The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
216
|
structure length |
213
|
Chain Sequence |
EVQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLELIGWIDPENGNTIYDPKFQDKASITADTSSNTAYLQLSSLTSEDTAVYYCARDTAAYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKKIP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of murine Fab D3 at 2.4 A resolution in comparison with the humanised Fab D3h44 (1.85A) provides structural insight into the humanisation process of the D3 anti-tissue factor antibody
rcsb |
| molecule tags |
Immune system
|
| source organism |
Mus musculus
|
| molecule keywords |
immunoglobulin Fab D3, light chain
|
| total genus |
40
|
| structure length |
213
|
| sequence length |
216
|
| ec nomenclature | |
| pdb deposition date | 2001-10-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
