1K6QH

Crystal structure of antibody fab fragment d3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
213
Chain Sequence
EVQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLELIGWIDPENGNTIYDPKFQDKASITADTSSNTAYLQLSSLTSEDTAVYYCARDTAAYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin Fab D3, light chain
publication title The crystal structure of murine Fab D3 at 2.4 A resolution in comparison with the humanised Fab D3h44 (1.85A) provides structural insight into the humanisation process of the D3 anti-tissue factor antibody
rcsb
source organism Mus musculus
total genus 40
structure length 213
sequence length 216
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qH02
4AENA 1W0WB 3IDJB 4F7CB 3LSOA 1OY3B 3QUMA 4NCDA 5JUEL 2DB8A 2AV7A 2BNRD 3JWDH 2JB5H 4KUZH 1K6QL 1FN4A 2IPUG 1CD9B 2XFXB 1JBJA 4TOYL 3MA7A 3L9RB 5EU4A 3SDCC 4HIIA 1KCKA 1W2KT 1WSST 3GMRA 1ZT7B 2MHAB 2IBGA 4DVBA 3GBNH 1SY6A 2NY1C 2MCG1 3MOBL 1SM3L 1AXSA 1MQKL 4JHWH 1KTLB 4BH7A 2LABA 3DMMC 4UNTA 1LO3H 3QPQD 4WENB 4AL8H 5K9OB 4GG6B 2R69L 5SX5K 1T21B 5JXAH 4O2FB 3QP3A 5GS0L 5IEKB 2EXWC 2APXA 2X7LB 2H2PD 3GIZL 4TTDC 3FN0L 1FSKC 2DLFL 4M1GH 1IGML 3CZJA 3L6FB 4MNQB 2R2HB 5F3BB 1JZ4A 3BZ4A 1II4E 2Y23A 4BKLB 1MY7A 4LGPB 4P5KB 3MXVL 4N0RA 2UYLA 5A2FA 3IS1X 2UY7A 1KPVA 4XHJC 3CXDH 3LB6C 3REVB 1T1ZB 4E42B 4I3GA 1QD0A 4R0LA 3SE4A 4NN5C 4HHAA 4OT1L 5L7XH 4XPFH 3QRGH 4P46B 3QDGE 4FQ1L 2OJEA 3U7YL 2IH3B 4Y2DB 3VFSB 1KEGL 2BVYA 3SKNB 1RZ7L 3J8F7 4R96B 2Q8BH 4PJEB 3BUTA 1H8NA 3NABH 5D1XC 1CDBA 4P4KD 5JQHC 2W9LA 2ZCLL 3ZE2F 1UA6L 2IG2H 1ETZB 1BECA 4OCYL 1NLBL 1MRDH 2H6PB 3MRBA 1DBKL 5CWSB 3MRNA 3BEWA 1EAPB 1R3KA 3HG1E 2IANE 1IL1B 3NPSB 1NCCH 3I75A 3H0TA 3NPZB 5AD0B 2NXYB 1MJ7L 4PJDF 1A1NA 5CSBA 3SDAB 2F5BL 2G60H 3LEXA 1BOGB 2NY6D 2IQ9H 1YEHL 4EJ1C 3L5IA 1G7JA 1UXSB 1C7TA 4QRPD 3MJ9L 2CJUL 1W0VB 3VD5A 3IDGA 1SYSA 3QBTB 3QQNA 4KV5F 3UTSB 4S2SA 1U92B 3BZDA 1EMTH 4P2RD 2A77L 3T77A 1DLFL 4OFVA 1WICA 1UCBH 5SX4I 1BQHG 1Q9KA 4LRNH 3FB7B 3VRJB 1IC4L 4YDLB 2ARWA 5A16B 5L0QB 5F7YC 1P1ZA 1IAKA 5I18L 1S7XB 4YE4L 3HUJA 3O2WL 2RIKA 3GO1H 1EHAA 5I0DA 2Y4SA 3TNMB 3CSGA 2FEDC 3R8BB 2HJLA 1YEKH 2J6EL 4CDHA 2FLBT 5BO1L 4RDQF 4Q2ZB 4YDKH 4JPWH 1E4WH 2VIRB 5IB4B 4LVHC 3BT2L 2Z31D 1A21A 4OM1H 5SWSD 3F12A 4WNQB 3VFVB 1Z9OA 4Z76A 1JHKH 1DANT 3ZE1F 3VE0B 4LSQL 4ELMA 1XIWA 5C0AE 5LCVL 1CLOH 35C8H 2CD0A 1XCTB 4C57C 3G6DH 5FXCH 1ZANL 3KNBB 5HVHB 4PTTA 3LPGA 1U8KB 3QO1A 3ZDZF 1IAMA 4HK3N 1ZE3C 1A7OH 2QQKL 4P2CG 4YIQA 1IT9H 1JTPA 4JFXB 5DJYA 4HUWB 1MVUA 2X44D 4QRRB 5FCSH 3MLYL 3IVKB 1E27B 2HTKC 4YNYB 5GQBA 5E99L 1SJXA 1IC7H 5LWYL 2W0PA 4MJ6A 5BVJA 4F7TB 1LWRA 4MNGB 4PY8J 5KW9H 3CXHK 4N0CD 5F7UA 1SJHA 1N5AB 1CDIA 3HFMH 5ETUA 3DECA 2LAGB 4W4OA 2AXGA 1IEBA 5DJDA 1P7QD 3KPQA 1GOHA 4ZXBD 2XZCH 4QRUA 1CS6A 2XA8L 1CXFA 2YD2A 4TUKL 1O7SA 1CXIA 3QEHB 3U9UB 4YQXH 1BQLL 1G7MB 4WEBL 1NKOA 4HDIA 4MDIB 1SEQL 3NZ8A 2V2XA 3PJSA 1ACYL 1CICB 4P2OC 1A7BA 3O2DH 3PQYE 3UYPA 5I66B 5DUPL 1SVCP 3FO0L 2IPTL 2NW2A 3A6BL 4V1DE 4G9FE 2YR3A 2W38A 5BRZE 4DCQA 4TNWK 1MHEB 3CUPB 3RTQC 3CFBA 2AJZB 3B6SA 5TF1H 3RWEA 5E70A 2XRAH 4XCFL 1YY8B 3WJJC 2NY3C 5J11C 1AXTL 1KJ2A 5FM5O 4MXVF 1RK0B 3P4OB 1X5AA 5JUEH 3ZKNC 5C0NC 2PTUA 4RBPK 1XR8B 1EJ6A 4U6TA 4ONHA 5C0BB 5DHXB 4DEPB 1WAAF 4ELKA 3F5WA 3QULA 4PJXF 2VLRB 4U05A 2VLKA 2FHBA 4GBXD 4MX7B 4IS6A 5CD3A 2OSLB 3KPRA 1UXWB 2APWA 5ELIA 4C4KO 1SM3H 1MQKH 4LCUB 5HHQB 3DVNA 3AMLA 2EDRA 4DGYH 1W8OA 1K2DA 5DS8A 2BNRE 3SCMC 2IAMD 5GGUB 2O5XL 5I1IH 2C1OB 3O8XB 4S1SH 5CIPB 2R4SH 2R69H 4HIEA 4JRXE 2DD8L 4QRSB 2DQHH 2X9WA 3TBTA 3UP1A 3S4SA 5GS0H 1DN0A 3FCTA 3GIZH 2C4FU 2DBLL 3FN0H 4MAYC 4O58L 4I0PD 4Q6IA 3VI3E 4X0KA 2DLFH 3OPZL 4ZFFA 3BP7A 3KG5A 3VI4E 1PX3A 3DX6A 1A64A 3QJHA 3QEQD 4HS8L 3MXVH 2RHEA 3BYTA 3QUZC 3AAZB 2VSCA 3GMPB 5GS2D 2P43B 1MSPA 4OT1H 4ZTPL 2FLRT 4XXCC 4ODWA 1MH5B 4NO2B 3PIQB 3VFMB 2DQGH 5C08D 4I2XE 1LNUA 2DWDA 5EFIB 5E7FA 3RA7L 5E6IC 5FO7A 5IBTL 4DZBB 1EO8H 1RUQH 1RZ7H 3JBG7 5EUOF 4LASL 2B1HH 1IM9A 1UJ3A 4ZO7A 3Q48A 1I9RL 2Y25A 1CXHA 2ZCLH 5FHBL 1UA6H 3KPPA 3I84A 3PHOB 1OARL 4L29B 2NY2C 1CFTA 2QKIB 5BV7B 5E24E 1T0MA 1CQYA 2W9DL 3MLVH 1DBKH 3V5HB 5AAWA 4OLYL 4PJFB 4NM8L 4UUJA 3CFEA 4BZ1L 3WDIA 3EDDA 3NZHH 3ZO0A 4M6AA 3NIDF 4ZPVB 5E8PB 4ODVL 3P0VL 2F5BH 3KLHD 5F1OB 1D6EA 4ZUWA 1FO0B 3AB0B 5D96C 3OJDA 3DV6B 5DC0A 4Z5RB 3JUZA 1YEHH 2ZOLB 3I6LD 4ZAKA 2JKXA 3MJ9H 2CJUH 4MZ3A 4RA3A 1J8HD 1XF4A 4QHMB 3SJVB 3EO9H 1ZLUH 5DD5H 1BIIA 1P69B 2A77H 1MRFL 2EE9A 4QHKJ 5K59F 1DLFH 5EBMA 4R26L 3H42L 6FABL 1Y6MR 2E9WA 4HWUA 2A74B 5DDHB 1ROWA 1JF6A 3V6FB 2OS7A 1SBBA 2YD8A 3T08A 3P2TA 3O2WH 2CGRH 4KDVA 4K8RH 2ADFL 3CX5K 5TQ0H 5HYQB 2EDTA 4OGAC 4JKPH 1DBBH 4C55A 3T1WA 2NPLX 3ARBB 3G08A 4P2RE 5EU5A 5BO1H 3HZYB 3GIVA 3M45A 3O9WB 3BT2H 2E8ZA 1ND0A 4JFEE 3X3GL 3HMXA 3WHXA 2W1NA 4M7KL 4HLZH 2EC9U 1AD0B 4FTVA 4PJAF 3MRDB 4LSQH 4D9LH 4XVUD 1VGEL 4XPHH 1G9NL 4LQ1A 5LCVH 4NO5A 5HYJD 5HPMA 3H9SA 4I9WD 4MJ2A 1ZANH 1K8IA 1M71A 1CGWA 3CSYA 1E28B 4IRSC 2QQKH 4WFEE 2H9GA 5LGHL 2R0KL 4PRBB 1T7YA 4MA7H 1T2QH 1RZGA 1RJYA 5SWSE 2V7NB 1OHQA 2LU7A 