAIYYCVRNRVQMEVSPATQSTWYMDLWGRGTLVSVSSPSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title Vaccine-Induced Antibodies that Neutralize Group 1 and Group 2 Influenza A Viruses.
pubmed doi rcsb
source organism Influenza a virus (strain a/hong kong/1/1968 h3n2)
molecule tags Immune system
total genus 41
structure length 231
sequence length 231
chains with identical sequence H, J
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kanG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kanG01
1LO4L 4NUGH 3RVWC 5D72H 4FQHB 3BISA 2UYLB 1XF4B 2VXTL 2ORBH 1Q72H 3D39E 1OB1B 2X1QA 5DC4B 2GCYA 3BT2L 1BIIB 3KPOA 4G8FA 3S7GA 3HMWL 5T1KB 1URLA 4WFFD 2NLJA 3QT2A 1WFTA 5DUBB 2NY2B 5TDNA 3H9SB 3GMNA 3UTSD 1PKQB 5AD0B 1S8DA 3D2UB 4LSSH 1CL7L 5I8OL 4X5XB 5MI0B 3BMWA 4PJXA 5HI4D 4NM4L 1KXTB 4PLJC 1CGSH 4EI6B 4GT7A 5K59E 3MMEA 5IEHA 3O11B 4PLOB 2VUOA 2AABL 4D0DB 3CFKB 4XVSL 4AEHL 1IGCH 1HI6A 3ARBB 4K23H 5HVWA 4PRPA 4ZYKB 2MWCA 2K1MA 4WU7B 5GRYA 4YXKH 3SE8H 2HT3D 5E6IC 3V6OC 3L7EA 4YHZH 2YA0A 3D48R 4BH8A 1IARB 1UM5L 4AG4L 1E6JL 2LU7A 3IJYA 2KQNA 3KXFA 2IFFL 2J6EL 5KSBB 2QTEA 1F4AA 1HINL 3QCVL 4WWKC 4MAYD 5ICXB 4NO5A 5DMKB 5DF0A 2I9TA 3F6IA 1JGVL 1AGCB 4F8QA 2NZIA 3QDJE 3HG1A 4RNRA 1S9KC 1PZ5A 5IV2A 1OGAE 4NQXA 1BBJA 3UPCA 4N8PA 1F6AB 3KYKH 1JPGB 1VFAA 1ODAA 1DLHA 2VLRA 4X6DB 4XB7A 1FZOA 4NQVA 4KV5F 2ZCHL 5DJ2B 2NY5H 1TXKA 3MJ6A 4ACPA 4F3FB 2GJZA 3FRUA 5H37G 3MUZ1 4YHLL 4M7KH 1RZGA 4KK9D 5T5FH 4QWWC 3WHXA 5F3BB 3MRHB 3UJTH 4HIEA 3AXLB 4ELMB 1AKJD 5E8OB 4KDVA 2R0ZL 5HYJB 1NL0L 1WJ3A 2ATPA 2V9RA 3VXUE 3UJIH 3ZHKA 4Q6YA 4BH7A 1YDPB 1I1FA 3K2UL 4HJJL 3DXAE 2IADA 3OXRB 1FFPA 1P84K 2AJ3A 4F33A 1CDIA 3VW3L 4Y5XA 2C7UB 4LPVA 2VQUA 4QTIL 1RIUL 4DKFH 4IRJB 4R8WH 1QLFB 4NUGL 5ANMB 3I9GH 1OQOA 5H37H 2Z91A 1UXWA 3IGAB 4NT6B 1A02N 4AIOA 4LRIC 1BQHA 1T21A 1M71A 1Q72L 3BAEH 4DUXA 2CUHA 4MDJA 2P24B 4GG6E 3E3QE 4K94H 4MA7H 3OXSA 1WZMA 3SKUD 5FKAB 3C08L 3AS3A 3QUMA 4TRPH 2B5IC 3SE3A 3TVMA 5EZLB 2DM4A 3BKYH 3WDJA 5E2WL 4NQSA 1GVIA 3MLZH 5ADOH 2HRPH 4NO3A 3PABA 4X9FA 3TNMB 3F12A 5L0QB 2VWEC 1K6QH 1CT8B 2YBRB 2BOBA 3C8KB 4DN4H 4OIAA 1JF6A 1G6RH 3MRBB 5A2LH 4MB4A 5BJTB 3L7FB 1FLRH 3MOAH 8CGTA 4K23L 5I17B 1P5VA 4UV7H 1KB5H 2QLVB 1DUYB 1JTTA 1E27B 3GMMA 1W2KT 4YXKL 4H0IA 3SE8L 1G1YA 4LCYA 4NNXA 3VU2A 3AS0A 4YHZL 1J1OH 4NQDB 5TPWH 1A7NL 1N59B 3ARRA 4N8VB 2VLJD 2FCBA 4H1LB 1KCUH 2V2TA 4JLRB 3BZ4B 4PJ5D 4ZTOH 2OQJA 4EIGB 1VADB 2B7DT 4JN2A 4A6YB 1RUMH 2FJFA 1YEHH 2WSKA 5EC1B 4P0DA 5E1AB 4L4TB 5HGAB 2Z4QB 4DUWA 3QDAA 5J1TC 2OLDA 4L8SA 1BFOA 3C6LB 2HLFC 3EYOA 3RY4A 2FRGP 3SGEI 3V6ZA 1XGRA 5IBUB 3P9LA 3V4PH 5D7IB 4PBXA 3WN5A 1RU9H 5F9JB 5KSBF 2XTJE 2A38A 5A40E 2VABB 4AEEA 4GG8B 4JQIH 2F15A 4MXQC 4GBXB 1NGPL 1ZVSB 5ID1B 3ALPA 4V1DD 3DIFB 1WT5A 4NO2B 2YOCA 3O2WH 4PG9B 4XPTH 3TN0A 3VRJA 4EIZC 4FTVA 2N7BA 4M7KL 5D93C 1RHHA 5C09B 2VLKD 3M17B 4LF3A 5DRNB 3GSVA 1YYMH 3UJTL 4YQXH 5IBLD 1ED3B 3FONB 3JXAA 1N5YL 3CH8A 5E94A 2FDBP 2CRIA 1U8HB 4U1HB 3SE4C 3ZDYF 4MNGB 3UJIL 4XNMB 1WZ1H 2DWDB 1QVOB 4HPOL 4X6DF 3NFSH 2HT3C 1CGXA 2DQEH 4DKAA 3SGJC 2ILLA 3U0WH 3IKCA 4IIQC 4JREC 4R8WL 1ONQA 4HH9A 1JUFB 1VACB 2OJZL 3QFJD 2QKIA 4J6RL 4PV9B 1DJSA 2VYRE 3QJHB 3BAEL 5IHZA 1RZKC 3T8XA 1QRNB 5T5NF 2LQRA 3MRKB 4K94L 1DN2A 2BCKB 4Y1AD 2VXQH 2F54D 3KYNB 4TRPL 3VXTA 1FO0L 2A0LD 2ID5A 3O6FD 3BKYL 4NWUH 5C08A 2IANE 5TE4L 3TO4C 2EDQA 1JN6B 3MLZL 5ADOL 1FYTE 2HRPL 2X7LA 2BJML 3EDJA 3WUWG 1K6QL 3MREB 4KK9C 4DN4L 3OX8B 5HI3D 5F7UA 1QHPA 5L2KE 3ULUD 2YD8A 3WFZA 1YEDB 1WBXB 3OWEA 1FLRL 1JPFA 1BFTA 5LJYH 3IJHA 5SX5K 2AV1A 2C4FU 3DVGB 4JFOB 1KB5L 3RY6A 1ZOXA 1I9RH 4QRUA 1BD2A 5KS9E 4GKSA 4KK6D 4NQCA 4UT6L 2P8PB 4Q9RH 1J1OL 2C1OB 4YGAB 4QNPE 3QUYB 2DYPB 4DEPB 1P4LB 1KCUL 5EBWB 4BFIA 1ZS8B 4XVUC 1UM4L 4Z7QE 2EIDA 4UIMB 3BD4A 3I75A 1IGYA 4GRLB 4ZTOL 1YN7A 3F7VA 3GSNH 2NPLX 4OUOA 4ZXBB 5J3HD 4LNRB 2Z8WC 5GGSB 1P7QB 3CDFA 2NXZD 4XAKE 5FA4B 3UC0L 3GFUA 4JM2A 5J11B 2GJJA 2ESVD 1OF2A 3BZFA 1Y6MR 2YD5A 1CLYL 4J23A 4MMZC 3QAZB 3BHBA 4UT7L 4NOBA 4L5FL 1VEOA 2CJUH 3RIAF 2OP4H 3Q3GA 1JMZA 1WIUA 3V4PL 4X7SL 1RU9L 4XI5D 3JUZA 1VDGA 3NFPA 3RUGB 3HNVL 1KCRH 4UUJA 4Q2ZB 2R9HC 5FYKL 3RL1A 4HEPG 4Y2DA 2NR6C 1WLHA 4WI4A 4YZFF 1YNKH 5EN2A 1S5HB 1WCQA 2Y6SD 1E4KA 4XPTL 4ZDHB 4Y5VB 4MNQA 4QLRA 5BZWB 2V9QA 4AK1A 3TYFA 2PO6B 5CEYB 4JFPA 5D70H 3EFDH 1RK1A 4YQXL 4JCMA 5J6HB 4LCIH 1PG7W 2GITA 5D8JH 4G8IB 2YMXH 1UKTA 3PGDA 4PRHB 5KSAD 1DVFD 5JOFB 1T66D 3HMXL 5TDPB 2B2XH 2EYTA 4C56E 2MKLC 4GAJH 3IXAA 2DQEL 5D7IF 1P9MC 4PFEA 3W0WD 4WI6A 3LDBB 3U0WL 2BVPA 1PD6A 3LKQB 1NEUA 4GXUN 3HC4H 5J1AA 4P4RA 4JRYE 4XBGA 1S7TB 3T0EC 4BJLA 1IGMH 5KW9H 4NN6C 2AEQH 3HZKB 1NFDB 1BWWA 4XCYB 3O8XA 4M93C 5EC2A 3U4BL 5IMKB 5I2IB 3Q5OA 4PR5A 4U1JB 2EO1A 4PRIE 3MGAA 4TOYH 2NX5E 4MNHA 2HMIC 3UXFA 1LO3H 4LLWA 3WHE1 3DSFH 3QQ3A 1BVLA 5CJ8A 1HH6A 4M6NH 3MV9E 4WFEE 3TA3B 2PXYD 5D7LA 1HHGA 3ZO0A 2FJGB 4Y4KD 3RGVB 1NEZA 3ARDB 1GOGA 3IFOB 4NWUL 1B0GA 3EYFB 3QEHA 4QTHB 5ACZA 1UJTA 1KIPB 3BD3A 5DVLA 2ADGA 2FO4A 3ES6A 2X40A 1G6RB 5EDXA 3N1QC 3CFCL 3HRZB 2ZNWA 3RWEB 1AC0A 