3O3DA 2AS5M 4U31A 3FQNA 3I02B 4MWFB 3F58L 4A6YL 2P5ED 3QHFL 1FGVL 1F6FB 5D6DC 4WW2F 1U3ZA 4WTXA 4KKAD 4OLVL 3CZFA 1A4JA 3VH8A 4JG0H 4KK9D 4M03A 5C0DB 3REWB 1BQLH 4NM4L 4OV6F 4QXGH 3MROB 1N0LA 2DMBA 1SEQH 3FHAA 4PJIB 4QO1A 1X5IA 3D0LB 1ACYH 2A6IB 5FUZL 3C6SA 5DUPH 1YNLL 3FO0H 3UROR 3A6BH 4U0QB 3MLZH 1KIPA 3IU3B 1HXYB 4I0CC 1HKFA 3W0WA 4EN3A 5I2IA 2GW5A 5FOBB 2GI7A 2BX5A 3VFGL 1N6QL 2B5IB 4XCFH 2FX9H 3FZUD 1I9IH 2I5YH 1LD9B 3MO1A 3LQAC 2FX8L 1RJZA 5TDPB 3GMLA 4XBGB 2EO9A 2I9LA 2WUCL 3AM8A 3BKYH 4WHTA 5BMFH 3T3MF 4D9QD 2HKHH 3LKRB 1R3HB 2JJSC 2BNQE 5F6IC 3KXFD 3F62A 1U95A 3MRFA 5EIVA 4OCXL 2ZUQB 3TYFB 1OGAD 1XMWA 2YD3A 3ARED 1ZTXH 3FMGH 4LARL 3EIFA 3ZT5A 5JXED 1LP9E 4NZJA 2EYRB 1EDQA 2CIIB 3HZMB 1VACB 2FJFB 3QI9A 4EI5C 2CXGA 2XTJB 3B3IA 3BEVB 3TF7C 2O5XH 2WV3A 5C71A 3V6OA 3KPNA 3MRQA 5EC1B 2G75A 5DRZB 2DD8H 5EIQA 2CKBB 2V5MA 3DURA 2CK0H 1P4LB 3SQBA 5E9DB 4U1NB 4S1QL 4CADB 2DBLH 4UB0H 4O58H 3V8CA 4KFZC 1CLYH 1XZ0A 5H8DA 3D3VD 4JGMA 4N8VA 4R4BB 1TPXC 3X13B 5C07A 3GK8L 4NO0D 4YXHL 1FC2D 4PG9B 4HS8H 5IVXE 3E6HB 4HXBL 5IJKA 2WMPA 1V05A 5HDQH 3ZLQC 1KLGB 2PO6A 3JVGA 3T65A 4WI4A 5GRVL 1QYGL 1N5YL 4QT5B 4NZTH 1YC8A 4OLZL 4XXDA 1JZ8A 5D2NB 4KKCC 1VADB 3B2VL 5ICZA 1BQUA 3HZVB 4LASH 3SDXF 4TSCH 3QEQE 1DEEB 4IMKC 3OF6A 4WDIB 4R6UA 1PG7L 4PJBB 1I9RH 1BZQK 4L4JA 3RWIA 2VH5L 3PL6A 2QADC 4OCSL 3VD9A 1OARH 4JKLA 3OGOE 2W9DH 1JN6B 1WT5C 4X6CA 3T4YA 2OBGA 4OLYH 5A2IH 4NM8H 4OZFB 5C08E 4ZUUB 3FFCA 4ZNCD 4JM2A 3OKEA 4HG4J 3NCBB 3SBWA 2I25N 1TQCB 3P0VH 1QLFA 3LS5L 4Y5XC 4HLJA 1YMME 2HT2D 1U42A 5CJOH 3AVEA 3R0NA 5D1QD 4F7MB 4JB9H 4I48B 3QSKB 1I8LA 3RIAK 4NRYB 3RUGF 3SGJC 3RIFK 1MRFH 1UH3A 4G8GA 4R26H 1T5WA 3H42H 5DK2A 1GVIA 7FABH 4PJCF 3MBED 2P8PB 1I7TB 1CTNA 2E9IA 4Y5VC 3T1FA 4P48A 1OSZA 3VXRD 3P30L 2EEAA 1C1EL 4M6OH 4A2MA 2Z0BA 1JNHA 3C09B 1MLBB 3I6LE 3RVXD 3NH7L 1JCKA 2GFBB 4Z7WA 1J8HE 3G6AA 3ARFD 1N3NA 2NLJB 5GZND 2AK4B 2BXZA 5CINL 5GJTL 3LD8C 4NQVB 2Y07L 1YNTA 1C7SA 3GHEH 5FCUL 2PN5A 3X3GH 2OMBA 4L3AA 4RNRB 2MCPL 1YEFL 4HXAL 4M7KH 4KI5F 1YEGL 2E7CA 3GGWA 1KTRL 1U93A 3NAAL 4OUOA 2PCPA 2JCCB 1M7DB 1ZAGA 1BF8A 4GAJH 1ZEAL 1GC1C 1X6LA 4H8WH 1G9MC 4XCYB 3BZFA 3V5KB 5HYSB 3OKMB 1NC4B 2R23A 3UEZA 3OMZA 3P4NA 5FFLA 3JV6B 1JI2A 1JNJA 3IT8D 1AGDA 3EFDL 3WUWG 4G6FB 3F58H 4A6YH 3L3OB 3WFZA 5DWUL 4HKBB 3VFPB 1CVRA 1FGVH 4I9WE 5MI0B 4KJQC 4OZIE 2BRRL 5C0EA 5CJBA 4OLVH 5KSAB 2C4XA 5HJ3A 5HI4C 3S35X 3TA3A 3PGFH 1JFQL 1FRGL 1IAIH 1MI5A 2X70A 4GRWB 1BP3B 3BH9B 4NM4H 1D5IH 1EVTC 1JPSH 2BOBA 4XPBH 2COQA 4D0CB 4P59H 2ERJC 4LAQL 1OW0C 1JJUA 1TZHA 4NZUL 2P5EE 2X4UA 4PGBB 5DHYB 5FUZH 2E6JA 4RA0C 4CUCA 4HKXB 1YNLH 2BSRB 1YN6B 1A02N 1BQHA 4U3CA 3UBXB 4JAMA 4JZJB 1KT2A 4WW2C 1F8TL 3QWOA 1UVQB 5HGDB 1IGYA 5FKPA 1G9NC 1JIBA 3VFGH 4KK8D 5F1NB 1N6QH 1AGCA 2WWMC 1AC6A 5FGRA 1DQTA 1S7VA 4FOMA 5HGGS 4IM8A 2SEBA 3GMQA 4IRJA 4FXGB 3UDWA 4UIKL 5FO9B 4LCWB 4WU5A 3VFOB 2WUCH 3O11B 5F96L 1EERB 3L1OH 4JFDB 4LLYB 4XP4L 5DUML 5SWQA 2X89A 3INUL 4UI2A 4NQDA 3P40A 1I1AA 5EOQL 2IWGA 2P47B 2HP4A 4MB4A 3ARGC 5I1LB 4DK6A 4HGWA 5GPRA 4LARH 4WI6A 1ZGLP 1BD2A 4WI9A 4PJ8A 4P99A 3RNKB 4YO0B 2AV1B 5C0JA 1GHFL 1MUJB 3K80A 3LEYL 3VXPB 1GGIL 4D9QE 1AP2B 4PV8B 1KB5B 5DVNA 3K1DA 2MFNA 1OP5H 4K94H 3KXFE 2ARJA 4JHAL 3WE6B 4S1QH 4KVNH 4OSUH 5DHVA 5F97E 1OGAE 3VFNA 4HFWA 3E2HB 4HJJH 4X6FB 2FJGA 3U30B 4DJMA 4ZDHB 2BOCA 3KDMA 2EDQA 3AY4C 3VRLE 3GSVB 3S9DB 1R24A 1UB5B 2H2SC 2OTUB 2DIBA 3FTGA 1LEKA 2NXZD 2AGJH 4U1JA 3DIFA 1CI5A 1NMBL 1MHHA 3CXHJ 2X2YA 4NQEB 2XG4A 4OLZH 4Y2DD 1A6AA 4XZUA 2DBJA 3BVNA 5J13C 3D3VE 4GO6B 3IGAB 1HNFA 4YUEL 1EGJL 2V2WA 5FKAB 5CEYA 4PRPA 1PG7H 4X9HA 2ZPKH 4LVNC 3DVFA 4ODBD 5F7NC 3WNOA 3U0PB 4F3FB 2UWEF 1M05B 4OCSH 3MACL 5GGSA 4ENEC 3ZL4H 4N5EC 3MUGA 3ARRA 2FIKB 2NXYD 5EPMB 4UDTB 1FYTA 1JPGA 3S8WA 5KVFL 3SDAD 4OZHB 3D1MC 3PGDB 4ZFZA 3V52L 2OJZH 5DJXA 1G6RL 3NIFF 1B0RA 1QHPA 4UOW0 1RPQA 3VWJA 1U8HB 3RDTD 1FV1B 5KZCB 3UTSD 4BSVB 1CFQA 2GK2A 4XAWL 4K7FB 1I8KB 3U2SA 3A6CL 1OT1A 2GSGB 4Q9QL 1KLFA 4NQUA 3KYMB 4LLWB 5ESAB 2HT4D 1D5XA 4TQEL 1WZMA 4OCNC 2ITCA 1KYOK 3EZ8A 4HC1H 1IGFL 3LDBC 4WU7B 1KOAA 2Y6SC 5ENWA 5I76B 1CBVL 4FNLL 2VN7A 5D7IA 3IXTB 4GKZA 4HUVB 3MRPA 3MRMB 3P30H 3GSXA 1KPRA 4PJ9C 3IRPX 4YK4B 1HN1A 3B9KB 3HNTL 3NH7H 4YC2B 4DAGL 4ORGB 2VABA 4RAHA 5C0CB 3IJHB 3VXSD 1NAMB 1KN4L 5GJTH 1FJ1A 5CINH 5LGJA 4UAOC 5IR1A 2E9BA 3A0OA 1AGBB 5IB1B 5E2JA 1NGWA 1YEFH 4Z7VF 3BW9A 2Q7YB 1NBQA 1YEGH 1S7QB 3VXRE 3NAAH 3VFTB 3TIEA 3ET9F 4WY7H 2FH6A 4KY1L 1JNLL 1RZJL 4WO4A 2R8SH 1FPTL 2R2EB 1PY9A 3PP4L 5CJXA 1ZEAH 4KK6C 4GOSA 5DK3A 4F33B 2E6QA 4P9MH 1MF2H 1MY5A 3IFNH 1KIRA 1JYWA 3V7MA 3MLUL 5I17B 5IFJA 5DZLA 3STLA 1VFMA 4HIHA 4WIQA 1P7KB 3VXMA 3EFDH 4M02A 1YUHA 2I24N 2MQ3A 4OD3H 5DWUH 1IJ9A 4OZGE 3SE8H 4KI5C 4X5XB 3QB7C 1UZ6E 5MEQA 3CFKA 3HE6B 4ALAL 4MD5A 2Z91A 4GRMB 1EEYB 3QNYB 4MB5A 4MMXC 5HYEA 3RZCD 3V4VH 1FRGH 3WXVL 2X4NA 3PDDA 1XH3B 3QDMB 3M17A 1FNFA 2NY0C 4PD4J 1CICD 4CVZA 4M9OA 1U8JA 1EH9A 3ARQA 3CSBA 4JFZL 4EVNB 1IE5A 4LAQH 3MYJB 5DRXB 4IIQC 1TJHL 2BRQA 3TZVA 1S9YB 4HS6A 3RY6C 3SDDC 4YPGB 4H88L 2CUHA 1ZHNB 4XI5C 2AJVH 3MRHB 4CVXA 1U3HB 3V9FA 5DQJB 4PY8I 1F8TH 1TETH 5TFSH 2HKFL 1F5WA 4JPKL 4Y4KD 1HNGA 3QDJD 3I6KB 4QHLA 1CFSA 3NCJH 3S34L 1QLEL 1IEAA 5FK9B 2J5LC 2C4FT 3DI2B 4LSSL 2HTLD 5ILTL 1LGVA 4L3CA 3HRZB 4XP4H 1V7ML 2Q8AH 4EOWL 3INUH 2UV3A 2BVOB 1D5MA 2Z93A 5LKNA 3WJLC 2K7PA 4EDWL 5J6GA 2O61A 4H0HB 1IGTB 4PLNC 5HHOB 3SKJL 3O8XD 5GS2H 2VUOA 1BIHA 4Z9KB 3U82B 3O4LB 4AIZA 3RVTC 1M6OB 1GGIH 1ORQB 4K23H 5C2BL 2MNUA 5D1ZC 3QPXL 1G7PB 4XVTL 4NWTL 4HH8A 4JHAH 3N85L 3UO1L 4X6DA 2VQ1A 2MTPA 4YFLI 5B38B 2D03H 3TH3T 3QUXB 5I15H 3RKPA 2P48B 3B2UC 5IHUL 3LN5B 1CDJA 5GRXG 1OP3K 4GG6E 1HHHA 2DM4A 4Q74A 1MCSA 3LRGA 5C0IB 5D5MF 4QXUL 1R5IA 5DD6B 4PJHB 5A2KH 2VZTA 2OTWB 4LNVA 2OM5A 1Z9LA 5FYJU 1NMBH 3FO2A 2G9HB 2ZZUT 2P1YA 3MZGB 1MHCB 3AMKA 3HC0A 1A47A 4U1SA 4APQA 1G7LA 2R29L 2NZ9D 3S5LB 3TO4A 4I5BB 1JYXA 3WN5A 4NZRL 2H26B 4G8EA 2DTSA 4ZMAT 1T0NB 1UM5L 3RU8L 3R06B 2ADGB 3ZHDA 4G5ZL 2ADIB 2BNUA 4J6RH 5IV2A 4M3JA 5I6XC 1WWWX 4XWGL 1SJVA 2ATPA 1KJVB 1KG0B 4I18A 4R7DA 3QIWB 4PJEE 5I8EB 3T8XA 1ZLSL 5JHDA 3O0RL 5IEHB 1G6RH 3N9GH 4U1LB 2JIXB 32C2B 4NSKB 4YDJA 2HG5A 4XVSH 5K9KA 1QSVA 4MAYA 3SJVD 3O2DA 4UDUB 1WC7B 3N06B 3MV8D 2DQJH 3A6CH 1EEZA 3GFUA 2EC9T 4KUCD 5DMGC 2OMNA 4QF1B 3UPRA 4O51B 5CSZB 43C9A 3T0EC 1C12A 3FFDA 1IGFH 1FORH 3FOMA 3FQTA 3SDYL 5FYJL 3FT4B 4LHUD 4BELD 1VPOL 1PZ5B 3F6IA 1J05A 2EYTA 3ARBD 3UTSE 3HNTH 5F7EL 4F37F 3ZZ1A 2V17L 4L1DA 3D0VA 2YN5A 1CK0L 4IOFD 5IWLC 5EO1B 5TH2A 3GDBA 1H8OA 3O9WD 3SY0A 1JWSB 3D6GA 4KQ3H 4XMKL 4YFDB 5KN5B 1HHJA 1KN4H 2DKSA 5EC2A 3SKUD 5DK0A 1LE5A 5MERB 1Q0YH 1H9VA 1KCUH 2XZZA 5F9JB 4EUPG 3O3EA 4QHKI 4XBPA 5DSCB 4AT6B 2DQIL 4RGNC 5K9QG 5DJ0A 1L0XA 2X1XR 4L4VD 1PAMA 2NZIA 5D7JA 4K7PL 1FPTH 2FWOB 3PP4H 2FNBA 3P9MA 3ALWA 1UZ6F 1U41A 1I3GL 3VXSE 1U8IB 3MJ7A 5CEXB 1UB6B 4GW5A 4HV8B 4MJIA 5E00A 3MLUH 2Y5TB 4NUJB 4RQQB 3BHBA 5J57B 3RX8A 4M7LT 5I9QC 4I77L 4Y16C 5HVGB 1DE4B 3ARUA 5HHXH 1FFOA 1X7QB 4Y1AB 1S9WA 2BVPA 2JJTC 3P77B 2P24B 5D2LB 1F6AB 3BP5B 2NW3A 4ALAH 4YBLC 4QRRE 3VGAC 2LE9A 3W39A 5MP6L 3ZYOA 4HH9A 1FNGA 2YD9A 3MMEA 3FONB 4FS0A 4MNGE 1SEBA 1TJHH 3ILQC 1LO5A 3C8KB 2A9NL 4H88H 4HK0A 4XPTL 3S96A 2QHLA 5LQBL 2GCYB 1MVFA 2MWCA 1Q94A 3PWPB 1PW3A 3MGTB 3IKCA 2FEEL 3I3DA 5E94B 1GPOH 4OFYA 3SDCB 2HKFH 1LO2L 5TDOA 2G5BB 2NY1B 3IF1A 1IGIH 1RZJC 3S34H 5KVMC 1QLEH 3F7VA 1QFWL 1VEMA 2F53B 5E8OB 2FECL 1KIUA 4ZSOA 1XT5A 3DMMB 4LSSH 4NN7C 2HN7A 2BVEA 5ILTH 4L8BB 1QRND 5IKCB 3CDFA 1LEGB 4N0FA 1I7ZA 3MJ9A 4EOWH 4WWKA 3MXWH 1S7RB 2NR6D 3S3JA 2GITB 5TDNA 4CMMA 1FSKB 1OTTD 3G5VA 5CLWA 2YMXL 1DDHA 3QDJE 2V2TB 1OAYL 1YDPB 1J0ZA 5EH1A 5SV3A 4E41B 5BOPA 2XTJD 3W11C 1IAII 4OUUA 5BZDA 5L88H 5ITBL 1MCNA 1BLNA 1EPFA 1OCWL 2IQAB 5E9DD 4NN5B 3K4DA 4UT9H 5T5FL 2PXYC 1A7PH 5KTEH 3QPXH 3WUWA 3N1QC 4XVTH 5CHNB 1IRAY 3ELAT 3LIZL 3N85H 1ORSB 2J6EA 1FCCA 1T1WB 2Y5EA 5DQDH 3QZWG 3Q5OA 1A3QA 5DMYA 1MEXL 5D1XB 5IHUH 3JTTA 1N2RB 4CKVX 4JPVL 1T5XA 1AQKH 1ZGLM 4J8RA 4QXUH 2F9BT 5D7SL 1KIQB 3M1BB 2FR4B 1Z5LB 3L7FB 4HWBL 1MCLA 2FJHA 1FQ9C 1AFVL 1QFPA 8FABB 2PW1B 2R29H 2OK0L 4NZRH 3HR5A 2UVEA 1A1OA 4YDIL 1ZA3B 3EHBD 4KXZI 1UM5H 4WI3A 1NJ9B 3C8DA 2X4SB 4O9HL 3IDNA 3MRJA 4G5ZH 4HT1H 5DUBA 3DETC 5INDB 5DEFA 3K0WA 4PREA 5EIIB 4RZCB 2C1PA 3BOVA 3Q6GH 5D71H 4JFOA 1KTDA 1EHLH 1L0QA 1H15A 3Q2CA 2Q20A 3LKPA 2VDRL 4K7PY 2C3VA 4XH2B 4DUXA 3AC0A 1ZLSH 4LLMB 2R9HD 4ZUTA 4KDTC 5CZKA 2WZPD 3U46A 2Z4QB 3V6ZB 1UEYA 1I85A 2Y36H 3V0VB 3GJFA 4LPVA 3WFHB 1I7UA 4PJFE 2HA1A 3GI8H 1FZKA 4J23A 1JGDB 4JN2B 5GZOD 1R3LA 1HHIA 4ZPTA 1VSCA 2VXVL 1A6ZB 3QIUA 5ERWA 2PTTA 4U1HA 4X8XA 4FFVC 2Q87A 1XF2A 1JF1B 5EN2A 4IMLB 2EIDA 5IG7A 1ZWIB 3EYFB 3UYRL 3PHSA 4Z7QE 1MIML 1TZIA 4LPWA 1VKXA 3SJVE 5E5MA 2O5ZL 3IAGC 5F7EH 3TO2A 3O6FB 2V17H 1DSFL 5T33L 3C60C 1CK0H 4MA1B 4X99B 4Y4HA 1CU4L 4S11A 3MRCA 2ZOKA 5ALCH 2ZUWA 2VDOH 3DGGA 3LKSB 1H3TA 3QDGA 4Y5YA 3V8OA 3BMWA 4IMKA 1A9BB 4LSDA 3MRRB 5IMOB 3G5YA 4MZ2A 3C5ZA 4LLQB 4L8CB 4UNUA 4LPCA 3GB7B 3P11L 4HWNA 5KSUB 1FIEA 1RULL 1FNLA 1C16B 2XN9B 2EYSB 1ED3B 1YQVL 2VYRE 4X7TA 5C3TA 3DVIA 1VFAB 4P23C 3V0WH 4LSVL 1NC4D 5BXFA 2VLMD 3U0WL 4LNRA 1FAIL 4ZG1A 4NNYB 1CLZH 5FF6A 2IANA 3HNVL 3I6GB 5F70A 2EKSA 5IFAH 1HDMB 4TNVK 3V4PL 4G6FD 2BJMH 4ZQKB 3U0TA 5F88A 2IJ0C 3U36A 4I77H 4P2OB 4GG8B 2EDHA 1XR9A 4Y4FA 2LTQC 3DUUB 4L4VE 5KSAD 3OSKA 1R0AL 1FHGA 4WFGD 1QFWM 5IHZB 3RVWD 2DDQL 3RTQB 3QT2A 1BZ7A 4M6ML 4JQVC 1QBAA 1D9KA 4PJ7B 2YZ1A 5HHNB 3L5WB 5IP4A 4JN1L 5MP6H 3OXRB 4TSAL 2NY3B 1NEUA 2B4CL 1CDGA 5J11B 1N0XL 3IKKA 1V8HA 2X4QB 5T1LB 1SHMA 2A9NH 2PYEB 1OTSD 1X3DA 1RUAH 5IROA 3O41A 1IM9D 5LQBH 5MEOB 5TGBB 1U8MA 3DROA 2XXCB 3EGSA 3BZEB 5ESQA 1Y18A 1CT8A 2I60L 5CKGA 1NH6A 1JGLL 1LO2H 1UG9A 2W0FB 5J0BA 2HLFC 3FOLA 4G3YH 4DGVL 3WHE1 5C0AA 3SCMB 4I13B 1F4HA 5E2WL 5IVZA 4YX2H 4GW1A 3LZFL 4X5LA 1F45A 2F54B 3O3AB 1HSBB 3ULVF 1XF5A 4DTGL 4HULB 3D9AL 5IW6A 1QLRB 4JO4L 1J0YA 3TJHD 2VAAB 5I8CA 4LBEA 1LDPH 4WUKH 3TESA 1IGJB 5JTWA 1KUMA 1CD8A 2QSQA 1OAYH 2X10A 1VGKB 4JHBA 2DM2A 4G9DA 1FLTX 3TC9A 4MCZA 3TIDB 1PKQB 4POZD 3QUZB 5BQ7B 5GS1A 1P2CA 4NRZB 4KRLB 1OCWH 3T0AA 1QRNE 3EO0A 1NANH 3DX9A 5J12C 1YEIL 1AQDB 2C7UA 