3I2CH 3ISWA 1KB9J 3O4LD 5IBLC 4M5ZH 2O5XH 1KB5B 2DIJA 1ZLSH 2HH0H 4LAJH 3WIHA 4TYUA 2EIZB 4X6CF 3IU4H 4NQED 1J8HD 1PDKA 5L9DH 1I9RL 1RZJH 3BDXA 2IH3A 1SMAA 1GGYA 1R3KA 4Q9RL 1BOYA 4EBQL 4LLUB 1MCKA 3G6JE 3U9PH 4JHBA 3MCLH 1LQSR 3RI5F 3UO1H 2FEEL 4BSWA 5D1XD 5EULV 5HDBE 4X7CC 4RRPG 3T2QA 2VZOA 3MJ8B 4P57A 3GSNL 4YPJA 4U2YA 1VENA 2ZJSH 3UJJL 5FGRA 4PJBE 3MLUL 2FX9H 3F65A 1DQML 1P7KA 5JO5B 2H41A 3UTTA 1K4DB 3ZKND 3BPNB 5JIKA 3HFMH 4CNIA 1LO5B 5TE6H 3TCXA 5FGBA 1T83C 3KPSE 4HBCH 2MPAH 4D9RE 2A0LC 3O6FC 2OP4L 1BQUA 2CKBA 4RIRB 1F3DJ 5JW5B 4PJCF 4QRSA 3NAAH 3OKMB 5IGXH 5IB4A 3Q1SH 5EUKB 4Z0BL 2NZ9D 3QG6A 4AM0A 1BVKA 4XCEA 1U6AH 1CZ8L 5F3HB 1T1YB 1XIWB 4JY6A 5D70L 5HGHA 4JDZA 4Q6IA 2X44D 2QADD 5F7HA 5IG7A 1NC2A 1YMMA 4LCIL 5D8JL 3NA9L 2YMXL 5K9QI 3K8KA 1KJ2H 4HLJA 4OZHE 1MFCL 4KKAD 1KCVL 2YA1A 1BWMA 4ENED 3QXUA 4U05A 4RGMB 5DJDA 1OAYH 2B2XL 2VXUH 2VN7A 3VFPB 4BK5A 1I7ZA 3DX9B 3RUGF 3HC4L 3DGGA 4FQXC 1J88A 4KXZH 1N7ML 5HHPA 1IGML 1XGTB 1FVDB 5IF0A 1ZMYA 1S7WB 2Q76B 5IMLA 3DYMA 5J3HC 3MXWH 2NW3B 1R3LA 5FK9B 1UKSA 3QWRA 1M6OA 5HYQA 2G9HA 4PJ9A 1OCWL 4PLNC 2P5WB 1OSPL 3QZWA 3PQYA 1VGEH 3DSFL 2PTVA 3N50A 3C5ZD 4M6NL 4MD5A 1CN4A 2EKSB 4JO2H 4G6KH 4HIHA 5IVZB 1WC7B 1AP2A 4EOWH 4Y4FD 2ICWI 2I60H 2DL2A 1MVFA 2YN5A 4TTDC 5T1LD 3G5YA 3MPCA 3G5VB 3F7RA 2GTWB 2Y6SC 5IB2A 3K2MC 3ARGC 3FO2B 5FO7B 2Z8SA 5CP3A 3NCYP 3L3HA 3QFDA 4P23D 1S7VA 4UDUB 1JNLL 1S9XA 2YSSB 5C0DB 4OFYD 5CZVH 1NCTA 3MRIB 4FNLH 5JZ7D 1DVFC 3GJEA 4PGZA 4RX4A 5I1AA 5L9DL 2ITCB 3MV8B 2HWZH 2G5BA 1RIHH 1OSZA 3WUWB 5IP4A 4PGCA 4EN3D 3VXNA 3WJLC 4NNPL 1RUKL 5FYJE 4D2NA 1F4HA 1DZBA 3UO1L 3CSPA 3DGCR 3U0TB 4G3YH 2B4CL 4QHKI 5MEOA 4U6YB 5DVOA 3HAEA 4HWZA 5LBSH 3IAGC 1I7TA 5F89B 4HLZG 4GKOA 3RZCA 2D9CA 5E00A 4LCWA 4LNVA 3LD8B 3NH7H 3HFML 1B0RA 3WIIL 5LCVH 5TE6L 2XXCB 3VXMA 2PXYC 2XWTA 4HBCL 4TUJA 4Y4KC 1KGCD 5J6GB 3B43A 4KHTL 3L3GB 2DIAA 1BZQK 2HT2D 4L4VD 2I07B 4ZO7A 3EOBB 5GS2H 2Z35B 3NAAL 5IGXL 3JWOC 1I3RB 2MMXA 3KVQA 3KPRA 5I75B 4JPIA 4U1SB 1U6AL 4Y16D 3MNVB 5FIEA 1MRFL 1B2WH 2BNQA 1OTSD 2R2BB 3GSRB 4OZGA 4ELKB 2D7NA 5DHVH 3O3DA 3CXHJ 2VH5H 4JFHD 1G7LA 1CICA 1KJ2L 1CLZH 1CLCA 1PLGH 1OAYL 2VXUL 1ZHBB 5D9SA 4X9HA 3X14B 5FGCB 4GW1B 4PD4K 2FH6A 4Y5YB 3PWPA 3DV4B 1UEMA 1YPZE 2ZUVA 4R0LA 1A14H 4HKBB 4S1DD 1AO7A 2D7QA 3BXNA 4KTDL 3QDGD 2H32A 5ESAA 1CYGA 3MXWL 4MCZB 2XWBB 1RZ7H 2QJDA 3QXDB 4IOIA 4PUBH 1R3IH 4K07A 4XT1C 3SDYH 2XZAL 4QRRD 4KAQH 5CJBA 1VGEL 4EI5A 1W0WB 2XZZA 3DX7B 4RZCB 4H0GA 1X7QA 2Y5EA 3FTGB 4JO2L 4EOWL 2FNBA 3HNSH 3MFGB 2Q20A 1AD0A 3FJTA 4IHOB 1AJ7H 4F7TA 5GIRB 2F74A 5DRZB 5T3ZH 5IIEB 1YNTA 3T65A 2NZ9C 4J3TA 4KWUA 5HD8D 1YNLH 1KF9B 3MNWB 2QV2A 1DQQA 5C0GA 5F7LB 5DD0H 2XKSA 3SDCC 3MRMA 3HC0B 1OPGL 1QBBA 4JO3H 1RK0B 4WWID 3C60A 1KXQE 4H8WC 3D0VB 5SWQA 4GAYB 4LVOB 2CDEA 3V4VH 5BQ7B 4UDTB 1QBAA 4KK8C 3QIBB 4QHMB 4Q97A 1GCFA 5F9WB 2HWZL 5CD3B 1TJGH 2VXVH 1RIHL 1FYTB 3VFTA 3O9WB 3B5TA 3NCJL 2OX5A 4WW1A 1X5JA 4OTXL 3HE6A 4G3YL 4KJYA 1ADQH 4L9LA 4LEXH 1ZHLA 4GG6F 4M6AA 3VXSE 2X70B 2XQBL 3NH7L 4MJIB 5I74B 5IR1A 1I8KA 4QYOB 4G6AD 4OQ1A 2IPUK 5TGBA 5LCVL 3C5ZC 2YUZA 4YO0B 3OB0K 4P2RD 4TNWK 4YIQA 4PJIA 5LGJB 3UZEA 3CFDA 4RDQG 4PBVC 3MUHL 4S2SA 1A7QH 3FFCD 5F6HI 3BUYB 4FABL 4ZNEE 3BH9A 2IQ9H 4NRXA 4NSKB 1WUNT 3Q5TA 4I18B 4LBEA 4JCLA 1S7QA 5CEZE 3S4SA 3MV7B 2EDBA 4WUUD 3FQXB 5FYLH 2YK1H 3GSUA 5DDHA 4HUXB 1FNGB 4YDLB 2E27H 3R0NA 1CLZL 2YEZB 3QI9D 4ZO8A 1PLGL 3CFEB 3G5ZA 3AC0A 1E4WL 1WCBA 1A6TA 2BVOB 1FG2B 3SE3C 1FRGH 4EN3C 1JYXA 1EHXA 1TZGL 5SX5H 1WFOA 3TVMC 4NC1E 2P5EE 4W4OA 1MHPH 3TO2A 2R2EA 2XPGB 4JFEE 3RWCA 4LEOA 5CUSH 3QXAA 2GJ6E 3WS6A 1PY4A 2R2HB 4UAOB 5C07E 5JA9A 1IJ9A 3WS3B 4F9LC 1C08A 4PUBL 2AS5M 3O2DH 1N6UA 4UQ3A 4YAQB 5IW1A 1V7MH 4Y8DC 2R4SL 5DJXA 2APFA 5C86A 1EO8L 3B6SB 2NY1B 2CDGB 2XFXA 4F9PA 5I73B 1IQWH 4HT1H 1BJ8A 1A1NB 4OF5A 4U1MA 4I0PD 3EO0A 5EFIA 2Z93A 5HPOA 2DQFA 4APQB 2Q86B 1W8OA 5F6IB 4G5ZL 3U82B 3ALXA 2OK0H 3HNSL 5D96B 5E5MB 1AJ7L 5FDWA 5GQBA 5IVNA 1NFIA 3JWDC 1BM3H 2DQIL 4MZ3A 5KN5B 2NTFB 3SGEH 1NCDH 4ZPTB 4ZAKB 5DD0L 3DRQA 4IRSD 3U46B 1KG0B 1XR9B 3CJJA 2CKNA 4CW1B 1NDGA 5FHAH 3ROLB 3GNMH 2QQQA 1GGTA 1ITCA 1A6UH 4I1NB 4LASH 2AP2A 3O2VH 1T7VA 3HI1B 5DJCB 1MWAB 2VLLB 1KC5H 2VXVL 4I2XB 3VGHA 1NDMA 4S1DC 2XICA 3O6LH 5KAQF 3CAFA 2NY6D 5EBLA 3VXQA 1J0YA 4Q58C 5KZCD 5E56A 4LEXL 3QRGL 4JR9H 2AK4B 1WT5C 3TN0C 5DMIH 4QHUB 4XNQA 3VWKD 4DTGH 1YJDC 4ODHH 3FQTA 3FB7B 5J57B 2DQCL 1B88A 3D3VD 1A6PA 3WEXB 4JKMA 1JZ2A 5I6XB 2IAMB 4TPRH 1H3WM 3PV6A 1KLGB 4PJDE 5IFJA 1WWWX 1NBQA 5LWYH 5GSRA 3B5HA 3LRGA 1MAJA 2E7BA 2L4OA 3GMOB 4G43A 2IQ9L 2YRZA 2E3VA 2AJVH 3PWVA 3I84A 1NGWA 2NW2A 5FYLL 4Z7NE 1B4JH 3JV6B 2YK1L 1CDHA 3QNXA 5DLMH 5B22A 3RVTD 3BP4B 4OUUA 1XF2A 2E27L 4KRPD 3I6GA 1ZVYA 1ZT7A 2G75A 3GBLA 4FQ2H 5FOBA 3S96A 5IW6B 5HVHB 4M48L 2QQLH 1ZGLA 4F57H 1S7XA 4Z7QF 3QIUA 3WCYA 1FRGL 5E9DA 4OKVA 5EWIL 2HFEB 2LTQB 3S3JA 1AHWA 1SEBA 4X4XB 4OD3H 4EUPA 1A1OB 3S98A 3V8CA 5DR5H 4GW4A 1IL1B 2B8OT 3K3QA 1A9BA 1MH5B 3PL6A 3L3IA 1QSFD 4PGDB 4G6AC 3ORJA 4K9EC 1HYSC 2V17H 4JDVB 1SYSA 1IQWL 2GTZA 