1OW0A 3LIZH 3Q5TA 5E6IB 3JXAA 4K8RC 3Q3GB 5F1IB 4QWWD 2XTJE 1MEXH 3PQYA 5BV7L 2VC2L 2DL2A 4N8CL 4UQ2B 4V1DA 4G9FA 4FTVD 4JPVH 3L3JB 4KKBD 5ID1B 3N1FC 5BRZA 2FD6H 3QH3A 1ZXQA 2YBRB 5E9DE 12E8H 1J11A 1RZKH 3H9SD 3BN9C 3OR6A 4PRIB 1FO0L 3QRFM 5IB2A 3B9DA 2BC4A 4G7YL 1BZ9B 4PLKD 2BSED 4Y88A 4AIOA 2OLDA 4JQXA 4LIQE 3VD4A 2OK0H 3NCYP 4YDIH 1T66D 1WCBA 2BDNL 3BEWB 5B3NA 4YHNA 4JY5L 3H0TB 4O9HH 2BCKA 5J7CC 1MLCB 4A6YA 4X4XB 3BE1H 4QY8B 1MPAL 3WFBL 3RVVC 4LOUC 3M07A 5D2NE 1G7JB 1K3IA 1E6JL 1RIVL 3ZDYF 3ZDXE 3VFWB 4P46C 2VDRH 1AC0A 3WEXA 3BQUC 1FL5B 1U8QA 5KZCD 1AKJA 4ZUSA 2GYSA 1WF5A 3TFKC 4PJDB 3PWLA 3ZT7A 1Q9LB 4HD9A 3D48R 5HI3D 5ITFB 4JRXA 2RAMA 3CFJB 1E4XL 4ZS6C 1UQSB 1GIGH 2AERT 1A7NL 2ZUUA 1T22B 4RMTA 1IAKB 4YGVB 1KCSL 4MA3B 4NC1E 2Y9RT 2AXFB 4JGJA 2VL4A 5IB5B 1VFBB 3W0WD 4NC0B 4EN3D 3K1KC 2HJLB 1X5JA 1EZVX 4OGYL 2MQ0A 3B9KD 4U6YB 2R1XA 1UM6L 5IUSA 1MIMH 4MD0A 1QKZL 4WW1A 1BPVA 5L2JA 3QWQB 2R2BB 3SGDH 5C0CD 2O5ZH 2FZ3A 5CGMA 1DSFH 1CU4H 2YN3A 4FQQB 1AIFB 4IRSB 4NRXB 2OQJA 1G7IB 2AXJA 1ITBB 4I2XA 4NIKB 1INQA 1AGEB 1J0IA 1R5VA 1T83A 2IADA 2P49B 4Y7MA 3C6LB 1FDLL 4XPGH 1L4IA 4JFYA 4HEPG 4O2CA 2VISA 1RULH 5L0QC 2FRGP 4L8SC 2WBJC 2AQ3A 3NGBB 5I8KL 1YQVH 1J0JA 2IH1A 3EOYG 3BMVA 4HKJA 1MREL 3S6CA 1FL3A 2CH8A 3KLSA 3HNVH 5DD0L 1SJHB 3TVMA 1TLKA 1CLCA 3BH8B 2AP2A 1VCAA 4KC3B 5E8EA 3SDXA 2ZP0T 1JZ5A 3HE7B 4FMKA 2XKNB 5CZXC 2AJSL 1PKOA 3E3QE 1XGUA 4QTHA 2B0SL 4P4KA 5DQ9B 1KXQE 1R0AH 2A0LC 4LQFL 2EXYD 2DDQH 2VLME 4LRIC 3CJJA 4M6MH 3QDMD 2PO6D 3BO8B 4M00A 2GJZA 3FT2A 4PJ9A 3BKMH 4JN1H 3STZA 4PJIF 2YK1H 1A6VL 5I75B 3W81A 4TSAH 4PB9L 5FHAL 4RFEB 3RJDA 3D85B 3MLTB 2VLJB 2IALB 2Z92A 4GMSL 5IF0B 3U1SH 1U3HD 1CXKA 4XNYL 3PUCA 3OF6D 4KAQL 1R5WB 5B8CA 1KJ2B 4P2RA 4JZNA 4HBCL 2CMRL 5D9SB 4GRWE 3WV0A 4R3SA 3BI9X 3TCLA 5F44A 4JFEA 4OI8A 2Z35A 2X4PB 4MD4A 1BBJA 5CIPH 4F9LC 3ME0A 4OM0H 2CKBL 4HUUA 4DGVH 5KOVC 1JRHH 3QULB 4EI5B 3ABZA 3WLWC 1NMAL 2HWZL 4JY6A 5JW3H 3LZFH 2V7HA 4TULH 1H3XA 3BGMA 3D9AH 4EUPA 1T4KB 4DGIL 1WFOA 4JO4H 1EIBA 1XF1A 2VUYA 5KVDL 1A8JH 2HVJA 4LIQL 5DF0A 3RRQA 2OL3H 1DP0A 1R3JA 5SWSA 1TPXB 5HHOD 1WITA 4G8GD 5CBEB 2KKQA 3QUYC 4HC1A 4PJXB 3O4LD 1A22B 4J4PC 5GSRB 3O3BA 4JFDE 4XWOD 1J88A 1N64L 1MNUL 2F74B 5IFHL 1MJUL 5IQ9B 5GISL 3TYGL 5HDLA 3DX6B 4MS8C 2B4CC 5DRNB 1HHGB 3ULVC 4XT1C 3BGFB 4GXUM 3MPCA 1WTGT 5A1AA 3O45B 3RNQA 4PLJC 4UV4H 4TUOA 4ODWB 1B4JL 4P4RA 3EOBA 5BV7H 1P7HL 2KPNA 1P4BH 4N8CH 3KR3L 3VDAA 4UNVA 2Q3AA 4OLXL 1P7QA 2QADB 4JZOB 4MQXD 4ZXBA 5JPNB 5JHLL 3W5MA 1IC1A 2R0ZL 4HIXL 3VJ6B 3G04B 3H9HB 4OI7A 1DLHA 4NCC2 4G7YH 4FQ2L 4Y5XB 4PJBF 1WISA 1JGVH 5HVFB 4RMSA 4H8WC 5JW4M 3LMJL 4P3CL 3WIHH 1N26A 2IEPA 5EUOB 1RUKL 2ZSVB 4I0KA 3MC0A 5L8JB 2BNQA 4NQEE 1FZOB 1LK2B 1D6EB 3H9SE 4M6NL 3WFBH 4N0UE 3HI5L 4H20L 4KJYB 5AZ2L 3RKDD 1QNZH 1LP9A 4Y5VB 3SE3C 5ACMA 3DRTB 3P4LA 2KH2B 5D1ZA 4ZYKB 4LEOA 5T1KD 3P73A 4PRDB 3NOIA 3NBNA 4XNZC 3K3QA 3SO3C 5D6CA 4FQXC 4GH7B 3RWJA 1KCSH 1MCPL 4JPIB 3LD8B 4OZHE 1OLZA 5DD1L 3OKYA 4PRAB 3IDYC 4GBXA 1JWMA 1DFBH 5IVXA 3NTCL 4XCEB 3SKMB 2X4OA 2A2QT 5DI8B 3WHXB 4JEGB 3BIAX 2A83A 1YYMH 5H2BA 3QQ3B 3QZWA 1D6VL 1E6OL 1TVBB 2X89D 4I0PA 3VXOA 4DZ8A 1NPUA 5JORA 5B3JF 1I1FB 4NPYA 1I1AD 1K8IB 1OAKL 2FH8A 2JCCF 1FDLH 2HFGL 3QEQA 2H9GB 3TN0C 2H2PC 1UJTA 2VITB 3LQMA 4FP8H 4ODSH 3CCHA 3LKOA 3L95A 3HI1A 5C0CE 4PJAB 2RCSL 4F9PC 3S36X 25C8H 4G43A 1CR9L 4Z95L 5FA3A 4JFHE 3S37L 5C08A 1ZT1A 2BK8A 3BJLA 4YBQC 5DD0H 4AIXA 3TNNA 2I07B 4NNPL 5EBLB 5EG6C 2VXTL 1KCLA 1YMMA 4B0MM 1GAFL 4OI9A 4JCLA 3CVIH 4WCYH 2AJSH 1W72B 1S7WA 2B0SH 3N1PC 1JK8B 1ULVA 4W81A 2NYYC 4JDVB 4RMVA 3Q1SH 2D31B 4LQFH 4PGCA 5KSVB 3A6OA 5E2TL 4WW2B 4GRWF 1DBAH 2AJ3A 5EBWB 5BCAA 1A6VH 3MA9L 5DJ6A 2HJFA 5FHAH 3TT1H 2GTZB 3QXAA 3KYOA 1NDMA 3VFRA 5F21B 2YWZA 1EGJA 3ILPB 3MCKA 2XWBA 1MJJA 4QTIL 3QIBC 2H1PL 1J8HA 4KAQH 4PRPD 2VE6A 1BAFL 4LKXB 3IJSA 3N1MC 5I1AB 3SDCD 2FSEA 2NY6C 3QDME 5EOTB 3B4NA 4RAVB 3WS6C 3ARGB 2NY1D 3HCVA 3FB5B 4X83A 1AR1D 2Q76B 1FYTD 5A43C 5INCA 3DRQA 2F53D 3CK0L 1KB5L 5CS7A 4XAKD 1P4IL 4KGLA 1WZ1L 3CC5B 5HDBE 4HPYL 1G6RA 4KPHH 1F42A 2HWZH 1F3DH 1XGQA 3HPJA 2GSIA 1SJEB 3VWJD 1CXLA 5CP3H 2EXWD 4K2UL 1BX2A 4TTDD 3UTTB 5GRZA 5KVDH 3QI9B 3K46A 3WFCL 1INDH 5IVOA 4YEFA 4LIQH 4PPTA 2CDFA 1C08A 1NL0L 4U1KB 4X7CC 2XWJA 4EQ2A 3DURB 3MFFA 2JJTA 2C3HA 3T2OA 4WTZG 4XHJD 4XGZB 1WCQA 3LB6D 1DL7L 4FMFA 1HH9B 3C9NA 1OL0A 4G7VH 1ZVHA 1N64H 1FVCB 2Z31C 1CG9B 5IBUB 2DRUA 2WP3T 4OZIA 3U83A 3TYGH 4GAFB 2XWTB 2DLEA 2HJKA 2VO5A 3QXVA 5JW4R 2M2DA 1FGNL 5MENB 3W9EA 2DJUA 3C2SA 3ESVF 4BQ8A 5J13B 1PYWB 2ZUQC 5HHOE 1CFNA 3SEPA 1NBZB 3DX8A 5F7DA 4K3JL 1HH6B 5DGQA 3DV4B 3O4LE 4YHZL 2P5EA 3K4ZA 1X4XA 2FEEI 3WSQL 1KB9K 3KR3H 1ADQL 4LVNB 4DVRH 4YDVB 2PW2B 5GGQH 4PR5A 4J3XA 4PJ5D 5D70L 2XPGB 5ICXA 4M7JL 2HFFA 2FECI 1EJOL 2R0ZH 2GQHA 4HIXH 2AABL 3PL6B 2E7LA 4X98A 1NFDF 1FH5H 4AMKH 4FQ2H 2OTPA 4LHJB 2YUWA 1AGFB 4PJHE 4P3CH 2QSCH 1K4DA 3FRPG 1RUKH 1GGBL 3MV9B 5B39G 1U8PB 1QLFB 4M6NH 5F9WC 5DJ8B 4UU9B 2NY7L 4NKMA 5H35A 5AZ2H 1JZ2A 1VEOA 3TPUA 5FDWA 3LDBB 3CH8A 5JDSA 5JMRA 1NANI 1QACA 4YR6B 2PXYA 4NHUA 3QCUL 4BFIA 4AJ0A 1U8LA 1NAML 1BVLA 2FEDD 3WKNA 4RFNB 2ILLA 2A1WL 1TFHA 4P5MB 1WVZA 3VDCA 4IRZH 5FUOL 5IIEA 4BUHA 3KXFA 4R7NB 3CFDB 1C5CL 4LVEA 1S7TA 5DD1H 1EX0A 2CIKB 5KVEL 1P84J 1OGAA 2XI9A 3AREA 1CFBA 3RUGB 5JXEA 4JJ5B 3SPVB 4Z7WB 4UQ3B 4KGJA 1QR1A 4HJ0C 2X4RA 3OKDA 3MREA 4JRYB 4PJCB 2ZUVA 5MEPA 1EFXA 4G8FB 3UJTH 4LHUG 5FECB 4OBSA 4HIJB 3OKOA 4CW1A 4FZEL 1PQZB 3ZE0F 3OAZH 1L6XA 1EO5A 4L9LC 3MJ8B 1WIPA 2PCPB 3GKZA 1D6VH 4OGXH 3NFPA 43CAA 5JIHA 3D3VA 1GGCH 2K9UA 3CH1B 3DX7A 3S35L 1L7TL 4NBZB 2W0LA 4NO0A 2HFGH 4UINH 2XN9D 4G8IB 3T4AA 4R97C 3PWVB 3P4NB 1I4FA 5AYQA 3L5HA 1S78C 4GRLB 4U4BA 3IJYA 1NBYB 5J6HA 4UBDC 3S37H 4R4FL 1I1YB 5E8NB 4KDTA 2ZCKL 2NY0B 3ARVA 1E4KC 4NNPH 3EOTL 3OKNA 2VXTH 1JPST 4F37K 4IIQB 5DURB 1GAFH 4E9LA 3SDDB 4D8PB 4X6BB 1UZ8A 1OF2A 5GGRB 3FRUA 3RTQD 4CDGC 1RJLA 4G6JH 4Q9CA 4FRWA 1NDGB 1WBZA 4R9HA 4OQ1A 1RIHL 1EUUA 4LDLB 4E0RA 5E2TH 2H3NB 4ONGL 2OCFD 4Z7UF 2X4UB 3LQZB 4QYOA 2NY3D 1MCIA 3FQXB 3ZHKA 2HRPL 3NA4A 1NGXB 5DJCB 4B41A 3MA9H 4JAMB 5T1LD 3DUHA 3ZKND 4ETQA 4FFZL 2PYED 3V2AR 2KZ1B 4APQD 4GKSB 2D4FA 5DGRA 3DXAB 1VESA 3LN9A 2J5LB 3GKWL 4Y1AE 1YEDA 1BEYH 4OF7A 5D1QA 5F89A 5D2LE 1NKRA 1Q8MA 4HZLB 3TH2T 2WWKT 3D69B 3QR2A 1K3ZA 3WYRA 4Y19B 1IEHA 4OV5B 1ZHLB 1XGTA 3KPMA 3EJJX 3ARDC 1IVLA 3UTZB 1HQRB 1U91B 2C3GA 3MNWB 1JWUA 1TENA 1WFUA 2WAHA 4P23A 1N6VA 3CK0H 1T89C 3SCMD 3WIFB 1S5HB 3VXRA 2CLZB 1WZ1H 2F54D 3D18A 4HPYH 5T1DH 1ZGLA 3TM6A 1UACH 4G6ML 2KZWA 1XFPA 2EE3A 3Q6FB 4PRPE 3ARFA 2R1YB 2JELH 4K2UH 5D7LB 1KBGH 4KDWA 4MAYD 4KQ4H 2D7MA 4NQTA 5HI5C 4GAYA 5ESVB 3WFCH 4JZJC 4AM0A 1RU9L 1NCAL 2ESVB 3HMXH 4E5XB 2EDKA 1NL0H 3RWCB 3UTQB 4NT6A 1ERNA 2F53E 5FDYA 3E8UL 2EC8A 4XAKE 3FT3A 4JFQA 4OZGA 2AK1H 3S97C 4YHLL 4Z8FL 3ARTA 4OIAA 1KXTB 1ZS8B 4XTRD 3H3KA 5FA4A 5JR1L 1ZLUK 3IAQA 3SOBL 5DFVC 3IDIA 4M61A 3GSNB 4XVUC 5C9JB 1FGNH 5E6ID 3QG7H 4OFDA 4RRPG 1R24B 1TVHB 5JLZA 1LEKB 1IFHH 3U4EA 3JV4A 3L3IA 1NGYA 3VD7A 4K3JH 1MHHB 1ADQH 4NKIH 3GHBH 2NY2D 3KPLB 5SX4H 1MHPL 4U6XB 1K4CA 1C8PA 4PRID 5F1SA 2V2WB 5D70H 2NNAA 4L3EB 4YHML 1JRHI 3BRFA 1S8DB 4PBWD 1EJOH 4TVSa 4HZAA 2AABH 2E8YA 3GI9L 4HS3B 5KG9A 3FQUA 3RIFF 3E2HC 4X7FC 4KK9C 2ORBL 5DRWB 2AI0L 4P2YA 2CLRB 3B9VA 3B5TA 4CN6A 1GGBH 2LAAA 3UTOA 5HSFA 4PJ5E 5JIPA 5C0GB 3G6JF 2NY7H 1MFBL 2NTFB 3T0EB 5HD8C 1HIML 1F3JA 4AEIL 2UWEB 3IXAB 1W0WA 4OZFG 3IDJA 1UC6A 4F7CA 2ZNWA 3I9GL 1D5XB 4HSQA 3GEWB 4OGAD 4MSWB 3QCUH 2OP4L 1NAMH 2XFXA 2EO1A 2A1WH 3L9RA 3VRIB 1F4YH 5FUOH 5D7IB 4QRTB 3WS3B 1XGRB 1O0VA 3WFEL 4OB5L 3BAEH 1ZT7A 2MHAA 3GSXB 4RMUA 4CJ0A 5KVEH 4GQ9L 4HAFA 3RGVB 1KTLA 2VABB 4OFYD 3DWTA 2RQ8A 3OGCB 4RGNB 4F80A 5K9OA 4GG6A 4FZ8L 1BJMA 5IESL 4O2FA 1JPFB 2D7NA 5BW7A 4IRSD 5IEKA 5GRYA 2X7LA 4WJ5B 5FGSA 4FZEH 2J8UF 1S9VB 4IHOB 3L6FA 3B83A 2R2HA 4MNQA 5F3BA 2GK0A 4WWKD 4BKLA 5J3HC 1WV7T 4P5KA 3JV0A 1I7RB 4ESKA 5I9QB 4LKCB 1S3KL 1L7TH 3UJJH 5CBAB 3REVA 3PWJB 4Y16B 4JFPB 4L5FH 1T1ZA 4E42A 5EU6B 4GKOA 4J1UB 2GJ6B 2VSDA 5GS3A 2IH3A 4UIMB 2IC2A 1NAKH 1NC2B 2XQBH 4YC2C 4Y2DA 4ODUB 4R4FH 3VFSA 4KKLD 5KJRH 1WGOA 5HYSG 4EQ3A 2ZCKH 4R96A 2GAZB 4PJEA 1E4XI 1QSZA 3R4DA 3EOTH 4ISVB 3THML 5KS9F 3S4SG 2DL9A 2XN9E 5HVWA 1ETZA 3QNZB 1EBAA 1S7UA 5JO5B 1NGQL 5CWSA 4GKNA 1OM3L 1EAPA 5KSBE 4K3GA 1IL1A 3ZKXB 5F3HB 5AD0A 3QISA 3CMGA 4ONGH 3SDAA 2OI9C 3B9EA 4S1DC 1DZBA 1MFEH 2HRPH 3L3KB 4JVUA 4PUBL 1BOGA 3E0GA 4HWBA 2VLJD 4QOKB 4X6DE 5HXMA 1UXSA 1QA9A 2AKRB 4HUNB 1W0VA 2VLLB 5K93A 3UTSA 2R56L 4NN7B 1U92A 3C5SB 3MBXL 4PJ7E 4LLVB 3UBXG 4KK5C 3VRJA 3FB7A 4ODTH 4LL9A 1QRKA 1YC7A 5A16A 3HE6C 4JREC 3CLFL 1S7XA 4FQHB 4QCIB 3RP1A 4EI5D 2PYEE 5F72S 4WUUD 2YPLB 2Y7QB 3L3DA 5C6PB 4M5ZH 3TNMA 3MBEC 1GGUA 1CQKA 1ZHKB 4Q2ZA 2C3XA 3LRSB 2R15A 2VIRA 3IDUA 1A7QL 5IB4A 5J06A 3VXSA 1OTUC 2VDLL 4TYUA 1AY1L 1K9TA 4OF5A 4WEUD 3VFVA 1NSNH 5E8DL 3BKJL 3VE0A 2W59A 1V3MA 4M43L 4PJGF 4J2XA 4JO2L 2Y06L 2BVQB 1XCTA 1U36A 4NDMB 5FUCC 2UZIL 3KNBA 5IOPB 2F54E 3ALPA 4Z78B 2VQ1B 4P2QB 1U8KA 3SQOL 3V0AC 3OKKB 4JFXA 5FGBA 5JR1H 3ES6B 2CLVB 3MOAL 4HUWA 3SOBH 1ZVSB 3MNVB 4QRRA 4KKCD 1X5XA 3NCEB 2UY6A 1YMHB 1HHHB 3IVKA 1E27A 2WLYA 1JGUL 4YNYA 5F71A 4OAWB 4F7TA 4MNGA 5FYKU 15C8H 4K71C 2YC1B 1KEMH 1N5AA 1PKQE 3LHPH 3T0DA 4BM7A 4DOHB 2EIEA 2WM0A 2QADD 3KHQA 5DEZA 5D93C 1MHPH 4NP4H 4G8EB 1QFHA 1TJIH 3QEHA 3U9UA 1G7MA 4YHMH 3RZCA 5HGHB 5D5MB 4MDIA 3FB8B 1BM3H 1CICA 2IAND 3GI9H 4LU5L 1H5BC 1TZGH 4MA8L 3U6RB 2QQLH 1HE7A 1MHEA 1ZK9A 2AI0H 3GJEB 3QUXC 3CUPA 4KHTL 1GOGA 2AJZA 5EZOL 4PRIE 3GMNA 1FZJB 2VOTA 3NA9L 4CU6A 4TPRL 1MFBH 1YY8A 3OZ9H 3FKUS 1HIMH 4GSDH 4AEIH 1BREA 3T2NL 1RK0A 3P4OA 5E2VH 1BVKB 4OZ4B 3VU2A 5FIEA 3I9GH 2C5DC 4ZFOB 1KULA 2OP4H 1CL7H 3GSOB 1XR8A 3FFDB 3IFPB 4F7PB 3C2AL 3UCRA 3C60B 2VLRA 3ZE2E 4NBXB 2J8OA 1SYVB 4X7SL 4XP6L 4MX7A 4ZO8A 4WTZA 4OB5H 2OSLA 5IJVB 1UXWA 1UKSA 4LCUA 5HHQA 3D0VB 4NOFA 1DUYB 4PJDE 4PG2C 2WQRA 2C1OA 3O8XA 3QIWC 4XVJL 5CIPA 1IM3B 4I3RH 5AYUL 1AJ7L 4QRSA 5IESH 4OCLC 1TQBC 1QSFD 4PBVC 4JG1H 2GY5A 1XF3B 3TEUA 4BQ9A 3X12B 4PRHD 3F7RA 1CVSC 3HHRB 4FQCL 2FATL 4C56B 4KV5E 5LXGL 3BSZH 5DHVH 1WK0A 5HGAB 5J8OA 5D7JB 4W6WB 4QRQA 3PGCB 3D87B 4S10A 