3PXJA 1IQDB 1FL5A 2CKBL 1AIFA 1OHQA 3V95A 4Z78A 3CUPA 3R8QA 3TWCH 1RZKH 2OK0L 5GGRY 1Q1JL 4M7ZC 4W6WB 2IC2A 3RPKA 1RJYA 4U1NB 1PVHA 1C12A 1XZ0A 1I1AA 3CC5B 4OQTH 3FQNA 2CR6A 1HILB 1NCDL 1T0NB 5IVOA 2A73B 3RTQA 4XCNB 3HZMA 5BVJA 1RFDH 5HHOD 3G5XB 1IZJA 1QOKA 3GMQB 5FHAL 3JWNC 2BSRB 5C0AB 2A9NH 3GNML 1G9NC 2J8UE 1A21A 5TH2B 2GEEA 4FHBD 3RWFB 1YN6A 3QI9C 4JM2C 1A6UL 3WNOA 3KLDA 4LASL 5A3ID 3O2VL 3HUJB 4Z18A 8FABB 5E6IB 4EDXB 1L0YA 1HSAB 4TSAH 1CE1H 1OTTD 4J8RA 4FFVD 1KIRB 4WWKB 1JNNL 3UBXI 2OL3A 5DMIL 4F80A 4Z5RB 3S35X 5D1XA 3GEWB 1HN1A 4WW2C 1JPTH 2VMFA 4I0PC 3Q6FA 4TPRL 4LVNC 4U0RC 3I6LE 1CQYA 1NBZA 3QULB 2BNRD 3RA7H 4IOFC 1MUJA 2FGWH 5GZND 2HJKB 5C0BD 3H9HB 1Y18A 5FO8B 1IZKA 2EYSA 1T0MA 3ZHLA 5SWSA 5KVEH 2AJVL 1KPUA 4KI5E 5GZOC 3B9AA 5F88A 5FHBL 3QEQA 5CMAA 1MY7A 1MEXH 4HXAH 3NIGE 1B4JL 2WZPD 5I1KH 4LQFH 3P4NB 2Q1EA 2XTLA 3KS0H 4X80L 4YHPB 1NLBH 5BVPH 4NWTL 5FYKE 4YXLH 5F1IB 1A7OH 1FNHA 2DQDH 4FQ2L 5HGGS 1FZJA 3V7AG 5K9KB 5I8CB 3G6JF 4LGRB 4S1RL 3EUUA 3RWGA 2QQLL 4JEGB 1Q9WA 5HDBF 5IB5B 1M7IA 5BRZA 1EFXB 4OLXH 1YUHA 4HJGB 3N1PC 4WDIB 5ALCH 3MUGB 1ETZB 3PWUB 4LHJB 2JK5A 12E8H 4PJBF 5ALBH 3CFJA 1TCRB 1IM9B 4PGBA 2R8SH 1ORQA 2BC4A 2YKLH 5ESVA 1F4WH 1UA6H 3BW9B 4S10A 2WLZA 1U3YA 3STLA 3VWKC 1IM3A 3B3IA 4LLQA 1QBLH 3VRLE 4BQCA 2WBJA 4X6BB 4NBXB 5K9QG 2B5IB 1W72A 3FCTA 1YPZB 4YDIH 5HJ3A 1FORL 3VE0A 4JJ5A 3TCLA 2NY0C 2EDFA 3V52L 5C0CA 1V3JA 2O93L 4K3DL 2PYEB 2XRAH 4OQTL 3FT2A 4ODWA 5DD6B 5DUML 3MJ7B 5HPMB 1WAAA 5EU4A 4YEEA 4X6FA 4U31A 1PGRB 1SQ2N 4OZHF 2A9NL 1A4KB 4FQJH 5GGTH 3LN5A 4ZQKA 5I18H 1EAPB 3D0LB 4JRXD 1VFUA 4FQCH 5JDSB 2EEAA 4PJ8D 1U8IA 3DARA 1BEYH 4HXBH 1IEHA 1RZIA 2H45A 1EVTC 4B53A 5E8EB 1GGCH 4NZRH 4OCXH 4KZDH 5C2BH 3E0GA 4NYLA 3T1WA 1CE1L 4WUKH 2GSIA 2H2PD 2YD6A 1JHLH 2P44B 3B2UC 2R1YA 4ZFOA 1MJJA 3G9VA 4Y0GA 4X7TA 5GSVB 1MVUB 2VDRH 3ARUA 3MUY1 4ZSOE 5FKPA 3L5WA 4JZNA 1E6OH 4LMQI 4WFGD 4HGMA 4YE4H 1JPTL 4PRDA 5EORH 5I71C 2ZUXA 4OFPA 4PJHB 1T80A 3D6GA 3HUJF 1UACH 3TH2T 1JV5B 3RA7L 3UTSB 2DQJH 2FGWL 2PW1B 3DMMD 3P9MA 3P11H 4OFIA 1KPRA 5JXED 1U3HC 3VFRB 1MLCA 5KVEL 2CLRB 1GHFL 3A6CL 2ICEB 1TZIB 4JGJA 5GRWA 5HDQH 3SDAA 1GC1C 2AJXL 4HXAL 4F37K 4Q9CA 2FYYB 3BIAX 5D93B 4LQFL 3R1GH 5I1KL 4L4VA 3WLWC 4N0UB 5BVPL 3QCTH 5EU6D 3WV0A 4WHTB 3NZ8A 4PJXE 4RAVA 4ODUA 4YXLL 1A7OL 3NN8A 2DQDL 5DI8B 3ULUH 5A3IC 1FNSH 4B50A 2EE3A 3HN3A 4LKXA 2X1PA 5DMYA 1NAMH 3IDUA 4UIKH 1F58H 1JGLH 4G8GE 1EV2E 1RZ8B 4OLXL 4PRPE 4XWGH 5CHNB 4Z77B 5KSVA 5ALBL 2OI9C 5HY9B 1EJOH 4IIQB 2ARJB 4JREB 4MCYA 1Q0XH 3MLRH 3M07A 4GH7B 1K9TA 4XC3H 5ECJE 5FUZH 3IKKA 4HC1A 4NPYB 1I8MB 1U92A 3KXFE 3UTOA 4RFOH 1QBLL 1KTLB 1N8ZA 1RJLA 4DFHA 1TVDA 5DQJB 1MHCA 4HIIB 3GBNL 3HG1E 1TTFA 1OL0A 3LS5L 4KUCF 1U8MA 2F53D 2AI0H 1U58A 1V5JA 2DWEA 4EUPG 4L3EA 4LKCB 2VDOH 2GK0B 2JF1A 3MFFA 3TO4B 3UTQA 4CU6A 3KNBB 1WEJH 3WFHB 3TPUA 2XRAL 2VLRE 5ID0A 4E41D 4KTYA 3GSWA 3QQ9D 1GSMA 5CBEA 4KK5D 1J5OH 1ITBB 1DBBH 5GGTL 4FQJL 4M1CD 2F8OA 2X4TA 3WXWH 1AKJB 1FN4A 1FSKC 3IFPB 3ALWA 1YQVH 3KPTA 3K4DA 3QUXD 2YPLD 3ZT5A 4FQCL 5A1AA 4K3HA 15C8H 4AT6A 4NC0B 2VR9A 4LCUB 4XMLH 4HXBL 1MFBL 1YPZF 4RA0C 1GGCL 4NBZB 1NGZA 1L4IA 4NZRL 2ZOLA 3ZE2F 4EUPH 4LHUA 1QFUH 3VXOB 4QXGH 1Q0YL 4GS7C 3T4YB 4QGYA 1YEEL 4U3XA 3FOMA 2P7TB 4OLYL 4U7SA 4K8RL 4OCWL 5E4EC 1KEGL 1DCLA 2LFGA 1KJ3H 4HJ0C 2V2WA 3TBTB 4XB8A 2NQCA 5F21B 4L8CB 4YE4L 1UH3A 5EORL 2NY4C 1N64L 1G7QB 5INDB 1XCTB 1H3VA 4N0FA 1CICC 4NKMB 4FP8H 4XGZB 2ZSVA 1CWVA 1T5WA 3EZJB 1UACL 2DQJL 2ATKB 4R4NC 1IKNA 3P11L 2LVCA 4MA3A 3BQUA 4NN5B 5HDQL 4I5BA 1Q94B 4HKZB 4K7PH 3R1GL 3JWOH 5I15H 3QCTL 7CGTA 2FD6H 4PP1C 5DJ8B 3MBED 1F45A 4QRPE 1CG9B 1BZ9B 1AQDA 1IE5A 1JE6A 3C6SA 4PJGE 4Y19E 5EIIA 1FNEB 4EI5C 3ULUL 1I7RB 1FNSL 4XPGH 4L3CB 4J3UA 1MFDH 5GRJH 2XN9D 4HFWA 5EOQH 1F58L 1IT9L 1JGLL 3REVB 2A9MH 5TDOB 4XWGL 3HLAB 1ZGLP 4PJ5B 3T0EB 3MLRL 1CD1B 4XC3L 5IEKA 4NN6B 5FUZL 2XYCA 2C1PA 1XH3B 1TTUA 3LN4A 4YNYA 4M93B 3RZWA 4QHLA 5E2UL 4RFOL 2YN3A 4MQ7B 3SY0B 1Q38A 3AM8A 2DS4A 5F72S 2ADJA 4LGSB 1X5KA 4E0RA 3C60C 1RMFH 1CDYA 1S9WB 3VFWB 3IAQA 4OF8A 1ZHNB 1CTNA 2VAJA 2VNCA 32C2A 3AY4C 2AI0L 1HHKB 1HZHH 4PTTB 3DMMC 4U1KB 2EDOA 2W9EH 2FLRT 5JXEC 3E2HC 4UQ2B 1U93A 3O3UN 5C3LD 4OCSH 3AMLA 5DQ9A 5ICZA 3WFEH 3H42H 4ZOCA 5EA0H 1YC7A 4R2GC 4WNQA 2AV7A 1AGBA 3HE6C 3P4MB 3QXVA 4V1DB 3E8UH 4OGAD 5JORB 2W59A 3MRPB 4JKPL 4L9LC 5EIVA 1J5OL 2VLKB 4CVZB 4OBRA 1VCAA 3K4AA 3WXWL 2W60A 2C4XA 3OJDB 1YQVL 3FOLA 1QSEE 3V0WH 4H8WH 2RR3A 3SQBA 1YEFH 3MRRA 1NQBA 1WISA 3D69A 3HRPA 2DQHH 3CCHA 4XTRD 4HFUL 1N2RB 3EOAA 1QFUL 4XNYH 4QXGL 1BZ7A 4LPCA 3ZHDA 3DRTA 4HK0B 5SWZA 4TNVF 2H8PB 2W0KA 4MWFA 3P0GB 5KG9B 5HHQA 3QEUA 5F97E 2NNAA 3SCMC 1KJ3L 4YHKL 3MGTB 4WFHD 1NFKA 1ZWIB 2VE6B 4M03A 3SJVD 3LKRA 1BLNB 4Y1AB 4FP8L 1HOCB 3RNKA 2GK2A 1S9YB 4R7NA 4OF7A 4FN0A 3O6FB 3PWLB 2JJVA 3CSYB 2ICWB 1JF1A 4P2OA 2X05A 2ZUUA 4JFFD 4PREA 5DK3A 3T4AA 1F11B 4W4OC 4LCCA 1KJMB 2UWEB 3VFOA 3QQ9C 5C08E 2H9GA 4ZO9A 1ZV5A 4K7PL 3M8OH 1OGAA 4IMLA 3TIDA 5I15L 4G9FA 3KPNB 5J0BA 3SDXB 3RJQB 2GW5A 4M7JH 2OMBA 1NAMB 4MB3A 4F9PC 1QQDA 