4OFKA 3GMPA 5TE6L 3NFSL 1GJIA 4KJQD 2LTQB 2A6DA 1N4XL 2A6KA 2VRAA 4H1LB 1MH5A 4NO2A 5HI4D 2ZNXA 3ARZA 3PIQA 3VFMA 2VDNL 3QQ4B 1JHLL 5EFIA 1YPZF 4HJGB 5LBSL 1E4JA 4DZBA 3O4OC 4QHUB 3KPOA 2MJWA 1S9WB 4ZTOL 4FQLH 2F15A 3FRPA 4NN6B 3VG9C 5EO0B 5B39A 3QCVH 3GSQB 4GMTL 3ZE1E 3PHOA 5F7HA 4L29A 5ALBL 2QKIA 3H7BB 3PQYD 5HHVL 1NGQH 4L8DB 1OM3H 3V5HA 1TCRB 4PJFA 4Z77B 4V1DD 3PNWB 1RZ8B 5ID0B 2X9XA 1OP5K 3ZDZE 5KAQF 5E8PA 2WWMD 3MUZ1 3C08L 4PUBH 1FO0A 4N68A 5M7QA 5EOCJ 3RPIB 3DV6A 4Z5RA 2ZOLA 2X1WL 4NGHH 3EYVB 1CF8L 1PVHA 2EDBA 4QHMA 3SJVA 2R56H 3EBAA 4HGMA 3MBXH 1MFDL 4OTXL 1MCRA 5GRVK 5I30L 2A74A 5DDHA 1EO7A 2ICES 3PDOA 4HG4K 3V6FA 1QBBA 3CLFH 1M1SA 2ZCHL 2KQNA 2VLJE 1I7ZB 3KWWB 4F9PA 3BXNB 4CMMB 2BVTA 5TE7L 4KMQA 3FO9B 3ARBA 1AKJD 2ATKB 2R0WH 4GLRH 1CTOA 3HZYA 3UTTD 3LKNB 1HEZB 1A7QH 3O9WA 3UBXI 1DN2A 4JRXD 2LQRA 3MNZB 3V6BR 4G6KL 5J12B 3KYNB 3OTTA 1YJDL 4RIRB 1KLUA 3BKJH 1AD0A 5DMIL 3MRDA 2Y06H 3WUZA 3TBWB 4LSPL 2AJYL 2WSKA 3S7GA 1HZHL 4WUUE 5C7XL 4OCRL 4MXVE 3SQOH 4L4VA 1C5DB 1P9MA 1E28A 1DEDA 4R8WH 4POUB 2EH7H 4PRBA 3MOAH 5EA0L 1WZLA 3W82A 2V7NA 3MRIB 1WAAE 1T5XB 4PJXE 2HT3D 4J8RB 3I02A 1P5VA 4MWFA 5B38G 2YA0A 4P5TC 3PWNA 2OZ4L 4M1DH 5F6HI 1HSAB 2RBLA 5KVGH 2OR7A 3WS6A 4ENED 4N5ED 3AU1B 4FFYH 3VGGA 2JK5A 4NQXB 5C6TL 3REWA 3EDJA 2IPKB 4CN4A 4N5UA 3MROA 2ED8A 4PJIA 3D0LA 3EYQC 2R0LL 2A6IA 3BQUB 2CR3A 3TVMD 3S5LG 1OAUL 3P9LB 3R1GL 3MV9D 2FHCA 3IU3A 1HXYA 4RWYL 3TJEL 5EZOH 5FOBA 3W9DA 3NA9H 1X5GA 2ZKHL 1MCWW 2Y6SD 3ZMRA 1LD9A 1RHHA 2B1AH 4F2MB 4XBGA 4PJ9D 5T5NG 1LEIB 4H25B 4PGDB 3BPCB 1FZKB 3LKRA 5DO2C 4S1RL 5EUOE 4D0BB 4EZMA 1HCFX 2PTTB 4Y4KC 4U1GC 4P9HL 1QRNA 5BZWB 3UPCA 1MJ8L 1T1YB 2AXHA 2DTML 3HUJF 3IDMB 3GSWA 5E0QA 3QDHA 5C6WH 2EYRA 5HGBB 2CIIA 1TZIB 4WHYH 3HZMA 1VACA 5EO9B 3P3YA 2FJFA 2ADJA 4JFED 3GM0A 4MDJB 3NIDE 3X11B 3BEVA 3LV3B 4XVJH 5AYUH 5EC1A 5DRZA 2CKBA 4L8SB 2VXUH 4KK6D 2Q86A 2WBJB 1P4LA 4RRPA 3RPKA 5E9DA 4ELMF 4U1NA 4MLIA 4CADA 3T0BA 2FATH 5CP3A 2DJ4A 4KTEL 1F90L 4ERSL 1RIUH 3C87A 4NYLB 4R4BA 5LXGH 4WFED 2XKSA 5K59E 3KLAB 3QQ9C 2DYPB 3WHE0 4PG9A 1I8MB 3MUY1 3GSUB 1C5BH 2QLVB 3RY5A 2DF3A 1G7QB 4LNRB 3GSRB 3HG1B 4KI5D 3NFSH 5I19L 5HPOA 1Z3GL 2DOCA 4UILH 3KPTA 3EAKA 1BBDL 4FN0A 3X3FH 2DQFB 1S9XB 1QSFE 4PRHE 4FQJH 4XNMA 1JHLH 5D2NA 3O6FC 3LQAL 1VADA 2NY0D 4MA1C 1Q72L 1ZHBB 2A6JB 5EOCH 2VQTA 5DMKA 4HMEA 3HZVA 5DURD 1DEEA 4ZTOH 4WDIA 3SDDD 4PJBA 4XI5D 1IGCH 1KJ2L 2NY5L 1P53A 4OQTL 1NGZB 1TMCB 5DLMH 4YFEA 4WWID 4PJAE 2ZG2A 5I1CH 1CD1B 4DN4L 2NZ9C 5HHVH 1JN6A 3CLEL 3DYPA 4OZFA 1UH4A 4ZUUA 4UTAL 4QHNB 1FFNB 1DVFC 4QXTB 2XQYG 3C08H 5HHPB 3HN3A 2VXQL 2W91A 3HNSL 1T04A 5C86A 5I1HL 4F7MA 4BZ2L 4I48A 1CT8B 1PG7X 1CF8H 3DTXB 1XGPB 4NRYA 4Y19D 2APVA 3VWKB 5CSGA 1ZLVH 1L7IL 5EZIH 3DVGB 3MCLH 2EDNA 5I30H 2P8PA 1I7TA 5F9OH 2BNQD 1FLRL 4KJPD 1L9NA 1H0DB 3X14B 1AR2A 1CYGA 2HVKB 4TUJB 2ZCHH 1HQ4B 3QUYB 4QKXB 3PABB 1MLBA 3AS3A 3V4UH 1ZVYA 2GFBA 3S3PA 3DUSB 4XMPL 5D7LD 2NLJA 5D1ZD 4LHQB 4NQVA 4XCNB 3QA3B 5F93C 1K6QH 4RNRA 3ZYIA 1T20B 2UVFA 3ARPA 4D3CL 3FQWB 4TOYH 3MV11 3KPSB 5DMIH 1J1OL 1M7DA 3B2UD 2VWEC 1LVEA 2PUQT 2BY2A 4LSPH 2AJYH 3DX9B 4LP5A 1HZHH 5C7XH 3VXUB 3OHXB 3I2CL 3MOBH 4YWGL 4XCYA 3FB6B 4ORZC 3UTTE 5HYSA 1NC4A 5GGVY 2HH0L 3T3ME 4M4PA 5BS0B 3JV6A 2OR8A 3OG6B 1N8ZB 5IW1B 4EBQL 3BYYA 3RZWA 3L3OA 4HKBA 1IGMH 3VFPA 2OZ4H 1JNNL 2R2CA 1HYSC 5C09B 1NGPL 5LVEA 5KSAA 3AS2A 5FM4A 3VA6A 5DT1L 4L3ED 1GYAA 2FIRT 4YZFF 5IMLB 2P42B 1QUNA 5A3IC 5MENE 2J88L 3BFOA 1OD9A 5C6TH 4KH2A 2BFVL 5GSVB 4LLDB 4D0CA 3MRLB 1KJ3L 2R0LH 2X09A 4NKDB 1MWAB 4F7EB 4O5LL 1UWXH 4FQ1H 5H94A 3QXDB 3U7YH 4PGBA 5DHYA 2VR4A 5JA8B 3V79C 2YXFA 3IETB 1F11A 4HKXA 2BSRA 1YN6A 4R0LC 1KEGH 3UBXA 3LRHA 3OG4B 1YMMD 1A6WL 2QQQA 4U1MB 5DMGD 1YJDC 4XNZB 1NEZB 3SO3B 3TJEH 4FQXB 1UVQA 1RK1B 5GXBB 1GCFA 3LEVL 1FC1A 4G80B 2BNRB 5F1NA 1U8OB 3MLXL 5AEAA 4OCYH 1NLBH 3RI5K 3IDYB 4WGWB 4PD4K 3WNKA 5J1SC 4JDZB 4P49A 4BA8A 4FXGA 3QNXB 4LCWA 3VFOA 3RY4A 1MJ7H 1GC1L 3O11A 1MELA 3RWDB 5J9PB 4M5YL 2IFFL 1G9ML 4JFDA 3VA2C 5DTFB 4RFOL 3SDXE 3MV9E 2CQVA 3KJ6L 5ISZB 4W70A 1B0GB 1ZT4B 4LSRL 2MPAL 5I1LA 4YAQB 2R1XB 4JR9L 2EIZB 5DC9B 5E03A 5B4MC 3L5JA 4KMTL 2FZ3B 4RGND 4LDOB 4ODHL 4YO0A 3RNKA 2AV1A 1MUJA 3VXPA 1IC4H 3TN0B 4KMLB 1AP2A 3DHJA 4PV8A 1KB5A 4C54A 1LK3L 1ZSDA 2YEZB 4TNVF 5I18H 3H9ZA 4JKKA 3MQIA 3QFJB 4YE4H 3CSPA 3WE6A 4RISL 4HCRL 1HWGB 1PDKA 3RUGE 4X6FA 2CO6B 2J6EH 2X6MA 3LOWA 1W72L 2WQ8A 2IH1B 1N7ML 4C4KT 4ZDHA 4Y16D 4HKJB 3VFUB 4PJCE 4JRYE 4CVWA 3VG0L 5EU6D 2AJUL 2OTUA 4NKOB 1SQ2N 1OT2A 3PHQB 2UUDH 4TTGA 4U2ZA 3TV3L 1BBDH 3CDGB 4WHYG 2G5RA 3K2UL 1NC2D 2V9RA 2P46B 1GL4B 4NQEA 3PWUB 5JW4Q 4N0UA 2BSSB 3IGAA 1CL7I 1Q72H 2CUIA 2CRZA 2AJXL 1PD6A 3D39B 1AO7B 1G9EA 5FKAA 1XIWC 3ILQD 1CE1L 1N59B 4P9HC 3RWHB 3MLYH 2H32B 4OQTH 3U0PA 4KI5E 4F3FA 3C6LC 5E99H 1M05A 3SE9L 5LWYH 3QXUA 1NMCB 3NIGF 4DN4H 3QIBB 5EPMA 2LV4A 1JV5B 1ADQA 4KRPD 4UDTA 4JY4B 4ODXB 3NGBC 2RFXB 2NY6B 4OZHA 1UEMA 3EOAA 1KELL 3PGDA 1FFPB 3MYZA 4PLOB 4QOKD 4QRPB 4WI7A 1JVKA 2XA8H 1LQSR 1U8HA 4TUKH 1EXUB 2VXQH 1FV1A 5A2LH 3HNSH 2VN4A 1Q9WB 2GT9B 4WEBH 1AHWB 4JZNB 