2EC9T 4I3SH 1MFAH 5MEQB 1A1MA 1MFDL 1TTGA 5D2LB 5EZJB 5GRJL 5BMFL 1QHOA 2OTWA 3QQ4B 3D85A 3MRFA 3T2PA 5IMOA 5TQ2L 1ROWA 4FQXB 1BD2E 3RFZC 4NQCE 3S36X 1MLBA 2X9XA 2D0GA 5ISZB 2Y4SA 1A6VH 3CDCA 3PHOA 4XVTH 2A1WH 1TQBC 2W92A 3VXUA 4XNXH 2NXZB 3KHOA 3E6HB 5AZEH 5A16A 4PJDF 5CILL 2Z8RA 4RGNE 4FZ8H 3S37H 1KCSH 2OJEA 2ESVB 3IJSA 3DXAA 5BS0A 2K7QA 3UAJC 5CKAA 5HYJD 1A9EA 3RNQA 5E2VH 2ARJQ 5CS7A 1DANT 4UMGA 1HZHL 1C16A 1R6VA 3BEWB 3KS0J 3CX5K 5CZXC 2W9EL 5F7EH 4HUUB 3WD5L 1AGDA 3VXRB 4MQSB 4Z7NF 1T89A 4OCSL 5CEXB 3IF1B 3WFEL 2OTUB 3H42L 5EA0L 1D5MA 1NMAH 4XP4L 3E8UL 3ARGB 3JWDH 2YHGA 3G08B 2QEJA 4LVHC 3WFDH 5EPMB 4TUKH 4ZFZB 4DCQA 3MBEC 1F6LL 1RULL 2ITDB 3FO9A 4XNUH 3DHJA 4N0RA 1FAKT 5KTEH 4MNQE 4JGMA 4OI7A 5IM7B 4ODBD 5HHOA 1DVFB 3TP4A 2QSCL 3WO3B 3V0WL 4XZUA 1AI1H 3P0VL 3OAZK 2UZIH 4PTUA 1RURL 2CD0A 3PHQB 4X7EC 4GLRI 2FATH 5IJKA 2DQHL 1UQSB 3RWIB 4XVJH 5GGRA 2AJUH 1XGUA 1ZVHA 4LSTH 3VFNA 2Y5TB 3HE7D 1RUPL 4D8PB 2HJLA 2APVA 1DN0B 3IDGB 4NRYA 1FCCA 4L4JA 1G0DA 4BYHA 4LLYA 1T1XA 4YH6A 1LDPH 3OJ2C 1KSRA 1XEDA 4JFDE 2A6JA 3AGVA 1AGEA 2PXYB 1YJDH 5ENWA 5I19H 2HG5A 4LHUG 4Y4KB 4LFHD 5EOTB 2DTMH 5D7JA 1Q9LA 4XHJC 1YEKH 4GW5B 4NQDD 2Z9TA 3QIUC 3CLFH 3LKNA 5T3XD 4KPHL 3QH3A 4Z7WB 2ED9A 4OGAC 2EYRB 2V5TA 3EFFB 5ABDE 1OY3B 4MD0B 1KJVB 4HW6A 3M8OL 4LAQH 3ZSSA 2CIKA 3O4LB 3PL6C 1YC8A 4M7JL 4CRPA 3UBXG 4R4FH 1J8HB 5FYLE 4LLMB 4M8QA 2VL4A 4PRNA 2NLJB 1SBBA 3C6LD 5HI5D 3WFCH 2BY0A 2X10A 4WEUD 2BP3A 4JZJC 1OQXA 5GJSL 3P0YH 3GMNB 4HGKC 3BKMH 4H26A 4RMWA 1I1AC 4NKDA 1A6AB 2IQAA 3RTQC 3WNKA 4PJXB 3LRSB 5C09D 1OP3K 1DE4A 4XVTL 2A1WL 5GRUH 5JOPE 4XNXL 3LSOA 5AZEL 2Y36L 3KYOA 3MMEB 3S37L 5IEHB 1KCSL 5JNYA 3G9AB 4TVPD 1I7UB 1K8DB 2WWMD 4C83A 2ICWJ 1HI6B 3UTTE 4OJFL 4D9QE 4PRPB 4LP5A 3S88H 1U8OB 4KI5F 3ET9F 3DBXB 5E99H 3MSPA 1BF8A 3L7EB 3KYAA 3OHXA 3RL2A 2VXSH 1J0IA 3HPJB 2VZ3A 3NCCB 3NIGF 4WI8A 2JJTA 1NMAL 3IJYB 3KXFB 3BZEB 1FV1A 1U8PB 1MI5A 2W38A 2ZKHL 3SDCB 3LV3B 3BO8A 3WFDL 4TUKL 4NO5B 1S7UB 4XNUL 3WNMA 4D0BA 5KTEL 2R0WH 1TNNA 5DS8B 1KIQA 1PZ5B 3L95A 4GKZA 3TBYB 4Z8FH 3STBA 1G9NH 2UZIL 1YMME 3WUZA 3OR7A 2W65A 1BBJB 2ADIB 4EVNA 1LK3H 3TBVA 1DBMH 3V8OA 4XVJL 3RPIB 3MZGB 1DLHB 2VLRB 3DX6A 1EXUA 1K85A 2AJUL 4LQ1A 5C1MB 1BJMA 1FZOB 4QHKJ 4LSTL 4NQVB 4PJ8A 4HC1L 4MXWL 4U49A 4X98B 3V0VB 2VLME 1JVKA 1VERA 3BP5A 3VRLF 3VH8A 2MCPH 1U9KA 3A6BH 2KQMA 1WITA 3KJ6H 1LDPL 4ODSH 2LABA 3WHXB 1E28A 5KS9A 4N1HB 3C5ZB 3SKNA 2HFGL 5I19L 3LKSA 2ATPB 1GJIA 3PQYE 4OCMC 4JQVA 2DTML 4MD4A 1HH9A 4KJWC 3CGTA 5T1LB 1I1FB 3CLFL 3SDDD 3QUYD 2DYPD 2IADB 4QRTA 4F33B 1PQZA 4GRLD 1OAQH 2VISA 2JLLA 2YD3A 3T2NH 4WFFE 3MC0A 1FPTH 4NNYA 1FFNA 2Z91B 1UXWB 2EECA 4AH2B 1BQHB 1M71B 5GGVH 1AE6H 3NPZB 5BO1L 1DLFL 4R4FL 5E6YA 1Z9LA 2EE6A 4MDJB 3HCVA 1G7IA 5C71A 3OXSB 2WBJC 2ICCA 4YHYC 1R0AL 3WFCL 5E2TL 5FF6A 1F4XH 1KACB 2UVEA 5F7MC 5ILTH 4NO0A 5I1CH 3P0YL 1MCFA 4EN3B 2DQUH 3PWNA 3TVMB 2V7HB 1WZLA 5KANI 1MCWW 3BKML 3HE7C 3LVEA 3ZKSD 3MLSH 3R4DA 5I30L 4NO3B 3QNYA 3TBWB 1LMKA 2WUCL 2AJZA 4D0CA 3L3KB 4O9HH 4C56A 3EYSL 4UU9A 1A2YA 4LCWE 4PRHD 1RZFH 5E7BA 3IVKB 3WJJA 1K8IB 4JRYA 3P4OB 4S1SH 3S88L 4FQQA 3QBTB 5DJAA 4ZPVA 3VXME 3O0RH 3WSQH 3B8YA 4JHWL 4NNXB 2VXSL 2N1KA 1FVEA 3DUUA 4M1GH 2NX5A 3WL9A 5H2BA 2BNUA 4PJXF 5KVGL 1X4YA 3O3AA 3EJYC 3MV9A 4JN2B 3TBSA 2MQCA 1KNOA 3HNTL 2EZ0D 4YXHH 4CVXB 3WNLA 2JCCA 2BNQE 3FT4A 3PHSA 4OZGE 3TA3D 3BPOC 3RU8H 5HI5C 1CDUA 4DZ8A 2ZCKL 4Q74A 3K4ZA 3VI4E 2KH2B 3EYOB 3V6ZB 3QHFH 3ZDZE 4NC2B 4L1HA 3BPCB 2AJYH 3NGBC 3QDGB 5LAXA 4YC2C 4KGJA 1V3LA 4ONFH 2FIKB 1MCNA 4MJ6A 1LO2H 3D39D 3PWPE 3SDAC 1U95B 2I24N 4YGVA 2MCPL 3A6BL 3K80A 3TN0B 3VRJB 1UB5A 5B39G 1FAIH 1F8TH 3KJ6L 4FTVB 3U4AA 4ODSL 3V5DB 4LF3B 3GSVB 1I1CA 4RA3A 1JWMB 3P9WB 4GKNB 4NCC1 4PB9H 2WWMC 1EUUA 3QA3A 3FN3A 4NFDA 1IC5H 3V4UL 5F6HJ 5DRXA 1QA9A 3TFKC 1F3RB 1CLOL 4ZNCD 4ZUWA 2BZDA 3DX8A 3JTSB 5I1EH 4TUOA 3UCRA 6CGTA 5M7QA 2DMBA 3T2NL 3KPQB 1ONQB 4NHUA 5BZDB 3D1MC 4YWGH 3KPSA 4PJAA 5DUPL 4HULB 3ZE0F 3HR5A 5GGVL 5IHZB 2J2ZA 2R0KH 3OKLA 1F13A 1NUNB 3SBWA 5GISH 1IAIL 1ZLWK 2YRPA 1F4XL 2FEDD 4DK3A 5ILTL 5I1CL 3VXTB 25C8H 1ZT4B 1PG7H 3MGOA 1SBSH 1NLDH 4DN3H 3NABH 3P77A 5DZOA 2HKHH 3HHRB 2AVGA 1KTDA 2OZ4A 1CTOA 3TEUA 3QDJD 3B9EA 4P5TA 1XIWD 4JPKL 1A4JA 1M1SA 1MCPL 1UM6H 4O9HL 3MCKA 5TJWK 4X9IA 2DBJA 3UTPE 5I1DA 3FQWB 1RZFL 2VLJE 4BUGA 1JPFB 3IJHB 1NCWL 2AV1B 1JNHB 2F19H 1DDHA 3FFCB 1X5AA 4M7ZB 5HGDA 3RVVC 4DW2L 3GSXA 3O0RL 3EDEA 2WP3O 4GKSB 3SDDC 3WSQL 4R90L 4PG2A 4PJIE 3HS0A 4X6EB 4OSUH 4BFIB 3EJJX 1JGEB 1T04A 3I75B 3CSBA 1YN7B 1X5ZA 3G04A 4ISVA 5ETUA 1EMTL 3FB6B 3C9NA 3T1FA 1YY8A 4YXHL 3LCYA 3SN6N 1AY1L 1FZKB 3QI9B 4XNZC 5IQ7H 4JM2B 4FQHA 2XNAB 1OF2B 2CLVA 3BZFB 1IKFH 5CIPA 1NGXA 1OB1A 1IFHH 2ZP0T 4P46A 3QHFL 1BIIA 3MRCA 4RAUB 3QPXH 5H35A 1IKNC 5T1KA 2HTLD 3L3JB 1TETL 3NFPB 1T4KB 1WSST 4UUJB 5CKGA 5CBAA 4RCAA 3RL1B 3BQUC 2ZPKH 4ONFL 3H9SA 1LO2L 2X4PA 5EN2B 1IAOA 2VL5B 1F8TL 2OBGA 4K7FA 4MNQB 1PKQA 5AD0A 5HYIA 3D2UA 4JFPB 3MXVL 3F7QA 4S0SD 1RK1B 4OLWH 3O6MH 4X5XA 4BZ1L 3ZTNL 4WW2B 4I0PB 3K0WA 2GITB 4LVNB 5IHUH 1S7RB 