5K9JL 4BSVA 2IMNA 4RAUB 5I1HH 3F7YB 4BZ2H 4K7FA 4W4OC 1I8KA 4HMDA 1ES0B 2GSGA 3D25B 4PBXA 3HE7C 7CGTA 3KYMA 4LLWA 5ESAA 5EORL 1A2YB 5DJAB 1CGVA 2CSPA 2IPTH 3U7WL 3GJFH 1RAMA 4KTYA 1JZ3A 3QEGL 4WU7A 1FLRH 1D3CA 2QR0B 3CMOL 5I76A 4TVPE 5BVPL 2FHFA 2YPLD 3JWOC 4NQSB 1TXKA 3DXAE 4HUVA 3MRMA 2OXGA 3B9KA 5I75C 3FQRB 3K2MC 2FO1A 1AXTH 4ORGA 2Z31B 4XMPH 2PXYD 4Y19E 5C0CA 4BZYA 1NAMA 1CZ8L 3FL7A 2L7UA 3R0MA 4P3WA 5CP7B 1OGTA 5IT2L 2C3WA 2PYFB 1AGBA 5IB1A 1F02I 3L3GB 2P4AB 5JQ6L 2NY5C 2OR9L 4MJ5B 2XZAL 1HI6B 2Q7YA 1EZVY 1IQWL 2DKMA 2HLAB 1VDGA 3VFTA 1B4RA 1X5YA 2R2EA 2QV2A 5TE4L 2VDPL 3W5NA 4B50A 4XNQB 4F33A 5D7LE 2GY7B 1TJGL 2KBGA 4YWGH 3OX8B 1EFXD 3V7AG 2HH0H 4N9GB 5I17A 5F7WC 1P7KA 4KTDL 1YEJL 5C0FB 5CCKL 2DI7A 4LK4A 4ZXBB 3OPZH 4J3SA 4M7LL 3DETD 2NQCA 5E1AB 4X5XA 2Q6WB 3HI6L 1U9KA 1GZQB 1LE9B 4ZODA 1NGPH 3GUTB 1BFOB 3HE6A 4GRMA 3QNYA 4Q6IC 5ANMB 4PY7B 1IKNC 5F9WB 1XH3A 3QDMA 2BFVH 4HGKC 4B7IA 4ZTPH 3GMOB 4EVNA 3MYJA 4GLRI 3EYOB 4P57B 5DRXA 1AH1A 2YA1A 2E7BA 3BGFC 4YPGA 1ZHNA 3RA7H 5IBTH 3MRHA 5I74C 1U3HA 4JM2F 4OF8A 1U3JA 5DQJA 2NCMA 1A6WH 2HFEB 4PRNB 3RVUC 1ONQA 4L3EE 1T2XA 4X80L 1YN7B 5FHBH 4NQCB 3VD3A 4JQIL 3ULUF 3LEVH 5J1AA 4FFVD 4LEOB 3I6KA 2CRYA 3P73B 1DQQB 4GS7C 4H26A 5FK9A 4K3DL 4BZ1H 1GC1H 4M5YH 2DLHA 1EEUA 3JZ7A 4ODVH 2W9EL 3HRZA 1HILB 4RFOH 4GBXB 1NBVL 2AQ2A 1RZFL 1AD9B 4LSRH 2MPAH 2BVOA 3T0EE 2ID5A 4L9LB 2UWEE 4UMGA 1ZLWH 2IAMB 4MXQC 5F7LB 4Z7WF 4MQ7B 3S36L 3QJFB 4KMTH 5HHOA 5SWZB 1Q0XL 4PGEB 3T04D 6FABH 4QNPF 4ODHH 4ZAKC 4JJHA 3O4LA 2DQEL 1M6OA 3MX0A 1WIUA 1ORQA 3NIFE 4LPUA 4P23D 4R97B 5CZVL 1G7PA 1MAML 3L5XL 4JHZA 3SO5A 3QUKB 1CDUA 1FFRA 2R4RL 2ADFH 4HCRH 5B38A 5C3LD 3WL9B 3TBSB 2EH8L 3CCHB 1UCTA 4UTBL 1N7MH 4Q0XL 4RGNE 5IB3B 5JNYB 3LN5A 3OXSB 3VG0H 4M7ZB 2GUOB 2AJUH 4LCIL 4RDQG 5C0IA 4ZO9A 1Q9OB 5C08B 1ZT1B 5DD6A 4PJHA 1QQDB 2OTWA 3TV3H 1RURL 1VGEH 4M3KB 1G9NH 3K2UH 4OD2A 5FYJD 1K5NB 1V3JA 2G9HA 3WBDA 1MHCA 4TVPL 2BHZA 3OR7B 3S5LA 4D0DB 1A9EB 2NTSP 4I5BA 3EYUL 3VCLA 2H26A 1T0NA 5LGHH 3LY6A 2R0KH 1CE1H 3R06A 2ADGA 5EU6E 4L9DA 5L2KB 4Z7VE 4NJ9L 3MUJA 2ITDB 3H7LA 3SE9H 2ADIA 4WV1A 2ZUYA 1Z6JT 2DWEB 3QHFH 1F4XL 3OB0H 1KJVA 1KG0A 2EDXA 3QIWA 3HZKB 3ARDB 5I8EA 1DCLA 3QHTC 5IEHA 2HLFD 4U1LA 1MJJB 5JOPD 5EU3B 2JIXA 5ABDE 1J8HB 3RBSA 2X1QA 2E9JA 4NSKA 2VE6B 3B8YA 4O00A 5K9JH 3HRPA 1PSKL 2FSEB 2BZDA 4UDUA 1WC7A 5T1KA 1X4ZA 3HCVB 5AUMB 3HAEB 4QF1A 1DJSA 4O51A 5CSZA 3S98A 5JOEA 4BFBD 4AH2B 4BSWB 1I9JL 2DM7A 1QO3B 5GGTL 1A6UL 3HR6A 6CGTA 3FT4A 3CMOH 4QOKE 1IAOB 1PZ5A 3V95A 3KYKL 2D3VA 1I8IB 5FO8B 2FCBA 3QXTA 5IQ7L 3OL2A 3GSNL 4M4RA 5EO1A 5FOJA 3OJMB 2V9QA 1JWSA 2FX8H 1CZ8H 5KN5A 2XWJB 2XY1A 2NX5B 2D7QA 2ZG3A 5MERA 4C83B 4NC2B 1DQJB 1OB1B 5HYJB 5F9JA 5JQ6H 2OR9H 2XZAH 5DSCA 4G42B 4KXZH 4AT6A 3MV7B 1S7SB 2VJXA 3C5JB 2YPLE 4OCXH 3G9AB 3AM8C 5DC4B 3MRGB 3BIBX 4H5SB 1T6VN 2W65B 4KVCL 1QG3A 3ARWA 5DFWH 5TE4H 2VDPH 4NZDA 3LN4B 4BSJA 1CGXA 4W68A 1U8IA 1F13A 2DKUA 5CEXA 1UB6A 5TJWK 4HV8A 2YS4A 4OLEA 2D7OA 4LMQE 4NUJA 4R4NC 4RQQA 2LU3A 3H6JA 4FFWC 4PB0L 1YEJH 3J7HA 1J87A 2XOTA 1UWEL 3QI9C 4OCWL 4AEHL 4MNQD 4OF6A 1FNHA 1DE4A 2GIYA 3D5OF 5EWIL 4P2QE 5AWNL 2XV6B 5GIRB 4M7LH 3V6OC 3WD5L 3BP6B 2DLGA 1X7QA 3L3HB 3BPNC 4Y1AA 2ICWJ 4Z7NF 4X4YB 3HI6H 3P77A 2P24A 5D2LA 2K7QA 1F6AA 3GK8H 4K07A 4YXHH 3RVVD 2ICEB 4HXBH 4CNIB 1MFNA 1VENA 1MCDA 1DUZB 4XC3L 3MLSL 4P46D 1QYGH 3FONA 1OP9A 4IDJL 2VTFA 5IMMB 1N5YH 1PLGL 4RGMC 5IJKC 2EDWA 2ED9A 3TFKD 2W60B 3ZSTA 4DOHE 2PO6C 3JVGC 2GCYA 3B2VH 1YEEL 4ZS6D 1NFDB 3MGTA 5GGRY 4GJTB 3W2DL 4X80H 2JB5L 4PGZA 4M8QB 5E94A 1CCZA 5D5ME 3SDCA 4WFHD 3SKOB 2VH5H 5FEBA 4JQIH 2Z9TA 4OKVB 2G5BA 1LMKA 4N90D 5DJ2B 1FBIL 1CE6B 2PR4L 2F53A 4HPOL 4K3DH 5E8OA 5IIEB 2AEPL 3DMMA 3HS0B 3KXFB 1AI1L 3BD3A 3PL6C 4L8BA 1S7TB 5IKCA 2W9EH 3MR9B 4LAJH 1LEGA 3LS5H 1NBVH 3AREB 2FX7L 4W6YB 4JHWL 1S7RA 1BFVL 2GITA 5D7IF 1JTTA 1QR1B 1KGCE 4JM2C 1T1XB 4EUPH 3MREB 3SBWC 4AL8L 1NLDL 2F5AL 5JXAL 3ROLB 1YDPA 5ICYB 3BWAB 3BPLC 4E41A 3RAJL 1Q0XH 3MFGB 3ULUC 4M1GL 1I8LC 1KPUB 5BJTA 5C8JA 2IQAA 4Y0GA 4X9FA 2FYYB 5CZVH 1C1EH 3FO1B 5CHNA 1ORSA 4RFNC 3CXDL 1PFCA 1T1WA 3FHQA 3LPWA 1BWWA 2DYPD 3T4AB 5EU7C 1TIUA 2ZJSL 2EH8H 4RX4D 3BP4B 2B39A 4XPFL 3QRGL 2Y07H 5CZXD 4Q0XH 5D1XA 2J4WL 5FCUH 1A6TB 1N2RA 2MCPH 2YSSB 1FNEB 3T3PF 4HXAH 2A0LD 2ENYA 4O02L 3BDBA 5JMOC 1J18A 1KIQA 3OKLB 3M1BA 2FR4A 1Z5LA 3NABL 4MVBC 3L7FA 4PJ5A 1B90A 4KI1A 2VR5A 5I1EL 4Z0XB 3QHZL 5E4EC 8FABA 2PW1A 3MRKB 2OI9B 1MRDL 4QRRD 1ZA3A 4KRNA 5JOFA 3RWFB 1NJ9A 1NCCL 2X4SA 3AGVA 1B3JA 1NUDA 2X4TA 5INDA 4OIIL 4NJ9H 4YHYC 5EIIA 3LKQB 1A4KB 2DLTA 4EIGB 1D5BB 5FYJE 4JE4B 1JF5A 2BRRH 4GRLC 4XH2A 5TF0A 4JREB 4LLMA 1JFQH 3WLWD 4AG4L 4Z7UB 2VDQL 2EEBA 1URLA 2I26N 2Z4QA 1PSKH 3NCYS 3V6ZA 1XGTB 2HMIC 3V0VA 3MBEB 3WFHA 3TA3C 4NZUH 1Z0NA 4JN2A 1WZKA 1A6ZA 4MCYB 3H2WA 5GGTH 3RL1B 1KJMB 5HBBA 1YEKL 1JF1A 3QUYD 1KFAL 3N1GC 4IMLA 5JOPE 5FB8B 1ZWIA 4J4PD 3BIKB 3EYFA 5DJZB 3ROOB 1E4WL 1HHKB 5MHSD 3O6ML 4OM1L 4C59B 3T0VA 1WEJL 5IQ7H 3O6FA 1JHKL 2F8OA 4JANB 3GSNH 1PY4A 3G5XB 4X99A 4MS8D 4L4TB 3LKSA 1YNKL 4UIKH 1CLOL 3ULVD 1A9BA 3G6DL 5F96H 5C0BD 2KDGA 1RUPL 4O2EB 3MRRA 3FT3B 4EEEA 5IMOA 2CDGB 3KPSD 1A7RL 1BGXL 2VLRD 3QG6B 4OZGB 5DUMH 4L8CA 4GUPB 3GB7A 4DKDC 1UH2A 4IRJC 4X5WA 3UDWC 1W8NA 5JDJA 5EOQH 5KSUA 4K71B 2WIIB 3VXUD 1C16A 2XN9A 2EYSA 1ED3A 4KVCH 4KJWC 1VFAA 2G2RB 1JHTB 1QVOB 3HLAB 1I1AC 5D93B 5L8LB 4NNYA 5BS0D 5KSBA 5IBUG 2R1WB 2VZVA 3I6GA 1GHFH 3DLQR 3LEYH 1JZ6A 1HDMA 1QSEB 2DQTL 4ZQKA 2JJWA 1NCDL 4PB0H 4IOIB 3OAUL 4PJ8C 1UWEH 4GG8A 4P2OA 5IHLB 5CEZD 1L9MA 1H5BB 3DUUA 5EWIH 5AWNH 5C09D 5JPMB 4NCC1 1KACB 3EFFB 5IHZA 4EDXB 3RTQA 2P7TB 4PJ7A 3EJZC 5HHNA 3L5WA 3UAJC 3P0YL 3OXRA 4ZFOL 3WJJA 4H0GA 1PLGH 5ADOL 2X4QA 3NN8B 5T1LA 4MNQE 2PYEA 2XRAL 5MEOA 4YUEH 1NCBL 5TGBA 1EGJH 4FQXD 4MNHB 4GW4B 2DQDL 3PV6B 2XNAB 3BZEA 3W2DH 2YPKB 2VL5A 1U8NB 4P3DA 4LCCB 3AFLA 5JZ7C 1PX4A 2HRLA 2N4IA 5F8RC 2W0FA 3MACH 2VKWA 1FBIH 4PV9B 2PR4H 4HPOH 3G6JB 5KVFH 1S9KC 3SCMA 1A1MB 3D2UB 2VZ1A 1A0QL 2AEPH 3V52H 1JL8A 2F54A 3O3AA 1AI1H 1HSBA 5ISZD 4JFFB 3V5DA 4G6AC 4K9EC 2XT1B 1TQBB 1A3RL 2FX7H 1AR1C 1QLRA 5CMAB 2VAAA 1BFVH 4DGYL 1VEPA 4V2BA 1DQDL 5I1IL 4XAWH 1FZMB 4WFHE 4D9RD 4S1SL 2R4SL 1IGJA 1NLDH 5T3XD 2F5AH 2DQHL 4Q9QH 3G5ZB 3EO1B 1VGKA 4N90E 4TQEH 3VWJC 1MCKA 3RAJH 3TN0D 4Z7OF 4Q7DA 3TIDA 1PKQA 5BQ7A 3QUZA 2P5WB 4NRZA 2JB6B 5EUKB 3NCMA 3QFJD 4EKXA 2GK0B 5IM7B 4FNLH 5AG9A 1T6WA 3WKML 1CBVH 4XRCB 4Y8AA 4XXCA 2D7TL 2XZQL 2ZSWB 1LHZA 1AQDA 4M48L 4KZEL 4NNXB 4YBQD 4DAGH 5E6IA 4HAGA 3IU4L 4XHQA 3O4OB 1XAUA 2ZJSH 3BJ91 3Q3GA 5F1IA 3BRDA 2K3TA 2J8UB 2BMKB 4GXVL 2NXZB 4RGOL 2DQGL 4UQ2A 3K74B 2J4WH 3VG9B 5I71C 4W4NA 5CILL 1CDHA 3ZTJH 3JWDC 4I1NB 3L3JA 3RGVC 5ID1A 2NYYD 1EO8L 1RUQL 2YBRA 1L0YA 4O02H 5E7BA 3FN3A 2B1HL 1HXMB 3K8LA 4X4ME 4HF5L 4PRIA 4XBEL 1JGEB 1FVDB 3IFOB 4XPAL 4KY1H 3ECBB 3VXTB 1JNLH 1RZJH 5I1EH 4NO3B 3D39D 3VW3L 1AO7D 2JTDA 3QHZH 3EDKA 3ULSB 2QSTA 3DI3B 4NWUL 1BZ9A 1YY9C 1I3RB 4KU1A 1JZ7A 1S7UB 3MLVL 4GKNB 3QFDB 4HX1B 3VXQB 3NZHL 5E1HB 4WO4C 1MLCA 5CJXC 2HYMA 4OIIH 3DO7B 3QIBD 4X4XA 4DUVA 2K1MA 3MGOA 4LLAA 2OZ4A 4QY8A 5KS9B 3TBYB 1IBGL 2MOVA 3ZKMC 1BOYA 2YUZA 1QA9B 4V2CB 3RDTB 4HKZB 3VFWA 3UMTA 3NCFB 4U6HB 2MQCA 3EO9L 5DD5L 1DQLL 1FL5A 4PJDA 3WXVH 3TBVB 3K8KA 1Q9LA 4AG4H 2VDQH 1WBXB 1OWWA 1X5KA 2W07A 5ITFA 3CFJA 4JFZH 1UQSA 2FO4B 1T22A 4YGVA 1V3KA 4MA3A 4P0DA 2A73B 2CGRL 2AXFA 2CDEB 2L0DA 4K8RL 5TQ0L 3VGEA 4LLUB 5IB5A 3L3DB 4JKPL 1DBBL 3HB3C 1FCGA 1VFBA 3TPKA 3ZKXC 1EFQA 3TZVC 1KFAH 3DBXB 1SVZA 4U6YA 3BX7C 3O6MH 1V3LA 4JPKH 1GH7A 3VXSB 4F57L 2WBWB 4F15C 4FXKB 5AAMA 2R2BA 1WEJH 1M7IB 4FQQA 1AIFA 2GTWB 2CK2A 4IRSA 4NRXA 4D9LL 1G7IA 1YNKH 2IBZX 4XPHL 4FABL 2WINB 4YHPB 4OFPA 1VHPA 5C92A 1RUPH 1AGEA 4OLUL 1A7RH 1V7MH 1ITCA 1BGXH 3C6LA 4X6EB 3QEUB 3SHSA 4CJ1A 2YUVA 4MQSB 2APTA 4P5TB 5MHSE 5D6DA 4MA7L 1T2QL 4EDWH 4PJGB 3TLRA 4DFIA 2FB4L 3WNNA 3SKJH 3RL2B 4LCYB 1TNNA 1GZPB 1QEWB 1JYNA 2EZ0C 3GMMB 3ULVE 5C0BE 3JTSB 1H8SA 3KPSE 1T3FB 3BH8A 2DQTH 2VLRE 5C2BH 2I9TB 1NCDH 4FG6C 4HQQL 5DYOB 2IMMA 3HE7A 3OAUH 2XKNA 4NWTH 3KS0J 3PXJA 4HUXB 3UO1H 4JG0L 3VXUE 1TCMA 4JLRB 5DQ9A 4ZUVB 3RZCB 4QXGL 3VMPA 3AXLB 5JW5B 3GZKA 3WNLA 4I4WB 1IQDB 4K3HA 1Y0LB 3BESR 3VGFA 2FL5A 3CVHB 3BO8A 5BS0E 1F6LL 3UXFA 3OAZK 2VQUA 1IZJA 2PKDA 3P0YH 3LVEA 1WBYB 3ZYZA 3MLZL 2UZXB 2O5YL 3ETBF 3ORJA 4RFEA 5ADOH 3EJYC 3JSSA 3KJ4B 2P8MB 3D85A 2EKJA 2VLJA 3HPLB 3MLTA 3SN6N 2IALA 1XCQB 5IF0A 5CEZE 2W92A 3VXNB 2H8PB 5C09E 3GMNB 2BSTB 1JUFB 1BF2A 2FX9L 3OAYH 1I9IL 1R5WA 2JJSA 1NCBH 2I5YL 4Y4KB 3QDJB 4OQTA 2DQDH 4U1GB 3RU8H 2A38A 5D9SA 4NQCD 4U1IB 3RWGB 1UFUA 2ENSA 5CGYC 4APQC 3BKYL 5BMFL 4YLQT 2X4PA 2HKHL 3TO4C 3WN5C 5DEGB 3S88L 4YFLF 4BK5A 4HJ0D 4XWGH 5DVMA 4EI5A 2BXYA 4WUUA 1A0QH 1ZTXL 3FMGL 5K33A 3O0RH 3DHMA 3AROA 5I1DB 1A3RH 1T4KA 3QWRD 1HOCB 1DQDH 2B8OT 2VDML 2EIBA 4I18C 1G7HB 4BH8B 5SWZD 1WAAA 5CBEA 2CK0L 2F19L 4D94A 4PJXA 1FNAA 5GSRA 3E6FB 3BISA 3ZDYE 1QTYT 1EVUA 1FL6B 4H1LH 4UB0L 3UC0L 2F74A 5EZLB 1CLYL 3PG2A 1IKNA 5IQ9A 2FBJL 3SDYH 5FYJH 5ISZE 1S78D 2P8LB 3QCTL 1VPOH 3WKMH 4U7KA 1MFCL 2D7TH 2XZQH 5DRNA 5C0RL 4QRQB 1HHGA 4UBDD 1HWHB 2OL3B 3L7EA 4M48H 4KZEH 5HDQL 5TPWL 4D9RE 2AK4D 4FQIL 3IU4H 5T3XE 2XTLA 3O45A 3X17A 2APBA 2A6DB 2A6KB 4NZTL 4YHIB 4XTRC 4XMKH 4GXVH 4RGOH 4LF3B 5CILH 1KV3A 3T09A 4CU7A 3IDXL 3QFJE 4LSUL 4KROC 4JZOA 3U9PL 4J3TA 3KPOB 2DQIH 2WUBL 4TSCL 5JPNA 4JCMA 1WT5A 3IB4A 4HF5H 3WDJA 1G84A 4XBEH 5B39B 2CXKA 4XPAH 3VJ6A 3VW3H 3G04A 1EHNA 1FVEB 4K7PH 3T2QA 1FG2B 3H9HA 3JWNC 4NWUH 1DVFB 1I3GH 4Y5XA 4PP2B 5L2KD 1YPZB 5CD5C 1ZA6B 4BQBA 2AEQL 5D7JC 5EULV 5EUOA 1D5ZB 2ZSVA 1J1XL 1K8DB 1FZOA 1LK2A 1T03L 1NFIB 3SGJA 5K9QI 5CJOL 5I1JL 1IBGH 5GS0C 1RZIB 4J3OC 3ARDD 4KJYA 4JB9L 1G0XA 3ZTJG 3D39E 1AO7E 4Y5VA 1WWAX 3DRTA 1DQLH 3CPLB 1F00I 4X9GA 3MV8B 4ZYKA 1CD0A 4EIZC 4PRDA 4XC1L 7FABL 3GBML 5IMKB 5DZOA 5T1MB 4NN6C 3PDOB 2QTEA 3ULVL 3STBA 5I16B 4PTUB 4JPIA 3WLBB 4LHUB 5HI5D 4M6OL 3BUYB 4PRAA 4XPTH 4PP1C 4QRPE 1AXIB 4AENB 3LSOB 3QUMB 5DR5L 2AV7B 4XCEA 3SKMA 3GHEL 4PJIE 1FN4B 4U3HA 3TT3L 4F57H 5DI8A 4I8DA 4LCWD 1KLUB 2NX5D 1QFWH 3MA7B 1QSFA 5DFVD 4JFDD 3QQ3A 5EU4B 4PRHA 4FABH 1TVBA 3VGBA 4HIIB 3GMRB 5EZJA 4DVBB 4GAJL 4OLUH 1P84K 1I1FA 3MV7D