2FJHA 4U0RB 5JHLH 3MLTA 5L7XH 3PGDB 2OR8A 1BX2A 1GZPA 3BJ91 3RIAK 3CFBA 3L9RA 3O11A 2FX7H 4EEEA 4MVBC 3QFJE 3ARBA 2VZSA 2BVPB 2CIIB 5J1AB 1I9JL 1U3ZA 4ZYKA 4P4RB 3PP3H 1EIBA 4XBGB 2DICA 5C0ND 5JQ6H 1AXTH 1OP5K 3OB8A 2F54E 3BI9X 3UYRH 5EU7E 4WCYL 5KSBA 3AM8C 1NKRA 4M6OH 2R0KL 4MNHB 4K3GA 4KQ4H 5ICXA 4OZFG 2OR9H 1BVLB 4DGVH 1T3FA 5GISL 5KVFH 5DFWH 2HJFA 5D7LB 4F58L 1VEPA 1NEZB 5J7CC 1PG7L 2CUIA 1D6VH 5CJQH 3UDWA 4HCRH 1NLDL 3QEHB 1R5VB 1VSCA 4DN3L 3NABL 1F6AA 2FO4B 3ES6B 1RUQL 3EGSB 1ACYH 5LKNA 2WNGA 3VWKB 1EDQA 1EAJA 3CVIH 1UM6L 1KB9K 3D3VB 1BP3B 2DJSA 5DJ2A 4XX1E 3L5JA 1YYLH 1U2HA 4MJ4A 3K1DA 1LD9B 4F3FA 5C2UB 1OAXH 4PGEA 3JSSA 1Q8MA 3RHWK 5JIIA 1NC4B 4OZFH 5ACMA 3EHBC 1BOGB 2XTJD 3AXLA 3U48A 4ELMA 5JXAH 1JFQH 2RHEA 1XGPB 2IH3B 2NY0B 2UUDK 4W68A 3BKJL 1GPOH 4CGTA 1JYNA 1KOAA 4U7KA 5A2FA 1YDPA 2YUVA 4BSWB 4QOKA 1X5LA 3VJ6B 4NGHH 4JAMA 3OF6D 3ELAT 2MFNA 2YC1A 2ZUSA 3L6FA 4IRJA 4WIQA 1P7KB 4N9GB 5IQ7L 5DYOA 4RMVA 4NT6A 3IGAA 1IKFL 2XZQH 1IC7L 2FEDC 5JPMB 1IFHL 2QSQA 2WBKA 4FG6D 2P24A 4BZYA 1FL3A 3QPXL 2FX8L 1PAMA 2WUBH 5FKAA 4C55A 3RI5K 4QRSB 3MR9A 4NCDA 5E9DE 1EUTA 4LSDA 5F96H 2ZPKL 4YHNA 5IB4B 1NUFA 2D4DA 3QG6B 5EZLA 1LWRA 1BVKB 1EHAA 4HUMB 1QSFB 4FFYH 4JY6B 1LEKB 4R4BB 4OLWL 5HGHB 4JDZB 3W0WE 5IG7B 3C87A 3W5MA 1NC2B 4PYGA 5I71B 4JM2F 2YBRA 4J3OC 5IHUL 5L7XL 1Q9KB 1EX0A 2IAND 3MRBA 3GM0A 5BJTA 2M1KA 1FYTD 2FX7L 3L7FA 4DGIH 1I7ZB 4MYWB 5I17A 3IU3B 1QO3A 4LDEB 1U3HB 3VXSA 5F44A 3DGGB 1E27A 4PJ7E 5B39B 4OV5B 4P3WA 2J6EA 4CADA 5JQ6L 1AXTL 5L2KD 1JRHI 4AIZA 1WGOA 4NQDA 1N59A 4GAFB 4J3WA 1R3LB 3UYRL 4H1LA 5HYFA 2VAAA 2VDMH 4JLRA 1U8KB 5HYQB 2G9HB 3QO0B 3QZWB 4ZOBA 4HUWB 4KQ4L 3PQYB 4OIBA 2OR9L 3LOWA 4JG1H 3HZYA 3PUCA 1RHFA 4DGVL 4O5LL 4P2QA 4A6YA 3B9KA 1NBYA 5EC1A 5DFVD 4P2YA 4Q9QH 2DD8H 1D6VL 5CJQL 4TTGA 4L4TA 5HGAA 2GQHA 2APBA 2OI9B 1XT5A 3TJHC 5L2JB 4GLRH 4U1GC 3QIWA 1ACYL 4NQEE 4XAKD 1YEIH 1UZ6E 3CVIL 3E3QC 2BVQB 3Q48A 3GMLA 4PJFE 2VABA 5D1QC 4GG8A 1G9MC 4GBXA 5ID1A 1ZVSA 1E4XH 1CDGA 3M17A 3GJEB 4JFEA 1ED3A 5JXAL 4P4KA 1OAZH 3OKEB 1JFQL 3QYCA 1U8HA 4U1HA 5IVXA 2HVKB 1DBAH 1N3NA 1OSZB 3CD4A 1GGBH 3IDYC 2J4WH 3VXNB 1D6EB 3DROB 4HS3A 4JJHA 3NCMA 4HPYH 1HYRC 5SWSE 4GQ9L 3C09C 1EEYA 4NGHL 3HAEB 2AXFA 1JPSH 1XF5A 1I7TB 3N1FC 5E8PB 2W91A 2NY1D 1S9VB 3MA9H 1FSKB 1S7SA 4OZ4A 1BAFL 4I4WB 4JQXA 4P9ML 1LP9A 1B0RB 4FXKA 4J4PA 3ZKQD 2XZQL 4APQD 4PV9A 3VXMB 3QJHA 2XWTB 2CH8A 4G80B 2VZVA 1QRNA 4JO1H 2EDYA 5D7JC 2PN5A 1UWEL 2BCKA 4GS7B 4O2CB 4UNTA 4C4KT 3Q2CA 1OAUL 1O5DT 1PX4A 5BRZE 4ZAKD 1ZANH 4WO4D 4PRID 3KPRB 4JPIB 1HKLL 2YD2A 3E6FB 5E4EB 2IBGA 2CLZA 3BYTA 4FFYL 2XKNA 43C9A 5B3JE 4LARL 3RVUC 1NCBH 4WFED 1YEJH 3B5GA 2BDNH 5CJOH 2NY4B 3CXHK 3VFSA 4MJ5A 1PKOA 3MREA 2DQTL 1CICB 3OX8A 3ULVC 3ROOA 2N7AA 2XTJC 5CJ5A 5JMRA 3MRDB 5JW3H 3T0DA 3DVGA 1FHGA 3TIEB 1IAKA 1AO7B 1UXSA 4Q0XL 2H3NB 2P8PA 5ESAB 3HZVA 1MCSA 4M3KB 4IOIB 5EBWA 1ZS8A 2VDML 4POZD 4ODVH 3B4NA 4UIMA 3T3PE 4CN4A 4P9HH 5GRZA 2IAMD 4EI5B 4JG1L 4J3SA 3IDXL 4ZXBA 4LNRA 2EE9A 2XOTA 5SX4I 5GGSA 1P7QA 5HYSG 5JOEA 3QXTA 2I9LA 5FA4A 3INUL 3LHPH 1CDBA 4Q9QL 2DD8L 3BIKA 3OKOB 4F7TB 4LSRH 1AR1D 4K71C 3SKMB 43CAB 1YNTB 1D3CA 2JJTC 1JGUH 5GS0C 4HDIA 2H2SD 5C0GB 3UX9B 1YEIL 4ZS6D 1VEMA 3GO1L 1H5BA 3MRMB 4PJEB 4OZFB 1EHLH 4BSVB 3C60B 1QD0A 4IMKA 1HWHB 1FJ1B 4Y5VA 1Z3GH 2CDEB 1BHGA 1E4XL 4FS0A 2PO6A 3NFNA 4R3SB 1GYAA 4UTBH 1WWBX 2M2DA 5J6HA 4MS8D 3DMMB 1P4BH 4X4MA 5HGBA 3VFTB 1QZ1A 1MIML 1T7ZA 3KPLA 5TDPA 4R2GB 3HE6B 1DUZA 4HPYL 3EW3B 2AXGB 4W70A 1JPSL 3LKQA 2R29H 4ORZC 1KGCE 3MRLB 2WBWB 1S7TA 1JI1A 2AEPH 1J10A 4HZAA 3QDMB 5IR1B 1I8KB 4LSUL 4L4VE 1NFDA 2VERN 5F7NC 4XBEH 4FZEH 1H15B 3RDTA 3DVNA 5DFVC 4PJIB 3CFDB 4JQVC 4D3CH 4JG0H 4S2SB 5FV2A 1U91B 1CGVA 4QXTA 3TA3A 3WLBB 2DLHA 4NRXB 4YX2H 1ZLWH 1ZANL 2BHUA 1QSVA 4JFHE 4LBEB 4S1QH 3PDDA 2J8UA 3RGVA 3ARDA 4C59B 4G7VH 1PYWA 3SCMB 3EYFA 4AENA 1NCBL 1YEJL 1G6RA 2BDNL 2N56A 4P59H 3UZVB 3IS1X 3HRZA 3GJFH 2F53B 2ZOKA 1KB5A 4JPWH 3LPFA 5E6ID 1YY9C 5EO9B 5JW3L 1WIOA 1WCBB 4ZD3L 2EIZA 3ESVF 2D7TL 4UILH 3TZVA 4UBDC 3S9DB 4QRRE 4GJTB 4L3EE 3OZ9H 2E9WA 2R2EB 3QXAB 3WDHA 1IEBB 2BOCB 2W07A 4XP9L 4XP6H 4OZGF 4MQTB 5IW1B 5DJXB 4AYFA 4ODVL 3MJ8A 3QUXB 4P9HL 3VI4F 1L7TH 2Y7QA 4IDLA 5DEZA 4JY5H 5EFIB 2QR0B 4F7CB 5C0JB 2DQFB 5JO5A 4DFIA 4Y7MA 1K4DA 3CVHH 3LHPL 5FAAA 1LO5A 1QPPA 2AKRA 1BGXL 2ZUQC 4LFHG 5FDWB 3GGWA 4LSRL 3W81A 3ZT6A 1NFIB 1T2JA 3TESA 1EO7A 4WO4C 4N8VG 5EOCH 5B38G 5JPNA 3DRQB 5F71A 4QWWD 1TQBB 4HK3N 2AGJL 1OGTB 1FC2D 1MIEH 1EHLL 1NDGB 4QHNB 3DI3B 4MGXA 3QPQC 4MZ2A 4JKLA 3U36B 4ETQA 5F3HA 2GHWB 1Z3GL 5DHYA 1T1YA 3ZZ1A 1EGJH 4UTBL 1OARH 1SEQH 2RGSA 4KUCD 3VXPB 3H7BA 3FAXA 2A6DA 5E0QA 3C2AH 1MREH 1EFXD 5J06A 5KBNC 2Z31A 1NDMB 2AK1L 5CD5D 2VIRB 4HIXL 1IM9D 1QPXA 1I85A 5EBLB 3VFPA 3U30C 4JFQB 2DBLL 5T3XH 2G5RA 1MSPA 1P53A 3NCFB 4LVHB 3WIFB 2R29L 2YUXA 3ILPA 2ZUTA 3MLYL 3MBEB 2CO6B 4LSQH 1XGTA 5JW4M 4BK4A 1S7WA 2Q76A 3LEVH 4MLIA 3PGCA 1OP5H 2NW3A 1J1XH 4I3GA 1SY6H 1D5XB 4RGOH 1KT2B 2P5WA 5IFJB 5BV7C 4D3CL 4JVWA 1K4CB 1AR1C 2PYED 2EKSA 4S1QL 1WC7A 1H3TA 3PWVB 4ZS6C 1N5AA 1SJHB 3ARWA 4M9PA 3TT3L 4Z0XA 4XPFH 2J7LA 3G5VA 4DVBB 3QNXB 3QNZA 4B41A 3C5SA 4M61A 4KQ3L 5FECB 4P59L 1ZE3C 3AB0C 4OUUB 1W0VA 3FO2A 3LKPA 5FO7A 3I6GB 1ZT7B 2G75B 2DMKA 2JIXA 5IROA 3S96B 5FOBB 3JTTA 2XY1A 4UDUA 4PJIF 3SBWC 2LU4A 4TVPH 4MS8C 4JPWL 2YSSA 1ORSB 4UOJA 5C0DA 1ZGLB 3NIFE 1F4YH 1QEWA 3QIUB 4UILL 4NQTA 4PRAA 4WTXA 3QUZD 1AD9A 2ITCA 3MV8A 4ZUTA 3OZ9L 4XH2B 2CRMA 4IM8A 2NXYD 2UUDH 3WUWA 3FMGH 3GSNA 4P5TC 3BRFA 4XP6L 4H25A 1A9BB 4BA8A 4YHML 3PL6B 3O81A 3U0TA 2P8LA 3O41B 1FGNH 2ADFH 4NUJB 3EDDA 4OM0H 1SYSB 3VD7A 5A43C 2CR3A 1X5GA 1AIFB 4G7YH 1QBMH 2HLFD 4P2CG 1JBJA 1WBZA 4JZJB 3RKDC 5E8NB 1UC6A 1XZ0B 1C12B 4PG2C 1I1AB 2HP4A 5IB1B 4UV4L 1A3QA 4HS6A 4MXQD 3BYYA 5AWNH 2F5BH 5EOCL 1F3DH 3RTQB 3TYGH 2HYMA 5D5MA 5SWZE 1ZSDA 2NY7L 2HN7B 4ZOEA 3SJVB 4U1SA 3RBGA 4G8GA 5HYSB 5DJZB 2X4QA 4B7IA 1VB9A 3G6AA 1DQLL 1YN6B 3MNVA 1SEQL 2R2BA 1MCHA 3GSRA 5HVGB 3VCLB 1MREL 2RCSH 4YFLI 4JFFB 2APTA 5CEZD 4P46C 3BE1L 1I4FA 1U8JA 3GRWH 3P73B 3HI6H 1H3XA 4JZOB 5T3XL 3X14A 4Y4HA 3BGMA 4Y5YA 2OL3B 5DRWB 4LSQL 3X13A 5IESH 4UI2A 2CDFA 4A6YL 1JGDB 4G9FE 2DKSA 1O0VA 4GQPH 4ZMAT 1J1XL 2XWBA 1SY6L 4MCZA 4RGOL 3QEGH 5ICYA 3DUSB 2UY6A 4L8DB 4JN1H 5D6CA 2GT9B 2P5ED 1NBZB 5HHNA 2RIKA 3RKPA 1MUJB 3TO4D 4U6TA 2GJ6D 4GXVH 4BQBA 5C07D 1GRWA 2PNDA 1TIUA 1N0XH 4OLVH 4Z7UB 2YR3A 1ZEAH 2BX5A 2EO9A 3GSOA 4W4NA 5LVEA 5IJVA 3QEQB 3TT1H 3ZL4L 5B8CC 4X5LA 4Z7OE 2BRQA 4XPFL 4N68A 3GJFB 5IIEA 1W8NA 4R7DA 5JLZB 2IF7A 3MNWA 3ZDXF 4DKEH 3AROA 3HC0A 4GMSH 1RK0A 5E24E 1FZJB 1GIGL 1NCAL 4LDOB 1BQLL 2QHRH 4TVPL 3GSQA 3CK0L 5BS0E 1I1RA 4GAYA 1F4YL 2OXHA 4MAUH 4H88H 1KFAL 5CD5C 1M7IB 4IDJH 3QIBA 2MHAB 2UY7A 4XVUD 1TCMA 1TDQA 3CFJB 5D72L 5CD3A 1ORQB 2BC4B 2OCFD 5ESVB 4N0CD 3BP6A 3FMGL 1J0KA 2ORBL 3O9WA 4N1EA 1IM3B 2DIBA 1FFQA 3O45B 1FGNL 2ADFL 3JVGC 4OM0L 3B3IB 3PNWA 1WFNA 2RBLA 3CVHB 4S11A 3EOYG 3I3EA 3D9AH 3EYUH 3VG0H 5DD5H 2WBJB 4YHYB 3WE6A 2X70A 4NP4H 4G7YL 3DURB 4MJIA 1QBML 2WWKT 4QYOA 5ESQA 1MY5A 5HHOE 1W72B 5HJ3B 3SGDH 4YO0A 4LSSL 1M7DA 4JJ5B 5JHDA 3TCLB 2R9HD 3HE7B 1IEAA 5C0CB 2NR6D 4F7EA 5LGJA 1S5IH 4QRPA 4O2EB 1MHEB 4PJGA 4Y19A 3MOBH 4ODWB 3VGDA 4WV1C 3BUYA 2DMCA 1CGSL 3O6KH 4RRPA 5I1LB 5MENA 1MRDH 4NSKA 4I18A 2IMMA 1TMCB 4X8XA 3MV7A 1IGCL 4WTZG 1D9KD 2KL6A 5GS3A 1KJ2A 2SEBB 1B4RA 5JMOC 3K8MA 4HUXA 1U8IB 1A0QH 3AREC 3L5HA 2RCSL 4JANB 5DSCB 2YEZA 3GRWL 5DC0A 3QUZC 5B38B 3EO9H 3T0ED 2OM5A 1KBGH 2GSIB 1PJ9A 2BVOA 1FG2A 2NXYC 1LE9A 2R1YB 4ZFOB 1MJJB 3RVXD 2XWJB 3K8LA 1JZ7A 2X89A 4X7TB 2BNRE 4QEGA 4RMRA 2HMID 2XPGA 5FKPB 3L5WB 4JZNB 3VMOA 4DOHB 5C0BE 2R2HA 1KLUB 1JRHH 2P46B 3WS3A 1ZTXH 3QEGL 3KYKL 4JN1L 1NGYA 3DJ9A 3DYOA 3B6SA 4O02H 1LNUA 5DZLA 3RY5A 3H8NA 2CDGA 3ULVE 4J1UB 3OV6A 7FABH 1D5BA 1FIEA 1G7MA 3P9MB 2NY5L 4APQA 3NGBB 2ZSWB 1UJ3C 1ZEAL 1MLCB 4YC2B 3M45A 4F7PA 2CPCA 2X41A 4RFNC 3TT1L 5T5FL 2JJWA 2J12B 5CFHA 1QSEA 1ZHKB 3QG7H 5KN5A 2GUOB 3HR6A 4ZPTA 3NZ8B 1NKOA 1Y6NR 3DO7B 3NN8B 1XR9A 4GMSL 4X9GA 2QHRL 3VGAC 3ROLA 4BUHA 4LKXB 3F5WA 3B9KC 4MAUL 5CWSA 4H88L 2KZ1B 5BW7A 3DYPA 4IDJL 3EYQC 2E7HA 4BKLA 4DKFL 4Z7UF 3VWJA 4U4BA 5DJCA 2R2CA 5BCAA 1HCFX 1CL7I 3I9GL 3G6DH 3QIWC 4K55A 1SJEB 2FECI 1DFBH 2YD4A 1MI5E 4MA7L 4CVUA 1N8ZB 1RJLB 5I76B 1KELH 4X6CB 2AK4A 3VG0L 2QBWA 4QHUA 2Z0BA 1MHCB 3QHZH 4NC1C 1DQDH 3FB7A 4ZTPH 1KTRL 5ADPH 5ITFA 3WEXA 4AQOA 2DWEB 4P4KC 3MFFB 3UTQB 3DHMA 1KLGA 5EUOE 1J05A 4DGYH 5B3JF 4JRXE 3I02A 3MOBL 4LIQE 3UYOD 1KXVC 3O6KL 1G6RL 5CBEB 2QSTA 3GMOA 2EXWC 1MRDL 5EO0A 5I8EA 3K74B 4M00A 3PIQB 4MHHI 4XBPB 1T2XA 3I6LD 3MOAL 2X4TB 2UZYB 5D7SH 5DHVA 4UV7L 3JV6A 4J4PC 4X4YA 2PR4H 2QHLA 5D7KE 3BP4A 4O2FA 1A0QL 2CQVA 2DLFH 5TPWL 4HKJB 4KI5D 3SDDB 3U7AA 3LQAH 4PJCB 2V2XB 3BDBA 4FQXD 2ZOLB 5IW6A 1B90A 5DK2B 3FOMB 3PDOA 1SVZA 5ISZD 4N0CC 1BBDH 3W11D 1RUML 1WAAF 1YEHL 2CXGA 4RBPH 5FYKD 1X5IA 2HFEA 3BVNB 1J0ZA 1Y0LB 1C8PA 3UPRB 2P47B 4X4XA 3JUYA 2V2WB 1L6ZA 3BJLA 3K81A 1JRHL 4XNZB 5H94A 1ZTXL 3BDYH 1KN4H 1X4ZA 5EOCJ 1HHIB 1JYVA 2IH1A 3MRJB 1T5WB 3IYLW 4R6UA 5D71H 4JDVA 2NY3C 3U6RA 3VXRD 4TTDD 5EU6E 3OPZH 4HS8H 4GRWB 5SX4H 3NIDE 4JQIL 1IGIH 1X5XA 3RWHA 4MA3B 3KLHC 3O2WL 1M4KA 3BQUB 3ARGD 4GUPB 1N26A 2CRYA 1D5IH 4I5BB 5FCUH 3U4EB 4U1NA 1C5BH 1YYML 2N4IA 5FXCH 5MEPA 2IGFH 3QG7L 2IG2H 4G8EB 4NN7C 3CC5A 2COQA 1W0YT 1H0DB 1D9KC 3QUKB 1AQDB 1L0XA 3C6SB 3G5XA 1WZ1L 4JKKA 3NFSL 4K3EH 5D2NA 3MRNB 2BSRA 5C0AA 2H26B 3RIFK 1FG9C 3IETB 2APWA 3OKNA 1X4XA 1P1ZB 4HFWB 4W6YB 2D7MA 4YBLC 3VFUA 1HHJA 4OIIH 2FR4B 1BF2A 4XPAH 4K7PY 1MF2H 8FABA 2L7UA 3CZFA 3FQRB 1HDMA 4JFDA 1MJ8H 3RVXC 1ADQA 3V6OA 5IEKB 3G6DL 5E1HB 5KAQG 1NAKH 3LN4B 4YNYB 2X4NB 3OTTA 2JB6A 3GI8H 1HSAA 1H5BC 4QHLB 1DFBL 3AVEA 4KKLC 3U83A 2ADJB 1FP5A 4E0RB 4WWKA 3VGGA 1KELL 2VXQL 5DHXB 3BX7C 1JJUA 4OD1H 5C8JA 3QHZL 1RJCA 3V5KB 5BOZG 4YBQD 4JO4H 1DQDL 4ZTPL 3ARTA 3I6KB 4U33A 1SHMA 2JCCE 32C2B 4FMKA 3VMPA 5DJ6A 3ZKMC 1ND0A 4QF1B 4C58B 4I9WE 1H9VA 3REWB 3WKNA 1EEZA 5H8DA 3SEPA 5DQ9B 4DGYL 2BSTA 4I77H 1LILA 3D39B 1FGVH 2YPLE 2HJKA 1AGBB 4N90E 4RMSA 1FIGH 3IDIB 4GAGH 2VN4A 3LQZB 5D7SL 4FXGB 2G60H 3IDJB 3FOLB 4YHPA 2PR4L 3X11B 4K94C 4OCNC 5D1ZA 2DLFL 3CSGA 3RDTC 5F1IA 4XCFH 3LQAL 1XCQA 2Q87A 3D69B 1YQ2A 4B7LA 3EOAB 5K9KA 5I8CA 4IOSD 2P4AB 3DRTB 1BBDL 2XXMB 2EH7H 1EFXA 5HHQB 2NNAB 3MUGA 1ETZA 3O2DA 3PWUA 3X12A 5HHME 1JHKH 2A6KB 4JFZH 1T20B 3NZHH 4E42B 4PJAE 3BDYL 1KN4L 3LKRB 4X5WB 4Q7DA 2W0LA 3F8UB 2CJUL 4XHQA 4N8CH 4PRPD 5D71L 3RNKB 1T5XB 4MJ2A 1FL6A 1KCRL 2ZWLT 1JF1B 3DSNA 4U6XB 4HS8L 4ZUSA 4TNVK 1YNKL 4PREB 3TZVC 3HC3H 3KXFD 3OGOE 4U6HA 1TVBA 3QDJB 3OJMB 3VFOB 1BQSA 5HHXH 3SDCD 1D5IL 5FCUL 2H9GB 3EFDL 1C5BL 3HB3C 5C7XH 2IGFL 2RFXA 3P40A 4M6MH 2WK2A 1OGAB 5DD6A 4Z76B 4IRZH 3ARFA 2ED7A 3MJ7A 5HPMA 3NVQA 4KK8D 2JJSC 1QQDB 1RJZA 4K3EL 1WTLA 2BVUA 3CXDH 4GAJL 2ZG3A 1HXMB 1A1MB 4KKCD 1EAPA 4NKQB 4KI5C 1LEIA 2OTWB 2VLRD 5DT1H 2BRRH 3D85B 3MO1A 4GRWF 3F6LA 5JDSA 1UB6B 4DVRH 4HHAA 5KW9L 4UB0H 2AEQL 4OIIL 2HVJA 1T2QH 1XF3A 5HDOA 1MF2L 4P5MA 4JVUA 3W11C 5HVFB 1MCLA 1MJ8L 2G2RB 2E7MA 1NAKL 3GI8L 4TOYL 2Q7YA 3PHOB 1LO3L 2WINA 3VXUB 2ARWA 5A16B 1CI5A 3CU7A 5FUOH 1QR1B 3IJSB 3DXAB 5BS0B 5GSVA 1OD9A 4JO4L 2D31A 1LDSA 1FFOB 1C16B 4PJHA 1GH7A 2Z31C 2R15A 3U7YH 4LDLB 3ECBB 1JV5A 4U1GB 3UTSA 1I85C 2VITB 1D5MB 1EO5A 3I2CL 4TQEH 4U1IB 4Y2OA 4ZO6A 4M5ZL 2O5XL 4GG6B 1NGQH 1ZLSL 2HH0L 3VFRA 4NJ9H 5D1QB 3H9SE 3BH8A 1ZA6A 4DCQB 1TZIA 4XPBH 3IU4L 2G60L 1PKQE 5A2JH 3NIFF 4JFYA 3ULSA 3NTCH 4N0UA 1RZJL 3THMH 2Y25A 4U1LA 4PTUB 1GAFH 3VFVA 1MCWM 3OG4B 3U9PL 3TVMD 5DI8A 3SE4A 4FA8A 1C5CH 3MCLL 1MWAH 2R0LH 2DLEA 1T1WA 4KUZH 3OKDA 3BEVB 3IDYB 1XGUB 2D7OA 4L29B 2KPNA 3T0XA 4ZUUA 2VDLH 1OW0C 2ZJSL 1ZA3A 4X0KB 2FX9L 2EH7L 3C09B 1EZVY 3SGJA 2HJLB 4NRYB 4Z77A 5HY9A 1EK3A 2XV6B 5JW4Q 4IIQA 2ARJA 2W0FA 4LLYB 5GS1A 1T1XB 2X4SA 3NZHL 4HWUA 3FT3B 1ES0B 4MAYA 2MPAL 4J2XA 1I8MA 5KSBE 4WJ5B 4YBQC 3KWWA 4N8CL 3QJFB 4KC3B 5ENWB 1KTLA 1VA9A 1C1EH 3H3PH 3PF2A 5D7JB 3OKYA 5DQJA 1NANI 2DM3A 4HIIA 3Q1SL 2I25N 5K59F 4ORGA 3LPWA 1J87A 3QH3B 4WI7A 4HWBH 4OQTA 2W1NA 5DD1H 5HHXL 2WWKO 3OL2A 4LKCA 2PF6A 2GK0A 1HQRA 1CFTA 4FFWC 5DQDH 4F2MB 4X6DE 5FDYA 4RISH 1IILE 4OGYH 1RSFA 3CXDL 4M8QB 2XTJB 4PRNB 1U8NB 4YFDB 1A3LH 1AKJA 3LIZH 3IFPA 1JWSA 4WHCA 2BRRL 1VGKB 4B0MM 5IWLA 4A2LA 4DVRL 1JZ5A 2E7LA 4ELME 1T2QL 4H26B 4U2ZA 3RX7A 5FV1L 3IB4A 5FOJA 3WKMH 3TN0D 3TM6A 5EU3B 4FTVD 3VXOA 4PBWD 1DE4B 3T4YA 3FB5B 1MCIA 2R69H 4ZFFA 3LSOB 4R97C 4QOKE 3KYOB 5AG8A 5FUOL 3OKKB 5KVDH 4HKXB 4JPVH 2WM0A 4G6KL 1HE7A 3TH3T 3ZSTA 1WK0A 4JE4B 4C83B 3WO4C 2I60L 3EDKA 2WIIA 4L8CA 2E8YA 4XXDB 4H0HB 2XACC 2GKIA 3GHEH 5INDA 1XCTA 4NKMA 1CVRA 3U7YL 5JDJA 3OHXB 1X6NA 3QO1B 4K71B 3RL2B 5DEGB 1X9QA 1TITA 2ATKA 1U3JA 4S0TD 3U9UB 5DZNA 4TQEL 1FV1B 2FEEI 4NRZA 1NGQL 3HPLB 4ONGH 4Y4HC 2EDTA 1EFQA 3U0PB 4LL9A 3BP7B 1GZQA 5CZVL 4FNLL 2Q6WB 2DI7A 4D0BB 1A22B 1Q94A 5CLWA 1SYVB 2BY3A 2IANB 5L8LB 2VDKH 1KIQB 2UV3A 3THML 4Q9BA 1P4IH 4KKCC 1ZAGA 4G6MH 3OR7B 1BZ9A 4EVNB 3BMVA 3FRPG 1O7VA 1C5CL 1MWAL 2R0LL 4XP5H 5C08D 4KUZL 4L3CA 4DQOH 1EXUB 4O00A 2VDLL 5LBSL 5L2KB 3PJSA 4OFDA 5C9JA 1L9NA 3HI5H 3REVA 2FL5A 2VLJA 3HLAA 3VH8B 4PJ5A 3T0EA 1HYSD 2FHBA 5CJXA 1A64A 4NQDE 5KS9B 4X7DC 5FUCC 5T3XE 4OAWA 3BGAA 3VI3E 4YDVB 1TPXC 4MQ7A 3SY0A 1WWCA 2ERJC 3BGFB 1C1EL 1BD2D 1L7IH 3H3PL 3KR3H 4NQCD 4MD4B 2I5YH 4P2QE 1HH9B 1QNZH 4Y5XC 4I48A 4QRTB 3OAUH 1C7SA 1PQZB 3BWUC 5DD1L 3GBMH 1HHKA 4L4TE 1B2WL 2B4CC 4JY4B 4QRQA 3SPVB 4NZTH 3QCUH 3O9WC 5DQDL 2VH5L 4GMTH 5GRVK 5GGTA 1FFNB 4RISL 1FVCB 1FFRA 4V1DA 3MODH 5D7IE 4ODXB 4OGYL 3MRPA 4JM2D 2VLKA 1YA5A 3NACH 5MERA 1JZ3A 1BIHA 3LIZL 2PYFB 5C09E 5DEFA 4HV8B 4C54A 4ONHA 1A14L 2C3WA 4NO0B 1V7NH 3PWNB 1IGTA 4JGUA 4FXLA 5IVXE 4Y2DD 5IFAH 1RZ7L 2YD1A 3VDAA 4OZIA 1K5NB 1LEGB 4MNGE 1R3IL 1U8LB 1JK8A 4L1DA 4MNQD 3SDYL 4MMXC 2AJZB 4KAQL 5GGVY 4D0CB 4HK0A 2H8PA 3BPLC 4U6VH 4BSJA 4HG4J 5KG9A 5KVDL 4C56B 2E5EA 1KPVB 4JPVL 4NCC2 4UU9B 3ULVF 3QFJA 5FO9A 2EIBA 2R1XB 1CE6B 4IOFD 1WFUA 4JRYB 4RFEA 1LP9E 2PTTA 1ZWIA 2VE6A 3MNZA 3GHEL 4UOW1 5DJAB 4HWEH 5I9QC 2ZUQB 4Y1AA 1T83A 4ZPVB 5T3ZL 1HOCA 3CU1A 2F54A 1YNLL 2VQ1A 5GZOD 1QRNE 1S9YA 4WO4B 1MQKH 1TVHB 4HAFA 1FVEB 4PRIB 3O6FA 2HLAA 3PWLA 5BXFA 2NX5B 2ICWA 5H2BB 4JO3L 2BNUB 4OF3A 1J1PH 3O8XD 4ONGL 3O3AB 1PSKH 3S5LG 1F11A 3MV9B 4KZEH 1CGTA 3TBSB 2UWEA 3KPMB 3V4VL 3OQ3B 1KNOB 2IFGA 2HKFH 4KMTH 1LO4H 3FT4B 1AGFA 2PCPB 2VDKL 1RAMA 1K2DA 1P4IL 5CINH 3SDXA 1F90H 4L8SC 1TJGL 5D7LD 4G6ML 1CFQB 3W82A 4IEFB 2AERT 1NAMA 2A77H 3WN5C 4DQOL 3BT2H 2IBBA 5MEQA 1ADQL 5D2LA 5EZJA 5MHSD 3CPLA 3BWAB 1RPQA 3QWOB 3D25A 3U30B 5LAXB 3QQ4A 1U8QB 3HI5L 1JHTA 4YGVB 1OOAA 5DC9B 2QL1A 4HZLB 3VD9A 3TNNA 1ZXQA 2V9TA 2YPKA 1BJ1H 5EZOH 1NC4D 2GI7A 2J88H 3QA3B 3G6JB 1A7QL 1A3RH 3EJZD 3H7LA 4DZBA 1L7IL 3KR3L 2D03H 5BV7B 2ESVA 5DRXB 2I5YL 1QNZL 2NY0D 5DK0B 2DQGH 2GFBB 3GB7A 2AABH 2GIYA 4XVSH 5LGKA 3DETC 5BW7C 1CS6A 4ZUWB 1TFHA 4PJBB 3DX8B 2DAVA 3OAUL 4ZUVB 3VWJC 5JOPD 4KXZI 4KI1A 2O5ZH 1XGQB 4I0KA 4HUUA 1T1ZA 3QCUL 3ME0A 3KPSB 3KG5A 2VSDA 4PJAB 4GMTL 1UM5H 3GI9H 4OCRH 5KS9F 3AB0B 3MODL 3UTTD 2IFFH 3HR5B 2WQ8A 5EU5A 4CDHA 4CMMB 1QFOA 1HINH 3QCVH 4QNPF 5EPMA 1SJXA 4YDKH 5FB8A 4OD2A 4ZFZA 2ITDA 3KDMA 5DA0B 3FB8B 4AQ1B 3CH1B 1MHPL 1WBYB 1V7NL 5IM7A 2JB5H 5KSAA 1DVFA 4OKDA 1Z5LB 3MGOB 5CUSL 1R5WB 3PHQA 3B2UD 2E7CA 4X4ME 5CEZH 3W0WA 5IFAL 3O2DL 4AEIH 1KTDB 1V7ML 4H5SA 2CO7B 2D2OA 5J1SC 4P5TB 5I1IH 3WJLA 4OZHB 3AAZB 1A4JB 4DWHA 3RAJH 4HT1L 4D8PA 4U6VL 3MCKB 1NC2D 1OD7A 1YMMD 2H6PA 2IJ0C 5GRXG 2BMKA 2EDNA 4WI3A 5I1DB 1LE5B 3QHTC 3LEYH 5K9OA 3RY6C 4PJ7A 3NIDF 1NFDE 4M8VA 3QB7C 1QFWI 4KU1A 4HWEL 1BM3L 1DDHB 3KLAA 1UFUA 2VLMD 2PXYA 1U3HD 2R0ZH 4Y4KA 1NL0H 1MQKL 3L3DB 4YPGB 5FM5M 1J1PL 4RGNC 5E5UB 3WLWD 3K2UH 4ISVB 1PSKL 4LVEA 5ETUB 3QWRD 4KZEL 4Z7WA 3VW3H 4PJ9D 3W39B 1KYOJ 5I1GH 3EFFA 1RIUH 3SO3C 4MD0A 3PQYD 1HEZA 1KJVA 1MJ7H 1QUNA 2HKFL 4KMTL 3O4LA 5HHVH 1JWUB 2D7PA 5CINL 4PY8I 2VDPH 1F90L 1KC5L 2CLVB 5CIPB 4M62H 3Q6GH 1NGXB 1P2CA 4IBLT 4GXUM 4NQEA 1J8HA 2A77L 3O6LL 2BSSA 3OSKA 4P46B 1RUAH 3MRCB 4LLMA 5F1OB 5H35B 4PJFA 5ACLA 3FO1B 4Y2DC 4JR9L 2O5YH 3C08H 4MX7B 4HIJB 5CBAB 1E4KC 4OLZH 4DTGL 4LRNH 4ODHL 2X4PB 1IAOB 3D18A 5E2WH 4K7FB 1CFBA 3V9FA 1A6AA 2JCCF 1P6FA 3QISA 5EZOL 3LRSA 5C0IA 2J88L 2FECL 2Y23A 4RX4D 1VFBB 1H3PH 2FJHB 5LWYL 3MLTB 1A3RL 5D2NC 1BX2B 1GZPB 2D03L 2E6QA 3CFBB 3VD5A 2DQGL 3L9RB 1I7UA 1K8DA 3PV7A 4RMUA 1U8OA 3V6FB 3DBXA 2O5ZL 3O8XC 5DLML 4PLKC 5B8CB 3VDBA 4RMQA 3HPJA 3RZCD 4LCWD 3GI9L 1A7NH 4OCRL 3BZEA 1KCKA 1CDCA 1U8PA 1MCRA 3SDCA 1OTUD 1J0JA 3LV3A 4YDKL 3VXMD 2W9LA 1S7UA 4F57L 1T3FB 3L3OB 5FM5O 2HJFB 2JB5L 2PUQT 5DS8A 4OD3L 3TBYA 5IK3B 2VB5A 1CFNA 5DR5L 2ADIA 5CEZL 3KPRD 4AEIL 3VFMB 3RPIA 5I1IL 4PJAF 4HJ0D 4HUKB 2V17L 2BNQD 3RAJL 2P8MA 3BSZH 4HK3J 4X98A 2NY4D 3V0VA 1CICD 3X3FH 1NGPH 3TWCL 1DQJA 1RZKL 4PGEB 5LG1A 3LEYL 3EJZC 3GHBH 1XMWA 4R4ND 4YFLF 5D1ZC 4EXPX 5I8KH 2HT4D 3C5ZA 4HX1A 4ZODA 1N5YH 2AQ1A 3T08A 1NJ9A 3PWPD 2P5WE 3GUTB 3GMRB 1HWGB 1RFDL 2X1WL 4Y4FA 3U2SB 1AO7D 3ARXA 3RGHA 4HSQA 1FZMB 4HPOH 4WV1B 4K7PX 5T1LA 3VG9C 1AFVH 4QOKB 2R4RH 3KYMA 4JAMB 4PP1D 5ERWA 3SKJH 1R3HA 1BECA 2WIMA 5I1GL 3I85A 2YC1B 4MSWA 3L6FB 5GGUA 5FGBC 1MJ7L 4EI5D 2PW2A 5HHVL 4P23A 5EO1B 2OJZH 2VDPL 4G42A 5DYOB 3AS2A 1KIUA 4J6RH 4M62L 3QR2A 3Q6GL 4AH2A 3AREB 1R5IB 4OFYA 1DEEA 4YFEA 4TSAL 1RUAL 4X4ZA 5E03A 2Y06H 3RWJB 1FL3B 3QUZB 5EBGA 2X4UA 3JV0A 5GXBB 5J8OA 3S5LB 2O5YL 2VKXA 3MR9B 2NXYB 3H9YA 1VESA 4OLZL 4YHNB 2C9AA 2X1XR 4WI9A 1FO0H 4EN3A 4LRNL 2V7HA 3FFDA 2YRLA 3Q0HA 5F1SA 5TE4H 3MV8E 4Q6IC 3S97C 3C60D 5L8KB 2BJMH 3ARVA 4F9LA 3TBWA 3ARFC 3TV3H 3L3KA 3W2DH 1H3PL 1OT2A 4QY8B 5E7FA 4PIRF 4E5XB 5EBMA 3IVKA 1LO0H 5CSBA 1K8IA 1QO3B 4R2GD 1UJ3B 3P4OA 4Z95H 1WF5A 3VXSB 3HE6D 1MEXL 9CGTA 4RFNB 4X8JA 1CFSA 4CDGC 1NLBL 4CADB 4UT6H 1FC1A 1AQKH 3UTPD 4AIZB 4HBQA 3SKOB 1B6DA 2LVEA 4PJ9C 1VKXB 1QLRB 4Z7VA 3NCBB 4XXCA 4KMQA 2DRUA 3QDMD 2VAAB 3MJGX 5D5ME 1UM4H 2V5YA 3MLWH 4G6FB 1D5ZB 1FNAA 1TZHA 4Y16A 1TJIH 5T1MA 1VFOA 1NCUA 4KVNH 4XRCB 3HZYB 4JHAH 3RX8A 2ZZUT 4P2QB 3VGAB 2MNUA 3B9KB 3FKUS 4CVXA 1NBYB 5ALCL 2GSGA 3K7UA 3UC0H 12E8L 2R8SL 2IMNA 3MQIA 2R23A 3OR6B 2YKLL 1F4WL 1UA6L 4UT9H 1CLYH 3RRQA 3AS1A 4UT7H 3I50H 3SCMD 4L5FH 3QIWB 3IDMA 5D6DA 4X7SH 3BSZL 3BPCA 3QDGA 3GMLB 3HNVH 5FGCE 5FYKH 2FIKA 5HI4C 1YEGH 3X3FL 1U95A 1EVUA 4HH8A 3OGCA 2P5EB 4YDIL 3V5DA 4QRRA 3GHBL 2ZUYA 5F1KC 3IAPA 1JWMA 2F8VA 2FWOA 4JFEB 5I8KL 2GJ6B 4GKNA 4P4KB 1ZT1A 5GPRA 5C07B 5IVXB 1N3NB 4QT5A 3MOQA 3HMXH 5K9JH 4HS3B 2VKWA 3GKZA 1AFVL 1NANH 2C3HA 2R4RL 4BM7A 3RZCC 4K8RD 5I18L 1EEYB 3JTSA 3SKJL 2AXFB 1XF5B 5DVNA 5GS1C 2DLIA 2E9BA 2EDEA 2MOVA 1OTUC 4OZ4B 1S7SB 3KPQA 5BZDA 4MAYC 1BEYL 1LP9B 1HQ4B 3JV4A 4FXKB 3U4BH 2XIDA 3O4OC 5FUCE 2Q3AA 3EAKA 4ELMF 1QSZA 4LLDB 4MXVE 4OCXL 3DTXA 3N1GC 4KZDL 5C2BL 5CP7A 4WUKL 2L0DA 2Y06L 4RMTA 4HGWA 1JHLL 4F15C 3LY6A 5IMMA 1ZT4A 2VDRL 1E6OL 3EDFA 2CLZB 3DV6A 4IS6A 2A6IB 2XKNB 43C9B 3S37X 5IKCA 3UAJD 5C6TH 3AFLA 3VFSB 4MJ5B 3TV3L 3W2DL 3UBXA 3CFCH 4OV6F 3AU1A 3UEZA 3TJEH 3ROOB 1F3JB 1X44A 3R06B 4F7MA 2HT4C 2NY3B 5CZXD 2ED8A 3FQWA 1LO0L 4P2RA 4MJIE 4CL7A 4R0LC 5IWLC 2XT1B 4Z95L 4YHIB 4LLVB 1JNHA 2E7LC 2A74A 2YZ8A 3FFCA 3MA7B 1IAKB 5JHDE 2W9DH 1UXSB 1AQKL 4BZ2H 1OAKH 3HZVB 4X6EA 4EBQH 4NN7B 1EZVX 1UZ8B 1A6ZB 2EDDA 5LGHH 4PJDB 4WUUA 3MLWL 1D9KB 1JGEA 5MENE 3W9DA 1TJIL 3V5HA 3C8DA 3B2VH 3HTLX 3M1BB 4M7LT 4KVNL 3FB6A 3OAYK 3UJJH 1NAML 4JHAL 4UIKL 3MV7E 3MLUH 4QGTA 4U7MA 3GMPA 3UMTA 1YMHB 1DQMH 1BFSA 2I9LB 2XA3A 4YBLB 1FZKA 3QI9A 5I66B 1C7TA 1LVEA 1C5DA 1EJOL 1I75A 5D4QA 2XNAA 3BIKB 1Q0XL 4G9DB 2HFFA 1KENH 2EC9U 4UT9L 1BJ1J 4MQXD 3I50L 4XMPH 4LSPH 1MCDA 1HHHA 4RAUA 2OTPA 4HDIB 1PEZA 1F5WA 3L3JA 1H5BB 3VI3F 2YWZA 1T4KA 4NN5C 1YEGL 4Z0BH 3DNKA 5KSUA 2DM2A 2VL5A 1CZ8H 4WU5A 2IALA 3NFNB 3L1OH 1LGVA 2A83B 2DL9A 2VDOL 3FHAA 1AXIB 5JIPA 4XHJD 4WW2A 4I0PA 3QIUD 1OT1A 1WEJL 5E9DD 3NA9H 1S7RA 5HGBB 1MFCH 4LU5H 1KCVH 3KPLB 1OLZA 1M05B 5K9JL 2BERA 1AXSB 5C0FB 1DBBL 1DUZB 5C70A 1DANU 3PL6D 1I1YB 2CIIA 4ALAH 2QSVA 2WQRA 4ESKA 5JUEH 1N7MH 4IRSA 5KVMC 15C8L 5CJXC 3C5JB 4KTEH 4XMLL 2YA2A 2YD9A 3MRQA 3W9EA 3FZUD 1INQB 4DAGH 5GRVL 2J3SA 2WV3A 3RDTB 1OCWH 3DVNB 5IVXF 1OSPH 4PB0H 2VOTA 1FO0B 1HNFA 4A2MA 5I16B 1I1AD 5DJ0A 4NZDA 1MHHB 4QXTB 3RHWF 3MTRA 5E5RB 1A47A 2K9UA 4MDIB 3RTQD 2J8UB